2WCJA

Structure of bmori gobp2 (general odorant binding protein 2) with (10e,12z)-tetradecadien-1-ol
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
141
structure length
141
Chain Sequence
TAEVMSHVTAHFGKTLEECREESGLSVDILDEFKHFWSDDFDVVHRELGCAIICMSNKFSLMDDDVRMHHVNMDEYIKSFPNGQVLAEKMVKLIHNCEKQFDTETDDCTRVVKVAACFKEDSRKEGIAPEVAMVEAVIEKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENERAL ODORANT-BINDING PROTEIN 1
publication title Characterisation of Bombyx Mori Odorant-Binding Proteins Reveals that a General Odorant-Binding Protein Discriminates between Sex Pheromone Components.
pubmed doi rcsb
source organism Bombyx mori
molecule tags Transport protein
total genus 55
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2wcjA00
3CZ0A 3S0GA 3DYEA 4PT1A 3CDNA 4INWA 3R72A 3DY9A 2P71A 3RZSA 2ERBA 4OZDA 4F7FA 2PQLA 2H8VA 1QWVA 3FE9A 1OOFA 1OOGA 1P28A 3R1PA 3D77A 3D73A 3OGNA 3DZTA 2JPOA 1LS8A 3FE8A 3QMEA 3R1OA 3S0EA 1TWOA 3D74A 2FJYA 3L47A 1OW4A 2QEHA 4INXA 2L2CA 4FQTA 2WC6A 3CZ2A 3L4AA 3Q8IA 2WCKA 3B6XA 3B86A 3N7HA 2WCJA 3B7AA 3L4LA 3K1EA 3DXLA 3VB1A 1TUJA 3CZ1A 3CABA 2QEOA 2KPHA 2WCMA 3NHIA 4JD9A 3NHTA 2GTEA 3PJIA 3BFAA 2WCHA 3R1VA 5EL2A 3S0AA 3V2LA 2P70A 2QEBA 3D76A 1ORGA 2QDIA 3NGVA 5DICA 3CYZA 2WC5A 1OOHA 3S0FA 3S0BA 2QEVA 1XFRA 3FE6A 1DQEA 3D75A 1C3ZA 1C3YA 3BFHA 3BFBA 2WCLA 1GM0A 1T14A 3BJHA 3B88A 3S0DA 1OOIX 3B87A 3D78A
chains in the Genus database with same CATH superfamily
1DJZA 2LMVA 3ICBA 2NCPA 2NXQA 4N5XA 3SIAA 2AUCA 2JT0A 2I94A 3NSKA 4I5NB 2P71A 3TUYB 2KYFA 3RZSA 3AAJA 1EG3A 1MXEA 2L2EA 2LC5A 1SBJA 4F7FA 1EH2A 1UHJA 3DVJA 1NCZA 1PALA 2MLFC 1OSAA 1RK9A 5CSFA 1IG5A 5BPJA 1IKUA 3IQQA 1DC1A 1H4BA 1OOGA 1V1GA 3BOWA 3D73A 1YUUA 1CMGA 3OGNA 3KO0A 3DZTA 4KYNA 3ZNIA 5DKRA 1LS8A 3QMEA 1EJ3A 4WQ3A 1TWOA 1ZACA 3D74A 3QRXA 4D1EA 2JT8A 5HYDA 1JSAA 3SG5A 2PSRA 1SRAA 1XFXO 3VROA 2ZFDA 2KSPA 4MRXA 3AKAA 2QEHA 2K7CA 5JOLA 1QX2A 3AKBA 1M63B 1CFCA 1QS7A 2LHLA 1LA3A 2HPSA 3I5GC 1JF2A 5D3OA 2GGZA 3B6XA 2GV5A 2HF5A 3SG3A 2MLEC 3N7HA 4AOMA 1DF0B 2WCJA 3SG4A 1QX5B 3BUXB 3RM1A 4QJ4B 1OMDA 1OQPA 1PSBA 5GQQC 1FW4A 3KEVA 3DVMA 2KAYA 4JKTA 5D69A 1AUIB 2BE6A 4OV2A 4YGDB 2I18A 1B8CA 1KFUS 1ZMZA 3MSEB 1ODBA 4DUQA 1WDCC 4CFRA 1CTRA 2KAVA 3EKJA 3KF9A 2FJUB 2LP3A 2L5XB 1G4YR 1TUZA 3I5GB 5ER4X 5HKWA 5I2QA 1JUOA 1AVSA 1J7RA 1XK4A 2A4JA 4NQGA 1JWDA 2LV7A 3EVRA 1UWOA 4PHJA 4MSPA 1M46A 1RFJA 4M2QA 1H8BA 1UHIA 5FI7A 1F71A 3A8RA 1S6JA 1NCYA 1UHNA 1MR8A 2CNPA 2G9BA 1DGVA 1KWOC 3DVKA 2LMUA 2KGRA 4I5LB 1QATA 4P2YB 4HRGA 1AP4A 1SR6C 1IGVA 2KYCA 1TTXA 3NSIA 1MHOA 1K9KA 4PE7A 3D10A 2KDHA 3BUWB 4JWQA 3V2LA 2JOJA 1J7PA 3DVEA 1S6IA 1AJ5A 4FQOA 1GQMA 3LL8B 4HSZA 4L9MA 3SIBA 4IJ7A 3TDIA 2JTTA 1Y0VH 3O6BA 1U5IA 4USLA 1LINA 4GFTA 2RGIA 1DTLA 1TCFA 3SG7A 2CCMA 3D75A 3EG5B 3TS5C 4R1EA 1YTZC 3M0WA 1QV1A 3BFHA 2JZIA 1SL9A 1QVIZ 2O5GA 2O60A 2K2FA 4GGNA 2DOQA 1OOIX 1SCVA 2KFGA 1K8UA 1LVCD 1LA0A 2KI6D 3OX5A 4MBEA 3TZ1A 3D78A 3DD4A 3PATA 5AFPA 1QIWA 2F2PA 2Y1MA 4YBHB 1CB1A 3I5HB 4ORBB 4PT1A 1PRWA 2B1UA 1DJGA 1UURA 2LHIA 3CDNA 4OR9B 5AANA 3CWGA 5CPVA 1NUBA 3R72A 3SS5A 3TDZA 1JC2A 2ERBA 4CFQA 1K9UA 3TS5B 1AK8A 2PQLA 2H8VA 4I5KA 4ZCVA 2WCBA 4GNKB 4BY4A 1K94A 2LVVA 1KFXS 1P28A 1SW8A 3SG6A 1CMFA 2FCDA 2KNEA 1F54A 4OVNF 3UO9A 3O4YA 2K60A 2KI4C 1YUSA 2M49B 2MJWB 1N0YA 1FPWA 2HETA 1CFFA 3R1OA 2OPOA 2BCAA 2Q4UA 1ALWA 2PALA 2L98A 3LLEA 5J3XA 2JWWA 4AQIA 1JBAA 3BOWB 1G33A 1NWDA 3C1VA 2KHNA 3SS3A 5KSZA 1KK7Z 1DMOA 1HQVA 3EK8A 3NSOA 2LVIA 4FQTA 2WC6A 5TNCA 2JXLA 4M2PA 1KQVA 3WHTB 4C0JA 2JULA 3B86A 3BXKA 1XFZO 2KI4B 1DJWA 1LKJA 1CNPA 1Z4HA 3B7AA 2M97A 3L4LA 1IJ6A 1CLLA 1DVIA 1XFVO 5DKQA 3ZWHA 3UNWA 1XK4C 1KFUL 4YRUA 4PHNA 2SCPA 1VRKA 3HCMA 1A03A 2BBMA 2M0RA 3CR5X 1IQ3A 1MUXA 2OS8C 3K21A 4CPVA 5KTYA 1KCYA 3CZ1A 2EHBA 1BF5A 1IH0A 1M39A 2LVJA 1A2XA 2D8NA 2Y5IA 5I2LA 1L2OC 1IJ5A 1F4QA 1WLMA 4YGAA 1C7WA 1NCXA 5I8NA 3O2PA 4MN0A 1WY9A 2KI6C 1OOJA 3LK0A 1NX0A 1M45A 2TN4A 1K2HA 4JD9A 1OZOA 1QLSA 4C0LA 4DIRA 1SY9A 1BLQA 3PJIA 1C07A 1A29A 1R6PA 1XVJA 2BL0B 2F3YA 3BFAA 1JF0A 3CLNA 2OS8B 1LXFC 1QJTA 2BE4A 1IQ5A 1KK8C 1NIWA 1DEKA 3R1VA 4ORCB 5EL2A 2LUCA 1J1EA 1L2OB 1ZUZA 2H2KA 2L50A 1TNPA 2PYQA 4MVFA 3GOFA 4PHMA 4XJKA 2P70A 1NX1A 3PM2A 5B8IB 5DICA 3HX4A 1B1GA 1XFUO 1YRUB 1AHRA 2M8UA 2I2RE 2OTGC 1XFYO 3FWCA 2BNXA 1E8AA 2E6WA 1B7TZ 1BMOA 1K9PA 4QJ5B 4GBAA 3WNXB 2JQ6A 1KK8B 1XFRA 3OX6A 2K7BA 2K0JA 2KAXA 1KK7Y 1NYAA 1OZSA 2H61A 1BOCA 1C3YA 1SL8A 1MWNA 3BFBA 2WCLA 1WLZA 1U5IB 1GM0A 3CR2A 2Y1NA 1QX7A 2E30A 3B88A 1S5GZ 2V53A 3IF7A 1Y6WA 3VRPA 1SKTA 1DELA 2OTGB 4XYNA 1K90D 5FI6A 3S0GA 1GGWA 5AERA 3D0YA 5G08A 1BJFA 1CLMA 3SJSA 4MZJA 4GGFC 3F45A 3GK4X 4PALA 4Q04A 2MBXA 1BODA 2K61A 1XFWO 3VRQA 3RLZA 3I5HC 2ZN8A 1PSRA 1RJVA 5D7FA 1MQ1A 1DJXA 1EL4A 1J55A 4MZLA 1QWVA 1KFXL 1BG1A 3FE9A 1OOFA 1PVBA 1YVLA 2BECA 3CR4X 5I94A 4WQ2A 1SPYA 3CGAA 1CFPA 1DJYA 3BUNB 1F55A 4JQ0D 3FE8A 1W7IB 2BCXA 1YRTB 2LLTA 4N1FA 2FJYA 3L47A 4JPZB 1W7JB 1Y1XA 1J7OA 1Q80A 2EC6C 1OW4A 2R2IA 2MHHA 3EVUA 4INXA 1SYMA 2L5YA 4BY5A 1DJIA 1IRJA 2CTNA 3BUMB 3JTDB 2L2CA 4ETOA 1QIVA 1BT6A 3L4AA 1YX8A 5ER5A 3Q8IA 3NXAA 1QASA 1OE9B 2L4IA 1ZOTB 3I5IC 1RTP1 5I2OA 3EKHA 1N2DA 1HT9A 2LP2A 4GAOA 3LK1A 5IBWA 1K93D 3OBVA 2ZNEA 3IQOA 5HL1A 2EC6B 1FBVA 2NCOA 2LE9B 3DF0A 3K1EA 2WCFA 2BKHB 2F8PA 3DXLA 1B7TY 2KGBC 2LAPA 1F70A 1WRKA 4E68A 5CSJA 1UP5A 4MEWA 2M1KB 3O78A 3GK1A 4ORAB 2NLNA 2PMYA 1R2UA 4ZCUA 2WOSA 1OMVA 1BU3A 1QTXA 3I5IB 1CDLA 2NZ0A 5K89A 2HQ8A 3FS7A 1XA5A 2WCMA 4M2OA 2K2AA 2PRUA 2LVKA 1S5GY 3NHIA 4YI8A 1B8RA 2COLB 1W9ZA 2F2OA 2PVBA 1MF8B 1D1OA 3VGOA 2M1UA 3I5FC 4NDBA 4PE4A 4TNCA 3CZTX 4PE0A 1SCMB 5FYXA 1IWQA 1N65A 2WCHA 2K7DA 1B9AA 4OCIA 1X02A 1QV0A 3BQ3A 2JXCA 2IS9A 2BL0C 2LNKA 1AJ4A 1S26D 3SS4A 1S3PA 4DS7A 2QEBA 2M3WA 3PN7C 1NP8A 1ORGA 5JJGA 4A4CA 4MZKA 3PFVA 1A75A 2BBNA 2WC5A 2JC2A 4P5OE 1DGUA 2H61C 4XJKB 1YURA 1TNQA 2KQYA 3I5FB 1QVIY 4NDDA 1IIOA 1RECA 1RWYA 2AMIA 2FCEA 2VRGA 2F3ZA 1NX3A 2WC8A 2KLDA 5F6TA 4F0ZB 1JFJA 1F8HA 1YX7A 2BAPA 3H4SE 2HQWA 3E3RA 4IL1A 1TRFA 2I7AA 3FE6A 3EK7A 3VRNA 4HRHA 1DQEA 1V1FA 5HLOA 1C3ZA 1CFDA 2SASA 1XYDA 2L51A 4MLWA 4NDCA 2CXJA 1S36A 4MRYA 1SL7A 3PN7B 1J7QA 1CM4A 1T14A 1UHKA 1C7VA 3S0DA 1CM1A 3A4UB 3B87A 1FI6A 1CDPA 1YR5A 3AAKA 2M29A 5HLVA 1YVHA 3PALA 4HREE 2JNXA 2YGUA 3CZ0A 3PM8A 3DYEA 1B4CA 1K96A 2QPTA 2AAOA 4INWA 3DY9A 2CT9A 2KBIA 3SG2A 1Y1UA 1DJHA 2KBMA 2MRDA 4OZDA 2KQ6A 1TIZA 2K8MB 2LCPA 2M9GA 4PE1A 3D0YB 1PK0D 5PALA 3WXAA 4DCKA 1TNXA 2M7NA 1WRLA 3FIAA 5FI2A 3R1PA 2ZNDA 1WRZA 2F33A 1CDMA 3OHMB 3D77A 5AEQA 1EG4A 2ZN9A 1QLKA 1UHHA 1M31A 2JPOA 3JVTC 3WHUB 4N1GA 4GUKA 3S0EA 4UPGA 1KSOA 1ALVA 4YGCB 4OKHA 2KLEA 4AQJA 1G8IA 5HKYA 4YGBB 3EK4A 4PDZA 1DF0A 2KFFA 2LLUA 5KU1A 1TOPA 1QXPA 1CKKA 2LM5A 2WORA 2CBLA 3CZ2A 2WCKA 1YUTA 1CDNA 1TCOB 2P6BB 4DRWA 3BYAA 2KFHA 3IVTA 3JTDC 3JVTB 4WRIA 1S6CA 3KPXA 2G2BA 1WDCB 4ICBA 2Q91A 1TNWA 4YI9A 1CLBA 1Z2CB 2LANA 2EGDA 3OP0A 2WCEA 1NPQA 4FTGA 1J1DA 2ISDA 1EXRA 4A4BA 1F4OA 2ZRSA 3VB1A 3NSLA 1TUJA 2MAZA 3CABA 3DF0B 2GGMA 4PCWA 2QEOA 1SK6D 1SMGA 2JPTA 1KWOB 3TDUA 1PULA 2KPHA 1KQMC 1SR6B 2LLSA 3GK2A 4PHKA 1A4PA 1MXLC 2JTZA 4YGEB 1UUSA 2BCBA 2JT3A 2BKIB 3CS1A 5CSIA 3CTNA 2GTEA 3LCPC 3NHTA 1XO5A 4CLNA 2FOTA 2ZKMX 3S0AA 2QACA 5DKNA 2M7LA 1SSEB 1GGZA 1GJYA 1B8LA 1OMRA 3KHEA 1B47A 3VRRA 1SCMC 2JNFA 1SNLA 1KQMB 3D76A 1DT7B 1TN4A 2QDIA 3NGVA 1PVAA 4CIDA 2KOTA 1NX2A 3CYZA 5HKZA 1ZFSA 1OOHA 1K95A 1S1EA 2K7OA 1BR4B 1RROA 3S0FA 2MA2A 5CSNA 2WNDA 1NSHA 5AXIA 4U8DA 3EVVA 3S0BA 1FI5A 2L4HA 2LMTA 2QEVA 1A75B 1BR1B 1JFKA 2L0PA 2Y4QA 3TUYC 2JU0A 3FWBA 1KSMA 3O4XA 4GGFA 3BUOB 4C0KA 2ZRTA 3PSRA 4QJ3B 3OB1B 1Y1AA 3BJHA 3PLFB 1FF1A 2JRFA 2LUXA 4I5JA 3OB2B 4GPLB 2PASA 1L7ZA
chains in the Genus database with same CATH topology
3CZ0A 3S0GA 3DYEA 4PT1A 3CDNA 4INWA 3R72A 3DY9A 2P71A 3RZSA 2ERBA 4OZDA 4F7FA 2PQLA 2H8VA 1QWVA 3FE9A 1OOFA 1OOGA 1P28A 3R1PA 3D77A 3D73A 3OGNA 3DZTA 2JPOA 1LS8A 3FE8A 3QMEA 3R1OA 3S0EA 1TWOA 3D74A 2FJYA 3L47A 1OW4A 2QEHA 4INXA 2L2CA 4FQTA 2WC6A 3CZ2A 3L4AA 3Q8IA 2WCKA 3B6XA 3B86A 3N7HA 2WCJA 3B7AA 3L4LA 3K1EA 3DXLA 3VB1A 1TUJA 3CZ1A 3CABA 2QEOA 2KPHA 2WCMA 3NHIA 4JD9A 3NHTA 2GTEA 3PJIA 3BFAA 2WCHA 3R1VA 5EL2A 3S0AA 3V2LA 2P70A 2QEBA 3D76A 1ORGA 2QDIA 3NGVA 5DICA 3CYZA 2WC5A 1OOHA 3S0FA 3S0BA 2QEVA 1XFRA 3FE6A 1DQEA 3D75A 1C3ZA 1C3YA 3BFHA 3BFBA 2WCLA 1GM0A 1T14A 3BJHA 3B88A 3S0DA 1OOIX 3B87A 3D78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CZ0 A;  3S0G A;  3DYE A;  4PT1 A;  3CDN A;  4INW A;  3R72 A;  3DY9 A;  2P71 A;  3RZS A;  2ERB A;  4OZD A;  4F7F A;  2PQL A;  2H8V A;  1QWV A;  3FE9 A;  1OOF A;  1OOG A;  1P28 A;  3R1P A;  3D77 A;  3D73 A;  3OGN A;  3DZT A;  2JPO A;  1LS8 A;  3FE8 A;  3QME A;  3R1O A;  3S0E A;  1TWO A;  3D74 A;  2FJY A;  3L47 A;  1OW4 A;  2QEH A;  4INX A;  2L2C A;  4FQT A;  2WC6 A;  3CZ2 A;  3L4A A;  3Q8I A;  2WCK A;  3B6X A;  3B86 A;  3N7H A;  2WCJ A;  3B7A A;  3L4L A;  3K1E A;  3DXL A;  3VB1 A;  1TUJ A;  3CZ1 A;  3CAB A;  2QEO A;  2KPH A;  2WCM A;  3NHI A;  4JD9 A;  3NHT A;  2GTE A;  3PJI A;  3BFA A;  2WCH A;  3R1V A;  5EL2 A;  3S0A A;  3V2L A;  2P70 A;  2QEB A;  3D76 A;  1ORG A;  2QDI A;  3NGV A;  5DIC A;  3CYZ A;  2WC5 A;  1OOH A;  3S0F A;  3S0B A;  2QEV A;  1XFR A;  3FE6 A;  1DQE A;  3D75 A;  1C3Z A;  1C3Y A;  3BFH A;  3BFB A;  2WCL A;  1GM0 A;  1T14 A;  3BJH A;  3B88 A;  3S0D A;  1OOI X;  3B87 A;  3D78 A; 
#chains in the Genus database with same CATH topology
 1DJZ A;  2LMV A;  3ICB A;  2NCP A;  2NXQ A;  4N5X A;  3SIA A;  2AUC A;  2JT0 A;  2I94 A;  3NSK A;  4I5N B;  2P71 A;  3TUY B;  2KYF A;  3RZS A;  3AAJ A;  1EG3 A;  1MXE A;  2L2E A;  2LC5 A;  1SBJ A;  4F7F A;  1EH2 A;  1UHJ A;  3DVJ A;  1NCZ A;  1PAL A;  2MLF C;  1OSA A;  1RK9 A;  5CSF A;  1IG5 A;  5BPJ A;  1IKU A;  3IQQ A;  1DC1 A;  1H4B A;  1OOG A;  1V1G A;  3BOW A;  3D73 A;  1YUU A;  1CMG A;  3OGN A;  3KO0 A;  3DZT A;  4KYN A;  3ZNI A;  5DKR A;  1LS8 A;  3QME A;  1EJ3 A;  4WQ3 A;  1TWO A;  1ZAC A;  3D74 A;  3QRX A;  4D1E A;  2JT8 A;  5HYD A;  1JSA A;  3SG5 A;  2PSR A;  1SRA A;  1XFX O;  3VRO A;  2ZFD A;  2KSP A;  4MRX A;  3AKA A;  2QEH A;  2K7C A;  5JOL A;  1QX2 A;  3AKB A;  1M63 B;  1CFC A;  1QS7 A;  2LHL A;  1LA3 A;  2HPS A;  3I5G C;  1JF2 A;  5D3O A;  2GGZ A;  3B6X A;  2GV5 A;  2HF5 A;  3SG3 A;  2MLE C;  3N7H A;  4AOM A;  1DF0 B;  2WCJ A;  3SG4 A;  1QX5 B;  3BUX B;  3RM1 A;  4QJ4 B;  1OMD A;  1OQP A;  1PSB A;  5GQQ C;  1FW4 A;  3KEV A;  3DVM A;  2KAY A;  4JKT A;  5D69 A;  1AUI B;  2BE6 A;  4OV2 A;  4YGD B;  2I18 A;  1B8C A;  1KFU S;  1ZMZ A;  3MSE B;  1ODB A;  4DUQ A;  1WDC C;  4CFR A;  1CTR A;  2KAV A;  3EKJ A;  3KF9 A;  2FJU B;  2LP3 A;  2L5X B;  1G4Y R;  1TUZ A;  3I5G B;  5ER4 X;  5HKW A;  5I2Q A;  1JUO A;  1AVS A;  1J7R A;  1XK4 A;  2A4J A;  4NQG A;  1JWD A;  2LV7 A;  3EVR A;  1UWO A;  4PHJ A;  4MSP A;  1M46 A;  1RFJ A;  4M2Q A;  1H8B A;  1UHI A;  5FI7 A;  1F71 A;  3A8R A;  1S6J A;  1NCY A;  1UHN A;  1MR8 A;  2CNP A;  2G9B A;  1DGV A;  1KWO C;  3DVK A;  2LMU A;  2KGR A;  4I5L B;  1QAT A;  4P2Y B;  4HRG A;  1AP4 A;  1SR6 C;  1IGV A;  2KYC A;  1TTX A;  3NSI A;  1MHO A;  1K9K A;  4PE7 A;  3D10 A;  2KDH A;  3BUW B;  4JWQ A;  3V2L A;  2JOJ A;  1J7P A;  3DVE A;  1S6I A;  1AJ5 A;  4FQO A;  1GQM A;  3LL8 B;  4HSZ A;  4L9M A;  3SIB A;  4IJ7 A;  3TDI A;  2JTT A;  1Y0V H;  3O6B A;  1U5I A;  4USL A;  1LIN A;  4GFT A;  2RGI A;  1DTL A;  1TCF A;  3SG7 A;  2CCM A;  3D75 A;  3EG5 B;  3TS5 C;  4R1E A;  1YTZ C;  3M0W A;  1QV1 A;  3BFH A;  2JZI A;  1SL9 A;  1QVI Z;  2O5G A;  2O60 A;  2K2F A;  4GGN A;  2DOQ A;  1OOI X;  1SCV A;  2KFG A;  1K8U A;  1LVC D;  1LA0 A;  2KI6 D;  3OX5 A;  4MBE A;  3TZ1 A;  3D78 A;  3DD4 A;  3PAT A;  5AFP A;  1QIW A;  2F2P A;  2Y1M A;  4YBH B;  1CB1 A;  3I5H B;  4ORB B;  4PT1 A;  1PRW A;  2B1U A;  1DJG A;  1UUR A;  2LHI A;  3CDN A;  4OR9 B;  5AAN A;  3CWG A;  5CPV A;  1NUB A;  3R72 A;  3SS5 A;  3TDZ A;  1JC2 A;  2ERB A;  4CFQ A;  1K9U A;  3TS5 B;  1AK8 A;  2PQL A;  2H8V A;  4I5K A;  4ZCV A;  2WCB A;  4GNK B;  4BY4 A;  1K94 A;  2LVV A;  1KFX S;  1P28 A;  1SW8 A;  3SG6 A;  1CMF A;  2FCD A;  2KNE A;  1F54 A;  4OVN F;  3UO9 A;  3O4Y A;  2K60 A;  2KI4 C;  1YUS A;  2M49 B;  2MJW B;  1N0Y A;  1FPW A;  2HET A;  1CFF A;  3R1O A;  2OPO A;  2BCA A;  2Q4U A;  1ALW A;  2PAL A;  2L98 A;  3LLE A;  5J3X A;  2JWW A;  4AQI A;  1JBA A;  3BOW B;  1G33 A;  1NWD A;  3C1V A;  2KHN A;  3SS3 A;  5KSZ A;  1KK7 Z;  1DMO A;  1HQV A;  3EK8 A;  3NSO A;  2LVI A;  4FQT A;  2WC6 A;  5TNC A;  2JXL A;  4M2P A;  1KQV A;  3WHT B;  4C0J A;  2JUL A;  3B86 A;  3BXK A;  1XFZ O;  2KI4 B;  1DJW A;  1LKJ A;  1CNP A;  1Z4H A;  3B7A A;  2M97 A;  3L4L A;  1IJ6 A;  1CLL A;  1DVI A;  1XFV O;  5DKQ A;  3ZWH A;  3UNW A;  1XK4 C;  1KFU L;  4YRU A;  4PHN A;  2SCP A;  1VRK A;  3HCM A;  1A03 A;  2BBM A;  2M0R A;  3CR5 X;  1IQ3 A;  1MUX A;  2OS8 C;  3K21 A;  4CPV A;  5KTY A;  1KCY A;  3CZ1 A;  2EHB A;  1BF5 A;  1IH0 A;  1M39 A;  2LVJ A;  1A2X A;  2D8N A;  2Y5I A;  5I2L A;  1L2O C;  1IJ5 A;  1F4Q A;  1WLM A;  4YGA A;  1C7W A;  1NCX A;  5I8N A;  3O2P A;  4MN0 A;  1WY9 A;  2KI6 C;  1OOJ A;  3LK0 A;  1NX0 A;  1M45 A;  2TN4 A;  1K2H A;  4JD9 A;  1OZO A;  1QLS A;  4C0L A;  4DIR A;  1SY9 A;  1BLQ A;  3PJI A;  1C07 A;  1A29 A;  1R6P A;  1XVJ A;  2BL0 B;  2F3Y A;  3BFA A;  1JF0 A;  3CLN A;  2OS8 B;  1LXF C;  1QJT A;  2BE4 A;  1IQ5 A;  1KK8 C;  1NIW A;  1DEK A;  3R1V A;  4ORC B;  5EL2 A;  2LUC A;  1J1E A;  1L2O B;  1ZUZ A;  2H2K A;  2L50 A;  1TNP A;  2PYQ A;  4MVF A;  3GOF A;  4PHM A;  4XJK A;  2P70 A;  1NX1 A;  3PM2 A;  5B8I B;  5DIC A;  3HX4 A;  1B1G A;  1XFU O;  1YRU B;  1AHR A;  2M8U A;  2I2R E;  2OTG C;  1XFY O;  3FWC A;  2BNX A;  1E8A A;  2E6W A;  1B7T Z;  1BMO A;  1K9P A;  4QJ5 B;  4GBA A;  3WNX B;  2JQ6 A;  1KK8 B;  1XFR A;  3OX6 A;  2K7B A;  2K0J A;  2KAX A;  1KK7 Y;  1NYA A;  1OZS A;  2H61 A;  1BOC A;  1C3Y A;  1SL8 A;  1MWN A;  3BFB A;  2WCL A;  1WLZ A;  1U5I B;  1GM0 A;  3CR2 A;  2Y1N A;  1QX7 A;  2E30 A;  3B88 A;  1S5G Z;  2V53 A;  3IF7 A;  1Y6W A;  3VRP A;  1SKT A;  1DEL A;  2OTG B;  4XYN A;  1K90 D;  5FI6 A;  3S0G A;  1GGW A;  5AER A;  3D0Y A;  5G08 A;  1BJF A;  1CLM A;  3SJS A;  4MZJ A;  4GGF C;  3F45 A;  3GK4 X;  4PAL A;  4Q04 A;  2MBX A;  1BOD A;  2K61 A;  1XFW O;  3VRQ A;  3RLZ A;  3I5H C;  2ZN8 A;  1PSR A;  1RJV A;  5D7F A;  1MQ1 A;  1DJX A;  1EL4 A;  1J55 A;  4MZL A;  1QWV A;  1KFX L;  1BG1 A;  3FE9 A;  1OOF A;  1PVB A;  1YVL A;  2BEC A;  3CR4 X;  5I94 A;  4WQ2 A;  1SPY A;  3CGA A;  1CFP A;  1DJY A;  3BUN B;  1F55 A;  4JQ0 D;  3FE8 A;  1W7I B;  2BCX A;  1YRT B;  2LLT A;  4N1F A;  2FJY A;  3L47 A;  4JPZ B;  1W7J B;  1Y1X A;  1J7O A;  1Q80 A;  2EC6 C;  1OW4 A;  2R2I A;  2MHH A;  3EVU A;  4INX A;  1SYM A;  2L5Y A;  4BY5 A;  1DJI A;  1IRJ A;  2CTN A;  3BUM B;  3JTD B;  2L2C A;  4ETO A;  1QIV A;  1BT6 A;  3L4A A;  1YX8 A;  5ER5 A;  3Q8I A;  3NXA A;  1QAS A;  1OE9 B;  2L4I A;  1ZOT B;  3I5I C;  1RTP 1;  5I2O A;  3EKH A;  1N2D A;  1HT9 A;  2LP2 A;  4GAO A;  3LK1 A;  5IBW A;  1K93 D;  3OBV A;  2ZNE A;  3IQO A;  5HL1 A;  2EC6 B;  1FBV A;  2NCO A;  2LE9 B;  3DF0 A;  3K1E A;  2WCF A;  2BKH B;  2F8P A;  3DXL A;  1B7T Y;  2KGB C;  2LAP A;  1F70 A;  1WRK A;  4E68 A;  5CSJ A;  1UP5 A;  4MEW A;  2M1K B;  3O78 A;  3GK1 A;  4ORA B;  2NLN A;  2PMY A;  1R2U A;  4ZCU A;  2WOS A;  1OMV A;  1BU3 A;  1QTX A;  3I5I B;  1CDL A;  2NZ0 A;  5K89 A;  2HQ8 A;  3FS7 A;  1XA5 A;  2WCM A;  4M2O A;  2K2A A;  2PRU A;  2LVK A;  1S5G Y;  3NHI A;  4YI8 A;  1B8R A;  2COL B;  1W9Z A;  2F2O A;  2PVB A;  1MF8 B;  1D1O A;  3VGO A;  2M1U A;  3I5F C;  4NDB A;  4PE4 A;  4TNC A;  3CZT X;  4PE0 A;  1SCM B;  5FYX A;  1IWQ A;  1N65 A;  2WCH A;  2K7D A;  1B9A A;  4OCI A;  1X02 A;  1QV0 A;  3BQ3 A;  2JXC A;  2IS9 A;  2BL0 C;  2LNK A;  1AJ4 A;  1S26 D;  3SS4 A;  1S3P A;  4DS7 A;  2QEB A;  2M3W A;  3PN7 C;  1NP8 A;  1ORG A;  5JJG A;  4A4C A;  4MZK A;  3PFV A;  1A75 A;  2BBN A;  2WC5 A;  2JC2 A;  4P5O E;  1DGU A;  2H61 C;  4XJK B;  1YUR A;  1TNQ A;  2KQY A;  3I5F B;  1QVI Y;  4NDD A;  1IIO A;  1REC A;  1RWY A;  2AMI A;  2FCE A;  2VRG A;  2F3Z A;  1NX3 A;  2WC8 A;  2KLD A;  5F6T A;  4F0Z B;  1JFJ A;  1F8H A;  1YX7 A;  2BAP A;  3H4S E;  2HQW A;  3E3R A;  4IL1 A;  1TRF A;  2I7A A;  3FE6 A;  3EK7 A;  3VRN A;  4HRH A;  1DQE A;  1V1F A;  5HLO A;  1C3Z A;  1CFD A;  2SAS A;  1XYD A;  2L51 A;  4MLW A;  4NDC A;  2CXJ A;  1S36 A;  4MRY A;  1SL7 A;  3PN7 B;  1J7Q A;  1CM4 A;  1T14 A;  1UHK A;  1C7V A;  3S0D A;  1CM1 A;  3A4U B;  3B87 A;  1FI6 A;  1CDP A;  1YR5 A;  3AAK A;  2M29 A;  5HLV A;  1YVH A;  3PAL A;  4HRE E;  2JNX A;  2YGU A;  3CZ0 A;  3PM8 A;  3DYE A;  1B4C A;  1K96 A;  2QPT A;  2AAO A;  4INW A;  3DY9 A;  2CT9 A;  2KBI A;  3SG2 A;  1Y1U A;  1DJH A;  2KBM A;  2MRD A;  4OZD A;  2KQ6 A;  1TIZ A;  2K8M B;  2LCP A;  2M9G A;  4PE1 A;  3D0Y B;  1PK0 D;  5PAL A;  3WXA A;  4DCK A;  1TNX A;  2M7N A;  1WRL A;  3FIA A;  5FI2 A;  3R1P A;  2ZND A;  1WRZ A;  2F33 A;  1CDM A;  3OHM B;  3D77 A;  5AEQ A;  1EG4 A;  2ZN9 A;  1QLK A;  1UHH A;  1M31 A;  2JPO A;  3JVT C;  3WHU B;  4N1G A;  4GUK A;  3S0E A;  4UPG A;  1KSO A;  1ALV A;  4YGC B;  4OKH A;  2KLE A;  4AQJ A;  1G8I A;  5HKY A;  4YGB B;  3EK4 A;  4PDZ A;  1DF0 A;  2KFF A;  2LLU A;  5KU1 A;  1TOP A;  1QXP A;  1CKK A;  2LM5 A;  2WOR A;  2CBL A;  3CZ2 A;  2WCK A;  1YUT A;  1CDN A;  1TCO B;  2P6B B;  4DRW A;  3BYA A;  2KFH A;  3IVT A;  3JTD C;  3JVT B;  4WRI A;  1S6C A;  3KPX A;  2G2B A;  1WDC B;  4ICB A;  2Q91 A;  1TNW A;  4YI9 A;  1CLB A;  1Z2C B;  2LAN A;  2EGD A;  3OP0 A;  2WCE A;  1NPQ A;  4FTG A;  1J1D A;  2ISD A;  1EXR A;  4A4B A;  1F4O A;  2ZRS A;  3VB1 A;  3NSL A;  1TUJ A;  2MAZ A;  3CAB A;  3DF0 B;  2GGM A;  4PCW A;  2QEO A;  1SK6 D;  1SMG A;  2JPT A;  1KWO B;  3TDU A;  1PUL A;  2KPH A;  1KQM C;  1SR6 B;  2LLS A;  3GK2 A;  4PHK A;  1A4P A;  1MXL C;  2JTZ A;  4YGE B;  1UUS A;  2BCB A;  2JT3 A;  2BKI B;  3CS1 A;  5CSI A;  3CTN A;  2GTE A;  3LCP C;  3NHT A;  1XO5 A;  4CLN A;  2FOT A;  2ZKM X;  3S0A A;  2QAC A;  5DKN A;  2M7L A;  1SSE B;  1GGZ A;  1GJY A;  1B8L A;  1OMR A;  3KHE A;  1B47 A;  3VRR A;  1SCM C;  2JNF A;  1SNL A;  1KQM B;  3D76 A;  1DT7 B;  1TN4 A;  2QDI A;  3NGV A;  1PVA A;  4CID A;  2KOT A;  1NX2 A;  3CYZ A;  5HKZ A;  1ZFS A;  1OOH A;  1K95 A;  1S1E A;  2K7O A;  1BR4 B;  1RRO A;  3S0F A;  2MA2 A;  5CSN A;  2WND A;  1NSH A;  5AXI A;  4U8D A;  3EVV A;  3S0B A;  1FI5 A;  2L4H A;  2LMT A;  2QEV A;  1A75 B;  1BR1 B;  1JFK A;  2L0P A;  2Y4Q A;  3TUY C;  2JU0 A;  3FWB A;  1KSM A;  3O4X A;  4GGF A;  3BUO B;  4C0K A;  2ZRT A;  3PSR A;  4QJ3 B;  3OB1 B;  1Y1A A;  3BJH A;  3PLF B;  1FF1 A;  2JRF A;  2LUX A;  4I5J A;  3OB2 B;  4GPL B;  2PAS A;  1L7Z A; 
#chains in the Genus database with same CATH homology
 3CZ0 A;  3S0G A;  3DYE A;  4PT1 A;  3CDN A;  4INW A;  3R72 A;  3DY9 A;  2P71 A;  3RZS A;  2ERB A;  4OZD A;  4F7F A;  2PQL A;  2H8V A;  1QWV A;  3FE9 A;  1OOF A;  1OOG A;  1P28 A;  3R1P A;  3D77 A;  3D73 A;  3OGN A;  3DZT A;  2JPO A;  1LS8 A;  3FE8 A;  3QME A;  3R1O A;  3S0E A;  1TWO A;  3D74 A;  2FJY A;  3L47 A;  1OW4 A;  2QEH A;  4INX A;  2L2C A;  4FQT A;  2WC6 A;  3CZ2 A;  3L4A A;  3Q8I A;  2WCK A;  3B6X A;  3B86 A;  3N7H A;  2WCJ A;  3B7A A;  3L4L A;  3K1E A;  3DXL A;  3VB1 A;  1TUJ A;  3CZ1 A;  3CAB A;  2QEO A;  2KPH A;  2WCM A;  3NHI A;  4JD9 A;  3NHT A;  2GTE A;  3PJI A;  3BFA A;  2WCH A;  3R1V A;  5EL2 A;  3S0A A;  3V2L A;  2P70 A;  2QEB A;  3D76 A;  1ORG A;  2QDI A;  3NGV A;  5DIC A;  3CYZ A;  2WC5 A;  1OOH A;  3S0F A;  3S0B A;  2QEV A;  1XFR A;  3FE6 A;  1DQE A;  3D75 A;  1C3Z A;  1C3Y A;  3BFH A;  3BFB A;  2WCL A;  1GM0 A;  1T14 A;  3BJH A;  3B88 A;  3S0D A;  1OOI X;  3B87 A;  3D78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...