1YURA

Solution structure of apo-s100a13 (minimized mean structure)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
98
structure length
98
Chain Sequence
MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords S100 calcium-binding protein A13
publication title Structural Interplay between Calcium(II) and Copper(II) Binding to S100A13 Protein
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1yurA00
2KAXA 2AMIA 1KFXL 3BXKA 1OMVA 3DVJA 3H4SE 4YGBB 1YX8A 1MHOA 4GGNA 5GQQC 1V1FA 2LLSA 3WHUB 2BECA 3TUYB 4MZKA 2K7CA 4UPGA 1QX2A 1XK4C 2KI6C 2LUXA 1J1DA 2JU0A 1BF5A 3ICBA 1A2XA 1RECA 1TCOB 2L4HA 1QLSA 1S5GY 4DRWA 1TNXA 2JRFA 1S6JA 4BY5A 1BG1A 1IH0A 1UWOA 3FWCA 1K8UA 4OKHA 2RGIA 4YGCB 3SIBA 2JZIA 1XO5A 4MEWA 2K7BA 3OB1B 1G4YR 3EVRA 2NZ0A 1QTXA 1TNQA 3TS5B 2Q91A 1JFJA 2L98A 3EVUA 1LXFC 1WLZA 1YX7A 2KQ6A 1SCMC 4PDZA 4Q04A 4JQ0D 2LVIA 2M1KB 4I5JA 1DJZA 3FWBA 4MRXA 2LAPA 1C7VA 1YUSA 1AJ5A 1F70A 2G2BA 2JTZA 1S6CA 4CLNA 3BOWA 2M97A 3C1VA 4YI9A 1IQ5A 5CSFA 3TDIA 1EH2A 1QV0A 2L50A 3D0YB 4PHJA 5HLOA 2LHLA 1QATA 5JJGA 2LM5A 1S1EA 3I5GB 1U5IB 4I5KA 3CWGA 4ICBA 3NSLA 2LVKA 1CDMA 3AKAA 1FI6A 3EVVA 1J7RA 2LNKA 1SBJA 2HETA 1YUUA 1GQMA 2I18A 3I5HC 1B8RA 1VRKA 2WOSA 2LMUA 2BCXA 1SYMA 1QX5B 2FCEA 3EKJA 5I2LA 1SR6C 5K89A 3KEVA 1WRKA 3CS1A 1NX3A 1AUIB 1BT6A 1W7IB 1J7OA 1J1EA 1WY9A 1XVJA 1KFUS 2KYCA 3M0WA 4QJ3B 1YVLA 4PE7A 3VRPA 1RK9A 5CSIA 1AVSA 1KWOC 2R2IA 1ZOTB 1MWNA 2CBLA 4MRYA 4D1EA 1CM4A 1SPYA 3I5FC 4P2YB 3DF0B 1LINA 3BUOB 4A4BA 1DJYA 5I8NA 1H8BA 2JULA 2M8UA 4HRGA 4AQJA 4ORAB 2K7DA 2ZRTA 4YGDB 1B1GA 3MSEB 2QPTA 1G8IA 2OPOA 2F2PA 4MN0A 1NCZA 2LANA 3CR2A 1B8LA 1M45A 1QX7A 4XYNA 2JNXA 1L7ZA 2LVVA 3SJSA 3SIAA 1IRJA 4HRHA 3SG7A 1DMOA 1EL4A 3LK1A 4GFTA 3OP0A 1B9AA 1RFJA 1WDCB 2I2RE 4I5NB 4JPZB 1OOJA 1K93D 1QIWA 1NIWA 2SCPA 1OMDA 1KSOA 3BUNB 3JTDC 5KTYA 1NCXA 2JNFA 1DF0B 3GK2A 1ALWA 3WXAA 1S3PA 3SG3A 1SNLA 1CMFA 2KI4C 1SL9A 4CFRA 3OHMB 4OR9B 2NCPA 1CB1A 2KBIA 1KK7Z 1FW4A 2K8MB 1XYDA 1XFWO 2FCDA 2BL0C 1TN4A 4OV2A 4DS7A 1NUBA 3OB2B 5DKRA 1Y0VH 2LV7A 2HPSA 4I5LB 1A03A 1UP5A 2LP2A 1J7QA 5D69A 4NDDA 2KAVA 4M2PA 2KOTA 3PN7C 2KGRA 1DVIA 2OTGC 4PALA 1F4QA 1LA0A 2BCAA 2KFFA 4CIDA 1DTLA 5CSJA 1N0YA 3ZNIA 3E3RA 4XJKA 2E30A 4OVNF 2BKHB 2JT0A 2BE6A 3O4YA 1LVCD 3LK0A 3DVEA 1TTXA 1TOPA 2K61A 1SCVA 5D7FA 1JC2A 1NYAA 1M39A 2KAYA 2KYFA 3BOWB 2TN4A 2F3YA 4JWQA 1QVIZ 4PHKA 2WCFA 2ISDA 1F4OA 3EKHA 3SG4A 1M46A 1NSHA 1SL7A 3KF9A 4L9MA 1JSAA 4YRUA 3KHEA 1NCYA 2BE4A 2K2AA 3BQ3A 2COLB 2M29A 3TDZA 2L2EA 1PVBA 1QXPA 3DVMA 1KK8B 2JTTA 2JXCA 3CGAA 1KFXS 1BJFA 1JF2A 2EC6B 1L2OB 4C0JA 4CFQA 3TZ1A 4WQ3A 1B7TY 3PALA 1MUXA 1UURA 2WCEA 3EK8A 3JVTC 1S5GZ 4ZCUA 1PSBA 1XK4A 1QLKA 2GV5A 1OQPA 3I5IB 1IG5A 2I7AA 1FPWA 4M2QA 2Y1NA 2PALA 4YI8A 1ZFSA 1FF1A 1K9KA 4AQIA 2BBNA 4CPVA 1AP4A 1N65A 1HQVA 1XFUO 4PHNA 1GGZA 4DUQA 3TUYC 2KQYA 1UUSA 2K2FA 4PE1A 5FYXA 1BOCA 1IJ5A 1CM1A 2H2KA 5J3XA 2JC2A 3O78A 1R2UA 3CTNA 1KWOB 1CDNA 1EG4A 3CR5X 1CFFA 1YURA 1K2HA 2KBMA 2LMTA 1PK0D 3PFVA 1CFPA 1CFDA 1DJGA 1K90D 1W7JB 1XFXO 2LLUA 1MR8A 1NWDA 3I5FB 4WQ2A 4F0ZB 1F8HA 1XA5A 4PHMA 4GAOA 1Q80A 3SG5A 1PVAA 4ETOA 2KSPA 3O2PA 1JF0A 2MLEC 1Y1UA 3TS5C 1KCYA 1KFUL 2AUCA 3LCPC 1F71A 2LLTA 1QJTA 2MAZA 1CTRA 4GBAA 1ODBA 2CTNA 3GOFA 1TNPA 3BUXB 3ZWHA 1B4CA 2K0JA 2K7OA 2WCBA 1B8CA 3OX5A 3PSRA 1PSRA 2G9BA 2ZKMX 1NP8A 1HT9A 1JUOA 1SMGA 1YRUB 3JTDB 2F33A 3PATA 2VRGA 3IQOA 3I5GC 1K9PA 2CXJA 2Y1MA 4QJ4B 2H61C 1XFVO 3DD4A 2KI4B 1C7WA 3DVKA 1KSMA 3QRXA 5I2OA 3HX4A 1TCFA 1DT7B 5HLVA 1IKUA 4XJKB 2BL0B 2PRUA 3AKBA 3WNXB 1UHIA 2JWWA 1EJ3A 4N5XA 3NSKA 1IWQA 1CMGA 2JOJA 1QIVA 3NSOA 1U5IA 1OZSA 4BY4A 4N1GA 1LA3A 2H61A 4PCWA 5AANA 4HSZA 4GNKB 1AJ4A 1AHRA 2MHHA 4NDBA 2ZN9A 2O60A 2ZFDA 2MLFC 4GGFC 4ORBB 4ZCVA 5HKZA 1KQMB 3RM1A 1KQVA 5PALA 5JOLA 1S6IA 3IF7A 5B8IB 5ER4X 3PM8A 4USLA 1AK8A 1LKJA 1DJIA 4TNCA 2WC8A 2MJWB 4M2OA 5AFPA 2LCPA 2OS8C 3BUMB 1CNPA 1MXLC 1TRFA 5I2QA 3SG2A 2L5XB 2KFGA 2EHBA 2QACA 2JQ6A 1WDCC 4C0LA 4HREE 4OCIA 2WNDA 2KNEA 2IS9A 1J55A 5AERA 2ZRSA 3IQQA 2M9GA 3VRQA 1JFKA 4MLWA 1BODA 1ZACA 1YTZC 5DKQA 5CPVA 1NX1A 3HCMA 4MZJA 1X02A 2LMVA 2PVBA 2CT9A 1K96A 1DJWA 1GGWA 2F8PA 3F45A 2L4IA 2NLNA 1NPQA 2EGDA 1QV1A 2FJUB 2PSRA 3BUWB 1SCMB 2JXLA 1RROA 3PLFB 4YGAA 1CFCA 1K95A 1A75A 3LL8B 1OE9B 2FOTA 1TIZA 4WRIA 1D1OA 5KU1A 2O5GA 2KI6D 1EXRA 2WORA 1RTP1 4N1FA 4A4CA 5AEQA 1SK6D 2ZNEA 2M49B 3KO0A 1WRZA 3AAJA 3VRNA 4GPLB 2LP3A 2LVJA 1YR5A 2F3ZA 1B7TZ 5F6TA 4QJ5B 1NX2A 1S26D 1Y1AA 1UHNA 2HQWA 3I5HB 3NSIA 1OMRA 1YVHA 1RWYA 4DIRA 1SR6B 1YRTB 1ALVA 1Y1XA 1NX0A 2CCMA 5ER5A 3AAKA 2P6BB 2CNPA 3KPXA 1JBAA 1QASA 2BKIB 5G08A 2SASA 1IQ3A 2M7NA 1KK8C 1DGVA 4NDCA 1F54A 1SKTA 1SY9A 2ZNDA 1YUTA 2EC6C 1L2OC 2A4JA 2JPTA 4C0KA 4MSPA 4DCKA 2JT8A 1A4PA 3O6BA 1CDLA 1H4BA 3I5IC 1CKKA 2M3WA 1G33A 1OSAA 3A4UB 1CLMA 4YGEB 3CR4X 2M1UA 5TNCA 5IBWA 1Y6WA 2BCBA 3FS7A 1C07A 1WRLA 4AOMA 1XFYO 1A29A 3VROA 1BR4B 1CDPA 1E8AA 2MA2A 4FQOA 4MBEA 4PE4A 2MRDA 1M63B 4IL1A 2Y5IA 1RJVA 1S36A 1GJYA 1N2DA 1OZOA 5KSZA 4NQGA 1PULA 5CSNA 2B1UA 2KFHA 3WHTB 1FBVA 3EK7A 2Q4UA 3EK4A 5HKWA 1QS7A 1IJ6A 1WLMA 2PASA 2Y4QA 3NXAA 5HYDA 1FI5A 2D8NA 1BMOA 3D0YA 2F2OA 1SW8A 2M7LA 5AXIA 3SG6A 2NXQA 3VGOA 2PMYA 1F55A 3VRRA 1R6PA 3BYAA 1CLLA 2NCOA 3OX6A 2OTGB 3PN7B 4MZLA 4YBHB 1PALA 2OS8B 1JWDA 1PRWA 2L0PA 1ZMZA 1ZUZA 1CLBA 1M31A 2I94A 3CZTX 2GGZA 3D10A 1KK7Y 1UHHA 2V53A 5BPJA 2E6WA 2KHNA 1MXEA 1UHKA 1DGUA 1TNWA 1A75B 1DJHA 2KDHA 2MBXA 2AAOA 1BR1B 2JT3A 3A8RA 4U8DA 3DF0A 3FIAA 4E68A 4GUKA 2ZN8A 2L51A 4GGFA 1SL8A 1DJXA 4MVFA 2HQ8A 1IGVA 3CLNA 4R1EA 3GK1A 1MF8B 2BBMA 2LC5A 2LHIA 1XFZO 3K21A 1K94A 3LLEA 1UHJA 2GGMA 4ORCB 3RLZA 1V1GA 1BLQA 1BU3A 5HKYA 4PE0A 5DKNA 2KGBC 2M0RA 3JVTB 2LUCA 3GK4X 1KQMC 1EG3A 4FTGA 1QVIY 1MQ1A 3TDUA 4P5OE 1SRAA 1B47A 2DOQA 1DF0A 1J7PA 2LE9B 2HF5A 1K9UA
chains in the Genus database with same CATH superfamily
2KAXA 2AMIA 1KFXL 3BXKA 1OMVA 3DVJA 3H4SE 4YGBB 1YX8A 1MHOA 4GGNA 5GQQC 1V1FA 2LLSA 3WHUB 2BECA 3TUYB 4MZKA 2K7CA 4UPGA 1QX2A 1XK4C 2KI6C 2LUXA 1J1DA 2JU0A 1BF5A 3ICBA 1A2XA 1RECA 1TCOB 2L4HA 1QLSA 1S5GY 3BFAA 1TNXA 2JRFA 1S6JA 2QDIA 4BY5A 4DRWA 1BG1A 1UWOA 1IH0A 3FWCA 2BAPA 1K8UA 3B88A 2RGIA 4OKHA 4YGCB 3SIBA 2JZIA 1XO5A 4MEWA 4OZDA 2K7BA 3OB1B 1G4YR 3EVRA 2NZ0A 1QTXA 1TNQA 3TS5B 2Q91A 1JFJA 2FJYA 2L98A 3CZ0A 3EVUA 1LXFC 1WLZA 1YX7A 2KQ6A 1SCMC 4PDZA 4Q04A 4JQ0D 3SS4A 2LVIA 2M1KB 4I5JA 1DJZA 3FWBA 4MRXA 2LAPA 3PM2A 1YUSA 1AJ5A 1C7VA 2G2BA 2JTZA 1S6CA 5D3OA 4CLNA 3BOWA 2M97A 3C1VA 4YI9A 1IQ5A 3SS3A 5CSFA 3TDIA 1EH2A 1QV0A 3EG5B 2L50A 3D0YB 1OOGA 1TUJA 4PHJA 5HLOA 2LHLA 1QATA 5JJGA 2QEVA 2LM5A 3DYEA 1S1EA 3I5GB 1U5IB 4I5KA 3CWGA 4ICBA 3NSLA 2LVKA 1CDMA 3AKAA 1FI6A 3EVVA 1J7RA 2LNKA 1SBJA 2HETA 1YUUA 1GQMA 2I18A 2KLDA 3I5HC 1B8RA 1VRKA 2WOSA 2LMUA 2BCXA 1SYMA 1QX5B 2FCEA 3EKJA 5I2LA 1SR6C 3SS5A 3KEVA 1WRKA 3CS1A 1NX3A 5K89A 1AUIB 1BT6A 2BNXA 1W7IB 1J7OA 1J1EA 1WY9A 1XVJA 1KFUS 2KYCA 3K1EA 3M0WA 1YVLA 4FQTA 4PE7A 1RK9A 3VRPA 5CSIA 1AVSA 1KWOC 2R2IA 1ZOTB 1MWNA 2CBLA 4MRYA 4D1EA 1CM4A 1SPYA 3I5FC 4P2YB 3DF0B 1LINA 3BUOB 4A4BA 1DJYA 5I8NA 1H8BA 2JULA 2M8UA 4HRGA 4AQJA 4ORAB 1ORGA 2K7DA 2ZRTA 4YGDB 1B1GA 3S0EA 3MSEB 2QPTA 5FI7A 1G8IA 2OPOA 2F2PA 5FI6A 3D73A 4MN0A 3R1OA 1NCZA 2LANA 3CR2A 1B8LA 1M45A 1QX7A 4XYNA 2JNXA 1L7ZA 2LVVA 3SJSA 3SIAA 1IRJA 4HRHA 2L5YA 3SG7A 1DMOA 1EL4A 3LK1A 4GFTA 3OP0A 1B9AA 1RFJA 1WDCB 2I2RE 4I5NB 4JPZB 1OOJA 1K93D 1QIWA 1NIWA 2SCPA 1OMDA 1KSOA 3BUNB 3JTDC 3S0GA 5KTYA 1NCXA 2JNFA 1DF0B 3GK2A 1ALWA 3WXAA 1S3PA 3SG3A 1SNLA 1CMFA 2KI4C 1SL9A 4CFRA 3OHMB 4OR9B 2NCPA 1CB1A 2KBIA 1KK7Z 1FW4A 2K8MB 1XYDA 1XFWO 2FCDA 1T14A 2BL0C 1TN4A 4OV2A 4DS7A 1NUBA 2QEBA 1Z4HA 1Y0VH 2LV7A 3OB2B 5DKRA 2HPSA 4I5LB 1A03A 1UP5A 2LP2A 1OOIX 1J7QA 5D69A 3R72A 2KAVA 3CABA 4NDDA 4M2PA 2KOTA 3PN7C 2KGRA 1DVIA 2OTGC 4PALA 1IIOA 1F4QA 1LA0A 3O4XA 2BCAA 2KFFA 4CIDA 1DTLA 5CSJA 1N0YA 3ZNIA 3E3RA 4XJKA 2E30A 1DC1A 4OVNF 2BKHB 2JT0A 2BE6A 3O4YA 1LVCD 3B7AA 3LK0A 3DVEA 1TTXA 1TOPA 2K61A 2PYQA 5EL2A 1SCVA 5D7FA 1JC2A 4QJ3B 1NYAA 1M39A 2KAYA 2KYFA 3BOWB 2TN4A 2F3YA 4JWQA 1QVIZ 4PHKA 3L4LA 2WCFA 5I94A 2ISDA 1F4OA 3EKHA 3SG4A 1M46A 1NSHA 1SL7A 3KF9A 4L9MA 1GM0A 1JSAA 4YRUA 3KHEA 1NCYA 2BE4A 2K2AA 3BQ3A 2COLB 2M29A 5DICA 1QWVA 3TDZA 2L2EA 2L2CA 1PVBA 1QXPA 3DVMA 1KK8B 2JTTA 2JXCA 3CGAA 1KFXS 1BJFA 1JF2A 2EC6B 1L2OB 4C0JA 4CFQA 3TZ1A 3V2LA 4WQ3A 1B7TY 3PALA 2WC6A 1MUXA 1UURA 2WCEA 3EK8A 3JVTC 1S5GZ 4ZCUA 1PSBA 1XK4A 3NHIA 1QLKA 2GV5A 1OQPA 3UNWA 3I5IB 1IG5A 2I7AA 3PJIA 1FPWA 4M2QA 2Y1NA 2PALA 4YI8A 1ZFSA 1FF1A 1K9KA 4AQIA 2BBNA 4CPVA 2JPOA 1AP4A 1N65A 1HQVA 1XFUO 4PHNA 1GGZA 4DUQA 3TUYC 2KQYA 1UUSA 2K2FA 3OGNA 4PE1A 5FYXA 1BOCA 1IJ5A 1CM1A 2H2KA 5J3XA 2JC2A 3O78A 1R2UA 3CTNA 1KWOB 1CDNA 1EG4A 2YGUA 3CR5X 3D74A 1CFFA 1YURA 1K2HA 2KBMA 2LMTA 1PK0D 3PFVA 1CFPA 1CFDA 1DJGA 1K90D 1W7JB 1XFXO 2LLUA 1MR8A 1NWDA 3I5FB 4WQ2A 4F0ZB 3RZSA 1XA5A 4PHMA 4GAOA 1Q80A 1F8HA 3S0DA 3SG5A 1PVAA 3UO9A 2KSPA 3O2PA 3S0BA 4ETOA 1JF0A 2MLEC 1Y1UA 3TS5C 1KCYA 3S0AA 1KFUL 2AUCA 3LCPC 1F71A 2WCHA 1P28A 2LLTA 1QJTA 2MAZA 1CTRA 4GBAA 1ODBA 1Z2CB 1DEKA 2CTNA 3GOFA 1TNPA 3BUXB 3ZWHA 1B4CA 2K0JA 2K7OA 1TWOA 2WCBA 1B8CA 3OX5A 3PSRA 1PSRA 2G9BA 3Q8IA 2ZKMX 1NP8A 1HT9A 1JUOA 3BFBA 1SMGA 2WCMA 1YRUB 3JTDB 2F33A 3PATA 2VRGA 3IQOA 3I5GC 1F70A 1K9PA 2CXJA 1OOFA 2Y1MA 4QJ4B 2H61C 1XFVO 3D75A 3DD4A 4JD9A 2KI4B 3BFHA 1C7WA 3DVKA 1KSMA 3QRXA 5I2OA 3L47A 3HX4A 1TCFA 1DT7B 5HLVA 5HL1A 1IKUA 4XJKB 2BL0B 2PRUA 3AKBA 3NHTA 3WNXB 1UHIA 2JWWA 1EJ3A 2WCKA 4N5XA 3NSKA 1IWQA 1CMGA 2JOJA 1C3YA 1QIVA 3NSOA 4JKTA 1U5IA 1OZSA 3CYZA 4BY4A 3FE8A 1LA3A 2H61A 4N1GA 4PCWA 5AANA 4HSZA 4GNKB 1AJ4A 1AHRA 2MHHA 4NDBA 2ZN9A 2O60A 2ZFDA 2MLFC 4GGFC 3NGVA 4ORBB 4ZCVA 1KQMB 5HKZA 3RM1A 1KQVA 5PALA 5JOLA 1S6IA 3IF7A 5B8IB 5ER4X 3PM8A 4USLA 1AK8A 1LKJA 1DJIA 3FE9A 4TNCA 2WC8A 2MJWB 4M2OA 5AFPA 2LCPA 2OS8C 3BUMB 1CNPA 1MXLC 1TRFA 3FE6A 5I2QA 3SG2A 2L5XB 2KFGA 4PT1A 3IVTA 2EHBA 2QACA 2JQ6A 3N7HA 1WDCC 4C0LA 4HREE 4OCIA 2WNDA 2KNEA 2IS9A 1J55A 3VB1A 2KPHA 1C3ZA 5AERA 2ZRSA 3IQQA 3R1PA 2WCJA 2M9GA 4IJ7A 1JFKA 4MLWA 3VRQA 1ZACA 1BODA 1YTZC 5DKQA 3D76A 5CPVA 1NX1A 3HCMA 4MZJA 1X02A 2LMVA 2PVBA 2CT9A 1K96A 1DJWA 1GGWA 2F8PA 3F45A 2KLEA 2L4IA 2NLNA 1NPQA 2EGDA 3R1VA 1QV1A 2FJUB 2PSRA 3BUWB 1SCMB 2JXLA 1RROA 3PLFB 4YGAA 3QMEA 1K95A 1CFCA 2H8VA 2WCLA 1A75A 3LL8B 1OE9B 2FOTA 1TIZA 4WRIA 1D1OA 5KU1A 2O5GA 2KI6D 1EXRA 2WORA 1RTP1 4N1FA 4A4CA 5AEQA 2QEOA 3CDNA 1SK6D 2ZNEA 2M49B 3KO0A 2K60A 1WRZA 2ERBA 3B86A 3AAJA 3VRNA 3CZ1A 4GPLB 2LP3A 2LVJA 1YR5A 2F3ZA 4F7FA 1B7TZ 3BJHA 5F6TA 4QJ5B 1NX2A 1S26D 1Y1AA 1LS8A 1UHNA 2HQWA 3I5HB 3NSIA 1OMRA 1YVHA 1RWYA 4KYNA 3CZ2A 4DIRA 1SR6B 1YRTB 1ALVA 1Y1XA 2P70A 1NX0A 2CCMA 5ER5A 3AAKA 2P6BB 2CNPA 3D78A 3KPXA 3OBVA 1JBAA 1QASA 2BKIB 5G08A 3DY9A 2SASA 1IQ3A 1DELA 2M7NA 1KK8C 1DGVA 4NDCA 1F54A 1SKTA 1SY9A 2ZNDA 1YUTA 2EC6C 1L2OC 2A4JA 2JPTA 2P71A 4C0KA 2QEHA 3D77A 4MSPA 4DCKA 2JT8A 1A4PA 3O6BA 1CDLA 1H4BA 3I5IC 1CKKA 2M3WA 1G33A 1OSAA 3A4UB 1CLMA 4YGEB 3S0FA 3CR4X 2M1UA 5TNCA 5IBWA 1Y6WA 2BCBA 3FS7A 1C07A 1WRLA 4AOMA 1XFYO 1A29A 3VROA 1BR4B 1CDPA 1E8AA 2MA2A 4FQOA 4MBEA 4PE4A 2MRDA 1M63B 4IL1A 2Y5IA 1RJVA 1S36A 1GJYA 1N2DA 1OZOA 5KSZA 4NQGA 1PULA 5CSNA 2B1UA 2KFHA 3WHTB 1FBVA 3EK7A 2Q4UA 3EK4A 5HKWA 1QS7A 1IJ6A 1WLMA 2PASA 2Y4QA 3NXAA 4INXA 5HYDA 1FI5A 2D8NA 1BMOA 3D0YA 2F2OA 1SW8A 2M7LA 5AXIA 3SG6A 2NXQA 3VGOA 2PMYA 1F55A 3VRRA 1R6PA 3BYAA 2GTEA 3B6XA 1CLLA 2NCOA 3OX6A 2OTGB 3PN7B 4MZLA 5FI2A 4YBHB 1PALA 2OS8B 1JWDA 1PRWA 2L0PA 1ZMZA 3DZTA 1ZUZA 1CLBA 1M31A 2I94A 3CZTX 2GGZA 3D10A 1KK7Y 1UHHA 2V53A 5BPJA 3L4AA 2E6WA 2KHNA 1MXEA 1OW4A 1UHKA 1DGUA 1TNWA 1A75B 1DJHA 2KDHA 2MBXA 2AAOA 1BR1B 2JT3A 3A8RA 4U8DA 3DF0A 3FIAA 4E68A 4GUKA 2ZN8A 2L51A 4GGFA 1SL8A 1DJXA 4MVFA 2HQ8A 1IGVA 2PQLA 3CLNA 3DXLA 4R1EA 3GK1A 1MF8B 2BBMA 2LC5A 2LHIA 1SSEB 1XFZO 1K94A 3K21A 1UHJA 2GGMA 3LLEA 4ORCB 1DQEA 1OOHA 3RLZA 1TUZA 1V1GA 4INWA 1BLQA 1BU3A 3B87A 5HKYA 4PE0A 1W9ZA 2KGBC 2M0RA 3JVTB 5DKNA 2LUCA 3GK4X 1KQMC 1EG3A 4FTGA 1QVIY 1MQ1A 3TDUA 2WC5A 4P5OE 1XFRA 1SRAA 1B47A 2DOQA 1DF0A 1J7PA 2LE9B 2HF5A 1K9UA
chains in the Genus database with same CATH topology
2KAXA 2AMIA 1KFXL 3BXKA 1OMVA 3DVJA 3H4SE 4YGBB 1YX8A 1MHOA 4GGNA 5GQQC 1V1FA 2LLSA 3WHUB 2BECA 3TUYB 4MZKA 2K7CA 4UPGA 1QX2A 1XK4C 2KI6C 2LUXA 1J1DA 2JU0A 1BF5A 3ICBA 1A2XA 1RECA 1TCOB 2L4HA 1QLSA 1S5GY 4DRWA 1TNXA 2JRFA 1S6JA 4BY5A 1BG1A 1IH0A 1UWOA 3FWCA 1K8UA 4OKHA 2RGIA 4YGCB 3SIBA 2JZIA 1XO5A 4MEWA 2K7BA 3OB1B 1G4YR 3EVRA 2NZ0A 1QTXA 1TNQA 3TS5B 2Q91A 1JFJA 2L98A 3EVUA 1LXFC 1WLZA 1YX7A 2KQ6A 1SCMC 4PDZA 4Q04A 4JQ0D 2LVIA 2M1KB 4I5JA 1DJZA 3FWBA 4MRXA 2LAPA 1C7VA 1YUSA 1AJ5A 1F70A 2G2BA 2JTZA 1S6CA 4CLNA 3BOWA 2M97A 3C1VA 4YI9A 1IQ5A 5CSFA 3TDIA 1EH2A 1QV0A 2L50A 3D0YB 4PHJA 5HLOA 2LHLA 1QATA 5JJGA 2LM5A 1S1EA 3I5GB 1U5IB 4I5KA 3CWGA 4ICBA 3NSLA 2LVKA 1CDMA 3AKAA 1FI6A 3EVVA 1J7RA 2LNKA 1SBJA 2HETA 1YUUA 1GQMA 2I18A 3I5HC 1B8RA 1VRKA 2WOSA 2LMUA 2BCXA 1SYMA 1QX5B 2FCEA 3EKJA 5I2LA 1SR6C 5K89A 3KEVA 1WRKA 3CS1A 1NX3A 1AUIB 1BT6A 1W7IB 1J7OA 1J1EA 1WY9A 1XVJA 1KFUS 2KYCA 3M0WA 4QJ3B 1YVLA 4PE7A 3VRPA 1RK9A 5CSIA 1AVSA 1KWOC 2R2IA 1ZOTB 1MWNA 2CBLA 4MRYA 4D1EA 1CM4A 1SPYA 3I5FC 4P2YB 3DF0B 1LINA 3BUOB 4A4BA 1DJYA 5I8NA 1H8BA 2JULA 2M8UA 4HRGA 4AQJA 4ORAB 2K7DA 2ZRTA 4YGDB 1B1GA 3MSEB 2QPTA 1G8IA 2OPOA 2F2PA 4MN0A 1NCZA 2LANA 3CR2A 1B8LA 1M45A 1QX7A 4XYNA 2JNXA 1L7ZA 2LVVA 3SJSA 3SIAA 1IRJA 4HRHA 3SG7A 1DMOA 1EL4A 3LK1A 4GFTA 3OP0A 1B9AA 1RFJA 1WDCB 2I2RE 4I5NB 4JPZB 1OOJA 1K93D 1QIWA 1NIWA 2SCPA 1OMDA 1KSOA 3BUNB 3JTDC 5KTYA 1NCXA 2JNFA 1DF0B 3GK2A 1ALWA 3WXAA 1S3PA 3SG3A 1SNLA 1CMFA 2KI4C 1SL9A 4CFRA 3OHMB 4OR9B 2NCPA 1CB1A 2KBIA 1KK7Z 1FW4A 2K8MB 1XYDA 1XFWO 2FCDA 2BL0C 1TN4A 4OV2A 4DS7A 1NUBA 3OB2B 5DKRA 1Y0VH 2LV7A 2HPSA 4I5LB 1A03A 1UP5A 2LP2A 1J7QA 5D69A 4NDDA 2KAVA 4M2PA 2KOTA 3PN7C 2KGRA 1DVIA 2OTGC 4PALA 1F4QA 1LA0A 2BCAA 2KFFA 4CIDA 1DTLA 5CSJA 1N0YA 3ZNIA 3E3RA 4XJKA 2E30A 4OVNF 2BKHB 2JT0A 2BE6A 3O4YA 1LVCD 3LK0A 3DVEA 1TTXA 1TOPA 2K61A 1SCVA 5D7FA 1JC2A 1NYAA 1M39A 2KAYA 2KYFA 3BOWB 2TN4A 2F3YA 4JWQA 1QVIZ 4PHKA 2WCFA 2ISDA 1F4OA 3EKHA 3SG4A 1M46A 1NSHA 1SL7A 3KF9A 4L9MA 1JSAA 4YRUA 3KHEA 1NCYA 2BE4A 2K2AA 3BQ3A 2COLB 2M29A 3TDZA 2L2EA 1PVBA 1QXPA 3DVMA 1KK8B 2JTTA 2JXCA 3CGAA 1KFXS 1BJFA 1JF2A 2EC6B 1L2OB 4C0JA 4CFQA 3TZ1A 4WQ3A 1B7TY 3PALA 1MUXA 1UURA 2WCEA 3EK8A 3JVTC 1S5GZ 4ZCUA 1PSBA 1XK4A 1QLKA 2GV5A 1OQPA 3I5IB 1IG5A 2I7AA 1FPWA 4M2QA 2Y1NA 2PALA 4YI8A 1ZFSA 1FF1A 1K9KA 4AQIA 2BBNA 4CPVA 1AP4A 1N65A 1HQVA 1XFUO 4PHNA 1GGZA 4DUQA 3TUYC 2KQYA 1UUSA 2K2FA 4PE1A 5FYXA 1BOCA 1IJ5A 1CM1A 2H2KA 5J3XA 2JC2A 3O78A 1R2UA 3CTNA 1KWOB 1CDNA 1EG4A 3CR5X 1CFFA 1YURA 1K2HA 2KBMA 2LMTA 1PK0D 3PFVA 1CFPA 1CFDA 1DJGA 1K90D 1W7JB 1XFXO 2LLUA 1MR8A 1NWDA 3I5FB 4WQ2A 4F0ZB 1F8HA 1XA5A 4PHMA 4GAOA 1Q80A 3SG5A 1PVAA 4ETOA 2KSPA 3O2PA 1JF0A 2MLEC 1Y1UA 3TS5C 1KCYA 1KFUL 2AUCA 3LCPC 1F71A 2LLTA 1QJTA 2MAZA 1CTRA 4GBAA 1ODBA 2CTNA 3GOFA 1TNPA 3BUXB 3ZWHA 1B4CA 2K0JA 2K7OA 2WCBA 1B8CA 3OX5A 3PSRA 1PSRA 2G9BA 2ZKMX 1NP8A 1HT9A 1JUOA 1SMGA 1YRUB 3JTDB 2F33A 3PATA 2VRGA 3IQOA 3I5GC 1K9PA 2CXJA 2Y1MA 4QJ4B 2H61C 1XFVO 3DD4A 2KI4B 1C7WA 3DVKA 1KSMA 3QRXA 5I2OA 3HX4A 1TCFA 1DT7B 5HLVA 1IKUA 4XJKB 2BL0B 2PRUA 3AKBA 3WNXB 1UHIA 2JWWA 1EJ3A 4N5XA 3NSKA 1IWQA 1CMGA 2JOJA 1QIVA 3NSOA 1U5IA 1OZSA 4BY4A 4N1GA 1LA3A 2H61A 4PCWA 5AANA 4HSZA 4GNKB 1AJ4A 1AHRA 2MHHA 4NDBA 2ZN9A 2O60A 2ZFDA 2MLFC 4GGFC 4ORBB 4ZCVA 5HKZA 1KQMB 3RM1A 1KQVA 5PALA 5JOLA 1S6IA 3IF7A 5B8IB 5ER4X 3PM8A 4USLA 1AK8A 1LKJA 1DJIA 4TNCA 2WC8A 2MJWB 4M2OA 5AFPA 2LCPA 2OS8C 3BUMB 1CNPA 1MXLC 1TRFA 5I2QA 3SG2A 2L5XB 2KFGA 2EHBA 2QACA 2JQ6A 1WDCC 4C0LA 4HREE 4OCIA 2WNDA 2KNEA 2IS9A 1J55A 5AERA 2ZRSA 3IQQA 2M9GA 3VRQA 1JFKA 4MLWA 1BODA 1ZACA 1YTZC 5DKQA 5CPVA 1NX1A 3HCMA 4MZJA 1X02A 2LMVA 2PVBA 2CT9A 1K96A 1DJWA 1GGWA 2F8PA 3F45A 2L4IA 2NLNA 1NPQA 2EGDA 1QV1A 2FJUB 2PSRA 3BUWB 1SCMB 2JXLA 1RROA 3PLFB 4YGAA 1CFCA 1K95A 1A75A 3LL8B 1OE9B 2FOTA 1TIZA 4WRIA 1D1OA 5KU1A 2O5GA 2KI6D 1EXRA 2WORA 1RTP1 4N1FA 4A4CA 5AEQA 1SK6D 2ZNEA 2M49B 3KO0A 1WRZA 3AAJA 3VRNA 4GPLB 2LP3A 2LVJA 1YR5A 2F3ZA 1B7TZ 5F6TA 4QJ5B 1NX2A 1S26D 1Y1AA 1UHNA 2HQWA 3I5HB 3NSIA 1OMRA 1YVHA 1RWYA 4DIRA 1SR6B 1YRTB 1ALVA 1Y1XA 1NX0A 2CCMA 5ER5A 3AAKA 2P6BB 2CNPA 3KPXA 1JBAA 1QASA 2BKIB 5G08A 2SASA 1IQ3A 2M7NA 1KK8C 1DGVA 4NDCA 1F54A 1SKTA 1SY9A 2ZNDA 1YUTA 2EC6C 1L2OC 2A4JA 2JPTA 4C0KA 4MSPA 4DCKA 2JT8A 1A4PA 3O6BA 1CDLA 1H4BA 3I5IC 1CKKA 2M3WA 1G33A 1OSAA 3A4UB 1CLMA 4YGEB 3CR4X 2M1UA 5TNCA 5IBWA 1Y6WA 2BCBA 3FS7A 1C07A 1WRLA 4AOMA 1XFYO 1A29A 3VROA 1BR4B 1CDPA 1E8AA 2MA2A 4FQOA 4MBEA 4PE4A 2MRDA 1M63B 4IL1A 2Y5IA 1RJVA 1S36A 1GJYA 1N2DA 1OZOA 5KSZA 4NQGA 1PULA 5CSNA 2B1UA 2KFHA 3WHTB 1FBVA 3EK7A 2Q4UA 3EK4A 5HKWA 1QS7A 1IJ6A 1WLMA 2PASA 2Y4QA 3NXAA 5HYDA 1FI5A 2D8NA 1BMOA 3D0YA 2F2OA 1SW8A 2M7LA 5AXIA 3SG6A 2NXQA 3VGOA 2PMYA 1F55A 3VRRA 1R6PA 3BYAA 1CLLA 2NCOA 3OX6A 2OTGB 3PN7B 4MZLA 4YBHB 1PALA 2OS8B 1JWDA 1PRWA 2L0PA 1ZMZA 1ZUZA 1CLBA 1M31A 2I94A 3CZTX 2GGZA 3D10A 1KK7Y 1UHHA 2V53A 5BPJA 2E6WA 2KHNA 1MXEA 1UHKA 1DGUA 1TNWA 1A75B 1DJHA 2KDHA 2MBXA 2AAOA 1BR1B 2JT3A 3A8RA 4U8DA 3DF0A 3FIAA 4E68A 4GUKA 2ZN8A 2L51A 4GGFA 1SL8A 1DJXA 4MVFA 2HQ8A 1IGVA 3CLNA 4R1EA 3GK1A 1MF8B 2BBMA 2LC5A 2LHIA 1XFZO 3K21A 1K94A 3LLEA 1UHJA 2GGMA 4ORCB 3RLZA 1V1GA 1BLQA 1BU3A 5HKYA 4PE0A 5DKNA 2KGBC 2M0RA 3JVTB 2LUCA 3GK4X 1KQMC 1EG3A 4FTGA 1QVIY 1MQ1A 3TDUA 4P5OE 1SRAA 1B47A 2DOQA 1DF0A 1J7PA 2LE9B 2HF5A 1K9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KAX A;  2AMI A;  1KFX L;  3BXK A;  1OMV A;  3DVJ A;  3H4S E;  4YGB B;  1YX8 A;  1MHO A;  4GGN A;  5GQQ C;  1V1F A;  2LLS A;  3WHU B;  2BEC A;  3TUY B;  4MZK A;  2K7C A;  4UPG A;  1QX2 A;  1XK4 C;  2KI6 C;  2LUX A;  1J1D A;  2JU0 A;  1BF5 A;  3ICB A;  1A2X A;  1REC A;  1TCO B;  2L4H A;  1QLS A;  1S5G Y;  4DRW A;  1TNX A;  2JRF A;  1S6J A;  4BY5 A;  1BG1 A;  1IH0 A;  1UWO A;  3FWC A;  1K8U A;  4OKH A;  2RGI A;  4YGC B;  3SIB A;  2JZI A;  1XO5 A;  4MEW A;  2K7B A;  3OB1 B;  1G4Y R;  3EVR A;  2NZ0 A;  1QTX A;  1TNQ A;  3TS5 B;  2Q91 A;  1JFJ A;  2L98 A;  3EVU A;  1LXF C;  1WLZ A;  1YX7 A;  2KQ6 A;  1SCM C;  4PDZ A;  4Q04 A;  4JQ0 D;  2LVI A;  2M1K B;  4I5J A;  1DJZ A;  3FWB A;  4MRX A;  2LAP A;  1C7V A;  1YUS A;  1AJ5 A;  1F70 A;  2G2B A;  2JTZ A;  1S6C A;  4CLN A;  3BOW A;  2M97 A;  3C1V A;  4YI9 A;  1IQ5 A;  5CSF A;  3TDI A;  1EH2 A;  1QV0 A;  2L50 A;  3D0Y B;  4PHJ A;  5HLO A;  2LHL A;  1QAT A;  5JJG A;  2LM5 A;  1S1E A;  3I5G B;  1U5I B;  4I5K A;  3CWG A;  4ICB A;  3NSL A;  2LVK A;  1CDM A;  3AKA A;  1FI6 A;  3EVV A;  1J7R A;  2LNK A;  1SBJ A;  2HET A;  1YUU A;  1GQM A;  2I18 A;  3I5H C;  1B8R A;  1VRK A;  2WOS A;  2LMU A;  2BCX A;  1SYM A;  1QX5 B;  2FCE A;  3EKJ A;  5I2L A;  1SR6 C;  5K89 A;  3KEV A;  1WRK A;  3CS1 A;  1NX3 A;  1AUI B;  1BT6 A;  1W7I B;  1J7O A;  1J1E A;  1WY9 A;  1XVJ A;  1KFU S;  2KYC A;  3M0W A;  4QJ3 B;  1YVL A;  4PE7 A;  3VRP A;  1RK9 A;  5CSI A;  1AVS A;  1KWO C;  2R2I A;  1ZOT B;  1MWN A;  2CBL A;  4MRY A;  4D1E A;  1CM4 A;  1SPY A;  3I5F C;  4P2Y B;  3DF0 B;  1LIN A;  3BUO B;  4A4B A;  1DJY A;  5I8N A;  1H8B A;  2JUL A;  2M8U A;  4HRG A;  4AQJ A;  4ORA B;  2K7D A;  2ZRT A;  4YGD B;  1B1G A;  3MSE B;  2QPT A;  1G8I A;  2OPO A;  2F2P A;  4MN0 A;  1NCZ A;  2LAN A;  3CR2 A;  1B8L A;  1M45 A;  1QX7 A;  4XYN A;  2JNX A;  1L7Z A;  2LVV A;  3SJS A;  3SIA A;  1IRJ A;  4HRH A;  3SG7 A;  1DMO A;  1EL4 A;  3LK1 A;  4GFT A;  3OP0 A;  1B9A A;  1RFJ A;  1WDC B;  2I2R E;  4I5N B;  4JPZ B;  1OOJ A;  1K93 D;  1QIW A;  1NIW A;  2SCP A;  1OMD A;  1KSO A;  3BUN B;  3JTD C;  5KTY A;  1NCX A;  2JNF A;  1DF0 B;  3GK2 A;  1ALW A;  3WXA A;  1S3P A;  3SG3 A;  1SNL A;  1CMF A;  2KI4 C;  1SL9 A;  4CFR A;  3OHM B;  4OR9 B;  2NCP A;  1CB1 A;  2KBI A;  1KK7 Z;  1FW4 A;  2K8M B;  1XYD A;  1XFW O;  2FCD A;  2BL0 C;  1TN4 A;  4OV2 A;  4DS7 A;  1NUB A;  3OB2 B;  5DKR A;  1Y0V H;  2LV7 A;  2HPS A;  4I5L B;  1A03 A;  1UP5 A;  2LP2 A;  1J7Q A;  5D69 A;  4NDD A;  2KAV A;  4M2P A;  2KOT A;  3PN7 C;  2KGR A;  1DVI A;  2OTG C;  4PAL A;  1F4Q A;  1LA0 A;  2BCA A;  2KFF A;  4CID A;  1DTL A;  5CSJ A;  1N0Y A;  3ZNI A;  3E3R A;  4XJK A;  2E30 A;  4OVN F;  2BKH B;  2JT0 A;  2BE6 A;  3O4Y A;  1LVC D;  3LK0 A;  3DVE A;  1TTX A;  1TOP A;  2K61 A;  1SCV A;  5D7F A;  1JC2 A;  1NYA A;  1M39 A;  2KAY A;  2KYF A;  3BOW B;  2TN4 A;  2F3Y A;  4JWQ A;  1QVI Z;  4PHK A;  2WCF A;  2ISD A;  1F4O A;  3EKH A;  3SG4 A;  1M46 A;  1NSH A;  1SL7 A;  3KF9 A;  4L9M A;  1JSA A;  4YRU A;  3KHE A;  1NCY A;  2BE4 A;  2K2A A;  3BQ3 A;  2COL B;  2M29 A;  3TDZ A;  2L2E A;  1PVB A;  1QXP A;  3DVM A;  1KK8 B;  2JTT A;  2JXC A;  3CGA A;  1KFX S;  1BJF A;  1JF2 A;  2EC6 B;  1L2O B;  4C0J A;  4CFQ A;  3TZ1 A;  4WQ3 A;  1B7T Y;  3PAL A;  1MUX A;  1UUR A;  2WCE A;  3EK8 A;  3JVT C;  1S5G Z;  4ZCU A;  1PSB A;  1XK4 A;  1QLK A;  2GV5 A;  1OQP A;  3I5I B;  1IG5 A;  2I7A A;  1FPW A;  4M2Q A;  2Y1N A;  2PAL A;  4YI8 A;  1ZFS A;  1FF1 A;  1K9K A;  4AQI A;  2BBN A;  4CPV A;  1AP4 A;  1N65 A;  1HQV A;  1XFU O;  4PHN A;  1GGZ A;  4DUQ A;  3TUY C;  2KQY A;  1UUS A;  2K2F A;  4PE1 A;  5FYX A;  1BOC A;  1IJ5 A;  1CM1 A;  2H2K A;  5J3X A;  2JC2 A;  3O78 A;  1R2U A;  3CTN A;  1KWO B;  1CDN A;  1EG4 A;  3CR5 X;  1CFF A;  1YUR A;  1K2H A;  2KBM A;  2LMT A;  1PK0 D;  3PFV A;  1CFP A;  1CFD A;  1DJG A;  1K90 D;  1W7J B;  1XFX O;  2LLU A;  1MR8 A;  1NWD A;  3I5F B;  4WQ2 A;  4F0Z B;  1F8H A;  1XA5 A;  4PHM A;  4GAO A;  1Q80 A;  3SG5 A;  1PVA A;  4ETO A;  2KSP A;  3O2P A;  1JF0 A;  2MLE C;  1Y1U A;  3TS5 C;  1KCY A;  1KFU L;  2AUC A;  3LCP C;  1F71 A;  2LLT A;  1QJT A;  2MAZ A;  1CTR A;  4GBA A;  1ODB A;  2CTN A;  3GOF A;  1TNP A;  3BUX B;  3ZWH A;  1B4C A;  2K0J A;  2K7O A;  2WCB A;  1B8C A;  3OX5 A;  3PSR A;  1PSR A;  2G9B A;  2ZKM X;  1NP8 A;  1HT9 A;  1JUO A;  1SMG A;  1YRU B;  3JTD B;  2F33 A;  3PAT A;  2VRG A;  3IQO A;  3I5G C;  1K9P A;  2CXJ A;  2Y1M A;  4QJ4 B;  2H61 C;  1XFV O;  3DD4 A;  2KI4 B;  1C7W A;  3DVK A;  1KSM A;  3QRX A;  5I2O A;  3HX4 A;  1TCF A;  1DT7 B;  5HLV A;  1IKU A;  4XJK B;  2BL0 B;  2PRU A;  3AKB A;  3WNX B;  1UHI A;  2JWW A;  1EJ3 A;  4N5X A;  3NSK A;  1IWQ A;  1CMG A;  2JOJ A;  1QIV A;  3NSO A;  1U5I A;  1OZS A;  4BY4 A;  4N1G A;  1LA3 A;  2H61 A;  4PCW A;  5AAN A;  4HSZ A;  4GNK B;  1AJ4 A;  1AHR A;  2MHH A;  4NDB A;  2ZN9 A;  2O60 A;  2ZFD A;  2MLF C;  4GGF C;  4ORB B;  4ZCV A;  5HKZ A;  1KQM B;  3RM1 A;  1KQV A;  5PAL A;  5JOL A;  1S6I A;  3IF7 A;  5B8I B;  5ER4 X;  3PM8 A;  4USL A;  1AK8 A;  1LKJ A;  1DJI A;  4TNC A;  2WC8 A;  2MJW B;  4M2O A;  5AFP A;  2LCP A;  2OS8 C;  3BUM B;  1CNP A;  1MXL C;  1TRF A;  5I2Q A;  3SG2 A;  2L5X B;  2KFG A;  2EHB A;  2QAC A;  2JQ6 A;  1WDC C;  4C0L A;  4HRE E;  4OCI A;  2WND A;  2KNE A;  2IS9 A;  1J55 A;  5AER A;  2ZRS A;  3IQQ A;  2M9G A;  3VRQ A;  1JFK A;  4MLW A;  1BOD A;  1ZAC A;  1YTZ C;  5DKQ A;  5CPV A;  1NX1 A;  3HCM A;  4MZJ A;  1X02 A;  2LMV A;  2PVB A;  2CT9 A;  1K96 A;  1DJW A;  1GGW A;  2F8P A;  3F45 A;  2L4I A;  2NLN A;  1NPQ A;  2EGD A;  1QV1 A;  2FJU B;  2PSR A;  3BUW B;  1SCM B;  2JXL A;  1RRO A;  3PLF B;  4YGA A;  1CFC A;  1K95 A;  1A75 A;  3LL8 B;  1OE9 B;  2FOT A;  1TIZ A;  4WRI A;  1D1O A;  5KU1 A;  2O5G A;  2KI6 D;  1EXR A;  2WOR A;  1RTP 1;  4N1F A;  4A4C A;  5AEQ A;  1SK6 D;  2ZNE A;  2M49 B;  3KO0 A;  1WRZ A;  3AAJ A;  3VRN A;  4GPL B;  2LP3 A;  2LVJ A;  1YR5 A;  2F3Z A;  1B7T Z;  5F6T A;  4QJ5 B;  1NX2 A;  1S26 D;  1Y1A A;  1UHN A;  2HQW A;  3I5H B;  3NSI A;  1OMR A;  1YVH A;  1RWY A;  4DIR A;  1SR6 B;  1YRT B;  1ALV A;  1Y1X A;  1NX0 A;  2CCM A;  5ER5 A;  3AAK A;  2P6B B;  2CNP A;  3KPX A;  1JBA A;  1QAS A;  2BKI B;  5G08 A;  2SAS A;  1IQ3 A;  2M7N A;  1KK8 C;  1DGV A;  4NDC A;  1F54 A;  1SKT A;  1SY9 A;  2ZND A;  1YUT A;  2EC6 C;  1L2O C;  2A4J A;  2JPT A;  4C0K A;  4MSP A;  4DCK A;  2JT8 A;  1A4P A;  3O6B A;  1CDL A;  1H4B A;  3I5I C;  1CKK A;  2M3W A;  1G33 A;  1OSA A;  3A4U B;  1CLM A;  4YGE B;  3CR4 X;  2M1U A;  5TNC A;  5IBW A;  1Y6W A;  2BCB A;  3FS7 A;  1C07 A;  1WRL A;  4AOM A;  1XFY O;  1A29 A;  3VRO A;  1BR4 B;  1CDP A;  1E8A A;  2MA2 A;  4FQO A;  4MBE A;  4PE4 A;  2MRD A;  1M63 B;  4IL1 A;  2Y5I A;  1RJV A;  1S36 A;  1GJY A;  1N2D A;  1OZO A;  5KSZ A;  4NQG A;  1PUL A;  5CSN A;  2B1U A;  2KFH A;  3WHT B;  1FBV A;  3EK7 A;  2Q4U A;  3EK4 A;  5HKW A;  1QS7 A;  1IJ6 A;  1WLM A;  2PAS A;  2Y4Q A;  3NXA A;  5HYD A;  1FI5 A;  2D8N A;  1BMO A;  3D0Y A;  2F2O A;  1SW8 A;  2M7L A;  5AXI A;  3SG6 A;  2NXQ A;  3VGO A;  2PMY A;  1F55 A;  3VRR A;  1R6P A;  3BYA A;  1CLL A;  2NCO A;  3OX6 A;  2OTG B;  3PN7 B;  4MZL A;  4YBH B;  1PAL A;  2OS8 B;  1JWD A;  1PRW A;  2L0P A;  1ZMZ A;  1ZUZ A;  1CLB A;  1M31 A;  2I94 A;  3CZT X;  2GGZ A;  3D10 A;  1KK7 Y;  1UHH A;  2V53 A;  5BPJ A;  2E6W A;  2KHN A;  1MXE A;  1UHK A;  1DGU A;  1TNW A;  1A75 B;  1DJH A;  2KDH A;  2MBX A;  2AAO A;  1BR1 B;  2JT3 A;  3A8R A;  4U8D A;  3DF0 A;  3FIA A;  4E68 A;  4GUK A;  2ZN8 A;  2L51 A;  4GGF A;  1SL8 A;  1DJX A;  4MVF A;  2HQ8 A;  1IGV A;  3CLN A;  4R1E A;  3GK1 A;  1MF8 B;  2BBM A;  2LC5 A;  2LHI A;  1XFZ O;  3K21 A;  1K94 A;  3LLE A;  1UHJ A;  2GGM A;  4ORC B;  3RLZ A;  1V1G A;  1BLQ A;  1BU3 A;  5HKY A;  4PE0 A;  5DKN A;  2KGB C;  2M0R A;  3JVT B;  2LUC A;  3GK4 X;  1KQM C;  1EG3 A;  4FTG A;  1QVI Y;  1MQ1 A;  3TDU A;  4P5O E;  1SRA A;  1B47 A;  2DOQ A;  1DF0 A;  1J7P A;  2LE9 B;  2HF5 A;  1K9U A; 
#chains in the Genus database with same CATH topology
 2KAX A;  2AMI A;  1KFX L;  3BXK A;  1OMV A;  3DVJ A;  3H4S E;  4YGB B;  1YX8 A;  1MHO A;  4GGN A;  5GQQ C;  1V1F A;  2LLS A;  3WHU B;  2BEC A;  3TUY B;  4MZK A;  2K7C A;  4UPG A;  1QX2 A;  1XK4 C;  2KI6 C;  2LUX A;  1J1D A;  2JU0 A;  1BF5 A;  3ICB A;  1A2X A;  1REC A;  1TCO B;  2L4H A;  1QLS A;  1S5G Y;  3BFA A;  1TNX A;  2JRF A;  1S6J A;  2QDI A;  4BY5 A;  4DRW A;  1BG1 A;  1UWO A;  1IH0 A;  3FWC A;  2BAP A;  1K8U A;  3B88 A;  2RGI A;  4OKH A;  4YGC B;  3SIB A;  2JZI A;  1XO5 A;  4MEW A;  4OZD A;  2K7B A;  3OB1 B;  1G4Y R;  3EVR A;  2NZ0 A;  1QTX A;  1TNQ A;  3TS5 B;  2Q91 A;  1JFJ A;  2FJY A;  2L98 A;  3CZ0 A;  3EVU A;  1LXF C;  1WLZ A;  1YX7 A;  2KQ6 A;  1SCM C;  4PDZ A;  4Q04 A;  4JQ0 D;  3SS4 A;  2LVI A;  2M1K B;  4I5J A;  1DJZ A;  3FWB A;  4MRX A;  2LAP A;  3PM2 A;  1YUS A;  1AJ5 A;  1C7V A;  2G2B A;  2JTZ A;  1S6C A;  5D3O A;  4CLN A;  3BOW A;  2M97 A;  3C1V A;  4YI9 A;  1IQ5 A;  3SS3 A;  5CSF A;  3TDI A;  1EH2 A;  1QV0 A;  3EG5 B;  2L50 A;  3D0Y B;  1OOG A;  1TUJ A;  4PHJ A;  5HLO A;  2LHL A;  1QAT A;  5JJG A;  2QEV A;  2LM5 A;  3DYE A;  1S1E A;  3I5G B;  1U5I B;  4I5K A;  3CWG A;  4ICB A;  3NSL A;  2LVK A;  1CDM A;  3AKA A;  1FI6 A;  3EVV A;  1J7R A;  2LNK A;  1SBJ A;  2HET A;  1YUU A;  1GQM A;  2I18 A;  2KLD A;  3I5H C;  1B8R A;  1VRK A;  2WOS A;  2LMU A;  2BCX A;  1SYM A;  1QX5 B;  2FCE A;  3EKJ A;  5I2L A;  1SR6 C;  3SS5 A;  3KEV A;  1WRK A;  3CS1 A;  1NX3 A;  5K89 A;  1AUI B;  1BT6 A;  2BNX A;  1W7I B;  1J7O A;  1J1E A;  1WY9 A;  1XVJ A;  1KFU S;  2KYC A;  3K1E A;  3M0W A;  1YVL A;  4FQT A;  4PE7 A;  1RK9 A;  3VRP A;  5CSI A;  1AVS A;  1KWO C;  2R2I A;  1ZOT B;  1MWN A;  2CBL A;  4MRY A;  4D1E A;  1CM4 A;  1SPY A;  3I5F C;  4P2Y B;  3DF0 B;  1LIN A;  3BUO B;  4A4B A;  1DJY A;  5I8N A;  1H8B A;  2JUL A;  2M8U A;  4HRG A;  4AQJ A;  4ORA B;  1ORG A;  2K7D A;  2ZRT A;  4YGD B;  1B1G A;  3S0E A;  3MSE B;  2QPT A;  5FI7 A;  1G8I A;  2OPO A;  2F2P A;  5FI6 A;  3D73 A;  4MN0 A;  3R1O A;  1NCZ A;  2LAN A;  3CR2 A;  1B8L A;  1M45 A;  1QX7 A;  4XYN A;  2JNX A;  1L7Z A;  2LVV A;  3SJS A;  3SIA A;  1IRJ A;  4HRH A;  2L5Y A;  3SG7 A;  1DMO A;  1EL4 A;  3LK1 A;  4GFT A;  3OP0 A;  1B9A A;  1RFJ A;  1WDC B;  2I2R E;  4I5N B;  4JPZ B;  1OOJ A;  1K93 D;  1QIW A;  1NIW A;  2SCP A;  1OMD A;  1KSO A;  3BUN B;  3JTD C;  3S0G A;  5KTY A;  1NCX A;  2JNF A;  1DF0 B;  3GK2 A;  1ALW A;  3WXA A;  1S3P A;  3SG3 A;  1SNL A;  1CMF A;  2KI4 C;  1SL9 A;  4CFR A;  3OHM B;  4OR9 B;  2NCP A;  1CB1 A;  2KBI A;  1KK7 Z;  1FW4 A;  2K8M B;  1XYD A;  1XFW O;  2FCD A;  1T14 A;  2BL0 C;  1TN4 A;  4OV2 A;  4DS7 A;  1NUB A;  2QEB A;  1Z4H A;  1Y0V H;  2LV7 A;  3OB2 B;  5DKR A;  2HPS A;  4I5L B;  1A03 A;  1UP5 A;  2LP2 A;  1OOI X;  1J7Q A;  5D69 A;  3R72 A;  2KAV A;  3CAB A;  4NDD A;  4M2P A;  2KOT A;  3PN7 C;  2KGR A;  1DVI A;  2OTG C;  4PAL A;  1IIO A;  1F4Q A;  1LA0 A;  3O4X A;  2BCA A;  2KFF A;  4CID A;  1DTL A;  5CSJ A;  1N0Y A;  3ZNI A;  3E3R A;  4XJK A;  2E30 A;  1DC1 A;  4OVN F;  2BKH B;  2JT0 A;  2BE6 A;  3O4Y A;  1LVC D;  3B7A A;  3LK0 A;  3DVE A;  1TTX A;  1TOP A;  2K61 A;  2PYQ A;  5EL2 A;  1SCV A;  5D7F A;  1JC2 A;  4QJ3 B;  1NYA A;  1M39 A;  2KAY A;  2KYF A;  3BOW B;  2TN4 A;  2F3Y A;  4JWQ A;  1QVI Z;  4PHK A;  3L4L A;  2WCF A;  5I94 A;  2ISD A;  1F4O A;  3EKH A;  3SG4 A;  1M46 A;  1NSH A;  1SL7 A;  3KF9 A;  4L9M A;  1GM0 A;  1JSA A;  4YRU A;  3KHE A;  1NCY A;  2BE4 A;  2K2A A;  3BQ3 A;  2COL B;  2M29 A;  5DIC A;  1QWV A;  3TDZ A;  2L2E A;  2L2C A;  1PVB A;  1QXP A;  3DVM A;  1KK8 B;  2JTT A;  2JXC A;  3CGA A;  1KFX S;  1BJF A;  1JF2 A;  2EC6 B;  1L2O B;  4C0J A;  4CFQ A;  3TZ1 A;  3V2L A;  4WQ3 A;  1B7T Y;  3PAL A;  2WC6 A;  1MUX A;  1UUR A;  2WCE A;  3EK8 A;  3JVT C;  1S5G Z;  4ZCU A;  1PSB A;  1XK4 A;  3NHI A;  1QLK A;  2GV5 A;  1OQP A;  3UNW A;  3I5I B;  1IG5 A;  2I7A A;  3PJI A;  1FPW A;  4M2Q A;  2Y1N A;  2PAL A;  4YI8 A;  1ZFS A;  1FF1 A;  1K9K A;  4AQI A;  2BBN A;  4CPV A;  2JPO A;  1AP4 A;  1N65 A;  1HQV A;  1XFU O;  4PHN A;  1GGZ A;  4DUQ A;  3TUY C;  2KQY A;  1UUS A;  2K2F A;  3OGN A;  4PE1 A;  5FYX A;  1BOC A;  1IJ5 A;  1CM1 A;  2H2K A;  5J3X A;  2JC2 A;  3O78 A;  1R2U A;  3CTN A;  1KWO B;  1CDN A;  1EG4 A;  2YGU A;  3CR5 X;  3D74 A;  1CFF A;  1YUR A;  1K2H A;  2KBM A;  2LMT A;  1PK0 D;  3PFV A;  1CFP A;  1CFD A;  1DJG A;  1K90 D;  1W7J B;  1XFX O;  2LLU A;  1MR8 A;  1NWD A;  3I5F B;  4WQ2 A;  4F0Z B;  3RZS A;  1XA5 A;  4PHM A;  4GAO A;  1Q80 A;  1F8H A;  3S0D A;  3SG5 A;  1PVA A;  3UO9 A;  2KSP A;  3O2P A;  3S0B A;  4ETO A;  1JF0 A;  2MLE C;  1Y1U A;  3TS5 C;  1KCY A;  3S0A A;  1KFU L;  2AUC A;  3LCP C;  1F71 A;  2WCH A;  1P28 A;  2LLT A;  1QJT A;  2MAZ A;  1CTR A;  4GBA A;  1ODB A;  1Z2C B;  1DEK A;  2CTN A;  3GOF A;  1TNP A;  3BUX B;  3ZWH A;  1B4C A;  2K0J A;  2K7O A;  1TWO A;  2WCB A;  1B8C A;  3OX5 A;  3PSR A;  1PSR A;  2G9B A;  3Q8I A;  2ZKM X;  1NP8 A;  1HT9 A;  1JUO A;  3BFB A;  1SMG A;  2WCM A;  1YRU B;  3JTD B;  2F33 A;  3PAT A;  2VRG A;  3IQO A;  3I5G C;  1F70 A;  1K9P A;  2CXJ A;  1OOF A;  2Y1M A;  4QJ4 B;  2H61 C;  1XFV O;  3D75 A;  3DD4 A;  4JD9 A;  2KI4 B;  3BFH A;  1C7W A;  3DVK A;  1KSM A;  3QRX A;  5I2O A;  3L47 A;  3HX4 A;  1TCF A;  1DT7 B;  5HLV A;  5HL1 A;  1IKU A;  4XJK B;  2BL0 B;  2PRU A;  3AKB A;  3NHT A;  3WNX B;  1UHI A;  2JWW A;  1EJ3 A;  2WCK A;  4N5X A;  3NSK A;  1IWQ A;  1CMG A;  2JOJ A;  1C3Y A;  1QIV A;  3NSO A;  4JKT A;  1U5I A;  1OZS A;  3CYZ A;  4BY4 A;  3FE8 A;  1LA3 A;  2H61 A;  4N1G A;  4PCW A;  5AAN A;  4HSZ A;  4GNK B;  1AJ4 A;  1AHR A;  2MHH A;  4NDB A;  2ZN9 A;  2O60 A;  2ZFD A;  2MLF C;  4GGF C;  3NGV A;  4ORB B;  4ZCV A;  1KQM B;  5HKZ A;  3RM1 A;  1KQV A;  5PAL A;  5JOL A;  1S6I A;  3IF7 A;  5B8I B;  5ER4 X;  3PM8 A;  4USL A;  1AK8 A;  1LKJ A;  1DJI A;  3FE9 A;  4TNC A;  2WC8 A;  2MJW B;  4M2O A;  5AFP A;  2LCP A;  2OS8 C;  3BUM B;  1CNP A;  1MXL C;  1TRF A;  3FE6 A;  5I2Q A;  3SG2 A;  2L5X B;  2KFG A;  4PT1 A;  3IVT A;  2EHB A;  2QAC A;  2JQ6 A;  3N7H A;  1WDC C;  4C0L A;  4HRE E;  4OCI A;  2WND A;  2KNE A;  2IS9 A;  1J55 A;  3VB1 A;  2KPH A;  1C3Z A;  5AER A;  2ZRS A;  3IQQ A;  3R1P A;  2WCJ A;  2M9G A;  4IJ7 A;  1JFK A;  4MLW A;  3VRQ A;  1ZAC A;  1BOD A;  1YTZ C;  5DKQ A;  3D76 A;  5CPV A;  1NX1 A;  3HCM A;  4MZJ A;  1X02 A;  2LMV A;  2PVB A;  2CT9 A;  1K96 A;  1DJW A;  1GGW A;  2F8P A;  3F45 A;  2KLE A;  2L4I A;  2NLN A;  1NPQ A;  2EGD A;  3R1V A;  1QV1 A;  2FJU B;  2PSR A;  3BUW B;  1SCM B;  2JXL A;  1RRO A;  3PLF B;  4YGA A;  3QME A;  1K95 A;  1CFC A;  2H8V A;  2WCL A;  1A75 A;  3LL8 B;  1OE9 B;  2FOT A;  1TIZ A;  4WRI A;  1D1O A;  5KU1 A;  2O5G A;  2KI6 D;  1EXR A;  2WOR A;  1RTP 1;  4N1F A;  4A4C A;  5AEQ A;  2QEO A;  3CDN A;  1SK6 D;  2ZNE A;  2M49 B;  3KO0 A;  2K60 A;  1WRZ A;  2ERB A;  3B86 A;  3AAJ A;  3VRN A;  3CZ1 A;  4GPL B;  2LP3 A;  2LVJ A;  1YR5 A;  2F3Z A;  4F7F A;  1B7T Z;  3BJH A;  5F6T A;  4QJ5 B;  1NX2 A;  1S26 D;  1Y1A A;  1LS8 A;  1UHN A;  2HQW A;  3I5H B;  3NSI A;  1OMR A;  1YVH A;  1RWY A;  4KYN A;  3CZ2 A;  4DIR A;  1SR6 B;  1YRT B;  1ALV A;  1Y1X A;  2P70 A;  1NX0 A;  2CCM A;  5ER5 A;  3AAK A;  2P6B B;  2CNP A;  3D78 A;  3KPX A;  3OBV A;  1JBA A;  1QAS A;  2BKI B;  5G08 A;  3DY9 A;  2SAS A;  1IQ3 A;  1DEL A;  2M7N A;  1KK8 C;  1DGV A;  4NDC A;  1F54 A;  1SKT A;  1SY9 A;  2ZND A;  1YUT A;  2EC6 C;  1L2O C;  2A4J A;  2JPT A;  2P71 A;  4C0K A;  2QEH A;  3D77 A;  4MSP A;  4DCK A;  2JT8 A;  1A4P A;  3O6B A;  1CDL A;  1H4B A;  3I5I C;  1CKK A;  2M3W A;  1G33 A;  1OSA A;  3A4U B;  1CLM A;  4YGE B;  3S0F A;  3CR4 X;  2M1U A;  5TNC A;  5IBW A;  1Y6W A;  2BCB A;  3FS7 A;  1C07 A;  1WRL A;  4AOM A;  1XFY O;  1A29 A;  3VRO A;  1BR4 B;  1CDP A;  1E8A A;  2MA2 A;  4FQO A;  4MBE A;  4PE4 A;  2MRD A;  1M63 B;  4IL1 A;  2Y5I A;  1RJV A;  1S36 A;  1GJY A;  1N2D A;  1OZO A;  5KSZ A;  4NQG A;  1PUL A;  5CSN A;  2B1U A;  2KFH A;  3WHT B;  1FBV A;  3EK7 A;  2Q4U A;  3EK4 A;  5HKW A;  1QS7 A;  1IJ6 A;  1WLM A;  2PAS A;  2Y4Q A;  3NXA A;  4INX A;  5HYD A;  1FI5 A;  2D8N A;  1BMO A;  3D0Y A;  2F2O A;  1SW8 A;  2M7L A;  5AXI A;  3SG6 A;  2NXQ A;  3VGO A;  2PMY A;  1F55 A;  3VRR A;  1R6P A;  3BYA A;  2GTE A;  3B6X A;  1CLL A;  2NCO A;  3OX6 A;  2OTG B;  3PN7 B;  4MZL A;  5FI2 A;  4YBH B;  1PAL A;  2OS8 B;  1JWD A;  1PRW A;  2L0P A;  1ZMZ A;  3DZT A;  1ZUZ A;  1CLB A;  1M31 A;  2I94 A;  3CZT X;  2GGZ A;  3D10 A;  1KK7 Y;  1UHH A;  2V53 A;  5BPJ A;  3L4A A;  2E6W A;  2KHN A;  1MXE A;  1OW4 A;  1UHK A;  1DGU A;  1TNW A;  1A75 B;  1DJH A;  2KDH A;  2MBX A;  2AAO A;  1BR1 B;  2JT3 A;  3A8R A;  4U8D A;  3DF0 A;  3FIA A;  4E68 A;  4GUK A;  2ZN8 A;  2L51 A;  4GGF A;  1SL8 A;  1DJX A;  4MVF A;  2HQ8 A;  1IGV A;  2PQL A;  3CLN A;  3DXL A;  4R1E A;  3GK1 A;  1MF8 B;  2BBM A;  2LC5 A;  2LHI A;  1SSE B;  1XFZ O;  1K94 A;  3K21 A;  1UHJ A;  2GGM A;  3LLE A;  4ORC B;  1DQE A;  1OOH A;  3RLZ A;  1TUZ A;  1V1G A;  4INW A;  1BLQ A;  1BU3 A;  3B87 A;  5HKY A;  4PE0 A;  1W9Z A;  2KGB C;  2M0R A;  3JVT B;  5DKN A;  2LUC A;  3GK4 X;  1KQM C;  1EG3 A;  4FTG A;  1QVI Y;  1MQ1 A;  3TDU A;  2WC5 A;  4P5O E;  1XFR A;  1SRA A;  1B47 A;  2DOQ A;  1DF0 A;  1J7P A;  2LE9 B;  2HF5 A;  1K9U A; 
#chains in the Genus database with same CATH homology
 2KAX A;  2AMI A;  1KFX L;  3BXK A;  1OMV A;  3DVJ A;  3H4S E;  4YGB B;  1YX8 A;  1MHO A;  4GGN A;  5GQQ C;  1V1F A;  2LLS A;  3WHU B;  2BEC A;  3TUY B;  4MZK A;  2K7C A;  4UPG A;  1QX2 A;  1XK4 C;  2KI6 C;  2LUX A;  1J1D A;  2JU0 A;  1BF5 A;  3ICB A;  1A2X A;  1REC A;  1TCO B;  2L4H A;  1QLS A;  1S5G Y;  4DRW A;  1TNX A;  2JRF A;  1S6J A;  4BY5 A;  1BG1 A;  1IH0 A;  1UWO A;  3FWC A;  1K8U A;  4OKH A;  2RGI A;  4YGC B;  3SIB A;  2JZI A;  1XO5 A;  4MEW A;  2K7B A;  3OB1 B;  1G4Y R;  3EVR A;  2NZ0 A;  1QTX A;  1TNQ A;  3TS5 B;  2Q91 A;  1JFJ A;  2L98 A;  3EVU A;  1LXF C;  1WLZ A;  1YX7 A;  2KQ6 A;  1SCM C;  4PDZ A;  4Q04 A;  4JQ0 D;  2LVI A;  2M1K B;  4I5J A;  1DJZ A;  3FWB A;  4MRX A;  2LAP A;  1C7V A;  1YUS A;  1AJ5 A;  1F70 A;  2G2B A;  2JTZ A;  1S6C A;  4CLN A;  3BOW A;  2M97 A;  3C1V A;  4YI9 A;  1IQ5 A;  5CSF A;  3TDI A;  1EH2 A;  1QV0 A;  2L50 A;  3D0Y B;  4PHJ A;  5HLO A;  2LHL A;  1QAT A;  5JJG A;  2LM5 A;  1S1E A;  3I5G B;  1U5I B;  4I5K A;  3CWG A;  4ICB A;  3NSL A;  2LVK A;  1CDM A;  3AKA A;  1FI6 A;  3EVV A;  1J7R A;  2LNK A;  1SBJ A;  2HET A;  1YUU A;  1GQM A;  2I18 A;  3I5H C;  1B8R A;  1VRK A;  2WOS A;  2LMU A;  2BCX A;  1SYM A;  1QX5 B;  2FCE A;  3EKJ A;  5I2L A;  1SR6 C;  5K89 A;  3KEV A;  1WRK A;  3CS1 A;  1NX3 A;  1AUI B;  1BT6 A;  1W7I B;  1J7O A;  1J1E A;  1WY9 A;  1XVJ A;  1KFU S;  2KYC A;  3M0W A;  4QJ3 B;  1YVL A;  4PE7 A;  3VRP A;  1RK9 A;  5CSI A;  1AVS A;  1KWO C;  2R2I A;  1ZOT B;  1MWN A;  2CBL A;  4MRY A;  4D1E A;  1CM4 A;  1SPY A;  3I5F C;  4P2Y B;  3DF0 B;  1LIN A;  3BUO B;  4A4B A;  1DJY A;  5I8N A;  1H8B A;  2JUL A;  2M8U A;  4HRG A;  4AQJ A;  4ORA B;  2K7D A;  2ZRT A;  4YGD B;  1B1G A;  3MSE B;  2QPT A;  1G8I A;  2OPO A;  2F2P A;  4MN0 A;  1NCZ A;  2LAN A;  3CR2 A;  1B8L A;  1M45 A;  1QX7 A;  4XYN A;  2JNX A;  1L7Z A;  2LVV A;  3SJS A;  3SIA A;  1IRJ A;  4HRH A;  3SG7 A;  1DMO A;  1EL4 A;  3LK1 A;  4GFT A;  3OP0 A;  1B9A A;  1RFJ A;  1WDC B;  2I2R E;  4I5N B;  4JPZ B;  1OOJ A;  1K93 D;  1QIW A;  1NIW A;  2SCP A;  1OMD A;  1KSO A;  3BUN B;  3JTD C;  5KTY A;  1NCX A;  2JNF A;  1DF0 B;  3GK2 A;  1ALW A;  3WXA A;  1S3P A;  3SG3 A;  1SNL A;  1CMF A;  2KI4 C;  1SL9 A;  4CFR A;  3OHM B;  4OR9 B;  2NCP A;  1CB1 A;  2KBI A;  1KK7 Z;  1FW4 A;  2K8M B;  1XYD A;  1XFW O;  2FCD A;  2BL0 C;  1TN4 A;  4OV2 A;  4DS7 A;  1NUB A;  3OB2 B;  5DKR A;  1Y0V H;  2LV7 A;  2HPS A;  4I5L B;  1A03 A;  1UP5 A;  2LP2 A;  1J7Q A;  5D69 A;  4NDD A;  2KAV A;  4M2P A;  2KOT A;  3PN7 C;  2KGR A;  1DVI A;  2OTG C;  4PAL A;  1F4Q A;  1LA0 A;  2BCA A;  2KFF A;  4CID A;  1DTL A;  5CSJ A;  1N0Y A;  3ZNI A;  3E3R A;  4XJK A;  2E30 A;  4OVN F;  2BKH B;  2JT0 A;  2BE6 A;  3O4Y A;  1LVC D;  3LK0 A;  3DVE A;  1TTX A;  1TOP A;  2K61 A;  1SCV A;  5D7F A;  1JC2 A;  1NYA A;  1M39 A;  2KAY A;  2KYF A;  3BOW B;  2TN4 A;  2F3Y A;  4JWQ A;  1QVI Z;  4PHK A;  2WCF A;  2ISD A;  1F4O A;  3EKH A;  3SG4 A;  1M46 A;  1NSH A;  1SL7 A;  3KF9 A;  4L9M A;  1JSA A;  4YRU A;  3KHE A;  1NCY A;  2BE4 A;  2K2A A;  3BQ3 A;  2COL B;  2M29 A;  3TDZ A;  2L2E A;  1PVB A;  1QXP A;  3DVM A;  1KK8 B;  2JTT A;  2JXC A;  3CGA A;  1KFX S;  1BJF A;  1JF2 A;  2EC6 B;  1L2O B;  4C0J A;  4CFQ A;  3TZ1 A;  4WQ3 A;  1B7T Y;  3PAL A;  1MUX A;  1UUR A;  2WCE A;  3EK8 A;  3JVT C;  1S5G Z;  4ZCU A;  1PSB A;  1XK4 A;  1QLK A;  2GV5 A;  1OQP A;  3I5I B;  1IG5 A;  2I7A A;  1FPW A;  4M2Q A;  2Y1N A;  2PAL A;  4YI8 A;  1ZFS A;  1FF1 A;  1K9K A;  4AQI A;  2BBN A;  4CPV A;  1AP4 A;  1N65 A;  1HQV A;  1XFU O;  4PHN A;  1GGZ A;  4DUQ A;  3TUY C;  2KQY A;  1UUS A;  2K2F A;  4PE1 A;  5FYX A;  1BOC A;  1IJ5 A;  1CM1 A;  2H2K A;  5J3X A;  2JC2 A;  3O78 A;  1R2U A;  3CTN A;  1KWO B;  1CDN A;  1EG4 A;  3CR5 X;  1CFF A;  1YUR A;  1K2H A;  2KBM A;  2LMT A;  1PK0 D;  3PFV A;  1CFP A;  1CFD A;  1DJG A;  1K90 D;  1W7J B;  1XFX O;  2LLU A;  1MR8 A;  1NWD A;  3I5F B;  4WQ2 A;  4F0Z B;  1F8H A;  1XA5 A;  4PHM A;  4GAO A;  1Q80 A;  3SG5 A;  1PVA A;  4ETO A;  2KSP A;  3O2P A;  1JF0 A;  2MLE C;  1Y1U A;  3TS5 C;  1KCY A;  1KFU L;  2AUC A;  3LCP C;  1F71 A;  2LLT A;  1QJT A;  2MAZ A;  1CTR A;  4GBA A;  1ODB A;  2CTN A;  3GOF A;  1TNP A;  3BUX B;  3ZWH A;  1B4C A;  2K0J A;  2K7O A;  2WCB A;  1B8C A;  3OX5 A;  3PSR A;  1PSR A;  2G9B A;  2ZKM X;  1NP8 A;  1HT9 A;  1JUO A;  1SMG A;  1YRU B;  3JTD B;  2F33 A;  3PAT A;  2VRG A;  3IQO A;  3I5G C;  1K9P A;  2CXJ A;  2Y1M A;  4QJ4 B;  2H61 C;  1XFV O;  3DD4 A;  2KI4 B;  1C7W A;  3DVK A;  1KSM A;  3QRX A;  5I2O A;  3HX4 A;  1TCF A;  1DT7 B;  5HLV A;  1IKU A;  4XJK B;  2BL0 B;  2PRU A;  3AKB A;  3WNX B;  1UHI A;  2JWW A;  1EJ3 A;  4N5X A;  3NSK A;  1IWQ A;  1CMG A;  2JOJ A;  1QIV A;  3NSO A;  1U5I A;  1OZS A;  4BY4 A;  4N1G A;  1LA3 A;  2H61 A;  4PCW A;  5AAN A;  4HSZ A;  4GNK B;  1AJ4 A;  1AHR A;  2MHH A;  4NDB A;  2ZN9 A;  2O60 A;  2ZFD A;  2MLF C;  4GGF C;  4ORB B;  4ZCV A;  5HKZ A;  1KQM B;  3RM1 A;  1KQV A;  5PAL A;  5JOL A;  1S6I A;  3IF7 A;  5B8I B;  5ER4 X;  3PM8 A;  4USL A;  1AK8 A;  1LKJ A;  1DJI A;  4TNC A;  2WC8 A;  2MJW B;  4M2O A;  5AFP A;  2LCP A;  2OS8 C;  3BUM B;  1CNP A;  1MXL C;  1TRF A;  5I2Q A;  3SG2 A;  2L5X B;  2KFG A;  2EHB A;  2QAC A;  2JQ6 A;  1WDC C;  4C0L A;  4HRE E;  4OCI A;  2WND A;  2KNE A;  2IS9 A;  1J55 A;  5AER A;  2ZRS A;  3IQQ A;  2M9G A;  3VRQ A;  1JFK A;  4MLW A;  1BOD A;  1ZAC A;  1YTZ C;  5DKQ A;  5CPV A;  1NX1 A;  3HCM A;  4MZJ A;  1X02 A;  2LMV A;  2PVB A;  2CT9 A;  1K96 A;  1DJW A;  1GGW A;  2F8P A;  3F45 A;  2L4I A;  2NLN A;  1NPQ A;  2EGD A;  1QV1 A;  2FJU B;  2PSR A;  3BUW B;  1SCM B;  2JXL A;  1RRO A;  3PLF B;  4YGA A;  1CFC A;  1K95 A;  1A75 A;  3LL8 B;  1OE9 B;  2FOT A;  1TIZ A;  4WRI A;  1D1O A;  5KU1 A;  2O5G A;  2KI6 D;  1EXR A;  2WOR A;  1RTP 1;  4N1F A;  4A4C A;  5AEQ A;  1SK6 D;  2ZNE A;  2M49 B;  3KO0 A;  1WRZ A;  3AAJ A;  3VRN A;  4GPL B;  2LP3 A;  2LVJ A;  1YR5 A;  2F3Z A;  1B7T Z;  5F6T A;  4QJ5 B;  1NX2 A;  1S26 D;  1Y1A A;  1UHN A;  2HQW A;  3I5H B;  3NSI A;  1OMR A;  1YVH A;  1RWY A;  4DIR A;  1SR6 B;  1YRT B;  1ALV A;  1Y1X A;  1NX0 A;  2CCM A;  5ER5 A;  3AAK A;  2P6B B;  2CNP A;  3KPX A;  1JBA A;  1QAS A;  2BKI B;  5G08 A;  2SAS A;  1IQ3 A;  2M7N A;  1KK8 C;  1DGV A;  4NDC A;  1F54 A;  1SKT A;  1SY9 A;  2ZND A;  1YUT A;  2EC6 C;  1L2O C;  2A4J A;  2JPT A;  4C0K A;  4MSP A;  4DCK A;  2JT8 A;  1A4P A;  3O6B A;  1CDL A;  1H4B A;  3I5I C;  1CKK A;  2M3W A;  1G33 A;  1OSA A;  3A4U B;  1CLM A;  4YGE B;  3CR4 X;  2M1U A;  5TNC A;  5IBW A;  1Y6W A;  2BCB A;  3FS7 A;  1C07 A;  1WRL A;  4AOM A;  1XFY O;  1A29 A;  3VRO A;  1BR4 B;  1CDP A;  1E8A A;  2MA2 A;  4FQO A;  4MBE A;  4PE4 A;  2MRD A;  1M63 B;  4IL1 A;  2Y5I A;  1RJV A;  1S36 A;  1GJY A;  1N2D A;  1OZO A;  5KSZ A;  4NQG A;  1PUL A;  5CSN A;  2B1U A;  2KFH A;  3WHT B;  1FBV A;  3EK7 A;  2Q4U A;  3EK4 A;  5HKW A;  1QS7 A;  1IJ6 A;  1WLM A;  2PAS A;  2Y4Q A;  3NXA A;  5HYD A;  1FI5 A;  2D8N A;  1BMO A;  3D0Y A;  2F2O A;  1SW8 A;  2M7L A;  5AXI A;  3SG6 A;  2NXQ A;  3VGO A;  2PMY A;  1F55 A;  3VRR A;  1R6P A;  3BYA A;  1CLL A;  2NCO A;  3OX6 A;  2OTG B;  3PN7 B;  4MZL A;  4YBH B;  1PAL A;  2OS8 B;  1JWD A;  1PRW A;  2L0P A;  1ZMZ A;  1ZUZ A;  1CLB A;  1M31 A;  2I94 A;  3CZT X;  2GGZ A;  3D10 A;  1KK7 Y;  1UHH A;  2V53 A;  5BPJ A;  2E6W A;  2KHN A;  1MXE A;  1UHK A;  1DGU A;  1TNW A;  1A75 B;  1DJH A;  2KDH A;  2MBX A;  2AAO A;  1BR1 B;  2JT3 A;  3A8R A;  4U8D A;  3DF0 A;  3FIA A;  4E68 A;  4GUK A;  2ZN8 A;  2L51 A;  4GGF A;  1SL8 A;  1DJX A;  4MVF A;  2HQ8 A;  1IGV A;  3CLN A;  4R1E A;  3GK1 A;  1MF8 B;  2BBM A;  2LC5 A;  2LHI A;  1XFZ O;  3K21 A;  1K94 A;  3LLE A;  1UHJ A;  2GGM A;  4ORC B;  3RLZ A;  1V1G A;  1BLQ A;  1BU3 A;  5HKY A;  4PE0 A;  5DKN A;  2KGB C;  2M0R A;  3JVT B;  2LUC A;  3GK4 X;  1KQM C;  1EG3 A;  4FTG A;  1QVI Y;  1MQ1 A;  3TDU A;  4P5O E;  1SRA A;  1B47 A;  2DOQ A;  1DF0 A;  1J7P A;  2LE9 B;  2HF5 A;  1K9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...