2HPSA

Crystal structure of coelenterazine-binding protein from renilla muelleri
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
184
structure length
184
Chain Sequence
EITESERAYHLRKMKTRMQRVDVTGDGFISREDYELIAVRIAKIAKLSAEKAEETRQEFLRVADQLGLAPGVRISVEEAAVNATDSLLKMKGEEKAMAVIQSLIMYDCIDTDKDGYVSLPEFKAFLQAVGPDLTDDKAITCFNTLDFNKNGQISRDEFLVTVNDFLFGLEETALANAFYGDLVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords coelenterazine-binding protein with bound coelenterazine
publication title Crystal structure of coelenterazine-binding protein from Renilla muelleri at 1.7 A: why it is not a calcium-regulated photoprotein.
pubmed doi rcsb
source organism Renilla muelleri
molecule tags Luminescent protein
total genus 68
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2006-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2hpsA00
2NCOA 1XVJA 3PSRA 5HLOA 2WCFA 1XK4A 2I18A 1BODA 2JTZA 1AHRA 1NIWA 1M63B 4MRXA 3TDUA 3I5IB 5I2OA 1B8LA 2LAPA 2R2IA 3O4YA 3RLZA 1LKJA 1S5GZ 1KSMA 2ZN9A 4CFRA 3HX4A 3D0YB 1SW8A 1CLLA 1QLKA 3AAKA 1CLBA 5AANA 3PFVA 1DGVA 1LXFC 4JQ0D 3SG5A 4CPVA 1F8HA 2KYFA 2KOTA 2ZNEA 3TUYC 1F70A 2K0JA 4P5OE 2H61A 4ORBB 1FF1A 4QJ4B 2CCMA 2I94A 2ISDA 1CLMA 2M1UA 3BOWB 2K61A 1SL9A 3CTNA 3D0YA 2PMYA 2L0PA 1GGZA 4ZCUA 1CFCA 2O5GA 2WNDA 1IWQA 3OX6A 1S5GY 2LP2A 1TCFA 3VROA 2MRDA 3SJSA 1M31A 5J3XA 2Y1MA 2KI6D 1JSAA 4C0LA 2BBNA 2BCAA 1YVLA 1NPQA 2LP3A 2NLNA 1SL8A 4GUKA 2HQ8A 4IL1A 2M97A 1DJWA 2KYCA 1JUOA 2JPTA 3H4SE 3BOWA 3A8RA 2LCPA 2FOTA 1XFYO 2M3WA 3BUWB 2KBMA 1NYAA 3I5FC 1DF0B 3JTDC 3A4UB 4OR9B 1YUSA 1DJGA 1TNXA 1W7IB 1NWDA 1MWNA 4CIDA 4GPLB 3OB1B 4YBHB 4U8DA 5D7FA 5DKQA 3K21A 2WOSA 1FI6A 5K89A 2MJWB 2MA2A 5KSZA 1SCVA 1PVAA 1OZSA 1J7OA 1J1EA 5PALA 1IRJA 4WRIA 1K90D 1IQ5A 1J55A 3WHTB 2E30A 4XJKB 4MBEA 1ODBA 3CS1A 1K2HA 2MHHA 2PVBA 2BKIB 1DF0A 4WQ3A 3SG4A 4DUQA 1UHJA 5CSNA 2PASA 4NDCA 1UHIA 1AJ4A 3DVKA 1EXRA 2JT3A 1GQMA 3SIAA 1W7JB 2HQWA 1PSBA 1RJVA 1IJ5A 4PHJA 1B7TY 1XA5A 1OMDA 1YRUB 1ZFSA 4WQ2A 2K2FA 3PALA 1WLZA 1F71A 3I5HC 1PALA 4C0KA 1NX3A 1S6IA 1YTZC 1CDPA 2KFFA 3BUXB 1CM1A 1SKTA 1B47A 2F2PA 4XJKA 1EH2A 2F3YA 1F54A 3JVTB 2O60A 1D1OA 2LMVA 5CSIA 1AUIB 2BL0C 2LVVA 4FTGA 2Q91A 1K9KA 3SG2A 5JOLA 3FWBA 4NDDA 1OQPA 2F2OA 4OV2A 2LNKA 1PVBA 4PHNA 3PN7C 3TDIA 2BCBA 3CGAA 1Y0VH 4GGFC 4ORAB 1DMOA 1IGVA 3IQQA 3LLEA 1BF5A 1YR5A 4MLWA 2LM5A 4DS7A 1YUUA 1KK7Y 2CBLA 4YI9A 5AXIA 4CLNA 1UUSA 2KI6C 2NXQA 1PK0D 3AKAA 4JPZB 4TNCA 3OP0A 1ALWA 4JWQA 2MBXA 4PE7A 2MLFC 1KK8B 2JOJA 5AFPA 1R6PA 2F3ZA 1DTLA 4AQJA 1SK6D 3SG7A 1SBJA 3KO0A 5D69A 1H4BA 2WCEA 1WDCC 1EG3A 3NSLA 1SNLA 1QV1A 2LVJA 1S6CA 1IJ6A 1MHOA 1G4YR 2M0RA 4N5XA 3SG3A 2M29A 4CFQA 1DJHA 1QVIY 3ICBA 1G33A 2HF5A 1N2DA 2LLUA 5IBWA 1VRKA 3I5GC 2JNFA 1BU3A 1UURA 1MR8A 1NX0A 2G2BA 3NSOA 3DF0B 2MLEC 1XO5A 2H2KA 2LE9B 1M46A 1B8CA 2OPOA 4MZJA 1L2OC 4M2OA 4HREE 1E8AA 4AOMA 3WNXB 1SR6B 3GK4X 3CWGA 2K2AA 2DOQA 5HKZA 1DGUA 3F45A 3EVRA 1QTXA 1RWYA 1OE9B 3BYAA 1A2XA 4PDZA 3D10A 2OTGC 3DVJA 1OMVA 1WRZA 3JTDB 2BCXA 2LMUA 3EKHA 1JBAA 4BY5A 1WRLA 3DF0A 1K96A 1ZOTB 3RM1A 1NCXA 1S26D 2OS8C 5HKYA 1A29A 5ER5A 1CB1A 3VRPA 1B9AA 2HETA 2WC8A 1FPWA 3NSKA 1JFJA 2H61C 4PE4A 1MQ1A 2LVKA 1K9UA 1QXPA 1B7TZ 1CDNA 1CKKA 2A4JA 3KEVA 1NX2A 3EVVA 1SPYA 3HCMA 2ZNDA 3LK0A 4DRWA 4E68A 1OZOA 4DCKA 1SCMB 4I5KA 5KTYA 1QLSA 1JF0A 2KGBC 2I7AA 1ZMZA 1GJYA 3EKJA 1HQVA 3O2PA 1WLMA 3TS5C 3WHUB 1F55A 4ICBA 3I5HB 2KNEA 2JZIA 1CDMA 2KFGA 1SMGA 2F33A 3CR2A 2K7OA 1ZACA 3KHEA 5HLVA 4A4CA 3VRNA 1U5IB 2JU0A 1J7QA 4GBAA 4NQGA 1A75B 2JT0A 4YI8A 1TNWA 1R2UA 2KI4B 1DJZA 1TOPA 1N65A 1TTXA 4MRYA 3EK8A 1Y1UA 5TNCA 3VGOA 1PULA 3NSIA 2KSPA 2M1KB 1DJIA 2G9BA 1BJFA 2LANA 2M49B 3LK1A 4UPGA 3MSEB 2EC6B 2LLTA 1KK7Z 4DIRA 1BT6A 4ETOA 5B8IB 1C07A 1SL7A 4USLA 1WRKA 3OHMB 2PRUA 2ZRTA 2L4HA 4N1FA 4ZCVA 2VRGA 2K7BA 1U5IA 1BMOA 3DVEA 2V53A 5JJGA 1QASA 4C0JA 1K8UA 1B1GA 1NX1A 2NZ0A 3CZTX 3IF7A 3PATA 1UWOA 2K7DA 3AKBA 3OB2B 1X02A 3CR5X 1KFXL 2IS9A 1LA0A 2I2RE 1KQMC 1SRAA 1YVHA 1B4CA 3LL8B 2L98A 1QVIZ 2L50A 2L51A 4M2PA 2M8UA 3AAJA 1NCYA 1BR4B 1EL4A 1DVIA 1UP5A 2CNPA 1ALVA 2KAYA 4GGNA 4YGEB 3IQOA 1OOJA 1XFVO 2D8NA 4HRGA 4BY4A 2MAZA 3BXKA 1NP8A 1TRFA 4I5NB 2BE4A 2JT8A 2TN4A 3GK1A 1JFKA 1RTP1 2AUCA 1S1EA 2B1UA 1RROA 2GGMA 1XYDA 2L5XB 3CLNA 5I8NA 4FQOA 1KCYA 1TNQA 1KWOC 1RECA 1Y1XA 5I2LA 3TUYB 1BLQA 1KQVA 2SASA 4I5JA 5AEQA 2EHBA 4HSZA 2LHLA 1CFDA 1DJXA 1K93D 1LINA 1MXLC 4Q04A 1UHNA 2JC2A 4PALA 1C7WA 2OTGB 2PSRA 2Y1NA 1J1DA 2K7CA 1YX8A 2K8MB 4MSPA 4F0ZB 4MZLA 1QV0A 5I2QA 4L9MA 1KFUL 1MF8B 1FBVA 2KBIA 2LUXA 3QRXA 3JVTC 4HRHA 3EVUA 1GGWA 1QIWA 5BPJA 2WORA 4OCIA 2OS8B 1BR1B 2JWWA 1FI5A 1EJ3A 1XK4C 1YX7A 2LV7A 1S6JA 3BUMB 3E3RA 5FYXA 4YRUA 1M45A 1TN4A 1QX7A 1MXEA 2L2EA 4I5LB 1K94A 1CM4A 3C1VA 1QS7A 1G8IA 1CTRA 5CSFA 4MVFA 3I5FB 1JF2A 1RK9A 2QPTA 2HPSA 2KGRA 4PCWA 2EGDA 1A03A 4GNKB 3ZWHA 1DJYA 4PHMA 3KF9A 2KHNA 4MZKA 1NUBA 2KFHA 2ZKMX 3TS5B 3VRRA 1AP4A 5HYDA 4QJ5B 1QX2A 2RGIA 3KPXA 1KK8C 3TDZA 1F4QA 3GOFA 3CR4X 2KDHA 3I5IC 3WXAA 1CMFA 1NCZA 1SY9A 1SYMA 1BG1A 1TNPA 1AVSA 4PE1A 1WY9A 1Y6WA 1AK8A 5CSJA 2LUCA 2E6WA 1A4PA 2LMTA 4PHKA 1XFXO 1M39A 1CDLA 1B8RA 3O6BA 2LC5A 1RFJA 4P2YB 1S3PA 4MEWA 1JC2A 1UHHA 1IKUA 1QIVA 2JNXA 5ER4X 5F6TA 3SIBA 1J7RA 1YRTB 2JXLA 2Y4QA 1C7VA 1TCOB 1Y1AA 2LVIA 2LHIA 3BUOB 5CPVA 1J7PA 1SR6C 1XFZO 1YUTA 4D1EA 2LLSA 2P6BB 1Q80A 4YGDB 2KQYA 1L7ZA 1KFXS 1QX5B 2ZN8A 1OMRA 1FW4A 2AAOA 2CXJA 2FCDA 2BECA 2BL0B 4OVNF 3GK2A 4R1EA 2SCPA 1KQMB 4GAOA 4M2QA 1K95A 1BOCA 4OKHA 2QACA 2COLB 3PN7B 4NDBA 1QATA 3TZ1A 3EK7A 1JWDA 1PRWA 2CT9A 2NCPA 1AJ5A 1XFWO 3PLFB 5KU1A 1A75A 3M0WA 4A4BA 2AMIA 1IG5A 2M7LA 4QJ3B 3VRQA 1V1GA 1ZUZA 1PSRA 1HT9A 1IQ3A 1SCMC 1YURA 2Y5IA 2JXCA 1KWOB 3OX5A 1LVCD 1XFUO 3LCPC 3O78A 1K9PA 2M7NA 5HKWA 1EG4A 2ZRSA 3PM8A 2PALA 2L4IA 3BQ3A 2ZFDA 3EK4A 1CFFA 1MUXA 2JQ6A 2KAXA 1WDCB 4GGFA 3ZNIA 1KFUS 5GQQC 4ORCB 4YGBB 2FCEA 2JULA 3BUNB 2GGZA 1F4OA 1N0YA 2BE6A 2KQ6A 3I5GB 1CNPA 1QJTA 2KI4C 3DVMA 4N1GA 3SG6A 3FWCA 2GV5A 4PE0A 2M9GA 1NSHA 1TIZA 2BBMA 4XYNA 2KAVA 1V1FA 3FIAA 1L2OB 1DT7B 2EC6C 2JRFA 5DKRA 3NXAA 1CFPA 1H8BA 4MN0A 2BKHB 4AQIA 1IH0A 3DD4A 2WCBA 2FJUB 1S36A 2F8PA 3FS7A 2JTTA 1OSAA 4GFTA 1CMGA 1KSOA 4YGAA 2CTNA 5G08A 5AERA 1LA3A 4YGCB 5DKNA 1UHKA 2Q4UA
chains in the Genus database with same CATH superfamily
2NCOA 1XVJA 3PSRA 5HLOA 3DY9A 2WCFA 1XK4A 2I18A 1BODA 2JTZA 1AHRA 1NIWA 1M63B 3D73A 4MRXA 3TDUA 3I5IB 5I2OA 1B8LA 2LAPA 2R2IA 3O4YA 3RLZA 1LKJA 1S5GZ 1KSMA 2ZN9A 3BFBA 4CFRA 3EG5B 3HX4A 3D0YB 1SW8A 1CLLA 1IIOA 1QLKA 3AAKA 1CLBA 5AANA 3PFVA 1DGVA 1LXFC 2WCMA 4JQ0D 3SG5A 4CPVA 1F8HA 3S0GA 2KYFA 1OOHA 2KOTA 2ZNEA 3TUYC 1C3YA 1F70A 2K0JA 4P5OE 2H61A 4ORBB 1FF1A 4QJ4B 2CCMA 2I94A 2ISDA 1CLMA 2M1UA 3BOWB 2K61A 1SL9A 3CTNA 3D0YA 3B87A 2PMYA 2L0PA 3K1EA 1GGZA 4ZCUA 3PM2A 1CFCA 2O5GA 2QEHA 2WNDA 3V2LA 1IWQA 3OX6A 1S5GY 2LP2A 1TCFA 3VROA 2MRDA 3SJSA 1OOIX 3CYZA 1M31A 5J3XA 2Y1MA 2KI6D 1JSAA 4C0LA 2BBNA 2BCAA 1YVLA 1NPQA 2LP3A 2NLNA 1SL8A 4GUKA 2HQ8A 3UNWA 4IL1A 2M97A 1DJWA 2KYCA 1JUOA 2JPTA 4JKTA 3H4SE 3BOWA 3A8RA 2LCPA 2FOTA 1XFYO 2M3WA 3BUWB 2KBMA 1NYAA 3I5FC 3R1VA 1DF0B 3JTDC 3A4UB 4OR9B 1YUSA 1DJGA 1TNXA 1W7IB 1NWDA 3RZSA 1MWNA 4CIDA 3DYEA 4GPLB 3OB1B 4YBHB 4U8DA 1SSEB 5D7FA 3K21A 2WOSA 5DKQA 5K89A 2MJWB 2MA2A 5KSZA 1FI6A 2L5YA 1SCVA 1PVAA 1OZSA 1J7OA 1J1EA 5PALA 1IRJA 4WRIA 1K90D 1IQ5A 1J55A 3WHTB 2E30A 4XJKB 4MBEA 1ODBA 3CS1A 1K2HA 2MHHA 2PVBA 2BKIB 1DF0A 4WQ3A 3SG4A 4DUQA 1UHJA 5CSNA 2PASA 4NDCA 1UHIA 1AJ4A 3DVKA 1EXRA 2JT3A 3UO9A 1GQMA 3SIAA 1W7JB 2HQWA 1PSBA 1RJVA 1IJ5A 4PHJA 1B7TY 1XA5A 1OMDA 1YRUB 1ZFSA 3B88A 4FQTA 4WQ2A 2K2FA 3N7HA 1WLZA 3PALA 1F71A 3I5HC 1PALA 4C0KA 1NX3A 2P71A 1S6IA 1YTZC 1CDPA 2KFFA 3BUXB 1CM1A 1OOFA 1SKTA 1B47A 3B86A 2F2PA 4XJKA 1EH2A 2F3YA 1F54A 3JVTB 2O60A 1D1OA 2LMVA 5CSIA 1AUIB 2BL0C 2LVVA 4FTGA 2Q91A 5DICA 1K9KA 3SG2A 5JOLA 3FWBA 4NDDA 1OQPA 2F2OA 2ERBA 2L2CA 4OV2A 2QEOA 3R1PA 2LNKA 1PVBA 1Z2CB 4PHNA 3PN7C 3TDIA 2BCBA 3CGAA 1Y0VH 4GGFC 4ORAB 1DMOA 1IGVA 3R1OA 4INWA 3IQQA 3LLEA 1BF5A 1YR5A 4MLWA 2LM5A 4DS7A 1YUUA 1KK7Y 2CBLA 4YI9A 5AXIA 4CLNA 1UUSA 2KI6C 2NXQA 1PK0D 3AKAA 4JPZB 4TNCA 3OP0A 1ALWA 4JWQA 2MBXA 2BNXA 2MLFC 1KK8B 2QEVA 4PE7A 2JOJA 3DXLA 5AFPA 4F7FA 1R6PA 2F3ZA 1DTLA 4AQJA 1SK6D 3SG7A 1SBJA 3KO0A 5D69A 1TUZA 1H4BA 3D77A 2K60A 2WCEA 1WDCC 1EG3A 3NSLA 1SNLA 1QV1A 2LVJA 1S6CA 1IJ6A 1MHOA 1G4YR 2M0RA 4N5XA 3SG3A 2M29A 4CFQA 1DJHA 1QVIY 3ICBA 1G33A 2HF5A 1N2DA 2LLUA 5IBWA 1VRKA 3I5GC 2JNFA 1BU3A 1UURA 1MR8A 1NX0A 2G2BA 3NSOA 3DF0B 2MLEC 1XO5A 2H2KA 2LE9B 3CZ1A 1M46A 1B8CA 2FJYA 2H8VA 2OPOA 3BJHA 3D76A 3PJIA 4MZJA 1L2OC 4M2OA 2GTEA 4HREE 1E8AA 4AOMA 3WNXB 1SR6B 3GK4X 3CWGA 2K2AA 2DOQA 5HKZA 1DGUA 3F45A 3EVRA 1QTXA 1RWYA 1OE9B 3BYAA 1A2XA 4PDZA 4GGNA 3D10A 2OTGC 3DVJA 2WCLA 1OMVA 1WRZA 3S0BA 3JTDB 2BCXA 2LMUA 3EKHA 1JBAA 4BY5A 1WRLA 3DF0A 1K96A 1ZOTB 3RM1A 1NCXA 1S26D 2OS8C 5HKYA 1A29A 5ER5A 5I94A 3SS3A 3VRPA 1B9AA 2HETA 1CB1A 2WC8A 1FPWA 3NSKA 1JFJA 2H61C 5FI6A 4PE4A 1MQ1A 2LVKA 1K9UA 2KLDA 1QXPA 3S0DA 1B7TZ 2BAPA 1CDNA 1CKKA 2A4JA 3KEVA 1NX2A 3EVVA 1SPYA 3HCMA 2ZNDA 3LK0A 4DRWA 4E68A 1OZOA 4DCKA 1SCMB 4I5KA 3D78A 5KTYA 1QLSA 1JF0A 2KGBC 2I7AA 1ZMZA 1GJYA 3EKJA 2QDIA 1HQVA 3O2PA 1WLMA 3S0EA 3TS5C 3WHUB 4ICBA 1DC1A 1F55A 3I5HB 2KNEA 2JZIA 1CDMA 1DEKA 2KFGA 1SMGA 3SS4A 2F33A 3CR2A 2K7OA 1ZACA 3KHEA 5HLVA 4A4CA 3VRNA 1U5IB 2JU0A 1J7QA 4GBAA 4NQGA 1A75B 1Z4HA 2JT0A 4YI8A 1TNWA 1R2UA 2KI4B 1DJZA 1TOPA 1N65A 1TTXA 3DZTA 4MRYA 3EK8A 1Y1UA 5TNCA 3VGOA 1PULA 3NSIA 1LS8A 4YGEB 2KSPA 2KPHA 1DJIA 2G9BA 1BJFA 2LANA 2M49B 2M1KB 3LK1A 4UPGA 3MSEB 2EC6B 2LLTA 1KK7Z 4DIRA 1BT6A 4ETOA 5B8IB 1C07A 1SL7A 1TWOA 4USLA 1WRKA 3OHMB 2PRUA 2ZRTA 2L4HA 4N1FA 4ZCVA 2VRGA 2K7BA 1U5IA 1BMOA 2QEBA 2V53A 3DVEA 1QASA 4C0JA 1K8UA 5JJGA 1B1GA 1NX1A 2WCKA 2NZ0A 3CZTX 3IF7A 3CZ0A 3PATA 1ORGA 1UWOA 2K7DA 2PQLA 3AKBA 3OB2B 1X02A 3CR5X 1KFXL 2IS9A 1LA0A 2I2RE 1KQMC 1SRAA 1YVHA 1B4CA 3LL8B 2L98A 1QVIZ 2L50A 1T14A 2L51A 3L47A 4M2PA 2M8UA 3AAJA 1NCYA 1BR4B 1EL4A 1UP5A 1C3ZA 1DVIA 1ALVA 2CNPA 2KAYA 1W9ZA 3IQOA 1OOJA 1XFVO 2D8NA 4HRGA 5FI7A 4BY4A 2MAZA 3BXKA 1QWVA 1NP8A 1TRFA 4I5NB 2BE4A 2JT8A 2TN4A 3GK1A 1JFKA 1RTP1 4OZDA 2AUCA 1S1EA 2B1UA 1RROA 2GGMA 1XYDA 2L5XB 3CLNA 5I8NA 4FQOA 1KCYA 3S0AA 1TNQA 1KWOC 1RECA 1Y1XA 3B6XA 3NHTA 3BFAA 5I2LA 3TUYB 1BLQA 1KQVA 2SASA 4I5JA 5AEQA 1OOGA 2EHBA 4HSZA 2LHLA 1CFDA 1DJXA 1K93D 1LINA 1MXLC 4Q04A 1UHNA 2JC2A 3B7AA 4PALA 1C7WA 2OTGB 2PSRA 2Y1NA 1J1DA 2K7CA 1YX8A 2K8MB 4MSPA 4F0ZB 4MZLA 2JPOA 1QV0A 5I2QA 4L9MA 1KFUL 1MF8B 1FBVA 3R72A 2KBIA 2LUXA 3QRXA 2WCJA 3JVTC 4HRHA 3EVUA 4KYNA 1GGWA 1QIWA 5BPJA 2WORA 4OCIA 2OS8B 1BR1B 2JWWA 1FI5A 3D75A 1EJ3A 1XK4C 1YX7A 2LV7A 1S6JA 3BUMB 3E3RA 5FYXA 4YRUA 1M45A 1TN4A 1QX7A 3CZ2A 1MXEA 2L2EA 4I5LB 1K94A 1CM4A 3C1VA 1QS7A 1G8IA 1CTRA 5CSFA 4MVFA 1DQEA 1JF2A 3I5FB 1RK9A 2QPTA 2HPSA 2KGRA 3CABA 2EGDA 4PCWA 1A03A 4GNKB 1XFRA 3ZWHA 1DJYA 4PHMA 3KF9A 2KHNA 4MZKA 1NUBA 2KFHA 2ZKMX 3TS5B 3VRRA 1AP4A 5HYDA 1TUJA 5EL2A 4QJ5B 3SS5A 1QX2A 2RGIA 3FE8A 3KPXA 1KK8C 3TDZA 1F4QA 3GOFA 3CR4X 2KDHA 3I5IC 3WXAA 1CMFA 3FE9A 1NCZA 1SY9A 1SYMA 1BG1A 1TNPA 1AVSA 4PE1A 1WY9A 1Y6WA 1AK8A 5CSJA 2LUCA 2E6WA 1A4PA 2LMTA 4PHKA 5D3OA 1XFXO 1M39A 1CDLA 1B8RA 2YGUA 2LC5A 1RFJA 3O6BA 3BFHA 4P2YB 1S3PA 4MEWA 1JC2A 1UHHA 1IKUA 1QIVA 2JNXA 5ER4X 5F6TA 3SIBA 1J7RA 1YRTB 3D74A 2JXLA 2Y4QA 1C7VA 1TCOB 1Y1AA 2LVIA 2LHIA 3BUOB 5CPVA 1J7PA 3NGVA 1SR6C 1XFZO 1YUTA 3L4LA 4D1EA 2LLSA 2P6BB 1Q80A 4YGDB 2KQYA 1L7ZA 1KFXS 1QX5B 2PYQA 2ZN8A 1OMRA 1FW4A 2AAOA 2CXJA 2FCDA 2BECA 2BL0B 4OVNF 3GK2A 2WCHA 3O4XA 4R1EA 2SCPA 1KQMB 4GAOA 1P28A 3FE6A 4M2QA 1K95A 1BOCA 4OKHA 2QACA 2COLB 3IVTA 3PN7B 4NDBA 1QATA 3TZ1A 3EK7A 1JWDA 1PRWA 2CT9A 2NCPA 1AJ5A 1XFWO 3PLFB 5KU1A 1A75A 3M0WA 4A4BA 2AMIA 1IG5A 2M7LA 4QJ3B 3VRQA 1V1GA 1ZUZA 1PSRA 1HT9A 1IQ3A 1SCMC 1YURA 2Y5IA 2JXCA 1KWOB 3OX5A 5HL1A 1LVCD 1XFUO 3LCPC 3O78A 1K9PA 2M7NA 4JD9A 1DELA 1EG4A 3NHIA 4IJ7A 2ZRSA 3PM8A 2PALA 5HKWA 2L4IA 3BQ3A 2ZFDA 3EK4A 1CFFA 1MUXA 2JQ6A 2KAXA 1WDCB 4GGFA 3ZNIA 2KLEA 1KFUS 5GQQC 2WC5A 4INXA 4ORCB 2FCEA 4YGBB 2JULA 3BUNB 2WC6A 2GGZA 1F4OA 1N0YA 2BE6A 2KQ6A 3I5GB 1CNPA 1QJTA 2KI4C 3DVMA 4N1GA 3SG6A 3FWCA 3OGNA 2GV5A 4PE0A 2M9GA 1NSHA 1TIZA 3L4AA 2BBMA 4XYNA 2KAVA 4PT1A 1V1FA 3FIAA 5FI2A 1L2OB 1DT7B 3S0FA 1OW4A 2EC6C 2JRFA 5DKRA 3NXAA 1CFPA 1H8BA 4MN0A 2BKHB 3OBVA 4AQIA 1IH0A 3DD4A 2WCBA 3CDNA 2FJUB 1GM0A 1S36A 2F8PA 3FS7A 3Q8IA 3QMEA 2JTTA 1OSAA 4GFTA 3VB1A 2P70A 1KSOA 4YGAA 1CMGA 2CTNA 5G08A 5AERA 1LA3A 4YGCB 5DKNA 1UHKA 2Q4UA
chains in the Genus database with same CATH topology
2NCOA 1XVJA 3PSRA 5HLOA 2WCFA 1XK4A 2I18A 1BODA 2JTZA 1AHRA 1NIWA 1M63B 4MRXA 3TDUA 3I5IB 5I2OA 1B8LA 2LAPA 2R2IA 3O4YA 3RLZA 1LKJA 1S5GZ 1KSMA 2ZN9A 4CFRA 3HX4A 3D0YB 1SW8A 1CLLA 1QLKA 3AAKA 1CLBA 5AANA 3PFVA 1DGVA 1LXFC 4JQ0D 3SG5A 4CPVA 1F8HA 2KYFA 2KOTA 2ZNEA 3TUYC 1F70A 2K0JA 4P5OE 2H61A 4ORBB 1FF1A 4QJ4B 2CCMA 2I94A 2ISDA 1CLMA 2M1UA 3BOWB 2K61A 1SL9A 3CTNA 3D0YA 2PMYA 2L0PA 1GGZA 4ZCUA 1CFCA 2O5GA 2WNDA 1IWQA 3OX6A 1S5GY 2LP2A 1TCFA 3VROA 2MRDA 3SJSA 1M31A 5J3XA 2Y1MA 2KI6D 1JSAA 4C0LA 2BBNA 2BCAA 1YVLA 1NPQA 2LP3A 2NLNA 1SL8A 4GUKA 2HQ8A 4IL1A 2M97A 1DJWA 2KYCA 1JUOA 2JPTA 3H4SE 3BOWA 3A8RA 2LCPA 2FOTA 1XFYO 2M3WA 3BUWB 2KBMA 1NYAA 3I5FC 1DF0B 3JTDC 3A4UB 4OR9B 1YUSA 1DJGA 1TNXA 1W7IB 1NWDA 1MWNA 4CIDA 4GPLB 3OB1B 4YBHB 4U8DA 5D7FA 5DKQA 3K21A 2WOSA 1FI6A 5K89A 2MJWB 2MA2A 5KSZA 1SCVA 1PVAA 1OZSA 1J7OA 1J1EA 5PALA 1IRJA 4WRIA 1K90D 1IQ5A 1J55A 3WHTB 2E30A 4XJKB 4MBEA 1ODBA 3CS1A 1K2HA 2MHHA 2PVBA 2BKIB 1DF0A 4WQ3A 3SG4A 4DUQA 1UHJA 5CSNA 2PASA 4NDCA 1UHIA 1AJ4A 3DVKA 1EXRA 2JT3A 1GQMA 3SIAA 1W7JB 2HQWA 1PSBA 1RJVA 1IJ5A 4PHJA 1B7TY 1XA5A 1OMDA 1YRUB 1ZFSA 4WQ2A 2K2FA 3PALA 1WLZA 1F71A 3I5HC 1PALA 4C0KA 1NX3A 1S6IA 1YTZC 1CDPA 2KFFA 3BUXB 1CM1A 1SKTA 1B47A 2F2PA 4XJKA 1EH2A 2F3YA 1F54A 3JVTB 2O60A 1D1OA 2LMVA 5CSIA 1AUIB 2BL0C 2LVVA 4FTGA 2Q91A 1K9KA 3SG2A 5JOLA 3FWBA 4NDDA 1OQPA 2F2OA 4OV2A 2LNKA 1PVBA 4PHNA 3PN7C 3TDIA 2BCBA 3CGAA 1Y0VH 4GGFC 4ORAB 1DMOA 1IGVA 3IQQA 3LLEA 1BF5A 1YR5A 4MLWA 2LM5A 4DS7A 1YUUA 1KK7Y 2CBLA 4YI9A 5AXIA 4CLNA 1UUSA 2KI6C 2NXQA 1PK0D 3AKAA 4JPZB 4TNCA 3OP0A 1ALWA 4JWQA 2MBXA 4PE7A 2MLFC 1KK8B 2JOJA 5AFPA 1R6PA 2F3ZA 1DTLA 4AQJA 1SK6D 3SG7A 1SBJA 3KO0A 5D69A 1H4BA 2WCEA 1WDCC 1EG3A 3NSLA 1SNLA 1QV1A 2LVJA 1S6CA 1IJ6A 1MHOA 1G4YR 2M0RA 4N5XA 3SG3A 2M29A 4CFQA 1DJHA 1QVIY 3ICBA 1G33A 2HF5A 1N2DA 2LLUA 5IBWA 1VRKA 3I5GC 2JNFA 1BU3A 1UURA 1MR8A 1NX0A 2G2BA 3NSOA 3DF0B 2MLEC 1XO5A 2H2KA 2LE9B 1M46A 1B8CA 2OPOA 4MZJA 1L2OC 4M2OA 4HREE 1E8AA 4AOMA 3WNXB 1SR6B 3GK4X 3CWGA 2K2AA 2DOQA 5HKZA 1DGUA 3F45A 3EVRA 1QTXA 1RWYA 1OE9B 3BYAA 1A2XA 4PDZA 3D10A 2OTGC 3DVJA 1OMVA 1WRZA 3JTDB 2BCXA 2LMUA 3EKHA 1JBAA 4BY5A 1WRLA 3DF0A 1K96A 1ZOTB 3RM1A 1NCXA 1S26D 2OS8C 5HKYA 1A29A 5ER5A 1CB1A 3VRPA 1B9AA 2HETA 2WC8A 1FPWA 3NSKA 1JFJA 2H61C 4PE4A 1MQ1A 2LVKA 1K9UA 1QXPA 1B7TZ 1CDNA 1CKKA 2A4JA 3KEVA 1NX2A 3EVVA 1SPYA 3HCMA 2ZNDA 3LK0A 4DRWA 4E68A 1OZOA 4DCKA 1SCMB 4I5KA 5KTYA 1QLSA 1JF0A 2KGBC 2I7AA 1ZMZA 1GJYA 3EKJA 1HQVA 3O2PA 1WLMA 3TS5C 3WHUB 1F55A 4ICBA 3I5HB 2KNEA 2JZIA 1CDMA 2KFGA 1SMGA 2F33A 3CR2A 2K7OA 1ZACA 3KHEA 5HLVA 4A4CA 3VRNA 1U5IB 2JU0A 1J7QA 4GBAA 4NQGA 1A75B 2JT0A 4YI8A 1TNWA 1R2UA 2KI4B 1DJZA 1TOPA 1N65A 1TTXA 4MRYA 3EK8A 1Y1UA 5TNCA 3VGOA 1PULA 3NSIA 2KSPA 2M1KB 1DJIA 2G9BA 1BJFA 2LANA 2M49B 3LK1A 4UPGA 3MSEB 2EC6B 2LLTA 1KK7Z 4DIRA 1BT6A 4ETOA 5B8IB 1C07A 1SL7A 4USLA 1WRKA 3OHMB 2PRUA 2ZRTA 2L4HA 4N1FA 4ZCVA 2VRGA 2K7BA 1U5IA 1BMOA 3DVEA 2V53A 5JJGA 1QASA 4C0JA 1K8UA 1B1GA 1NX1A 2NZ0A 3CZTX 3IF7A 3PATA 1UWOA 2K7DA 3AKBA 3OB2B 1X02A 3CR5X 1KFXL 2IS9A 1LA0A 2I2RE 1KQMC 1SRAA 1YVHA 1B4CA 3LL8B 2L98A 1QVIZ 2L50A 2L51A 4M2PA 2M8UA 3AAJA 1NCYA 1BR4B 1EL4A 1DVIA 1UP5A 2CNPA 1ALVA 2KAYA 4GGNA 4YGEB 3IQOA 1OOJA 1XFVO 2D8NA 4HRGA 4BY4A 2MAZA 3BXKA 1NP8A 1TRFA 4I5NB 2BE4A 2JT8A 2TN4A 3GK1A 1JFKA 1RTP1 2AUCA 1S1EA 2B1UA 1RROA 2GGMA 1XYDA 2L5XB 3CLNA 5I8NA 4FQOA 1KCYA 1TNQA 1KWOC 1RECA 1Y1XA 5I2LA 3TUYB 1BLQA 1KQVA 2SASA 4I5JA 5AEQA 2EHBA 4HSZA 2LHLA 1CFDA 1DJXA 1K93D 1LINA 1MXLC 4Q04A 1UHNA 2JC2A 4PALA 1C7WA 2OTGB 2PSRA 2Y1NA 1J1DA 2K7CA 1YX8A 2K8MB 4MSPA 4F0ZB 4MZLA 1QV0A 5I2QA 4L9MA 1KFUL 1MF8B 1FBVA 2KBIA 2LUXA 3QRXA 3JVTC 4HRHA 3EVUA 1GGWA 1QIWA 5BPJA 2WORA 4OCIA 2OS8B 1BR1B 2JWWA 1FI5A 1EJ3A 1XK4C 1YX7A 2LV7A 1S6JA 3BUMB 3E3RA 5FYXA 4YRUA 1M45A 1TN4A 1QX7A 1MXEA 2L2EA 4I5LB 1K94A 1CM4A 3C1VA 1QS7A 1G8IA 1CTRA 5CSFA 4MVFA 3I5FB 1JF2A 1RK9A 2QPTA 2HPSA 2KGRA 4PCWA 2EGDA 1A03A 4GNKB 3ZWHA 1DJYA 4PHMA 3KF9A 2KHNA 4MZKA 1NUBA 2KFHA 2ZKMX 3TS5B 3VRRA 1AP4A 5HYDA 4QJ5B 1QX2A 2RGIA 3KPXA 1KK8C 3TDZA 1F4QA 3GOFA 3CR4X 2KDHA 3I5IC 3WXAA 1CMFA 1NCZA 1SY9A 1SYMA 1BG1A 1TNPA 1AVSA 4PE1A 1WY9A 1Y6WA 1AK8A 5CSJA 2LUCA 2E6WA 1A4PA 2LMTA 4PHKA 1XFXO 1M39A 1CDLA 1B8RA 3O6BA 2LC5A 1RFJA 4P2YB 1S3PA 4MEWA 1JC2A 1UHHA 1IKUA 1QIVA 2JNXA 5ER4X 5F6TA 3SIBA 1J7RA 1YRTB 2JXLA 2Y4QA 1C7VA 1TCOB 1Y1AA 2LVIA 2LHIA 3BUOB 5CPVA 1J7PA 1SR6C 1XFZO 1YUTA 4D1EA 2LLSA 2P6BB 1Q80A 4YGDB 2KQYA 1L7ZA 1KFXS 1QX5B 2ZN8A 1OMRA 1FW4A 2AAOA 2CXJA 2FCDA 2BECA 2BL0B 4OVNF 3GK2A 4R1EA 2SCPA 1KQMB 4GAOA 4M2QA 1K95A 1BOCA 4OKHA 2QACA 2COLB 3PN7B 4NDBA 1QATA 3TZ1A 3EK7A 1JWDA 1PRWA 2CT9A 2NCPA 1AJ5A 1XFWO 3PLFB 5KU1A 1A75A 3M0WA 4A4BA 2AMIA 1IG5A 2M7LA 4QJ3B 3VRQA 1V1GA 1ZUZA 1PSRA 1HT9A 1IQ3A 1SCMC 1YURA 2Y5IA 2JXCA 1KWOB 3OX5A 1LVCD 1XFUO 3LCPC 3O78A 1K9PA 2M7NA 5HKWA 1EG4A 2ZRSA 3PM8A 2PALA 2L4IA 3BQ3A 2ZFDA 3EK4A 1CFFA 1MUXA 2JQ6A 2KAXA 1WDCB 4GGFA 3ZNIA 1KFUS 5GQQC 4ORCB 4YGBB 2FCEA 2JULA 3BUNB 2GGZA 1F4OA 1N0YA 2BE6A 2KQ6A 3I5GB 1CNPA 1QJTA 2KI4C 3DVMA 4N1GA 3SG6A 3FWCA 2GV5A 4PE0A 2M9GA 1NSHA 1TIZA 2BBMA 4XYNA 2KAVA 1V1FA 3FIAA 1L2OB 1DT7B 2EC6C 2JRFA 5DKRA 3NXAA 1CFPA 1H8BA 4MN0A 2BKHB 4AQIA 1IH0A 3DD4A 2WCBA 2FJUB 1S36A 2F8PA 3FS7A 2JTTA 1OSAA 4GFTA 1CMGA 1KSOA 4YGAA 2CTNA 5G08A 5AERA 1LA3A 4YGCB 5DKNA 1UHKA 2Q4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NCO A;  1XVJ A;  3PSR A;  5HLO A;  2WCF A;  1XK4 A;  2I18 A;  1BOD A;  2JTZ A;  1AHR A;  1NIW A;  1M63 B;  4MRX A;  3TDU A;  3I5I B;  5I2O A;  1B8L A;  2LAP A;  2R2I A;  3O4Y A;  3RLZ A;  1LKJ A;  1S5G Z;  1KSM A;  2ZN9 A;  4CFR A;  3HX4 A;  3D0Y B;  1SW8 A;  1CLL A;  1QLK A;  3AAK A;  1CLB A;  5AAN A;  3PFV A;  1DGV A;  1LXF C;  4JQ0 D;  3SG5 A;  4CPV A;  1F8H A;  2KYF A;  2KOT A;  2ZNE A;  3TUY C;  1F70 A;  2K0J A;  4P5O E;  2H61 A;  4ORB B;  1FF1 A;  4QJ4 B;  2CCM A;  2I94 A;  2ISD A;  1CLM A;  2M1U A;  3BOW B;  2K61 A;  1SL9 A;  3CTN A;  3D0Y A;  2PMY A;  2L0P A;  1GGZ A;  4ZCU A;  1CFC A;  2O5G A;  2WND A;  1IWQ A;  3OX6 A;  1S5G Y;  2LP2 A;  1TCF A;  3VRO A;  2MRD A;  3SJS A;  1M31 A;  5J3X A;  2Y1M A;  2KI6 D;  1JSA A;  4C0L A;  2BBN A;  2BCA A;  1YVL A;  1NPQ A;  2LP3 A;  2NLN A;  1SL8 A;  4GUK A;  2HQ8 A;  4IL1 A;  2M97 A;  1DJW A;  2KYC A;  1JUO A;  2JPT A;  3H4S E;  3BOW A;  3A8R A;  2LCP A;  2FOT A;  1XFY O;  2M3W A;  3BUW B;  2KBM A;  1NYA A;  3I5F C;  1DF0 B;  3JTD C;  3A4U B;  4OR9 B;  1YUS A;  1DJG A;  1TNX A;  1W7I B;  1NWD A;  1MWN A;  4CID A;  4GPL B;  3OB1 B;  4YBH B;  4U8D A;  5D7F A;  5DKQ A;  3K21 A;  2WOS A;  1FI6 A;  5K89 A;  2MJW B;  2MA2 A;  5KSZ A;  1SCV A;  1PVA A;  1OZS A;  1J7O A;  1J1E A;  5PAL A;  1IRJ A;  4WRI A;  1K90 D;  1IQ5 A;  1J55 A;  3WHT B;  2E30 A;  4XJK B;  4MBE A;  1ODB A;  3CS1 A;  1K2H A;  2MHH A;  2PVB A;  2BKI B;  1DF0 A;  4WQ3 A;  3SG4 A;  4DUQ A;  1UHJ A;  5CSN A;  2PAS A;  4NDC A;  1UHI A;  1AJ4 A;  3DVK A;  1EXR A;  2JT3 A;  1GQM A;  3SIA A;  1W7J B;  2HQW A;  1PSB A;  1RJV A;  1IJ5 A;  4PHJ A;  1B7T Y;  1XA5 A;  1OMD A;  1YRU B;  1ZFS A;  4WQ2 A;  2K2F A;  3PAL A;  1WLZ A;  1F71 A;  3I5H C;  1PAL A;  4C0K A;  1NX3 A;  1S6I A;  1YTZ C;  1CDP A;  2KFF A;  3BUX B;  1CM1 A;  1SKT A;  1B47 A;  2F2P A;  4XJK A;  1EH2 A;  2F3Y A;  1F54 A;  3JVT B;  2O60 A;  1D1O A;  2LMV A;  5CSI A;  1AUI B;  2BL0 C;  2LVV A;  4FTG A;  2Q91 A;  1K9K A;  3SG2 A;  5JOL A;  3FWB A;  4NDD A;  1OQP A;  2F2O A;  4OV2 A;  2LNK A;  1PVB A;  4PHN A;  3PN7 C;  3TDI A;  2BCB A;  3CGA A;  1Y0V H;  4GGF C;  4ORA B;  1DMO A;  1IGV A;  3IQQ A;  3LLE A;  1BF5 A;  1YR5 A;  4MLW A;  2LM5 A;  4DS7 A;  1YUU A;  1KK7 Y;  2CBL A;  4YI9 A;  5AXI A;  4CLN A;  1UUS A;  2KI6 C;  2NXQ A;  1PK0 D;  3AKA A;  4JPZ B;  4TNC A;  3OP0 A;  1ALW A;  4JWQ A;  2MBX A;  4PE7 A;  2MLF C;  1KK8 B;  2JOJ A;  5AFP A;  1R6P A;  2F3Z A;  1DTL A;  4AQJ A;  1SK6 D;  3SG7 A;  1SBJ A;  3KO0 A;  5D69 A;  1H4B A;  2WCE A;  1WDC C;  1EG3 A;  3NSL A;  1SNL A;  1QV1 A;  2LVJ A;  1S6C A;  1IJ6 A;  1MHO A;  1G4Y R;  2M0R A;  4N5X A;  3SG3 A;  2M29 A;  4CFQ A;  1DJH A;  1QVI Y;  3ICB A;  1G33 A;  2HF5 A;  1N2D A;  2LLU A;  5IBW A;  1VRK A;  3I5G C;  2JNF A;  1BU3 A;  1UUR A;  1MR8 A;  1NX0 A;  2G2B A;  3NSO A;  3DF0 B;  2MLE C;  1XO5 A;  2H2K A;  2LE9 B;  1M46 A;  1B8C A;  2OPO A;  4MZJ A;  1L2O C;  4M2O A;  4HRE E;  1E8A A;  4AOM A;  3WNX B;  1SR6 B;  3GK4 X;  3CWG A;  2K2A A;  2DOQ A;  5HKZ A;  1DGU A;  3F45 A;  3EVR A;  1QTX A;  1RWY A;  1OE9 B;  3BYA A;  1A2X A;  4PDZ A;  3D10 A;  2OTG C;  3DVJ A;  1OMV A;  1WRZ A;  3JTD B;  2BCX A;  2LMU A;  3EKH A;  1JBA A;  4BY5 A;  1WRL A;  3DF0 A;  1K96 A;  1ZOT B;  3RM1 A;  1NCX A;  1S26 D;  2OS8 C;  5HKY A;  1A29 A;  5ER5 A;  1CB1 A;  3VRP A;  1B9A A;  2HET A;  2WC8 A;  1FPW A;  3NSK A;  1JFJ A;  2H61 C;  4PE4 A;  1MQ1 A;  2LVK A;  1K9U A;  1QXP A;  1B7T Z;  1CDN A;  1CKK A;  2A4J A;  3KEV A;  1NX2 A;  3EVV A;  1SPY A;  3HCM A;  2ZND A;  3LK0 A;  4DRW A;  4E68 A;  1OZO A;  4DCK A;  1SCM B;  4I5K A;  5KTY A;  1QLS A;  1JF0 A;  2KGB C;  2I7A A;  1ZMZ A;  1GJY A;  3EKJ A;  1HQV A;  3O2P A;  1WLM A;  3TS5 C;  3WHU B;  1F55 A;  4ICB A;  3I5H B;  2KNE A;  2JZI A;  1CDM A;  2KFG A;  1SMG A;  2F33 A;  3CR2 A;  2K7O A;  1ZAC A;  3KHE A;  5HLV A;  4A4C A;  3VRN A;  1U5I B;  2JU0 A;  1J7Q A;  4GBA A;  4NQG A;  1A75 B;  2JT0 A;  4YI8 A;  1TNW A;  1R2U A;  2KI4 B;  1DJZ A;  1TOP A;  1N65 A;  1TTX A;  4MRY A;  3EK8 A;  1Y1U A;  5TNC A;  3VGO A;  1PUL A;  3NSI A;  2KSP A;  2M1K B;  1DJI A;  2G9B A;  1BJF A;  2LAN A;  2M49 B;  3LK1 A;  4UPG A;  3MSE B;  2EC6 B;  2LLT A;  1KK7 Z;  4DIR A;  1BT6 A;  4ETO A;  5B8I B;  1C07 A;  1SL7 A;  4USL A;  1WRK A;  3OHM B;  2PRU A;  2ZRT A;  2L4H A;  4N1F A;  4ZCV A;  2VRG A;  2K7B A;  1U5I A;  1BMO A;  3DVE A;  2V53 A;  5JJG A;  1QAS A;  4C0J A;  1K8U A;  1B1G A;  1NX1 A;  2NZ0 A;  3CZT X;  3IF7 A;  3PAT A;  1UWO A;  2K7D A;  3AKB A;  3OB2 B;  1X02 A;  3CR5 X;  1KFX L;  2IS9 A;  1LA0 A;  2I2R E;  1KQM C;  1SRA A;  1YVH A;  1B4C A;  3LL8 B;  2L98 A;  1QVI Z;  2L50 A;  2L51 A;  4M2P A;  2M8U A;  3AAJ A;  1NCY A;  1BR4 B;  1EL4 A;  1DVI A;  1UP5 A;  2CNP A;  1ALV A;  2KAY A;  4GGN A;  4YGE B;  3IQO A;  1OOJ A;  1XFV O;  2D8N A;  4HRG A;  4BY4 A;  2MAZ A;  3BXK A;  1NP8 A;  1TRF A;  4I5N B;  2BE4 A;  2JT8 A;  2TN4 A;  3GK1 A;  1JFK A;  1RTP 1;  2AUC A;  1S1E A;  2B1U A;  1RRO A;  2GGM A;  1XYD A;  2L5X B;  3CLN A;  5I8N A;  4FQO A;  1KCY A;  1TNQ A;  1KWO C;  1REC A;  1Y1X A;  5I2L A;  3TUY B;  1BLQ A;  1KQV A;  2SAS A;  4I5J A;  5AEQ A;  2EHB A;  4HSZ A;  2LHL A;  1CFD A;  1DJX A;  1K93 D;  1LIN A;  1MXL C;  4Q04 A;  1UHN A;  2JC2 A;  4PAL A;  1C7W A;  2OTG B;  2PSR A;  2Y1N A;  1J1D A;  2K7C A;  1YX8 A;  2K8M B;  4MSP A;  4F0Z B;  4MZL A;  1QV0 A;  5I2Q A;  4L9M A;  1KFU L;  1MF8 B;  1FBV A;  2KBI A;  2LUX A;  3QRX A;  3JVT C;  4HRH A;  3EVU A;  1GGW A;  1QIW A;  5BPJ A;  2WOR A;  4OCI A;  2OS8 B;  1BR1 B;  2JWW A;  1FI5 A;  1EJ3 A;  1XK4 C;  1YX7 A;  2LV7 A;  1S6J A;  3BUM B;  3E3R A;  5FYX A;  4YRU A;  1M45 A;  1TN4 A;  1QX7 A;  1MXE A;  2L2E A;  4I5L B;  1K94 A;  1CM4 A;  3C1V A;  1QS7 A;  1G8I A;  1CTR A;  5CSF A;  4MVF A;  3I5F B;  1JF2 A;  1RK9 A;  2QPT A;  2HPS A;  2KGR A;  4PCW A;  2EGD A;  1A03 A;  4GNK B;  3ZWH A;  1DJY A;  4PHM A;  3KF9 A;  2KHN A;  4MZK A;  1NUB A;  2KFH A;  2ZKM X;  3TS5 B;  3VRR A;  1AP4 A;  5HYD A;  4QJ5 B;  1QX2 A;  2RGI A;  3KPX A;  1KK8 C;  3TDZ A;  1F4Q A;  3GOF A;  3CR4 X;  2KDH A;  3I5I C;  3WXA A;  1CMF A;  1NCZ A;  1SY9 A;  1SYM A;  1BG1 A;  1TNP A;  1AVS A;  4PE1 A;  1WY9 A;  1Y6W A;  1AK8 A;  5CSJ A;  2LUC A;  2E6W A;  1A4P A;  2LMT A;  4PHK A;  1XFX O;  1M39 A;  1CDL A;  1B8R A;  3O6B A;  2LC5 A;  1RFJ A;  4P2Y B;  1S3P A;  4MEW A;  1JC2 A;  1UHH A;  1IKU A;  1QIV A;  2JNX A;  5ER4 X;  5F6T A;  3SIB A;  1J7R A;  1YRT B;  2JXL A;  2Y4Q A;  1C7V A;  1TCO B;  1Y1A A;  2LVI A;  2LHI A;  3BUO B;  5CPV A;  1J7P A;  1SR6 C;  1XFZ O;  1YUT A;  4D1E A;  2LLS A;  2P6B B;  1Q80 A;  4YGD B;  2KQY A;  1L7Z A;  1KFX S;  1QX5 B;  2ZN8 A;  1OMR A;  1FW4 A;  2AAO A;  2CXJ A;  2FCD A;  2BEC A;  2BL0 B;  4OVN F;  3GK2 A;  4R1E A;  2SCP A;  1KQM B;  4GAO A;  4M2Q A;  1K95 A;  1BOC A;  4OKH A;  2QAC A;  2COL B;  3PN7 B;  4NDB A;  1QAT A;  3TZ1 A;  3EK7 A;  1JWD A;  1PRW A;  2CT9 A;  2NCP A;  1AJ5 A;  1XFW O;  3PLF B;  5KU1 A;  1A75 A;  3M0W A;  4A4B A;  2AMI A;  1IG5 A;  2M7L A;  4QJ3 B;  3VRQ A;  1V1G A;  1ZUZ A;  1PSR A;  1HT9 A;  1IQ3 A;  1SCM C;  1YUR A;  2Y5I A;  2JXC A;  1KWO B;  3OX5 A;  1LVC D;  1XFU O;  3LCP C;  3O78 A;  1K9P A;  2M7N A;  5HKW A;  1EG4 A;  2ZRS A;  3PM8 A;  2PAL A;  2L4I A;  3BQ3 A;  2ZFD A;  3EK4 A;  1CFF A;  1MUX A;  2JQ6 A;  2KAX A;  1WDC B;  4GGF A;  3ZNI A;  1KFU S;  5GQQ C;  4ORC B;  4YGB B;  2FCE A;  2JUL A;  3BUN B;  2GGZ A;  1F4O A;  1N0Y A;  2BE6 A;  2KQ6 A;  3I5G B;  1CNP A;  1QJT A;  2KI4 C;  3DVM A;  4N1G A;  3SG6 A;  3FWC A;  2GV5 A;  4PE0 A;  2M9G A;  1NSH A;  1TIZ A;  2BBM A;  4XYN A;  2KAV A;  1V1F A;  3FIA A;  1L2O B;  1DT7 B;  2EC6 C;  2JRF A;  5DKR A;  3NXA A;  1CFP A;  1H8B A;  4MN0 A;  2BKH B;  4AQI A;  1IH0 A;  3DD4 A;  2WCB A;  2FJU B;  1S36 A;  2F8P A;  3FS7 A;  2JTT A;  1OSA A;  4GFT A;  1CMG A;  1KSO A;  4YGA A;  2CTN A;  5G08 A;  5AER A;  1LA3 A;  4YGC B;  5DKN A;  1UHK A;  2Q4U A; 
#chains in the Genus database with same CATH topology
 2NCO A;  1XVJ A;  3PSR A;  5HLO A;  3DY9 A;  2WCF A;  1XK4 A;  2I18 A;  1BOD A;  2JTZ A;  1AHR A;  1NIW A;  1M63 B;  3D73 A;  4MRX A;  3TDU A;  3I5I B;  5I2O A;  1B8L A;  2LAP A;  2R2I A;  3O4Y A;  3RLZ A;  1LKJ A;  1S5G Z;  1KSM A;  2ZN9 A;  3BFB A;  4CFR A;  3EG5 B;  3HX4 A;  3D0Y B;  1SW8 A;  1CLL A;  1IIO A;  1QLK A;  3AAK A;  1CLB A;  5AAN A;  3PFV A;  1DGV A;  1LXF C;  2WCM A;  4JQ0 D;  3SG5 A;  4CPV A;  1F8H A;  3S0G A;  2KYF A;  1OOH A;  2KOT A;  2ZNE A;  3TUY C;  1C3Y A;  1F70 A;  2K0J A;  4P5O E;  2H61 A;  4ORB B;  1FF1 A;  4QJ4 B;  2CCM A;  2I94 A;  2ISD A;  1CLM A;  2M1U A;  3BOW B;  2K61 A;  1SL9 A;  3CTN A;  3D0Y A;  3B87 A;  2PMY A;  2L0P A;  3K1E A;  1GGZ A;  4ZCU A;  3PM2 A;  1CFC A;  2O5G A;  2QEH A;  2WND A;  3V2L A;  1IWQ A;  3OX6 A;  1S5G Y;  2LP2 A;  1TCF A;  3VRO A;  2MRD A;  3SJS A;  1OOI X;  3CYZ A;  1M31 A;  5J3X A;  2Y1M A;  2KI6 D;  1JSA A;  4C0L A;  2BBN A;  2BCA A;  1YVL A;  1NPQ A;  2LP3 A;  2NLN A;  1SL8 A;  4GUK A;  2HQ8 A;  3UNW A;  4IL1 A;  2M97 A;  1DJW A;  2KYC A;  1JUO A;  2JPT A;  4JKT A;  3H4S E;  3BOW A;  3A8R A;  2LCP A;  2FOT A;  1XFY O;  2M3W A;  3BUW B;  2KBM A;  1NYA A;  3I5F C;  3R1V A;  1DF0 B;  3JTD C;  3A4U B;  4OR9 B;  1YUS A;  1DJG A;  1TNX A;  1W7I B;  1NWD A;  3RZS A;  1MWN A;  4CID A;  3DYE A;  4GPL B;  3OB1 B;  4YBH B;  4U8D A;  1SSE B;  5D7F A;  3K21 A;  2WOS A;  5DKQ A;  5K89 A;  2MJW B;  2MA2 A;  5KSZ A;  1FI6 A;  2L5Y A;  1SCV A;  1PVA A;  1OZS A;  1J7O A;  1J1E A;  5PAL A;  1IRJ A;  4WRI A;  1K90 D;  1IQ5 A;  1J55 A;  3WHT B;  2E30 A;  4XJK B;  4MBE A;  1ODB A;  3CS1 A;  1K2H A;  2MHH A;  2PVB A;  2BKI B;  1DF0 A;  4WQ3 A;  3SG4 A;  4DUQ A;  1UHJ A;  5CSN A;  2PAS A;  4NDC A;  1UHI A;  1AJ4 A;  3DVK A;  1EXR A;  2JT3 A;  3UO9 A;  1GQM A;  3SIA A;  1W7J B;  2HQW A;  1PSB A;  1RJV A;  1IJ5 A;  4PHJ A;  1B7T Y;  1XA5 A;  1OMD A;  1YRU B;  1ZFS A;  3B88 A;  4FQT A;  4WQ2 A;  2K2F A;  3N7H A;  1WLZ A;  3PAL A;  1F71 A;  3I5H C;  1PAL A;  4C0K A;  1NX3 A;  2P71 A;  1S6I A;  1YTZ C;  1CDP A;  2KFF A;  3BUX B;  1CM1 A;  1OOF A;  1SKT A;  1B47 A;  3B86 A;  2F2P A;  4XJK A;  1EH2 A;  2F3Y A;  1F54 A;  3JVT B;  2O60 A;  1D1O A;  2LMV A;  5CSI A;  1AUI B;  2BL0 C;  2LVV A;  4FTG A;  2Q91 A;  5DIC A;  1K9K A;  3SG2 A;  5JOL A;  3FWB A;  4NDD A;  1OQP A;  2F2O A;  2ERB A;  2L2C A;  4OV2 A;  2QEO A;  3R1P A;  2LNK A;  1PVB A;  1Z2C B;  4PHN A;  3PN7 C;  3TDI A;  2BCB A;  3CGA A;  1Y0V H;  4GGF C;  4ORA B;  1DMO A;  1IGV A;  3R1O A;  4INW A;  3IQQ A;  3LLE A;  1BF5 A;  1YR5 A;  4MLW A;  2LM5 A;  4DS7 A;  1YUU A;  1KK7 Y;  2CBL A;  4YI9 A;  5AXI A;  4CLN A;  1UUS A;  2KI6 C;  2NXQ A;  1PK0 D;  3AKA A;  4JPZ B;  4TNC A;  3OP0 A;  1ALW A;  4JWQ A;  2MBX A;  2BNX A;  2MLF C;  1KK8 B;  2QEV A;  4PE7 A;  2JOJ A;  3DXL A;  5AFP A;  4F7F A;  1R6P A;  2F3Z A;  1DTL A;  4AQJ A;  1SK6 D;  3SG7 A;  1SBJ A;  3KO0 A;  5D69 A;  1TUZ A;  1H4B A;  3D77 A;  2K60 A;  2WCE A;  1WDC C;  1EG3 A;  3NSL A;  1SNL A;  1QV1 A;  2LVJ A;  1S6C A;  1IJ6 A;  1MHO A;  1G4Y R;  2M0R A;  4N5X A;  3SG3 A;  2M29 A;  4CFQ A;  1DJH A;  1QVI Y;  3ICB A;  1G33 A;  2HF5 A;  1N2D A;  2LLU A;  5IBW A;  1VRK A;  3I5G C;  2JNF A;  1BU3 A;  1UUR A;  1MR8 A;  1NX0 A;  2G2B A;  3NSO A;  3DF0 B;  2MLE C;  1XO5 A;  2H2K A;  2LE9 B;  3CZ1 A;  1M46 A;  1B8C A;  2FJY A;  2H8V A;  2OPO A;  3BJH A;  3D76 A;  3PJI A;  4MZJ A;  1L2O C;  4M2O A;  2GTE A;  4HRE E;  1E8A A;  4AOM A;  3WNX B;  1SR6 B;  3GK4 X;  3CWG A;  2K2A A;  2DOQ A;  5HKZ A;  1DGU A;  3F45 A;  3EVR A;  1QTX A;  1RWY A;  1OE9 B;  3BYA A;  1A2X A;  4PDZ A;  4GGN A;  3D10 A;  2OTG C;  3DVJ A;  2WCL A;  1OMV A;  1WRZ A;  3S0B A;  3JTD B;  2BCX A;  2LMU A;  3EKH A;  1JBA A;  4BY5 A;  1WRL A;  3DF0 A;  1K96 A;  1ZOT B;  3RM1 A;  1NCX A;  1S26 D;  2OS8 C;  5HKY A;  1A29 A;  5ER5 A;  5I94 A;  3SS3 A;  3VRP A;  1B9A A;  2HET A;  1CB1 A;  2WC8 A;  1FPW A;  3NSK A;  1JFJ A;  2H61 C;  5FI6 A;  4PE4 A;  1MQ1 A;  2LVK A;  1K9U A;  2KLD A;  1QXP A;  3S0D A;  1B7T Z;  2BAP A;  1CDN A;  1CKK A;  2A4J A;  3KEV A;  1NX2 A;  3EVV A;  1SPY A;  3HCM A;  2ZND A;  3LK0 A;  4DRW A;  4E68 A;  1OZO A;  4DCK A;  1SCM B;  4I5K A;  3D78 A;  5KTY A;  1QLS A;  1JF0 A;  2KGB C;  2I7A A;  1ZMZ A;  1GJY A;  3EKJ A;  2QDI A;  1HQV A;  3O2P A;  1WLM A;  3S0E A;  3TS5 C;  3WHU B;  4ICB A;  1DC1 A;  1F55 A;  3I5H B;  2KNE A;  2JZI A;  1CDM A;  1DEK A;  2KFG A;  1SMG A;  3SS4 A;  2F33 A;  3CR2 A;  2K7O A;  1ZAC A;  3KHE A;  5HLV A;  4A4C A;  3VRN A;  1U5I B;  2JU0 A;  1J7Q A;  4GBA A;  4NQG A;  1A75 B;  1Z4H A;  2JT0 A;  4YI8 A;  1TNW A;  1R2U A;  2KI4 B;  1DJZ A;  1TOP A;  1N65 A;  1TTX A;  3DZT A;  4MRY A;  3EK8 A;  1Y1U A;  5TNC A;  3VGO A;  1PUL A;  3NSI A;  1LS8 A;  4YGE B;  2KSP A;  2KPH A;  1DJI A;  2G9B A;  1BJF A;  2LAN A;  2M49 B;  2M1K B;  3LK1 A;  4UPG A;  3MSE B;  2EC6 B;  2LLT A;  1KK7 Z;  4DIR A;  1BT6 A;  4ETO A;  5B8I B;  1C07 A;  1SL7 A;  1TWO A;  4USL A;  1WRK A;  3OHM B;  2PRU A;  2ZRT A;  2L4H A;  4N1F A;  4ZCV A;  2VRG A;  2K7B A;  1U5I A;  1BMO A;  2QEB A;  2V53 A;  3DVE A;  1QAS A;  4C0J A;  1K8U A;  5JJG A;  1B1G A;  1NX1 A;  2WCK A;  2NZ0 A;  3CZT X;  3IF7 A;  3CZ0 A;  3PAT A;  1ORG A;  1UWO A;  2K7D A;  2PQL A;  3AKB A;  3OB2 B;  1X02 A;  3CR5 X;  1KFX L;  2IS9 A;  1LA0 A;  2I2R E;  1KQM C;  1SRA A;  1YVH A;  1B4C A;  3LL8 B;  2L98 A;  1QVI Z;  2L50 A;  1T14 A;  2L51 A;  3L47 A;  4M2P A;  2M8U A;  3AAJ A;  1NCY A;  1BR4 B;  1EL4 A;  1UP5 A;  1C3Z A;  1DVI A;  1ALV A;  2CNP A;  2KAY A;  1W9Z A;  3IQO A;  1OOJ A;  1XFV O;  2D8N A;  4HRG A;  5FI7 A;  4BY4 A;  2MAZ A;  3BXK A;  1QWV A;  1NP8 A;  1TRF A;  4I5N B;  2BE4 A;  2JT8 A;  2TN4 A;  3GK1 A;  1JFK A;  1RTP 1;  4OZD A;  2AUC A;  1S1E A;  2B1U A;  1RRO A;  2GGM A;  1XYD A;  2L5X B;  3CLN A;  5I8N A;  4FQO A;  1KCY A;  3S0A A;  1TNQ A;  1KWO C;  1REC A;  1Y1X A;  3B6X A;  3NHT A;  3BFA A;  5I2L A;  3TUY B;  1BLQ A;  1KQV A;  2SAS A;  4I5J A;  5AEQ A;  1OOG A;  2EHB A;  4HSZ A;  2LHL A;  1CFD A;  1DJX A;  1K93 D;  1LIN A;  1MXL C;  4Q04 A;  1UHN A;  2JC2 A;  3B7A A;  4PAL A;  1C7W A;  2OTG B;  2PSR A;  2Y1N A;  1J1D A;  2K7C A;  1YX8 A;  2K8M B;  4MSP A;  4F0Z B;  4MZL A;  2JPO A;  1QV0 A;  5I2Q A;  4L9M A;  1KFU L;  1MF8 B;  1FBV A;  3R72 A;  2KBI A;  2LUX A;  3QRX A;  2WCJ A;  3JVT C;  4HRH A;  3EVU A;  4KYN A;  1GGW A;  1QIW A;  5BPJ A;  2WOR A;  4OCI A;  2OS8 B;  1BR1 B;  2JWW A;  1FI5 A;  3D75 A;  1EJ3 A;  1XK4 C;  1YX7 A;  2LV7 A;  1S6J A;  3BUM B;  3E3R A;  5FYX A;  4YRU A;  1M45 A;  1TN4 A;  1QX7 A;  3CZ2 A;  1MXE A;  2L2E A;  4I5L B;  1K94 A;  1CM4 A;  3C1V A;  1QS7 A;  1G8I A;  1CTR A;  5CSF A;  4MVF A;  1DQE A;  1JF2 A;  3I5F B;  1RK9 A;  2QPT A;  2HPS A;  2KGR A;  3CAB A;  2EGD A;  4PCW A;  1A03 A;  4GNK B;  1XFR A;  3ZWH A;  1DJY A;  4PHM A;  3KF9 A;  2KHN A;  4MZK A;  1NUB A;  2KFH A;  2ZKM X;  3TS5 B;  3VRR A;  1AP4 A;  5HYD A;  1TUJ A;  5EL2 A;  4QJ5 B;  3SS5 A;  1QX2 A;  2RGI A;  3FE8 A;  3KPX A;  1KK8 C;  3TDZ A;  1F4Q A;  3GOF A;  3CR4 X;  2KDH A;  3I5I C;  3WXA A;  1CMF A;  3FE9 A;  1NCZ A;  1SY9 A;  1SYM A;  1BG1 A;  1TNP A;  1AVS A;  4PE1 A;  1WY9 A;  1Y6W A;  1AK8 A;  5CSJ A;  2LUC A;  2E6W A;  1A4P A;  2LMT A;  4PHK A;  5D3O A;  1XFX O;  1M39 A;  1CDL A;  1B8R A;  2YGU A;  2LC5 A;  1RFJ A;  3O6B A;  3BFH A;  4P2Y B;  1S3P A;  4MEW A;  1JC2 A;  1UHH A;  1IKU A;  1QIV A;  2JNX A;  5ER4 X;  5F6T A;  3SIB A;  1J7R A;  1YRT B;  3D74 A;  2JXL A;  2Y4Q A;  1C7V A;  1TCO B;  1Y1A A;  2LVI A;  2LHI A;  3BUO B;  5CPV A;  1J7P A;  3NGV A;  1SR6 C;  1XFZ O;  1YUT A;  3L4L A;  4D1E A;  2LLS A;  2P6B B;  1Q80 A;  4YGD B;  2KQY A;  1L7Z A;  1KFX S;  1QX5 B;  2PYQ A;  2ZN8 A;  1OMR A;  1FW4 A;  2AAO A;  2CXJ A;  2FCD A;  2BEC A;  2BL0 B;  4OVN F;  3GK2 A;  2WCH A;  3O4X A;  4R1E A;  2SCP A;  1KQM B;  4GAO A;  1P28 A;  3FE6 A;  4M2Q A;  1K95 A;  1BOC A;  4OKH A;  2QAC A;  2COL B;  3IVT A;  3PN7 B;  4NDB A;  1QAT A;  3TZ1 A;  3EK7 A;  1JWD A;  1PRW A;  2CT9 A;  2NCP A;  1AJ5 A;  1XFW O;  3PLF B;  5KU1 A;  1A75 A;  3M0W A;  4A4B A;  2AMI A;  1IG5 A;  2M7L A;  4QJ3 B;  3VRQ A;  1V1G A;  1ZUZ A;  1PSR A;  1HT9 A;  1IQ3 A;  1SCM C;  1YUR A;  2Y5I A;  2JXC A;  1KWO B;  3OX5 A;  5HL1 A;  1LVC D;  1XFU O;  3LCP C;  3O78 A;  1K9P A;  2M7N A;  4JD9 A;  1DEL A;  1EG4 A;  3NHI A;  4IJ7 A;  2ZRS A;  3PM8 A;  2PAL A;  5HKW A;  2L4I A;  3BQ3 A;  2ZFD A;  3EK4 A;  1CFF A;  1MUX A;  2JQ6 A;  2KAX A;  1WDC B;  4GGF A;  3ZNI A;  2KLE A;  1KFU S;  5GQQ C;  2WC5 A;  4INX A;  4ORC B;  2FCE A;  4YGB B;  2JUL A;  3BUN B;  2WC6 A;  2GGZ A;  1F4O A;  1N0Y A;  2BE6 A;  2KQ6 A;  3I5G B;  1CNP A;  1QJT A;  2KI4 C;  3DVM A;  4N1G A;  3SG6 A;  3FWC A;  3OGN A;  2GV5 A;  4PE0 A;  2M9G A;  1NSH A;  1TIZ A;  3L4A A;  2BBM A;  4XYN A;  2KAV A;  4PT1 A;  1V1F A;  3FIA A;  5FI2 A;  1L2O B;  1DT7 B;  3S0F A;  1OW4 A;  2EC6 C;  2JRF A;  5DKR A;  3NXA A;  1CFP A;  1H8B A;  4MN0 A;  2BKH B;  3OBV A;  4AQI A;  1IH0 A;  3DD4 A;  2WCB A;  3CDN A;  2FJU B;  1GM0 A;  1S36 A;  2F8P A;  3FS7 A;  3Q8I A;  3QME A;  2JTT A;  1OSA A;  4GFT A;  3VB1 A;  2P70 A;  1KSO A;  4YGA A;  1CMG A;  2CTN A;  5G08 A;  5AER A;  1LA3 A;  4YGC B;  5DKN A;  1UHK A;  2Q4U A; 
#chains in the Genus database with same CATH homology
 2NCO A;  1XVJ A;  3PSR A;  5HLO A;  2WCF A;  1XK4 A;  2I18 A;  1BOD A;  2JTZ A;  1AHR A;  1NIW A;  1M63 B;  4MRX A;  3TDU A;  3I5I B;  5I2O A;  1B8L A;  2LAP A;  2R2I A;  3O4Y A;  3RLZ A;  1LKJ A;  1S5G Z;  1KSM A;  2ZN9 A;  4CFR A;  3HX4 A;  3D0Y B;  1SW8 A;  1CLL A;  1QLK A;  3AAK A;  1CLB A;  5AAN A;  3PFV A;  1DGV A;  1LXF C;  4JQ0 D;  3SG5 A;  4CPV A;  1F8H A;  2KYF A;  2KOT A;  2ZNE A;  3TUY C;  1F70 A;  2K0J A;  4P5O E;  2H61 A;  4ORB B;  1FF1 A;  4QJ4 B;  2CCM A;  2I94 A;  2ISD A;  1CLM A;  2M1U A;  3BOW B;  2K61 A;  1SL9 A;  3CTN A;  3D0Y A;  2PMY A;  2L0P A;  1GGZ A;  4ZCU A;  1CFC A;  2O5G A;  2WND A;  1IWQ A;  3OX6 A;  1S5G Y;  2LP2 A;  1TCF A;  3VRO A;  2MRD A;  3SJS A;  1M31 A;  5J3X A;  2Y1M A;  2KI6 D;  1JSA A;  4C0L A;  2BBN A;  2BCA A;  1YVL A;  1NPQ A;  2LP3 A;  2NLN A;  1SL8 A;  4GUK A;  2HQ8 A;  4IL1 A;  2M97 A;  1DJW A;  2KYC A;  1JUO A;  2JPT A;  3H4S E;  3BOW A;  3A8R A;  2LCP A;  2FOT A;  1XFY O;  2M3W A;  3BUW B;  2KBM A;  1NYA A;  3I5F C;  1DF0 B;  3JTD C;  3A4U B;  4OR9 B;  1YUS A;  1DJG A;  1TNX A;  1W7I B;  1NWD A;  1MWN A;  4CID A;  4GPL B;  3OB1 B;  4YBH B;  4U8D A;  5D7F A;  5DKQ A;  3K21 A;  2WOS A;  1FI6 A;  5K89 A;  2MJW B;  2MA2 A;  5KSZ A;  1SCV A;  1PVA A;  1OZS A;  1J7O A;  1J1E A;  5PAL A;  1IRJ A;  4WRI A;  1K90 D;  1IQ5 A;  1J55 A;  3WHT B;  2E30 A;  4XJK B;  4MBE A;  1ODB A;  3CS1 A;  1K2H A;  2MHH A;  2PVB A;  2BKI B;  1DF0 A;  4WQ3 A;  3SG4 A;  4DUQ A;  1UHJ A;  5CSN A;  2PAS A;  4NDC A;  1UHI A;  1AJ4 A;  3DVK A;  1EXR A;  2JT3 A;  1GQM A;  3SIA A;  1W7J B;  2HQW A;  1PSB A;  1RJV A;  1IJ5 A;  4PHJ A;  1B7T Y;  1XA5 A;  1OMD A;  1YRU B;  1ZFS A;  4WQ2 A;  2K2F A;  3PAL A;  1WLZ A;  1F71 A;  3I5H C;  1PAL A;  4C0K A;  1NX3 A;  1S6I A;  1YTZ C;  1CDP A;  2KFF A;  3BUX B;  1CM1 A;  1SKT A;  1B47 A;  2F2P A;  4XJK A;  1EH2 A;  2F3Y A;  1F54 A;  3JVT B;  2O60 A;  1D1O A;  2LMV A;  5CSI A;  1AUI B;  2BL0 C;  2LVV A;  4FTG A;  2Q91 A;  1K9K A;  3SG2 A;  5JOL A;  3FWB A;  4NDD A;  1OQP A;  2F2O A;  4OV2 A;  2LNK A;  1PVB A;  4PHN A;  3PN7 C;  3TDI A;  2BCB A;  3CGA A;  1Y0V H;  4GGF C;  4ORA B;  1DMO A;  1IGV A;  3IQQ A;  3LLE A;  1BF5 A;  1YR5 A;  4MLW A;  2LM5 A;  4DS7 A;  1YUU A;  1KK7 Y;  2CBL A;  4YI9 A;  5AXI A;  4CLN A;  1UUS A;  2KI6 C;  2NXQ A;  1PK0 D;  3AKA A;  4JPZ B;  4TNC A;  3OP0 A;  1ALW A;  4JWQ A;  2MBX A;  4PE7 A;  2MLF C;  1KK8 B;  2JOJ A;  5AFP A;  1R6P A;  2F3Z A;  1DTL A;  4AQJ A;  1SK6 D;  3SG7 A;  1SBJ A;  3KO0 A;  5D69 A;  1H4B A;  2WCE A;  1WDC C;  1EG3 A;  3NSL A;  1SNL A;  1QV1 A;  2LVJ A;  1S6C A;  1IJ6 A;  1MHO A;  1G4Y R;  2M0R A;  4N5X A;  3SG3 A;  2M29 A;  4CFQ A;  1DJH A;  1QVI Y;  3ICB A;  1G33 A;  2HF5 A;  1N2D A;  2LLU A;  5IBW A;  1VRK A;  3I5G C;  2JNF A;  1BU3 A;  1UUR A;  1MR8 A;  1NX0 A;  2G2B A;  3NSO A;  3DF0 B;  2MLE C;  1XO5 A;  2H2K A;  2LE9 B;  1M46 A;  1B8C A;  2OPO A;  4MZJ A;  1L2O C;  4M2O A;  4HRE E;  1E8A A;  4AOM A;  3WNX B;  1SR6 B;  3GK4 X;  3CWG A;  2K2A A;  2DOQ A;  5HKZ A;  1DGU A;  3F45 A;  3EVR A;  1QTX A;  1RWY A;  1OE9 B;  3BYA A;  1A2X A;  4PDZ A;  3D10 A;  2OTG C;  3DVJ A;  1OMV A;  1WRZ A;  3JTD B;  2BCX A;  2LMU A;  3EKH A;  1JBA A;  4BY5 A;  1WRL A;  3DF0 A;  1K96 A;  1ZOT B;  3RM1 A;  1NCX A;  1S26 D;  2OS8 C;  5HKY A;  1A29 A;  5ER5 A;  1CB1 A;  3VRP A;  1B9A A;  2HET A;  2WC8 A;  1FPW A;  3NSK A;  1JFJ A;  2H61 C;  4PE4 A;  1MQ1 A;  2LVK A;  1K9U A;  1QXP A;  1B7T Z;  1CDN A;  1CKK A;  2A4J A;  3KEV A;  1NX2 A;  3EVV A;  1SPY A;  3HCM A;  2ZND A;  3LK0 A;  4DRW A;  4E68 A;  1OZO A;  4DCK A;  1SCM B;  4I5K A;  5KTY A;  1QLS A;  1JF0 A;  2KGB C;  2I7A A;  1ZMZ A;  1GJY A;  3EKJ A;  1HQV A;  3O2P A;  1WLM A;  3TS5 C;  3WHU B;  1F55 A;  4ICB A;  3I5H B;  2KNE A;  2JZI A;  1CDM A;  2KFG A;  1SMG A;  2F33 A;  3CR2 A;  2K7O A;  1ZAC A;  3KHE A;  5HLV A;  4A4C A;  3VRN A;  1U5I B;  2JU0 A;  1J7Q A;  4GBA A;  4NQG A;  1A75 B;  2JT0 A;  4YI8 A;  1TNW A;  1R2U A;  2KI4 B;  1DJZ A;  1TOP A;  1N65 A;  1TTX A;  4MRY A;  3EK8 A;  1Y1U A;  5TNC A;  3VGO A;  1PUL A;  3NSI A;  2KSP A;  2M1K B;  1DJI A;  2G9B A;  1BJF A;  2LAN A;  2M49 B;  3LK1 A;  4UPG A;  3MSE B;  2EC6 B;  2LLT A;  1KK7 Z;  4DIR A;  1BT6 A;  4ETO A;  5B8I B;  1C07 A;  1SL7 A;  4USL A;  1WRK A;  3OHM B;  2PRU A;  2ZRT A;  2L4H A;  4N1F A;  4ZCV A;  2VRG A;  2K7B A;  1U5I A;  1BMO A;  3DVE A;  2V53 A;  5JJG A;  1QAS A;  4C0J A;  1K8U A;  1B1G A;  1NX1 A;  2NZ0 A;  3CZT X;  3IF7 A;  3PAT A;  1UWO A;  2K7D A;  3AKB A;  3OB2 B;  1X02 A;  3CR5 X;  1KFX L;  2IS9 A;  1LA0 A;  2I2R E;  1KQM C;  1SRA A;  1YVH A;  1B4C A;  3LL8 B;  2L98 A;  1QVI Z;  2L50 A;  2L51 A;  4M2P A;  2M8U A;  3AAJ A;  1NCY A;  1BR4 B;  1EL4 A;  1DVI A;  1UP5 A;  2CNP A;  1ALV A;  2KAY A;  4GGN A;  4YGE B;  3IQO A;  1OOJ A;  1XFV O;  2D8N A;  4HRG A;  4BY4 A;  2MAZ A;  3BXK A;  1NP8 A;  1TRF A;  4I5N B;  2BE4 A;  2JT8 A;  2TN4 A;  3GK1 A;  1JFK A;  1RTP 1;  2AUC A;  1S1E A;  2B1U A;  1RRO A;  2GGM A;  1XYD A;  2L5X B;  3CLN A;  5I8N A;  4FQO A;  1KCY A;  1TNQ A;  1KWO C;  1REC A;  1Y1X A;  5I2L A;  3TUY B;  1BLQ A;  1KQV A;  2SAS A;  4I5J A;  5AEQ A;  2EHB A;  4HSZ A;  2LHL A;  1CFD A;  1DJX A;  1K93 D;  1LIN A;  1MXL C;  4Q04 A;  1UHN A;  2JC2 A;  4PAL A;  1C7W A;  2OTG B;  2PSR A;  2Y1N A;  1J1D A;  2K7C A;  1YX8 A;  2K8M B;  4MSP A;  4F0Z B;  4MZL A;  1QV0 A;  5I2Q A;  4L9M A;  1KFU L;  1MF8 B;  1FBV A;  2KBI A;  2LUX A;  3QRX A;  3JVT C;  4HRH A;  3EVU A;  1GGW A;  1QIW A;  5BPJ A;  2WOR A;  4OCI A;  2OS8 B;  1BR1 B;  2JWW A;  1FI5 A;  1EJ3 A;  1XK4 C;  1YX7 A;  2LV7 A;  1S6J A;  3BUM B;  3E3R A;  5FYX A;  4YRU A;  1M45 A;  1TN4 A;  1QX7 A;  1MXE A;  2L2E A;  4I5L B;  1K94 A;  1CM4 A;  3C1V A;  1QS7 A;  1G8I A;  1CTR A;  5CSF A;  4MVF A;  3I5F B;  1JF2 A;  1RK9 A;  2QPT A;  2HPS A;  2KGR A;  4PCW A;  2EGD A;  1A03 A;  4GNK B;  3ZWH A;  1DJY A;  4PHM A;  3KF9 A;  2KHN A;  4MZK A;  1NUB A;  2KFH A;  2ZKM X;  3TS5 B;  3VRR A;  1AP4 A;  5HYD A;  4QJ5 B;  1QX2 A;  2RGI A;  3KPX A;  1KK8 C;  3TDZ A;  1F4Q A;  3GOF A;  3CR4 X;  2KDH A;  3I5I C;  3WXA A;  1CMF A;  1NCZ A;  1SY9 A;  1SYM A;  1BG1 A;  1TNP A;  1AVS A;  4PE1 A;  1WY9 A;  1Y6W A;  1AK8 A;  5CSJ A;  2LUC A;  2E6W A;  1A4P A;  2LMT A;  4PHK A;  1XFX O;  1M39 A;  1CDL A;  1B8R A;  3O6B A;  2LC5 A;  1RFJ A;  4P2Y B;  1S3P A;  4MEW A;  1JC2 A;  1UHH A;  1IKU A;  1QIV A;  2JNX A;  5ER4 X;  5F6T A;  3SIB A;  1J7R A;  1YRT B;  2JXL A;  2Y4Q A;  1C7V A;  1TCO B;  1Y1A A;  2LVI A;  2LHI A;  3BUO B;  5CPV A;  1J7P A;  1SR6 C;  1XFZ O;  1YUT A;  4D1E A;  2LLS A;  2P6B B;  1Q80 A;  4YGD B;  2KQY A;  1L7Z A;  1KFX S;  1QX5 B;  2ZN8 A;  1OMR A;  1FW4 A;  2AAO A;  2CXJ A;  2FCD A;  2BEC A;  2BL0 B;  4OVN F;  3GK2 A;  4R1E A;  2SCP A;  1KQM B;  4GAO A;  4M2Q A;  1K95 A;  1BOC A;  4OKH A;  2QAC A;  2COL B;  3PN7 B;  4NDB A;  1QAT A;  3TZ1 A;  3EK7 A;  1JWD A;  1PRW A;  2CT9 A;  2NCP A;  1AJ5 A;  1XFW O;  3PLF B;  5KU1 A;  1A75 A;  3M0W A;  4A4B A;  2AMI A;  1IG5 A;  2M7L A;  4QJ3 B;  3VRQ A;  1V1G A;  1ZUZ A;  1PSR A;  1HT9 A;  1IQ3 A;  1SCM C;  1YUR A;  2Y5I A;  2JXC A;  1KWO B;  3OX5 A;  1LVC D;  1XFU O;  3LCP C;  3O78 A;  1K9P A;  2M7N A;  5HKW A;  1EG4 A;  2ZRS A;  3PM8 A;  2PAL A;  2L4I A;  3BQ3 A;  2ZFD A;  3EK4 A;  1CFF A;  1MUX A;  2JQ6 A;  2KAX A;  1WDC B;  4GGF A;  3ZNI A;  1KFU S;  5GQQ C;  4ORC B;  4YGB B;  2FCE A;  2JUL A;  3BUN B;  2GGZ A;  1F4O A;  1N0Y A;  2BE6 A;  2KQ6 A;  3I5G B;  1CNP A;  1QJT A;  2KI4 C;  3DVM A;  4N1G A;  3SG6 A;  3FWC A;  2GV5 A;  4PE0 A;  2M9G A;  1NSH A;  1TIZ A;  2BBM A;  4XYN A;  2KAV A;  1V1F A;  3FIA A;  1L2O B;  1DT7 B;  2EC6 C;  2JRF A;  5DKR A;  3NXA A;  1CFP A;  1H8B A;  4MN0 A;  2BKH B;  4AQI A;  1IH0 A;  3DD4 A;  2WCB A;  2FJU B;  1S36 A;  2F8P A;  3FS7 A;  2JTT A;  1OSA A;  4GFT A;  1CMG A;  1KSO A;  4YGA A;  2CTN A;  5G08 A;  5AER A;  1LA3 A;  4YGC B;  5DKN A;  1UHK A;  2Q4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...