2WCJA

Structure of bmori gobp2 (general odorant binding protein 2) with (10e,12z)-tetradecadien-1-ol
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
141
structure length
141
Chain Sequence
b'TAEVMSHVTAHFGKTLEECREESGLSVDILDEFKHFWSDDFDVVHRELGCAIICMSNKFSLMDDDVRMHHVNMDEYIKSFPNGQVLAEKMVKLIHNCEKQFDTETDDCTRVVKVAACFKEDSRKEGIAPEVAMVEAVIEKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENERAL ODORANT-BINDING PROTEIN 1
publication title Characterisation of Bombyx Mori Odorant-Binding Proteins Reveals that a General Odorant-Binding Protein Discriminates between Sex Pheromone Components.
pubmed doi rcsb
source organism Bombyx mori
molecule tags Transport protein
total genus 55
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2wcjA00
1OOGA 1OOFA 3VB1A 3BJHA 2WCHA 3NGVA 2WCLA 2WC5A 3Q8IA 3N7HA 2WCMA 1P28A 3B86A 1TUJA 3D77A 4FQTA 3BFHA 2WCJA 3RZSA 1DQEA 2WC6A 1OOIX 2QEHA 3DZTA 3L4AA 3DY9A 3R1VA 1OW4A 3D78A 1LS8A 3D74A 3FE8A 2ERBA 2WCKA 3S0FA 2QEOA 2QDIA 2JPOA 3DYEA 4F7FA 3NHTA 1XFRA 1OOHA 3B7AA 3QMEA 1ORGA 3CDNA 3S0GA 3NHIA 2FJYA 4INXA 4OZDA 1TWOA 2L2CA 3S0DA 2GTEA 3S0EA 1T14A 3D75A 3K1EA 3BFAA 3DXLA 3B88A 3CABA 3S0BA 3L4LA 3CZ2A 3S0AA 3D73A 2PQLA 5EL2A 1C3YA 3B87A 3D76A 1C3ZA 3OGNA 3BFBA 3R1OA 2QEBA 3CYZA 2KPHA 3B6XA 3L47A 1QWVA 4JD9A 4INWA 3CZ0A 2QEVA 2P70A 4PT1A 3CZ1A 2P71A 3FE6A 2H8VA 3FE9A 5DICA 3R1PA 3PJIA 3R72A 1GM0A 3V2LA
chains in the Genus database with same CATH superfamily
1PVAA 4WQ3A 1H4BA 1OOFA 2AUCA 3VB1A 2KNEA 2M1UA 1AP4A 1UHKA 4P2YB 2EC6C 3NGVA 1B7TY 1B9AA 1W7IB 2FOTA 2K0JA 2KQ6A 2LLTA 1K9KA 3ZNIA 5KU1A 4YBHB 5B8IB 1K2HA 2WC5A 2JNXA 2KAVA 1MQ1A 2R2IA 4GBAA 3LCPC 1OOJA 1F55A 5FYXA 2WCMA 1TUJA 1YVHA 1FPWA 2Y1NA 1BMOA 3KF9A 3SG6A 2GGZA 1WDCC 3CGAA 4M2QA 3RZSA 4CPVA 4PHMA 2WC6A 4YGEB 1Y1AA 2LANA 3CTNA 3BQ3A 1OOIX 2KFFA 5TNCA 4PHNA 1RJVA 1KWOC 2KAYA 2MJWB 1ZMZA 5JOLA 1AUIB 3VROA 4PALA 1KFXL 2BECA 2ERBA 2NXQA 1GGWA 2PRUA 2SCPA 1NX3A 1CKKA 1ALWA 1KK8C 1LINA 1J1DA 2QDIA 1QATA 2MA2A 1S6IA 2JPOA 1NWDA 2HQWA 1K90D 3EKJA 3NHTA 1UWOA 3WHTB 4A4BA 3JVTB 3QMEA 3BOWB 3FS7A 5I2OA 1CDMA 5I94A 4QJ3B 2G2BA 4AQJA 5CSIA 1F54A 3AAKA 2FJYA 2FCEA 2EGDA 2WNDA 2JULA 4GNKB 3I5GC 1UUSA 2BL0B 1L2OB 2LHIA 3OB1B 1G8IA 3S0EA 4DCKA 4QJ4B 3TUYC 2KBMA 1BR1B 1TNPA 3K1EA 3EVRA 2WOSA 4D1EA 3B88A 1DGUA 4ORAB 2LAPA 1K96A 4PHKA 3CABA 2SASA 4MZJA 1QLKA 2CBLA 2Y1MA 1M31A 3FWCA 4GUKA 1TNWA 1CDNA 2KYFA 1TNQA 2K60A 3BXKA 3LK1A 1ALVA 2K61A 2M0RA 4PE4A 1F4QA 2M29A 1NX0A 3H4SE 1SPYA 3VRNA 3VRPA 3WXAA 4OCIA 2PQLA 2KGBC 3OX5A 2M3WA 1PULA 1BODA 1XYDA 3BUNB 4R1EA 3IQQA 2I94A 1UURA 1Z2CB 1C3ZA 3OGNA 1K9PA 2M1KB 1B8RA 3E3RA 1XK4C 1QV0A 5AANA 2YGUA 1A75B 1EG4A 1RTP1 2F2OA 3I5FB 1JSAA 3CYZA 3KPXA 1MXLC 2OS8C 2KHNA 1KCYA 1ZFSA 2F3YA 2KLEA 1SCMC 1NP8A 2L4IA 3EVUA 1TUZA 1N0YA 1H8BA 1TNXA 3GOFA 1FI5A 1XFWO 4IJ7A 1RK9A 4HREE 1J7RA 2JC2A 1SR6B 2ZN9A 3O4XA 5ER4X 2FJUB 2LVJA 2L98A 3SS4A 3AAJA 3DVJA 3SIBA 5HYDA 1KSOA 1WRLA 4L9MA 2RGIA 3R1PA 1IQ3A 1J7QA 4CFQA 1Y1UA 1SSEB 1B7TZ 1BJFA 3DVEA 1GQMA 1F70A 1YRUB 4YI9A 5HLVA 1B1GA 4I5NB 1IJ5A 1N2DA 2IS9A 2ZKMX 1NCXA 4PDZA 4GGFC 3EKHA 2E6WA 2BKIB 1NPQA 1KK7Z 2Q4UA 1IJ6A 1SMGA 5D3OA 1AVSA 1NIWA 5JJGA 4M2PA 2DOQA 1F8HA 2BBNA 1AHRA 4CIDA 1CM4A 1SBJA 3LLEA 1MUXA 2BBMA 2JZIA 4OR9B 4ORBB 2H61A 2COLB 4YGDB 3D77A 4FQTA 3UO9A 4GGFA 4YRUA 3D10A 1PSRA 1YRTB 1SNLA 1E8AA 2L0PA 3CZTX 3NSLA 5D69A 3EK7A 3DZTA 3FWBA 4UPGA 1R2UA 2QPTA 1JC2A 3C1VA 1QASA 2JPTA 4XJKB 5ER5A 3ICBA 2L5XB 2LVIA 2WCKA 3PSRA 2P6BB 2LMVA 2QEOA 1MXEA 2JT8A 1KSMA 1BG1A 1J1EA 4MZLA 4F7FA 4DS7A 1S5GZ 2K7DA 3JVTC 1ORGA 3PN7B 1QIVA 1NYAA 1KK7Y 1IKUA 3S0GA 2MLFC 3NHIA 4INXA 2K7BA 2JOJA 3O2PA 3GK2A 3KEVA 1QXPA 2BL0C 1QS7A 1L2OC 5DKRA 5IBWA 4FQOA 3S0DA 4I5LB 1BOCA 1T14A 1TCFA 4WQ2A 4E68A 3BFAA 3DXLA 1MF8B 5FI2A 5HLOA 4CLNA 5CPVA 2Y5IA 1SCVA 1SL8A 1DF0A 2JWWA 2HF5A 1TTXA 1YVLA 2NCOA 3CR2A 3BUMB 1AK8A 1K95A 2LLSA 3S0AA 4ETOA 4ZCUA 4YGCB 3SG3A 1WLZA 1CNPA 2A4JA 1CMFA 1OMVA 5J3XA 1SKTA 2L4HA 3RLZA 3CS1A 5EL2A 1JFJA 3B87A 5FI7A 5KSZA 1J55A 1TRFA 1X02A 3D76A 3I5IB 5FI6A 1S5GY 4CFRA 3BFBA 4HRGA 1YURA 2V53A 1IWQA 2EHBA 1S6JA 2F33A 2QEBA 3IVTA 1B8CA 1JF0A 3GK1A 2L51A 2ZRSA 3K21A 5HKYA 3I5FC 1DTLA 1BT6A 1NCZA 2CCMA 2BCXA 1QVIY 1TN4A 1RECA 1EJ3A 1DC1A 2EC6B 2M97A 2CTNA 2O60A 1AJ5A 1QWVA 1XFVO 1R6PA 3CZ0A 2PALA 1FW4A 2BE4A 3GK4X 1DJIA 1PK0D 2ZN8A 3CZ1A 4BY5A 2P71A 1CFPA 3SG2A 1WDCB 1SR6C 2NCPA 3SG5A 1W9ZA 2JTZA 2BE6A 2JQ6A 3KHEA 2LHLA 2PASA 5CSNA 2JNFA 2GV5A 1U5IA 4OV2A 1K8UA 4GPLB 4ORCB 3SG4A 1GM0A 1DELA 1OOGA 1G4YR 2L2EA 2OPOA 2L50A 2LUCA 4PE1A 1ODBA 2KFHA 2WCHA 2LC5A 2LUXA 1MR8A 1ZUZA 3NSKA 1WRZA 1UHIA 2FCDA 2JU0A 3MSEB 1CB1A 1YUTA 3EG5B 3Q8IA 4MVFA 1JWDA 1XK4A 2LMUA 2M49B 1NCYA 2KI4B 4MSPA 1P28A 1TOPA 2GGMA 2AAOA 2E30A 2WCJA 1Y6WA 4OKHA 3NSOA 3DF0A 1J7PA 3HX4A 3BUXB 1S6CA 5HL1A 4HSZA 1BLQA 2LV7A 1BR4B 1NUBA 2L5YA 3R1VA 1OW4A 1XFZO 1LS8A 3D0YA 2WCEA 3D74A 3F45A 3IF7A 3O4YA 1PSBA 2K2AA 3SS5A 1M45A 1S26D 5I2LA 3S0FA 1WRKA 1LKJA 1UP5A 3NSIA 1CTRA 1YUUA 2LCPA 2LVVA 4DRWA 1J7OA 4JPZB 5AERA 1QTXA 3DYEA 1DJZA 2WCFA 5F6TA 1BU3A 4AQIA 4BY4A 1KFUL 1YUSA 1XFRA 1Z4HA 1A2XA 1DGVA 1M39A 1OOHA 2ZFDA 3B7AA 3IQOA 5GQQC 3PN7C 4AOMA 5I8NA 2LVKA 2WC8A 5DKQA 3LK0A 4OZDA 3O6BA 1EH2A 1TWOA 5G08A 3TS5B 1IG5A 4A4CA 3EK8A 3PM8A 1W7JB 1IIOA 2BCAA 1GJYA 4JKTA 2GTEA 2HPSA 1YTZC 4WRIA 4PE7A 4YGAA 3VRRA 4I5KA 1FBVA 1SYMA 2F2PA 1EL4A 1C7VA 1EG3A 1V1GA 1K93D 3S0BA 2AMIA 2PMYA 2G9BA 2PVBA 2OTGB 3L4LA 4MRYA 1FF1A 4MN0A 4JQ0D 1KFUS 1IH0A 4GGNA 1QX7A 4C0KA 1DJYA 3KO0A 4GAOA 3TDZA 1CMGA 2M8UA 4KYNA 1YR5A 1CFFA 3SG7A 4DIRA 1A29A 4YI8A 1A03A 1C3YA 2JXLA 4MEWA 1IQ5A 2JT0A 1DEKA 3I5IC 1FI6A 1MHOA 1QVIZ 3A8RA 1CDPA 1M63B 1HT9A 2LE9B 4NDDA 3BOWA 4C0LA 3AKBA 2LLUA 2KI6D 3CLNA 3PALA 1IRJA 2KDHA 2ZNEA 3SS3A 2KYCA 3I5HB 1CDLA 4MBEA 3TDIA 4INWA 1NX2A 1HQVA 4PE0A 3WNXB 4HRHA 5K89A 1OMRA 1PRWA 4NDBA 2MAZA 4YGBB 1DJHA 1LXFC 1RROA 4ZCVA 5I2QA 2B1UA 1UHHA 2BCBA 1KQMB 4NDCA 4ICBA 1JUOA 1SK6D 3PJIA 1F4OA 3R72A 3JTDB 2PYQA 4N1GA 3VRQA 2PSRA 2CT9A 1SW8A 1SL7A 2K7CA 4Q04A 4USLA 1S3PA 1S1EA 3NXAA 4FTGA 3PATA 2M9GA 3BJHA 3PLFB 2JRFA 2QACA 2WCLA 1C7WA 3DVMA 1BF5A 3UNWA 1NSHA 1IGVA 1PALA 1SRAA 1MWNA 1WY9A 2I2RE 3BUWB 1UHNA 1TIZA 2KI4C 2WCBA 1PVBA 3N7HA 1A75A 1NX1A 5KTYA 2LNKA 3B86A 3CWGA 1VRKA 4DUQA 1RWYA 2JT3A 3TDUA 1DF0B 4M2OA 2JTTA 3BFHA 4I5JA 2BNXA 1DQEA 1XVJA 2HETA 3OB2B 2QEHA 4MRXA 2KSPA 1DVIA 5CSFA 1KWOB 2F8PA 1LVCD 3L4AA 3DY9A 1KFXS 2KBIA 1B8LA 1V1FA 2VRGA 3D78A 2MHHA 2H2KA 2KOTA 3CR5X 3FE8A 4GFTA 1D1OA 1XA5A 2KQYA 1KK8B 1B47A 1YX8A 5AXIA 3AKAA 1S36A 3EK4A 3PM2A 1XFXO 1JFKA 1JBAA 2MRDA 3SIAA 2MLEC 1M46A 3HCMA 5AFPA 2ISDA 1OZOA 4TNCA 1WLMA 2BAPA 1XFUO 1Q80A 2M7LA 2LM5A 2O5GA 3CDNA 1QLSA 1QX5B 3DD4A 2LMTA 3BUOB 2KLDA 1OSAA 2ZRTA 4N1FA 2Q91A 4XYNA 3TS5C 4QJ5B 2L2CA 5CSJA 3I5GB 2CXJA 2D8NA 2LP2A 1CLLA 3VGOA 1DMOA 3SJSA 1OMDA 2NZ0A 3OBVA 1ZACA 3D75A 4PCWA 5HKWA 3TUYB 1B4CA 1GGZA 1CFCA 1CLBA 1XFYO 1CLMA 1DJWA 2K2FA 1LA0A 3M0WA 3RM1A 1UHJA 4PHJA 2OTGC 1OQPA 3CZ2A 1XO5A 5AEQA 1EXRA 2NLNA 1C07A 1CM1A 1SY9A 1U5IB 2Y4QA 2ZNDA 1JF2A 1K9UA 3OX6A 4P5OE 4XJKA 1DJGA 1QX2A 3D73A 5HKZA 2I18A 2TN4A 3DVKA 1CFDA 3O78A 1A4PA 1OE9B 1Y0VH 2KAXA 3R1OA 2MBXA 4JWQA 3OP0A 1LA3A 1QV1A 1TCOB 5D7FA 2BKHB 2H61C 3CR4X 2HQ8A 1OZSA 3PFVA 4MZKA 1RFJA 4C0JA 1AJ4A 2OS8B 2K8MB 2KPHA 3ZWHA 3A4UB 2KI6C 2JXCA 1QJTA 3EVVA 1SCMB 3B6XA 3DF0B 5PALA 3L47A 3I5HC 2I7AA 2WORA 4OVNF 4JD9A 1K94A 1SL9A 1ZOTB 2CNPA 3BYAA 2QEVA 2P70A 3D0YB 3LL8B 2K7OA 4PT1A 1F71A 2KGRA 2M7NA 4MLWA 1G33A 4U8DA 1QIWA 1KQVA 3FE6A 1KQMC 1DJXA 1L7ZA 2H8VA 2KFGA 4IL1A 5BPJA 3FE9A 2F3ZA 3QRXA 4N5XA 4NQGA 1N65A 2LP3A 5DICA 3TZ1A 3WHUB 3JTDC 4F0ZB 1YX7A 1DT7B 5DKNA 1Y1XA 3OHMB 3FIAA 3V2LA
chains in the Genus database with same CATH topology
1OOGA 1OOFA 3VB1A 3BJHA 2WCHA 3NGVA 2WCLA 2WC5A 3Q8IA 3N7HA 2WCMA 1P28A 3B86A 1TUJA 3D77A 4FQTA 3BFHA 2WCJA 3RZSA 1DQEA 2WC6A 1OOIX 2QEHA 3DZTA 3L4AA 3DY9A 3R1VA 1OW4A 3D78A 1LS8A 3D74A 3FE8A 2ERBA 2WCKA 3S0FA 2QEOA 2QDIA 2JPOA 3DYEA 4F7FA 3NHTA 1XFRA 1OOHA 3B7AA 3QMEA 1ORGA 3CDNA 3S0GA 3NHIA 2FJYA 4INXA 4OZDA 1TWOA 2L2CA 3S0DA 2GTEA 3S0EA 1T14A 3D75A 3K1EA 3BFAA 3DXLA 3B88A 3CABA 3S0BA 3L4LA 3CZ2A 3S0AA 3D73A 2PQLA 5EL2A 1C3YA 3B87A 3D76A 1C3ZA 3OGNA 3BFBA 3R1OA 2QEBA 3CYZA 2KPHA 3B6XA 3L47A 1QWVA 4JD9A 4INWA 3CZ0A 2QEVA 2P70A 4PT1A 3CZ1A 2P71A 3FE6A 2H8VA 3FE9A 5DICA 3R1PA 3PJIA 3R72A 1GM0A 3V2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OOG A;  1OOF A;  3VB1 A;  3BJH A;  2WCH A;  3NGV A;  2WCL A;  2WC5 A;  3Q8I A;  3N7H A;  2WCM A;  1P28 A;  3B86 A;  1TUJ A;  3D77 A;  4FQT A;  3BFH A;  2WCJ A;  3RZS A;  1DQE A;  2WC6 A;  1OOI X;  2QEH A;  3DZT A;  3L4A A;  3DY9 A;  3R1V A;  1OW4 A;  3D78 A;  1LS8 A;  3D74 A;  3FE8 A;  2ERB A;  2WCK A;  3S0F A;  2QEO A;  2QDI A;  2JPO A;  3DYE A;  4F7F A;  3NHT A;  1XFR A;  1OOH A;  3B7A A;  3QME A;  1ORG A;  3CDN A;  3S0G A;  3NHI A;  2FJY A;  4INX A;  4OZD A;  1TWO A;  2L2C A;  3S0D A;  2GTE A;  3S0E A;  1T14 A;  3D75 A;  3K1E A;  3BFA A;  3DXL A;  3B88 A;  3CAB A;  3S0B A;  3L4L A;  3CZ2 A;  3S0A A;  3D73 A;  2PQL A;  5EL2 A;  1C3Y A;  3B87 A;  3D76 A;  1C3Z A;  3OGN A;  3BFB A;  3R1O A;  2QEB A;  3CYZ A;  2KPH A;  3B6X A;  3L47 A;  1QWV A;  4JD9 A;  4INW A;  3CZ0 A;  2QEV A;  2P70 A;  4PT1 A;  3CZ1 A;  2P71 A;  3FE6 A;  2H8V A;  3FE9 A;  5DIC A;  3R1P A;  3PJI A;  3R72 A;  1GM0 A;  3V2L A; 
#chains in the Genus database with same CATH topology
 1PVA A;  4WQ3 A;  1H4B A;  1OOF A;  2AUC A;  3VB1 A;  2KNE A;  2M1U A;  1AP4 A;  1UHK A;  4P2Y B;  2EC6 C;  3NGV A;  1B7T Y;  1B9A A;  1W7I B;  2FOT A;  2K0J A;  2KQ6 A;  2LLT A;  1K9K A;  3ZNI A;  5KU1 A;  4YBH B;  5B8I B;  1K2H A;  2WC5 A;  2JNX A;  2KAV A;  1MQ1 A;  2R2I A;  4GBA A;  3LCP C;  1OOJ A;  1F55 A;  5FYX A;  2WCM A;  1TUJ A;  1YVH A;  1FPW A;  2Y1N A;  1BMO A;  3KF9 A;  3SG6 A;  2GGZ A;  1WDC C;  3CGA A;  4M2Q A;  3RZS A;  4CPV A;  4PHM A;  2WC6 A;  4YGE B;  1Y1A A;  2LAN A;  3CTN A;  3BQ3 A;  1OOI X;  2KFF A;  5TNC A;  4PHN A;  1RJV A;  1KWO C;  2KAY A;  2MJW B;  1ZMZ A;  5JOL A;  1AUI B;  3VRO A;  4PAL A;  1KFX L;  2BEC A;  2ERB A;  2NXQ A;  1GGW A;  2PRU A;  2SCP A;  1NX3 A;  1CKK A;  1ALW A;  1KK8 C;  1LIN A;  1J1D A;  2QDI A;  1QAT A;  2MA2 A;  1S6I A;  2JPO A;  1NWD A;  2HQW A;  1K90 D;  3EKJ A;  3NHT A;  1UWO A;  3WHT B;  4A4B A;  3JVT B;  3QME A;  3BOW B;  3FS7 A;  5I2O A;  1CDM A;  5I94 A;  4QJ3 B;  2G2B A;  4AQJ A;  5CSI A;  1F54 A;  3AAK A;  2FJY A;  2FCE A;  2EGD A;  2WND A;  2JUL A;  4GNK B;  3I5G C;  1UUS A;  2BL0 B;  1L2O B;  2LHI A;  3OB1 B;  1G8I A;  3S0E A;  4DCK A;  4QJ4 B;  3TUY C;  2KBM A;  1BR1 B;  1TNP A;  3K1E A;  3EVR A;  2WOS A;  4D1E A;  3B88 A;  1DGU A;  4ORA B;  2LAP A;  1K96 A;  4PHK A;  3CAB A;  2SAS A;  4MZJ A;  1QLK A;  2CBL A;  2Y1M A;  1M31 A;  3FWC A;  4GUK A;  1TNW A;  1CDN A;  2KYF A;  1TNQ A;  2K60 A;  3BXK A;  3LK1 A;  1ALV A;  2K61 A;  2M0R A;  4PE4 A;  1F4Q A;  2M29 A;  1NX0 A;  3H4S E;  1SPY A;  3VRN A;  3VRP A;  3WXA A;  4OCI A;  2PQL A;  2KGB C;  3OX5 A;  2M3W A;  1PUL A;  1BOD A;  1XYD A;  3BUN B;  4R1E A;  3IQQ A;  2I94 A;  1UUR A;  1Z2C B;  1C3Z A;  3OGN A;  1K9P A;  2M1K B;  1B8R A;  3E3R A;  1XK4 C;  1QV0 A;  5AAN A;  2YGU A;  1A75 B;  1EG4 A;  1RTP 1;  2F2O A;  3I5F B;  1JSA A;  3CYZ A;  3KPX A;  1MXL C;  2OS8 C;  2KHN A;  1KCY A;  1ZFS A;  2F3Y A;  2KLE A;  1SCM C;  1NP8 A;  2L4I A;  3EVU A;  1TUZ A;  1N0Y A;  1H8B A;  1TNX A;  3GOF A;  1FI5 A;  1XFW O;  4IJ7 A;  1RK9 A;  4HRE E;  1J7R A;  2JC2 A;  1SR6 B;  2ZN9 A;  3O4X A;  5ER4 X;  2FJU B;  2LVJ A;  2L98 A;  3SS4 A;  3AAJ A;  3DVJ A;  3SIB A;  5HYD A;  1KSO A;  1WRL A;  4L9M A;  2RGI A;  3R1P A;  1IQ3 A;  1J7Q A;  4CFQ A;  1Y1U A;  1SSE B;  1B7T Z;  1BJF A;  3DVE A;  1GQM A;  1F70 A;  1YRU B;  4YI9 A;  5HLV A;  1B1G A;  4I5N B;  1IJ5 A;  1N2D A;  2IS9 A;  2ZKM X;  1NCX A;  4PDZ A;  4GGF C;  3EKH A;  2E6W A;  2BKI B;  1NPQ A;  1KK7 Z;  2Q4U A;  1IJ6 A;  1SMG A;  5D3O A;  1AVS A;  1NIW A;  5JJG A;  4M2P A;  2DOQ A;  1F8H A;  2BBN A;  1AHR A;  4CID A;  1CM4 A;  1SBJ A;  3LLE A;  1MUX A;  2BBM A;  2JZI A;  4OR9 B;  4ORB B;  2H61 A;  2COL B;  4YGD B;  3D77 A;  4FQT A;  3UO9 A;  4GGF A;  4YRU A;  3D10 A;  1PSR A;  1YRT B;  1SNL A;  1E8A A;  2L0P A;  3CZT X;  3NSL A;  5D69 A;  3EK7 A;  3DZT A;  3FWB A;  4UPG A;  1R2U A;  2QPT A;  1JC2 A;  3C1V A;  1QAS A;  2JPT A;  4XJK B;  5ER5 A;  3ICB A;  2L5X B;  2LVI A;  2WCK A;  3PSR A;  2P6B B;  2LMV A;  2QEO A;  1MXE A;  2JT8 A;  1KSM A;  1BG1 A;  1J1E A;  4MZL A;  4F7F A;  4DS7 A;  1S5G Z;  2K7D A;  3JVT C;  1ORG A;  3PN7 B;  1QIV A;  1NYA A;  1KK7 Y;  1IKU A;  3S0G A;  2MLF C;  3NHI A;  4INX A;  2K7B A;  2JOJ A;  3O2P A;  3GK2 A;  3KEV A;  1QXP A;  2BL0 C;  1QS7 A;  1L2O C;  5DKR A;  5IBW A;  4FQO A;  3S0D A;  4I5L B;  1BOC A;  1T14 A;  1TCF A;  4WQ2 A;  4E68 A;  3BFA A;  3DXL A;  1MF8 B;  5FI2 A;  5HLO A;  4CLN A;  5CPV A;  2Y5I A;  1SCV A;  1SL8 A;  1DF0 A;  2JWW A;  2HF5 A;  1TTX A;  1YVL A;  2NCO A;  3CR2 A;  3BUM B;  1AK8 A;  1K95 A;  2LLS A;  3S0A A;  4ETO A;  4ZCU A;  4YGC B;  3SG3 A;  1WLZ A;  1CNP A;  2A4J A;  1CMF A;  1OMV A;  5J3X A;  1SKT A;  2L4H A;  3RLZ A;  3CS1 A;  5EL2 A;  1JFJ A;  3B87 A;  5FI7 A;  5KSZ A;  1J55 A;  1TRF A;  1X02 A;  3D76 A;  3I5I B;  5FI6 A;  1S5G Y;  4CFR A;  3BFB A;  4HRG A;  1YUR A;  2V53 A;  1IWQ A;  2EHB A;  1S6J A;  2F33 A;  2QEB A;  3IVT A;  1B8C A;  1JF0 A;  3GK1 A;  2L51 A;  2ZRS A;  3K21 A;  5HKY A;  3I5F C;  1DTL A;  1BT6 A;  1NCZ A;  2CCM A;  2BCX A;  1QVI Y;  1TN4 A;  1REC A;  1EJ3 A;  1DC1 A;  2EC6 B;  2M97 A;  2CTN A;  2O60 A;  1AJ5 A;  1QWV A;  1XFV O;  1R6P A;  3CZ0 A;  2PAL A;  1FW4 A;  2BE4 A;  3GK4 X;  1DJI A;  1PK0 D;  2ZN8 A;  3CZ1 A;  4BY5 A;  2P71 A;  1CFP A;  3SG2 A;  1WDC B;  1SR6 C;  2NCP A;  3SG5 A;  1W9Z A;  2JTZ A;  2BE6 A;  2JQ6 A;  3KHE A;  2LHL A;  2PAS A;  5CSN A;  2JNF A;  2GV5 A;  1U5I A;  4OV2 A;  1K8U A;  4GPL B;  4ORC B;  3SG4 A;  1GM0 A;  1DEL A;  1OOG A;  1G4Y R;  2L2E A;  2OPO A;  2L50 A;  2LUC A;  4PE1 A;  1ODB A;  2KFH A;  2WCH A;  2LC5 A;  2LUX A;  1MR8 A;  1ZUZ A;  3NSK A;  1WRZ A;  1UHI A;  2FCD A;  2JU0 A;  3MSE B;  1CB1 A;  1YUT A;  3EG5 B;  3Q8I A;  4MVF A;  1JWD A;  1XK4 A;  2LMU A;  2M49 B;  1NCY A;  2KI4 B;  4MSP A;  1P28 A;  1TOP A;  2GGM A;  2AAO A;  2E30 A;  2WCJ A;  1Y6W A;  4OKH A;  3NSO A;  3DF0 A;  1J7P A;  3HX4 A;  3BUX B;  1S6C A;  5HL1 A;  4HSZ A;  1BLQ A;  2LV7 A;  1BR4 B;  1NUB A;  2L5Y A;  3R1V A;  1OW4 A;  1XFZ O;  1LS8 A;  3D0Y A;  2WCE A;  3D74 A;  3F45 A;  3IF7 A;  3O4Y A;  1PSB A;  2K2A A;  3SS5 A;  1M45 A;  1S26 D;  5I2L A;  3S0F A;  1WRK A;  1LKJ A;  1UP5 A;  3NSI A;  1CTR A;  1YUU A;  2LCP A;  2LVV A;  4DRW A;  1J7O A;  4JPZ B;  5AER A;  1QTX A;  3DYE A;  1DJZ A;  2WCF A;  5F6T A;  1BU3 A;  4AQI A;  4BY4 A;  1KFU L;  1YUS A;  1XFR A;  1Z4H A;  1A2X A;  1DGV A;  1M39 A;  1OOH A;  2ZFD A;  3B7A A;  3IQO A;  5GQQ C;  3PN7 C;  4AOM A;  5I8N A;  2LVK A;  2WC8 A;  5DKQ A;  3LK0 A;  4OZD A;  3O6B A;  1EH2 A;  1TWO A;  5G08 A;  3TS5 B;  1IG5 A;  4A4C A;  3EK8 A;  3PM8 A;  1W7J B;  1IIO A;  2BCA A;  1GJY A;  4JKT A;  2GTE A;  2HPS A;  1YTZ C;  4WRI A;  4PE7 A;  4YGA A;  3VRR A;  4I5K A;  1FBV A;  1SYM A;  2F2P A;  1EL4 A;  1C7V A;  1EG3 A;  1V1G A;  1K93 D;  3S0B A;  2AMI A;  2PMY A;  2G9B A;  2PVB A;  2OTG B;  3L4L A;  4MRY A;  1FF1 A;  4MN0 A;  4JQ0 D;  1KFU S;  1IH0 A;  4GGN A;  1QX7 A;  4C0K A;  1DJY A;  3KO0 A;  4GAO A;  3TDZ A;  1CMG A;  2M8U A;  4KYN A;  1YR5 A;  1CFF A;  3SG7 A;  4DIR A;  1A29 A;  4YI8 A;  1A03 A;  1C3Y A;  2JXL A;  4MEW A;  1IQ5 A;  2JT0 A;  1DEK A;  3I5I C;  1FI6 A;  1MHO A;  1QVI Z;  3A8R A;  1CDP A;  1M63 B;  1HT9 A;  2LE9 B;  4NDD A;  3BOW A;  4C0L A;  3AKB A;  2LLU A;  2KI6 D;  3CLN A;  3PAL A;  1IRJ A;  2KDH A;  2ZNE A;  3SS3 A;  2KYC A;  3I5H B;  1CDL A;  4MBE A;  3TDI A;  4INW A;  1NX2 A;  1HQV A;  4PE0 A;  3WNX B;  4HRH A;  5K89 A;  1OMR A;  1PRW A;  4NDB A;  2MAZ A;  4YGB B;  1DJH A;  1LXF C;  1RRO A;  4ZCV A;  5I2Q A;  2B1U A;  1UHH A;  2BCB A;  1KQM B;  4NDC A;  4ICB A;  1JUO A;  1SK6 D;  3PJI A;  1F4O A;  3R72 A;  3JTD B;  2PYQ A;  4N1G A;  3VRQ A;  2PSR A;  2CT9 A;  1SW8 A;  1SL7 A;  2K7C A;  4Q04 A;  4USL A;  1S3P A;  1S1E A;  3NXA A;  4FTG A;  3PAT A;  2M9G A;  3BJH A;  3PLF B;  2JRF A;  2QAC A;  2WCL A;  1C7W A;  3DVM A;  1BF5 A;  3UNW A;  1NSH A;  1IGV A;  1PAL A;  1SRA A;  1MWN A;  1WY9 A;  2I2R E;  3BUW B;  1UHN A;  1TIZ A;  2KI4 C;  2WCB A;  1PVB A;  3N7H A;  1A75 A;  1NX1 A;  5KTY A;  2LNK A;  3B86 A;  3CWG A;  1VRK A;  4DUQ A;  1RWY A;  2JT3 A;  3TDU A;  1DF0 B;  4M2O A;  2JTT A;  3BFH A;  4I5J A;  2BNX A;  1DQE A;  1XVJ A;  2HET A;  3OB2 B;  2QEH A;  4MRX A;  2KSP A;  1DVI A;  5CSF A;  1KWO B;  2F8P A;  1LVC D;  3L4A A;  3DY9 A;  1KFX S;  2KBI A;  1B8L A;  1V1F A;  2VRG A;  3D78 A;  2MHH A;  2H2K A;  2KOT A;  3CR5 X;  3FE8 A;  4GFT A;  1D1O A;  1XA5 A;  2KQY A;  1KK8 B;  1B47 A;  1YX8 A;  5AXI A;  3AKA A;  1S36 A;  3EK4 A;  3PM2 A;  1XFX O;  1JFK A;  1JBA A;  2MRD A;  3SIA A;  2MLE C;  1M46 A;  3HCM A;  5AFP A;  2ISD A;  1OZO A;  4TNC A;  1WLM A;  2BAP A;  1XFU O;  1Q80 A;  2M7L A;  2LM5 A;  2O5G A;  3CDN A;  1QLS A;  1QX5 B;  3DD4 A;  2LMT A;  3BUO B;  2KLD A;  1OSA A;  2ZRT A;  4N1F A;  2Q91 A;  4XYN A;  3TS5 C;  4QJ5 B;  2L2C A;  5CSJ A;  3I5G B;  2CXJ A;  2D8N A;  2LP2 A;  1CLL A;  3VGO A;  1DMO A;  3SJS A;  1OMD A;  2NZ0 A;  3OBV A;  1ZAC A;  3D75 A;  4PCW A;  5HKW A;  3TUY B;  1B4C A;  1GGZ A;  1CFC A;  1CLB A;  1XFY O;  1CLM A;  1DJW A;  2K2F A;  1LA0 A;  3M0W A;  3RM1 A;  1UHJ A;  4PHJ A;  2OTG C;  1OQP A;  3CZ2 A;  1XO5 A;  5AEQ A;  1EXR A;  2NLN A;  1C07 A;  1CM1 A;  1SY9 A;  1U5I B;  2Y4Q A;  2ZND A;  1JF2 A;  1K9U A;  3OX6 A;  4P5O E;  4XJK A;  1DJG A;  1QX2 A;  3D73 A;  5HKZ A;  2I18 A;  2TN4 A;  3DVK A;  1CFD A;  3O78 A;  1A4P A;  1OE9 B;  1Y0V H;  2KAX A;  3R1O A;  2MBX A;  4JWQ A;  3OP0 A;  1LA3 A;  1QV1 A;  1TCO B;  5D7F A;  2BKH B;  2H61 C;  3CR4 X;  2HQ8 A;  1OZS A;  3PFV A;  4MZK A;  1RFJ A;  4C0J A;  1AJ4 A;  2OS8 B;  2K8M B;  2KPH A;  3ZWH A;  3A4U B;  2KI6 C;  2JXC A;  1QJT A;  3EVV A;  1SCM B;  3B6X A;  3DF0 B;  5PAL A;  3L47 A;  3I5H C;  2I7A A;  2WOR A;  4OVN F;  4JD9 A;  1K94 A;  1SL9 A;  1ZOT B;  2CNP A;  3BYA A;  2QEV A;  2P70 A;  3D0Y B;  3LL8 B;  2K7O A;  4PT1 A;  1F71 A;  2KGR A;  2M7N A;  4MLW A;  1G33 A;  4U8D A;  1QIW A;  1KQV A;  3FE6 A;  1KQM C;  1DJX A;  1L7Z A;  2H8V A;  2KFG A;  4IL1 A;  5BPJ A;  3FE9 A;  2F3Z A;  3QRX A;  4N5X A;  4NQG A;  1N65 A;  2LP3 A;  5DIC A;  3TZ1 A;  3WHU B;  3JTD C;  4F0Z B;  1YX7 A;  1DT7 B;  5DKN A;  1Y1X A;  3OHM B;  3FIA A;  3V2L A; 
#chains in the Genus database with same CATH homology
 1OOG A;  1OOF A;  3VB1 A;  3BJH A;  2WCH A;  3NGV A;  2WCL A;  2WC5 A;  3Q8I A;  3N7H A;  2WCM A;  1P28 A;  3B86 A;  1TUJ A;  3D77 A;  4FQT A;  3BFH A;  2WCJ A;  3RZS A;  1DQE A;  2WC6 A;  1OOI X;  2QEH A;  3DZT A;  3L4A A;  3DY9 A;  3R1V A;  1OW4 A;  3D78 A;  1LS8 A;  3D74 A;  3FE8 A;  2ERB A;  2WCK A;  3S0F A;  2QEO A;  2QDI A;  2JPO A;  3DYE A;  4F7F A;  3NHT A;  1XFR A;  1OOH A;  3B7A A;  3QME A;  1ORG A;  3CDN A;  3S0G A;  3NHI A;  2FJY A;  4INX A;  4OZD A;  1TWO A;  2L2C A;  3S0D A;  2GTE A;  3S0E A;  1T14 A;  3D75 A;  3K1E A;  3BFA A;  3DXL A;  3B88 A;  3CAB A;  3S0B A;  3L4L A;  3CZ2 A;  3S0A A;  3D73 A;  2PQL A;  5EL2 A;  1C3Y A;  3B87 A;  3D76 A;  1C3Z A;  3OGN A;  3BFB A;  3R1O A;  2QEB A;  3CYZ A;  2KPH A;  3B6X A;  3L47 A;  1QWV A;  4JD9 A;  4INW A;  3CZ0 A;  2QEV A;  2P70 A;  4PT1 A;  3CZ1 A;  2P71 A;  3FE6 A;  2H8V A;  3FE9 A;  5DIC A;  3R1P A;  3PJI A;  3R72 A;  1GM0 A;  3V2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...