1YURA

Solution structure of apo-s100a13 (minimized mean structure)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
98
structure length
98
Chain Sequence
MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Interplay between Calcium(II) and Copper(II) Binding to S100A13 Protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords S100 calcium-binding protein A13
total genus 30
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1yurA00
4CPVA 1WDCB 2QACA 4N1GA 2LLUA 1WDCC 4C0LA 4FQOA 4NQGA 1BOCA 1CFPA 2ZNEA 2LCPA 1J7PA 1QX2A 1RK9A 4ZCVA 2I7AA 2PSRA 4QJ3B 4AQIA 1FBVA 3TZ1A 1A75A 1CLLA 1LA3A 5ER5A 5I2OA 4YGCB 3I5FC 1BLQA 1XA5A 1ALWA 1YUTA 5IBWA 4GGNA 4CIDA 4GUKA 5HKWA 2M0RA 1HT9A 2NZ0A 1KCYA 2EC6C 1NX0A 1WRLA 5AXIA 1EL4A 1UHHA 2QPTA 2RGIA 1QS7A 2M1UA 2GGZA 1DTLA 2IS9A 3PSRA 1DJGA 1DF0A 1SYMA 1B7TY 1U5IA 5B8IB 2FJUB 3BUWB 2K7CA 1NIWA 2M8UA 3ZWHA 2LVJA 2LNKA 5I2QA 4PE1A 1BR4B 4YGBB 1PSBA 1NCYA 3I5GB 3DVEA 1SL7A 5HKZA 5TNCA 1JF0A 1NUBA 2F8PA 1MXEA 3KF9A 4CLNA 2K61A 4I5KA 3I5IB 1DJHA 4AOMA 2WCEA 1DGVA 1BU3A 3GOFA 1MQ1A 2KAVA 3I5IC 1BR1B 1SCMC 2L51A 5DKQA 2F2PA 3EKJA 1K2HA 1SL9A 2NCOA 2CTNA 3CZTX 1TNXA 2BECA 2FCDA 2CBLA 2L50A 3FWBA 3DF0A 1NSHA 4I5JA 2BBMA 2M97A 5I8NA 2VRGA 2K2FA 2LV7A 2K7DA 2MAZA 1CDMA 1MUXA 1KFUS 1CDPA 4MEWA 4NDDA 1RTP1 1Y6WA 3OX5A 4IL1A 1JSAA 2KSPA 3DVMA 1KFXS 1CTRA 2LE9B 3TS5B 1UHIA 4A4BA 1YVLA 3EK7A 4GAOA 1Y1UA 2K0JA 3EK4A 1BF5A 1TN4A 5CSNA 1OZOA 3QRXA 1M63B 1OE9B 2BCXA 2LMVA 1CM1A 2K2AA 1JC2A 1EH2A 3A4UB 5JJGA 2ZN8A 2JZIA 2L4IA 4NDBA 2LM5A 1CLMA 1M46A 3BOWA 3IQOA 1F4QA 2JXCA 1BT6A 1KK8B 1KSMA 4PDZA 1S36A 2BKHB 2MLEC 4M2PA 2KI4B 2K7OA 1NPQA 1B9AA 3LK0A 2OS8B 2KI4C 2LVVA 1UURA 1VRKA 2H2KA 2LLTA 1CFCA 1FF1A 1OMRA 1B8RA 3F45A 2GGMA 1KK7Y 1NX1A 1QX7A 1SR6C 1MF8B 3SIBA 2LAPA 1AJ5A 1YX8A 5CSFA 4GGFA 4UPGA 3PFVA 1WLZA 4FTGA 2ZNDA 1WRKA 3I5HC 2MA2A 5G08A 3HCMA 4I5LB 1Y0VH 1RFJA 2JULA 3KEVA 1RROA 1AHRA 2PRUA 3E3RA 4YGAA 2LHLA 4WRIA 2P6BB 2M3WA 2H61A 2E6WA 4P2YB 4TNCA 1YRUB 3NSIA 1DMOA 1IJ5A 3DF0B 3PN7C 2LUXA 5HLOA 2KGBC 4YGEB 2JT3A 3PN7B 3D10A 3WXAA 1QASA 1XFUO 1ZACA 1JUOA 5JOLA 3ZNIA 1UHKA 1QXPA 3CWGA 1V1GA 5AANA 1KFUL 2ZRSA 1JF2A 1EG4A 2JNFA 1XFXO 4OKHA 3VRRA 2LHIA 3CS1A 1QV0A 4DIRA 3WNXB 1NCZA 1J7OA 1AUIB 1B4CA 4QJ4B 1K93D 2F3YA 1S3PA 2HPSA 1R6PA 1FI5A 2JWWA 2ZKMX 2BE6A 1K95A 3JTDC 2H61C 1MHOA 1PALA 3H4SE 1SNLA 3GK2A 1GJYA 1ALVA 1SCMB 1Y1XA 1K9UA 1SL8A 1M39A 1J1DA 5CSJA 3I5FB 1S6JA 1L2OB 2KBMA 1IWQA 1SRAA 1KFXL 2WORA 4HREE 1OOJA 3SG3A 1FPWA 4XYNA 5ER4X 1L2OC 3TDUA 1CMFA 1J1EA 3BUMB 1KQMC 5HLVA 1AJ4A 4GNKB 2KOTA 1V1FA 3CR2A 1NX3A 1YUUA 1C7WA 2BBNA 1RJVA 2KDHA 3A8RA 3EVVA 1SPYA 4C0KA 1KWOB 1IKUA 1OZSA 1JFKA 1F8HA 2I94A 4YI9A 3FIAA 1LA0A 1BG1A 1A2XA 1TRFA 1EG3A 1TNWA 5F6TA 3BOWB 2JPTA 5BPJA 1CDNA 2FOTA 2KYCA 1F70A 1DGUA 1DF0B 1M31A 1QLKA 3PATA 1H4BA 1ZOTB 1D1OA 2M9GA 1SBJA 2KHNA 4USLA 4QJ5B 4BY4A 1MR8A 1TOPA 1B7TZ 1KK8C 4GPLB 1ZFSA 3KO0A 5D7FA 2KAXA 2Y1MA 4YBHB 4MRYA 3TDIA 3OX6A 3OB1B 2L2EA 1NCXA 2JC2A 1MXLC 2E30A 2NCPA 3DVJA 2MJWB 2JTTA 1TIZA 4JPZB 4ORAB 4DRWA 4PHMA 2EHBA 1KK7Z 4MVFA 1N65A 1U5IB 4I5NB 2NXQA 4OCIA 1NX2A 2CCMA 1R2UA 2L4HA 2FCEA 1F71A 2LANA 1UHNA 5KSZA 2G9BA 1TCFA 3WHUB 1OQPA 5D69A 1W7JB 5AEQA 1QIWA 2COLB 2KFFA 3NSLA 1OSAA 3LL8B 4PHNA 3JVTC 2LMTA 3TUYC 3JVTB 2HQ8A 1YR5A 3BUNB 3TUYB 1FW4A 4N5XA 3SG6A 1S5GY 1UUSA 3VRPA 4U8DA 3BQ3A 4HRGA 1DJIA 3O4YA 1G4YR 4M2QA 1A75B 4OVNF 2KGRA 1ZUZA 2AUCA 2PALA 1CMGA 1QVIY 2ISDA 3MSEB 4ZCUA 3RLZA 4E68A 1CFFA 3I5GC 2JOJA 1GGWA 1TCOB 2M1KB 1ZMZA 1PULA 3ICBA 1EXRA 2KFHA 1IG5A 1S1EA 1YTZC 2BCAA 1MWNA 3PALA 1F4OA 4DCKA 5HKYA 2MBXA 2CXJA 3I5HB 4L9MA 4F0ZB 1M45A 3D0YA 2G2BA 3SIAA 4MZLA 1BMOA 3KPXA 3BXKA 1LINA 2WCFA 2AMIA 3CLNA 1IQ3A 3OHMB 3KHEA 2MLFC 2B1UA 3PM8A 2D8NA 4JQ0D 2K8MB 4MZJA 5GQQC 2Y5IA 2M29A 1PVAA 2JTZA 1WRZA 4A4CA 1AVSA 1RWYA 1XO5A 2LVIA 3EKHA 2BCBA 5AFPA 2LVKA 3D0YB 1SW8A 1QV1A 1DT7B 1AK8A 2A4JA 2O60A 2F33A 1K96A 2AAOA 3CGAA 1GGZA 1XFWO 2HF5A 3IF7A 4JWQA 3CR4X 3C1VA 2WOSA 3LCPC 4ETOA 2JRFA 3SG5A 2JNXA 2SASA 4HSZA 3OP0A 3EVRA 3VRQA 1CB1A 2PVBA 4NDCA 2KAYA 2F3ZA 2JXLA 4MZKA 3SG4A 1XFVO 1DJZA 2Y4QA 1H8BA 4MBEA 2OS8C 1YURA 1IJ6A 1A29A 3GK4X 5CSIA 4D1EA 1K9KA 1A4PA 1XFZO 2LLSA 1S26D 2BKIB 2JT0A 2WNDA 3DVKA 2OTGB 4XJKB 5CPVA 5K89A 1SMGA 4MLWA 1CLBA 1QIVA 4N1FA 4BY5A 1OMDA 4PCWA 1IH0A 2F2OA 2BL0C 1TNQA 1K90D 1SCVA 3VGOA 1KQVA 1JWDA 2KNEA 2K7BA 3GK1A 4DS7A 2CNPA 4PALA 1XVJA 4ORBB 1PVBA 3BUXB 1G33A 1RECA 2TN4A 1XFYO 3OB2B 4HRHA 3LLEA 3SJSA 1K8UA 1NP8A 1N2DA 4GFTA 1GQMA 1B8CA 1C7VA 2KFGA 1J7RA 1CFDA 4MSPA 5PALA 2ZFDA 4CFRA 1CKKA 1Q80A 3IQQA 1F54A 3AKBA 1UHJA 1QJTA 1CM4A 1J7QA 3NSOA 1NYAA 1SR6B 1CNPA 2Q91A 2Q4UA 3FS7A 1SY9A 1X02A 1QX5B 4WQ3A 3TDZA 3RM1A 1CDLA 2LP2A 4MN0A 3JTDB 4XJKA 1IGVA 2JU0A 4YI8A 4PE4A 1JFJA 1PRWA 1DVIA 1YRTB 1YX7A 3BYAA 4YRUA 1S5GZ 1BODA 2L98A 2BE4A 4M2OA 4R1EA 2EC6B 1OMVA 1N0YA 2LP3A 2HQWA 1KQMB 2PASA 2SCPA 1PK0D 3O6BA 2NLNA 4Q04A 4YGDB 2KI6C 2M49B 1A03A 2I18A 2JQ6A 5J3XA 1NWDA 1KWOC 3VRNA 1EJ3A 3O2PA 1PSRA 2M7LA 1WLMA 1IRJA 1Y1AA 3K21A 4OV2A 1K9PA 1S6CA 3SG2A 5KTYA 2KQ6A 1DJYA 1C07A 2ZN9A 2KBIA 2GV5A 2LUCA 4AQJA 1DJXA 4GBAA 4PHJA 5DKRA 3DD4A 2PMYA 1DJWA 2L5XB 1J55A 3HX4A 2LMUA 4OR9B 1QTXA 1LXFC 4WQ2A 1WY9A 1XK4A 5HYDA 2Y1NA 1B1GA 3VROA 1XYDA 2L0PA 2DOQA 3EVUA 1XK4C 1TTXA 3NXAA 5I2LA 2I2RE 4ORCB 3AKAA 4MRXA 1B47A 3O78A 1KSOA 2HETA 4PE0A 2KI6D 3NSKA 5AERA 1SKTA 2OTGC 2R2IA 1QVIZ 1BJFA 2V53A 4CFQA 1QATA 2KQYA 2MRDA 3AAJA 3TS5C 1YVHA 4P5OE 1FI6A 5KU1A 1G8IA 1JBAA 1K94A 2BL0B 2WC8A 2ZRTA 3FWCA 5FYXA 3CR5X 3M0WA 1IQ5A 2WCBA 1B8LA 1ODBA 3WHTB 3EK8A 1TNPA 2LC5A 1SK6D 1UWOA 1L7ZA 1UP5A 2O5GA 1S6IA 3LK1A 4PE7A 3PLFB 2JT8A 4PHKA 3SG7A 3CTNA 1LKJA 4DUQA 4ICBA 1LVCD 2MHHA 1AP4A 1E8AA 3BUOB 2EGDA 1QLSA 2M7NA 2OPOA 3AAKA 2CT9A 1W7IB 1HQVA 4C0JA 1YUSA 4GGFC 5DKNA 2KYFA 1F55A
chains in the Genus database with same CATH superfamily
4CPVA 1WDCB 2QACA 3B7AA 4N1GA 2LLUA 5FI2A 1WDCC 4C0LA 4FQOA 4NQGA 3D74A 1C3YA 1BOCA 1CFPA 2QEHA 2ZNEA 2LCPA 1J7PA 1QX2A 1RK9A 4ZCVA 2I7AA 2PSRA 4QJ3B 4AQIA 1FBVA 3TZ1A 1A75A 1CLLA 1LA3A 5ER5A 5I2OA 3SS4A 4YGCB 3I5FC 3D75A 1XA5A 3QMEA 1BLQA 1ALWA 1YUTA 5IBWA 4GGNA 4CIDA 4GUKA 2WCMA 5HKWA 2M0RA 4INXA 1HT9A 2NZ0A 1KCYA 2EC6C 1NX0A 1WRLA 5AXIA 1EL4A 1UHHA 2QPTA 2RGIA 1QS7A 2M1UA 2GGZA 1DTLA 2IS9A 3PSRA 1DJGA 1DF0A 1SYMA 1B7TY 1U5IA 5B8IB 2FJUB 3BUWB 2K7CA 5I94A 1NIWA 2M8UA 3ZWHA 2LVJA 2LNKA 5I2QA 4FQTA 1BR4B 4PE1A 1PSBA 1NCYA 3I5GB 3DVEA 1SL7A 4YGBB 5HKZA 5TNCA 1JF0A 1NUBA 2F8PA 1MXEA 5DICA 3KF9A 4CLNA 3B6XA 2K61A 4I5KA 3I5IB 1DJHA 4AOMA 2WCEA 1DGVA 3L4AA 1BU3A 3GOFA 1MQ1A 2KAVA 3I5IC 1BR1B 1SCMC 2L51A 5DKQA 2F2PA 3EKJA 1K2HA 1SL9A 2NCOA 2CTNA 3CZTX 1TNXA 2BECA 2FCDA 2CBLA 2L50A 3FWBA 3DF0A 1NSHA 4I5JA 2BBMA 1XFRA 2M97A 2WCJA 5I8NA 2VRGA 2K2FA 2LV7A 2K7DA 2MAZA 1CDMA 1MUXA 3R1VA 1KFUS 1CDPA 4MEWA 4NDDA 3UNWA 1RTP1 4IJ7A 1Y6WA 3OX5A 4IL1A 1JSAA 2KSPA 3DVMA 1KFXS 1TWOA 1CTRA 2LE9B 1Z2CB 3TS5B 1UHIA 4A4BA 1YVLA 3EK7A 4GAOA 1Y1UA 2K0JA 2FJYA 3EK4A 1TN4A 1BF5A 5CSNA 1OZOA 3QRXA 1M63B 1OE9B 2BCXA 2LMVA 1CM1A 2K2AA 3S0GA 1JC2A 1EH2A 3A4UB 3BFBA 5JJGA 1DC1A 2ZN8A 2JZIA 2L4IA 4NDBA 2LM5A 1CLMA 1M46A 3BOWA 3CDNA 3IQOA 1F4QA 2JXCA 1BT6A 1KK8B 1KSMA 4PDZA 1S36A 2BKHB 2MLEC 3DYEA 2KI4B 4M2PA 2K7OA 1NPQA 1B9AA 3LK0A 2OS8B 2KI4C 2LVVA 3K1EA 1UURA 1VRKA 2H2KA 2LLTA 1CFCA 1FF1A 1OMRA 1B8RA 3F45A 2GGMA 1KK7Y 1NX1A 1QX7A 1SR6C 1MF8B 3SIBA 2LAPA 1AJ5A 1YX8A 5KTYA 2PQLA 4GGFA 5CSFA 4UPGA 3PFVA 1WLZA 4FTGA 2ZNDA 1WRKA 3I5HC 2MA2A 5G08A 3HCMA 1W9ZA 1Y0VH 4I5LB 1RFJA 2JULA 3KEVA 1RROA 1AHRA 2PRUA 3E3RA 4YGAA 1GM0A 3D73A 3O4XA 2LHLA 4WRIA 2P6BB 2M3WA 1OOGA 2H61A 2E6WA 4P2YB 4TNCA 1YRUB 3NSIA 1DMOA 1QWVA 1IJ5A 3DF0B 3PN7C 2LUXA 5HLOA 2KGBC 4YGEB 2JT3A 3PN7B 3D10A 3WXAA 1QASA 1XFUO 1ZACA 1JUOA 5JOLA 3ZNIA 1UHKA 1QXPA 3CWGA 3S0DA 1V1GA 1OOHA 5AANA 1KFUL 2ZRSA 1JF2A 1P28A 1EG4A 2JNFA 1XFXO 2KLEA 3DXLA 4OKHA 3VRRA 2LHIA 3CS1A 1QV0A 4DIRA 2L5YA 3WNXB 1NCZA 1J7OA 1AUIB 1Z4HA 1B4CA 4QJ4B 1K93D 2F3YA 3D78A 1S3PA 2HPSA 1R6PA 1FI5A 2JWWA 2ZKMX 2BE6A 3L4LA 1K95A 3S0AA 3JTDC 2H61C 1MHOA 1PALA 3H4SE 2GTEA 1SNLA 1IIOA 3GK2A 1GJYA 1ALVA 1SCMB 1Y1XA 1K9UA 1SL8A 1M39A 1J1DA 5CSJA 2JPOA 3B88A 3I5FB 1S6JA 1L2OB 2KBMA 3N7HA 1IWQA 1SRAA 1KFXL 2WORA 4HREE 1OOJA 2WCHA 3SG3A 4XYNA 5ER4X 1FPWA 1L2OC 3IVTA 3TDUA 1CMFA 1J1EA 3BUMB 1KQMC 5HLVA 1AJ4A 4GNKB 2KOTA 1V1FA 3CR2A 3S0BA 1NX3A 1YUUA 1C7WA 2BBNA 1RJVA 2KDHA 3A8RA 3EVVA 1SPYA 4C0KA 3NHIA 1KWOB 1IKUA 1OZSA 1JFKA 1F8HA 2I94A 4YI9A 3NHTA 3FIAA 1LA0A 1BG1A 1A2XA 3DY9A 1TRFA 1EG3A 1TNWA 3DZTA 3BFHA 3BOWB 2JPTA 3CYZA 5F6TA 2QDIA 5BPJA 1CDNA 2FOTA 2KYCA 1F70A 1DGUA 3PM2A 1DF0B 1M31A 1QLKA 3PATA 1H4BA 1LS8A 1ZOTB 1D1OA 3FE8A 2H8VA 2M9GA 1SBJA 2KHNA 4USLA 4QJ5B 4BY4A 1MR8A 4JKTA 1TOPA 1B7TZ 1KK8C 4GPLB 1ZFSA 3KO0A 5D7FA 2KAXA 2Y1MA 4YBHB 4MRYA 3TDIA 2K60A 3OX6A 3OB1B 2L2EA 1NCXA 2JC2A 1MXLC 2E30A 2NCPA 3DVJA 2MJWB 2JTTA 1TIZA 4JPZB 4ORAB 4DRWA 4PHMA 2EHBA 1KK7Z 1TUJA 1N65A 1U5IB 4MVFA 4I5NB 2NXQA 2L2CA 4OCIA 3FE9A 1NX2A 2CCMA 3BJHA 1R2UA 1DELA 2FCEA 2L4HA 1F71A 2LANA 2QEVA 1UHNA 5KSZA 1TCFA 2G9BA 3WHUB 1OQPA 5D69A 1W7JB 5AEQA 1QIWA 2COLB 2KFFA 3NSLA 1OSAA 3LL8B 4PHNA 3JVTC 2LMTA 3D77A 3TUYC 3JVTB 2HQ8A 3V2LA 5FI6A 1YR5A 3BUNB 3TUYB 1FW4A 4N5XA 3SG6A 1S5GY 1UUSA 3VRPA 4INWA 3S0FA 4U8DA 3BQ3A 4HRGA 1DJIA 3O4YA 1G4YR 4M2QA 1A75B 4OVNF 2KGRA 1ZUZA 2AUCA 2PALA 1CMGA 1QVIY 2ISDA 3MSEB 4ZCUA 3RLZA 4E68A 2PYQA 1CFFA 3I5GC 2JOJA 1GGWA 1TCOB 2M1KB 1ZMZA 1PULA 3ICBA 1EXRA 2KFHA 1IG5A 1S1EA 2BCAA 1YTZC 1C3ZA 1MWNA 1F4OA 3PALA 5D3OA 4DCKA 5HKYA 2MBXA 2CXJA 3I5HB 4L9MA 4F0ZB 1M45A 3D0YA 2G2BA 3SIAA 4MZLA 5FI7A 1BMOA 3KPXA 3BXKA 1LINA 2WCFA 3FE6A 2AMIA 2BAPA 3CLNA 5HL1A 1IQ3A 3OHMB 4PT1A 3KHEA 3CZ2A 2MLFC 2B1UA 3PM8A 2D8NA 4JQ0D 2K8MB 4MZJA 5GQQC 2Y5IA 2ERBA 2P70A 2M29A 1PVAA 2JTZA 1WRZA 4A4CA 1AVSA 1RWYA 1XO5A 2LVIA 3EKHA 2BCBA 5AFPA 2LVKA 3D0YB 1SW8A 1QV1A 1SSEB 1DT7B 1AK8A 2A4JA 2O60A 2F33A 3OGNA 3SS5A 1K96A 2AAOA 2WC6A 3CGAA 1GGZA 1XFWO 2HF5A 3IF7A 4JWQA 3CR4X 1OOFA 3C1VA 2WOSA 3LCPC 4ETOA 2JRFA 3SG5A 2JNXA 1ORGA 2SASA 3CZ0A 4HSZA 3OP0A 3EVRA 3VRQA 1CB1A 2PVBA 4NDCA 2KAYA 2F3ZA 4OZDA 4F7FA 3R1PA 2KLDA 2JXLA 4MZKA 3D76A 3SG4A 1XFVO 1DJZA 2Y4QA 3B86A 1H8BA 4MBEA 2OS8C 1YURA 1IJ6A 1A29A 3GK4X 5CSIA 4D1EA 1DQEA 1K9KA 1A4PA 1XFZO 2LLSA 1S26D 2BKIB 2JT0A 2WNDA 3DVKA 2OTGB 4XJKB 5CPVA 5K89A 1SMGA 4MLWA 1CLBA 1QIVA 4N1FA 4BY5A 1OMDA 4PCWA 1IH0A 2BL0C 2F2OA 1TNQA 1K90D 1SCVA 3CZ1A 3VGOA 1KQVA 1JWDA 2KNEA 2K7BA 4JD9A 3GK1A 4DS7A 2CNPA 4PALA 1XVJA 4ORBB 1PVBA 3BUXB 1G33A 1RECA 2TN4A 1XFYO 2KPHA 3OB2B 4HRHA 3LLEA 3SJSA 1K8UA 1NP8A 1N2DA 4GFTA 1GQMA 3RZSA 1B8CA 1C7VA 2KFGA 1J7RA 1CFDA 4MSPA 5PALA 2ZFDA 2YGUA 4CFRA 1CKKA 1Q80A 3IQQA 1F54A 3AKBA 1UHJA 1QJTA 1CM4A 1J7QA 3NSOA 1NYAA 1SR6B 1CNPA 2WCLA 2Q91A 2Q4UA 3FS7A 1SY9A 1X02A 1QX5B 4WQ3A 3TDZA 3RM1A 1TUZA 1CDLA 2LP2A 4MN0A 3JTDB 4XJKA 1IGVA 2JU0A 4YI8A 4PE4A 1JFJA 1PRWA 1DVIA 1YRTB 1YX7A 3BYAA 4YRUA 1S5GZ 1BODA 2L98A 2BE4A 4M2OA 4R1EA 1OOIX 2EC6B 1OMVA 1N0YA 2LP3A 2HQWA 1KQMB 2PASA 2SCPA 1PK0D 3O6BA 2NLNA 4Q04A 3UO9A 4YGDB 2QEBA 2BNXA 2KI6C 2M49B 1A03A 2I18A 2JQ6A 5J3XA 1NWDA 1KWOC 3VRNA 1EJ3A 3O2PA 3CABA 1B1GA 1PSRA 2M7LA 3S0EA 1WLMA 1IRJA 1Y1AA 3B87A 1OW4A 1K9PA 1S6CA 3K21A 4OV2A 2KQ6A 3EG5B 3SG2A 1DJYA 1C07A 2ZN9A 2KBIA 2GV5A 2LUCA 4AQJA 1DJXA 4GBAA 4PHJA 3OBVA 3DD4A 2PMYA 1DJWA 2L5XB 5DKRA 1J55A 3L47A 3HX4A 3NGVA 2LMUA 4OR9B 1QTXA 1LXFC 4WQ2A 1WY9A 1XK4A 5HYDA 2Y1NA 2QEOA 3VROA 1XYDA 2L0PA 2DOQA 3EVUA 1XK4C 1TTXA 2WCKA 3NXAA 5EL2A 5I2LA 2I2RE 3BFAA 4ORCB 2P71A 3AKAA 4MRXA 1B47A 3O78A 1KSOA 2HETA 4PE0A 2KI6D 3NSKA 5AERA 1SKTA 2OTGC 2R2IA 1QVIZ 1BJFA 2V53A 4CFQA 1QATA 3PJIA 2KQYA 2MRDA 3AAJA 3TS5C 1YVHA 4P5OE 1FI6A 5KU1A 3R1OA 1G8IA 1JBAA 1K94A 2BL0B 2WC8A 2ZRTA 3FWCA 5FYXA 3CR5X 3M0WA 3R72A 1IQ5A 2WCBA 3SS3A 1B8LA 1ODBA 3WHTB 3EK8A 1TNPA 2LC5A 1SK6D 4KYNA 1UWOA 1L7ZA 1UP5A 2O5GA 1S6IA 3LK1A 4PE7A 3PLFB 2JT8A 4PHKA 3SG7A 3CTNA 1LKJA 4DUQA 1T14A 2WC5A 1LVCD 4ICBA 2MHHA 1AP4A 1E8AA 3BUOB 2EGDA 1QLSA 2M7NA 2OPOA 3AAKA 2CT9A 1W7IB 1DEKA 1HQVA 4C0JA 1YUSA 4GGFC 5DKNA 3Q8IA 2KYFA 1F55A 3VB1A
chains in the Genus database with same CATH topology
4CPVA 1WDCB 2QACA 4N1GA 2LLUA 1WDCC 4C0LA 4FQOA 4NQGA 1BOCA 1CFPA 2ZNEA 2LCPA 1J7PA 1QX2A 1RK9A 4ZCVA 2I7AA 2PSRA 4QJ3B 4AQIA 1FBVA 3TZ1A 1A75A 1CLLA 1LA3A 5ER5A 5I2OA 4YGCB 3I5FC 1BLQA 1XA5A 1ALWA 1YUTA 5IBWA 4GGNA 4CIDA 4GUKA 5HKWA 2M0RA 1HT9A 2NZ0A 1KCYA 2EC6C 1NX0A 1WRLA 5AXIA 1EL4A 1UHHA 2QPTA 2RGIA 1QS7A 2M1UA 2GGZA 1DTLA 2IS9A 3PSRA 1DJGA 1DF0A 1SYMA 1B7TY 1U5IA 5B8IB 2FJUB 3BUWB 2K7CA 1NIWA 2M8UA 3ZWHA 2LVJA 2LNKA 5I2QA 4PE1A 1BR4B 4YGBB 1PSBA 1NCYA 3I5GB 3DVEA 1SL7A 5HKZA 5TNCA 1JF0A 1NUBA 2F8PA 1MXEA 3KF9A 4CLNA 2K61A 4I5KA 3I5IB 1DJHA 4AOMA 2WCEA 1DGVA 1BU3A 3GOFA 1MQ1A 2KAVA 3I5IC 1BR1B 1SCMC 2L51A 5DKQA 2F2PA 3EKJA 1K2HA 1SL9A 2NCOA 2CTNA 3CZTX 1TNXA 2BECA 2FCDA 2CBLA 2L50A 3FWBA 3DF0A 1NSHA 4I5JA 2BBMA 2M97A 5I8NA 2VRGA 2K2FA 2LV7A 2K7DA 2MAZA 1CDMA 1MUXA 1KFUS 1CDPA 4MEWA 4NDDA 1RTP1 1Y6WA 3OX5A 4IL1A 1JSAA 2KSPA 3DVMA 1KFXS 1CTRA 2LE9B 3TS5B 1UHIA 4A4BA 1YVLA 3EK7A 4GAOA 1Y1UA 2K0JA 3EK4A 1BF5A 1TN4A 5CSNA 1OZOA 3QRXA 1M63B 1OE9B 2BCXA 2LMVA 1CM1A 2K2AA 1JC2A 1EH2A 3A4UB 5JJGA 2ZN8A 2JZIA 2L4IA 4NDBA 2LM5A 1CLMA 1M46A 3BOWA 3IQOA 1F4QA 2JXCA 1BT6A 1KK8B 1KSMA 4PDZA 1S36A 2BKHB 2MLEC 4M2PA 2KI4B 2K7OA 1NPQA 1B9AA 3LK0A 2OS8B 2KI4C 2LVVA 1UURA 1VRKA 2H2KA 2LLTA 1CFCA 1FF1A 1OMRA 1B8RA 3F45A 2GGMA 1KK7Y 1NX1A 1QX7A 1SR6C 1MF8B 3SIBA 2LAPA 1AJ5A 1YX8A 5CSFA 4GGFA 4UPGA 3PFVA 1WLZA 4FTGA 2ZNDA 1WRKA 3I5HC 2MA2A 5G08A 3HCMA 4I5LB 1Y0VH 1RFJA 2JULA 3KEVA 1RROA 1AHRA 2PRUA 3E3RA 4YGAA 2LHLA 4WRIA 2P6BB 2M3WA 2H61A 2E6WA 4P2YB 4TNCA 1YRUB 3NSIA 1DMOA 1IJ5A 3DF0B 3PN7C 2LUXA 5HLOA 2KGBC 4YGEB 2JT3A 3PN7B 3D10A 3WXAA 1QASA 1XFUO 1ZACA 1JUOA 5JOLA 3ZNIA 1UHKA 1QXPA 3CWGA 1V1GA 5AANA 1KFUL 2ZRSA 1JF2A 1EG4A 2JNFA 1XFXO 4OKHA 3VRRA 2LHIA 3CS1A 1QV0A 4DIRA 3WNXB 1NCZA 1J7OA 1AUIB 1B4CA 4QJ4B 1K93D 2F3YA 1S3PA 2HPSA 1R6PA 1FI5A 2JWWA 2ZKMX 2BE6A 1K95A 3JTDC 2H61C 1MHOA 1PALA 3H4SE 1SNLA 3GK2A 1GJYA 1ALVA 1SCMB 1Y1XA 1K9UA 1SL8A 1M39A 1J1DA 5CSJA 3I5FB 1S6JA 1L2OB 2KBMA 1IWQA 1SRAA 1KFXL 2WORA 4HREE 1OOJA 3SG3A 1FPWA 4XYNA 5ER4X 1L2OC 3TDUA 1CMFA 1J1EA 3BUMB 1KQMC 5HLVA 1AJ4A 4GNKB 2KOTA 1V1FA 3CR2A 1NX3A 1YUUA 1C7WA 2BBNA 1RJVA 2KDHA 3A8RA 3EVVA 1SPYA 4C0KA 1KWOB 1IKUA 1OZSA 1JFKA 1F8HA 2I94A 4YI9A 3FIAA 1LA0A 1BG1A 1A2XA 1TRFA 1EG3A 1TNWA 5F6TA 3BOWB 2JPTA 5BPJA 1CDNA 2FOTA 2KYCA 1F70A 1DGUA 1DF0B 1M31A 1QLKA 3PATA 1H4BA 1ZOTB 1D1OA 2M9GA 1SBJA 2KHNA 4USLA 4QJ5B 4BY4A 1MR8A 1TOPA 1B7TZ 1KK8C 4GPLB 1ZFSA 3KO0A 5D7FA 2KAXA 2Y1MA 4YBHB 4MRYA 3TDIA 3OX6A 3OB1B 2L2EA 1NCXA 2JC2A 1MXLC 2E30A 2NCPA 3DVJA 2MJWB 2JTTA 1TIZA 4JPZB 4ORAB 4DRWA 4PHMA 2EHBA 1KK7Z 4MVFA 1N65A 1U5IB 4I5NB 2NXQA 4OCIA 1NX2A 2CCMA 1R2UA 2L4HA 2FCEA 1F71A 2LANA 1UHNA 5KSZA 2G9BA 1TCFA 3WHUB 1OQPA 5D69A 1W7JB 5AEQA 1QIWA 2COLB 2KFFA 3NSLA 1OSAA 3LL8B 4PHNA 3JVTC 2LMTA 3TUYC 3JVTB 2HQ8A 1YR5A 3BUNB 3TUYB 1FW4A 4N5XA 3SG6A 1S5GY 1UUSA 3VRPA 4U8DA 3BQ3A 4HRGA 1DJIA 3O4YA 1G4YR 4M2QA 1A75B 4OVNF 2KGRA 1ZUZA 2AUCA 2PALA 1CMGA 1QVIY 2ISDA 3MSEB 4ZCUA 3RLZA 4E68A 1CFFA 3I5GC 2JOJA 1GGWA 1TCOB 2M1KB 1ZMZA 1PULA 3ICBA 1EXRA 2KFHA 1IG5A 1S1EA 1YTZC 2BCAA 1MWNA 3PALA 1F4OA 4DCKA 5HKYA 2MBXA 2CXJA 3I5HB 4L9MA 4F0ZB 1M45A 3D0YA 2G2BA 3SIAA 4MZLA 1BMOA 3KPXA 3BXKA 1LINA 2WCFA 2AMIA 3CLNA 1IQ3A 3OHMB 3KHEA 2MLFC 2B1UA 3PM8A 2D8NA 4JQ0D 2K8MB 4MZJA 5GQQC 2Y5IA 2M29A 1PVAA 2JTZA 1WRZA 4A4CA 1AVSA 1RWYA 1XO5A 2LVIA 3EKHA 2BCBA 5AFPA 2LVKA 3D0YB 1SW8A 1QV1A 1DT7B 1AK8A 2A4JA 2O60A 2F33A 1K96A 2AAOA 3CGAA 1GGZA 1XFWO 2HF5A 3IF7A 4JWQA 3CR4X 3C1VA 2WOSA 3LCPC 4ETOA 2JRFA 3SG5A 2JNXA 2SASA 4HSZA 3OP0A 3EVRA 3VRQA 1CB1A 2PVBA 4NDCA 2KAYA 2F3ZA 2JXLA 4MZKA 3SG4A 1XFVO 1DJZA 2Y4QA 1H8BA 4MBEA 2OS8C 1YURA 1IJ6A 1A29A 3GK4X 5CSIA 4D1EA 1K9KA 1A4PA 1XFZO 2LLSA 1S26D 2BKIB 2JT0A 2WNDA 3DVKA 2OTGB 4XJKB 5CPVA 5K89A 1SMGA 4MLWA 1CLBA 1QIVA 4N1FA 4BY5A 1OMDA 4PCWA 1IH0A 2F2OA 2BL0C 1TNQA 1K90D 1SCVA 3VGOA 1KQVA 1JWDA 2KNEA 2K7BA 3GK1A 4DS7A 2CNPA 4PALA 1XVJA 4ORBB 1PVBA 3BUXB 1G33A 1RECA 2TN4A 1XFYO 3OB2B 4HRHA 3LLEA 3SJSA 1K8UA 1NP8A 1N2DA 4GFTA 1GQMA 1B8CA 1C7VA 2KFGA 1J7RA 1CFDA 4MSPA 5PALA 2ZFDA 4CFRA 1CKKA 1Q80A 3IQQA 1F54A 3AKBA 1UHJA 1QJTA 1CM4A 1J7QA 3NSOA 1NYAA 1SR6B 1CNPA 2Q91A 2Q4UA 3FS7A 1SY9A 1X02A 1QX5B 4WQ3A 3TDZA 3RM1A 1CDLA 2LP2A 4MN0A 3JTDB 4XJKA 1IGVA 2JU0A 4YI8A 4PE4A 1JFJA 1PRWA 1DVIA 1YRTB 1YX7A 3BYAA 4YRUA 1S5GZ 1BODA 2L98A 2BE4A 4M2OA 4R1EA 2EC6B 1OMVA 1N0YA 2LP3A 2HQWA 1KQMB 2PASA 2SCPA 1PK0D 3O6BA 2NLNA 4Q04A 4YGDB 2KI6C 2M49B 1A03A 2I18A 2JQ6A 5J3XA 1NWDA 1KWOC 3VRNA 1EJ3A 3O2PA 1PSRA 2M7LA 1WLMA 1IRJA 1Y1AA 3K21A 4OV2A 1K9PA 1S6CA 3SG2A 5KTYA 2KQ6A 1DJYA 1C07A 2ZN9A 2KBIA 2GV5A 2LUCA 4AQJA 1DJXA 4GBAA 4PHJA 5DKRA 3DD4A 2PMYA 1DJWA 2L5XB 1J55A 3HX4A 2LMUA 4OR9B 1QTXA 1LXFC 4WQ2A 1WY9A 1XK4A 5HYDA 2Y1NA 1B1GA 3VROA 1XYDA 2L0PA 2DOQA 3EVUA 1XK4C 1TTXA 3NXAA 5I2LA 2I2RE 4ORCB 3AKAA 4MRXA 1B47A 3O78A 1KSOA 2HETA 4PE0A 2KI6D 3NSKA 5AERA 1SKTA 2OTGC 2R2IA 1QVIZ 1BJFA 2V53A 4CFQA 1QATA 2KQYA 2MRDA 3AAJA 3TS5C 1YVHA 4P5OE 1FI6A 5KU1A 1G8IA 1JBAA 1K94A 2BL0B 2WC8A 2ZRTA 3FWCA 5FYXA 3CR5X 3M0WA 1IQ5A 2WCBA 1B8LA 1ODBA 3WHTB 3EK8A 1TNPA 2LC5A 1SK6D 1UWOA 1L7ZA 1UP5A 2O5GA 1S6IA 3LK1A 4PE7A 3PLFB 2JT8A 4PHKA 3SG7A 3CTNA 1LKJA 4DUQA 4ICBA 1LVCD 2MHHA 1AP4A 1E8AA 3BUOB 2EGDA 1QLSA 2M7NA 2OPOA 3AAKA 2CT9A 1W7IB 1HQVA 4C0JA 1YUSA 4GGFC 5DKNA 2KYFA 1F55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CPV A;  1WDC B;  2QAC A;  4N1G A;  2LLU A;  1WDC C;  4C0L A;  4FQO A;  4NQG A;  1BOC A;  1CFP A;  2ZNE A;  2LCP A;  1J7P A;  1QX2 A;  1RK9 A;  4ZCV A;  2I7A A;  2PSR A;  4QJ3 B;  4AQI A;  1FBV A;  3TZ1 A;  1A75 A;  1CLL A;  1LA3 A;  5ER5 A;  5I2O A;  4YGC B;  3I5F C;  1BLQ A;  1XA5 A;  1ALW A;  1YUT A;  5IBW A;  4GGN A;  4CID A;  4GUK A;  5HKW A;  2M0R A;  1HT9 A;  2NZ0 A;  1KCY A;  2EC6 C;  1NX0 A;  1WRL A;  5AXI A;  1EL4 A;  1UHH A;  2QPT A;  2RGI A;  1QS7 A;  2M1U A;  2GGZ A;  1DTL A;  2IS9 A;  3PSR A;  1DJG A;  1DF0 A;  1SYM A;  1B7T Y;  1U5I A;  5B8I B;  2FJU B;  3BUW B;  2K7C A;  1NIW A;  2M8U A;  3ZWH A;  2LVJ A;  2LNK A;  5I2Q A;  4PE1 A;  1BR4 B;  4YGB B;  1PSB A;  1NCY A;  3I5G B;  3DVE A;  1SL7 A;  5HKZ A;  5TNC A;  1JF0 A;  1NUB A;  2F8P A;  1MXE A;  3KF9 A;  4CLN A;  2K61 A;  4I5K A;  3I5I B;  1DJH A;  4AOM A;  2WCE A;  1DGV A;  1BU3 A;  3GOF A;  1MQ1 A;  2KAV A;  3I5I C;  1BR1 B;  1SCM C;  2L51 A;  5DKQ A;  2F2P A;  3EKJ A;  1K2H A;  1SL9 A;  2NCO A;  2CTN A;  3CZT X;  1TNX A;  2BEC A;  2FCD A;  2CBL A;  2L50 A;  3FWB A;  3DF0 A;  1NSH A;  4I5J A;  2BBM A;  2M97 A;  5I8N A;  2VRG A;  2K2F A;  2LV7 A;  2K7D A;  2MAZ A;  1CDM A;  1MUX A;  1KFU S;  1CDP A;  4MEW A;  4NDD A;  1RTP 1;  1Y6W A;  3OX5 A;  4IL1 A;  1JSA A;  2KSP A;  3DVM A;  1KFX S;  1CTR A;  2LE9 B;  3TS5 B;  1UHI A;  4A4B A;  1YVL A;  3EK7 A;  4GAO A;  1Y1U A;  2K0J A;  3EK4 A;  1BF5 A;  1TN4 A;  5CSN A;  1OZO A;  3QRX A;  1M63 B;  1OE9 B;  2BCX A;  2LMV A;  1CM1 A;  2K2A A;  1JC2 A;  1EH2 A;  3A4U B;  5JJG A;  2ZN8 A;  2JZI A;  2L4I A;  4NDB A;  2LM5 A;  1CLM A;  1M46 A;  3BOW A;  3IQO A;  1F4Q A;  2JXC A;  1BT6 A;  1KK8 B;  1KSM A;  4PDZ A;  1S36 A;  2BKH B;  2MLE C;  4M2P A;  2KI4 B;  2K7O A;  1NPQ A;  1B9A A;  3LK0 A;  2OS8 B;  2KI4 C;  2LVV A;  1UUR A;  1VRK A;  2H2K A;  2LLT A;  1CFC A;  1FF1 A;  1OMR A;  1B8R A;  3F45 A;  2GGM A;  1KK7 Y;  1NX1 A;  1QX7 A;  1SR6 C;  1MF8 B;  3SIB A;  2LAP A;  1AJ5 A;  1YX8 A;  5CSF A;  4GGF A;  4UPG A;  3PFV A;  1WLZ A;  4FTG A;  2ZND A;  1WRK A;  3I5H C;  2MA2 A;  5G08 A;  3HCM A;  4I5L B;  1Y0V H;  1RFJ A;  2JUL A;  3KEV A;  1RRO A;  1AHR A;  2PRU A;  3E3R A;  4YGA A;  2LHL A;  4WRI A;  2P6B B;  2M3W A;  2H61 A;  2E6W A;  4P2Y B;  4TNC A;  1YRU B;  3NSI A;  1DMO A;  1IJ5 A;  3DF0 B;  3PN7 C;  2LUX A;  5HLO A;  2KGB C;  4YGE B;  2JT3 A;  3PN7 B;  3D10 A;  3WXA A;  1QAS A;  1XFU O;  1ZAC A;  1JUO A;  5JOL A;  3ZNI A;  1UHK A;  1QXP A;  3CWG A;  1V1G A;  5AAN A;  1KFU L;  2ZRS A;  1JF2 A;  1EG4 A;  2JNF A;  1XFX O;  4OKH A;  3VRR A;  2LHI A;  3CS1 A;  1QV0 A;  4DIR A;  3WNX B;  1NCZ A;  1J7O A;  1AUI B;  1B4C A;  4QJ4 B;  1K93 D;  2F3Y A;  1S3P A;  2HPS A;  1R6P A;  1FI5 A;  2JWW A;  2ZKM X;  2BE6 A;  1K95 A;  3JTD C;  2H61 C;  1MHO A;  1PAL A;  3H4S E;  1SNL A;  3GK2 A;  1GJY A;  1ALV A;  1SCM B;  1Y1X A;  1K9U A;  1SL8 A;  1M39 A;  1J1D A;  5CSJ A;  3I5F B;  1S6J A;  1L2O B;  2KBM A;  1IWQ A;  1SRA A;  1KFX L;  2WOR A;  4HRE E;  1OOJ A;  3SG3 A;  1FPW A;  4XYN A;  5ER4 X;  1L2O C;  3TDU A;  1CMF A;  1J1E A;  3BUM B;  1KQM C;  5HLV A;  1AJ4 A;  4GNK B;  2KOT A;  1V1F A;  3CR2 A;  1NX3 A;  1YUU A;  1C7W A;  2BBN A;  1RJV A;  2KDH A;  3A8R A;  3EVV A;  1SPY A;  4C0K A;  1KWO B;  1IKU A;  1OZS A;  1JFK A;  1F8H A;  2I94 A;  4YI9 A;  3FIA A;  1LA0 A;  1BG1 A;  1A2X A;  1TRF A;  1EG3 A;  1TNW A;  5F6T A;  3BOW B;  2JPT A;  5BPJ A;  1CDN A;  2FOT A;  2KYC A;  1F70 A;  1DGU A;  1DF0 B;  1M31 A;  1QLK A;  3PAT A;  1H4B A;  1ZOT B;  1D1O A;  2M9G A;  1SBJ A;  2KHN A;  4USL A;  4QJ5 B;  4BY4 A;  1MR8 A;  1TOP A;  1B7T Z;  1KK8 C;  4GPL B;  1ZFS A;  3KO0 A;  5D7F A;  2KAX A;  2Y1M A;  4YBH B;  4MRY A;  3TDI A;  3OX6 A;  3OB1 B;  2L2E A;  1NCX A;  2JC2 A;  1MXL C;  2E30 A;  2NCP A;  3DVJ A;  2MJW B;  2JTT A;  1TIZ A;  4JPZ B;  4ORA B;  4DRW A;  4PHM A;  2EHB A;  1KK7 Z;  4MVF A;  1N65 A;  1U5I B;  4I5N B;  2NXQ A;  4OCI A;  1NX2 A;  2CCM A;  1R2U A;  2L4H A;  2FCE A;  1F71 A;  2LAN A;  1UHN A;  5KSZ A;  2G9B A;  1TCF A;  3WHU B;  1OQP A;  5D69 A;  1W7J B;  5AEQ A;  1QIW A;  2COL B;  2KFF A;  3NSL A;  1OSA A;  3LL8 B;  4PHN A;  3JVT C;  2LMT A;  3TUY C;  3JVT B;  2HQ8 A;  1YR5 A;  3BUN B;  3TUY B;  1FW4 A;  4N5X A;  3SG6 A;  1S5G Y;  1UUS A;  3VRP A;  4U8D A;  3BQ3 A;  4HRG A;  1DJI A;  3O4Y A;  1G4Y R;  4M2Q A;  1A75 B;  4OVN F;  2KGR A;  1ZUZ A;  2AUC A;  2PAL A;  1CMG A;  1QVI Y;  2ISD A;  3MSE B;  4ZCU A;  3RLZ A;  4E68 A;  1CFF A;  3I5G C;  2JOJ A;  1GGW A;  1TCO B;  2M1K B;  1ZMZ A;  1PUL A;  3ICB A;  1EXR A;  2KFH A;  1IG5 A;  1S1E A;  1YTZ C;  2BCA A;  1MWN A;  3PAL A;  1F4O A;  4DCK A;  5HKY A;  2MBX A;  2CXJ A;  3I5H B;  4L9M A;  4F0Z B;  1M45 A;  3D0Y A;  2G2B A;  3SIA A;  4MZL A;  1BMO A;  3KPX A;  3BXK A;  1LIN A;  2WCF A;  2AMI A;  3CLN A;  1IQ3 A;  3OHM B;  3KHE A;  2MLF C;  2B1U A;  3PM8 A;  2D8N A;  4JQ0 D;  2K8M B;  4MZJ A;  5GQQ C;  2Y5I A;  2M29 A;  1PVA A;  2JTZ A;  1WRZ A;  4A4C A;  1AVS A;  1RWY A;  1XO5 A;  2LVI A;  3EKH A;  2BCB A;  5AFP A;  2LVK A;  3D0Y B;  1SW8 A;  1QV1 A;  1DT7 B;  1AK8 A;  2A4J A;  2O60 A;  2F33 A;  1K96 A;  2AAO A;  3CGA A;  1GGZ A;  1XFW O;  2HF5 A;  3IF7 A;  4JWQ A;  3CR4 X;  3C1V A;  2WOS A;  3LCP C;  4ETO A;  2JRF A;  3SG5 A;  2JNX A;  2SAS A;  4HSZ A;  3OP0 A;  3EVR A;  3VRQ A;  1CB1 A;  2PVB A;  4NDC A;  2KAY A;  2F3Z A;  2JXL A;  4MZK A;  3SG4 A;  1XFV O;  1DJZ A;  2Y4Q A;  1H8B A;  4MBE A;  2OS8 C;  1YUR A;  1IJ6 A;  1A29 A;  3GK4 X;  5CSI A;  4D1E A;  1K9K A;  1A4P A;  1XFZ O;  2LLS A;  1S26 D;  2BKI B;  2JT0 A;  2WND A;  3DVK A;  2OTG B;  4XJK B;  5CPV A;  5K89 A;  1SMG A;  4MLW A;  1CLB A;  1QIV A;  4N1F A;  4BY5 A;  1OMD A;  4PCW A;  1IH0 A;  2F2O A;  2BL0 C;  1TNQ A;  1K90 D;  1SCV A;  3VGO A;  1KQV A;  1JWD A;  2KNE A;  2K7B A;  3GK1 A;  4DS7 A;  2CNP A;  4PAL A;  1XVJ A;  4ORB B;  1PVB A;  3BUX B;  1G33 A;  1REC A;  2TN4 A;  1XFY O;  3OB2 B;  4HRH A;  3LLE A;  3SJS A;  1K8U A;  1NP8 A;  1N2D A;  4GFT A;  1GQM A;  1B8C A;  1C7V A;  2KFG A;  1J7R A;  1CFD A;  4MSP A;  5PAL A;  2ZFD A;  4CFR A;  1CKK A;  1Q80 A;  3IQQ A;  1F54 A;  3AKB A;  1UHJ A;  1QJT A;  1CM4 A;  1J7Q A;  3NSO A;  1NYA A;  1SR6 B;  1CNP A;  2Q91 A;  2Q4U A;  3FS7 A;  1SY9 A;  1X02 A;  1QX5 B;  4WQ3 A;  3TDZ A;  3RM1 A;  1CDL A;  2LP2 A;  4MN0 A;  3JTD B;  4XJK A;  1IGV A;  2JU0 A;  4YI8 A;  4PE4 A;  1JFJ A;  1PRW A;  1DVI A;  1YRT B;  1YX7 A;  3BYA A;  4YRU A;  1S5G Z;  1BOD A;  2L98 A;  2BE4 A;  4M2O A;  4R1E A;  2EC6 B;  1OMV A;  1N0Y A;  2LP3 A;  2HQW A;  1KQM B;  2PAS A;  2SCP A;  1PK0 D;  3O6B A;  2NLN A;  4Q04 A;  4YGD B;  2KI6 C;  2M49 B;  1A03 A;  2I18 A;  2JQ6 A;  5J3X A;  1NWD A;  1KWO C;  3VRN A;  1EJ3 A;  3O2P A;  1PSR A;  2M7L A;  1WLM A;  1IRJ A;  1Y1A A;  3K21 A;  4OV2 A;  1K9P A;  1S6C A;  3SG2 A;  5KTY A;  2KQ6 A;  1DJY A;  1C07 A;  2ZN9 A;  2KBI A;  2GV5 A;  2LUC A;  4AQJ A;  1DJX A;  4GBA A;  4PHJ A;  5DKR A;  3DD4 A;  2PMY A;  1DJW A;  2L5X B;  1J55 A;  3HX4 A;  2LMU A;  4OR9 B;  1QTX A;  1LXF C;  4WQ2 A;  1WY9 A;  1XK4 A;  5HYD A;  2Y1N A;  1B1G A;  3VRO A;  1XYD A;  2L0P A;  2DOQ A;  3EVU A;  1XK4 C;  1TTX A;  3NXA A;  5I2L A;  2I2R E;  4ORC B;  3AKA A;  4MRX A;  1B47 A;  3O78 A;  1KSO A;  2HET A;  4PE0 A;  2KI6 D;  3NSK A;  5AER A;  1SKT A;  2OTG C;  2R2I A;  1QVI Z;  1BJF A;  2V53 A;  4CFQ A;  1QAT A;  2KQY A;  2MRD A;  3AAJ A;  3TS5 C;  1YVH A;  4P5O E;  1FI6 A;  5KU1 A;  1G8I A;  1JBA A;  1K94 A;  2BL0 B;  2WC8 A;  2ZRT A;  3FWC A;  5FYX A;  3CR5 X;  3M0W A;  1IQ5 A;  2WCB A;  1B8L A;  1ODB A;  3WHT B;  3EK8 A;  1TNP A;  2LC5 A;  1SK6 D;  1UWO A;  1L7Z A;  1UP5 A;  2O5G A;  1S6I A;  3LK1 A;  4PE7 A;  3PLF B;  2JT8 A;  4PHK A;  3SG7 A;  3CTN A;  1LKJ A;  4DUQ A;  4ICB A;  1LVC D;  2MHH A;  1AP4 A;  1E8A A;  3BUO B;  2EGD A;  1QLS A;  2M7N A;  2OPO A;  3AAK A;  2CT9 A;  1W7I B;  1HQV A;  4C0J A;  1YUS A;  4GGF C;  5DKN A;  2KYF A;  1F55 A; 
#chains in the Genus database with same CATH topology
 4CPV A;  1WDC B;  2QAC A;  3B7A A;  4N1G A;  2LLU A;  5FI2 A;  1WDC C;  4C0L A;  4FQO A;  4NQG A;  3D74 A;  1C3Y A;  1BOC A;  1CFP A;  2QEH A;  2ZNE A;  2LCP A;  1J7P A;  1QX2 A;  1RK9 A;  4ZCV A;  2I7A A;  2PSR A;  4QJ3 B;  4AQI A;  1FBV A;  3TZ1 A;  1A75 A;  1CLL A;  1LA3 A;  5ER5 A;  5I2O A;  3SS4 A;  4YGC B;  3I5F C;  3D75 A;  1XA5 A;  3QME A;  1BLQ A;  1ALW A;  1YUT A;  5IBW A;  4GGN A;  4CID A;  4GUK A;  2WCM A;  5HKW A;  2M0R A;  4INX A;  1HT9 A;  2NZ0 A;  1KCY A;  2EC6 C;  1NX0 A;  1WRL A;  5AXI A;  1EL4 A;  1UHH A;  2QPT A;  2RGI A;  1QS7 A;  2M1U A;  2GGZ A;  1DTL A;  2IS9 A;  3PSR A;  1DJG A;  1DF0 A;  1SYM A;  1B7T Y;  1U5I A;  5B8I B;  2FJU B;  3BUW B;  2K7C A;  5I94 A;  1NIW A;  2M8U A;  3ZWH A;  2LVJ A;  2LNK A;  5I2Q A;  4FQT A;  1BR4 B;  4PE1 A;  1PSB A;  1NCY A;  3I5G B;  3DVE A;  1SL7 A;  4YGB B;  5HKZ A;  5TNC A;  1JF0 A;  1NUB A;  2F8P A;  1MXE A;  5DIC A;  3KF9 A;  4CLN A;  3B6X A;  2K61 A;  4I5K A;  3I5I B;  1DJH A;  4AOM A;  2WCE A;  1DGV A;  3L4A A;  1BU3 A;  3GOF A;  1MQ1 A;  2KAV A;  3I5I C;  1BR1 B;  1SCM C;  2L51 A;  5DKQ A;  2F2P A;  3EKJ A;  1K2H A;  1SL9 A;  2NCO A;  2CTN A;  3CZT X;  1TNX A;  2BEC A;  2FCD A;  2CBL A;  2L50 A;  3FWB A;  3DF0 A;  1NSH A;  4I5J A;  2BBM A;  1XFR A;  2M97 A;  2WCJ A;  5I8N A;  2VRG A;  2K2F A;  2LV7 A;  2K7D A;  2MAZ A;  1CDM A;  1MUX A;  3R1V A;  1KFU S;  1CDP A;  4MEW A;  4NDD A;  3UNW A;  1RTP 1;  4IJ7 A;  1Y6W A;  3OX5 A;  4IL1 A;  1JSA A;  2KSP A;  3DVM A;  1KFX S;  1TWO A;  1CTR A;  2LE9 B;  1Z2C B;  3TS5 B;  1UHI A;  4A4B A;  1YVL A;  3EK7 A;  4GAO A;  1Y1U A;  2K0J A;  2FJY A;  3EK4 A;  1TN4 A;  1BF5 A;  5CSN A;  1OZO A;  3QRX A;  1M63 B;  1OE9 B;  2BCX A;  2LMV A;  1CM1 A;  2K2A A;  3S0G A;  1JC2 A;  1EH2 A;  3A4U B;  3BFB A;  5JJG A;  1DC1 A;  2ZN8 A;  2JZI A;  2L4I A;  4NDB A;  2LM5 A;  1CLM A;  1M46 A;  3BOW A;  3CDN A;  3IQO A;  1F4Q A;  2JXC A;  1BT6 A;  1KK8 B;  1KSM A;  4PDZ A;  1S36 A;  2BKH B;  2MLE C;  3DYE A;  2KI4 B;  4M2P A;  2K7O A;  1NPQ A;  1B9A A;  3LK0 A;  2OS8 B;  2KI4 C;  2LVV A;  3K1E A;  1UUR A;  1VRK A;  2H2K A;  2LLT A;  1CFC A;  1FF1 A;  1OMR A;  1B8R A;  3F45 A;  2GGM A;  1KK7 Y;  1NX1 A;  1QX7 A;  1SR6 C;  1MF8 B;  3SIB A;  2LAP A;  1AJ5 A;  1YX8 A;  5KTY A;  2PQL A;  4GGF A;  5CSF A;  4UPG A;  3PFV A;  1WLZ A;  4FTG A;  2ZND A;  1WRK A;  3I5H C;  2MA2 A;  5G08 A;  3HCM A;  1W9Z A;  1Y0V H;  4I5L B;  1RFJ A;  2JUL A;  3KEV A;  1RRO A;  1AHR A;  2PRU A;  3E3R A;  4YGA A;  1GM0 A;  3D73 A;  3O4X A;  2LHL A;  4WRI A;  2P6B B;  2M3W A;  1OOG A;  2H61 A;  2E6W A;  4P2Y B;  4TNC A;  1YRU B;  3NSI A;  1DMO A;  1QWV A;  1IJ5 A;  3DF0 B;  3PN7 C;  2LUX A;  5HLO A;  2KGB C;  4YGE B;  2JT3 A;  3PN7 B;  3D10 A;  3WXA A;  1QAS A;  1XFU O;  1ZAC A;  1JUO A;  5JOL A;  3ZNI A;  1UHK A;  1QXP A;  3CWG A;  3S0D A;  1V1G A;  1OOH A;  5AAN A;  1KFU L;  2ZRS A;  1JF2 A;  1P28 A;  1EG4 A;  2JNF A;  1XFX O;  2KLE A;  3DXL A;  4OKH A;  3VRR A;  2LHI A;  3CS1 A;  1QV0 A;  4DIR A;  2L5Y A;  3WNX B;  1NCZ A;  1J7O A;  1AUI B;  1Z4H A;  1B4C A;  4QJ4 B;  1K93 D;  2F3Y A;  3D78 A;  1S3P A;  2HPS A;  1R6P A;  1FI5 A;  2JWW A;  2ZKM X;  2BE6 A;  3L4L A;  1K95 A;  3S0A A;  3JTD C;  2H61 C;  1MHO A;  1PAL A;  3H4S E;  2GTE A;  1SNL A;  1IIO A;  3GK2 A;  1GJY A;  1ALV A;  1SCM B;  1Y1X A;  1K9U A;  1SL8 A;  1M39 A;  1J1D A;  5CSJ A;  2JPO A;  3B88 A;  3I5F B;  1S6J A;  1L2O B;  2KBM A;  3N7H A;  1IWQ A;  1SRA A;  1KFX L;  2WOR A;  4HRE E;  1OOJ A;  2WCH A;  3SG3 A;  4XYN A;  5ER4 X;  1FPW A;  1L2O C;  3IVT A;  3TDU A;  1CMF A;  1J1E A;  3BUM B;  1KQM C;  5HLV A;  1AJ4 A;  4GNK B;  2KOT A;  1V1F A;  3CR2 A;  3S0B A;  1NX3 A;  1YUU A;  1C7W A;  2BBN A;  1RJV A;  2KDH A;  3A8R A;  3EVV A;  1SPY A;  4C0K A;  3NHI A;  1KWO B;  1IKU A;  1OZS A;  1JFK A;  1F8H A;  2I94 A;  4YI9 A;  3NHT A;  3FIA A;  1LA0 A;  1BG1 A;  1A2X A;  3DY9 A;  1TRF A;  1EG3 A;  1TNW A;  3DZT A;  3BFH A;  3BOW B;  2JPT A;  3CYZ A;  5F6T A;  2QDI A;  5BPJ A;  1CDN A;  2FOT A;  2KYC A;  1F70 A;  1DGU A;  3PM2 A;  1DF0 B;  1M31 A;  1QLK A;  3PAT A;  1H4B A;  1LS8 A;  1ZOT B;  1D1O A;  3FE8 A;  2H8V A;  2M9G A;  1SBJ A;  2KHN A;  4USL A;  4QJ5 B;  4BY4 A;  1MR8 A;  4JKT A;  1TOP A;  1B7T Z;  1KK8 C;  4GPL B;  1ZFS A;  3KO0 A;  5D7F A;  2KAX A;  2Y1M A;  4YBH B;  4MRY A;  3TDI A;  2K60 A;  3OX6 A;  3OB1 B;  2L2E A;  1NCX A;  2JC2 A;  1MXL C;  2E30 A;  2NCP A;  3DVJ A;  2MJW B;  2JTT A;  1TIZ A;  4JPZ B;  4ORA B;  4DRW A;  4PHM A;  2EHB A;  1KK7 Z;  1TUJ A;  1N65 A;  1U5I B;  4MVF A;  4I5N B;  2NXQ A;  2L2C A;  4OCI A;  3FE9 A;  1NX2 A;  2CCM A;  3BJH A;  1R2U A;  1DEL A;  2FCE A;  2L4H A;  1F71 A;  2LAN A;  2QEV A;  1UHN A;  5KSZ A;  1TCF A;  2G9B A;  3WHU B;  1OQP A;  5D69 A;  1W7J B;  5AEQ A;  1QIW A;  2COL B;  2KFF A;  3NSL A;  1OSA A;  3LL8 B;  4PHN A;  3JVT C;  2LMT A;  3D77 A;  3TUY C;  3JVT B;  2HQ8 A;  3V2L A;  5FI6 A;  1YR5 A;  3BUN B;  3TUY B;  1FW4 A;  4N5X A;  3SG6 A;  1S5G Y;  1UUS A;  3VRP A;  4INW A;  3S0F A;  4U8D A;  3BQ3 A;  4HRG A;  1DJI A;  3O4Y A;  1G4Y R;  4M2Q A;  1A75 B;  4OVN F;  2KGR A;  1ZUZ A;  2AUC A;  2PAL A;  1CMG A;  1QVI Y;  2ISD A;  3MSE B;  4ZCU A;  3RLZ A;  4E68 A;  2PYQ A;  1CFF A;  3I5G C;  2JOJ A;  1GGW A;  1TCO B;  2M1K B;  1ZMZ A;  1PUL A;  3ICB A;  1EXR A;  2KFH A;  1IG5 A;  1S1E A;  2BCA A;  1YTZ C;  1C3Z A;  1MWN A;  1F4O A;  3PAL A;  5D3O A;  4DCK A;  5HKY A;  2MBX A;  2CXJ A;  3I5H B;  4L9M A;  4F0Z B;  1M45 A;  3D0Y A;  2G2B A;  3SIA A;  4MZL A;  5FI7 A;  1BMO A;  3KPX A;  3BXK A;  1LIN A;  2WCF A;  3FE6 A;  2AMI A;  2BAP A;  3CLN A;  5HL1 A;  1IQ3 A;  3OHM B;  4PT1 A;  3KHE A;  3CZ2 A;  2MLF C;  2B1U A;  3PM8 A;  2D8N A;  4JQ0 D;  2K8M B;  4MZJ A;  5GQQ C;  2Y5I A;  2ERB A;  2P70 A;  2M29 A;  1PVA A;  2JTZ A;  1WRZ A;  4A4C A;  1AVS A;  1RWY A;  1XO5 A;  2LVI A;  3EKH A;  2BCB A;  5AFP A;  2LVK A;  3D0Y B;  1SW8 A;  1QV1 A;  1SSE B;  1DT7 B;  1AK8 A;  2A4J A;  2O60 A;  2F33 A;  3OGN A;  3SS5 A;  1K96 A;  2AAO A;  2WC6 A;  3CGA A;  1GGZ A;  1XFW O;  2HF5 A;  3IF7 A;  4JWQ A;  3CR4 X;  1OOF A;  3C1V A;  2WOS A;  3LCP C;  4ETO A;  2JRF A;  3SG5 A;  2JNX A;  1ORG A;  2SAS A;  3CZ0 A;  4HSZ A;  3OP0 A;  3EVR A;  3VRQ A;  1CB1 A;  2PVB A;  4NDC A;  2KAY A;  2F3Z A;  4OZD A;  4F7F A;  3R1P A;  2KLD A;  2JXL A;  4MZK A;  3D76 A;  3SG4 A;  1XFV O;  1DJZ A;  2Y4Q A;  3B86 A;  1H8B A;  4MBE A;  2OS8 C;  1YUR A;  1IJ6 A;  1A29 A;  3GK4 X;  5CSI A;  4D1E A;  1DQE A;  1K9K A;  1A4P A;  1XFZ O;  2LLS A;  1S26 D;  2BKI B;  2JT0 A;  2WND A;  3DVK A;  2OTG B;  4XJK B;  5CPV A;  5K89 A;  1SMG A;  4MLW A;  1CLB A;  1QIV A;  4N1F A;  4BY5 A;  1OMD A;  4PCW A;  1IH0 A;  2BL0 C;  2F2O A;  1TNQ A;  1K90 D;  1SCV A;  3CZ1 A;  3VGO A;  1KQV A;  1JWD A;  2KNE A;  2K7B A;  4JD9 A;  3GK1 A;  4DS7 A;  2CNP A;  4PAL A;  1XVJ A;  4ORB B;  1PVB A;  3BUX B;  1G33 A;  1REC A;  2TN4 A;  1XFY O;  2KPH A;  3OB2 B;  4HRH A;  3LLE A;  3SJS A;  1K8U A;  1NP8 A;  1N2D A;  4GFT A;  1GQM A;  3RZS A;  1B8C A;  1C7V A;  2KFG A;  1J7R A;  1CFD A;  4MSP A;  5PAL A;  2ZFD A;  2YGU A;  4CFR A;  1CKK A;  1Q80 A;  3IQQ A;  1F54 A;  3AKB A;  1UHJ A;  1QJT A;  1CM4 A;  1J7Q A;  3NSO A;  1NYA A;  1SR6 B;  1CNP A;  2WCL A;  2Q91 A;  2Q4U A;  3FS7 A;  1SY9 A;  1X02 A;  1QX5 B;  4WQ3 A;  3TDZ A;  3RM1 A;  1TUZ A;  1CDL A;  2LP2 A;  4MN0 A;  3JTD B;  4XJK A;  1IGV A;  2JU0 A;  4YI8 A;  4PE4 A;  1JFJ A;  1PRW A;  1DVI A;  1YRT B;  1YX7 A;  3BYA A;  4YRU A;  1S5G Z;  1BOD A;  2L98 A;  2BE4 A;  4M2O A;  4R1E A;  1OOI X;  2EC6 B;  1OMV A;  1N0Y A;  2LP3 A;  2HQW A;  1KQM B;  2PAS A;  2SCP A;  1PK0 D;  3O6B A;  2NLN A;  4Q04 A;  3UO9 A;  4YGD B;  2QEB A;  2BNX A;  2KI6 C;  2M49 B;  1A03 A;  2I18 A;  2JQ6 A;  5J3X A;  1NWD A;  1KWO C;  3VRN A;  1EJ3 A;  3O2P A;  3CAB A;  1B1G A;  1PSR A;  2M7L A;  3S0E A;  1WLM A;  1IRJ A;  1Y1A A;  3B87 A;  1OW4 A;  1K9P A;  1S6C A;  3K21 A;  4OV2 A;  2KQ6 A;  3EG5 B;  3SG2 A;  1DJY A;  1C07 A;  2ZN9 A;  2KBI A;  2GV5 A;  2LUC A;  4AQJ A;  1DJX A;  4GBA A;  4PHJ A;  3OBV A;  3DD4 A;  2PMY A;  1DJW A;  2L5X B;  5DKR A;  1J55 A;  3L47 A;  3HX4 A;  3NGV A;  2LMU A;  4OR9 B;  1QTX A;  1LXF C;  4WQ2 A;  1WY9 A;  1XK4 A;  5HYD A;  2Y1N A;  2QEO A;  3VRO A;  1XYD A;  2L0P A;  2DOQ A;  3EVU A;  1XK4 C;  1TTX A;  2WCK A;  3NXA A;  5EL2 A;  5I2L A;  2I2R E;  3BFA A;  4ORC B;  2P71 A;  3AKA A;  4MRX A;  1B47 A;  3O78 A;  1KSO A;  2HET A;  4PE0 A;  2KI6 D;  3NSK A;  5AER A;  1SKT A;  2OTG C;  2R2I A;  1QVI Z;  1BJF A;  2V53 A;  4CFQ A;  1QAT A;  3PJI A;  2KQY A;  2MRD A;  3AAJ A;  3TS5 C;  1YVH A;  4P5O E;  1FI6 A;  5KU1 A;  3R1O A;  1G8I A;  1JBA A;  1K94 A;  2BL0 B;  2WC8 A;  2ZRT A;  3FWC A;  5FYX A;  3CR5 X;  3M0W A;  3R72 A;  1IQ5 A;  2WCB A;  3SS3 A;  1B8L A;  1ODB A;  3WHT B;  3EK8 A;  1TNP A;  2LC5 A;  1SK6 D;  4KYN A;  1UWO A;  1L7Z A;  1UP5 A;  2O5G A;  1S6I A;  3LK1 A;  4PE7 A;  3PLF B;  2JT8 A;  4PHK A;  3SG7 A;  3CTN A;  1LKJ A;  4DUQ A;  1T14 A;  2WC5 A;  1LVC D;  4ICB A;  2MHH A;  1AP4 A;  1E8A A;  3BUO B;  2EGD A;  1QLS A;  2M7N A;  2OPO A;  3AAK A;  2CT9 A;  1W7I B;  1DEK A;  1HQV A;  4C0J A;  1YUS A;  4GGF C;  5DKN A;  3Q8I A;  2KYF A;  1F55 A;  3VB1 A; 
#chains in the Genus database with same CATH homology
 4CPV A;  1WDC B;  2QAC A;  4N1G A;  2LLU A;  1WDC C;  4C0L A;  4FQO A;  4NQG A;  1BOC A;  1CFP A;  2ZNE A;  2LCP A;  1J7P A;  1QX2 A;  1RK9 A;  4ZCV A;  2I7A A;  2PSR A;  4QJ3 B;  4AQI A;  1FBV A;  3TZ1 A;  1A75 A;  1CLL A;  1LA3 A;  5ER5 A;  5I2O A;  4YGC B;  3I5F C;  1BLQ A;  1XA5 A;  1ALW A;  1YUT A;  5IBW A;  4GGN A;  4CID A;  4GUK A;  5HKW A;  2M0R A;  1HT9 A;  2NZ0 A;  1KCY A;  2EC6 C;  1NX0 A;  1WRL A;  5AXI A;  1EL4 A;  1UHH A;  2QPT A;  2RGI A;  1QS7 A;  2M1U A;  2GGZ A;  1DTL A;  2IS9 A;  3PSR A;  1DJG A;  1DF0 A;  1SYM A;  1B7T Y;  1U5I A;  5B8I B;  2FJU B;  3BUW B;  2K7C A;  1NIW A;  2M8U A;  3ZWH A;  2LVJ A;  2LNK A;  5I2Q A;  4PE1 A;  1BR4 B;  4YGB B;  1PSB A;  1NCY A;  3I5G B;  3DVE A;  1SL7 A;  5HKZ A;  5TNC A;  1JF0 A;  1NUB A;  2F8P A;  1MXE A;  3KF9 A;  4CLN A;  2K61 A;  4I5K A;  3I5I B;  1DJH A;  4AOM A;  2WCE A;  1DGV A;  1BU3 A;  3GOF A;  1MQ1 A;  2KAV A;  3I5I C;  1BR1 B;  1SCM C;  2L51 A;  5DKQ A;  2F2P A;  3EKJ A;  1K2H A;  1SL9 A;  2NCO A;  2CTN A;  3CZT X;  1TNX A;  2BEC A;  2FCD A;  2CBL A;  2L50 A;  3FWB A;  3DF0 A;  1NSH A;  4I5J A;  2BBM A;  2M97 A;  5I8N A;  2VRG A;  2K2F A;  2LV7 A;  2K7D A;  2MAZ A;  1CDM A;  1MUX A;  1KFU S;  1CDP A;  4MEW A;  4NDD A;  1RTP 1;  1Y6W A;  3OX5 A;  4IL1 A;  1JSA A;  2KSP A;  3DVM A;  1KFX S;  1CTR A;  2LE9 B;  3TS5 B;  1UHI A;  4A4B A;  1YVL A;  3EK7 A;  4GAO A;  1Y1U A;  2K0J A;  3EK4 A;  1BF5 A;  1TN4 A;  5CSN A;  1OZO A;  3QRX A;  1M63 B;  1OE9 B;  2BCX A;  2LMV A;  1CM1 A;  2K2A A;  1JC2 A;  1EH2 A;  3A4U B;  5JJG A;  2ZN8 A;  2JZI A;  2L4I A;  4NDB A;  2LM5 A;  1CLM A;  1M46 A;  3BOW A;  3IQO A;  1F4Q A;  2JXC A;  1BT6 A;  1KK8 B;  1KSM A;  4PDZ A;  1S36 A;  2BKH B;  2MLE C;  4M2P A;  2KI4 B;  2K7O A;  1NPQ A;  1B9A A;  3LK0 A;  2OS8 B;  2KI4 C;  2LVV A;  1UUR A;  1VRK A;  2H2K A;  2LLT A;  1CFC A;  1FF1 A;  1OMR A;  1B8R A;  3F45 A;  2GGM A;  1KK7 Y;  1NX1 A;  1QX7 A;  1SR6 C;  1MF8 B;  3SIB A;  2LAP A;  1AJ5 A;  1YX8 A;  5CSF A;  4GGF A;  4UPG A;  3PFV A;  1WLZ A;  4FTG A;  2ZND A;  1WRK A;  3I5H C;  2MA2 A;  5G08 A;  3HCM A;  4I5L B;  1Y0V H;  1RFJ A;  2JUL A;  3KEV A;  1RRO A;  1AHR A;  2PRU A;  3E3R A;  4YGA A;  2LHL A;  4WRI A;  2P6B B;  2M3W A;  2H61 A;  2E6W A;  4P2Y B;  4TNC A;  1YRU B;  3NSI A;  1DMO A;  1IJ5 A;  3DF0 B;  3PN7 C;  2LUX A;  5HLO A;  2KGB C;  4YGE B;  2JT3 A;  3PN7 B;  3D10 A;  3WXA A;  1QAS A;  1XFU O;  1ZAC A;  1JUO A;  5JOL A;  3ZNI A;  1UHK A;  1QXP A;  3CWG A;  1V1G A;  5AAN A;  1KFU L;  2ZRS A;  1JF2 A;  1EG4 A;  2JNF A;  1XFX O;  4OKH A;  3VRR A;  2LHI A;  3CS1 A;  1QV0 A;  4DIR A;  3WNX B;  1NCZ A;  1J7O A;  1AUI B;  1B4C A;  4QJ4 B;  1K93 D;  2F3Y A;  1S3P A;  2HPS A;  1R6P A;  1FI5 A;  2JWW A;  2ZKM X;  2BE6 A;  1K95 A;  3JTD C;  2H61 C;  1MHO A;  1PAL A;  3H4S E;  1SNL A;  3GK2 A;  1GJY A;  1ALV A;  1SCM B;  1Y1X A;  1K9U A;  1SL8 A;  1M39 A;  1J1D A;  5CSJ A;  3I5F B;  1S6J A;  1L2O B;  2KBM A;  1IWQ A;  1SRA A;  1KFX L;  2WOR A;  4HRE E;  1OOJ A;  3SG3 A;  1FPW A;  4XYN A;  5ER4 X;  1L2O C;  3TDU A;  1CMF A;  1J1E A;  3BUM B;  1KQM C;  5HLV A;  1AJ4 A;  4GNK B;  2KOT A;  1V1F A;  3CR2 A;  1NX3 A;  1YUU A;  1C7W A;  2BBN A;  1RJV A;  2KDH A;  3A8R A;  3EVV A;  1SPY A;  4C0K A;  1KWO B;  1IKU A;  1OZS A;  1JFK A;  1F8H A;  2I94 A;  4YI9 A;  3FIA A;  1LA0 A;  1BG1 A;  1A2X A;  1TRF A;  1EG3 A;  1TNW A;  5F6T A;  3BOW B;  2JPT A;  5BPJ A;  1CDN A;  2FOT A;  2KYC A;  1F70 A;  1DGU A;  1DF0 B;  1M31 A;  1QLK A;  3PAT A;  1H4B A;  1ZOT B;  1D1O A;  2M9G A;  1SBJ A;  2KHN A;  4USL A;  4QJ5 B;  4BY4 A;  1MR8 A;  1TOP A;  1B7T Z;  1KK8 C;  4GPL B;  1ZFS A;  3KO0 A;  5D7F A;  2KAX A;  2Y1M A;  4YBH B;  4MRY A;  3TDI A;  3OX6 A;  3OB1 B;  2L2E A;  1NCX A;  2JC2 A;  1MXL C;  2E30 A;  2NCP A;  3DVJ A;  2MJW B;  2JTT A;  1TIZ A;  4JPZ B;  4ORA B;  4DRW A;  4PHM A;  2EHB A;  1KK7 Z;  4MVF A;  1N65 A;  1U5I B;  4I5N B;  2NXQ A;  4OCI A;  1NX2 A;  2CCM A;  1R2U A;  2L4H A;  2FCE A;  1F71 A;  2LAN A;  1UHN A;  5KSZ A;  2G9B A;  1TCF A;  3WHU B;  1OQP A;  5D69 A;  1W7J B;  5AEQ A;  1QIW A;  2COL B;  2KFF A;  3NSL A;  1OSA A;  3LL8 B;  4PHN A;  3JVT C;  2LMT A;  3TUY C;  3JVT B;  2HQ8 A;  1YR5 A;  3BUN B;  3TUY B;  1FW4 A;  4N5X A;  3SG6 A;  1S5G Y;  1UUS A;  3VRP A;  4U8D A;  3BQ3 A;  4HRG A;  1DJI A;  3O4Y A;  1G4Y R;  4M2Q A;  1A75 B;  4OVN F;  2KGR A;  1ZUZ A;  2AUC A;  2PAL A;  1CMG A;  1QVI Y;  2ISD A;  3MSE B;  4ZCU A;  3RLZ A;  4E68 A;  1CFF A;  3I5G C;  2JOJ A;  1GGW A;  1TCO B;  2M1K B;  1ZMZ A;  1PUL A;  3ICB A;  1EXR A;  2KFH A;  1IG5 A;  1S1E A;  1YTZ C;  2BCA A;  1MWN A;  3PAL A;  1F4O A;  4DCK A;  5HKY A;  2MBX A;  2CXJ A;  3I5H B;  4L9M A;  4F0Z B;  1M45 A;  3D0Y A;  2G2B A;  3SIA A;  4MZL A;  1BMO A;  3KPX A;  3BXK A;  1LIN A;  2WCF A;  2AMI A;  3CLN A;  1IQ3 A;  3OHM B;  3KHE A;  2MLF C;  2B1U A;  3PM8 A;  2D8N A;  4JQ0 D;  2K8M B;  4MZJ A;  5GQQ C;  2Y5I A;  2M29 A;  1PVA A;  2JTZ A;  1WRZ A;  4A4C A;  1AVS A;  1RWY A;  1XO5 A;  2LVI A;  3EKH A;  2BCB A;  5AFP A;  2LVK A;  3D0Y B;  1SW8 A;  1QV1 A;  1DT7 B;  1AK8 A;  2A4J A;  2O60 A;  2F33 A;  1K96 A;  2AAO A;  3CGA A;  1GGZ A;  1XFW O;  2HF5 A;  3IF7 A;  4JWQ A;  3CR4 X;  3C1V A;  2WOS A;  3LCP C;  4ETO A;  2JRF A;  3SG5 A;  2JNX A;  2SAS A;  4HSZ A;  3OP0 A;  3EVR A;  3VRQ A;  1CB1 A;  2PVB A;  4NDC A;  2KAY A;  2F3Z A;  2JXL A;  4MZK A;  3SG4 A;  1XFV O;  1DJZ A;  2Y4Q A;  1H8B A;  4MBE A;  2OS8 C;  1YUR A;  1IJ6 A;  1A29 A;  3GK4 X;  5CSI A;  4D1E A;  1K9K A;  1A4P A;  1XFZ O;  2LLS A;  1S26 D;  2BKI B;  2JT0 A;  2WND A;  3DVK A;  2OTG B;  4XJK B;  5CPV A;  5K89 A;  1SMG A;  4MLW A;  1CLB A;  1QIV A;  4N1F A;  4BY5 A;  1OMD A;  4PCW A;  1IH0 A;  2F2O A;  2BL0 C;  1TNQ A;  1K90 D;  1SCV A;  3VGO A;  1KQV A;  1JWD A;  2KNE A;  2K7B A;  3GK1 A;  4DS7 A;  2CNP A;  4PAL A;  1XVJ A;  4ORB B;  1PVB A;  3BUX B;  1G33 A;  1REC A;  2TN4 A;  1XFY O;  3OB2 B;  4HRH A;  3LLE A;  3SJS A;  1K8U A;  1NP8 A;  1N2D A;  4GFT A;  1GQM A;  1B8C A;  1C7V A;  2KFG A;  1J7R A;  1CFD A;  4MSP A;  5PAL A;  2ZFD A;  4CFR A;  1CKK A;  1Q80 A;  3IQQ A;  1F54 A;  3AKB A;  1UHJ A;  1QJT A;  1CM4 A;  1J7Q A;  3NSO A;  1NYA A;  1SR6 B;  1CNP A;  2Q91 A;  2Q4U A;  3FS7 A;  1SY9 A;  1X02 A;  1QX5 B;  4WQ3 A;  3TDZ A;  3RM1 A;  1CDL A;  2LP2 A;  4MN0 A;  3JTD B;  4XJK A;  1IGV A;  2JU0 A;  4YI8 A;  4PE4 A;  1JFJ A;  1PRW A;  1DVI A;  1YRT B;  1YX7 A;  3BYA A;  4YRU A;  1S5G Z;  1BOD A;  2L98 A;  2BE4 A;  4M2O A;  4R1E A;  2EC6 B;  1OMV A;  1N0Y A;  2LP3 A;  2HQW A;  1KQM B;  2PAS A;  2SCP A;  1PK0 D;  3O6B A;  2NLN A;  4Q04 A;  4YGD B;  2KI6 C;  2M49 B;  1A03 A;  2I18 A;  2JQ6 A;  5J3X A;  1NWD A;  1KWO C;  3VRN A;  1EJ3 A;  3O2P A;  1PSR A;  2M7L A;  1WLM A;  1IRJ A;  1Y1A A;  3K21 A;  4OV2 A;  1K9P A;  1S6C A;  3SG2 A;  5KTY A;  2KQ6 A;  1DJY A;  1C07 A;  2ZN9 A;  2KBI A;  2GV5 A;  2LUC A;  4AQJ A;  1DJX A;  4GBA A;  4PHJ A;  5DKR A;  3DD4 A;  2PMY A;  1DJW A;  2L5X B;  1J55 A;  3HX4 A;  2LMU A;  4OR9 B;  1QTX A;  1LXF C;  4WQ2 A;  1WY9 A;  1XK4 A;  5HYD A;  2Y1N A;  1B1G A;  3VRO A;  1XYD A;  2L0P A;  2DOQ A;  3EVU A;  1XK4 C;  1TTX A;  3NXA A;  5I2L A;  2I2R E;  4ORC B;  3AKA A;  4MRX A;  1B47 A;  3O78 A;  1KSO A;  2HET A;  4PE0 A;  2KI6 D;  3NSK A;  5AER A;  1SKT A;  2OTG C;  2R2I A;  1QVI Z;  1BJF A;  2V53 A;  4CFQ A;  1QAT A;  2KQY A;  2MRD A;  3AAJ A;  3TS5 C;  1YVH A;  4P5O E;  1FI6 A;  5KU1 A;  1G8I A;  1JBA A;  1K94 A;  2BL0 B;  2WC8 A;  2ZRT A;  3FWC A;  5FYX A;  3CR5 X;  3M0W A;  1IQ5 A;  2WCB A;  1B8L A;  1ODB A;  3WHT B;  3EK8 A;  1TNP A;  2LC5 A;  1SK6 D;  1UWO A;  1L7Z A;  1UP5 A;  2O5G A;  1S6I A;  3LK1 A;  4PE7 A;  3PLF B;  2JT8 A;  4PHK A;  3SG7 A;  3CTN A;  1LKJ A;  4DUQ A;  4ICB A;  1LVC D;  2MHH A;  1AP4 A;  1E8A A;  3BUO B;  2EGD A;  1QLS A;  2M7N A;  2OPO A;  3AAK A;  2CT9 A;  1W7I B;  1HQV A;  4C0J A;  1YUS A;  4GGF C;  5DKN A;  2KYF A;  1F55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...