1YURA

Solution structure of apo-s100a13 (minimized mean structure)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
98
structure length
98
Chain Sequence
b'MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Interplay between Calcium(II) and Copper(II) Binding to S100A13 Protein
pubmed doi rcsb
molecule keywords S100 calcium-binding protein A13
source organism Homo sapiens
molecule tags Metal binding protein
total genus 30
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1yurA00
3E3RA 2BKIB 1PALA 2M29A 1IJ5A 1W7JB 5AXIA 2JT8A 4ZCUA 1XVJA 2MLEC 4A4BA 3SG6A 4JPZB 4PHMA 4YBHB 4FQOA 3EVRA 1YUUA 1Y0VH 3D10A 3KPXA 3MSEB 4ORCB 1QLSA 3SIAA 2BE6A 1S36A 3SG7A 1GQMA 1NCXA 2EC6B 1GGWA 3SG5A 1KFXS 1KQVA 4AOMA 1OZOA 4CFRA 1DJZA 1SL8A 4C0LA 1KK7Y 2KGBC 1IH0A 4M2PA 4I5KA 2CTNA 2H61A 1YUSA 1BU3A 3BOWA 1K93D 4YGCB 1B8LA 1HT9A 2KHNA 1CKKA 3C1VA 1KFXL 4YGAA 5JOLA 1DJXA 1SRAA 2I18A 2G2BA 1J7QA 1W7IB 2JNFA 1V1GA 1SCVA 3I5GB 3EK8A 2JXCA 2KFHA 1UP5A 1Y6WA 1KCYA 2LLUA 1AJ5A 1BOCA 2LE9B 4YGBB 1KSOA 4TNCA 4C0KA 1LINA 1M46A 1WY9A 2MAZA 1CNPA 1CDLA 5HLVA 1F55A 3CR2A 1UHJA 2Y1MA 1IQ5A 1WDCC 3EKHA 3KHEA 1WLZA 1MUXA 1CM1A 2MJWB 4BY5A 5DKQA 3ZWHA 1CLLA 2L2EA 1DF0B 1KK7Z 1TN4A 5HLOA 1SMGA 1OE9B 2O5GA 1CDMA 3BUNB 4PALA 2K7DA 3EKJA 1AVSA 1PSBA 2FJUB 3H4SE 1KK8B 5I2LA 1EG3A 1AUIB 1ODBA 2MA2A 2JNXA 2MBXA 1ZUZA 1DJYA 3PN7B 3BYAA 1ZMZA 3JVTC 1JFJA 4XYNA 1SKTA 2LNKA 2WC8A 4DS7A 1HQVA 1YVLA 3DVMA 3ZNIA 1M45A 1NYAA 2JWWA 2KNEA 4HSZA 4WQ2A 1CFPA 4JQ0D 1BT6A 1QVIY 3CWGA 4MSPA 2D8NA 1DJHA 2K61A 1BLQA 1NPQA 1J1DA 1CFCA 5G08A 2KI6D 4AQIA 1GGZA 2LV7A 5HKYA 1J7RA 2VRGA 2JU0A 4GPLB 2OS8B 1RTP1 3KEVA 2B1UA 4I5LB 1K90D 1M31A 3JTDB 2CNPA 2LLSA 1JWDA 1MWNA 2KSPA 4GUKA 1QV1A 1YRTB 1UHKA 2FCEA 2Y1NA 2ZRSA 2BCXA 1PVAA 3TS5C 1BODA 1YTZC 2LM5A 3WXAA 1CTRA 2JT3A 1B8CA 2PVBA 3CR4X 1XFVO 1B8RA 3IQOA 3PLFB 5KTYA 3BXKA 5TNCA 1SCMC 2K7BA 1XYDA 1KFUL 1XFZO 4PE7A 1LKJA 4PHKA 4HRGA 2JT0A 1SPYA 3D0YA 4ICBA 2M9GA 4OKHA 4NDCA 3DVJA 1KWOC 1NP8A 1QVIZ 2Y4QA 1CMFA 1DJIA 1F4QA 5KSZA 3K21A 2GGMA 1OQPA 1NCYA 2ZNDA 5FYXA 1C7WA 1QJTA 3EK7A 2JRFA 2V53A 2L4IA 2L4HA 1JF0A 5ER4X 2JTTA 2EHBA 1A03A 2CCMA 1SR6C 4MZJA 1F70A 3NSIA 1L2OC 1CLMA 4PE1A 2M1KB 1N65A 2F8PA 4DIRA 2JTZA 3FWBA 3FIAA 1QIWA 3I5IC 1YX7A 1LVCD 2JULA 1TNWA 1RK9A 1QX7A 1S6JA 1XK4C 2LHLA 2QACA 3NXAA 3DD4A 1M63B 2KYFA 2OTGC 4QJ3B 1TTXA 4HRHA 1DF0A 2LMTA 4CFQA 1WDCB 2Y5IA 3D0YB 3EK4A 5CSIA 1JSAA 1ZACA 5GQQC 2PRUA 1AP4A 1OSAA 3BUWB 2KQYA 3LL8B 1K95A 2F2OA 2KAVA 4GBAA 3FWCA 2NZ0A 1OZSA 4GGFA 1BJFA 4I5JA 1XA5A 2KFGA 2F3ZA 2AUCA 1D1OA 4YGEB 2K0JA 4N1FA 1UHHA 3TDIA 2F2PA 1XFYO 1J55A 3GK4X 4PE0A 2KAYA 2BL0C 1UURA 3JVTB 2G9BA 2HQ8A 1J1EA 4N5XA 4NDDA 4UPGA 1EL4A 1CFDA 3BUXB 3NSOA 2AAOA 3HX4A 2M7LA 1OMDA 3SJSA 3KF9A 2BBMA 2LMVA 4MLWA 1M39A 4WQ3A 1TCOB 2P6BB 4PHJA 3F45A 3AKAA 4CLNA 4MN0A 1RWYA 1E8AA 3IF7A 2LP3A 3RM1A 2LVJA 3OX5A 4ETOA 1YX8A 2GGZA 4CPVA 1QLKA 1WRZA 2KQ6A 3WNXB 1SY9A 2LVVA 1CDNA 3TUYC 4MRYA 1KSMA 1DVIA 1DMOA 2L51A 2DOQA 4DRWA 1S3PA 4IL1A 2CBLA 1FW4A 4E68A 2LHIA 2ZN9A 3TS5B 1QX5B 1MXLC 4MZLA 1N0YA 3IQQA 1DGUA 1XK4A 2COLB 2KBMA 1SCMB 4MZKA 4OCIA 3PSRA 2IS9A 2WORA 4WRIA 3QRXA 1G33A 2KGRA 1KWOB 1NWDA 1BR1B 4MRXA 1Y1AA 2LC5A 1S6CA 3LCPC 1L7ZA 2ZFDA 2KYCA 1A2XA 1Q80A 1EG4A 4CIDA 2PALA 2L5XB 4USLA 3A4UB 1F4OA 3M0WA 5HYDA 4OR9B 1NX2A 1IJ6A 1LA3A 1NX0A 1SR6B 2M49B 3VRNA 2BCBA 1SNLA 3BUMB 2HQWA 3VRQA 5AERA 1SYMA 3I5IB 2KFFA 1CDPA 1K9PA 2K2FA 4PHNA 1IQ3A 2LUCA 1JUOA 1RJVA 2KI4C 5CSNA 2BKHB 1AK8A 4I5NB 1R2UA 2K7OA 4BY4A 1C07A 3GK1A 1YUTA 4YI9A 2I94A 1FBVA 1PULA 1QIVA 3PM8A 2OTGB 4XJKA 2Q91A 2E30A 2K2AA 4P5OE 5I2OA 2JQ6A 3AKBA 5D69A 1UUSA 2NXQA 4N1GA 1EH2A 1VRKA 4QJ5B 3NSLA 1SBJA 1ZFSA 4D1EA 1QATA 2PMYA 1SL9A 1IWQA 4GNKB 5B8IB 2M8UA 1A75A 1MQ1A 4Q04A 2K8MB 2BBNA 1DT7B 2AMIA 5ER5A 3VRRA 1DTLA 2HPSA 4F0ZB 1AJ4A 4ORAB 2A4JA 4ZCVA 1RECA 2PASA 5K89A 2ZKMX 2BL0B 2BECA 1JC2A 3TZ1A 3CTNA 1K94A 1TNXA 2MHHA 1TCFA 5J3XA 1FI6A 5D7FA 1JF2A 1KQMC 4YRUA 1Y1XA 1CMGA 2KBIA 5CPVA 1UHIA 1NX3A 3OP0A 4QJ4B 4XJKB 2ZN8A 1MF8B 2LMUA 5HKZA 3RLZA 1V1FA 5I2QA 4PCWA 3OB2B 1S26D 5JJGA 1NSHA 1A4PA 3VRPA 1H4BA 1B7TY 2LAPA 3FS7A 1S5GY 1CLBA 1K2HA 2KDHA 1CFFA 3TUYB 4GFTA 5DKNA 5F6TA 4PDZA 3TDZA 1A75B 2LANA 4NQGA 2I7AA 1PVBA 4MVFA 1K8UA 2L98A 5CSFA 3I5FC 2L0PA 3PATA 3SG3A 1MR8A 2JC2A 3OB1B 3I5HC 2SASA 4MBEA 1SL7A 2LCPA 4FTGA 3CR5X 4ORBB 3LK1A 1MHOA 1SW8A 1NUBA 5AEQA 2LUXA 2F3YA 2BE4A 5I8NA 1TNQA 1BF5A 1X02A 4GAOA 5AFPA 1B47A 1TNPA 2M3WA 5DKRA 3ICBA 1R6PA 1N2DA 1ALWA 1DGVA 3CZTX 1OOJA 1TRFA 3DVKA 1CM4A 2JOJA 2EC6C 4R1EA 3SG2A 1TOPA 1XO5A 2M0RA 2NLNA 2MRDA 1UHNA 4C0JA 1B7TZ 1QASA 2M1UA 1S5GZ 1JFKA 1A29A 1EXRA 3CGAA 5BPJA 1YURA 3A8RA 1IGVA 1K9UA 2HF5A 2PSRA 2K7CA 1WRKA 4JWQA 4DCKA 3DF0A 1UWOA 3HCMA 2SCPA 2KI6C 5KU1A 2R2IA 2JZIA 1RFJA 2KI4B 1AHRA 4AQJA 1BG1A 4HREE 1U5IA 1G4YR 2CXJA 2LVIA 3BOWB 1OMRA 1IKUA 2O60A 3VROA 3I5GC 3AAKA 1WLMA 2LLTA 4M2OA 1B1GA 2H2KA 3PFVA 3VGOA 1RROA 2JXLA 1WRLA 1OMVA 1BMOA 1YR5A 1IRJA 1GJYA 1ZOTB 1BR4B 2L50A 1EJ3A 2TN4A 2WNDA 3AAJA 3OX6A 2ZNEA 1QXPA 1LA0A 2LVKA 3O4YA 2WOSA 2WCEA 2MLFC 4YGDB 2ISDA 1L2OB 1NX1A 3LK0A 4U8DA 3OHMB 1XFUO 1S6IA 2OPOA 4OVNF 1QV0A 1FF1A 4NDBA 1DJWA 1DJGA 2FOTA 2E6WA 2F33A 1PSRA 1YVHA 1Y1UA 2I2RE 1NIWA 1G8IA 1PRWA 2LP2A 3O2PA 4A4CA 2H61C 3DVEA 1ALVA 1XFWO 2M97A 1KK8C 1C7VA 1TIZA 2Q4UA 3LLEA 3O6BA 2QPTA 3DF0B 4L9MA 2JPTA 1JBAA 3KO0A 1F54A 1KQMB 4GGFC 1LXFC 3CS1A 4M2QA 4OV2A 5CSJA 1KFUS 2WCBA 1U5IB 3PN7C 1NCZA 2EGDA 2M7NA 3TDUA 2WCFA 3WHTB 1QS7A 5IBWA 1J7PA 4YI8A 4PE4A 5PALA 3NSKA 3SIBA 1IG5A 3EVUA 4DUQA 1QTXA 1CB1A 5AANA 5HKWA 2KOTA 4P2YB 3O78A 3PALA 1J7OA 1F8HA 1XFXO 3WHUB 3GOFA 2FCDA 2HETA 2KAXA 3CLNA 1H8BA 1S1EA 3SG4A 2NCPA 1PK0D 1F71A 4MEWA 1FPWA 1FI5A 2OS8C 2CT9A 3BQ3A 1B4CA 2GV5A 4GGNA 1QX2A 3JTDC 3I5FB 1B9AA 2NCOA 2ZRTA 1YRUB 3I5HB 3EVVA 2RGIA 3BUOB 1K96A 1MXEA 3GK2A 2BCAA 1SK6D 1K9KA
chains in the Genus database with same CATH superfamily
3E3RA 2BKIB 1PALA 2M29A 1IJ5A 1W7JB 5AXIA 2JT8A 4ZCUA 1XVJA 2MLEC 4A4BA 3D77A 3SG6A 4JPZB 1T14A 3QMEA 4PHMA 4YBHB 3UO9A 4FQOA 3EVRA 1YUUA 1Y0VH 1Z4HA 3D10A 3KPXA 3MSEB 4ORCB 1QLSA 3SIAA 2BE6A 3UNWA 1S36A 3SG7A 1GQMA 1NCXA 2EC6B 1GGWA 3SG5A 1KFXS 4JD9A 1ORGA 1KQVA 4AOMA 1OZOA 4CFRA 3BJHA 1DJZA 1SL8A 4C0LA 1KK7Y 2KGBC 1IH0A 4M2PA 4I5KA 2CTNA 2H61A 1YUSA 1BU3A 2JPOA 1K93D 2WCJA 3BOWA 4F7FA 3BFAA 4YGCB 1B8LA 1HT9A 2KHNA 1CKKA 3C1VA 1KFXL 4YGAA 5JOLA 3VB1A 1DJXA 3S0GA 1SRAA 2I18A 2G2BA 3B6XA 1J7QA 1W7IB 2JNFA 3S0AA 1V1GA 1SCVA 3I5GB 3EK8A 3FE9A 2JXCA 2KFHA 1UP5A 1Y6WA 1KCYA 3S0FA 2LLUA 1AJ5A 1BOCA 2LE9B 4YGBB 1KSOA 4TNCA 1GM0A 4C0KA 1LINA 2P71A 1M46A 1WY9A 2MAZA 1CNPA 1CDLA 5HLVA 1F55A 3CR2A 1UHJA 2Y1MA 1IQ5A 1WDCC 3EKHA 5FI6A 2WCLA 3KHEA 3PM2A 1WLZA 1MUXA 1CM1A 2MJWB 4BY5A 5DKQA 3ZWHA 4KYNA 1CLLA 2L2EA 1DF0B 1KK7Z 1TN4A 5HLOA 1SMGA 1OE9B 2O5GA 1CDMA 3BUNB 4PALA 2K7DA 3R1VA 3EKJA 1AVSA 1PSBA 2FJUB 3H4SE 1KK8B 5I2LA 1EG3A 1AUIB 3CZ2A 1ODBA 2MA2A 2JNXA 3BFBA 1ZUZA 2MBXA 2WCKA 1DJYA 3PN7B 3BYAA 1ZMZA 3JVTC 1JFJA 4XYNA 1SKTA 2LNKA 2WC8A 4DS7A 1HQVA 1YVLA 3DVMA 3ZNIA 1M45A 1NYAA 2KLEA 2JWWA 2KNEA 4HSZA 4WQ2A 1CFPA 4JQ0D 3DY9A 1BT6A 1C3YA 1QVIY 1TUJA 3CWGA 4MSPA 2D8NA 1DJHA 2K61A 3OGNA 1NPQA 1J1DA 1BLQA 5DICA 5G08A 2KI6D 4AQIA 1GGZA 3N7HA 2LV7A 5HKYA 1J7RA 3SS3A 2VRGA 2JU0A 4GPLB 2OS8B 3B87A 1RTP1 3KEVA 2B1UA 4I5LB 1K90D 1M31A 3JTDB 2CNPA 2LLSA 1JWDA 1MWNA 2KSPA 4GUKA 1QV1A 1YRTB 1UHKA 2FCEA 2Y1NA 2ZRSA 2ERBA 2BCXA 1PVAA 3TS5C 1BODA 1YTZC 2LM5A 3WXAA 1CTRA 2JT3A 1B8CA 2PVBA 3CR4X 1XFVO 1B8RA 3IQOA 2BNXA 3CYZA 3PLFB 5KTYA 3BXKA 5TNCA 1SCMC 2K7BA 1XYDA 2QDIA 1KFUL 1XFZO 4PE7A 1LKJA 4PHKA 4HRGA 2JT0A 1SSEB 1SPYA 3D0YA 4ICBA 2M9GA 4OKHA 4NDCA 3DVJA 1KWOC 1NP8A 1QVIZ 2Y4QA 1CMFA 1DJIA 1F4QA 2WCHA 5KSZA 3K21A 2GGMA 2L5YA 1OQPA 1NCYA 2ZNDA 5FYXA 1C7WA 1QJTA 3EK7A 2JRFA 2V53A 2L4IA 2L4HA 1JF0A 5ER4X 2JTTA 2EHBA 1A03A 2CCMA 1SR6C 4MZJA 1F70A 3NSIA 1L2OC 1CLMA 4PE1A 2M1KB 1N65A 2F8PA 4DIRA 2JTZA 3FWBA 1C3ZA 3FIAA 1QIWA 3I5IC 1YX7A 3B88A 1LVCD 2JULA 1TNWA 1RK9A 2QEOA 1QX7A 1S6JA 1XK4C 3R1OA 2LHLA 2QACA 3NXAA 3DD4A 1M63B 2FJYA 2KYFA 2OTGC 4QJ3B 1TTXA 3Q8IA 4HRHA 1DF0A 2LMTA 4CFQA 1WDCB 2Y5IA 3CZ0A 3D0YB 3EK4A 5CSIA 1JSAA 1ZACA 5GQQC 3NHTA 2PRUA 1AP4A 1OSAA 3BUWB 2KQYA 3LL8B 1K95A 1OOHA 2F2OA 2KAVA 4GBAA 3FWCA 2NZ0A 1OZSA 4GGFA 1BJFA 4I5JA 1XA5A 2KFGA 4INWA 2F3ZA 2AUCA 1D1OA 4YGEB 2K0JA 4N1FA 1UHHA 3TDIA 2F2PA 1XFYO 1J55A 3GK4X 4PE0A 2KAYA 2BL0C 1UURA 5FI2A 1W9ZA 3JVTB 2G9BA 2HQ8A 1J1EA 4N5XA 4NDDA 4UPGA 1EL4A 1CFDA 3BUXB 3NSOA 2AAOA 3HX4A 2M7LA 1OMDA 3CZ1A 3KF9A 2BBMA 1QWVA 2LMVA 2WC6A 4MLWA 1M39A 4WQ3A 1TCOB 2P6BB 4PHJA 3F45A 3AKAA 4CLNA 4MN0A 1XFRA 1RWYA 1E8AA 3D78A 3IF7A 2LP3A 3RM1A 2LVJA 3DXLA 3OX5A 4ETOA 1YX8A 2GGZA 4CPVA 3EG5B 1QLKA 1WRZA 3PJIA 2KQ6A 3WNXB 3RZSA 1SY9A 2LVVA 1CDNA 3TUYC 4MRYA 1KSMA 1DVIA 1DMOA 2L51A 2DOQA 4DRWA 1S3PA 4IL1A 2CBLA 1FW4A 4E68A 2LHIA 2ZN9A 3TS5B 1OW4A 1QX5B 1MXLC 4MZLA 1N0YA 3IQQA 1DGUA 1XK4A 2COLB 2KBMA 3OBVA 1SCMB 2QEVA 4MZKA 4OCIA 3PSRA 2IS9A 2WORA 4WRIA 3QRXA 3SS4A 1G33A 2KGRA 1KWOB 1NWDA 1BR1B 3FE8A 4MRXA 1Y1AA 2LC5A 1S6CA 3LCPC 1L7ZA 2ZFDA 2KYCA 3B86A 3S0BA 3CABA 1DELA 1A2XA 1Q80A 1EG4A 4CIDA 4JKTA 2PALA 2PYQA 2L5XB 4USLA 3A4UB 1F4OA 3M0WA 5HYDA 3L4LA 4OR9B 1NX2A 1IJ6A 1LA3A 2L2CA 1NX0A 1SR6B 2M49B 3VRNA 2BCBA 1SNLA 3BUMB 2HQWA 3VRQA 5AERA 1SYMA 3I5IB 2KFFA 2WCMA 1CDPA 1K9PA 2K2FA 4PHNA 1IQ3A 2LUCA 1JUOA 1RJVA 2KI4C 5CSNA 2BKHB 1AK8A 4I5NB 1R2UA 2K7OA 4BY4A 1DC1A 1C07A 3GK1A 1YUTA 3IVTA 4YI9A 2I94A 1FBVA 1PULA 1QIVA 3PM8A 2OTGB 4XJKA 5HL1A 2Q91A 2E30A 2K2AA 4P5OE 5I2OA 2JQ6A 3AKBA 5D69A 1UUSA 2NXQA 4N1GA 1EH2A 1VRKA 4QJ5B 2WC5A 3NSLA 1SBJA 1ZFSA 4D1EA 1QATA 2PMYA 2QEBA 1SL9A 1IWQA 4GNKB 5B8IB 2M8UA 1A75A 1MQ1A 4Q04A 3R1PA 1OOIX 3SS5A 2K8MB 2BBNA 1DT7B 2AMIA 5ER5A 3VRRA 1DTLA 2HPSA 4F0ZB 1AJ4A 2KLDA 4ORAB 2A4JA 4ZCVA 1OOFA 1RECA 2PASA 5K89A 2ZKMX 2BL0B 5I94A 2BECA 1JC2A 3TZ1A 3CTNA 1K94A 1TNXA 2MHHA 1TCFA 1OOGA 5J3XA 1FI6A 5D7FA 1JF2A 1KQMC 4YRUA 1Y1XA 1CMGA 2KBIA 5CPVA 1UHIA 1IIOA 1NX3A 3OP0A 4QJ4B 4XJKB 2ZN8A 1MF8B 2LMUA 5HKZA 3RLZA 1V1FA 5I2QA 4IJ7A 4PCWA 3OB2B 1S26D 5JJGA 1NSHA 1A4PA 3VRPA 1H4BA 1B7TY 2LAPA 3FS7A 1S5GY 4INXA 1CLBA 2KDHA 3NHIA 1CFFA 1K2HA 1TWOA 3TUYB 3D73A 4GFTA 5DKNA 4PDZA 5F6TA 3S0DA 1A75B 2LANA 3FE6A 3TDZA 3SJSA 4NQGA 2I7AA 1PVBA 4MVFA 1K8UA 2L98A 2K60A 3V2LA 5CSFA 3I5FC 2L0PA 3PATA 3SG3A 1MR8A 2JC2A 3OB1B 2YGUA 2BAPA 3I5HC 2SASA 4MBEA 2PQLA 1SL7A 2LCPA 4FTGA 3CR5X 4ORBB 3LK1A 1MHOA 1SW8A 1NUBA 2GTEA 2LUXA 2F3YA 2BE4A 5AEQA 5I8NA 1P28A 3NGVA 3D74A 1TNQA 1DEKA 1BF5A 1X02A 4OZDA 3CDNA 3O4XA 4GAOA 5AFPA 1B47A 1TNPA 2M3WA 5DKRA 3ICBA 1R6PA 1N2DA 1ALWA 1DGVA 3CZTX 1OOJA 1TRFA 3DVKA 1CM4A 3L47A 2JOJA 2EC6C 4R1EA 3SG2A 3BFHA 1TOPA 1XO5A 2M0RA 2NLNA 2MRDA 1UHNA 4C0JA 1B7TZ 1QASA 2M1UA 1S5GZ 3S0EA 1JFKA 1A29A 1EXRA 3CGAA 5BPJA 1YURA 3A8RA 1IGVA 1K9UA 3B7AA 2HF5A 2PSRA 2K7CA 1WRKA 4JWQA 2KPHA 4DCKA 3DF0A 1UWOA 3HCMA 2SCPA 2KI6C 5KU1A 2R2IA 2JZIA 1RFJA 2KI4B 1AHRA 4AQJA 1BG1A 4HREE 1U5IA 1G4YR 2CXJA 2LVIA 2QEHA 1OMRA 3BOWB 3DYEA 1IKUA 2O60A 3VROA 3I5GC 3AAKA 5D3OA 1WLMA 2LLTA 4M2OA 1B1GA 2H2KA 2H8VA 3PFVA 3VGOA 1RROA 2JXLA 1WRLA 1OMVA 1BMOA 1YR5A 1IRJA 1GJYA 1ZOTB 1BR4B 2L50A 1EJ3A 2P70A 2TN4A 2WNDA 3AAJA 3OX6A 2ZNEA 3DZTA 1QXPA 1LA0A 2LVKA 3O4YA 2WOSA 2WCEA 2MLFC 4YGDB 2ISDA 1L2OB 1NX1A 3LK0A 4U8DA 3OHMB 1XFUO 1S6IA 2OPOA 4OVNF 1QV0A 1FF1A 4NDBA 1DJWA 1DJGA 2FOTA 3K1EA 2E6WA 2F33A 1PSRA 1YVHA 4PT1A 1Y1UA 2I2RE 1NIWA 1G8IA 1PRWA 2LP2A 3O2PA 4A4CA 2H61C 3DVEA 1ALVA 1XFWO 5EL2A 2M97A 1KK8C 1C7VA 1TIZA 2Q4UA 3LLEA 3O6BA 3D75A 1Z2CB 2QPTA 3DF0B 4L9MA 2JPTA 1JBAA 3KO0A 1F54A 1KQMB 4GGFC 1LXFC 3CS1A 4M2QA 4OV2A 5CSJA 1KFUS 2WCBA 1U5IB 3PN7C 1NCZA 2EGDA 2M7NA 3TDUA 2WCFA 3WHTB 1QS7A 5IBWA 1J7PA 4YI8A 4PE4A 5PALA 3NSKA 3SIBA 1IG5A 3EVUA 3R72A 1QTXA 4DUQA 1CB1A 5AANA 5HKWA 2KOTA 4P2YB 3O78A 3PALA 1J7OA 1F8HA 1XFXO 3WHUB 4FQTA 3GOFA 2FCDA 2HETA 2KAXA 3CLNA 1H8BA 1S1EA 3SG4A 2NCPA 5FI7A 3L4AA 1LS8A 1DQEA 1TUZA 1PK0D 1F71A 4MEWA 1FPWA 1FI5A 2OS8C 2CT9A 3BQ3A 1B4CA 2GV5A 4GGNA 1QX2A 3JTDC 3I5FB 1B9AA 2NCOA 2ZRTA 1YRUB 3I5HB 3EVVA 3D76A 2RGIA 3BUOB 1K96A 1MXEA 1CFCA 3GK2A 2BCAA 1SK6D 1K9KA
chains in the Genus database with same CATH topology
3E3RA 2BKIB 1PALA 2M29A 1IJ5A 1W7JB 5AXIA 2JT8A 4ZCUA 1XVJA 2MLEC 4A4BA 3SG6A 4JPZB 4PHMA 4YBHB 4FQOA 3EVRA 1YUUA 1Y0VH 3D10A 3KPXA 3MSEB 4ORCB 1QLSA 3SIAA 2BE6A 1S36A 3SG7A 1GQMA 1NCXA 2EC6B 1GGWA 3SG5A 1KFXS 1KQVA 4AOMA 1OZOA 4CFRA 1DJZA 1SL8A 4C0LA 1KK7Y 2KGBC 1IH0A 4M2PA 4I5KA 2CTNA 2H61A 1YUSA 1BU3A 3BOWA 1K93D 4YGCB 1B8LA 1HT9A 2KHNA 1CKKA 3C1VA 1KFXL 4YGAA 5JOLA 1DJXA 1SRAA 2I18A 2G2BA 1J7QA 1W7IB 2JNFA 1V1GA 1SCVA 3I5GB 3EK8A 2JXCA 2KFHA 1UP5A 1Y6WA 1KCYA 2LLUA 1AJ5A 1BOCA 2LE9B 4YGBB 1KSOA 4TNCA 4C0KA 1LINA 1M46A 1WY9A 2MAZA 1CNPA 1CDLA 5HLVA 1F55A 3CR2A 1UHJA 2Y1MA 1IQ5A 1WDCC 3EKHA 3KHEA 1WLZA 1MUXA 1CM1A 2MJWB 4BY5A 5DKQA 3ZWHA 1CLLA 2L2EA 1DF0B 1KK7Z 1TN4A 5HLOA 1SMGA 1OE9B 2O5GA 1CDMA 3BUNB 4PALA 2K7DA 3EKJA 1AVSA 1PSBA 2FJUB 3H4SE 1KK8B 5I2LA 1EG3A 1AUIB 1ODBA 2MA2A 2JNXA 2MBXA 1ZUZA 1DJYA 3PN7B 3BYAA 1ZMZA 3JVTC 1JFJA 4XYNA 1SKTA 2LNKA 2WC8A 4DS7A 1HQVA 1YVLA 3DVMA 3ZNIA 1M45A 1NYAA 2JWWA 2KNEA 4HSZA 4WQ2A 1CFPA 4JQ0D 1BT6A 1QVIY 3CWGA 4MSPA 2D8NA 1DJHA 2K61A 1BLQA 1NPQA 1J1DA 1CFCA 5G08A 2KI6D 4AQIA 1GGZA 2LV7A 5HKYA 1J7RA 2VRGA 2JU0A 4GPLB 2OS8B 1RTP1 3KEVA 2B1UA 4I5LB 1K90D 1M31A 3JTDB 2CNPA 2LLSA 1JWDA 1MWNA 2KSPA 4GUKA 1QV1A 1YRTB 1UHKA 2FCEA 2Y1NA 2ZRSA 2BCXA 1PVAA 3TS5C 1BODA 1YTZC 2LM5A 3WXAA 1CTRA 2JT3A 1B8CA 2PVBA 3CR4X 1XFVO 1B8RA 3IQOA 3PLFB 5KTYA 3BXKA 5TNCA 1SCMC 2K7BA 1XYDA 1KFUL 1XFZO 4PE7A 1LKJA 4PHKA 4HRGA 2JT0A 1SPYA 3D0YA 4ICBA 2M9GA 4OKHA 4NDCA 3DVJA 1KWOC 1NP8A 1QVIZ 2Y4QA 1CMFA 1DJIA 1F4QA 5KSZA 3K21A 2GGMA 1OQPA 1NCYA 2ZNDA 5FYXA 1C7WA 1QJTA 3EK7A 2JRFA 2V53A 2L4IA 2L4HA 1JF0A 5ER4X 2JTTA 2EHBA 1A03A 2CCMA 1SR6C 4MZJA 1F70A 3NSIA 1L2OC 1CLMA 4PE1A 2M1KB 1N65A 2F8PA 4DIRA 2JTZA 3FWBA 3FIAA 1QIWA 3I5IC 1YX7A 1LVCD 2JULA 1TNWA 1RK9A 1QX7A 1S6JA 1XK4C 2LHLA 2QACA 3NXAA 3DD4A 1M63B 2KYFA 2OTGC 4QJ3B 1TTXA 4HRHA 1DF0A 2LMTA 4CFQA 1WDCB 2Y5IA 3D0YB 3EK4A 5CSIA 1JSAA 1ZACA 5GQQC 2PRUA 1AP4A 1OSAA 3BUWB 2KQYA 3LL8B 1K95A 2F2OA 2KAVA 4GBAA 3FWCA 2NZ0A 1OZSA 4GGFA 1BJFA 4I5JA 1XA5A 2KFGA 2F3ZA 2AUCA 1D1OA 4YGEB 2K0JA 4N1FA 1UHHA 3TDIA 2F2PA 1XFYO 1J55A 3GK4X 4PE0A 2KAYA 2BL0C 1UURA 3JVTB 2G9BA 2HQ8A 1J1EA 4N5XA 4NDDA 4UPGA 1EL4A 1CFDA 3BUXB 3NSOA 2AAOA 3HX4A 2M7LA 1OMDA 3SJSA 3KF9A 2BBMA 2LMVA 4MLWA 1M39A 4WQ3A 1TCOB 2P6BB 4PHJA 3F45A 3AKAA 4CLNA 4MN0A 1RWYA 1E8AA 3IF7A 2LP3A 3RM1A 2LVJA 3OX5A 4ETOA 1YX8A 2GGZA 4CPVA 1QLKA 1WRZA 2KQ6A 3WNXB 1SY9A 2LVVA 1CDNA 3TUYC 4MRYA 1KSMA 1DVIA 1DMOA 2L51A 2DOQA 4DRWA 1S3PA 4IL1A 2CBLA 1FW4A 4E68A 2LHIA 2ZN9A 3TS5B 1QX5B 1MXLC 4MZLA 1N0YA 3IQQA 1DGUA 1XK4A 2COLB 2KBMA 1SCMB 4MZKA 4OCIA 3PSRA 2IS9A 2WORA 4WRIA 3QRXA 1G33A 2KGRA 1KWOB 1NWDA 1BR1B 4MRXA 1Y1AA 2LC5A 1S6CA 3LCPC 1L7ZA 2ZFDA 2KYCA 1A2XA 1Q80A 1EG4A 4CIDA 2PALA 2L5XB 4USLA 3A4UB 1F4OA 3M0WA 5HYDA 4OR9B 1NX2A 1IJ6A 1LA3A 1NX0A 1SR6B 2M49B 3VRNA 2BCBA 1SNLA 3BUMB 2HQWA 3VRQA 5AERA 1SYMA 3I5IB 2KFFA 1CDPA 1K9PA 2K2FA 4PHNA 1IQ3A 2LUCA 1JUOA 1RJVA 2KI4C 5CSNA 2BKHB 1AK8A 4I5NB 1R2UA 2K7OA 4BY4A 1C07A 3GK1A 1YUTA 4YI9A 2I94A 1FBVA 1PULA 1QIVA 3PM8A 2OTGB 4XJKA 2Q91A 2E30A 2K2AA 4P5OE 5I2OA 2JQ6A 3AKBA 5D69A 1UUSA 2NXQA 4N1GA 1EH2A 1VRKA 4QJ5B 3NSLA 1SBJA 1ZFSA 4D1EA 1QATA 2PMYA 1SL9A 1IWQA 4GNKB 5B8IB 2M8UA 1A75A 1MQ1A 4Q04A 2K8MB 2BBNA 1DT7B 2AMIA 5ER5A 3VRRA 1DTLA 2HPSA 4F0ZB 1AJ4A 4ORAB 2A4JA 4ZCVA 1RECA 2PASA 5K89A 2ZKMX 2BL0B 2BECA 1JC2A 3TZ1A 3CTNA 1K94A 1TNXA 2MHHA 1TCFA 5J3XA 1FI6A 5D7FA 1JF2A 1KQMC 4YRUA 1Y1XA 1CMGA 2KBIA 5CPVA 1UHIA 1NX3A 3OP0A 4QJ4B 4XJKB 2ZN8A 1MF8B 2LMUA 5HKZA 3RLZA 1V1FA 5I2QA 4PCWA 3OB2B 1S26D 5JJGA 1NSHA 1A4PA 3VRPA 1H4BA 1B7TY 2LAPA 3FS7A 1S5GY 1CLBA 1K2HA 2KDHA 1CFFA 3TUYB 4GFTA 5DKNA 5F6TA 4PDZA 3TDZA 1A75B 2LANA 4NQGA 2I7AA 1PVBA 4MVFA 1K8UA 2L98A 5CSFA 3I5FC 2L0PA 3PATA 3SG3A 1MR8A 2JC2A 3OB1B 3I5HC 2SASA 4MBEA 1SL7A 2LCPA 4FTGA 3CR5X 4ORBB 3LK1A 1MHOA 1SW8A 1NUBA 5AEQA 2LUXA 2F3YA 2BE4A 5I8NA 1TNQA 1BF5A 1X02A 4GAOA 5AFPA 1B47A 1TNPA 2M3WA 5DKRA 3ICBA 1R6PA 1N2DA 1ALWA 1DGVA 3CZTX 1OOJA 1TRFA 3DVKA 1CM4A 2JOJA 2EC6C 4R1EA 3SG2A 1TOPA 1XO5A 2M0RA 2NLNA 2MRDA 1UHNA 4C0JA 1B7TZ 1QASA 2M1UA 1S5GZ 1JFKA 1A29A 1EXRA 3CGAA 5BPJA 1YURA 3A8RA 1IGVA 1K9UA 2HF5A 2PSRA 2K7CA 1WRKA 4JWQA 4DCKA 3DF0A 1UWOA 3HCMA 2SCPA 2KI6C 5KU1A 2R2IA 2JZIA 1RFJA 2KI4B 1AHRA 4AQJA 1BG1A 4HREE 1U5IA 1G4YR 2CXJA 2LVIA 3BOWB 1OMRA 1IKUA 2O60A 3VROA 3I5GC 3AAKA 1WLMA 2LLTA 4M2OA 1B1GA 2H2KA 3PFVA 3VGOA 1RROA 2JXLA 1WRLA 1OMVA 1BMOA 1YR5A 1IRJA 1GJYA 1ZOTB 1BR4B 2L50A 1EJ3A 2TN4A 2WNDA 3AAJA 3OX6A 2ZNEA 1QXPA 1LA0A 2LVKA 3O4YA 2WOSA 2WCEA 2MLFC 4YGDB 2ISDA 1L2OB 1NX1A 3LK0A 4U8DA 3OHMB 1XFUO 1S6IA 2OPOA 4OVNF 1QV0A 1FF1A 4NDBA 1DJWA 1DJGA 2FOTA 2E6WA 2F33A 1PSRA 1YVHA 1Y1UA 2I2RE 1NIWA 1G8IA 1PRWA 2LP2A 3O2PA 4A4CA 2H61C 3DVEA 1ALVA 1XFWO 2M97A 1KK8C 1C7VA 1TIZA 2Q4UA 3LLEA 3O6BA 2QPTA 3DF0B 4L9MA 2JPTA 1JBAA 3KO0A 1F54A 1KQMB 4GGFC 1LXFC 3CS1A 4M2QA 4OV2A 5CSJA 1KFUS 2WCBA 1U5IB 3PN7C 1NCZA 2EGDA 2M7NA 3TDUA 2WCFA 3WHTB 1QS7A 5IBWA 1J7PA 4YI8A 4PE4A 5PALA 3NSKA 3SIBA 1IG5A 3EVUA 4DUQA 1QTXA 1CB1A 5AANA 5HKWA 2KOTA 4P2YB 3O78A 3PALA 1J7OA 1F8HA 1XFXO 3WHUB 3GOFA 2FCDA 2HETA 2KAXA 3CLNA 1H8BA 1S1EA 3SG4A 2NCPA 1PK0D 1F71A 4MEWA 1FPWA 1FI5A 2OS8C 2CT9A 3BQ3A 1B4CA 2GV5A 4GGNA 1QX2A 3JTDC 3I5FB 1B9AA 2NCOA 2ZRTA 1YRUB 3I5HB 3EVVA 2RGIA 3BUOB 1K96A 1MXEA 3GK2A 2BCAA 1SK6D 1K9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E3R A;  2BKI B;  1PAL A;  2M29 A;  1IJ5 A;  1W7J B;  5AXI A;  2JT8 A;  4ZCU A;  1XVJ A;  2MLE C;  4A4B A;  3SG6 A;  4JPZ B;  4PHM A;  4YBH B;  4FQO A;  3EVR A;  1YUU A;  1Y0V H;  3D10 A;  3KPX A;  3MSE B;  4ORC B;  1QLS A;  3SIA A;  2BE6 A;  1S36 A;  3SG7 A;  1GQM A;  1NCX A;  2EC6 B;  1GGW A;  3SG5 A;  1KFX S;  1KQV A;  4AOM A;  1OZO A;  4CFR A;  1DJZ A;  1SL8 A;  4C0L A;  1KK7 Y;  2KGB C;  1IH0 A;  4M2P A;  4I5K A;  2CTN A;  2H61 A;  1YUS A;  1BU3 A;  3BOW A;  1K93 D;  4YGC B;  1B8L A;  1HT9 A;  2KHN A;  1CKK A;  3C1V A;  1KFX L;  4YGA A;  5JOL A;  1DJX A;  1SRA A;  2I18 A;  2G2B A;  1J7Q A;  1W7I B;  2JNF A;  1V1G A;  1SCV A;  3I5G B;  3EK8 A;  2JXC A;  2KFH A;  1UP5 A;  1Y6W A;  1KCY A;  2LLU A;  1AJ5 A;  1BOC A;  2LE9 B;  4YGB B;  1KSO A;  4TNC A;  4C0K A;  1LIN A;  1M46 A;  1WY9 A;  2MAZ A;  1CNP A;  1CDL A;  5HLV A;  1F55 A;  3CR2 A;  1UHJ A;  2Y1M A;  1IQ5 A;  1WDC C;  3EKH A;  3KHE A;  1WLZ A;  1MUX A;  1CM1 A;  2MJW B;  4BY5 A;  5DKQ A;  3ZWH A;  1CLL A;  2L2E A;  1DF0 B;  1KK7 Z;  1TN4 A;  5HLO A;  1SMG A;  1OE9 B;  2O5G A;  1CDM A;  3BUN B;  4PAL A;  2K7D A;  3EKJ A;  1AVS A;  1PSB A;  2FJU B;  3H4S E;  1KK8 B;  5I2L A;  1EG3 A;  1AUI B;  1ODB A;  2MA2 A;  2JNX A;  2MBX A;  1ZUZ A;  1DJY A;  3PN7 B;  3BYA A;  1ZMZ A;  3JVT C;  1JFJ A;  4XYN A;  1SKT A;  2LNK A;  2WC8 A;  4DS7 A;  1HQV A;  1YVL A;  3DVM A;  3ZNI A;  1M45 A;  1NYA A;  2JWW A;  2KNE A;  4HSZ A;  4WQ2 A;  1CFP A;  4JQ0 D;  1BT6 A;  1QVI Y;  3CWG A;  4MSP A;  2D8N A;  1DJH A;  2K61 A;  1BLQ A;  1NPQ A;  1J1D A;  1CFC A;  5G08 A;  2KI6 D;  4AQI A;  1GGZ A;  2LV7 A;  5HKY A;  1J7R A;  2VRG A;  2JU0 A;  4GPL B;  2OS8 B;  1RTP 1;  3KEV A;  2B1U A;  4I5L B;  1K90 D;  1M31 A;  3JTD B;  2CNP A;  2LLS A;  1JWD A;  1MWN A;  2KSP A;  4GUK A;  1QV1 A;  1YRT B;  1UHK A;  2FCE A;  2Y1N A;  2ZRS A;  2BCX A;  1PVA A;  3TS5 C;  1BOD A;  1YTZ C;  2LM5 A;  3WXA A;  1CTR A;  2JT3 A;  1B8C A;  2PVB A;  3CR4 X;  1XFV O;  1B8R A;  3IQO A;  3PLF B;  5KTY A;  3BXK A;  5TNC A;  1SCM C;  2K7B A;  1XYD A;  1KFU L;  1XFZ O;  4PE7 A;  1LKJ A;  4PHK A;  4HRG A;  2JT0 A;  1SPY A;  3D0Y A;  4ICB A;  2M9G A;  4OKH A;  4NDC A;  3DVJ A;  1KWO C;  1NP8 A;  1QVI Z;  2Y4Q A;  1CMF A;  1DJI A;  1F4Q A;  5KSZ A;  3K21 A;  2GGM A;  1OQP A;  1NCY A;  2ZND A;  5FYX A;  1C7W A;  1QJT A;  3EK7 A;  2JRF A;  2V53 A;  2L4I A;  2L4H A;  1JF0 A;  5ER4 X;  2JTT A;  2EHB A;  1A03 A;  2CCM A;  1SR6 C;  4MZJ A;  1F70 A;  3NSI A;  1L2O C;  1CLM A;  4PE1 A;  2M1K B;  1N65 A;  2F8P A;  4DIR A;  2JTZ A;  3FWB A;  3FIA A;  1QIW A;  3I5I C;  1YX7 A;  1LVC D;  2JUL A;  1TNW A;  1RK9 A;  1QX7 A;  1S6J A;  1XK4 C;  2LHL A;  2QAC A;  3NXA A;  3DD4 A;  1M63 B;  2KYF A;  2OTG C;  4QJ3 B;  1TTX A;  4HRH A;  1DF0 A;  2LMT A;  4CFQ A;  1WDC B;  2Y5I A;  3D0Y B;  3EK4 A;  5CSI A;  1JSA A;  1ZAC A;  5GQQ C;  2PRU A;  1AP4 A;  1OSA A;  3BUW B;  2KQY A;  3LL8 B;  1K95 A;  2F2O A;  2KAV A;  4GBA A;  3FWC A;  2NZ0 A;  1OZS A;  4GGF A;  1BJF A;  4I5J A;  1XA5 A;  2KFG A;  2F3Z A;  2AUC A;  1D1O A;  4YGE B;  2K0J A;  4N1F A;  1UHH A;  3TDI A;  2F2P A;  1XFY O;  1J55 A;  3GK4 X;  4PE0 A;  2KAY A;  2BL0 C;  1UUR A;  3JVT B;  2G9B A;  2HQ8 A;  1J1E A;  4N5X A;  4NDD A;  4UPG A;  1EL4 A;  1CFD A;  3BUX B;  3NSO A;  2AAO A;  3HX4 A;  2M7L A;  1OMD A;  3SJS A;  3KF9 A;  2BBM A;  2LMV A;  4MLW A;  1M39 A;  4WQ3 A;  1TCO B;  2P6B B;  4PHJ A;  3F45 A;  3AKA A;  4CLN A;  4MN0 A;  1RWY A;  1E8A A;  3IF7 A;  2LP3 A;  3RM1 A;  2LVJ A;  3OX5 A;  4ETO A;  1YX8 A;  2GGZ A;  4CPV A;  1QLK A;  1WRZ A;  2KQ6 A;  3WNX B;  1SY9 A;  2LVV A;  1CDN A;  3TUY C;  4MRY A;  1KSM A;  1DVI A;  1DMO A;  2L51 A;  2DOQ A;  4DRW A;  1S3P A;  4IL1 A;  2CBL A;  1FW4 A;  4E68 A;  2LHI A;  2ZN9 A;  3TS5 B;  1QX5 B;  1MXL C;  4MZL A;  1N0Y A;  3IQQ A;  1DGU A;  1XK4 A;  2COL B;  2KBM A;  1SCM B;  4MZK A;  4OCI A;  3PSR A;  2IS9 A;  2WOR A;  4WRI A;  3QRX A;  1G33 A;  2KGR A;  1KWO B;  1NWD A;  1BR1 B;  4MRX A;  1Y1A A;  2LC5 A;  1S6C A;  3LCP C;  1L7Z A;  2ZFD A;  2KYC A;  1A2X A;  1Q80 A;  1EG4 A;  4CID A;  2PAL A;  2L5X B;  4USL A;  3A4U B;  1F4O A;  3M0W A;  5HYD A;  4OR9 B;  1NX2 A;  1IJ6 A;  1LA3 A;  1NX0 A;  1SR6 B;  2M49 B;  3VRN A;  2BCB A;  1SNL A;  3BUM B;  2HQW A;  3VRQ A;  5AER A;  1SYM A;  3I5I B;  2KFF A;  1CDP A;  1K9P A;  2K2F A;  4PHN A;  1IQ3 A;  2LUC A;  1JUO A;  1RJV A;  2KI4 C;  5CSN A;  2BKH B;  1AK8 A;  4I5N B;  1R2U A;  2K7O A;  4BY4 A;  1C07 A;  3GK1 A;  1YUT A;  4YI9 A;  2I94 A;  1FBV A;  1PUL A;  1QIV A;  3PM8 A;  2OTG B;  4XJK A;  2Q91 A;  2E30 A;  2K2A A;  4P5O E;  5I2O A;  2JQ6 A;  3AKB A;  5D69 A;  1UUS A;  2NXQ A;  4N1G A;  1EH2 A;  1VRK A;  4QJ5 B;  3NSL A;  1SBJ A;  1ZFS A;  4D1E A;  1QAT A;  2PMY A;  1SL9 A;  1IWQ A;  4GNK B;  5B8I B;  2M8U A;  1A75 A;  1MQ1 A;  4Q04 A;  2K8M B;  2BBN A;  1DT7 B;  2AMI A;  5ER5 A;  3VRR A;  1DTL A;  2HPS A;  4F0Z B;  1AJ4 A;  4ORA B;  2A4J A;  4ZCV A;  1REC A;  2PAS A;  5K89 A;  2ZKM X;  2BL0 B;  2BEC A;  1JC2 A;  3TZ1 A;  3CTN A;  1K94 A;  1TNX A;  2MHH A;  1TCF A;  5J3X A;  1FI6 A;  5D7F A;  1JF2 A;  1KQM C;  4YRU A;  1Y1X A;  1CMG A;  2KBI A;  5CPV A;  1UHI A;  1NX3 A;  3OP0 A;  4QJ4 B;  4XJK B;  2ZN8 A;  1MF8 B;  2LMU A;  5HKZ A;  3RLZ A;  1V1F A;  5I2Q A;  4PCW A;  3OB2 B;  1S26 D;  5JJG A;  1NSH A;  1A4P A;  3VRP A;  1H4B A;  1B7T Y;  2LAP A;  3FS7 A;  1S5G Y;  1CLB A;  1K2H A;  2KDH A;  1CFF A;  3TUY B;  4GFT A;  5DKN A;  5F6T A;  4PDZ A;  3TDZ A;  1A75 B;  2LAN A;  4NQG A;  2I7A A;  1PVB A;  4MVF A;  1K8U A;  2L98 A;  5CSF A;  3I5F C;  2L0P A;  3PAT A;  3SG3 A;  1MR8 A;  2JC2 A;  3OB1 B;  3I5H C;  2SAS A;  4MBE A;  1SL7 A;  2LCP A;  4FTG A;  3CR5 X;  4ORB B;  3LK1 A;  1MHO A;  1SW8 A;  1NUB A;  5AEQ A;  2LUX A;  2F3Y A;  2BE4 A;  5I8N A;  1TNQ A;  1BF5 A;  1X02 A;  4GAO A;  5AFP A;  1B47 A;  1TNP A;  2M3W A;  5DKR A;  3ICB A;  1R6P A;  1N2D A;  1ALW A;  1DGV A;  3CZT X;  1OOJ A;  1TRF A;  3DVK A;  1CM4 A;  2JOJ A;  2EC6 C;  4R1E A;  3SG2 A;  1TOP A;  1XO5 A;  2M0R A;  2NLN A;  2MRD A;  1UHN A;  4C0J A;  1B7T Z;  1QAS A;  2M1U A;  1S5G Z;  1JFK A;  1A29 A;  1EXR A;  3CGA A;  5BPJ A;  1YUR A;  3A8R A;  1IGV A;  1K9U A;  2HF5 A;  2PSR A;  2K7C A;  1WRK A;  4JWQ A;  4DCK A;  3DF0 A;  1UWO A;  3HCM A;  2SCP A;  2KI6 C;  5KU1 A;  2R2I A;  2JZI A;  1RFJ A;  2KI4 B;  1AHR A;  4AQJ A;  1BG1 A;  4HRE E;  1U5I A;  1G4Y R;  2CXJ A;  2LVI A;  3BOW B;  1OMR A;  1IKU A;  2O60 A;  3VRO A;  3I5G C;  3AAK A;  1WLM A;  2LLT A;  4M2O A;  1B1G A;  2H2K A;  3PFV A;  3VGO A;  1RRO A;  2JXL A;  1WRL A;  1OMV A;  1BMO A;  1YR5 A;  1IRJ A;  1GJY A;  1ZOT B;  1BR4 B;  2L50 A;  1EJ3 A;  2TN4 A;  2WND A;  3AAJ A;  3OX6 A;  2ZNE A;  1QXP A;  1LA0 A;  2LVK A;  3O4Y A;  2WOS A;  2WCE A;  2MLF C;  4YGD B;  2ISD A;  1L2O B;  1NX1 A;  3LK0 A;  4U8D A;  3OHM B;  1XFU O;  1S6I A;  2OPO A;  4OVN F;  1QV0 A;  1FF1 A;  4NDB A;  1DJW A;  1DJG A;  2FOT A;  2E6W A;  2F33 A;  1PSR A;  1YVH A;  1Y1U A;  2I2R E;  1NIW A;  1G8I A;  1PRW A;  2LP2 A;  3O2P A;  4A4C A;  2H61 C;  3DVE A;  1ALV A;  1XFW O;  2M97 A;  1KK8 C;  1C7V A;  1TIZ A;  2Q4U A;  3LLE A;  3O6B A;  2QPT A;  3DF0 B;  4L9M A;  2JPT A;  1JBA A;  3KO0 A;  1F54 A;  1KQM B;  4GGF C;  1LXF C;  3CS1 A;  4M2Q A;  4OV2 A;  5CSJ A;  1KFU S;  2WCB A;  1U5I B;  3PN7 C;  1NCZ A;  2EGD A;  2M7N A;  3TDU A;  2WCF A;  3WHT B;  1QS7 A;  5IBW A;  1J7P A;  4YI8 A;  4PE4 A;  5PAL A;  3NSK A;  3SIB A;  1IG5 A;  3EVU A;  4DUQ A;  1QTX A;  1CB1 A;  5AAN A;  5HKW A;  2KOT A;  4P2Y B;  3O78 A;  3PAL A;  1J7O A;  1F8H A;  1XFX O;  3WHU B;  3GOF A;  2FCD A;  2HET A;  2KAX A;  3CLN A;  1H8B A;  1S1E A;  3SG4 A;  2NCP A;  1PK0 D;  1F71 A;  4MEW A;  1FPW A;  1FI5 A;  2OS8 C;  2CT9 A;  3BQ3 A;  1B4C A;  2GV5 A;  4GGN A;  1QX2 A;  3JTD C;  3I5F B;  1B9A A;  2NCO A;  2ZRT A;  1YRU B;  3I5H B;  3EVV A;  2RGI A;  3BUO B;  1K96 A;  1MXE A;  3GK2 A;  2BCA A;  1SK6 D;  1K9K A; 
#chains in the Genus database with same CATH topology
 3E3R A;  2BKI B;  1PAL A;  2M29 A;  1IJ5 A;  1W7J B;  5AXI A;  2JT8 A;  4ZCU A;  1XVJ A;  2MLE C;  4A4B A;  3D77 A;  3SG6 A;  4JPZ B;  1T14 A;  3QME A;  4PHM A;  4YBH B;  3UO9 A;  4FQO A;  3EVR A;  1YUU A;  1Y0V H;  1Z4H A;  3D10 A;  3KPX A;  3MSE B;  4ORC B;  1QLS A;  3SIA A;  2BE6 A;  3UNW A;  1S36 A;  3SG7 A;  1GQM A;  1NCX A;  2EC6 B;  1GGW A;  3SG5 A;  1KFX S;  4JD9 A;  1ORG A;  1KQV A;  4AOM A;  1OZO A;  4CFR A;  3BJH A;  1DJZ A;  1SL8 A;  4C0L A;  1KK7 Y;  2KGB C;  1IH0 A;  4M2P A;  4I5K A;  2CTN A;  2H61 A;  1YUS A;  1BU3 A;  2JPO A;  1K93 D;  2WCJ A;  3BOW A;  4F7F A;  3BFA A;  4YGC B;  1B8L A;  1HT9 A;  2KHN A;  1CKK A;  3C1V A;  1KFX L;  4YGA A;  5JOL A;  3VB1 A;  1DJX A;  3S0G A;  1SRA A;  2I18 A;  2G2B A;  3B6X A;  1J7Q A;  1W7I B;  2JNF A;  3S0A A;  1V1G A;  1SCV A;  3I5G B;  3EK8 A;  3FE9 A;  2JXC A;  2KFH A;  1UP5 A;  1Y6W A;  1KCY A;  3S0F A;  2LLU A;  1AJ5 A;  1BOC A;  2LE9 B;  4YGB B;  1KSO A;  4TNC A;  1GM0 A;  4C0K A;  1LIN A;  2P71 A;  1M46 A;  1WY9 A;  2MAZ A;  1CNP A;  1CDL A;  5HLV A;  1F55 A;  3CR2 A;  1UHJ A;  2Y1M A;  1IQ5 A;  1WDC C;  3EKH A;  5FI6 A;  2WCL A;  3KHE A;  3PM2 A;  1WLZ A;  1MUX A;  1CM1 A;  2MJW B;  4BY5 A;  5DKQ A;  3ZWH A;  4KYN A;  1CLL A;  2L2E A;  1DF0 B;  1KK7 Z;  1TN4 A;  5HLO A;  1SMG A;  1OE9 B;  2O5G A;  1CDM A;  3BUN B;  4PAL A;  2K7D A;  3R1V A;  3EKJ A;  1AVS A;  1PSB A;  2FJU B;  3H4S E;  1KK8 B;  5I2L A;  1EG3 A;  1AUI B;  3CZ2 A;  1ODB A;  2MA2 A;  2JNX A;  3BFB A;  1ZUZ A;  2MBX A;  2WCK A;  1DJY A;  3PN7 B;  3BYA A;  1ZMZ A;  3JVT C;  1JFJ A;  4XYN A;  1SKT A;  2LNK A;  2WC8 A;  4DS7 A;  1HQV A;  1YVL A;  3DVM A;  3ZNI A;  1M45 A;  1NYA A;  2KLE A;  2JWW A;  2KNE A;  4HSZ A;  4WQ2 A;  1CFP A;  4JQ0 D;  3DY9 A;  1BT6 A;  1C3Y A;  1QVI Y;  1TUJ A;  3CWG A;  4MSP A;  2D8N A;  1DJH A;  2K61 A;  3OGN A;  1NPQ A;  1J1D A;  1BLQ A;  5DIC A;  5G08 A;  2KI6 D;  4AQI A;  1GGZ A;  3N7H A;  2LV7 A;  5HKY A;  1J7R A;  3SS3 A;  2VRG A;  2JU0 A;  4GPL B;  2OS8 B;  3B87 A;  1RTP 1;  3KEV A;  2B1U A;  4I5L B;  1K90 D;  1M31 A;  3JTD B;  2CNP A;  2LLS A;  1JWD A;  1MWN A;  2KSP A;  4GUK A;  1QV1 A;  1YRT B;  1UHK A;  2FCE A;  2Y1N A;  2ZRS A;  2ERB A;  2BCX A;  1PVA A;  3TS5 C;  1BOD A;  1YTZ C;  2LM5 A;  3WXA A;  1CTR A;  2JT3 A;  1B8C A;  2PVB A;  3CR4 X;  1XFV O;  1B8R A;  3IQO A;  2BNX A;  3CYZ A;  3PLF B;  5KTY A;  3BXK A;  5TNC A;  1SCM C;  2K7B A;  1XYD A;  2QDI A;  1KFU L;  1XFZ O;  4PE7 A;  1LKJ A;  4PHK A;  4HRG A;  2JT0 A;  1SSE B;  1SPY A;  3D0Y A;  4ICB A;  2M9G A;  4OKH A;  4NDC A;  3DVJ A;  1KWO C;  1NP8 A;  1QVI Z;  2Y4Q A;  1CMF A;  1DJI A;  1F4Q A;  2WCH A;  5KSZ A;  3K21 A;  2GGM A;  2L5Y A;  1OQP A;  1NCY A;  2ZND A;  5FYX A;  1C7W A;  1QJT A;  3EK7 A;  2JRF A;  2V53 A;  2L4I A;  2L4H A;  1JF0 A;  5ER4 X;  2JTT A;  2EHB A;  1A03 A;  2CCM A;  1SR6 C;  4MZJ A;  1F70 A;  3NSI A;  1L2O C;  1CLM A;  4PE1 A;  2M1K B;  1N65 A;  2F8P A;  4DIR A;  2JTZ A;  3FWB A;  1C3Z A;  3FIA A;  1QIW A;  3I5I C;  1YX7 A;  3B88 A;  1LVC D;  2JUL A;  1TNW A;  1RK9 A;  2QEO A;  1QX7 A;  1S6J A;  1XK4 C;  3R1O A;  2LHL A;  2QAC A;  3NXA A;  3DD4 A;  1M63 B;  2FJY A;  2KYF A;  2OTG C;  4QJ3 B;  1TTX A;  3Q8I A;  4HRH A;  1DF0 A;  2LMT A;  4CFQ A;  1WDC B;  2Y5I A;  3CZ0 A;  3D0Y B;  3EK4 A;  5CSI A;  1JSA A;  1ZAC A;  5GQQ C;  3NHT A;  2PRU A;  1AP4 A;  1OSA A;  3BUW B;  2KQY A;  3LL8 B;  1K95 A;  1OOH A;  2F2O A;  2KAV A;  4GBA A;  3FWC A;  2NZ0 A;  1OZS A;  4GGF A;  1BJF A;  4I5J A;  1XA5 A;  2KFG A;  4INW A;  2F3Z A;  2AUC A;  1D1O A;  4YGE B;  2K0J A;  4N1F A;  1UHH A;  3TDI A;  2F2P A;  1XFY O;  1J55 A;  3GK4 X;  4PE0 A;  2KAY A;  2BL0 C;  1UUR A;  5FI2 A;  1W9Z A;  3JVT B;  2G9B A;  2HQ8 A;  1J1E A;  4N5X A;  4NDD A;  4UPG A;  1EL4 A;  1CFD A;  3BUX B;  3NSO A;  2AAO A;  3HX4 A;  2M7L A;  1OMD A;  3CZ1 A;  3KF9 A;  2BBM A;  1QWV A;  2LMV A;  2WC6 A;  4MLW A;  1M39 A;  4WQ3 A;  1TCO B;  2P6B B;  4PHJ A;  3F45 A;  3AKA A;  4CLN A;  4MN0 A;  1XFR A;  1RWY A;  1E8A A;  3D78 A;  3IF7 A;  2LP3 A;  3RM1 A;  2LVJ A;  3DXL A;  3OX5 A;  4ETO A;  1YX8 A;  2GGZ A;  4CPV A;  3EG5 B;  1QLK A;  1WRZ A;  3PJI A;  2KQ6 A;  3WNX B;  3RZS A;  1SY9 A;  2LVV A;  1CDN A;  3TUY C;  4MRY A;  1KSM A;  1DVI A;  1DMO A;  2L51 A;  2DOQ A;  4DRW A;  1S3P A;  4IL1 A;  2CBL A;  1FW4 A;  4E68 A;  2LHI A;  2ZN9 A;  3TS5 B;  1OW4 A;  1QX5 B;  1MXL C;  4MZL A;  1N0Y A;  3IQQ A;  1DGU A;  1XK4 A;  2COL B;  2KBM A;  3OBV A;  1SCM B;  2QEV A;  4MZK A;  4OCI A;  3PSR A;  2IS9 A;  2WOR A;  4WRI A;  3QRX A;  3SS4 A;  1G33 A;  2KGR A;  1KWO B;  1NWD A;  1BR1 B;  3FE8 A;  4MRX A;  1Y1A A;  2LC5 A;  1S6C A;  3LCP C;  1L7Z A;  2ZFD A;  2KYC A;  3B86 A;  3S0B A;  3CAB A;  1DEL A;  1A2X A;  1Q80 A;  1EG4 A;  4CID A;  4JKT A;  2PAL A;  2PYQ A;  2L5X B;  4USL A;  3A4U B;  1F4O A;  3M0W A;  5HYD A;  3L4L A;  4OR9 B;  1NX2 A;  1IJ6 A;  1LA3 A;  2L2C A;  1NX0 A;  1SR6 B;  2M49 B;  3VRN A;  2BCB A;  1SNL A;  3BUM B;  2HQW A;  3VRQ A;  5AER A;  1SYM A;  3I5I B;  2KFF A;  2WCM A;  1CDP A;  1K9P A;  2K2F A;  4PHN A;  1IQ3 A;  2LUC A;  1JUO A;  1RJV A;  2KI4 C;  5CSN A;  2BKH B;  1AK8 A;  4I5N B;  1R2U A;  2K7O A;  4BY4 A;  1DC1 A;  1C07 A;  3GK1 A;  1YUT A;  3IVT A;  4YI9 A;  2I94 A;  1FBV A;  1PUL A;  1QIV A;  3PM8 A;  2OTG B;  4XJK A;  5HL1 A;  2Q91 A;  2E30 A;  2K2A A;  4P5O E;  5I2O A;  2JQ6 A;  3AKB A;  5D69 A;  1UUS A;  2NXQ A;  4N1G A;  1EH2 A;  1VRK A;  4QJ5 B;  2WC5 A;  3NSL A;  1SBJ A;  1ZFS A;  4D1E A;  1QAT A;  2PMY A;  2QEB A;  1SL9 A;  1IWQ A;  4GNK B;  5B8I B;  2M8U A;  1A75 A;  1MQ1 A;  4Q04 A;  3R1P A;  1OOI X;  3SS5 A;  2K8M B;  2BBN A;  1DT7 B;  2AMI A;  5ER5 A;  3VRR A;  1DTL A;  2HPS A;  4F0Z B;  1AJ4 A;  2KLD A;  4ORA B;  2A4J A;  4ZCV A;  1OOF A;  1REC A;  2PAS A;  5K89 A;  2ZKM X;  2BL0 B;  5I94 A;  2BEC A;  1JC2 A;  3TZ1 A;  3CTN A;  1K94 A;  1TNX A;  2MHH A;  1TCF A;  1OOG A;  5J3X A;  1FI6 A;  5D7F A;  1JF2 A;  1KQM C;  4YRU A;  1Y1X A;  1CMG A;  2KBI A;  5CPV A;  1UHI A;  1IIO A;  1NX3 A;  3OP0 A;  4QJ4 B;  4XJK B;  2ZN8 A;  1MF8 B;  2LMU A;  5HKZ A;  3RLZ A;  1V1F A;  5I2Q A;  4IJ7 A;  4PCW A;  3OB2 B;  1S26 D;  5JJG A;  1NSH A;  1A4P A;  3VRP A;  1H4B A;  1B7T Y;  2LAP A;  3FS7 A;  1S5G Y;  4INX A;  1CLB A;  2KDH A;  3NHI A;  1CFF A;  1K2H A;  1TWO A;  3TUY B;  3D73 A;  4GFT A;  5DKN A;  4PDZ A;  5F6T A;  3S0D A;  1A75 B;  2LAN A;  3FE6 A;  3TDZ A;  3SJS A;  4NQG A;  2I7A A;  1PVB A;  4MVF A;  1K8U A;  2L98 A;  2K60 A;  3V2L A;  5CSF A;  3I5F C;  2L0P A;  3PAT A;  3SG3 A;  1MR8 A;  2JC2 A;  3OB1 B;  2YGU A;  2BAP A;  3I5H C;  2SAS A;  4MBE A;  2PQL A;  1SL7 A;  2LCP A;  4FTG A;  3CR5 X;  4ORB B;  3LK1 A;  1MHO A;  1SW8 A;  1NUB A;  2GTE A;  2LUX A;  2F3Y A;  2BE4 A;  5AEQ A;  5I8N A;  1P28 A;  3NGV A;  3D74 A;  1TNQ A;  1DEK A;  1BF5 A;  1X02 A;  4OZD A;  3CDN A;  3O4X A;  4GAO A;  5AFP A;  1B47 A;  1TNP A;  2M3W A;  5DKR A;  3ICB A;  1R6P A;  1N2D A;  1ALW A;  1DGV A;  3CZT X;  1OOJ A;  1TRF A;  3DVK A;  1CM4 A;  3L47 A;  2JOJ A;  2EC6 C;  4R1E A;  3SG2 A;  3BFH A;  1TOP A;  1XO5 A;  2M0R A;  2NLN A;  2MRD A;  1UHN A;  4C0J A;  1B7T Z;  1QAS A;  2M1U A;  1S5G Z;  3S0E A;  1JFK A;  1A29 A;  1EXR A;  3CGA A;  5BPJ A;  1YUR A;  3A8R A;  1IGV A;  1K9U A;  3B7A A;  2HF5 A;  2PSR A;  2K7C A;  1WRK A;  4JWQ A;  2KPH A;  4DCK A;  3DF0 A;  1UWO A;  3HCM A;  2SCP A;  2KI6 C;  5KU1 A;  2R2I A;  2JZI A;  1RFJ A;  2KI4 B;  1AHR A;  4AQJ A;  1BG1 A;  4HRE E;  1U5I A;  1G4Y R;  2CXJ A;  2LVI A;  2QEH A;  1OMR A;  3BOW B;  3DYE A;  1IKU A;  2O60 A;  3VRO A;  3I5G C;  3AAK A;  5D3O A;  1WLM A;  2LLT A;  4M2O A;  1B1G A;  2H2K A;  2H8V A;  3PFV A;  3VGO A;  1RRO A;  2JXL A;  1WRL A;  1OMV A;  1BMO A;  1YR5 A;  1IRJ A;  1GJY A;  1ZOT B;  1BR4 B;  2L50 A;  1EJ3 A;  2P70 A;  2TN4 A;  2WND A;  3AAJ A;  3OX6 A;  2ZNE A;  3DZT A;  1QXP A;  1LA0 A;  2LVK A;  3O4Y A;  2WOS A;  2WCE A;  2MLF C;  4YGD B;  2ISD A;  1L2O B;  1NX1 A;  3LK0 A;  4U8D A;  3OHM B;  1XFU O;  1S6I A;  2OPO A;  4OVN F;  1QV0 A;  1FF1 A;  4NDB A;  1DJW A;  1DJG A;  2FOT A;  3K1E A;  2E6W A;  2F33 A;  1PSR A;  1YVH A;  4PT1 A;  1Y1U A;  2I2R E;  1NIW A;  1G8I A;  1PRW A;  2LP2 A;  3O2P A;  4A4C A;  2H61 C;  3DVE A;  1ALV A;  1XFW O;  5EL2 A;  2M97 A;  1KK8 C;  1C7V A;  1TIZ A;  2Q4U A;  3LLE A;  3O6B A;  3D75 A;  1Z2C B;  2QPT A;  3DF0 B;  4L9M A;  2JPT A;  1JBA A;  3KO0 A;  1F54 A;  1KQM B;  4GGF C;  1LXF C;  3CS1 A;  4M2Q A;  4OV2 A;  5CSJ A;  1KFU S;  2WCB A;  1U5I B;  3PN7 C;  1NCZ A;  2EGD A;  2M7N A;  3TDU A;  2WCF A;  3WHT B;  1QS7 A;  5IBW A;  1J7P A;  4YI8 A;  4PE4 A;  5PAL A;  3NSK A;  3SIB A;  1IG5 A;  3EVU A;  3R72 A;  1QTX A;  4DUQ A;  1CB1 A;  5AAN A;  5HKW A;  2KOT A;  4P2Y B;  3O78 A;  3PAL A;  1J7O A;  1F8H A;  1XFX O;  3WHU B;  4FQT A;  3GOF A;  2FCD A;  2HET A;  2KAX A;  3CLN A;  1H8B A;  1S1E A;  3SG4 A;  2NCP A;  5FI7 A;  3L4A A;  1LS8 A;  1DQE A;  1TUZ A;  1PK0 D;  1F71 A;  4MEW A;  1FPW A;  1FI5 A;  2OS8 C;  2CT9 A;  3BQ3 A;  1B4C A;  2GV5 A;  4GGN A;  1QX2 A;  3JTD C;  3I5F B;  1B9A A;  2NCO A;  2ZRT A;  1YRU B;  3I5H B;  3EVV A;  3D76 A;  2RGI A;  3BUO B;  1K96 A;  1MXE A;  1CFC A;  3GK2 A;  2BCA A;  1SK6 D;  1K9K A; 
#chains in the Genus database with same CATH homology
 3E3R A;  2BKI B;  1PAL A;  2M29 A;  1IJ5 A;  1W7J B;  5AXI A;  2JT8 A;  4ZCU A;  1XVJ A;  2MLE C;  4A4B A;  3SG6 A;  4JPZ B;  4PHM A;  4YBH B;  4FQO A;  3EVR A;  1YUU A;  1Y0V H;  3D10 A;  3KPX A;  3MSE B;  4ORC B;  1QLS A;  3SIA A;  2BE6 A;  1S36 A;  3SG7 A;  1GQM A;  1NCX A;  2EC6 B;  1GGW A;  3SG5 A;  1KFX S;  1KQV A;  4AOM A;  1OZO A;  4CFR A;  1DJZ A;  1SL8 A;  4C0L A;  1KK7 Y;  2KGB C;  1IH0 A;  4M2P A;  4I5K A;  2CTN A;  2H61 A;  1YUS A;  1BU3 A;  3BOW A;  1K93 D;  4YGC B;  1B8L A;  1HT9 A;  2KHN A;  1CKK A;  3C1V A;  1KFX L;  4YGA A;  5JOL A;  1DJX A;  1SRA A;  2I18 A;  2G2B A;  1J7Q A;  1W7I B;  2JNF A;  1V1G A;  1SCV A;  3I5G B;  3EK8 A;  2JXC A;  2KFH A;  1UP5 A;  1Y6W A;  1KCY A;  2LLU A;  1AJ5 A;  1BOC A;  2LE9 B;  4YGB B;  1KSO A;  4TNC A;  4C0K A;  1LIN A;  1M46 A;  1WY9 A;  2MAZ A;  1CNP A;  1CDL A;  5HLV A;  1F55 A;  3CR2 A;  1UHJ A;  2Y1M A;  1IQ5 A;  1WDC C;  3EKH A;  3KHE A;  1WLZ A;  1MUX A;  1CM1 A;  2MJW B;  4BY5 A;  5DKQ A;  3ZWH A;  1CLL A;  2L2E A;  1DF0 B;  1KK7 Z;  1TN4 A;  5HLO A;  1SMG A;  1OE9 B;  2O5G A;  1CDM A;  3BUN B;  4PAL A;  2K7D A;  3EKJ A;  1AVS A;  1PSB A;  2FJU B;  3H4S E;  1KK8 B;  5I2L A;  1EG3 A;  1AUI B;  1ODB A;  2MA2 A;  2JNX A;  2MBX A;  1ZUZ A;  1DJY A;  3PN7 B;  3BYA A;  1ZMZ A;  3JVT C;  1JFJ A;  4XYN A;  1SKT A;  2LNK A;  2WC8 A;  4DS7 A;  1HQV A;  1YVL A;  3DVM A;  3ZNI A;  1M45 A;  1NYA A;  2JWW A;  2KNE A;  4HSZ A;  4WQ2 A;  1CFP A;  4JQ0 D;  1BT6 A;  1QVI Y;  3CWG A;  4MSP A;  2D8N A;  1DJH A;  2K61 A;  1BLQ A;  1NPQ A;  1J1D A;  1CFC A;  5G08 A;  2KI6 D;  4AQI A;  1GGZ A;  2LV7 A;  5HKY A;  1J7R A;  2VRG A;  2JU0 A;  4GPL B;  2OS8 B;  1RTP 1;  3KEV A;  2B1U A;  4I5L B;  1K90 D;  1M31 A;  3JTD B;  2CNP A;  2LLS A;  1JWD A;  1MWN A;  2KSP A;  4GUK A;  1QV1 A;  1YRT B;  1UHK A;  2FCE A;  2Y1N A;  2ZRS A;  2BCX A;  1PVA A;  3TS5 C;  1BOD A;  1YTZ C;  2LM5 A;  3WXA A;  1CTR A;  2JT3 A;  1B8C A;  2PVB A;  3CR4 X;  1XFV O;  1B8R A;  3IQO A;  3PLF B;  5KTY A;  3BXK A;  5TNC A;  1SCM C;  2K7B A;  1XYD A;  1KFU L;  1XFZ O;  4PE7 A;  1LKJ A;  4PHK A;  4HRG A;  2JT0 A;  1SPY A;  3D0Y A;  4ICB A;  2M9G A;  4OKH A;  4NDC A;  3DVJ A;  1KWO C;  1NP8 A;  1QVI Z;  2Y4Q A;  1CMF A;  1DJI A;  1F4Q A;  5KSZ A;  3K21 A;  2GGM A;  1OQP A;  1NCY A;  2ZND A;  5FYX A;  1C7W A;  1QJT A;  3EK7 A;  2JRF A;  2V53 A;  2L4I A;  2L4H A;  1JF0 A;  5ER4 X;  2JTT A;  2EHB A;  1A03 A;  2CCM A;  1SR6 C;  4MZJ A;  1F70 A;  3NSI A;  1L2O C;  1CLM A;  4PE1 A;  2M1K B;  1N65 A;  2F8P A;  4DIR A;  2JTZ A;  3FWB A;  3FIA A;  1QIW A;  3I5I C;  1YX7 A;  1LVC D;  2JUL A;  1TNW A;  1RK9 A;  1QX7 A;  1S6J A;  1XK4 C;  2LHL A;  2QAC A;  3NXA A;  3DD4 A;  1M63 B;  2KYF A;  2OTG C;  4QJ3 B;  1TTX A;  4HRH A;  1DF0 A;  2LMT A;  4CFQ A;  1WDC B;  2Y5I A;  3D0Y B;  3EK4 A;  5CSI A;  1JSA A;  1ZAC A;  5GQQ C;  2PRU A;  1AP4 A;  1OSA A;  3BUW B;  2KQY A;  3LL8 B;  1K95 A;  2F2O A;  2KAV A;  4GBA A;  3FWC A;  2NZ0 A;  1OZS A;  4GGF A;  1BJF A;  4I5J A;  1XA5 A;  2KFG A;  2F3Z A;  2AUC A;  1D1O A;  4YGE B;  2K0J A;  4N1F A;  1UHH A;  3TDI A;  2F2P A;  1XFY O;  1J55 A;  3GK4 X;  4PE0 A;  2KAY A;  2BL0 C;  1UUR A;  3JVT B;  2G9B A;  2HQ8 A;  1J1E A;  4N5X A;  4NDD A;  4UPG A;  1EL4 A;  1CFD A;  3BUX B;  3NSO A;  2AAO A;  3HX4 A;  2M7L A;  1OMD A;  3SJS A;  3KF9 A;  2BBM A;  2LMV A;  4MLW A;  1M39 A;  4WQ3 A;  1TCO B;  2P6B B;  4PHJ A;  3F45 A;  3AKA A;  4CLN A;  4MN0 A;  1RWY A;  1E8A A;  3IF7 A;  2LP3 A;  3RM1 A;  2LVJ A;  3OX5 A;  4ETO A;  1YX8 A;  2GGZ A;  4CPV A;  1QLK A;  1WRZ A;  2KQ6 A;  3WNX B;  1SY9 A;  2LVV A;  1CDN A;  3TUY C;  4MRY A;  1KSM A;  1DVI A;  1DMO A;  2L51 A;  2DOQ A;  4DRW A;  1S3P A;  4IL1 A;  2CBL A;  1FW4 A;  4E68 A;  2LHI A;  2ZN9 A;  3TS5 B;  1QX5 B;  1MXL C;  4MZL A;  1N0Y A;  3IQQ A;  1DGU A;  1XK4 A;  2COL B;  2KBM A;  1SCM B;  4MZK A;  4OCI A;  3PSR A;  2IS9 A;  2WOR A;  4WRI A;  3QRX A;  1G33 A;  2KGR A;  1KWO B;  1NWD A;  1BR1 B;  4MRX A;  1Y1A A;  2LC5 A;  1S6C A;  3LCP C;  1L7Z A;  2ZFD A;  2KYC A;  1A2X A;  1Q80 A;  1EG4 A;  4CID A;  2PAL A;  2L5X B;  4USL A;  3A4U B;  1F4O A;  3M0W A;  5HYD A;  4OR9 B;  1NX2 A;  1IJ6 A;  1LA3 A;  1NX0 A;  1SR6 B;  2M49 B;  3VRN A;  2BCB A;  1SNL A;  3BUM B;  2HQW A;  3VRQ A;  5AER A;  1SYM A;  3I5I B;  2KFF A;  1CDP A;  1K9P A;  2K2F A;  4PHN A;  1IQ3 A;  2LUC A;  1JUO A;  1RJV A;  2KI4 C;  5CSN A;  2BKH B;  1AK8 A;  4I5N B;  1R2U A;  2K7O A;  4BY4 A;  1C07 A;  3GK1 A;  1YUT A;  4YI9 A;  2I94 A;  1FBV A;  1PUL A;  1QIV A;  3PM8 A;  2OTG B;  4XJK A;  2Q91 A;  2E30 A;  2K2A A;  4P5O E;  5I2O A;  2JQ6 A;  3AKB A;  5D69 A;  1UUS A;  2NXQ A;  4N1G A;  1EH2 A;  1VRK A;  4QJ5 B;  3NSL A;  1SBJ A;  1ZFS A;  4D1E A;  1QAT A;  2PMY A;  1SL9 A;  1IWQ A;  4GNK B;  5B8I B;  2M8U A;  1A75 A;  1MQ1 A;  4Q04 A;  2K8M B;  2BBN A;  1DT7 B;  2AMI A;  5ER5 A;  3VRR A;  1DTL A;  2HPS A;  4F0Z B;  1AJ4 A;  4ORA B;  2A4J A;  4ZCV A;  1REC A;  2PAS A;  5K89 A;  2ZKM X;  2BL0 B;  2BEC A;  1JC2 A;  3TZ1 A;  3CTN A;  1K94 A;  1TNX A;  2MHH A;  1TCF A;  5J3X A;  1FI6 A;  5D7F A;  1JF2 A;  1KQM C;  4YRU A;  1Y1X A;  1CMG A;  2KBI A;  5CPV A;  1UHI A;  1NX3 A;  3OP0 A;  4QJ4 B;  4XJK B;  2ZN8 A;  1MF8 B;  2LMU A;  5HKZ A;  3RLZ A;  1V1F A;  5I2Q A;  4PCW A;  3OB2 B;  1S26 D;  5JJG A;  1NSH A;  1A4P A;  3VRP A;  1H4B A;  1B7T Y;  2LAP A;  3FS7 A;  1S5G Y;  1CLB A;  1K2H A;  2KDH A;  1CFF A;  3TUY B;  4GFT A;  5DKN A;  5F6T A;  4PDZ A;  3TDZ A;  1A75 B;  2LAN A;  4NQG A;  2I7A A;  1PVB A;  4MVF A;  1K8U A;  2L98 A;  5CSF A;  3I5F C;  2L0P A;  3PAT A;  3SG3 A;  1MR8 A;  2JC2 A;  3OB1 B;  3I5H C;  2SAS A;  4MBE A;  1SL7 A;  2LCP A;  4FTG A;  3CR5 X;  4ORB B;  3LK1 A;  1MHO A;  1SW8 A;  1NUB A;  5AEQ A;  2LUX A;  2F3Y A;  2BE4 A;  5I8N A;  1TNQ A;  1BF5 A;  1X02 A;  4GAO A;  5AFP A;  1B47 A;  1TNP A;  2M3W A;  5DKR A;  3ICB A;  1R6P A;  1N2D A;  1ALW A;  1DGV A;  3CZT X;  1OOJ A;  1TRF A;  3DVK A;  1CM4 A;  2JOJ A;  2EC6 C;  4R1E A;  3SG2 A;  1TOP A;  1XO5 A;  2M0R A;  2NLN A;  2MRD A;  1UHN A;  4C0J A;  1B7T Z;  1QAS A;  2M1U A;  1S5G Z;  1JFK A;  1A29 A;  1EXR A;  3CGA A;  5BPJ A;  1YUR A;  3A8R A;  1IGV A;  1K9U A;  2HF5 A;  2PSR A;  2K7C A;  1WRK A;  4JWQ A;  4DCK A;  3DF0 A;  1UWO A;  3HCM A;  2SCP A;  2KI6 C;  5KU1 A;  2R2I A;  2JZI A;  1RFJ A;  2KI4 B;  1AHR A;  4AQJ A;  1BG1 A;  4HRE E;  1U5I A;  1G4Y R;  2CXJ A;  2LVI A;  3BOW B;  1OMR A;  1IKU A;  2O60 A;  3VRO A;  3I5G C;  3AAK A;  1WLM A;  2LLT A;  4M2O A;  1B1G A;  2H2K A;  3PFV A;  3VGO A;  1RRO A;  2JXL A;  1WRL A;  1OMV A;  1BMO A;  1YR5 A;  1IRJ A;  1GJY A;  1ZOT B;  1BR4 B;  2L50 A;  1EJ3 A;  2TN4 A;  2WND A;  3AAJ A;  3OX6 A;  2ZNE A;  1QXP A;  1LA0 A;  2LVK A;  3O4Y A;  2WOS A;  2WCE A;  2MLF C;  4YGD B;  2ISD A;  1L2O B;  1NX1 A;  3LK0 A;  4U8D A;  3OHM B;  1XFU O;  1S6I A;  2OPO A;  4OVN F;  1QV0 A;  1FF1 A;  4NDB A;  1DJW A;  1DJG A;  2FOT A;  2E6W A;  2F33 A;  1PSR A;  1YVH A;  1Y1U A;  2I2R E;  1NIW A;  1G8I A;  1PRW A;  2LP2 A;  3O2P A;  4A4C A;  2H61 C;  3DVE A;  1ALV A;  1XFW O;  2M97 A;  1KK8 C;  1C7V A;  1TIZ A;  2Q4U A;  3LLE A;  3O6B A;  2QPT A;  3DF0 B;  4L9M A;  2JPT A;  1JBA A;  3KO0 A;  1F54 A;  1KQM B;  4GGF C;  1LXF C;  3CS1 A;  4M2Q A;  4OV2 A;  5CSJ A;  1KFU S;  2WCB A;  1U5I B;  3PN7 C;  1NCZ A;  2EGD A;  2M7N A;  3TDU A;  2WCF A;  3WHT B;  1QS7 A;  5IBW A;  1J7P A;  4YI8 A;  4PE4 A;  5PAL A;  3NSK A;  3SIB A;  1IG5 A;  3EVU A;  4DUQ A;  1QTX A;  1CB1 A;  5AAN A;  5HKW A;  2KOT A;  4P2Y B;  3O78 A;  3PAL A;  1J7O A;  1F8H A;  1XFX O;  3WHU B;  3GOF A;  2FCD A;  2HET A;  2KAX A;  3CLN A;  1H8B A;  1S1E A;  3SG4 A;  2NCP A;  1PK0 D;  1F71 A;  4MEW A;  1FPW A;  1FI5 A;  2OS8 C;  2CT9 A;  3BQ3 A;  1B4C A;  2GV5 A;  4GGN A;  1QX2 A;  3JTD C;  3I5F B;  1B9A A;  2NCO A;  2ZRT A;  1YRU B;  3I5H B;  3EVV A;  2RGI A;  3BUO B;  1K96 A;  1MXE A;  3GK2 A;  2BCA A;  1SK6 D;  1K9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...