1YURA

Solution structure of apo-s100a13 (minimized mean structure)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
98
structure length
98
Chain Sequence
b'MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S100 calcium-binding protein A13
publication title Structural Interplay between Calcium(II) and Copper(II) Binding to S100A13 Protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 30
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1yurA00
2HF5A 3BUNB 2MLEC 4N5XA 4OCIA 1QASA 5HKZA 4PHNA 3A4UB 2JPTA 1LXFC 1J55A 1JFJA 2M1KB 5CSJA 4C0KA 1F70A 2O5GA 2RGIA 4MZJA 1DF0A 3KHEA 4F0ZB 2IS9A 1QS7A 2KBMA 1KFXL 5AEQA 4OKHA 1M46A 2LVIA 3PN7C 1F4OA 2FCDA 3SG7A 1JC2A 2NLNA 2F8PA 3MSEB 1N0YA 2PALA 4P2YB 2ZN9A 2BE6A 4MZKA 4PHKA 2M7NA 2LNKA 2F3ZA 1DVIA 3LCPC 4GFTA 3PATA 1CMGA 5DKNA 2LMVA 1UURA 1A4PA 1QLSA 3JTDC 4C0JA 3DF0B 2KHNA 1NP8A 2LLTA 1OQPA 2M1UA 4QJ5B 1CB1A 2M97A 1BJFA 4HREE 3QRXA 3KEVA 1BLQA 3BOWA 1U5IB 2HQ8A 1AK8A 1R2UA 4WQ2A 1A75B 1CTRA 2NCPA 4I5LB 1IQ5A 1ZMZA 1EJ3A 1A2XA 1M31A 1TOPA 1B9AA 5DKRA 4FTGA 3LL8B 3OX5A 1PK0D 3M0WA 5AXIA 3VRQA 1UP5A 1R6PA 1TNWA 2P6BB 4M2OA 4PE7A 1M63B 1AJ5A 1TNPA 3KPXA 1IWQA 1XA5A 2M9GA 2O60A 1S5GZ 1CFFA 1J7QA 1TTXA 3CS1A 3WXAA 4P5OE 1BMOA 1KK7Z 2JNXA 2M3WA 3VRRA 1JWDA 1KWOB 2OS8B 3LK0A 1KK8B 1DF0B 3BQ3A 4FQOA 1QV0A 2M29A 1EG4A 5I8NA 1PSBA 1ALVA 2I18A 4ETOA 4BY5A 1YR5A 1CDPA 4PE0A 1CLBA 2CBLA 2VRGA 3CZTX 4GGNA 4UPGA 1KFXS 1SYMA 4AOMA 1RTP1 1OOJA 2JT0A 2GGZA 2BBMA 1SCVA 1Y0VH 4I5KA 3PLFB 4QJ4B 1K8UA 1XYDA 4MRXA 5B8IB 2K7CA 2MLFC 1JBAA 2DOQA 3H4SE 2H2KA 1ZUZA 3O4YA 1V1GA 1WRLA 4QJ3B 3BUXB 3OHMB 1Q80A 3FWCA 1Y1XA 1J1EA 2ZNDA 2K7OA 3E3RA 4YI9A 2ISDA 1WRZA 3BOWB 2KQYA 2E30A 1MQ1A 5I2LA 1NWDA 2OS8C 1YURA 1UHIA 4HSZA 1KK8C 1XK4A 1A29A 2MBXA 3AKBA 1GQMA 3PM8A 1F8HA 2NXQA 2WCEA 3EK8A 1MF8B 2KI6D 3NXAA 1IJ6A 4YGDB 3VGOA 3DVJA 1AHRA 4AQIA 1SL7A 2ZFDA 2LHIA 2R2IA 1S3PA 2F33A 5CSIA 1L2OC 2LV7A 3TUYB 1UWOA 1KK7Y 4A4CA 2G2BA 4L9MA 1L7ZA 4GGFA 5AFPA 1IQ3A 1QIVA 3EVVA 2ZKMX 2PASA 1K2HA 1DJWA 2ZRSA 2M7LA 4N1GA 2G9BA 2OTGB 2LVVA 3EKHA 4OR9B 5JOLA 2LCPA 3SG4A 1JFKA 3GK2A 2L98A 4DUQA 2KI4B 1QVIY 2JOJA 5J3XA 3EVUA 2K0JA 3ZNIA 1Y6WA 1NCXA 1SCMB 4U8DA 2JULA 2CXJA 4I5JA 3PFVA 3SG5A 4PHMA 2Q4UA 4NDBA 4ZCUA 1CDMA 1SW8A 2KQ6A 3WHTB 2MAZA 2WC8A 2KGRA 3I5IB 2LHLA 3OB1B 3TUYC 5ER4X 1Y1UA 2K2AA 3GOFA 1NYAA 1SPYA 1JSAA 2KAYA 1K9PA 1RJVA 1YRUB 2AUCA 2V53A 4XYNA 1NX2A 1ZOTB 2NZ0A 1YTZC 1VRKA 1FF1A 2PMYA 3IF7A 2HETA 1SY9A 2Q91A 3PALA 1KSOA 5CPVA 2CCMA 2A4JA 1SL9A 2LVJA 3O78A 2KI4C 1IKUA 2JTZA 1CMFA 2WCFA 4DS7A 1XVJA 1CKKA 2BKIB 1CLLA 1DJZA 1S6IA 4C0LA 4CLNA 1IH0A 1JF2A 1V1FA 1S26D 1DJXA 1EL4A 1B1GA 1DJGA 3CR4X 1TCFA 1MR8A 2ZRTA 2GV5A 2KI6C 3D0YA 2BCAA 2H61C 2F2OA 2BKHB 1LVCD 2KBIA 3CGAA 3KO0A 1YUUA 2L2EA 1QTXA 4NDCA 5F6TA 5PALA 2PVBA 3ICBA 4MEWA 1QJTA 2EC6B 1QX7A 2MHHA 2LP3A 1QLKA 2ZNEA 1K9UA 1OE9B 5D69A 5GQQC 1C07A 2I7AA 1H4BA 1UHKA 4M2QA 1NSHA 4ICBA 1BR4B 2JC2A 2LP2A 2WOSA 1DJHA 4GAOA 2MRDA 3I5FB 2BBNA 1F71A 1DJIA 1Y1AA 3FWBA 3I5HB 3DVKA 1RECA 5TNCA 1PVAA 1UHJA 4CPVA 1PULA 1G33A 3FIAA 1ZACA 5HKYA 1QATA 3SG6A 3BYAA 3I5GB 1BOCA 2BL0B 2KOTA 4YI8A 2AAOA 1WLZA 1AJ4A 2JTTA 2BE4A 2KFHA 2LLSA 1XFWO 4YBHB 4ZCVA 1B7TZ 1UUSA 3EVRA 3HX4A 5ER5A 1S1EA 2LLUA 1JF0A 4YGEB 3SG2A 3O2PA 4MBEA 4MZLA 4WQ3A 1KWOC 4MRYA 1PVBA 5KU1A 2K2FA 1N65A 3CTNA 1W7IB 2LAPA 3D0YB 4CFQA 1B8CA 1TNXA 1QX5B 3SIAA 2I2RE 1K90D 3GK1A 3CLNA 4PE4A 3WNXB 2LMUA 4CIDA 1S5GY 2M0RA 4PE1A 2WORA 1QV1A 1RK9A 2Y4QA 5FYXA 3VROA 3JVTB 1PSRA 2KNEA 4DCKA 1KFUL 1HQVA 5HYDA 3O6BA 3SIBA 1AUIB 4IL1A 1S36A 1J7OA 2LM5A 1BR1B 3RLZA 3NSLA 1CLMA 4NDDA 1EXRA 1MUXA 4TNCA 2Y1MA 5DKQA 1UHNA 5HKWA 3IQOA 2KAXA 3TZ1A 4CFRA 1NX1A 2NCOA 2GGMA 1LKJA 1OSAA 1LINA 2JQ6A 3HCMA 1BG1A 2L0PA 1YUSA 5AERA 1K94A 1C7VA 1AP4A 4MN0A 1F55A 1U5IA 2K7BA 3AAJA 3LK1A 4GPLB 4MSPA 1YX7A 5AANA 3ZWHA 1A75A 1B7TY 4NQGA 1CNPA 1MXLC 2LMTA 2KFFA 2BCXA 3A8RA 1TIZA 1CFDA 2K7DA 4YGAA 1B47A 1F4QA 3SG3A 5IBWA 2KGBC 2LUXA 3CWGA 4MVFA 1K93D 3C1VA 5HLVA 3EKJA 2KSPA 1RROA 1SBJA 3JTDB 1G8IA 2OPOA 3CR2A 1CM1A 5CSFA 3KF9A 2OTGC 2EGDA 1OMVA 2JU0A 4R1EA 4D1EA 2HQWA 2KYFA 1G4YR 1J7RA 2Y5IA 3PSRA 1KQMB 4GBAA 4GNKB 1WDCB 1QX2A 1XFUO 2KYCA 1DT7B 1NPQA 1UHHA 2JT3A 4YGCB 1S6JA 2B1UA 4DRWA 1CFCA 1M45A 1SCMC 1SKTA 2JT8A 1TRFA 2COLB 1FI6A 2KDHA 2JNFA 1EH2A 1XFVO 3AAKA 1A03A 1NX0A 2K61A 4AQJA 3NSOA 1H8BA 2HPSA 1KFUS 2ZN8A 3I5IC 5BPJA 4HRHA 1TNQA 3RM1A 4I5NB 4BY4A 1KQVA 1YVHA 1M39A 1ODBA 2JXLA 1MHOA 1W7JB 3IQQA 1OMDA 5KTYA 4DIRA 1E8AA 2SCPA 1SR6B 1XK4C 1BT6A 1B8RA 2K8MB 4XJKA 4WRIA 1NIWA 1XFYO 1EG3A 2JWWA 2PSRA 1B4CA 3K21A 3TS5B 2LC5A 4JWQA 2M8UA 1PALA 1QXPA 1KQMC 3CR5X 2WCBA 2MJWB 2FOTA 4PHJA 1HT9A 1MWNA 3LLEA 1WDCC 1IJ5A 1X02A 2BECA 2KFGA 2KAVA 1K96A 1TN4A 1IRJA 1GGWA 1WY9A 3AKAA 4PCWA 2JXCA 2FCEA 4GGFC 3NSIA 1WRKA 2LUCA 3BXKA 1FBVA 1KCYA 3DVEA 3BUOB 2FJUB 2F3YA 3EK7A 1RFJA 5K89A 3D10A 2JZIA 1NX3A 1FPWA 2LANA 1YX8A 1BU3A 1YUTA 1BF5A 2JRFA 2LVKA 1SR6C 3OP0A 4MLWA 4OV2A 1SMGA 4GUKA 1IGVA 4YRUA 2EC6C 3TDUA 4JPZB 2SASA 4N1FA 1CM4A 1SL8A 1SRAA 2I94A 3TS5C 1TCOB 1S6CA 1OMRA 1J7PA 1FW4A 1C7WA 5KSZA 1YVLA 1PRWA 4OVNF 4Q04A 1OZSA 3TDZA 5I2OA 4E68A 1QVIZ 2F2PA 1CDNA 2MA2A 1L2OB 1NCYA 1K95A 3BUMB 2L51A 3I5FC 2L4IA 3I5HC 1JUOA 2TN4A 2EHBA 1FI5A 4XJKB 1B8LA 3VRNA 1DGUA 1WLMA 3DVMA 1SK6D 1OZOA 1BODA 3OX6A 4HRGA 1CDLA 1NUBA 1RWYA 3WHUB 2CT9A 2QPTA 3OB2B 3I5GC 4ORAB 2PRUA 2BL0C 2H61A 4USLA 3VRPA 1CFPA 1LA3A 1GGZA 2L4HA 3DD4A 4JQ0D 3SJSA 1DGVA 2QACA 2WNDA 1YRTB 1GJYA 5CSNA 4ORBB 2CNPA 1IG5A 2Y1NA 3F45A 1J1DA 2L50A 1XFZO 2M49B 4PDZA 5HLOA 3FS7A 1F54A 2BCBA 3EK4A 1MXEA 3DF0A 4M2PA 1DJYA 2AMIA 1ZFSA 2E6WA 1K9KA 1SNLA 1DMOA 3PN7B 1XO5A 2CTNA 5I2QA 1LA0A 1N2DA 3BUWB 1DTLA 3TDIA 3JVTC 1ALWA 4ORCB 2D8NA 5JJGA 4YGBB 1KSMA 2LE9B 3GK4X 3NSKA 1QIWA 2L5XB 5D7FA 4PALA 4A4BA 1AVSA 1XFXO 5G08A 1D1OA 1NCZA
chains in the Genus database with same CATH superfamily
2HF5A 3BUNB 2MLEC 4N5XA 3CZ0A 1OOHA 4OCIA 5EL2A 1QASA 5HKZA 4PHNA 3A4UB 2JPTA 1LXFC 1J55A 1JFJA 3B86A 2KPHA 2M1KB 5CSJA 4C0KA 1F70A 2O5GA 2RGIA 2JPOA 1DF0A 3KHEA 4MZJA 4F0ZB 2IS9A 1QS7A 2KBMA 1KFXL 5AEQA 4OKHA 3D78A 1M46A 2LVIA 3PN7C 4JD9A 1F4OA 2FCDA 3CZ1A 3SG7A 2NLNA 2F8PA 1JC2A 3MSEB 3Q8IA 1N0YA 1C3ZA 2PALA 2ZN9A 2BE6A 4MZKA 4P2YB 2M7NA 1OOFA 2F3ZA 1DVIA 2LNKA 3B7AA 3LCPC 3PATA 4GFTA 1CMGA 5DKNA 4FQTA 2LMVA 1UURA 1A4PA 1QLSA 3JTDC 3K1EA 4C0JA 3DF0B 2KHNA 1NP8A 2LLTA 1OQPA 2M1UA 4QJ5B 1CB1A 2M97A 1BJFA 4HREE 3QRXA 3KEVA 1BLQA 3BOWA 1U5IB 2HQ8A 1AK8A 1TWOA 2YGUA 1R2UA 4WQ2A 1A75B 1CTRA 2NCPA 3OGNA 4I5LB 1IQ5A 1ZMZA 1EJ3A 3S0BA 1A2XA 1M31A 1TOPA 1B9AA 5DKRA 1DEKA 2WCLA 4FTGA 3LL8B 2KLDA 3OX5A 1PK0D 3M0WA 2K60A 5AXIA 3VRQA 1UP5A 1R6PA 1TNWA 3L4LA 2P6BB 4M2OA 4PE7A 1M63B 1AJ5A 1TNPA 3KPXA 1IWQA 1XA5A 2M9GA 2O60A 4KYNA 1S5GZ 2L2CA 1CFFA 1J7QA 1SSEB 1TTXA 3CS1A 3CZ2A 3WXAA 4P5OE 1Z2CB 1BMOA 1KK7Z 2JNXA 3PM2A 2M3WA 3VRRA 1JWDA 1KWOB 3UNWA 2OS8B 4PHKA 3LK0A 1KK8B 4INWA 1DF0B 3BQ3A 4FQOA 1QV0A 2M29A 1EG4A 5I8NA 1PSBA 1ALVA 2I18A 2WC6A 4ETOA 4IJ7A 4BY5A 1YR5A 1CDPA 1T14A 4PE0A 1CLBA 2CBLA 2VRGA 3CZTX 4GGNA 4UPGA 1KFXS 1SYMA 4AOMA 1RTP1 1OOJA 2JT0A 2GGZA 2BBMA 1SCVA 1Y0VH 4I5KA 3PLFB 4QJ4B 1K8UA 1XYDA 4MRXA 5B8IB 2K7CA 2MLFC 2P70A 1JBAA 2DOQA 3H4SE 2H2KA 1ZUZA 3O4YA 1V1GA 1WRLA 4QJ3B 3BUXB 3OHMB 1Q80A 3FWCA 1Y1XA 1J1EA 2ZNDA 2K7OA 3E3RA 3D75A 4YI9A 1WRZA 3BOWB 2KQYA 2ISDA 2E30A 1MQ1A 1Z4HA 5I2LA 1NWDA 2OS8C 1YURA 1UHIA 4HSZA 1KK8C 1XK4A 1A29A 3CDNA 2MBXA 3AKBA 1GQMA 3PM8A 1F8HA 2NXQA 2WCEA 3EK8A 1MF8B 2KI6D 3O4XA 3NXAA 1IJ6A 4YGDB 3VGOA 3D73A 1AHRA 3DVJA 4AQIA 1SL7A 2ZFDA 2LHIA 3L4AA 2R2IA 1S3PA 2F33A 5CSIA 1L2OC 2LV7A 3TUYB 2WCMA 1UWOA 2WCJA 1KK7Y 4A4CA 2G2BA 4L9MA 1GM0A 1L7ZA 4GGFA 5AFPA 1IQ3A 1QIVA 3EVVA 2ZKMX 2PASA 1K2HA 1DJWA 2ZRSA 2M7LA 4N1GA 2P71A 2G9BA 2OTGB 2LVVA 3EKHA 4OR9B 3NGVA 5JOLA 2LCPA 3SG4A 1JFKA 3GK2A 2L98A 3B88A 4DUQA 2KI4B 1QVIY 2JOJA 5J3XA 3EVUA 2K0JA 3ZNIA 1Y6WA 1NCXA 1SCMB 4U8DA 2JULA 2CXJA 4I5JA 3PFVA 3SG5A 5FI6A 4PHMA 2Q4UA 4NDBA 4ZCUA 1CDMA 1SW8A 2KQ6A 3WHTB 2MAZA 2WC8A 2KGRA 3I5IB 1DC1A 5DICA 2LHLA 3OB1B 3TUYC 5ER4X 1Y1UA 2K2AA 3GOFA 1NYAA 1SPYA 1JSAA 1W9ZA 2KAYA 1K9PA 1P28A 1RJVA 1YRUB 2AUCA 2V53A 4XYNA 1NX2A 1ZOTB 2NZ0A 1YTZC 1VRKA 1FF1A 2PMYA 3IF7A 2HETA 3OBVA 1SY9A 2Q91A 3PALA 1KSOA 5CPVA 2CCMA 2A4JA 1SL9A 2LVJA 3O78A 2KI4C 1IKUA 2JTZA 3PJIA 1CMFA 2WCFA 4DS7A 1XVJA 1CKKA 2BKIB 1CLLA 1DJZA 2GTEA 4JKTA 1S6IA 2L5YA 4C0LA 4CLNA 1IH0A 1JF2A 1V1FA 1S26D 1DJXA 1EL4A 2PQLA 1DELA 1DJGA 3R1PA 1B1GA 3CR4X 1TCFA 1MR8A 2ZRTA 2GV5A 2KI6C 3D0YA 2BCAA 2H61C 2F2OA 2BKHB 1LVCD 2KBIA 3CGAA 3KO0A 1YUUA 2L2EA 1QTXA 4NDCA 5F6TA 5PALA 2PYQA 3DYEA 2PVBA 3NHIA 3ICBA 2QEOA 3R1OA 4MEWA 1QJTA 2EC6B 1QX7A 2MHHA 1OOIX 2QEVA 2LP3A 3S0EA 2WCHA 1QLKA 4F7FA 2ZNEA 1K9UA 3VB1A 1OE9B 3DZTA 5D69A 5GQQC 3R1VA 3S0DA 1C07A 2I7AA 1H4BA 1UHKA 4M2QA 1NSHA 2WC5A 4ICBA 1BR4B 5D3OA 1TUJA 2JC2A 2LP2A 2WOSA 1DJHA 2H8VA 4GAOA 2MRDA 3I5FB 2BBNA 1F71A 1DJIA 1Y1AA 3FWBA 3I5HB 3DVKA 1RECA 5TNCA 1PVAA 1UHJA 4CPVA 1PULA 1G33A 3D74A 3FIAA 1ZACA 5HKYA 1QATA 3SG6A 3BYAA 3I5GB 1BOCA 2BL0B 2KOTA 4YI8A 2AAOA 1WLZA 3FE6A 1AJ4A 2JTTA 2BE4A 2KFHA 1C3YA 2LLSA 1XFWO 4YBHB 4ZCVA 1B7TZ 1UUSA 3EVRA 3HX4A 5ER5A 1S1EA 2LLUA 1JF0A 4YGEB 3SG2A 3O2PA 3FE9A 4MBEA 4MZLA 4WQ3A 1KWOC 3CABA 4MRYA 1PVBA 5KU1A 2K2FA 1N65A 3CTNA 1W7IB 2LAPA 3D0YB 4CFQA 1B8CA 1TNXA 1QX5B 3SIAA 1OOGA 2I2RE 5I94A 1K90D 3GK1A 3CLNA 4PE4A 3WNXB 2LMUA 3NHTA 4CIDA 3SS3A 1S5GY 2M0RA 4PE1A 4INXA 2WORA 1QV1A 1RK9A 2Y4QA 5FYXA 3VROA 3JVTB 1PSRA 2KNEA 4DCKA 1KFUL 2KLEA 1HQVA 5HYDA 3O6BA 3SIBA 1AUIB 4IL1A 1S36A 1J7OA 2LM5A 1BR1B 3RLZA 3NSLA 1CLMA 4NDDA 1EXRA 1MUXA 2QEHA 4TNCA 3L47A 2Y1MA 5DKQA 1ORGA 1UHNA 3IQOA 2KAXA 3R72A 5HKWA 3TZ1A 1NX1A 2NCOA 4CFRA 2GGMA 1LKJA 1OSAA 1LINA 2JQ6A 3HCMA 1BG1A 2L0PA 1YUSA 5AERA 1K94A 1C7VA 1AP4A 1IIOA 4MN0A 1F55A 1U5IA 2K7BA 3AAJA 3LK1A 4GPLB 4MSPA 1YX7A 5AANA 3ZWHA 1A75A 1B7TY 4NQGA 1CNPA 1MXLC 2LMTA 2KFFA 2BCXA 3A8RA 1TIZA 3IVTA 1CFDA 2K7DA 4YGAA 1B47A 1F4QA 3SG3A 5IBWA 2KGBC 2LUXA 3CWGA 3RZSA 4MVFA 1K93D 3C1VA 5HLVA 3EKJA 2KSPA 1RROA 1SBJA 3JTDB 1G8IA 2OPOA 3CR2A 3BFHA 1CM1A 5CSFA 3KF9A 2OTGC 2EGDA 1OMVA 2JU0A 4R1EA 4D1EA 3EG5B 2HQWA 2KYFA 1G4YR 1J7RA 2Y5IA 3PSRA 1KQMB 2QEBA 4GBAA 4GNKB 1WDCB 1QX2A 5HL1A 1XFUO 2KYCA 1DT7B 1NPQA 1UHHA 2JT3A 4YGCB 1S6JA 2B1UA 4DRWA 1CFCA 1M45A 1SCMC 1SKTA 2JT8A 1TRFA 3V2LA 2COLB 1FI6A 2KDHA 2WCKA 2JNFA 1EH2A 3S0FA 1XFVO 3AAKA 1A03A 1NX0A 2K61A 3N7HA 4AQJA 3NSOA 1H8BA 2HPSA 1KFUS 2ZN8A 3I5IC 5BPJA 4HRHA 1TNQA 3RM1A 4I5NB 4BY4A 1KQVA 1YVHA 1M39A 1ODBA 3B6XA 2JXLA 1MHOA 1W7JB 2ERBA 3IQQA 1OMDA 5KTYA 4DIRA 1E8AA 2SCPA 1SR6B 1XK4C 1BT6A 1B8RA 2K8MB 4XJKA 4WRIA 1NIWA 1XFYO 1EG3A 2JWWA 2PSRA 3D76A 1B4CA 3K21A 3TS5B 2LC5A 4JWQA 2M8UA 1PALA 1QXPA 1KQMC 3CR5X 2WCBA 2MJWB 2FOTA 4PHJA 1OW4A 1HT9A 1MWNA 3LLEA 1WDCC 1IJ5A 1X02A 2BECA 2KFGA 1QWVA 2KAVA 1K96A 1TN4A 1IRJA 1GGWA 1WY9A 3AKAA 4PCWA 2JXCA 2FCEA 4GGFC 3NSIA 1WRKA 2LUCA 3BXKA 1FBVA 1KCYA 3DVEA 3BUOB 2FJUB 2F3YA 3B87A 3EK7A 1RFJA 5K89A 3D10A 2JZIA 3UO9A 1NX3A 1FPWA 1TUZA 2LANA 1YX8A 1BU3A 4OZDA 1YUTA 1BF5A 2JRFA 2LVKA 1SR6C 3OP0A 4MLWA 4OV2A 1SMGA 2BNXA 4GUKA 5FI7A 1IGVA 4YRUA 2EC6C 3TDUA 4JPZB 2SASA 4N1FA 1CM4A 1SL8A 1SRAA 2I94A 3TS5C 1TCOB 1S6CA 1OMRA 1J7PA 3D77A 1FW4A 1C7WA 5KSZA 1YVLA 1PRWA 4OVNF 4Q04A 2BAPA 1OZSA 3TDZA 1XFRA 5I2OA 1QVIZ 4E68A 3CYZA 3DY9A 2F2PA 5FI2A 1CDNA 2MA2A 1L2OB 3SS5A 1NCYA 1K95A 3BUMB 2L51A 4PT1A 3I5FC 2L4IA 2QDIA 3I5HC 1JUOA 2TN4A 2EHBA 1FI5A 4XJKB 1B8LA 3S0GA 3VRNA 1DGUA 1WLMA 3DVMA 1SK6D 1OZOA 1BODA 3OX6A 4HRGA 1CDLA 1NUBA 1RWYA 3WHUB 2CT9A 2QPTA 3OB2B 3FE8A 3I5GC 4ORAB 2PRUA 2BL0C 2H61A 1LS8A 4USLA 3VRPA 3BFBA 3DXLA 1CFPA 1LA3A 1GGZA 2L4HA 3DD4A 4JQ0D 3SJSA 1DGVA 2QACA 2WNDA 1YRTB 1GJYA 5CSNA 4ORBB 2CNPA 1IG5A 2Y1NA 3F45A 1J1DA 2L50A 1XFZO 2M49B 4PDZA 5HLOA 3FS7A 3SS4A 1F54A 2BCBA 3EK4A 1MXEA 3DF0A 4M2PA 1DJYA 2AMIA 1ZFSA 2E6WA 1K9KA 1SNLA 3QMEA 1DMOA 3PN7B 1XO5A 2CTNA 5I2QA 3BFAA 3S0AA 2FJYA 1LA0A 1N2DA 3BUWB 1DTLA 3TDIA 3JVTC 1ALWA 4ORCB 2D8NA 5JJGA 4YGBB 1KSMA 2LE9B 3BJHA 3GK4X 3NSKA 1DQEA 1QIWA 2L5XB 5D7FA 4PALA 4A4BA 1AVSA 1XFXO 5G08A 1D1OA 1NCZA
chains in the Genus database with same CATH topology
2HF5A 3BUNB 2MLEC 4N5XA 4OCIA 1QASA 5HKZA 4PHNA 3A4UB 2JPTA 1LXFC 1J55A 1JFJA 2M1KB 5CSJA 4C0KA 1F70A 2O5GA 2RGIA 4MZJA 1DF0A 3KHEA 4F0ZB 2IS9A 1QS7A 2KBMA 1KFXL 5AEQA 4OKHA 1M46A 2LVIA 3PN7C 1F4OA 2FCDA 3SG7A 1JC2A 2NLNA 2F8PA 3MSEB 1N0YA 2PALA 4P2YB 2ZN9A 2BE6A 4MZKA 4PHKA 2M7NA 2LNKA 2F3ZA 1DVIA 3LCPC 4GFTA 3PATA 1CMGA 5DKNA 2LMVA 1UURA 1A4PA 1QLSA 3JTDC 4C0JA 3DF0B 2KHNA 1NP8A 2LLTA 1OQPA 2M1UA 4QJ5B 1CB1A 2M97A 1BJFA 4HREE 3QRXA 3KEVA 1BLQA 3BOWA 1U5IB 2HQ8A 1AK8A 1R2UA 4WQ2A 1A75B 1CTRA 2NCPA 4I5LB 1IQ5A 1ZMZA 1EJ3A 1A2XA 1M31A 1TOPA 1B9AA 5DKRA 4FTGA 3LL8B 3OX5A 1PK0D 3M0WA 5AXIA 3VRQA 1UP5A 1R6PA 1TNWA 2P6BB 4M2OA 4PE7A 1M63B 1AJ5A 1TNPA 3KPXA 1IWQA 1XA5A 2M9GA 2O60A 1S5GZ 1CFFA 1J7QA 1TTXA 3CS1A 3WXAA 4P5OE 1BMOA 1KK7Z 2JNXA 2M3WA 3VRRA 1JWDA 1KWOB 2OS8B 3LK0A 1KK8B 1DF0B 3BQ3A 4FQOA 1QV0A 2M29A 1EG4A 5I8NA 1PSBA 1ALVA 2I18A 4ETOA 4BY5A 1YR5A 1CDPA 4PE0A 1CLBA 2CBLA 2VRGA 3CZTX 4GGNA 4UPGA 1KFXS 1SYMA 4AOMA 1RTP1 1OOJA 2JT0A 2GGZA 2BBMA 1SCVA 1Y0VH 4I5KA 3PLFB 4QJ4B 1K8UA 1XYDA 4MRXA 5B8IB 2K7CA 2MLFC 1JBAA 2DOQA 3H4SE 2H2KA 1ZUZA 3O4YA 1V1GA 1WRLA 4QJ3B 3BUXB 3OHMB 1Q80A 3FWCA 1Y1XA 1J1EA 2ZNDA 2K7OA 3E3RA 4YI9A 2ISDA 1WRZA 3BOWB 2KQYA 2E30A 1MQ1A 5I2LA 1NWDA 2OS8C 1YURA 1UHIA 4HSZA 1KK8C 1XK4A 1A29A 2MBXA 3AKBA 1GQMA 3PM8A 1F8HA 2NXQA 2WCEA 3EK8A 1MF8B 2KI6D 3NXAA 1IJ6A 4YGDB 3VGOA 3DVJA 1AHRA 4AQIA 1SL7A 2ZFDA 2LHIA 2R2IA 1S3PA 2F33A 5CSIA 1L2OC 2LV7A 3TUYB 1UWOA 1KK7Y 4A4CA 2G2BA 4L9MA 1L7ZA 4GGFA 5AFPA 1IQ3A 1QIVA 3EVVA 2ZKMX 2PASA 1K2HA 1DJWA 2ZRSA 2M7LA 4N1GA 2G9BA 2OTGB 2LVVA 3EKHA 4OR9B 5JOLA 2LCPA 3SG4A 1JFKA 3GK2A 2L98A 4DUQA 2KI4B 1QVIY 2JOJA 5J3XA 3EVUA 2K0JA 3ZNIA 1Y6WA 1NCXA 1SCMB 4U8DA 2JULA 2CXJA 4I5JA 3PFVA 3SG5A 4PHMA 2Q4UA 4NDBA 4ZCUA 1CDMA 1SW8A 2KQ6A 3WHTB 2MAZA 2WC8A 2KGRA 3I5IB 2LHLA 3OB1B 3TUYC 5ER4X 1Y1UA 2K2AA 3GOFA 1NYAA 1SPYA 1JSAA 2KAYA 1K9PA 1RJVA 1YRUB 2AUCA 2V53A 4XYNA 1NX2A 1ZOTB 2NZ0A 1YTZC 1VRKA 1FF1A 2PMYA 3IF7A 2HETA 1SY9A 2Q91A 3PALA 1KSOA 5CPVA 2CCMA 2A4JA 1SL9A 2LVJA 3O78A 2KI4C 1IKUA 2JTZA 1CMFA 2WCFA 4DS7A 1XVJA 1CKKA 2BKIB 1CLLA 1DJZA 1S6IA 4C0LA 4CLNA 1IH0A 1JF2A 1V1FA 1S26D 1DJXA 1EL4A 1B1GA 1DJGA 3CR4X 1TCFA 1MR8A 2ZRTA 2GV5A 2KI6C 3D0YA 2BCAA 2H61C 2F2OA 2BKHB 1LVCD 2KBIA 3CGAA 3KO0A 1YUUA 2L2EA 1QTXA 4NDCA 5F6TA 5PALA 2PVBA 3ICBA 4MEWA 1QJTA 2EC6B 1QX7A 2MHHA 2LP3A 1QLKA 2ZNEA 1K9UA 1OE9B 5D69A 5GQQC 1C07A 2I7AA 1H4BA 1UHKA 4M2QA 1NSHA 4ICBA 1BR4B 2JC2A 2LP2A 2WOSA 1DJHA 4GAOA 2MRDA 3I5FB 2BBNA 1F71A 1DJIA 1Y1AA 3FWBA 3I5HB 3DVKA 1RECA 5TNCA 1PVAA 1UHJA 4CPVA 1PULA 1G33A 3FIAA 1ZACA 5HKYA 1QATA 3SG6A 3BYAA 3I5GB 1BOCA 2BL0B 2KOTA 4YI8A 2AAOA 1WLZA 1AJ4A 2JTTA 2BE4A 2KFHA 2LLSA 1XFWO 4YBHB 4ZCVA 1B7TZ 1UUSA 3EVRA 3HX4A 5ER5A 1S1EA 2LLUA 1JF0A 4YGEB 3SG2A 3O2PA 4MBEA 4MZLA 4WQ3A 1KWOC 4MRYA 1PVBA 5KU1A 2K2FA 1N65A 3CTNA 1W7IB 2LAPA 3D0YB 4CFQA 1B8CA 1TNXA 1QX5B 3SIAA 2I2RE 1K90D 3GK1A 3CLNA 4PE4A 3WNXB 2LMUA 4CIDA 1S5GY 2M0RA 4PE1A 2WORA 1QV1A 1RK9A 2Y4QA 5FYXA 3VROA 3JVTB 1PSRA 2KNEA 4DCKA 1KFUL 1HQVA 5HYDA 3O6BA 3SIBA 1AUIB 4IL1A 1S36A 1J7OA 2LM5A 1BR1B 3RLZA 3NSLA 1CLMA 4NDDA 1EXRA 1MUXA 4TNCA 2Y1MA 5DKQA 1UHNA 5HKWA 3IQOA 2KAXA 3TZ1A 4CFRA 1NX1A 2NCOA 2GGMA 1LKJA 1OSAA 1LINA 2JQ6A 3HCMA 1BG1A 2L0PA 1YUSA 5AERA 1K94A 1C7VA 1AP4A 4MN0A 1F55A 1U5IA 2K7BA 3AAJA 3LK1A 4GPLB 4MSPA 1YX7A 5AANA 3ZWHA 1A75A 1B7TY 4NQGA 1CNPA 1MXLC 2LMTA 2KFFA 2BCXA 3A8RA 1TIZA 1CFDA 2K7DA 4YGAA 1B47A 1F4QA 3SG3A 5IBWA 2KGBC 2LUXA 3CWGA 4MVFA 1K93D 3C1VA 5HLVA 3EKJA 2KSPA 1RROA 1SBJA 3JTDB 1G8IA 2OPOA 3CR2A 1CM1A 5CSFA 3KF9A 2OTGC 2EGDA 1OMVA 2JU0A 4R1EA 4D1EA 2HQWA 2KYFA 1G4YR 1J7RA 2Y5IA 3PSRA 1KQMB 4GBAA 4GNKB 1WDCB 1QX2A 1XFUO 2KYCA 1DT7B 1NPQA 1UHHA 2JT3A 4YGCB 1S6JA 2B1UA 4DRWA 1CFCA 1M45A 1SCMC 1SKTA 2JT8A 1TRFA 2COLB 1FI6A 2KDHA 2JNFA 1EH2A 1XFVO 3AAKA 1A03A 1NX0A 2K61A 4AQJA 3NSOA 1H8BA 2HPSA 1KFUS 2ZN8A 3I5IC 5BPJA 4HRHA 1TNQA 3RM1A 4I5NB 4BY4A 1KQVA 1YVHA 1M39A 1ODBA 2JXLA 1MHOA 1W7JB 3IQQA 1OMDA 5KTYA 4DIRA 1E8AA 2SCPA 1SR6B 1XK4C 1BT6A 1B8RA 2K8MB 4XJKA 4WRIA 1NIWA 1XFYO 1EG3A 2JWWA 2PSRA 1B4CA 3K21A 3TS5B 2LC5A 4JWQA 2M8UA 1PALA 1QXPA 1KQMC 3CR5X 2WCBA 2MJWB 2FOTA 4PHJA 1HT9A 1MWNA 3LLEA 1WDCC 1IJ5A 1X02A 2BECA 2KFGA 2KAVA 1K96A 1TN4A 1IRJA 1GGWA 1WY9A 3AKAA 4PCWA 2JXCA 2FCEA 4GGFC 3NSIA 1WRKA 2LUCA 3BXKA 1FBVA 1KCYA 3DVEA 3BUOB 2FJUB 2F3YA 3EK7A 1RFJA 5K89A 3D10A 2JZIA 1NX3A 1FPWA 2LANA 1YX8A 1BU3A 1YUTA 1BF5A 2JRFA 2LVKA 1SR6C 3OP0A 4MLWA 4OV2A 1SMGA 4GUKA 1IGVA 4YRUA 2EC6C 3TDUA 4JPZB 2SASA 4N1FA 1CM4A 1SL8A 1SRAA 2I94A 3TS5C 1TCOB 1S6CA 1OMRA 1J7PA 1FW4A 1C7WA 5KSZA 1YVLA 1PRWA 4OVNF 4Q04A 1OZSA 3TDZA 5I2OA 4E68A 1QVIZ 2F2PA 1CDNA 2MA2A 1L2OB 1NCYA 1K95A 3BUMB 2L51A 3I5FC 2L4IA 3I5HC 1JUOA 2TN4A 2EHBA 1FI5A 4XJKB 1B8LA 3VRNA 1DGUA 1WLMA 3DVMA 1SK6D 1OZOA 1BODA 3OX6A 4HRGA 1CDLA 1NUBA 1RWYA 3WHUB 2CT9A 2QPTA 3OB2B 3I5GC 4ORAB 2PRUA 2BL0C 2H61A 4USLA 3VRPA 1CFPA 1LA3A 1GGZA 2L4HA 3DD4A 4JQ0D 3SJSA 1DGVA 2QACA 2WNDA 1YRTB 1GJYA 5CSNA 4ORBB 2CNPA 1IG5A 2Y1NA 3F45A 1J1DA 2L50A 1XFZO 2M49B 4PDZA 5HLOA 3FS7A 1F54A 2BCBA 3EK4A 1MXEA 3DF0A 4M2PA 1DJYA 2AMIA 1ZFSA 2E6WA 1K9KA 1SNLA 1DMOA 3PN7B 1XO5A 2CTNA 5I2QA 1LA0A 1N2DA 3BUWB 1DTLA 3TDIA 3JVTC 1ALWA 4ORCB 2D8NA 5JJGA 4YGBB 1KSMA 2LE9B 3GK4X 3NSKA 1QIWA 2L5XB 5D7FA 4PALA 4A4BA 1AVSA 1XFXO 5G08A 1D1OA 1NCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HF5 A;  3BUN B;  2MLE C;  4N5X A;  4OCI A;  1QAS A;  5HKZ A;  4PHN A;  3A4U B;  2JPT A;  1LXF C;  1J55 A;  1JFJ A;  2M1K B;  5CSJ A;  4C0K A;  1F70 A;  2O5G A;  2RGI A;  4MZJ A;  1DF0 A;  3KHE A;  4F0Z B;  2IS9 A;  1QS7 A;  2KBM A;  1KFX L;  5AEQ A;  4OKH A;  1M46 A;  2LVI A;  3PN7 C;  1F4O A;  2FCD A;  3SG7 A;  1JC2 A;  2NLN A;  2F8P A;  3MSE B;  1N0Y A;  2PAL A;  4P2Y B;  2ZN9 A;  2BE6 A;  4MZK A;  4PHK A;  2M7N A;  2LNK A;  2F3Z A;  1DVI A;  3LCP C;  4GFT A;  3PAT A;  1CMG A;  5DKN A;  2LMV A;  1UUR A;  1A4P A;  1QLS A;  3JTD C;  4C0J A;  3DF0 B;  2KHN A;  1NP8 A;  2LLT A;  1OQP A;  2M1U A;  4QJ5 B;  1CB1 A;  2M97 A;  1BJF A;  4HRE E;  3QRX A;  3KEV A;  1BLQ A;  3BOW A;  1U5I B;  2HQ8 A;  1AK8 A;  1R2U A;  4WQ2 A;  1A75 B;  1CTR A;  2NCP A;  4I5L B;  1IQ5 A;  1ZMZ A;  1EJ3 A;  1A2X A;  1M31 A;  1TOP A;  1B9A A;  5DKR A;  4FTG A;  3LL8 B;  3OX5 A;  1PK0 D;  3M0W A;  5AXI A;  3VRQ A;  1UP5 A;  1R6P A;  1TNW A;  2P6B B;  4M2O A;  4PE7 A;  1M63 B;  1AJ5 A;  1TNP A;  3KPX A;  1IWQ A;  1XA5 A;  2M9G A;  2O60 A;  1S5G Z;  1CFF A;  1J7Q A;  1TTX A;  3CS1 A;  3WXA A;  4P5O E;  1BMO A;  1KK7 Z;  2JNX A;  2M3W A;  3VRR A;  1JWD A;  1KWO B;  2OS8 B;  3LK0 A;  1KK8 B;  1DF0 B;  3BQ3 A;  4FQO A;  1QV0 A;  2M29 A;  1EG4 A;  5I8N A;  1PSB A;  1ALV A;  2I18 A;  4ETO A;  4BY5 A;  1YR5 A;  1CDP A;  4PE0 A;  1CLB A;  2CBL A;  2VRG A;  3CZT X;  4GGN A;  4UPG A;  1KFX S;  1SYM A;  4AOM A;  1RTP 1;  1OOJ A;  2JT0 A;  2GGZ A;  2BBM A;  1SCV A;  1Y0V H;  4I5K A;  3PLF B;  4QJ4 B;  1K8U A;  1XYD A;  4MRX A;  5B8I B;  2K7C A;  2MLF C;  1JBA A;  2DOQ A;  3H4S E;  2H2K A;  1ZUZ A;  3O4Y A;  1V1G A;  1WRL A;  4QJ3 B;  3BUX B;  3OHM B;  1Q80 A;  3FWC A;  1Y1X A;  1J1E A;  2ZND A;  2K7O A;  3E3R A;  4YI9 A;  2ISD A;  1WRZ A;  3BOW B;  2KQY A;  2E30 A;  1MQ1 A;  5I2L A;  1NWD A;  2OS8 C;  1YUR A;  1UHI A;  4HSZ A;  1KK8 C;  1XK4 A;  1A29 A;  2MBX A;  3AKB A;  1GQM A;  3PM8 A;  1F8H A;  2NXQ A;  2WCE A;  3EK8 A;  1MF8 B;  2KI6 D;  3NXA A;  1IJ6 A;  4YGD B;  3VGO A;  3DVJ A;  1AHR A;  4AQI A;  1SL7 A;  2ZFD A;  2LHI A;  2R2I A;  1S3P A;  2F33 A;  5CSI A;  1L2O C;  2LV7 A;  3TUY B;  1UWO A;  1KK7 Y;  4A4C A;  2G2B A;  4L9M A;  1L7Z A;  4GGF A;  5AFP A;  1IQ3 A;  1QIV A;  3EVV A;  2ZKM X;  2PAS A;  1K2H A;  1DJW A;  2ZRS A;  2M7L A;  4N1G A;  2G9B A;  2OTG B;  2LVV A;  3EKH A;  4OR9 B;  5JOL A;  2LCP A;  3SG4 A;  1JFK A;  3GK2 A;  2L98 A;  4DUQ A;  2KI4 B;  1QVI Y;  2JOJ A;  5J3X A;  3EVU A;  2K0J A;  3ZNI A;  1Y6W A;  1NCX A;  1SCM B;  4U8D A;  2JUL A;  2CXJ A;  4I5J A;  3PFV A;  3SG5 A;  4PHM A;  2Q4U A;  4NDB A;  4ZCU A;  1CDM A;  1SW8 A;  2KQ6 A;  3WHT B;  2MAZ A;  2WC8 A;  2KGR A;  3I5I B;  2LHL A;  3OB1 B;  3TUY C;  5ER4 X;  1Y1U A;  2K2A A;  3GOF A;  1NYA A;  1SPY A;  1JSA A;  2KAY A;  1K9P A;  1RJV A;  1YRU B;  2AUC A;  2V53 A;  4XYN A;  1NX2 A;  1ZOT B;  2NZ0 A;  1YTZ C;  1VRK A;  1FF1 A;  2PMY A;  3IF7 A;  2HET A;  1SY9 A;  2Q91 A;  3PAL A;  1KSO A;  5CPV A;  2CCM A;  2A4J A;  1SL9 A;  2LVJ A;  3O78 A;  2KI4 C;  1IKU A;  2JTZ A;  1CMF A;  2WCF A;  4DS7 A;  1XVJ A;  1CKK A;  2BKI B;  1CLL A;  1DJZ A;  1S6I A;  4C0L A;  4CLN A;  1IH0 A;  1JF2 A;  1V1F A;  1S26 D;  1DJX A;  1EL4 A;  1B1G A;  1DJG A;  3CR4 X;  1TCF A;  1MR8 A;  2ZRT A;  2GV5 A;  2KI6 C;  3D0Y A;  2BCA A;  2H61 C;  2F2O A;  2BKH B;  1LVC D;  2KBI A;  3CGA A;  3KO0 A;  1YUU A;  2L2E A;  1QTX A;  4NDC A;  5F6T A;  5PAL A;  2PVB A;  3ICB A;  4MEW A;  1QJT A;  2EC6 B;  1QX7 A;  2MHH A;  2LP3 A;  1QLK A;  2ZNE A;  1K9U A;  1OE9 B;  5D69 A;  5GQQ C;  1C07 A;  2I7A A;  1H4B A;  1UHK A;  4M2Q A;  1NSH A;  4ICB A;  1BR4 B;  2JC2 A;  2LP2 A;  2WOS A;  1DJH A;  4GAO A;  2MRD A;  3I5F B;  2BBN A;  1F71 A;  1DJI A;  1Y1A A;  3FWB A;  3I5H B;  3DVK A;  1REC A;  5TNC A;  1PVA A;  1UHJ A;  4CPV A;  1PUL A;  1G33 A;  3FIA A;  1ZAC A;  5HKY A;  1QAT A;  3SG6 A;  3BYA A;  3I5G B;  1BOC A;  2BL0 B;  2KOT A;  4YI8 A;  2AAO A;  1WLZ A;  1AJ4 A;  2JTT A;  2BE4 A;  2KFH A;  2LLS A;  1XFW O;  4YBH B;  4ZCV A;  1B7T Z;  1UUS A;  3EVR A;  3HX4 A;  5ER5 A;  1S1E A;  2LLU A;  1JF0 A;  4YGE B;  3SG2 A;  3O2P A;  4MBE A;  4MZL A;  4WQ3 A;  1KWO C;  4MRY A;  1PVB A;  5KU1 A;  2K2F A;  1N65 A;  3CTN A;  1W7I B;  2LAP A;  3D0Y B;  4CFQ A;  1B8C A;  1TNX A;  1QX5 B;  3SIA A;  2I2R E;  1K90 D;  3GK1 A;  3CLN A;  4PE4 A;  3WNX B;  2LMU A;  4CID A;  1S5G Y;  2M0R A;  4PE1 A;  2WOR A;  1QV1 A;  1RK9 A;  2Y4Q A;  5FYX A;  3VRO A;  3JVT B;  1PSR A;  2KNE A;  4DCK A;  1KFU L;  1HQV A;  5HYD A;  3O6B A;  3SIB A;  1AUI B;  4IL1 A;  1S36 A;  1J7O A;  2LM5 A;  1BR1 B;  3RLZ A;  3NSL A;  1CLM A;  4NDD A;  1EXR A;  1MUX A;  4TNC A;  2Y1M A;  5DKQ A;  1UHN A;  5HKW A;  3IQO A;  2KAX A;  3TZ1 A;  4CFR A;  1NX1 A;  2NCO A;  2GGM A;  1LKJ A;  1OSA A;  1LIN A;  2JQ6 A;  3HCM A;  1BG1 A;  2L0P A;  1YUS A;  5AER A;  1K94 A;  1C7V A;  1AP4 A;  4MN0 A;  1F55 A;  1U5I A;  2K7B A;  3AAJ A;  3LK1 A;  4GPL B;  4MSP A;  1YX7 A;  5AAN A;  3ZWH A;  1A75 A;  1B7T Y;  4NQG A;  1CNP A;  1MXL C;  2LMT A;  2KFF A;  2BCX A;  3A8R A;  1TIZ A;  1CFD A;  2K7D A;  4YGA A;  1B47 A;  1F4Q A;  3SG3 A;  5IBW A;  2KGB C;  2LUX A;  3CWG A;  4MVF A;  1K93 D;  3C1V A;  5HLV A;  3EKJ A;  2KSP A;  1RRO A;  1SBJ A;  3JTD B;  1G8I A;  2OPO A;  3CR2 A;  1CM1 A;  5CSF A;  3KF9 A;  2OTG C;  2EGD A;  1OMV A;  2JU0 A;  4R1E A;  4D1E A;  2HQW A;  2KYF A;  1G4Y R;  1J7R A;  2Y5I A;  3PSR A;  1KQM B;  4GBA A;  4GNK B;  1WDC B;  1QX2 A;  1XFU O;  2KYC A;  1DT7 B;  1NPQ A;  1UHH A;  2JT3 A;  4YGC B;  1S6J A;  2B1U A;  4DRW A;  1CFC A;  1M45 A;  1SCM C;  1SKT A;  2JT8 A;  1TRF A;  2COL B;  1FI6 A;  2KDH A;  2JNF A;  1EH2 A;  1XFV O;  3AAK A;  1A03 A;  1NX0 A;  2K61 A;  4AQJ A;  3NSO A;  1H8B A;  2HPS A;  1KFU S;  2ZN8 A;  3I5I C;  5BPJ A;  4HRH A;  1TNQ A;  3RM1 A;  4I5N B;  4BY4 A;  1KQV A;  1YVH A;  1M39 A;  1ODB A;  2JXL A;  1MHO A;  1W7J B;  3IQQ A;  1OMD A;  5KTY A;  4DIR A;  1E8A A;  2SCP A;  1SR6 B;  1XK4 C;  1BT6 A;  1B8R A;  2K8M B;  4XJK A;  4WRI A;  1NIW A;  1XFY O;  1EG3 A;  2JWW A;  2PSR A;  1B4C A;  3K21 A;  3TS5 B;  2LC5 A;  4JWQ A;  2M8U A;  1PAL A;  1QXP A;  1KQM C;  3CR5 X;  2WCB A;  2MJW B;  2FOT A;  4PHJ A;  1HT9 A;  1MWN A;  3LLE A;  1WDC C;  1IJ5 A;  1X02 A;  2BEC A;  2KFG A;  2KAV A;  1K96 A;  1TN4 A;  1IRJ A;  1GGW A;  1WY9 A;  3AKA A;  4PCW A;  2JXC A;  2FCE A;  4GGF C;  3NSI A;  1WRK A;  2LUC A;  3BXK A;  1FBV A;  1KCY A;  3DVE A;  3BUO B;  2FJU B;  2F3Y A;  3EK7 A;  1RFJ A;  5K89 A;  3D10 A;  2JZI A;  1NX3 A;  1FPW A;  2LAN A;  1YX8 A;  1BU3 A;  1YUT A;  1BF5 A;  2JRF A;  2LVK A;  1SR6 C;  3OP0 A;  4MLW A;  4OV2 A;  1SMG A;  4GUK A;  1IGV A;  4YRU A;  2EC6 C;  3TDU A;  4JPZ B;  2SAS A;  4N1F A;  1CM4 A;  1SL8 A;  1SRA A;  2I94 A;  3TS5 C;  1TCO B;  1S6C A;  1OMR A;  1J7P A;  1FW4 A;  1C7W A;  5KSZ A;  1YVL A;  1PRW A;  4OVN F;  4Q04 A;  1OZS A;  3TDZ A;  5I2O A;  4E68 A;  1QVI Z;  2F2P A;  1CDN A;  2MA2 A;  1L2O B;  1NCY A;  1K95 A;  3BUM B;  2L51 A;  3I5F C;  2L4I A;  3I5H C;  1JUO A;  2TN4 A;  2EHB A;  1FI5 A;  4XJK B;  1B8L A;  3VRN A;  1DGU A;  1WLM A;  3DVM A;  1SK6 D;  1OZO A;  1BOD A;  3OX6 A;  4HRG A;  1CDL A;  1NUB A;  1RWY A;  3WHU B;  2CT9 A;  2QPT A;  3OB2 B;  3I5G C;  4ORA B;  2PRU A;  2BL0 C;  2H61 A;  4USL A;  3VRP A;  1CFP A;  1LA3 A;  1GGZ A;  2L4H A;  3DD4 A;  4JQ0 D;  3SJS A;  1DGV A;  2QAC A;  2WND A;  1YRT B;  1GJY A;  5CSN A;  4ORB B;  2CNP A;  1IG5 A;  2Y1N A;  3F45 A;  1J1D A;  2L50 A;  1XFZ O;  2M49 B;  4PDZ A;  5HLO A;  3FS7 A;  1F54 A;  2BCB A;  3EK4 A;  1MXE A;  3DF0 A;  4M2P A;  1DJY A;  2AMI A;  1ZFS A;  2E6W A;  1K9K A;  1SNL A;  1DMO A;  3PN7 B;  1XO5 A;  2CTN A;  5I2Q A;  1LA0 A;  1N2D A;  3BUW B;  1DTL A;  3TDI A;  3JVT C;  1ALW A;  4ORC B;  2D8N A;  5JJG A;  4YGB B;  1KSM A;  2LE9 B;  3GK4 X;  3NSK A;  1QIW A;  2L5X B;  5D7F A;  4PAL A;  4A4B A;  1AVS A;  1XFX O;  5G08 A;  1D1O A;  1NCZ A; 
#chains in the Genus database with same CATH topology
 2HF5 A;  3BUN B;  2MLE C;  4N5X A;  3CZ0 A;  1OOH A;  4OCI A;  5EL2 A;  1QAS A;  5HKZ A;  4PHN A;  3A4U B;  2JPT A;  1LXF C;  1J55 A;  1JFJ A;  3B86 A;  2KPH A;  2M1K B;  5CSJ A;  4C0K A;  1F70 A;  2O5G A;  2RGI A;  2JPO A;  1DF0 A;  3KHE A;  4MZJ A;  4F0Z B;  2IS9 A;  1QS7 A;  2KBM A;  1KFX L;  5AEQ A;  4OKH A;  3D78 A;  1M46 A;  2LVI A;  3PN7 C;  4JD9 A;  1F4O A;  2FCD A;  3CZ1 A;  3SG7 A;  2NLN A;  2F8P A;  1JC2 A;  3MSE B;  3Q8I A;  1N0Y A;  1C3Z A;  2PAL A;  2ZN9 A;  2BE6 A;  4MZK A;  4P2Y B;  2M7N A;  1OOF A;  2F3Z A;  1DVI A;  2LNK A;  3B7A A;  3LCP C;  3PAT A;  4GFT A;  1CMG A;  5DKN A;  4FQT A;  2LMV A;  1UUR A;  1A4P A;  1QLS A;  3JTD C;  3K1E A;  4C0J A;  3DF0 B;  2KHN A;  1NP8 A;  2LLT A;  1OQP A;  2M1U A;  4QJ5 B;  1CB1 A;  2M97 A;  1BJF A;  4HRE E;  3QRX A;  3KEV A;  1BLQ A;  3BOW A;  1U5I B;  2HQ8 A;  1AK8 A;  1TWO A;  2YGU A;  1R2U A;  4WQ2 A;  1A75 B;  1CTR A;  2NCP A;  3OGN A;  4I5L B;  1IQ5 A;  1ZMZ A;  1EJ3 A;  3S0B A;  1A2X A;  1M31 A;  1TOP A;  1B9A A;  5DKR A;  1DEK A;  2WCL A;  4FTG A;  3LL8 B;  2KLD A;  3OX5 A;  1PK0 D;  3M0W A;  2K60 A;  5AXI A;  3VRQ A;  1UP5 A;  1R6P A;  1TNW A;  3L4L A;  2P6B B;  4M2O A;  4PE7 A;  1M63 B;  1AJ5 A;  1TNP A;  3KPX A;  1IWQ A;  1XA5 A;  2M9G A;  2O60 A;  4KYN A;  1S5G Z;  2L2C A;  1CFF A;  1J7Q A;  1SSE B;  1TTX A;  3CS1 A;  3CZ2 A;  3WXA A;  4P5O E;  1Z2C B;  1BMO A;  1KK7 Z;  2JNX A;  3PM2 A;  2M3W A;  3VRR A;  1JWD A;  1KWO B;  3UNW A;  2OS8 B;  4PHK A;  3LK0 A;  1KK8 B;  4INW A;  1DF0 B;  3BQ3 A;  4FQO A;  1QV0 A;  2M29 A;  1EG4 A;  5I8N A;  1PSB A;  1ALV A;  2I18 A;  2WC6 A;  4ETO A;  4IJ7 A;  4BY5 A;  1YR5 A;  1CDP A;  1T14 A;  4PE0 A;  1CLB A;  2CBL A;  2VRG A;  3CZT X;  4GGN A;  4UPG A;  1KFX S;  1SYM A;  4AOM A;  1RTP 1;  1OOJ A;  2JT0 A;  2GGZ A;  2BBM A;  1SCV A;  1Y0V H;  4I5K A;  3PLF B;  4QJ4 B;  1K8U A;  1XYD A;  4MRX A;  5B8I B;  2K7C A;  2MLF C;  2P70 A;  1JBA A;  2DOQ A;  3H4S E;  2H2K A;  1ZUZ A;  3O4Y A;  1V1G A;  1WRL A;  4QJ3 B;  3BUX B;  3OHM B;  1Q80 A;  3FWC A;  1Y1X A;  1J1E A;  2ZND A;  2K7O A;  3E3R A;  3D75 A;  4YI9 A;  1WRZ A;  3BOW B;  2KQY A;  2ISD A;  2E30 A;  1MQ1 A;  1Z4H A;  5I2L A;  1NWD A;  2OS8 C;  1YUR A;  1UHI A;  4HSZ A;  1KK8 C;  1XK4 A;  1A29 A;  3CDN A;  2MBX A;  3AKB A;  1GQM A;  3PM8 A;  1F8H A;  2NXQ A;  2WCE A;  3EK8 A;  1MF8 B;  2KI6 D;  3O4X A;  3NXA A;  1IJ6 A;  4YGD B;  3VGO A;  3D73 A;  1AHR A;  3DVJ A;  4AQI A;  1SL7 A;  2ZFD A;  2LHI A;  3L4A A;  2R2I A;  1S3P A;  2F33 A;  5CSI A;  1L2O C;  2LV7 A;  3TUY B;  2WCM A;  1UWO A;  2WCJ A;  1KK7 Y;  4A4C A;  2G2B A;  4L9M A;  1GM0 A;  1L7Z A;  4GGF A;  5AFP A;  1IQ3 A;  1QIV A;  3EVV A;  2ZKM X;  2PAS A;  1K2H A;  1DJW A;  2ZRS A;  2M7L A;  4N1G A;  2P71 A;  2G9B A;  2OTG B;  2LVV A;  3EKH A;  4OR9 B;  3NGV A;  5JOL A;  2LCP A;  3SG4 A;  1JFK A;  3GK2 A;  2L98 A;  3B88 A;  4DUQ A;  2KI4 B;  1QVI Y;  2JOJ A;  5J3X A;  3EVU A;  2K0J A;  3ZNI A;  1Y6W A;  1NCX A;  1SCM B;  4U8D A;  2JUL A;  2CXJ A;  4I5J A;  3PFV A;  3SG5 A;  5FI6 A;  4PHM A;  2Q4U A;  4NDB A;  4ZCU A;  1CDM A;  1SW8 A;  2KQ6 A;  3WHT B;  2MAZ A;  2WC8 A;  2KGR A;  3I5I B;  1DC1 A;  5DIC A;  2LHL A;  3OB1 B;  3TUY C;  5ER4 X;  1Y1U A;  2K2A A;  3GOF A;  1NYA A;  1SPY A;  1JSA A;  1W9Z A;  2KAY A;  1K9P A;  1P28 A;  1RJV A;  1YRU B;  2AUC A;  2V53 A;  4XYN A;  1NX2 A;  1ZOT B;  2NZ0 A;  1YTZ C;  1VRK A;  1FF1 A;  2PMY A;  3IF7 A;  2HET A;  3OBV A;  1SY9 A;  2Q91 A;  3PAL A;  1KSO A;  5CPV A;  2CCM A;  2A4J A;  1SL9 A;  2LVJ A;  3O78 A;  2KI4 C;  1IKU A;  2JTZ A;  3PJI A;  1CMF A;  2WCF A;  4DS7 A;  1XVJ A;  1CKK A;  2BKI B;  1CLL A;  1DJZ A;  2GTE A;  4JKT A;  1S6I A;  2L5Y A;  4C0L A;  4CLN A;  1IH0 A;  1JF2 A;  1V1F A;  1S26 D;  1DJX A;  1EL4 A;  2PQL A;  1DEL A;  1DJG A;  3R1P A;  1B1G A;  3CR4 X;  1TCF A;  1MR8 A;  2ZRT A;  2GV5 A;  2KI6 C;  3D0Y A;  2BCA A;  2H61 C;  2F2O A;  2BKH B;  1LVC D;  2KBI A;  3CGA A;  3KO0 A;  1YUU A;  2L2E A;  1QTX A;  4NDC A;  5F6T A;  5PAL A;  2PYQ A;  3DYE A;  2PVB A;  3NHI A;  3ICB A;  2QEO A;  3R1O A;  4MEW A;  1QJT A;  2EC6 B;  1QX7 A;  2MHH A;  1OOI X;  2QEV A;  2LP3 A;  3S0E A;  2WCH A;  1QLK A;  4F7F A;  2ZNE A;  1K9U A;  3VB1 A;  1OE9 B;  3DZT A;  5D69 A;  5GQQ C;  3R1V A;  3S0D A;  1C07 A;  2I7A A;  1H4B A;  1UHK A;  4M2Q A;  1NSH A;  2WC5 A;  4ICB A;  1BR4 B;  5D3O A;  1TUJ A;  2JC2 A;  2LP2 A;  2WOS A;  1DJH A;  2H8V A;  4GAO A;  2MRD A;  3I5F B;  2BBN A;  1F71 A;  1DJI A;  1Y1A A;  3FWB A;  3I5H B;  3DVK A;  1REC A;  5TNC A;  1PVA A;  1UHJ A;  4CPV A;  1PUL A;  1G33 A;  3D74 A;  3FIA A;  1ZAC A;  5HKY A;  1QAT A;  3SG6 A;  3BYA A;  3I5G B;  1BOC A;  2BL0 B;  2KOT A;  4YI8 A;  2AAO A;  1WLZ A;  3FE6 A;  1AJ4 A;  2JTT A;  2BE4 A;  2KFH A;  1C3Y A;  2LLS A;  1XFW O;  4YBH B;  4ZCV A;  1B7T Z;  1UUS A;  3EVR A;  3HX4 A;  5ER5 A;  1S1E A;  2LLU A;  1JF0 A;  4YGE B;  3SG2 A;  3O2P A;  3FE9 A;  4MBE A;  4MZL A;  4WQ3 A;  1KWO C;  3CAB A;  4MRY A;  1PVB A;  5KU1 A;  2K2F A;  1N65 A;  3CTN A;  1W7I B;  2LAP A;  3D0Y B;  4CFQ A;  1B8C A;  1TNX A;  1QX5 B;  3SIA A;  1OOG A;  2I2R E;  5I94 A;  1K90 D;  3GK1 A;  3CLN A;  4PE4 A;  3WNX B;  2LMU A;  3NHT A;  4CID A;  3SS3 A;  1S5G Y;  2M0R A;  4PE1 A;  4INX A;  2WOR A;  1QV1 A;  1RK9 A;  2Y4Q A;  5FYX A;  3VRO A;  3JVT B;  1PSR A;  2KNE A;  4DCK A;  1KFU L;  2KLE A;  1HQV A;  5HYD A;  3O6B A;  3SIB A;  1AUI B;  4IL1 A;  1S36 A;  1J7O A;  2LM5 A;  1BR1 B;  3RLZ A;  3NSL A;  1CLM A;  4NDD A;  1EXR A;  1MUX A;  2QEH A;  4TNC A;  3L47 A;  2Y1M A;  5DKQ A;  1ORG A;  1UHN A;  3IQO A;  2KAX A;  3R72 A;  5HKW A;  3TZ1 A;  1NX1 A;  2NCO A;  4CFR A;  2GGM A;  1LKJ A;  1OSA A;  1LIN A;  2JQ6 A;  3HCM A;  1BG1 A;  2L0P A;  1YUS A;  5AER A;  1K94 A;  1C7V A;  1AP4 A;  1IIO A;  4MN0 A;  1F55 A;  1U5I A;  2K7B A;  3AAJ A;  3LK1 A;  4GPL B;  4MSP A;  1YX7 A;  5AAN A;  3ZWH A;  1A75 A;  1B7T Y;  4NQG A;  1CNP A;  1MXL C;  2LMT A;  2KFF A;  2BCX A;  3A8R A;  1TIZ A;  3IVT A;  1CFD A;  2K7D A;  4YGA A;  1B47 A;  1F4Q A;  3SG3 A;  5IBW A;  2KGB C;  2LUX A;  3CWG A;  3RZS A;  4MVF A;  1K93 D;  3C1V A;  5HLV A;  3EKJ A;  2KSP A;  1RRO A;  1SBJ A;  3JTD B;  1G8I A;  2OPO A;  3CR2 A;  3BFH A;  1CM1 A;  5CSF A;  3KF9 A;  2OTG C;  2EGD A;  1OMV A;  2JU0 A;  4R1E A;  4D1E A;  3EG5 B;  2HQW A;  2KYF A;  1G4Y R;  1J7R A;  2Y5I A;  3PSR A;  1KQM B;  2QEB A;  4GBA A;  4GNK B;  1WDC B;  1QX2 A;  5HL1 A;  1XFU O;  2KYC A;  1DT7 B;  1NPQ A;  1UHH A;  2JT3 A;  4YGC B;  1S6J A;  2B1U A;  4DRW A;  1CFC A;  1M45 A;  1SCM C;  1SKT A;  2JT8 A;  1TRF A;  3V2L A;  2COL B;  1FI6 A;  2KDH A;  2WCK A;  2JNF A;  1EH2 A;  3S0F A;  1XFV O;  3AAK A;  1A03 A;  1NX0 A;  2K61 A;  3N7H A;  4AQJ A;  3NSO A;  1H8B A;  2HPS A;  1KFU S;  2ZN8 A;  3I5I C;  5BPJ A;  4HRH A;  1TNQ A;  3RM1 A;  4I5N B;  4BY4 A;  1KQV A;  1YVH A;  1M39 A;  1ODB A;  3B6X A;  2JXL A;  1MHO A;  1W7J B;  2ERB A;  3IQQ A;  1OMD A;  5KTY A;  4DIR A;  1E8A A;  2SCP A;  1SR6 B;  1XK4 C;  1BT6 A;  1B8R A;  2K8M B;  4XJK A;  4WRI A;  1NIW A;  1XFY O;  1EG3 A;  2JWW A;  2PSR A;  3D76 A;  1B4C A;  3K21 A;  3TS5 B;  2LC5 A;  4JWQ A;  2M8U A;  1PAL A;  1QXP A;  1KQM C;  3CR5 X;  2WCB A;  2MJW B;  2FOT A;  4PHJ A;  1OW4 A;  1HT9 A;  1MWN A;  3LLE A;  1WDC C;  1IJ5 A;  1X02 A;  2BEC A;  2KFG A;  1QWV A;  2KAV A;  1K96 A;  1TN4 A;  1IRJ A;  1GGW A;  1WY9 A;  3AKA A;  4PCW A;  2JXC A;  2FCE A;  4GGF C;  3NSI A;  1WRK A;  2LUC A;  3BXK A;  1FBV A;  1KCY A;  3DVE A;  3BUO B;  2FJU B;  2F3Y A;  3B87 A;  3EK7 A;  1RFJ A;  5K89 A;  3D10 A;  2JZI A;  3UO9 A;  1NX3 A;  1FPW A;  1TUZ A;  2LAN A;  1YX8 A;  1BU3 A;  4OZD A;  1YUT A;  1BF5 A;  2JRF A;  2LVK A;  1SR6 C;  3OP0 A;  4MLW A;  4OV2 A;  1SMG A;  2BNX A;  4GUK A;  5FI7 A;  1IGV A;  4YRU A;  2EC6 C;  3TDU A;  4JPZ B;  2SAS A;  4N1F A;  1CM4 A;  1SL8 A;  1SRA A;  2I94 A;  3TS5 C;  1TCO B;  1S6C A;  1OMR A;  1J7P A;  3D77 A;  1FW4 A;  1C7W A;  5KSZ A;  1YVL A;  1PRW A;  4OVN F;  4Q04 A;  2BAP A;  1OZS A;  3TDZ A;  1XFR A;  5I2O A;  1QVI Z;  4E68 A;  3CYZ A;  3DY9 A;  2F2P A;  5FI2 A;  1CDN A;  2MA2 A;  1L2O B;  3SS5 A;  1NCY A;  1K95 A;  3BUM B;  2L51 A;  4PT1 A;  3I5F C;  2L4I A;  2QDI A;  3I5H C;  1JUO A;  2TN4 A;  2EHB A;  1FI5 A;  4XJK B;  1B8L A;  3S0G A;  3VRN A;  1DGU A;  1WLM A;  3DVM A;  1SK6 D;  1OZO A;  1BOD A;  3OX6 A;  4HRG A;  1CDL A;  1NUB A;  1RWY A;  3WHU B;  2CT9 A;  2QPT A;  3OB2 B;  3FE8 A;  3I5G C;  4ORA B;  2PRU A;  2BL0 C;  2H61 A;  1LS8 A;  4USL A;  3VRP A;  3BFB A;  3DXL A;  1CFP A;  1LA3 A;  1GGZ A;  2L4H A;  3DD4 A;  4JQ0 D;  3SJS A;  1DGV A;  2QAC A;  2WND A;  1YRT B;  1GJY A;  5CSN A;  4ORB B;  2CNP A;  1IG5 A;  2Y1N A;  3F45 A;  1J1D A;  2L50 A;  1XFZ O;  2M49 B;  4PDZ A;  5HLO A;  3FS7 A;  3SS4 A;  1F54 A;  2BCB A;  3EK4 A;  1MXE A;  3DF0 A;  4M2P A;  1DJY A;  2AMI A;  1ZFS A;  2E6W A;  1K9K A;  1SNL A;  3QME A;  1DMO A;  3PN7 B;  1XO5 A;  2CTN A;  5I2Q A;  3BFA A;  3S0A A;  2FJY A;  1LA0 A;  1N2D A;  3BUW B;  1DTL A;  3TDI A;  3JVT C;  1ALW A;  4ORC B;  2D8N A;  5JJG A;  4YGB B;  1KSM A;  2LE9 B;  3BJH A;  3GK4 X;  3NSK A;  1DQE A;  1QIW A;  2L5X B;  5D7F A;  4PAL A;  4A4B A;  1AVS A;  1XFX O;  5G08 A;  1D1O A;  1NCZ A; 
#chains in the Genus database with same CATH homology
 2HF5 A;  3BUN B;  2MLE C;  4N5X A;  4OCI A;  1QAS A;  5HKZ A;  4PHN A;  3A4U B;  2JPT A;  1LXF C;  1J55 A;  1JFJ A;  2M1K B;  5CSJ A;  4C0K A;  1F70 A;  2O5G A;  2RGI A;  4MZJ A;  1DF0 A;  3KHE A;  4F0Z B;  2IS9 A;  1QS7 A;  2KBM A;  1KFX L;  5AEQ A;  4OKH A;  1M46 A;  2LVI A;  3PN7 C;  1F4O A;  2FCD A;  3SG7 A;  1JC2 A;  2NLN A;  2F8P A;  3MSE B;  1N0Y A;  2PAL A;  4P2Y B;  2ZN9 A;  2BE6 A;  4MZK A;  4PHK A;  2M7N A;  2LNK A;  2F3Z A;  1DVI A;  3LCP C;  4GFT A;  3PAT A;  1CMG A;  5DKN A;  2LMV A;  1UUR A;  1A4P A;  1QLS A;  3JTD C;  4C0J A;  3DF0 B;  2KHN A;  1NP8 A;  2LLT A;  1OQP A;  2M1U A;  4QJ5 B;  1CB1 A;  2M97 A;  1BJF A;  4HRE E;  3QRX A;  3KEV A;  1BLQ A;  3BOW A;  1U5I B;  2HQ8 A;  1AK8 A;  1R2U A;  4WQ2 A;  1A75 B;  1CTR A;  2NCP A;  4I5L B;  1IQ5 A;  1ZMZ A;  1EJ3 A;  1A2X A;  1M31 A;  1TOP A;  1B9A A;  5DKR A;  4FTG A;  3LL8 B;  3OX5 A;  1PK0 D;  3M0W A;  5AXI A;  3VRQ A;  1UP5 A;  1R6P A;  1TNW A;  2P6B B;  4M2O A;  4PE7 A;  1M63 B;  1AJ5 A;  1TNP A;  3KPX A;  1IWQ A;  1XA5 A;  2M9G A;  2O60 A;  1S5G Z;  1CFF A;  1J7Q A;  1TTX A;  3CS1 A;  3WXA A;  4P5O E;  1BMO A;  1KK7 Z;  2JNX A;  2M3W A;  3VRR A;  1JWD A;  1KWO B;  2OS8 B;  3LK0 A;  1KK8 B;  1DF0 B;  3BQ3 A;  4FQO A;  1QV0 A;  2M29 A;  1EG4 A;  5I8N A;  1PSB A;  1ALV A;  2I18 A;  4ETO A;  4BY5 A;  1YR5 A;  1CDP A;  4PE0 A;  1CLB A;  2CBL A;  2VRG A;  3CZT X;  4GGN A;  4UPG A;  1KFX S;  1SYM A;  4AOM A;  1RTP 1;  1OOJ A;  2JT0 A;  2GGZ A;  2BBM A;  1SCV A;  1Y0V H;  4I5K A;  3PLF B;  4QJ4 B;  1K8U A;  1XYD A;  4MRX A;  5B8I B;  2K7C A;  2MLF C;  1JBA A;  2DOQ A;  3H4S E;  2H2K A;  1ZUZ A;  3O4Y A;  1V1G A;  1WRL A;  4QJ3 B;  3BUX B;  3OHM B;  1Q80 A;  3FWC A;  1Y1X A;  1J1E A;  2ZND A;  2K7O A;  3E3R A;  4YI9 A;  2ISD A;  1WRZ A;  3BOW B;  2KQY A;  2E30 A;  1MQ1 A;  5I2L A;  1NWD A;  2OS8 C;  1YUR A;  1UHI A;  4HSZ A;  1KK8 C;  1XK4 A;  1A29 A;  2MBX A;  3AKB A;  1GQM A;  3PM8 A;  1F8H A;  2NXQ A;  2WCE A;  3EK8 A;  1MF8 B;  2KI6 D;  3NXA A;  1IJ6 A;  4YGD B;  3VGO A;  3DVJ A;  1AHR A;  4AQI A;  1SL7 A;  2ZFD A;  2LHI A;  2R2I A;  1S3P A;  2F33 A;  5CSI A;  1L2O C;  2LV7 A;  3TUY B;  1UWO A;  1KK7 Y;  4A4C A;  2G2B A;  4L9M A;  1L7Z A;  4GGF A;  5AFP A;  1IQ3 A;  1QIV A;  3EVV A;  2ZKM X;  2PAS A;  1K2H A;  1DJW A;  2ZRS A;  2M7L A;  4N1G A;  2G9B A;  2OTG B;  2LVV A;  3EKH A;  4OR9 B;  5JOL A;  2LCP A;  3SG4 A;  1JFK A;  3GK2 A;  2L98 A;  4DUQ A;  2KI4 B;  1QVI Y;  2JOJ A;  5J3X A;  3EVU A;  2K0J A;  3ZNI A;  1Y6W A;  1NCX A;  1SCM B;  4U8D A;  2JUL A;  2CXJ A;  4I5J A;  3PFV A;  3SG5 A;  4PHM A;  2Q4U A;  4NDB A;  4ZCU A;  1CDM A;  1SW8 A;  2KQ6 A;  3WHT B;  2MAZ A;  2WC8 A;  2KGR A;  3I5I B;  2LHL A;  3OB1 B;  3TUY C;  5ER4 X;  1Y1U A;  2K2A A;  3GOF A;  1NYA A;  1SPY A;  1JSA A;  2KAY A;  1K9P A;  1RJV A;  1YRU B;  2AUC A;  2V53 A;  4XYN A;  1NX2 A;  1ZOT B;  2NZ0 A;  1YTZ C;  1VRK A;  1FF1 A;  2PMY A;  3IF7 A;  2HET A;  1SY9 A;  2Q91 A;  3PAL A;  1KSO A;  5CPV A;  2CCM A;  2A4J A;  1SL9 A;  2LVJ A;  3O78 A;  2KI4 C;  1IKU A;  2JTZ A;  1CMF A;  2WCF A;  4DS7 A;  1XVJ A;  1CKK A;  2BKI B;  1CLL A;  1DJZ A;  1S6I A;  4C0L A;  4CLN A;  1IH0 A;  1JF2 A;  1V1F A;  1S26 D;  1DJX A;  1EL4 A;  1B1G A;  1DJG A;  3CR4 X;  1TCF A;  1MR8 A;  2ZRT A;  2GV5 A;  2KI6 C;  3D0Y A;  2BCA A;  2H61 C;  2F2O A;  2BKH B;  1LVC D;  2KBI A;  3CGA A;  3KO0 A;  1YUU A;  2L2E A;  1QTX A;  4NDC A;  5F6T A;  5PAL A;  2PVB A;  3ICB A;  4MEW A;  1QJT A;  2EC6 B;  1QX7 A;  2MHH A;  2LP3 A;  1QLK A;  2ZNE A;  1K9U A;  1OE9 B;  5D69 A;  5GQQ C;  1C07 A;  2I7A A;  1H4B A;  1UHK A;  4M2Q A;  1NSH A;  4ICB A;  1BR4 B;  2JC2 A;  2LP2 A;  2WOS A;  1DJH A;  4GAO A;  2MRD A;  3I5F B;  2BBN A;  1F71 A;  1DJI A;  1Y1A A;  3FWB A;  3I5H B;  3DVK A;  1REC A;  5TNC A;  1PVA A;  1UHJ A;  4CPV A;  1PUL A;  1G33 A;  3FIA A;  1ZAC A;  5HKY A;  1QAT A;  3SG6 A;  3BYA A;  3I5G B;  1BOC A;  2BL0 B;  2KOT A;  4YI8 A;  2AAO A;  1WLZ A;  1AJ4 A;  2JTT A;  2BE4 A;  2KFH A;  2LLS A;  1XFW O;  4YBH B;  4ZCV A;  1B7T Z;  1UUS A;  3EVR A;  3HX4 A;  5ER5 A;  1S1E A;  2LLU A;  1JF0 A;  4YGE B;  3SG2 A;  3O2P A;  4MBE A;  4MZL A;  4WQ3 A;  1KWO C;  4MRY A;  1PVB A;  5KU1 A;  2K2F A;  1N65 A;  3CTN A;  1W7I B;  2LAP A;  3D0Y B;  4CFQ A;  1B8C A;  1TNX A;  1QX5 B;  3SIA A;  2I2R E;  1K90 D;  3GK1 A;  3CLN A;  4PE4 A;  3WNX B;  2LMU A;  4CID A;  1S5G Y;  2M0R A;  4PE1 A;  2WOR A;  1QV1 A;  1RK9 A;  2Y4Q A;  5FYX A;  3VRO A;  3JVT B;  1PSR A;  2KNE A;  4DCK A;  1KFU L;  1HQV A;  5HYD A;  3O6B A;  3SIB A;  1AUI B;  4IL1 A;  1S36 A;  1J7O A;  2LM5 A;  1BR1 B;  3RLZ A;  3NSL A;  1CLM A;  4NDD A;  1EXR A;  1MUX A;  4TNC A;  2Y1M A;  5DKQ A;  1UHN A;  5HKW A;  3IQO A;  2KAX A;  3TZ1 A;  4CFR A;  1NX1 A;  2NCO A;  2GGM A;  1LKJ A;  1OSA A;  1LIN A;  2JQ6 A;  3HCM A;  1BG1 A;  2L0P A;  1YUS A;  5AER A;  1K94 A;  1C7V A;  1AP4 A;  4MN0 A;  1F55 A;  1U5I A;  2K7B A;  3AAJ A;  3LK1 A;  4GPL B;  4MSP A;  1YX7 A;  5AAN A;  3ZWH A;  1A75 A;  1B7T Y;  4NQG A;  1CNP A;  1MXL C;  2LMT A;  2KFF A;  2BCX A;  3A8R A;  1TIZ A;  1CFD A;  2K7D A;  4YGA A;  1B47 A;  1F4Q A;  3SG3 A;  5IBW A;  2KGB C;  2LUX A;  3CWG A;  4MVF A;  1K93 D;  3C1V A;  5HLV A;  3EKJ A;  2KSP A;  1RRO A;  1SBJ A;  3JTD B;  1G8I A;  2OPO A;  3CR2 A;  1CM1 A;  5CSF A;  3KF9 A;  2OTG C;  2EGD A;  1OMV A;  2JU0 A;  4R1E A;  4D1E A;  2HQW A;  2KYF A;  1G4Y R;  1J7R A;  2Y5I A;  3PSR A;  1KQM B;  4GBA A;  4GNK B;  1WDC B;  1QX2 A;  1XFU O;  2KYC A;  1DT7 B;  1NPQ A;  1UHH A;  2JT3 A;  4YGC B;  1S6J A;  2B1U A;  4DRW A;  1CFC A;  1M45 A;  1SCM C;  1SKT A;  2JT8 A;  1TRF A;  2COL B;  1FI6 A;  2KDH A;  2JNF A;  1EH2 A;  1XFV O;  3AAK A;  1A03 A;  1NX0 A;  2K61 A;  4AQJ A;  3NSO A;  1H8B A;  2HPS A;  1KFU S;  2ZN8 A;  3I5I C;  5BPJ A;  4HRH A;  1TNQ A;  3RM1 A;  4I5N B;  4BY4 A;  1KQV A;  1YVH A;  1M39 A;  1ODB A;  2JXL A;  1MHO A;  1W7J B;  3IQQ A;  1OMD A;  5KTY A;  4DIR A;  1E8A A;  2SCP A;  1SR6 B;  1XK4 C;  1BT6 A;  1B8R A;  2K8M B;  4XJK A;  4WRI A;  1NIW A;  1XFY O;  1EG3 A;  2JWW A;  2PSR A;  1B4C A;  3K21 A;  3TS5 B;  2LC5 A;  4JWQ A;  2M8U A;  1PAL A;  1QXP A;  1KQM C;  3CR5 X;  2WCB A;  2MJW B;  2FOT A;  4PHJ A;  1HT9 A;  1MWN A;  3LLE A;  1WDC C;  1IJ5 A;  1X02 A;  2BEC A;  2KFG A;  2KAV A;  1K96 A;  1TN4 A;  1IRJ A;  1GGW A;  1WY9 A;  3AKA A;  4PCW A;  2JXC A;  2FCE A;  4GGF C;  3NSI A;  1WRK A;  2LUC A;  3BXK A;  1FBV A;  1KCY A;  3DVE A;  3BUO B;  2FJU B;  2F3Y A;  3EK7 A;  1RFJ A;  5K89 A;  3D10 A;  2JZI A;  1NX3 A;  1FPW A;  2LAN A;  1YX8 A;  1BU3 A;  1YUT A;  1BF5 A;  2JRF A;  2LVK A;  1SR6 C;  3OP0 A;  4MLW A;  4OV2 A;  1SMG A;  4GUK A;  1IGV A;  4YRU A;  2EC6 C;  3TDU A;  4JPZ B;  2SAS A;  4N1F A;  1CM4 A;  1SL8 A;  1SRA A;  2I94 A;  3TS5 C;  1TCO B;  1S6C A;  1OMR A;  1J7P A;  1FW4 A;  1C7W A;  5KSZ A;  1YVL A;  1PRW A;  4OVN F;  4Q04 A;  1OZS A;  3TDZ A;  5I2O A;  4E68 A;  1QVI Z;  2F2P A;  1CDN A;  2MA2 A;  1L2O B;  1NCY A;  1K95 A;  3BUM B;  2L51 A;  3I5F C;  2L4I A;  3I5H C;  1JUO A;  2TN4 A;  2EHB A;  1FI5 A;  4XJK B;  1B8L A;  3VRN A;  1DGU A;  1WLM A;  3DVM A;  1SK6 D;  1OZO A;  1BOD A;  3OX6 A;  4HRG A;  1CDL A;  1NUB A;  1RWY A;  3WHU B;  2CT9 A;  2QPT A;  3OB2 B;  3I5G C;  4ORA B;  2PRU A;  2BL0 C;  2H61 A;  4USL A;  3VRP A;  1CFP A;  1LA3 A;  1GGZ A;  2L4H A;  3DD4 A;  4JQ0 D;  3SJS A;  1DGV A;  2QAC A;  2WND A;  1YRT B;  1GJY A;  5CSN A;  4ORB B;  2CNP A;  1IG5 A;  2Y1N A;  3F45 A;  1J1D A;  2L50 A;  1XFZ O;  2M49 B;  4PDZ A;  5HLO A;  3FS7 A;  1F54 A;  2BCB A;  3EK4 A;  1MXE A;  3DF0 A;  4M2P A;  1DJY A;  2AMI A;  1ZFS A;  2E6W A;  1K9K A;  1SNL A;  1DMO A;  3PN7 B;  1XO5 A;  2CTN A;  5I2Q A;  1LA0 A;  1N2D A;  3BUW B;  1DTL A;  3TDI A;  3JVT C;  1ALW A;  4ORC B;  2D8N A;  5JJG A;  4YGB B;  1KSM A;  2LE9 B;  3GK4 X;  3NSK A;  1QIW A;  2L5X B;  5D7F A;  4PAL A;  4A4B A;  1AVS A;  1XFX O;  5G08 A;  1D1O A;  1NCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...