2HPSA

Crystal structure of coelenterazine-binding protein from renilla muelleri
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
184
structure length
184
Chain Sequence
EITESERAYHLRKMKTRMQRVDVTGDGFISREDYELIAVRIAKIAKLSAEKAEETRQEFLRVADQLGLAPGVRISVEEAAVNATDSLLKMKGEEKAMAVIQSLIMYDCIDTDKDGYVSLPEFKAFLQAVGPDLTDDKAITCFNTLDFNKNGQISRDEFLVTVNDFLFGLEETALANAFYGDLVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Luminescent protein
molecule keywords coelenterazine-binding protein with bound coelenterazine
publication title Crystal structure of coelenterazine-binding protein from Renilla muelleri at 1.7 A: why it is not a calcium-regulated photoprotein.
pubmed doi rcsb
source organism Renilla muelleri
total genus 68
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2006-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2hpsA00
1CFFA 2NLNA 1NWDA 2WORA 2M1UA 1TNWA 4AQJA 3WHTB 2LMUA 1MXLC 1QIVA 2K7OA 1EXRA 2KGBC 2LLTA 1XFYO 1FI5A 2L4HA 3AAKA 2EGDA 1B8RA 1SNLA 2NCOA 3OX6A 1UHJA 2GGMA 2K7DA 2PRUA 1KWOC 1GQMA 1KQMC 1Y1AA 2G2BA 3ZWHA 1PSRA 1DMOA 3OP0A 2WCEA 5AFPA 3NSOA 2LLUA 2MJWB 2VRGA 1TNXA 1PRWA 1XFXO 1ZOTB 2BBMA 2CCMA 1DTLA 1DGVA 1WY9A 3BUNB 5AANA 5I8NA 2ZN8A 1G8IA 4DIRA 2LC5A 2I2RE 2K7BA 2FOTA 4Q04A 2LANA 4N1FA 3DF0A 1Q80A 2NCPA 2M3WA 3DF0B 4DS7A 1NCZA 3KO0A 1YUTA 2EC6B 3LL8B 1SL8A 4YGAA 2NZ0A 4PHMA 3CWGA 2IS9A 1C07A 2A4JA 1K94A 4HSZA 4I5NB 1JUOA 1S5GY 4ORCB 4MBEA 1SW8A 1OQPA 3CR4X 5CPVA 4PDZA 2LMTA 5CSNA 1KFUL 2BE4A 3OB2B 4PE4A 4UPGA 3K21A 3JVTB 4AOMA 4E68A 2WCFA 4TNCA 1C7WA 1OMRA 4R1EA 3SG4A 2H61C 4OCIA 2MRDA 1LA0A 2K61A 2FJUB 5HLOA 1CDNA 4I5JA 4WQ3A 1KWOB 3DVMA 1S36A 1TNPA 3CZTX 2KFGA 1KFUS 2M1KB 2R2IA 1BMOA 2BECA 2JPTA 3F45A 2PVBA 1AJ5A 4ORAB 4FTGA 2MLFC 1CMGA 1JFKA 1ODBA 3CLNA 1JSAA 2MLEC 4YBHB 4MZJA 2L98A 1TTXA 1QJTA 5I2OA 1SYMA 3BUWB 3FS7A 4YI9A 2JULA 1YRTB 5G08A 1MQ1A 4YGDB 3M0WA 5D7FA 1LKJA 2M9GA 1K9KA 5CSJA 1LXFC 2BE6A 3ICBA 3PALA 2K7CA 5DKQA 2EHBA 2JWWA 2O60A 3RLZA 4XJKA 1AVSA 1JC2A 4PE1A 1E8AA 1NUBA 3O78A 4XJKB 1QVIY 3FIAA 1OOJA 2M29A 3GK4X 1B47A 4YGEB 2NXQA 4QJ5B 3HCMA 1YR5A 1YTZC 1ALWA 1H4BA 1A29A 1GJYA 2LP2A 1CNPA 2CXJA 1QX2A 1W7JB 2Y1MA 1IQ3A 1DJYA 2KQYA 4DCKA 1CDMA 1ZFSA 1R2UA 1TIZA 2JNXA 2G9BA 1SY9A 4HRHA 1A75A 5K89A 1NSHA 1AJ4A 2CT9A 4OV2A 5HKWA 5PALA 1UWOA 1A75B 1RROA 1CDPA 2BKIB 4N5XA 3TDIA 3SIBA 2F3YA 1A4PA 1B8CA 2LHIA 1NCXA 1AUIB 2ISDA 1IG5A 3KEVA 2ZFDA 2GGZA 4NDBA 4CFQA 3BXKA 2F2OA 1DJGA 4IL1A 1DF0A 4MLWA 5HKYA 1SR6C 2EC6C 2ZNDA 4GNKB 1DF0B 1OZSA 3VRPA 1XFVO 1N0YA 5HLVA 3GK2A 4ORBB 2LLSA 1PALA 5KU1A 1BG1A 2JNFA 1IRJA 3BOWA 2ZNEA 2AUCA 2KAXA 3BUMB 1TCOB 3BOWB 1A2XA 1MUXA 2Q91A 2FCDA 2L5XB 3GK1A 3PM8A 3JVTC 2MBXA 3PLFB 2RGIA 1DGUA 2MHHA 2M0RA 2PMYA 5HKZA 3EVVA 4PALA 1A03A 1F55A 2JT3A 2SCPA 3TS5B 2LV7A 2GV5A 1XFUO 2CNPA 1YX7A 5J3XA 4U8DA 1B1GA 5JJGA 1RJVA 2LHLA 4I5KA 1Y1XA 1G4YR 5JOLA 3VRRA 2HQ8A 5GQQC 3BQ3A 2PALA 1SCMC 3A8RA 2DOQA 2K2AA 1OMDA 1PK0D 2M49B 2ZRTA 1NX1A 1NX2A 2KFFA 1NP8A 2L50A 4HREE 4OR9B 1DT7B 4AQIA 1BODA 1CFPA 1ZACA 2E30A 1RTP1 3VRQA 2KFHA 5F6TA 1KSOA 2KAVA 2KI6D 1SR6B 1IQ5A 1TRFA 4BY4A 4MRXA 1B7TZ 4FQOA 1IGVA 1SKTA 2I18A 3FWBA 1WRLA 1M31A 2D8NA 5HYDA 4P2YB 4ZCVA 1UUSA 2BCXA 3EKJA 4NDCA 3JTDC 4JPZB 1UHIA 4NDDA 3I5HB 3BUXB 1BLQA 1YURA 1SMGA 2JC2A 3LLEA 1J7QA 4CPVA 2JTZA 1SL9A 1XO5A 2FCEA 1KSMA 2COLB 2I7AA 1WDCB 1QLKA 1BR1B 2F33A 4GGNA 3WHUB 1W7IB 1IJ5A 1WLZA 5I2LA 3ZNIA 1UHKA 2TN4A 3A4UB 2KGRA 4NQGA 1SCMB 1J7OA 2BCBA 2ZKMX 4GUKA 1QX7A 1FPWA 3O2PA 2WC8A 1J7RA 3C1VA 1M63B 3I5FB 3OB1B 4YGBB 4F0ZB 3LK0A 3WXAA 2F8PA 2BL0B 3NSKA 1CFDA 1TNQA 1EJ3A 2AAOA 1M45A 4M2PA 1IWQA 2HQWA 2L0PA 1F70A 2CBLA 1CFCA 1L7ZA 1SL7A 5CSIA 5ER4X 4MN0A 1KK7Z 1RFJA 1Y6WA 4QJ3B 1F71A 1QS7A 2MA2A 2HPSA 2JTTA 1BT6A 3SG2A 2HF5A 1K90D 5AEQA 2OTGB 2Y4QA 3SG7A 3JTDB 2WCBA 1J7PA 4BY5A 2M7NA 3KPXA 3SG6A 1N65A 4M2QA 1RWYA 2B1UA 1CB1A 1LA3A 1DVIA 4L9MA 1CKKA 2JZIA 1QIWA 1YVLA 1S5GZ 4MRYA 4ETOA 1PVAA 3I5GC 5ER5A 2KHNA 3DD4A 3SIAA 1S26D 1DJXA 4CFRA 2KAYA 4YI8A 3EVRA 2Y1NA 1X02A 3TDZA 1KFXS 3TS5C 1BOCA 5AERA 5KSZA 1HT9A 1B8LA 3DVKA 1OSAA 4ICBA 4I5LB 3KF9A 1XA5A 2K2FA 2F2PA 4QJ4B 5DKNA 2QPTA 3I5IC 1FF1A 2BBNA 1K8UA 1PVBA 1UP5A 3DVJA 1WRKA 4PHNA 4GAOA 1J1EA 1RK9A 1OMVA 3CTNA 3IQQA 1QV1A 3FWCA 3VGOA 2OS8B 3OX5A 5BPJA 1Y0VH 1AHRA 1KQVA 4HRGA 1NCYA 1CLBA 1AP4A 3BYAA 3CGAA 1NIWA 2WNDA 2OPOA 1YUSA 1ALVA 2LM5A 3IF7A 1G33A 5KTYA 1QXPA 1UHHA 2LVVA 4A4CA 2QACA 1K9UA 2L51A 2JQ6A 3I5HC 1KCYA 2AMIA 1MWNA 2HETA 4GGFC 1HQVA 1CLLA 3I5GB 1M39A 1EH2A 3EVUA 1QVIZ 4C0LA 3SG3A 2SASA 1WDCC 1XFWO 4N1GA 3TUYB 1ZMZA 3BUOB 1K2HA 2L2EA 3SJSA 4MZKA 3TDUA 4USLA 4PHKA 3DVEA 1IKUA 1B4CA 2KQ6A 3I5IB 4MEWA 5TNCA 3VRNA 1S6IA 4D1EA 4OKHA 3O4YA 3I5FC 5D69A 1JF0A 1F4OA 1VRKA 2LNKA 1CM4A 2BL0C 1F4QA 1SRAA 2JT0A 1K95A 2M97A 1XYDA 3AKAA 3WNXB 1XFZO 2JOJA 1ZUZA 1DJZA 2WOSA 1EG4A 1DJWA 1SK6D 1UHNA 2L4IA 3PN7C 1S1EA 1MR8A 3EK4A 2OTGC 1EG3A 1LVCD 1KK7Y 1YVHA 2LUCA 4GGFA 4A4BA 1QV0A 3AKBA 1OZOA 1KK8B 3EK8A 4PE0A 1L2OB 1MHOA 1V1FA 2LAPA 2KSPA 1UURA 1PSBA 1TN4A 1SBJA 1FW4A 1WLMA 3O6BA 2LVKA 1M46A 2LVJA 3PFVA 5FYXA 1R6PA 3E3RA 2LCPA 1YRUB 1IH0A 1WRZA 1RECA 2BKHB 5DKRA 3LCPC 2K8MB 3D0YA 3CR2A 1BR4B 1YX8A 3NSIA 3RM1A 2Y5IA 2Q4UA 2O5GA 3D0YB 4JWQA 4WQ2A 2JRFA 4ZCUA 3TZ1A 1S6JA 1KQMB 1S3PA 2K0JA 3PATA 1NPQA 2OS8C 4PHJA 1IJ6A 2KYCA 2KYFA 3CR5X 4P5OE 2KI4C 1TCFA 2LP3A 3PN7B 3QRXA 3D10A 1LINA 1K93D 1QLSA 5B8IB 2PSRA 1BF5A 1QATA 1JBAA 2KOTA 2ZRSA 1J1DA 3NXAA 1KFXL 1D1OA 1CLMA 1JFJA 4WRIA 1K96A 2LE9B 4MSPA 3EK7A 1AK8A 2KI6C 1NYAA 1SPYA 1J55A 1B9AA 5CSFA 1C7VA 4M2OA 4YGCB 3LK1A 1PULA 3KHEA 2KBIA 1YUUA 1DJIA 2KDHA 1CDLA 5IBWA 2M7LA 4GBAA 4CLNA 3TUYC 1XK4C 1U5IA 4CIDA 4PCWA 3MSEB 4DUQA 2H61A 1K9PA 1N2DA 1QTXA 1SCVA 1U5IB 1S6CA 4MVFA 1H8BA 1CTRA 1F8HA 4DRWA 4GFTA 1Y1UA 3PSRA 5AXIA 1BJFA 3OHMB 1NX3A 3EKHA 2BCAA 2KNEA 2JXLA 2ZN9A 3H4SE 3SG5A 4C0JA 1GGZA 4OVNF 2KI4B 2I94A 3AAJA 4XYNA 1XVJA 3IQOA 2JXCA 1MF8B 3HX4A 1BU3A 3CS1A 3GOFA 4YRUA 1FI6A 4C0KA 1B7TY 1QASA 1JF2A 2V53A 4MZLA 3NSLA 4JQ0D 2LMVA 5I2QA 1JWDA 2E6WA 2CTNA 1QX5B 4GPLB 2H2KA 1F54A 1OE9B 1KK8C 1CMFA 1EL4A 1L2OC 2JT8A 2MAZA 1CM1A 2M8UA 1MXEA 1V1GA 2P6BB 2PASA 1GGWA 2F3ZA 2JU0A 2KBMA 1XK4A 2LUXA 1FBVA 2LVIA 4PE7A 1NX0A 1DJHA 1TOPA 3VROA
chains in the Genus database with same CATH superfamily
1CFFA 2NLNA 1NWDA 2WORA 3S0DA 3EG5B 2M1UA 1TNWA 4AQJA 3WHTB 2LMUA 1MXLC 1QIVA 2K7OA 1EXRA 2KGBC 2LLTA 1XFYO 1FI5A 2L4HA 3B6XA 3AAKA 2EGDA 1B8RA 1SNLA 2NCOA 3OX6A 1UHJA 2GGMA 2K7DA 2PRUA 1KWOC 1GQMA 1KQMC 1Y1AA 5HL1A 2G2BA 3ZWHA 1PSRA 3BFBA 1DMOA 3OP0A 2WCEA 5AFPA 3NSOA 2LLUA 2MJWB 2VRGA 1TNXA 1PRWA 3CZ1A 1XFXO 1ZOTB 2BBMA 2CCMA 1DTLA 1DGVA 1WY9A 3BUNB 1W9ZA 5AANA 2ZN8A 5I8NA 1G8IA 4DIRA 3CYZA 2LC5A 2I2RE 2K7BA 2FOTA 4Q04A 2LANA 4N1FA 3DF0A 1Q80A 2NCPA 2PYQA 2M3WA 2WCMA 3S0GA 3DF0B 4DS7A 1NCZA 2KPHA 3KO0A 1YUTA 2EC6B 3LL8B 1SL8A 4YGAA 2NZ0A 4PHMA 3CWGA 2IS9A 1C07A 2A4JA 1DQEA 1K94A 4HSZA 4I5NB 1JUOA 1S5GY 4ORCB 4MBEA 1SW8A 1OQPA 3CR4X 5CPVA 4PDZA 2LMTA 1XFRA 1KFUL 2BE4A 3OB2B 5CSNA 4PE4A 4UPGA 3K21A 4OZDA 3JVTB 4AOMA 4E68A 1SSEB 2WCFA 4TNCA 3BFHA 1C7WA 1DEKA 1OMRA 3L4LA 4R1EA 2H61C 3SG4A 4OCIA 2MRDA 1LA0A 2K61A 2FJUB 5HLOA 1CDNA 4I5JA 4WQ3A 1KWOB 3DVMA 1S36A 1TNPA 3CZTX 2KFGA 1KFUS 2M1KB 2R2IA 1BMOA 2BECA 2JPTA 3F45A 2KLDA 2PVBA 1AJ5A 2QEVA 4ORAB 4FTGA 2MLFC 1CMGA 1JFKA 1ODBA 3CLNA 3R1PA 1JSAA 2MLEC 4YBHB 4MZJA 2L98A 1TTXA 1QJTA 1ORGA 1SYMA 5I2OA 3BUWB 2K60A 3FS7A 4YI9A 2JULA 1YRTB 5G08A 1MQ1A 3OBVA 4YGDB 3M0WA 5D7FA 1LKJA 2M9GA 1K9KA 5CSJA 1LXFC 2BE6A 3ICBA 3PALA 2K7CA 5DKQA 2EHBA 2JWWA 2O60A 3RLZA 4XJKA 1AVSA 1JC2A 4PE1A 1E8AA 1NUBA 3O78A 4XJKB 5FI6A 1QVIY 3CZ2A 3FIAA 3DY9A 1OOJA 1Z4HA 2ERBA 2M29A 3GK4X 1B47A 2PQLA 2NXQA 4YGEB 4QJ5B 3HCMA 1YR5A 1YTZC 1ALWA 1H4BA 1A29A 1GJYA 2LP2A 1CNPA 2CXJA 1QX2A 1W7JB 2Y1MA 1IQ3A 1DJYA 2KQYA 2WCJA 3CDNA 4DCKA 1CDMA 1ZFSA 1R2UA 2GTEA 1TIZA 2JNXA 2G9BA 1SY9A 4HRHA 1A75A 5K89A 1NSHA 1AJ4A 2CT9A 4OV2A 5HKWA 5PALA 1UWOA 1A75B 1RROA 1CDPA 2BKIB 4INXA 1QWVA 4N5XA 3TDIA 3SIBA 2F3YA 3S0AA 1A4PA 1B8CA 2WCHA 2LHIA 1NCXA 5FI7A 3Q8IA 1AUIB 2ISDA 1IG5A 3KEVA 2ZFDA 2GGZA 3D76A 4NDBA 4CFQA 3R1VA 3BXKA 2L5YA 2F2OA 1DJGA 4IL1A 1DF0A 4MLWA 5HKYA 1SR6C 2EC6C 2ZNDA 4GNKB 1DF0B 1OZSA 3VRPA 1XFVO 1N0YA 1GM0A 5HLVA 3GK2A 4ORBB 2LLSA 1PALA 5KU1A 1BG1A 2JNFA 1IRJA 2WCLA 3BOWA 2ZNEA 2WC5A 2AUCA 2KAXA 3BUMB 1TCOB 3BOWB 1A2XA 1MUXA 2Q91A 2FCDA 2BNXA 2L5XB 3GK1A 3PM8A 3JVTC 2MBXA 3PLFB 2RGIA 1DGUA 2MHHA 2M0RA 5FI2A 2PMYA 3NHIA 3V2LA 5HKZA 1TUZA 3EVVA 4PALA 1A03A 1F55A 2JT3A 2SCPA 3TS5B 2LV7A 1P28A 2GV5A 1XFUO 2CNPA 1YX7A 5J3XA 4U8DA 1B1GA 5JJGA 1RJVA 2LHLA 4I5KA 1Y1XA 1G4YR 2QDIA 5JOLA 2HQ8A 5GQQC 3BQ3A 2PALA 3VRRA 1SCMC 3A8RA 2DOQA 2K2AA 1OMDA 1PK0D 2M49B 2QEOA 1NX1A 1NX2A 2KFFA 1NP8A 2L50A 2ZRTA 4HREE 4OR9B 2P71A 4AQIA 1DT7B 1BODA 1CFPA 1ZACA 2E30A 3DXLA 1RTP1 3VRQA 2KFHA 5F6TA 1KSOA 2KAVA 2KI6D 1SR6B 1IQ5A 1TRFA 4BY4A 4MRXA 1B7TZ 4FQOA 1IGVA 1OOGA 1SKTA 2I18A 3FE6A 3FWBA 1WRLA 1M31A 2D8NA 3N7HA 4JKTA 4P2YB 5HYDA 4ZCVA 1UUSA 2BCXA 3RZSA 3EKJA 1Z2CB 4NDCA 3JTDC 3SS4A 4JPZB 1UHIA 5EL2A 4NDDA 3I5HB 3BUXB 1BLQA 1YURA 1SMGA 2JC2A 3LLEA 4F7FA 1J7QA 2QEHA 4CPVA 2H8VA 2JTZA 1SL9A 1XO5A 2FCEA 1KSMA 2COLB 2I7AA 1WDCB 1QLKA 1BR1B 2F33A 4GGNA 3WHUB 1W7IB 1IJ5A 1WLZA 3FE9A 5I2LA 2WCKA 3ZNIA 1OOIX 1UHKA 3UO9A 2TN4A 3A4UB 2KGRA 4NQGA 1SCMB 1J7OA 4INWA 2BCBA 2ZKMX 4GUKA 1QX7A 1FPWA 3O2PA 2WC8A 1J7RA 3C1VA 1M63B 3I5FB 3OB1B 4YGBB 4F0ZB 3LK0A 3WXAA 2F8PA 2BL0B 3NSKA 1CFDA 1TNQA 1EJ3A 2AAOA 1M45A 4M2PA 1IWQA 2HQWA 2L0PA 1F70A 2CBLA 1CFCA 1L7ZA 4JD9A 1SL7A 5CSIA 5ER4X 1IIOA 4MN0A 1KK7Z 1RFJA 1Y6WA 4QJ3B 3CABA 1QS7A 2MA2A 1F71A 2HPSA 2JTTA 1BT6A 3SG2A 2HF5A 1K90D 5DICA 5AEQA 2OTGB 2Y4QA 3SG7A 1DC1A 3JTDB 2WCBA 1J7PA 4BY5A 1DELA 2M7NA 3KPXA 3SG6A 1N65A 4M2QA 1C3YA 1RWYA 2B1UA 1CB1A 1LA3A 1DVIA 4L9MA 1CKKA 2JZIA 1QIWA 1YVLA 1S5GZ 4MRYA 4ETOA 1PVAA 1C3ZA 1LS8A 2KHNA 3DD4A 3I5GC 5ER5A 3SIAA 1S26D 1DJXA 4CFRA 2KAYA 4YI8A 3EVRA 2Y1NA 1X02A 3TDZA 1KFXS 3TS5C 3S0FA 3R72A 1BOCA 5AERA 5KSZA 1HT9A 1B8LA 3DVKA 1OSAA 4ICBA 4I5LB 3KF9A 1XA5A 2K2FA 3B86A 2F2PA 4QJ4B 5DKNA 2QPTA 3I5IC 1FF1A 2BBNA 3FE8A 1K8UA 1PVBA 1UP5A 3DVJA 1WRKA 4PHNA 4GAOA 1J1EA 3VB1A 1RK9A 2P70A 1OMVA 3CTNA 3IQQA 1QV1A 3FWCA 3VGOA 2OS8B 3OX5A 5BPJA 1Y0VH 1AHRA 1KQVA 4HRGA 1NCYA 1TWOA 1CLBA 1AP4A 3BYAA 3CGAA 1NIWA 2WNDA 2OPOA 3PM2A 1YUSA 1ALVA 2LM5A 3IF7A 1G33A 5KTYA 1QXPA 1UHHA 2LVVA 4A4CA 2QACA 1K9UA 2L51A 3D78A 3NHTA 2JQ6A 3I5HC 1KCYA 2AMIA 1MWNA 3D74A 2HETA 4GGFC 1HQVA 1CLLA 3I5GB 1M39A 1EH2A 3EVUA 1QVIZ 4C0LA 3SG3A 2SASA 1WDCC 3IVTA 1XFWO 4N1GA 3DYEA 3TUYB 3B87A 3B88A 1ZMZA 3BUOB 1K2HA 2L2EA 3SJSA 3D77A 4MZKA 4FQTA 3TDUA 4USLA 4PHKA 3DVEA 1IKUA 1B4CA 2KQ6A 3I5IB 3L4AA 4MEWA 5TNCA 1S6IA 3VRNA 4D1EA 4OKHA 3O4YA 3I5FC 5D69A 2KLEA 3S0BA 1JF0A 1F4OA 1VRKA 2LNKA 1CM4A 2BL0C 1F4QA 1SRAA 2JT0A 3PJIA 1K95A 2M97A 1XYDA 3AKAA 3WNXB 1XFZO 2JOJA 1ZUZA 1DJZA 2WOSA 1EG4A 1DJWA 1SK6D 1UHNA 3O4XA 2L4IA 3PN7C 1S1EA 3L47A 1MR8A 3EK4A 2OTGC 1EG3A 3SS3A 1LVCD 1KK7Y 1YVHA 2LUCA 4GGFA 4A4BA 1QV0A 3AKBA 1OZOA 1KK8B 3EK8A 4PE0A 1L2OB 1MHOA 1OOFA 1V1FA 2LAPA 2KSPA 3SS5A 4IJ7A 1UURA 4KYNA 1PSBA 1TN4A 1SBJA 1FW4A 1T14A 1WLMA 2FJYA 3O6BA 2LVKA 1M46A 3DZTA 2LVJA 3K1EA 2QEBA 2WC6A 3CZ0A 3PFVA 5FYXA 1R6PA 3E3RA 2LCPA 1YRUB 1IH0A 1WRZA 1RECA 2BKHB 5DKRA 3LCPC 2K8MB 3D0YA 3CR2A 1BR4B 1YX8A 3NSIA 3RM1A 2Y5IA 2Q4UA 3D73A 2O5GA 3D0YB 2L2CA 2YGUA 2JRFA 4JWQA 4WQ2A 4ZCUA 3TZ1A 1OOHA 1S6JA 1OW4A 1KQMB 1S3PA 2K0JA 3PATA 1NPQA 2OS8C 4PHJA 1IJ6A 2KYCA 2KYFA 3CR5X 4P5OE 2KI4C 1TCFA 2LP3A 3PN7B 1TUJA 3QRXA 3D10A 1LINA 1K93D 1QLSA 5B8IB 2PSRA 1BF5A 1QATA 1JBAA 2KOTA 2ZRSA 5D3OA 1J1DA 3NXAA 1KFXL 1D1OA 1CLMA 1JFJA 2BAPA 4WRIA 1K96A 2LE9B 4MSPA 3EK7A 1AK8A 2KI6C 1NYAA 1SPYA 1J55A 1B9AA 5CSFA 1C7VA 4M2OA 4YGCB 3LK1A 1PULA 3KHEA 2KBIA 1YUUA 1DJIA 2KDHA 1CDLA 3NGVA 5IBWA 2M7LA 3B7AA 4GBAA 4CLNA 3BJHA 3TUYC 1XK4C 3D75A 3R1OA 4PT1A 1U5IA 4CIDA 4PCWA 3MSEB 3BFAA 4DUQA 2H61A 1K9PA 1N2DA 1QTXA 1SCVA 1U5IB 1S6CA 4MVFA 1H8BA 1CTRA 1F8HA 4DRWA 4GFTA 1Y1UA 3PSRA 5AXIA 1BJFA 3OHMB 1NX3A 3EKHA 2BCAA 2KNEA 2JXLA 2ZN9A 3H4SE 3SG5A 4C0JA 1GGZA 4OVNF 5I94A 2KI4B 2I94A 3AAJA 4XYNA 1XVJA 3IQOA 2JXCA 1MF8B 3HX4A 1BU3A 3CS1A 3GOFA 4YRUA 1FI6A 4C0KA 1B7TY 1QASA 1JF2A 2V53A 4MZLA 3NSLA 4JQ0D 2LMVA 5I2QA 1JWDA 2E6WA 3S0EA 2CTNA 1QX5B 3QMEA 2H2KA 4GPLB 1F54A 1OE9B 1KK8C 3UNWA 1CMFA 1EL4A 1L2OC 2JT8A 2MAZA 1CM1A 2M8UA 1MXEA 1V1GA 2P6BB 2PASA 3OGNA 1GGWA 2F3ZA 2JU0A 2KBMA 1XK4A 2LUXA 1FBVA 2LVIA 4PE7A 1NX0A 1DJHA 1TOPA 3VROA 2JPOA
chains in the Genus database with same CATH topology
1CFFA 2NLNA 1NWDA 2WORA 2M1UA 1TNWA 4AQJA 3WHTB 2LMUA 1MXLC 1QIVA 2K7OA 1EXRA 2KGBC 2LLTA 1XFYO 1FI5A 2L4HA 3AAKA 2EGDA 1B8RA 1SNLA 2NCOA 3OX6A 1UHJA 2GGMA 2K7DA 2PRUA 1KWOC 1GQMA 1KQMC 1Y1AA 2G2BA 3ZWHA 1PSRA 1DMOA 3OP0A 2WCEA 5AFPA 3NSOA 2LLUA 2MJWB 2VRGA 1TNXA 1PRWA 1XFXO 1ZOTB 2BBMA 2CCMA 1DTLA 1DGVA 1WY9A 3BUNB 5AANA 5I8NA 2ZN8A 1G8IA 4DIRA 2LC5A 2I2RE 2K7BA 2FOTA 4Q04A 2LANA 4N1FA 3DF0A 1Q80A 2NCPA 2M3WA 3DF0B 4DS7A 1NCZA 3KO0A 1YUTA 2EC6B 3LL8B 1SL8A 4YGAA 2NZ0A 4PHMA 3CWGA 2IS9A 1C07A 2A4JA 1K94A 4HSZA 4I5NB 1JUOA 1S5GY 4ORCB 4MBEA 1SW8A 1OQPA 3CR4X 5CPVA 4PDZA 2LMTA 5CSNA 1KFUL 2BE4A 3OB2B 4PE4A 4UPGA 3K21A 3JVTB 4AOMA 4E68A 2WCFA 4TNCA 1C7WA 1OMRA 4R1EA 3SG4A 2H61C 4OCIA 2MRDA 1LA0A 2K61A 2FJUB 5HLOA 1CDNA 4I5JA 4WQ3A 1KWOB 3DVMA 1S36A 1TNPA 3CZTX 2KFGA 1KFUS 2M1KB 2R2IA 1BMOA 2BECA 2JPTA 3F45A 2PVBA 1AJ5A 4ORAB 4FTGA 2MLFC 1CMGA 1JFKA 1ODBA 3CLNA 1JSAA 2MLEC 4YBHB 4MZJA 2L98A 1TTXA 1QJTA 5I2OA 1SYMA 3BUWB 3FS7A 4YI9A 2JULA 1YRTB 5G08A 1MQ1A 4YGDB 3M0WA 5D7FA 1LKJA 2M9GA 1K9KA 5CSJA 1LXFC 2BE6A 3ICBA 3PALA 2K7CA 5DKQA 2EHBA 2JWWA 2O60A 3RLZA 4XJKA 1AVSA 1JC2A 4PE1A 1E8AA 1NUBA 3O78A 4XJKB 1QVIY 3FIAA 1OOJA 2M29A 3GK4X 1B47A 4YGEB 2NXQA 4QJ5B 3HCMA 1YR5A 1YTZC 1ALWA 1H4BA 1A29A 1GJYA 2LP2A 1CNPA 2CXJA 1QX2A 1W7JB 2Y1MA 1IQ3A 1DJYA 2KQYA 4DCKA 1CDMA 1ZFSA 1R2UA 1TIZA 2JNXA 2G9BA 1SY9A 4HRHA 1A75A 5K89A 1NSHA 1AJ4A 2CT9A 4OV2A 5HKWA 5PALA 1UWOA 1A75B 1RROA 1CDPA 2BKIB 4N5XA 3TDIA 3SIBA 2F3YA 1A4PA 1B8CA 2LHIA 1NCXA 1AUIB 2ISDA 1IG5A 3KEVA 2ZFDA 2GGZA 4NDBA 4CFQA 3BXKA 2F2OA 1DJGA 4IL1A 1DF0A 4MLWA 5HKYA 1SR6C 2EC6C 2ZNDA 4GNKB 1DF0B 1OZSA 3VRPA 1XFVO 1N0YA 5HLVA 3GK2A 4ORBB 2LLSA 1PALA 5KU1A 1BG1A 2JNFA 1IRJA 3BOWA 2ZNEA 2AUCA 2KAXA 3BUMB 1TCOB 3BOWB 1A2XA 1MUXA 2Q91A 2FCDA 2L5XB 3GK1A 3PM8A 3JVTC 2MBXA 3PLFB 2RGIA 1DGUA 2MHHA 2M0RA 2PMYA 5HKZA 3EVVA 4PALA 1A03A 1F55A 2JT3A 2SCPA 3TS5B 2LV7A 2GV5A 1XFUO 2CNPA 1YX7A 5J3XA 4U8DA 1B1GA 5JJGA 1RJVA 2LHLA 4I5KA 1Y1XA 1G4YR 5JOLA 3VRRA 2HQ8A 5GQQC 3BQ3A 2PALA 1SCMC 3A8RA 2DOQA 2K2AA 1OMDA 1PK0D 2M49B 2ZRTA 1NX1A 1NX2A 2KFFA 1NP8A 2L50A 4HREE 4OR9B 1DT7B 4AQIA 1BODA 1CFPA 1ZACA 2E30A 1RTP1 3VRQA 2KFHA 5F6TA 1KSOA 2KAVA 2KI6D 1SR6B 1IQ5A 1TRFA 4BY4A 4MRXA 1B7TZ 4FQOA 1IGVA 1SKTA 2I18A 3FWBA 1WRLA 1M31A 2D8NA 5HYDA 4P2YB 4ZCVA 1UUSA 2BCXA 3EKJA 4NDCA 3JTDC 4JPZB 1UHIA 4NDDA 3I5HB 3BUXB 1BLQA 1YURA 1SMGA 2JC2A 3LLEA 1J7QA 4CPVA 2JTZA 1SL9A 1XO5A 2FCEA 1KSMA 2COLB 2I7AA 1WDCB 1QLKA 1BR1B 2F33A 4GGNA 3WHUB 1W7IB 1IJ5A 1WLZA 5I2LA 3ZNIA 1UHKA 2TN4A 3A4UB 2KGRA 4NQGA 1SCMB 1J7OA 2BCBA 2ZKMX 4GUKA 1QX7A 1FPWA 3O2PA 2WC8A 1J7RA 3C1VA 1M63B 3I5FB 3OB1B 4YGBB 4F0ZB 3LK0A 3WXAA 2F8PA 2BL0B 3NSKA 1CFDA 1TNQA 1EJ3A 2AAOA 1M45A 4M2PA 1IWQA 2HQWA 2L0PA 1F70A 2CBLA 1CFCA 1L7ZA 1SL7A 5CSIA 5ER4X 4MN0A 1KK7Z 1RFJA 1Y6WA 4QJ3B 1F71A 1QS7A 2MA2A 2HPSA 2JTTA 1BT6A 3SG2A 2HF5A 1K90D 5AEQA 2OTGB 2Y4QA 3SG7A 3JTDB 2WCBA 1J7PA 4BY5A 2M7NA 3KPXA 3SG6A 1N65A 4M2QA 1RWYA 2B1UA 1CB1A 1LA3A 1DVIA 4L9MA 1CKKA 2JZIA 1QIWA 1YVLA 1S5GZ 4MRYA 4ETOA 1PVAA 3I5GC 5ER5A 2KHNA 3DD4A 3SIAA 1S26D 1DJXA 4CFRA 2KAYA 4YI8A 3EVRA 2Y1NA 1X02A 3TDZA 1KFXS 3TS5C 1BOCA 5AERA 5KSZA 1HT9A 1B8LA 3DVKA 1OSAA 4ICBA 4I5LB 3KF9A 1XA5A 2K2FA 2F2PA 4QJ4B 5DKNA 2QPTA 3I5IC 1FF1A 2BBNA 1K8UA 1PVBA 1UP5A 3DVJA 1WRKA 4PHNA 4GAOA 1J1EA 1RK9A 1OMVA 3CTNA 3IQQA 1QV1A 3FWCA 3VGOA 2OS8B 3OX5A 5BPJA 1Y0VH 1AHRA 1KQVA 4HRGA 1NCYA 1CLBA 1AP4A 3BYAA 3CGAA 1NIWA 2WNDA 2OPOA 1YUSA 1ALVA 2LM5A 3IF7A 1G33A 5KTYA 1QXPA 1UHHA 2LVVA 4A4CA 2QACA 1K9UA 2L51A 2JQ6A 3I5HC 1KCYA 2AMIA 1MWNA 2HETA 4GGFC 1HQVA 1CLLA 3I5GB 1M39A 1EH2A 3EVUA 1QVIZ 4C0LA 3SG3A 2SASA 1WDCC 1XFWO 4N1GA 3TUYB 1ZMZA 3BUOB 1K2HA 2L2EA 3SJSA 4MZKA 3TDUA 4USLA 4PHKA 3DVEA 1IKUA 1B4CA 2KQ6A 3I5IB 4MEWA 5TNCA 3VRNA 1S6IA 4D1EA 4OKHA 3O4YA 3I5FC 5D69A 1JF0A 1F4OA 1VRKA 2LNKA 1CM4A 2BL0C 1F4QA 1SRAA 2JT0A 1K95A 2M97A 1XYDA 3AKAA 3WNXB 1XFZO 2JOJA 1ZUZA 1DJZA 2WOSA 1EG4A 1DJWA 1SK6D 1UHNA 2L4IA 3PN7C 1S1EA 1MR8A 3EK4A 2OTGC 1EG3A 1LVCD 1KK7Y 1YVHA 2LUCA 4GGFA 4A4BA 1QV0A 3AKBA 1OZOA 1KK8B 3EK8A 4PE0A 1L2OB 1MHOA 1V1FA 2LAPA 2KSPA 1UURA 1PSBA 1TN4A 1SBJA 1FW4A 1WLMA 3O6BA 2LVKA 1M46A 2LVJA 3PFVA 5FYXA 1R6PA 3E3RA 2LCPA 1YRUB 1IH0A 1WRZA 1RECA 2BKHB 5DKRA 3LCPC 2K8MB 3D0YA 3CR2A 1BR4B 1YX8A 3NSIA 3RM1A 2Y5IA 2Q4UA 2O5GA 3D0YB 4JWQA 4WQ2A 2JRFA 4ZCUA 3TZ1A 1S6JA 1KQMB 1S3PA 2K0JA 3PATA 1NPQA 2OS8C 4PHJA 1IJ6A 2KYCA 2KYFA 3CR5X 4P5OE 2KI4C 1TCFA 2LP3A 3PN7B 3QRXA 3D10A 1LINA 1K93D 1QLSA 5B8IB 2PSRA 1BF5A 1QATA 1JBAA 2KOTA 2ZRSA 1J1DA 3NXAA 1KFXL 1D1OA 1CLMA 1JFJA 4WRIA 1K96A 2LE9B 4MSPA 3EK7A 1AK8A 2KI6C 1NYAA 1SPYA 1J55A 1B9AA 5CSFA 1C7VA 4M2OA 4YGCB 3LK1A 1PULA 3KHEA 2KBIA 1YUUA 1DJIA 2KDHA 1CDLA 5IBWA 2M7LA 4GBAA 4CLNA 3TUYC 1XK4C 1U5IA 4CIDA 4PCWA 3MSEB 4DUQA 2H61A 1K9PA 1N2DA 1QTXA 1SCVA 1U5IB 1S6CA 4MVFA 1H8BA 1CTRA 1F8HA 4DRWA 4GFTA 1Y1UA 3PSRA 5AXIA 1BJFA 3OHMB 1NX3A 3EKHA 2BCAA 2KNEA 2JXLA 2ZN9A 3H4SE 3SG5A 4C0JA 1GGZA 4OVNF 2KI4B 2I94A 3AAJA 4XYNA 1XVJA 3IQOA 2JXCA 1MF8B 3HX4A 1BU3A 3CS1A 3GOFA 4YRUA 1FI6A 4C0KA 1B7TY 1QASA 1JF2A 2V53A 4MZLA 3NSLA 4JQ0D 2LMVA 5I2QA 1JWDA 2E6WA 2CTNA 1QX5B 4GPLB 2H2KA 1F54A 1OE9B 1KK8C 1CMFA 1EL4A 1L2OC 2JT8A 2MAZA 1CM1A 2M8UA 1MXEA 1V1GA 2P6BB 2PASA 1GGWA 2F3ZA 2JU0A 2KBMA 1XK4A 2LUXA 1FBVA 2LVIA 4PE7A 1NX0A 1DJHA 1TOPA 3VROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CFF A;  2NLN A;  1NWD A;  2WOR A;  2M1U A;  1TNW A;  4AQJ A;  3WHT B;  2LMU A;  1MXL C;  1QIV A;  2K7O A;  1EXR A;  2KGB C;  2LLT A;  1XFY O;  1FI5 A;  2L4H A;  3AAK A;  2EGD A;  1B8R A;  1SNL A;  2NCO A;  3OX6 A;  1UHJ A;  2GGM A;  2K7D A;  2PRU A;  1KWO C;  1GQM A;  1KQM C;  1Y1A A;  2G2B A;  3ZWH A;  1PSR A;  1DMO A;  3OP0 A;  2WCE A;  5AFP A;  3NSO A;  2LLU A;  2MJW B;  2VRG A;  1TNX A;  1PRW A;  1XFX O;  1ZOT B;  2BBM A;  2CCM A;  1DTL A;  1DGV A;  1WY9 A;  3BUN B;  5AAN A;  5I8N A;  2ZN8 A;  1G8I A;  4DIR A;  2LC5 A;  2I2R E;  2K7B A;  2FOT A;  4Q04 A;  2LAN A;  4N1F A;  3DF0 A;  1Q80 A;  2NCP A;  2M3W A;  3DF0 B;  4DS7 A;  1NCZ A;  3KO0 A;  1YUT A;  2EC6 B;  3LL8 B;  1SL8 A;  4YGA A;  2NZ0 A;  4PHM A;  3CWG A;  2IS9 A;  1C07 A;  2A4J A;  1K94 A;  4HSZ A;  4I5N B;  1JUO A;  1S5G Y;  4ORC B;  4MBE A;  1SW8 A;  1OQP A;  3CR4 X;  5CPV A;  4PDZ A;  2LMT A;  5CSN A;  1KFU L;  2BE4 A;  3OB2 B;  4PE4 A;  4UPG A;  3K21 A;  3JVT B;  4AOM A;  4E68 A;  2WCF A;  4TNC A;  1C7W A;  1OMR A;  4R1E A;  3SG4 A;  2H61 C;  4OCI A;  2MRD A;  1LA0 A;  2K61 A;  2FJU B;  5HLO A;  1CDN A;  4I5J A;  4WQ3 A;  1KWO B;  3DVM A;  1S36 A;  1TNP A;  3CZT X;  2KFG A;  1KFU S;  2M1K B;  2R2I A;  1BMO A;  2BEC A;  2JPT A;  3F45 A;  2PVB A;  1AJ5 A;  4ORA B;  4FTG A;  2MLF C;  1CMG A;  1JFK A;  1ODB A;  3CLN A;  1JSA A;  2MLE C;  4YBH B;  4MZJ A;  2L98 A;  1TTX A;  1QJT A;  5I2O A;  1SYM A;  3BUW B;  3FS7 A;  4YI9 A;  2JUL A;  1YRT B;  5G08 A;  1MQ1 A;  4YGD B;  3M0W A;  5D7F A;  1LKJ A;  2M9G A;  1K9K A;  5CSJ A;  1LXF C;  2BE6 A;  3ICB A;  3PAL A;  2K7C A;  5DKQ A;  2EHB A;  2JWW A;  2O60 A;  3RLZ A;  4XJK A;  1AVS A;  1JC2 A;  4PE1 A;  1E8A A;  1NUB A;  3O78 A;  4XJK B;  1QVI Y;  3FIA A;  1OOJ A;  2M29 A;  3GK4 X;  1B47 A;  4YGE B;  2NXQ A;  4QJ5 B;  3HCM A;  1YR5 A;  1YTZ C;  1ALW A;  1H4B A;  1A29 A;  1GJY A;  2LP2 A;  1CNP A;  2CXJ A;  1QX2 A;  1W7J B;  2Y1M A;  1IQ3 A;  1DJY A;  2KQY A;  4DCK A;  1CDM A;  1ZFS A;  1R2U A;  1TIZ A;  2JNX A;  2G9B A;  1SY9 A;  4HRH A;  1A75 A;  5K89 A;  1NSH A;  1AJ4 A;  2CT9 A;  4OV2 A;  5HKW A;  5PAL A;  1UWO A;  1A75 B;  1RRO A;  1CDP A;  2BKI B;  4N5X A;  3TDI A;  3SIB A;  2F3Y A;  1A4P A;  1B8C A;  2LHI A;  1NCX A;  1AUI B;  2ISD A;  1IG5 A;  3KEV A;  2ZFD A;  2GGZ A;  4NDB A;  4CFQ A;  3BXK A;  2F2O A;  1DJG A;  4IL1 A;  1DF0 A;  4MLW A;  5HKY A;  1SR6 C;  2EC6 C;  2ZND A;  4GNK B;  1DF0 B;  1OZS A;  3VRP A;  1XFV O;  1N0Y A;  5HLV A;  3GK2 A;  4ORB B;  2LLS A;  1PAL A;  5KU1 A;  1BG1 A;  2JNF A;  1IRJ A;  3BOW A;  2ZNE A;  2AUC A;  2KAX A;  3BUM B;  1TCO B;  3BOW B;  1A2X A;  1MUX A;  2Q91 A;  2FCD A;  2L5X B;  3GK1 A;  3PM8 A;  3JVT C;  2MBX A;  3PLF B;  2RGI A;  1DGU A;  2MHH A;  2M0R A;  2PMY A;  5HKZ A;  3EVV A;  4PAL A;  1A03 A;  1F55 A;  2JT3 A;  2SCP A;  3TS5 B;  2LV7 A;  2GV5 A;  1XFU O;  2CNP A;  1YX7 A;  5J3X A;  4U8D A;  1B1G A;  5JJG A;  1RJV A;  2LHL A;  4I5K A;  1Y1X A;  1G4Y R;  5JOL A;  3VRR A;  2HQ8 A;  5GQQ C;  3BQ3 A;  2PAL A;  1SCM C;  3A8R A;  2DOQ A;  2K2A A;  1OMD A;  1PK0 D;  2M49 B;  2ZRT A;  1NX1 A;  1NX2 A;  2KFF A;  1NP8 A;  2L50 A;  4HRE E;  4OR9 B;  1DT7 B;  4AQI A;  1BOD A;  1CFP A;  1ZAC A;  2E30 A;  1RTP 1;  3VRQ A;  2KFH A;  5F6T A;  1KSO A;  2KAV A;  2KI6 D;  1SR6 B;  1IQ5 A;  1TRF A;  4BY4 A;  4MRX A;  1B7T Z;  4FQO A;  1IGV A;  1SKT A;  2I18 A;  3FWB A;  1WRL A;  1M31 A;  2D8N A;  5HYD A;  4P2Y B;  4ZCV A;  1UUS A;  2BCX A;  3EKJ A;  4NDC A;  3JTD C;  4JPZ B;  1UHI A;  4NDD A;  3I5H B;  3BUX B;  1BLQ A;  1YUR A;  1SMG A;  2JC2 A;  3LLE A;  1J7Q A;  4CPV A;  2JTZ A;  1SL9 A;  1XO5 A;  2FCE A;  1KSM A;  2COL B;  2I7A A;  1WDC B;  1QLK A;  1BR1 B;  2F33 A;  4GGN A;  3WHU B;  1W7I B;  1IJ5 A;  1WLZ A;  5I2L A;  3ZNI A;  1UHK A;  2TN4 A;  3A4U B;  2KGR A;  4NQG A;  1SCM B;  1J7O A;  2BCB A;  2ZKM X;  4GUK A;  1QX7 A;  1FPW A;  3O2P A;  2WC8 A;  1J7R A;  3C1V A;  1M63 B;  3I5F B;  3OB1 B;  4YGB B;  4F0Z B;  3LK0 A;  3WXA A;  2F8P A;  2BL0 B;  3NSK A;  1CFD A;  1TNQ A;  1EJ3 A;  2AAO A;  1M45 A;  4M2P A;  1IWQ A;  2HQW A;  2L0P A;  1F70 A;  2CBL A;  1CFC A;  1L7Z A;  1SL7 A;  5CSI A;  5ER4 X;  4MN0 A;  1KK7 Z;  1RFJ A;  1Y6W A;  4QJ3 B;  1F71 A;  1QS7 A;  2MA2 A;  2HPS A;  2JTT A;  1BT6 A;  3SG2 A;  2HF5 A;  1K90 D;  5AEQ A;  2OTG B;  2Y4Q A;  3SG7 A;  3JTD B;  2WCB A;  1J7P A;  4BY5 A;  2M7N A;  3KPX A;  3SG6 A;  1N65 A;  4M2Q A;  1RWY A;  2B1U A;  1CB1 A;  1LA3 A;  1DVI A;  4L9M A;  1CKK A;  2JZI A;  1QIW A;  1YVL A;  1S5G Z;  4MRY A;  4ETO A;  1PVA A;  3I5G C;  5ER5 A;  2KHN A;  3DD4 A;  3SIA A;  1S26 D;  1DJX A;  4CFR A;  2KAY A;  4YI8 A;  3EVR A;  2Y1N A;  1X02 A;  3TDZ A;  1KFX S;  3TS5 C;  1BOC A;  5AER A;  5KSZ A;  1HT9 A;  1B8L A;  3DVK A;  1OSA A;  4ICB A;  4I5L B;  3KF9 A;  1XA5 A;  2K2F A;  2F2P A;  4QJ4 B;  5DKN A;  2QPT A;  3I5I C;  1FF1 A;  2BBN A;  1K8U A;  1PVB A;  1UP5 A;  3DVJ A;  1WRK A;  4PHN A;  4GAO A;  1J1E A;  1RK9 A;  1OMV A;  3CTN A;  3IQQ A;  1QV1 A;  3FWC A;  3VGO A;  2OS8 B;  3OX5 A;  5BPJ A;  1Y0V H;  1AHR A;  1KQV A;  4HRG A;  1NCY A;  1CLB A;  1AP4 A;  3BYA A;  3CGA A;  1NIW A;  2WND A;  2OPO A;  1YUS A;  1ALV A;  2LM5 A;  3IF7 A;  1G33 A;  5KTY A;  1QXP A;  1UHH A;  2LVV A;  4A4C A;  2QAC A;  1K9U A;  2L51 A;  2JQ6 A;  3I5H C;  1KCY A;  2AMI A;  1MWN A;  2HET A;  4GGF C;  1HQV A;  1CLL A;  3I5G B;  1M39 A;  1EH2 A;  3EVU A;  1QVI Z;  4C0L A;  3SG3 A;  2SAS A;  1WDC C;  1XFW O;  4N1G A;  3TUY B;  1ZMZ A;  3BUO B;  1K2H A;  2L2E A;  3SJS A;  4MZK A;  3TDU A;  4USL A;  4PHK A;  3DVE A;  1IKU A;  1B4C A;  2KQ6 A;  3I5I B;  4MEW A;  5TNC A;  3VRN A;  1S6I A;  4D1E A;  4OKH A;  3O4Y A;  3I5F C;  5D69 A;  1JF0 A;  1F4O A;  1VRK A;  2LNK A;  1CM4 A;  2BL0 C;  1F4Q A;  1SRA A;  2JT0 A;  1K95 A;  2M97 A;  1XYD A;  3AKA A;  3WNX B;  1XFZ O;  2JOJ A;  1ZUZ A;  1DJZ A;  2WOS A;  1EG4 A;  1DJW A;  1SK6 D;  1UHN A;  2L4I A;  3PN7 C;  1S1E A;  1MR8 A;  3EK4 A;  2OTG C;  1EG3 A;  1LVC D;  1KK7 Y;  1YVH A;  2LUC A;  4GGF A;  4A4B A;  1QV0 A;  3AKB A;  1OZO A;  1KK8 B;  3EK8 A;  4PE0 A;  1L2O B;  1MHO A;  1V1F A;  2LAP A;  2KSP A;  1UUR A;  1PSB A;  1TN4 A;  1SBJ A;  1FW4 A;  1WLM A;  3O6B A;  2LVK A;  1M46 A;  2LVJ A;  3PFV A;  5FYX A;  1R6P A;  3E3R A;  2LCP A;  1YRU B;  1IH0 A;  1WRZ A;  1REC A;  2BKH B;  5DKR A;  3LCP C;  2K8M B;  3D0Y A;  3CR2 A;  1BR4 B;  1YX8 A;  3NSI A;  3RM1 A;  2Y5I A;  2Q4U A;  2O5G A;  3D0Y B;  4JWQ A;  4WQ2 A;  2JRF A;  4ZCU A;  3TZ1 A;  1S6J A;  1KQM B;  1S3P A;  2K0J A;  3PAT A;  1NPQ A;  2OS8 C;  4PHJ A;  1IJ6 A;  2KYC A;  2KYF A;  3CR5 X;  4P5O E;  2KI4 C;  1TCF A;  2LP3 A;  3PN7 B;  3QRX A;  3D10 A;  1LIN A;  1K93 D;  1QLS A;  5B8I B;  2PSR A;  1BF5 A;  1QAT A;  1JBA A;  2KOT A;  2ZRS A;  1J1D A;  3NXA A;  1KFX L;  1D1O A;  1CLM A;  1JFJ A;  4WRI A;  1K96 A;  2LE9 B;  4MSP A;  3EK7 A;  1AK8 A;  2KI6 C;  1NYA A;  1SPY A;  1J55 A;  1B9A A;  5CSF A;  1C7V A;  4M2O A;  4YGC B;  3LK1 A;  1PUL A;  3KHE A;  2KBI A;  1YUU A;  1DJI A;  2KDH A;  1CDL A;  5IBW A;  2M7L A;  4GBA A;  4CLN A;  3TUY C;  1XK4 C;  1U5I A;  4CID A;  4PCW A;  3MSE B;  4DUQ A;  2H61 A;  1K9P A;  1N2D A;  1QTX A;  1SCV A;  1U5I B;  1S6C A;  4MVF A;  1H8B A;  1CTR A;  1F8H A;  4DRW A;  4GFT A;  1Y1U A;  3PSR A;  5AXI A;  1BJF A;  3OHM B;  1NX3 A;  3EKH A;  2BCA A;  2KNE A;  2JXL A;  2ZN9 A;  3H4S E;  3SG5 A;  4C0J A;  1GGZ A;  4OVN F;  2KI4 B;  2I94 A;  3AAJ A;  4XYN A;  1XVJ A;  3IQO A;  2JXC A;  1MF8 B;  3HX4 A;  1BU3 A;  3CS1 A;  3GOF A;  4YRU A;  1FI6 A;  4C0K A;  1B7T Y;  1QAS A;  1JF2 A;  2V53 A;  4MZL A;  3NSL A;  4JQ0 D;  2LMV A;  5I2Q A;  1JWD A;  2E6W A;  2CTN A;  1QX5 B;  4GPL B;  2H2K A;  1F54 A;  1OE9 B;  1KK8 C;  1CMF A;  1EL4 A;  1L2O C;  2JT8 A;  2MAZ A;  1CM1 A;  2M8U A;  1MXE A;  1V1G A;  2P6B B;  2PAS A;  1GGW A;  2F3Z A;  2JU0 A;  2KBM A;  1XK4 A;  2LUX A;  1FBV A;  2LVI A;  4PE7 A;  1NX0 A;  1DJH A;  1TOP A;  3VRO A; 
#chains in the Genus database with same CATH topology
 1CFF A;  2NLN A;  1NWD A;  2WOR A;  3S0D A;  3EG5 B;  2M1U A;  1TNW A;  4AQJ A;  3WHT B;  2LMU A;  1MXL C;  1QIV A;  2K7O A;  1EXR A;  2KGB C;  2LLT A;  1XFY O;  1FI5 A;  2L4H A;  3B6X A;  3AAK A;  2EGD A;  1B8R A;  1SNL A;  2NCO A;  3OX6 A;  1UHJ A;  2GGM A;  2K7D A;  2PRU A;  1KWO C;  1GQM A;  1KQM C;  1Y1A A;  5HL1 A;  2G2B A;  3ZWH A;  1PSR A;  3BFB A;  1DMO A;  3OP0 A;  2WCE A;  5AFP A;  3NSO A;  2LLU A;  2MJW B;  2VRG A;  1TNX A;  1PRW A;  3CZ1 A;  1XFX O;  1ZOT B;  2BBM A;  2CCM A;  1DTL A;  1DGV A;  1WY9 A;  3BUN B;  1W9Z A;  5AAN A;  2ZN8 A;  5I8N A;  1G8I A;  4DIR A;  3CYZ A;  2LC5 A;  2I2R E;  2K7B A;  2FOT A;  4Q04 A;  2LAN A;  4N1F A;  3DF0 A;  1Q80 A;  2NCP A;  2PYQ A;  2M3W A;  2WCM A;  3S0G A;  3DF0 B;  4DS7 A;  1NCZ A;  2KPH A;  3KO0 A;  1YUT A;  2EC6 B;  3LL8 B;  1SL8 A;  4YGA A;  2NZ0 A;  4PHM A;  3CWG A;  2IS9 A;  1C07 A;  2A4J A;  1DQE A;  1K94 A;  4HSZ A;  4I5N B;  1JUO A;  1S5G Y;  4ORC B;  4MBE A;  1SW8 A;  1OQP A;  3CR4 X;  5CPV A;  4PDZ A;  2LMT A;  1XFR A;  1KFU L;  2BE4 A;  3OB2 B;  5CSN A;  4PE4 A;  4UPG A;  3K21 A;  4OZD A;  3JVT B;  4AOM A;  4E68 A;  1SSE B;  2WCF A;  4TNC A;  3BFH A;  1C7W A;  1DEK A;  1OMR A;  3L4L A;  4R1E A;  2H61 C;  3SG4 A;  4OCI A;  2MRD A;  1LA0 A;  2K61 A;  2FJU B;  5HLO A;  1CDN A;  4I5J A;  4WQ3 A;  1KWO B;  3DVM A;  1S36 A;  1TNP A;  3CZT X;  2KFG A;  1KFU S;  2M1K B;  2R2I A;  1BMO A;  2BEC A;  2JPT A;  3F45 A;  2KLD A;  2PVB A;  1AJ5 A;  2QEV A;  4ORA B;  4FTG A;  2MLF C;  1CMG A;  1JFK A;  1ODB A;  3CLN A;  3R1P A;  1JSA A;  2MLE C;  4YBH B;  4MZJ A;  2L98 A;  1TTX A;  1QJT A;  1ORG A;  1SYM A;  5I2O A;  3BUW B;  2K60 A;  3FS7 A;  4YI9 A;  2JUL A;  1YRT B;  5G08 A;  1MQ1 A;  3OBV A;  4YGD B;  3M0W A;  5D7F A;  1LKJ A;  2M9G A;  1K9K A;  5CSJ A;  1LXF C;  2BE6 A;  3ICB A;  3PAL A;  2K7C A;  5DKQ A;  2EHB A;  2JWW A;  2O60 A;  3RLZ A;  4XJK A;  1AVS A;  1JC2 A;  4PE1 A;  1E8A A;  1NUB A;  3O78 A;  4XJK B;  5FI6 A;  1QVI Y;  3CZ2 A;  3FIA A;  3DY9 A;  1OOJ A;  1Z4H A;  2ERB A;  2M29 A;  3GK4 X;  1B47 A;  2PQL A;  2NXQ A;  4YGE B;  4QJ5 B;  3HCM A;  1YR5 A;  1YTZ C;  1ALW A;  1H4B A;  1A29 A;  1GJY A;  2LP2 A;  1CNP A;  2CXJ A;  1QX2 A;  1W7J B;  2Y1M A;  1IQ3 A;  1DJY A;  2KQY A;  2WCJ A;  3CDN A;  4DCK A;  1CDM A;  1ZFS A;  1R2U A;  2GTE A;  1TIZ A;  2JNX A;  2G9B A;  1SY9 A;  4HRH A;  1A75 A;  5K89 A;  1NSH A;  1AJ4 A;  2CT9 A;  4OV2 A;  5HKW A;  5PAL A;  1UWO A;  1A75 B;  1RRO A;  1CDP A;  2BKI B;  4INX A;  1QWV A;  4N5X A;  3TDI A;  3SIB A;  2F3Y A;  3S0A A;  1A4P A;  1B8C A;  2WCH A;  2LHI A;  1NCX A;  5FI7 A;  3Q8I A;  1AUI B;  2ISD A;  1IG5 A;  3KEV A;  2ZFD A;  2GGZ A;  3D76 A;  4NDB A;  4CFQ A;  3R1V A;  3BXK A;  2L5Y A;  2F2O A;  1DJG A;  4IL1 A;  1DF0 A;  4MLW A;  5HKY A;  1SR6 C;  2EC6 C;  2ZND A;  4GNK B;  1DF0 B;  1OZS A;  3VRP A;  1XFV O;  1N0Y A;  1GM0 A;  5HLV A;  3GK2 A;  4ORB B;  2LLS A;  1PAL A;  5KU1 A;  1BG1 A;  2JNF A;  1IRJ A;  2WCL A;  3BOW A;  2ZNE A;  2WC5 A;  2AUC A;  2KAX A;  3BUM B;  1TCO B;  3BOW B;  1A2X A;  1MUX A;  2Q91 A;  2FCD A;  2BNX A;  2L5X B;  3GK1 A;  3PM8 A;  3JVT C;  2MBX A;  3PLF B;  2RGI A;  1DGU A;  2MHH A;  2M0R A;  5FI2 A;  2PMY A;  3NHI A;  3V2L A;  5HKZ A;  1TUZ A;  3EVV A;  4PAL A;  1A03 A;  1F55 A;  2JT3 A;  2SCP A;  3TS5 B;  2LV7 A;  1P28 A;  2GV5 A;  1XFU O;  2CNP A;  1YX7 A;  5J3X A;  4U8D A;  1B1G A;  5JJG A;  1RJV A;  2LHL A;  4I5K A;  1Y1X A;  1G4Y R;  2QDI A;  5JOL A;  2HQ8 A;  5GQQ C;  3BQ3 A;  2PAL A;  3VRR A;  1SCM C;  3A8R A;  2DOQ A;  2K2A A;  1OMD A;  1PK0 D;  2M49 B;  2QEO A;  1NX1 A;  1NX2 A;  2KFF A;  1NP8 A;  2L50 A;  2ZRT A;  4HRE E;  4OR9 B;  2P71 A;  4AQI A;  1DT7 B;  1BOD A;  1CFP A;  1ZAC A;  2E30 A;  3DXL A;  1RTP 1;  3VRQ A;  2KFH A;  5F6T A;  1KSO A;  2KAV A;  2KI6 D;  1SR6 B;  1IQ5 A;  1TRF A;  4BY4 A;  4MRX A;  1B7T Z;  4FQO A;  1IGV A;  1OOG A;  1SKT A;  2I18 A;  3FE6 A;  3FWB A;  1WRL A;  1M31 A;  2D8N A;  3N7H A;  4JKT A;  4P2Y B;  5HYD A;  4ZCV A;  1UUS A;  2BCX A;  3RZS A;  3EKJ A;  1Z2C B;  4NDC A;  3JTD C;  3SS4 A;  4JPZ B;  1UHI A;  5EL2 A;  4NDD A;  3I5H B;  3BUX B;  1BLQ A;  1YUR A;  1SMG A;  2JC2 A;  3LLE A;  4F7F A;  1J7Q A;  2QEH A;  4CPV A;  2H8V A;  2JTZ A;  1SL9 A;  1XO5 A;  2FCE A;  1KSM A;  2COL B;  2I7A A;  1WDC B;  1QLK A;  1BR1 B;  2F33 A;  4GGN A;  3WHU B;  1W7I B;  1IJ5 A;  1WLZ A;  3FE9 A;  5I2L A;  2WCK A;  3ZNI A;  1OOI X;  1UHK A;  3UO9 A;  2TN4 A;  3A4U B;  2KGR A;  4NQG A;  1SCM B;  1J7O A;  4INW A;  2BCB A;  2ZKM X;  4GUK A;  1QX7 A;  1FPW A;  3O2P A;  2WC8 A;  1J7R A;  3C1V A;  1M63 B;  3I5F B;  3OB1 B;  4YGB B;  4F0Z B;  3LK0 A;  3WXA A;  2F8P A;  2BL0 B;  3NSK A;  1CFD A;  1TNQ A;  1EJ3 A;  2AAO A;  1M45 A;  4M2P A;  1IWQ A;  2HQW A;  2L0P A;  1F70 A;  2CBL A;  1CFC A;  1L7Z A;  4JD9 A;  1SL7 A;  5CSI A;  5ER4 X;  1IIO A;  4MN0 A;  1KK7 Z;  1RFJ A;  1Y6W A;  4QJ3 B;  3CAB A;  1QS7 A;  2MA2 A;  1F71 A;  2HPS A;  2JTT A;  1BT6 A;  3SG2 A;  2HF5 A;  1K90 D;  5DIC A;  5AEQ A;  2OTG B;  2Y4Q A;  3SG7 A;  1DC1 A;  3JTD B;  2WCB A;  1J7P A;  4BY5 A;  1DEL A;  2M7N A;  3KPX A;  3SG6 A;  1N65 A;  4M2Q A;  1C3Y A;  1RWY A;  2B1U A;  1CB1 A;  1LA3 A;  1DVI A;  4L9M A;  1CKK A;  2JZI A;  1QIW A;  1YVL A;  1S5G Z;  4MRY A;  4ETO A;  1PVA A;  1C3Z A;  1LS8 A;  2KHN A;  3DD4 A;  3I5G C;  5ER5 A;  3SIA A;  1S26 D;  1DJX A;  4CFR A;  2KAY A;  4YI8 A;  3EVR A;  2Y1N A;  1X02 A;  3TDZ A;  1KFX S;  3TS5 C;  3S0F A;  3R72 A;  1BOC A;  5AER A;  5KSZ A;  1HT9 A;  1B8L A;  3DVK A;  1OSA A;  4ICB A;  4I5L B;  3KF9 A;  1XA5 A;  2K2F A;  3B86 A;  2F2P A;  4QJ4 B;  5DKN A;  2QPT A;  3I5I C;  1FF1 A;  2BBN A;  3FE8 A;  1K8U A;  1PVB A;  1UP5 A;  3DVJ A;  1WRK A;  4PHN A;  4GAO A;  1J1E A;  3VB1 A;  1RK9 A;  2P70 A;  1OMV A;  3CTN A;  3IQQ A;  1QV1 A;  3FWC A;  3VGO A;  2OS8 B;  3OX5 A;  5BPJ A;  1Y0V H;  1AHR A;  1KQV A;  4HRG A;  1NCY A;  1TWO A;  1CLB A;  1AP4 A;  3BYA A;  3CGA A;  1NIW A;  2WND A;  2OPO A;  3PM2 A;  1YUS A;  1ALV A;  2LM5 A;  3IF7 A;  1G33 A;  5KTY A;  1QXP A;  1UHH A;  2LVV A;  4A4C A;  2QAC A;  1K9U A;  2L51 A;  3D78 A;  3NHT A;  2JQ6 A;  3I5H C;  1KCY A;  2AMI A;  1MWN A;  3D74 A;  2HET A;  4GGF C;  1HQV A;  1CLL A;  3I5G B;  1M39 A;  1EH2 A;  3EVU A;  1QVI Z;  4C0L A;  3SG3 A;  2SAS A;  1WDC C;  3IVT A;  1XFW O;  4N1G A;  3DYE A;  3TUY B;  3B87 A;  3B88 A;  1ZMZ A;  3BUO B;  1K2H A;  2L2E A;  3SJS A;  3D77 A;  4MZK A;  4FQT A;  3TDU A;  4USL A;  4PHK A;  3DVE A;  1IKU A;  1B4C A;  2KQ6 A;  3I5I B;  3L4A A;  4MEW A;  5TNC A;  1S6I A;  3VRN A;  4D1E A;  4OKH A;  3O4Y A;  3I5F C;  5D69 A;  2KLE A;  3S0B A;  1JF0 A;  1F4O A;  1VRK A;  2LNK A;  1CM4 A;  2BL0 C;  1F4Q A;  1SRA A;  2JT0 A;  3PJI A;  1K95 A;  2M97 A;  1XYD A;  3AKA A;  3WNX B;  1XFZ O;  2JOJ A;  1ZUZ A;  1DJZ A;  2WOS A;  1EG4 A;  1DJW A;  1SK6 D;  1UHN A;  3O4X A;  2L4I A;  3PN7 C;  1S1E A;  3L47 A;  1MR8 A;  3EK4 A;  2OTG C;  1EG3 A;  3SS3 A;  1LVC D;  1KK7 Y;  1YVH A;  2LUC A;  4GGF A;  4A4B A;  1QV0 A;  3AKB A;  1OZO A;  1KK8 B;  3EK8 A;  4PE0 A;  1L2O B;  1MHO A;  1OOF A;  1V1F A;  2LAP A;  2KSP A;  3SS5 A;  4IJ7 A;  1UUR A;  4KYN A;  1PSB A;  1TN4 A;  1SBJ A;  1FW4 A;  1T14 A;  1WLM A;  2FJY A;  3O6B A;  2LVK A;  1M46 A;  3DZT A;  2LVJ A;  3K1E A;  2QEB A;  2WC6 A;  3CZ0 A;  3PFV A;  5FYX A;  1R6P A;  3E3R A;  2LCP A;  1YRU B;  1IH0 A;  1WRZ A;  1REC A;  2BKH B;  5DKR A;  3LCP C;  2K8M B;  3D0Y A;  3CR2 A;  1BR4 B;  1YX8 A;  3NSI A;  3RM1 A;  2Y5I A;  2Q4U A;  3D73 A;  2O5G A;  3D0Y B;  2L2C A;  2YGU A;  2JRF A;  4JWQ A;  4WQ2 A;  4ZCU A;  3TZ1 A;  1OOH A;  1S6J A;  1OW4 A;  1KQM B;  1S3P A;  2K0J A;  3PAT A;  1NPQ A;  2OS8 C;  4PHJ A;  1IJ6 A;  2KYC A;  2KYF A;  3CR5 X;  4P5O E;  2KI4 C;  1TCF A;  2LP3 A;  3PN7 B;  1TUJ A;  3QRX A;  3D10 A;  1LIN A;  1K93 D;  1QLS A;  5B8I B;  2PSR A;  1BF5 A;  1QAT A;  1JBA A;  2KOT A;  2ZRS A;  5D3O A;  1J1D A;  3NXA A;  1KFX L;  1D1O A;  1CLM A;  1JFJ A;  2BAP A;  4WRI A;  1K96 A;  2LE9 B;  4MSP A;  3EK7 A;  1AK8 A;  2KI6 C;  1NYA A;  1SPY A;  1J55 A;  1B9A A;  5CSF A;  1C7V A;  4M2O A;  4YGC B;  3LK1 A;  1PUL A;  3KHE A;  2KBI A;  1YUU A;  1DJI A;  2KDH A;  1CDL A;  3NGV A;  5IBW A;  2M7L A;  3B7A A;  4GBA A;  4CLN A;  3BJH A;  3TUY C;  1XK4 C;  3D75 A;  3R1O A;  4PT1 A;  1U5I A;  4CID A;  4PCW A;  3MSE B;  3BFA A;  4DUQ A;  2H61 A;  1K9P A;  1N2D A;  1QTX A;  1SCV A;  1U5I B;  1S6C A;  4MVF A;  1H8B A;  1CTR A;  1F8H A;  4DRW A;  4GFT A;  1Y1U A;  3PSR A;  5AXI A;  1BJF A;  3OHM B;  1NX3 A;  3EKH A;  2BCA A;  2KNE A;  2JXL A;  2ZN9 A;  3H4S E;  3SG5 A;  4C0J A;  1GGZ A;  4OVN F;  5I94 A;  2KI4 B;  2I94 A;  3AAJ A;  4XYN A;  1XVJ A;  3IQO A;  2JXC A;  1MF8 B;  3HX4 A;  1BU3 A;  3CS1 A;  3GOF A;  4YRU A;  1FI6 A;  4C0K A;  1B7T Y;  1QAS A;  1JF2 A;  2V53 A;  4MZL A;  3NSL A;  4JQ0 D;  2LMV A;  5I2Q A;  1JWD A;  2E6W A;  3S0E A;  2CTN A;  1QX5 B;  3QME A;  2H2K A;  4GPL B;  1F54 A;  1OE9 B;  1KK8 C;  3UNW A;  1CMF A;  1EL4 A;  1L2O C;  2JT8 A;  2MAZ A;  1CM1 A;  2M8U A;  1MXE A;  1V1G A;  2P6B B;  2PAS A;  3OGN A;  1GGW A;  2F3Z A;  2JU0 A;  2KBM A;  1XK4 A;  2LUX A;  1FBV A;  2LVI A;  4PE7 A;  1NX0 A;  1DJH A;  1TOP A;  3VRO A;  2JPO A; 
#chains in the Genus database with same CATH homology
 1CFF A;  2NLN A;  1NWD A;  2WOR A;  2M1U A;  1TNW A;  4AQJ A;  3WHT B;  2LMU A;  1MXL C;  1QIV A;  2K7O A;  1EXR A;  2KGB C;  2LLT A;  1XFY O;  1FI5 A;  2L4H A;  3AAK A;  2EGD A;  1B8R A;  1SNL A;  2NCO A;  3OX6 A;  1UHJ A;  2GGM A;  2K7D A;  2PRU A;  1KWO C;  1GQM A;  1KQM C;  1Y1A A;  2G2B A;  3ZWH A;  1PSR A;  1DMO A;  3OP0 A;  2WCE A;  5AFP A;  3NSO A;  2LLU A;  2MJW B;  2VRG A;  1TNX A;  1PRW A;  1XFX O;  1ZOT B;  2BBM A;  2CCM A;  1DTL A;  1DGV A;  1WY9 A;  3BUN B;  5AAN A;  5I8N A;  2ZN8 A;  1G8I A;  4DIR A;  2LC5 A;  2I2R E;  2K7B A;  2FOT A;  4Q04 A;  2LAN A;  4N1F A;  3DF0 A;  1Q80 A;  2NCP A;  2M3W A;  3DF0 B;  4DS7 A;  1NCZ A;  3KO0 A;  1YUT A;  2EC6 B;  3LL8 B;  1SL8 A;  4YGA A;  2NZ0 A;  4PHM A;  3CWG A;  2IS9 A;  1C07 A;  2A4J A;  1K94 A;  4HSZ A;  4I5N B;  1JUO A;  1S5G Y;  4ORC B;  4MBE A;  1SW8 A;  1OQP A;  3CR4 X;  5CPV A;  4PDZ A;  2LMT A;  5CSN A;  1KFU L;  2BE4 A;  3OB2 B;  4PE4 A;  4UPG A;  3K21 A;  3JVT B;  4AOM A;  4E68 A;  2WCF A;  4TNC A;  1C7W A;  1OMR A;  4R1E A;  3SG4 A;  2H61 C;  4OCI A;  2MRD A;  1LA0 A;  2K61 A;  2FJU B;  5HLO A;  1CDN A;  4I5J A;  4WQ3 A;  1KWO B;  3DVM A;  1S36 A;  1TNP A;  3CZT X;  2KFG A;  1KFU S;  2M1K B;  2R2I A;  1BMO A;  2BEC A;  2JPT A;  3F45 A;  2PVB A;  1AJ5 A;  4ORA B;  4FTG A;  2MLF C;  1CMG A;  1JFK A;  1ODB A;  3CLN A;  1JSA A;  2MLE C;  4YBH B;  4MZJ A;  2L98 A;  1TTX A;  1QJT A;  5I2O A;  1SYM A;  3BUW B;  3FS7 A;  4YI9 A;  2JUL A;  1YRT B;  5G08 A;  1MQ1 A;  4YGD B;  3M0W A;  5D7F A;  1LKJ A;  2M9G A;  1K9K A;  5CSJ A;  1LXF C;  2BE6 A;  3ICB A;  3PAL A;  2K7C A;  5DKQ A;  2EHB A;  2JWW A;  2O60 A;  3RLZ A;  4XJK A;  1AVS A;  1JC2 A;  4PE1 A;  1E8A A;  1NUB A;  3O78 A;  4XJK B;  1QVI Y;  3FIA A;  1OOJ A;  2M29 A;  3GK4 X;  1B47 A;  4YGE B;  2NXQ A;  4QJ5 B;  3HCM A;  1YR5 A;  1YTZ C;  1ALW A;  1H4B A;  1A29 A;  1GJY A;  2LP2 A;  1CNP A;  2CXJ A;  1QX2 A;  1W7J B;  2Y1M A;  1IQ3 A;  1DJY A;  2KQY A;  4DCK A;  1CDM A;  1ZFS A;  1R2U A;  1TIZ A;  2JNX A;  2G9B A;  1SY9 A;  4HRH A;  1A75 A;  5K89 A;  1NSH A;  1AJ4 A;  2CT9 A;  4OV2 A;  5HKW A;  5PAL A;  1UWO A;  1A75 B;  1RRO A;  1CDP A;  2BKI B;  4N5X A;  3TDI A;  3SIB A;  2F3Y A;  1A4P A;  1B8C A;  2LHI A;  1NCX A;  1AUI B;  2ISD A;  1IG5 A;  3KEV A;  2ZFD A;  2GGZ A;  4NDB A;  4CFQ A;  3BXK A;  2F2O A;  1DJG A;  4IL1 A;  1DF0 A;  4MLW A;  5HKY A;  1SR6 C;  2EC6 C;  2ZND A;  4GNK B;  1DF0 B;  1OZS A;  3VRP A;  1XFV O;  1N0Y A;  5HLV A;  3GK2 A;  4ORB B;  2LLS A;  1PAL A;  5KU1 A;  1BG1 A;  2JNF A;  1IRJ A;  3BOW A;  2ZNE A;  2AUC A;  2KAX A;  3BUM B;  1TCO B;  3BOW B;  1A2X A;  1MUX A;  2Q91 A;  2FCD A;  2L5X B;  3GK1 A;  3PM8 A;  3JVT C;  2MBX A;  3PLF B;  2RGI A;  1DGU A;  2MHH A;  2M0R A;  2PMY A;  5HKZ A;  3EVV A;  4PAL A;  1A03 A;  1F55 A;  2JT3 A;  2SCP A;  3TS5 B;  2LV7 A;  2GV5 A;  1XFU O;  2CNP A;  1YX7 A;  5J3X A;  4U8D A;  1B1G A;  5JJG A;  1RJV A;  2LHL A;  4I5K A;  1Y1X A;  1G4Y R;  5JOL A;  3VRR A;  2HQ8 A;  5GQQ C;  3BQ3 A;  2PAL A;  1SCM C;  3A8R A;  2DOQ A;  2K2A A;  1OMD A;  1PK0 D;  2M49 B;  2ZRT A;  1NX1 A;  1NX2 A;  2KFF A;  1NP8 A;  2L50 A;  4HRE E;  4OR9 B;  1DT7 B;  4AQI A;  1BOD A;  1CFP A;  1ZAC A;  2E30 A;  1RTP 1;  3VRQ A;  2KFH A;  5F6T A;  1KSO A;  2KAV A;  2KI6 D;  1SR6 B;  1IQ5 A;  1TRF A;  4BY4 A;  4MRX A;  1B7T Z;  4FQO A;  1IGV A;  1SKT A;  2I18 A;  3FWB A;  1WRL A;  1M31 A;  2D8N A;  5HYD A;  4P2Y B;  4ZCV A;  1UUS A;  2BCX A;  3EKJ A;  4NDC A;  3JTD C;  4JPZ B;  1UHI A;  4NDD A;  3I5H B;  3BUX B;  1BLQ A;  1YUR A;  1SMG A;  2JC2 A;  3LLE A;  1J7Q A;  4CPV A;  2JTZ A;  1SL9 A;  1XO5 A;  2FCE A;  1KSM A;  2COL B;  2I7A A;  1WDC B;  1QLK A;  1BR1 B;  2F33 A;  4GGN A;  3WHU B;  1W7I B;  1IJ5 A;  1WLZ A;  5I2L A;  3ZNI A;  1UHK A;  2TN4 A;  3A4U B;  2KGR A;  4NQG A;  1SCM B;  1J7O A;  2BCB A;  2ZKM X;  4GUK A;  1QX7 A;  1FPW A;  3O2P A;  2WC8 A;  1J7R A;  3C1V A;  1M63 B;  3I5F B;  3OB1 B;  4YGB B;  4F0Z B;  3LK0 A;  3WXA A;  2F8P A;  2BL0 B;  3NSK A;  1CFD A;  1TNQ A;  1EJ3 A;  2AAO A;  1M45 A;  4M2P A;  1IWQ A;  2HQW A;  2L0P A;  1F70 A;  2CBL A;  1CFC A;  1L7Z A;  1SL7 A;  5CSI A;  5ER4 X;  4MN0 A;  1KK7 Z;  1RFJ A;  1Y6W A;  4QJ3 B;  1F71 A;  1QS7 A;  2MA2 A;  2HPS A;  2JTT A;  1BT6 A;  3SG2 A;  2HF5 A;  1K90 D;  5AEQ A;  2OTG B;  2Y4Q A;  3SG7 A;  3JTD B;  2WCB A;  1J7P A;  4BY5 A;  2M7N A;  3KPX A;  3SG6 A;  1N65 A;  4M2Q A;  1RWY A;  2B1U A;  1CB1 A;  1LA3 A;  1DVI A;  4L9M A;  1CKK A;  2JZI A;  1QIW A;  1YVL A;  1S5G Z;  4MRY A;  4ETO A;  1PVA A;  3I5G C;  5ER5 A;  2KHN A;  3DD4 A;  3SIA A;  1S26 D;  1DJX A;  4CFR A;  2KAY A;  4YI8 A;  3EVR A;  2Y1N A;  1X02 A;  3TDZ A;  1KFX S;  3TS5 C;  1BOC A;  5AER A;  5KSZ A;  1HT9 A;  1B8L A;  3DVK A;  1OSA A;  4ICB A;  4I5L B;  3KF9 A;  1XA5 A;  2K2F A;  2F2P A;  4QJ4 B;  5DKN A;  2QPT A;  3I5I C;  1FF1 A;  2BBN A;  1K8U A;  1PVB A;  1UP5 A;  3DVJ A;  1WRK A;  4PHN A;  4GAO A;  1J1E A;  1RK9 A;  1OMV A;  3CTN A;  3IQQ A;  1QV1 A;  3FWC A;  3VGO A;  2OS8 B;  3OX5 A;  5BPJ A;  1Y0V H;  1AHR A;  1KQV A;  4HRG A;  1NCY A;  1CLB A;  1AP4 A;  3BYA A;  3CGA A;  1NIW A;  2WND A;  2OPO A;  1YUS A;  1ALV A;  2LM5 A;  3IF7 A;  1G33 A;  5KTY A;  1QXP A;  1UHH A;  2LVV A;  4A4C A;  2QAC A;  1K9U A;  2L51 A;  2JQ6 A;  3I5H C;  1KCY A;  2AMI A;  1MWN A;  2HET A;  4GGF C;  1HQV A;  1CLL A;  3I5G B;  1M39 A;  1EH2 A;  3EVU A;  1QVI Z;  4C0L A;  3SG3 A;  2SAS A;  1WDC C;  1XFW O;  4N1G A;  3TUY B;  1ZMZ A;  3BUO B;  1K2H A;  2L2E A;  3SJS A;  4MZK A;  3TDU A;  4USL A;  4PHK A;  3DVE A;  1IKU A;  1B4C A;  2KQ6 A;  3I5I B;  4MEW A;  5TNC A;  3VRN A;  1S6I A;  4D1E A;  4OKH A;  3O4Y A;  3I5F C;  5D69 A;  1JF0 A;  1F4O A;  1VRK A;  2LNK A;  1CM4 A;  2BL0 C;  1F4Q A;  1SRA A;  2JT0 A;  1K95 A;  2M97 A;  1XYD A;  3AKA A;  3WNX B;  1XFZ O;  2JOJ A;  1ZUZ A;  1DJZ A;  2WOS A;  1EG4 A;  1DJW A;  1SK6 D;  1UHN A;  2L4I A;  3PN7 C;  1S1E A;  1MR8 A;  3EK4 A;  2OTG C;  1EG3 A;  1LVC D;  1KK7 Y;  1YVH A;  2LUC A;  4GGF A;  4A4B A;  1QV0 A;  3AKB A;  1OZO A;  1KK8 B;  3EK8 A;  4PE0 A;  1L2O B;  1MHO A;  1V1F A;  2LAP A;  2KSP A;  1UUR A;  1PSB A;  1TN4 A;  1SBJ A;  1FW4 A;  1WLM A;  3O6B A;  2LVK A;  1M46 A;  2LVJ A;  3PFV A;  5FYX A;  1R6P A;  3E3R A;  2LCP A;  1YRU B;  1IH0 A;  1WRZ A;  1REC A;  2BKH B;  5DKR A;  3LCP C;  2K8M B;  3D0Y A;  3CR2 A;  1BR4 B;  1YX8 A;  3NSI A;  3RM1 A;  2Y5I A;  2Q4U A;  2O5G A;  3D0Y B;  4JWQ A;  4WQ2 A;  2JRF A;  4ZCU A;  3TZ1 A;  1S6J A;  1KQM B;  1S3P A;  2K0J A;  3PAT A;  1NPQ A;  2OS8 C;  4PHJ A;  1IJ6 A;  2KYC A;  2KYF A;  3CR5 X;  4P5O E;  2KI4 C;  1TCF A;  2LP3 A;  3PN7 B;  3QRX A;  3D10 A;  1LIN A;  1K93 D;  1QLS A;  5B8I B;  2PSR A;  1BF5 A;  1QAT A;  1JBA A;  2KOT A;  2ZRS A;  1J1D A;  3NXA A;  1KFX L;  1D1O A;  1CLM A;  1JFJ A;  4WRI A;  1K96 A;  2LE9 B;  4MSP A;  3EK7 A;  1AK8 A;  2KI6 C;  1NYA A;  1SPY A;  1J55 A;  1B9A A;  5CSF A;  1C7V A;  4M2O A;  4YGC B;  3LK1 A;  1PUL A;  3KHE A;  2KBI A;  1YUU A;  1DJI A;  2KDH A;  1CDL A;  5IBW A;  2M7L A;  4GBA A;  4CLN A;  3TUY C;  1XK4 C;  1U5I A;  4CID A;  4PCW A;  3MSE B;  4DUQ A;  2H61 A;  1K9P A;  1N2D A;  1QTX A;  1SCV A;  1U5I B;  1S6C A;  4MVF A;  1H8B A;  1CTR A;  1F8H A;  4DRW A;  4GFT A;  1Y1U A;  3PSR A;  5AXI A;  1BJF A;  3OHM B;  1NX3 A;  3EKH A;  2BCA A;  2KNE A;  2JXL A;  2ZN9 A;  3H4S E;  3SG5 A;  4C0J A;  1GGZ A;  4OVN F;  2KI4 B;  2I94 A;  3AAJ A;  4XYN A;  1XVJ A;  3IQO A;  2JXC A;  1MF8 B;  3HX4 A;  1BU3 A;  3CS1 A;  3GOF A;  4YRU A;  1FI6 A;  4C0K A;  1B7T Y;  1QAS A;  1JF2 A;  2V53 A;  4MZL A;  3NSL A;  4JQ0 D;  2LMV A;  5I2Q A;  1JWD A;  2E6W A;  2CTN A;  1QX5 B;  4GPL B;  2H2K A;  1F54 A;  1OE9 B;  1KK8 C;  1CMF A;  1EL4 A;  1L2O C;  2JT8 A;  2MAZ A;  1CM1 A;  2M8U A;  1MXE A;  1V1G A;  2P6B B;  2PAS A;  1GGW A;  2F3Z A;  2JU0 A;  2KBM A;  1XK4 A;  2LUX A;  1FBV A;  2LVI A;  4PE7 A;  1NX0 A;  1DJH A;  1TOP A;  3VRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...