1F4QA

Crystal structure of apo grancalcin
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
165
structure length
161
Chain Sequence
SVYTYFSAVAGQDGEVDAEELQRCLTQSGINGTYSPFSLETCRIMIAMLDRDHTGKMGFNAFKELWAALNAWKENFMTVDGTVEHHELRQAIGLMGYRLSPQTLTTIVKRYSKNGRIFFDDYVACCVKLRALTDFFKKRDHLQQGSADFIYDDFLQGTMAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GRANCALCIN
publication title Crystal structure of human grancalcin, a member of the penta-EF-hand protein family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 55
structure length 161
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1f4qA00
3KEVA 1QATA 2G2BA 2NCPA 3LLEA 1SCVA 1CDPA 1NPQA 4GGNA 2JQ6A 2JXLA 2KSPA 4MZKA 1CTRA 3M0WA 2LCPA 5CSIA 3VROA 1K90D 3VRPA 2EGDA 1OMVA 1NWDA 2ISDA 1DJHA 3BQ3A 1EG4A 2I18A 2ZFDA 2M3WA 2CXJA 4PE1A 3RM1A 2CT9A 3DVKA 2MHHA 4C0KA 5ER5A 2BCAA 2AMIA 4A4CA 2P6BB 2OPOA 3E3RA 1JUOA 1L2OC 1YTZC 2L0PA 4C0JA 1AP4A 4L9MA 1YURA 2G9BA 2KYCA 2WCEA 1M31A 5PALA 3IQOA 2M1KB 2ZN9A 4AQIA 2JC2A 2LE9B 2BCXA 2GGMA 2HF5A 4AOMA 4CLNA 2KI4B 4PCWA 1F55A 1K94A 1CDMA 1BLQA 1XFYO 1NCYA 1DGVA 2PALA 3I5FC 1UWOA 3KF9A 1J55A 2JTZA 3CR5X 1AVSA 3LCPC 3TS5C 1XA5A 3A8RA 1TRFA 3K21A 2EHBA 5AXIA 1IQ5A 1KK7Z 2ZRSA 2LVJA 1ALWA 4MZLA 2LM5A 3KPXA 3SG7A 3I5GB 1QIVA 2L51A 1S5GY 1J1EA 1A4PA 1XVJA 1ZUZA 1TNQA 4I5KA 2A4JA 4NDDA 2M9GA 2LV7A 1A03A 2F8PA 2JPTA 1HT9A 2M0RA 3OB2B 3HX4A 4YGCB 5K89A 4JWQA 2Q91A 1LXFC 4M2OA 1NYAA 4XYNA 5HKZA 1Q80A 4CFRA 1DJYA 1PSRA 2K7DA 3D0YB 1EXRA 1BOCA 1A2XA 1SL9A 1S26D 3OHMB 1TTXA 3MSEB 1J1DA 4QJ3B 1Y0VH 1K93D 1BT6A 1DVIA 3CGAA 5G08A 2JNFA 2KI4C 1Y1UA 1K2HA 1QASA 1MR8A 2K8MB 3PLFB 4P5OE 1J7QA 2IS9A 2MJWB 1UHNA 3NSLA 2PMYA 4MBEA 4GGFC 1V1FA 1B7TZ 1YR5A 2ZNDA 4ETOA 2ZKMX 1ZFSA 2I94A 2LLTA 4BY4A 1DGUA 1KK8B 3EK4A 5B8IB 3CWGA 3PFVA 4C0LA 3PATA 1DF0B 1FI6A 2LP3A 3GK1A 1YVHA 3DF0B 2LVVA 1KWOC 1C07A 1DMOA 3OX5A 1W7IB 2BE4A 1QS7A 1TNWA 2F3ZA 1XO5A 4OV2A 2L98A 2BL0B 5DKQA 1TCFA 1KQVA 4PHJA 4PE0A 3I5IC 3TS5B 2NLNA 4XJKA 1KSMA 1YRTB 2MA2A 5HKYA 1E8AA 1UHHA 2BKHB 2AUCA 3TDZA 2QPTA 2SCPA 2M8UA 4WQ2A 5CSNA 2H61A 1SRAA 2B1UA 3H4SE 2BE6A 1CB1A 2JZIA 4ORCB 1TIZA 1TN4A 1EL4A 1N65A 1BJFA 2LAPA 2R2IA 5I2LA 1OMDA 2JT3A 2BBNA 2WC8A 1DJGA 3C1VA 1MQ1A 4OCIA 1LKJA 2LUXA 5AEQA 4U8DA 2K7CA 3BUMB 1B47A 2V53A 3EKHA 1NCZA 3BOWB 3O4YA 4N1FA 4JQ0D 3ZWHA 1QTXA 1WRLA 2F2PA 1ZACA 1C7VA 1PVBA 2K2AA 1YUTA 1GGZA 1YX7A 5AANA 3TDIA 1UHJA 3CR4X 4CPVA 3CR2A 4MRYA 1CLMA 1F70A 2KI6D 3SJSA 4NDCA 1KQMC 2Y1NA 4GBAA 1BU3A 1TOPA 3GK4X 1KK8C 4M2PA 1CMGA 2JT0A 2JRFA 1WDCC 1CKKA 1CFPA 3OB1B 1JFKA 1DTLA 4BY5A 3WXAA 4YBHB 1B8LA 4HRHA 5JOLA 2OTGC 5KU1A 2QACA 1GGWA 5TNCA 1MXEA 1IH0A 5J3XA 2FCEA 2KQ6A 1B4CA 5DKRA 1UUSA 2I2RE 1RROA 4GNKB 2F33A 1U5IA 2LVKA 3VRRA 2BL0C 4HREE 1IKUA 4DIRA 4OKHA 3SIBA 4UPGA 2M49B 3WHTB 1NUBA 1YUSA 1AJ5A 3FIAA 2LLUA 2WORA 5I8NA 3OX6A 1BG1A 1DJIA 1IWQA 3DVEA 4MN0A 1ZMZA 1B1GA 1UP5A 3O78A 2VRGA 4PE7A 2M97A 2KAYA 2M7LA 2KGBC 2SASA 1QLKA 3ICBA 1ALVA 3JVTC 2WCBA 1NCXA 1KSOA 1KCYA 2JXCA 1KWOB 1XFXO 1BMOA 1VRKA 3SG6A 2L50A 4I5NB 3VGOA 2D8NA 1RECA 1JWDA 3DD4A 2H61C 1QVIZ 1SNLA 1N2DA 2KBIA 1WRZA 4PDZA 3EVRA 4YI8A 3TZ1A 3I5IB 1F71A 4YI9A 2BCBA 2WNDA 2I7AA 1DJWA 1KFUS 5CPVA 1S1EA 1MHOA 2JULA 1GQMA 4GAOA 1A75A 3NXAA 4DRWA 3AAJA 1R2UA 1JC2A 2MRDA 1QIWA 1W7JB 2EC6B 2LP2A 3BUNB 3VRNA 1H8BA 2L4HA 1S36A 3BUWB 1SK6D 3KHEA 4PE4A 2GV5A 3GOFA 3SG2A 1AUIB 5HLOA 2MBXA 2KGRA 1YUUA 3PM8A 2M1UA 5KSZA 2KFGA 3EK8A 1KFXS 2LNKA 1CLBA 3NSKA 1L7ZA 3CLNA 1K9KA 1N0YA 2JNXA 4PHKA 1MF8B 4OR9B 2COLB 1B8RA 1SCMB 1NSHA 1NP8A 3AKAA 1KQMB 1LA3A 1G4YR 3SG4A 3EVVA 2PVBA 1OE9B 1WDCB 2Y5IA 2ZNEA 5IBWA 1WY9A 1M39A 2CNPA 1J7RA 1MXLC 4MVFA 4GPLB 1Y1XA 2OTGB 2LANA 1TCOB 5GQQC 1DJXA 3O2PA 1YRUB 3F45A 3PSRA 3BUOB 1LA0A 3SG5A 5BPJA 1H4BA 3FS7A 2LLSA 1WRKA 1IQ3A 1KK7Y 1ZOTB 4HRGA 2HQ8A 4A4BA 1JFJA 1SL8A 2FJUB 3PN7C 1WLZA 2KYFA 3VRQA 4MRXA 4DCKA 4R1EA 4USLA 1QX7A 3WHUB 1DT7B 1NX1A 2LMUA 5HLVA 2FCDA 2JTTA 4MSPA 2Y4QA 1K9PA 4YGBB 5HKWA 1LVCD 2BECA 1CM1A 1F8HA 2EC6C 3JVTB 4M2QA 2HETA 2MAZA 1SPYA 1F54A 1NIWA 1S5GZ 2JT8A 4XJKB 2WCFA 2L2EA 3NSIA 2TN4A 4DUQA 2O5GA 5F6TA 1EJ3A 5AFPA 3TUYC 2E30A 1FW4A 2KFHA 2KBMA 1EG3A 3DVMA 4WQ3A 1S6JA 5JJGA 1FF1A 1DJZA 2E6WA 3CS1A 1CFDA 1Y6WA 3LK1A 1B9AA 1G33A 1PK0D 3EVUA 3QRXA 1PSBA 3RLZA 1OOJA 3DVJA 1WLMA 5D69A 1SCMC 2NXQA 3O6BA 4WRIA 2GGZA 1M63B 2H2KA 1YX8A 1RWYA 1QXPA 2KFFA 1MUXA 5FYXA 1OZSA 2K7OA 2JU0A 1BR1B 4I5LB 1XK4A 4PHNA 1CDNA 2CCMA 2LHLA 3JTDC 1AHRA 4IL1A 2KOTA 1RK9A 4YGDB 1BF5A 1SY9A 1UURA 5DKNA 2MLEC 1UHKA 1TNXA 1CNPA 1B7TY 4OVNF 5HYDA 1CMFA 2LMVA 4DS7A 1K8UA 2CTNA 1OMRA 1OZOA 1B8CA 2K61A 1D1OA 1IRJA 2L5XB 1HQVA 3CTNA 1K96A 2BBMA 1EH2A 4GGFA 4PALA 5CSFA 1LINA 2OS8C 2L4IA 1FBVA 1S6IA 3A4UB 4ORBB 1JF0A 3CZTX 1K95A 1U5IB 4ICBA 4HSZA 4Q04A 1CFFA 1CM4A 1RTP1 4MEWA 1PULA 1KFUL 1PRWA 1X02A 2JWWA 3AKBA 2FOTA 2ZRTA 1NX3A 2LMTA 3I5HC 2M7NA 2Q4UA 1QV1A 1M46A 3FWCA 1AJ4A 4MLWA 1G8IA 4PHMA 3BYAA 4QJ5B 1BR4B 1QX2A 3PN7B 4N5XA 1YVLA 1J7PA 1RJVA 1SBJA 3IF7A 1IGVA 1CLLA 1XFZO 1CDLA 3FWBA 2KI6C 1JF2A 3IQQA 4GUKA 2DOQA 2KNEA 1SR6B 1XFVO 3KO0A 4D1EA 1QX5B 4YRUA 3SIAA 1KFXL 2K0JA 2LHIA 4F0ZB 3NSOA 1AK8A 2M29A 4FQOA 5AERA 2F2OA 1IG5A 2ZN8A 3D0YA 1XFUO 4ZCVA 3TUYB 1BODA 1A75B 5I2OA 1R6PA 2KQYA 1F4OA 2O60A 1ODBA 3GK2A 1JBAA 1A29A 1S6CA 1SL7A 2WOSA 2PSRA 5I2QA 4E68A 2RGIA 1FPWA 1XK4C 1XYDA 2HPSA 1TNPA 3LL8B 1SYMA 5KTYA 3ZNIA 1OQPA 1CFCA 1XFWO 2PASA 1GJYA 1J7OA 1FI5A 1C7WA 3TDUA 2NCOA 2PRUA 3EKJA 1NX2A 2KDHA 1K9UA 4GFTA 1JSAA 2K2FA 2KHNA 3JTDB 4NQGA 2K7BA 2KAVA 2LVIA 5D7FA 3D10A 4P2YB 1MWNA 1F4QA 1DF0A 3BUXB 1SKTA 4YGEB 1IJ5A 3DF0A 3SG3A 3LK0A 4CFQA 1PVAA 1SW8A 1L2OB 3EK7A 3WNXB 5CSJA 4FTGA 2Y1MA 4ZCUA 1M45A 3OP0A 2AAOA 2OS8B 4TNCA 2F3YA 2HQWA 2LC5A 3HCMA 1NX0A 4YGAA 1PALA 1OSAA 3I5GC 4NDBA 4CIDA 1SR6C 1QLSA 2BKIB 4N1GA 3AAKA 4I5JA 1S3PA 2NZ0A 3I5FB 1QVIY 1V1GA 1UHIA 2KAXA 3BXKA 3I5HB 4JPZB 3PALA 1RFJA 2CBLA 1IJ6A 1Y1AA 2JOJA 5ER4X 4QJ4B 1SMGA 2MLFC 4MZJA 4AQJA 1QJTA 4ORAB 3BOWA 1QV0A 2LUCA
chains in the Genus database with same CATH superfamily
2L5YA 3KEVA 1QATA 2G2BA 2NCPA 3LLEA 1SCVA 1CDPA 1NPQA 4GGNA 5FI7A 2QDIA 2JQ6A 2JXLA 2KSPA 2QEHA 4MZKA 2FJYA 1CTRA 3M0WA 2LCPA 5CSIA 1SSEB 3VROA 1K90D 3VRPA 2EGDA 1LS8A 1NWDA 1OMVA 2ISDA 1DJHA 3BQ3A 1EG4A 2I18A 2ZFDA 1TUJA 2M3WA 2CXJA 4PE1A 3B86A 3RM1A 2CT9A 3DVKA 2MHHA 4C0KA 5ER5A 2BCAA 2AMIA 4A4CA 2P6BB 2PYQA 2OPOA 3E3RA 1JUOA 1L2OC 1YTZC 2L0PA 4C0JA 1AP4A 4L9MA 2YGUA 1YURA 2G9BA 2KYCA 2WCEA 1M31A 4IJ7A 5PALA 3IQOA 3S0DA 2M1KB 2ZN9A 4AQIA 2JC2A 2LE9B 2BCXA 2GGMA 2HF5A 4AOMA 4CLNA 2KI4B 4PCWA 1F55A 1K94A 1CDMA 1BLQA 1XFYO 1NCYA 1DGVA 3BFHA 2PALA 3I5FC 1UWOA 3KF9A 1J55A 2JTZA 3CR5X 1AVSA 3LCPC 3TS5C 3B7AA 1XA5A 5D3OA 3A8RA 1TRFA 3K21A 2EHBA 2KPHA 5DICA 5AXIA 1IQ5A 1KK7Z 2ZRSA 2LVJA 1ALWA 4MZLA 2LM5A 3KPXA 3SG7A 2KLEA 3I5GB 1ORGA 1QIVA 2L51A 1S5GY 1J1EA 1A4PA 1XVJA 3N7HA 1P28A 1TNQA 1ZUZA 4I5KA 2A4JA 5HL1A 4NDDA 2M9GA 2LV7A 1IIOA 1A03A 2F8PA 2JPTA 3L47A 1HT9A 2M0RA 3OB2B 5EL2A 3HX4A 4YGCB 5K89A 2BAPA 3D78A 4JWQA 4FQTA 2Q91A 1LXFC 4M2OA 1NYAA 4XYNA 5HKZA 5I94A 1Q80A 4CFRA 1DJYA 1PSRA 2K7DA 3D0YB 1EXRA 1BOCA 1A2XA 1SL9A 1S26D 3OHMB 1TTXA 3MSEB 1J1DA 4QJ3B 1Y0VH 1K93D 1BT6A 1DVIA 3CGAA 4INXA 5G08A 2JNFA 2P71A 2KI4C 1Y1UA 1K2HA 1QASA 1MR8A 2GTEA 2K8MB 3BJHA 3PLFB 4P5OE 2IS9A 2MJWB 1UHNA 3NSLA 2PMYA 3B6XA 4MBEA 4GGFC 1V1FA 4INWA 1B7TZ 1YR5A 2ZNDA 4ETOA 2ZKMX 1ZFSA 2I94A 2LLTA 4BY4A 3S0AA 1DGUA 1KK8B 3EK4A 3IVTA 5B8IB 3CWGA 3PFVA 4C0LA 3PATA 1OW4A 1DF0B 1FI6A 2LP3A 2L2CA 3GK1A 1YVHA 3DF0B 2LVVA 1T14A 1KWOC 1C07A 1DMOA 3OX5A 1W7IB 3UO9A 2QEOA 2BE4A 3B87A 1QS7A 1TNWA 2F3ZA 1DELA 1XO5A 4OV2A 2L98A 2BL0B 5DKQA 1TCFA 1KQVA 2PQLA 4PHJA 4PE0A 3I5IC 3TS5B 2NLNA 4XJKA 1KSMA 3S0GA 1YRTB 2MA2A 5HKYA 1E8AA 1UHHA 2AUCA 2BKHB 3TDZA 2QPTA 3CDNA 2SCPA 2M8UA 4WQ2A 5CSNA 2H61A 1SRAA 2B1UA 3H4SE 2BE6A 1CB1A 2JZIA 4ORCB 1TIZA 4JKTA 1TN4A 1EL4A 1N65A 1BJFA 2LAPA 2R2IA 5I2LA 1OMDA 2JT3A 2BBNA 2WC8A 1DJGA 3C1VA 1MQ1A 3DY9A 1LKJA 2LUXA 3D74A 4OCIA 5AEQA 2WC6A 2K7CA 3BUMB 1B47A 2V53A 3EKHA 1NCZA 3BOWB 3O4YA 4N1FA 4JQ0D 3ZWHA 1QTXA 1WRLA 2F2PA 1ZACA 1C7VA 1PVBA 2K2AA 1YUTA 1GGZA 1YX7A 3D77A 5AANA 3TDIA 1C3YA 1UHJA 3CR4X 4CPVA 3R1VA 3CR2A 4MRYA 1CLMA 1F70A 2KI6D 3SJSA 4NDCA 2WCHA 1KQMC 2Y1NA 4GBAA 1BU3A 1TOPA 3GK4X 3NGVA 1KK8C 4M2PA 1CMGA 2JT0A 2JRFA 1WDCC 1CKKA 1CFPA 3OB1B 1JFKA 1DTLA 4BY5A 3WXAA 4YBHB 4JD9A 1B8LA 1C3ZA 4HRHA 5JOLA 2OTGC 5KU1A 2QACA 1GGWA 5TNCA 1MXEA 1IH0A 5J3XA 2FCEA 2KQ6A 1B4CA 5DKRA 1UUSA 2I2RE 1RROA 4GNKB 1QWVA 2F33A 1U5IA 2LVKA 3VRRA 2BL0C 4HREE 1IKUA 4DIRA 4OKHA 3SIBA 4UPGA 2M49B 3WHTB 1NUBA 1YUSA 2WCJA 1AJ5A 3FIAA 2LLUA 2WORA 5I8NA 3OX6A 1BG1A 1DJIA 1IWQA 3NHTA 3NHIA 3SS4A 3DVEA 2P70A 4MN0A 1ZMZA 4PT1A 1B1GA 1UP5A 3O78A 2VRGA 4PE7A 2M97A 2KAYA 2M7LA 3SS3A 2KGBC 3UNWA 2SASA 1QLKA 3CZ1A 1ALVA 3ICBA 3JVTC 2WCBA 4KYNA 1NCXA 1KSOA 1KCYA 2JXCA 1KWOB 1XFXO 3DZTA 1BMOA 1VRKA 3SG6A 2L50A 4I5NB 3VGOA 2D8NA 1RECA 1JWDA 3DD4A 2H61C 1QVIZ 3PM2A 1SNLA 1N2DA 2KBIA 1WRZA 4PDZA 3EVRA 4YI8A 3TZ1A 3I5IB 1F71A 4YI9A 2BCBA 2WNDA 2I7AA 1DJWA 1KFUS 5CPVA 1S1EA 1MHOA 2JULA 1OOFA 1GQMA 4GAOA 1A75A 3NXAA 4DRWA 3AAJA 1R2UA 1JC2A 2WCKA 2MRDA 3FE6A 1QIWA 1OOGA 1W7JB 2EC6B 2LP2A 3BUNB 3VRNA 1H8BA 2L4HA 1S36A 3BUWB 1SK6D 3KHEA 4PE4A 2GV5A 3GOFA 3SG2A 1AUIB 5HLOA 2MBXA 2KGRA 1TUZA 1YUUA 2JPOA 3PM8A 3FE9A 2M1UA 5KSZA 2KFGA 3EK8A 1KFXS 2LNKA 1CLBA 3NSKA 1L7ZA 3CLNA 1K9KA 1N0YA 2JNXA 2QEVA 4PHKA 1MF8B 4OR9B 2COLB 1B8RA 1SCMB 1NSHA 1NP8A 3AKAA 1KQMB 1LA3A 3K1EA 1J7QA 1G4YR 3SG4A 3EVVA 2PVBA 1OE9B 1WDCB 2Y5IA 2ZNEA 5IBWA 1WY9A 1M39A 2CNPA 1J7RA 1MXLC 4MVFA 4GPLB 1Y1XA 1Z2CB 2OTGB 2LANA 1TCOB 5GQQC 1DJXA 3O2PA 2H8VA 1YRUB 3F45A 3PSRA 5FI6A 3BUOB 1LA0A 3SG5A 1DC1A 5BPJA 2WCLA 1H4BA 3FS7A 2LLSA 5FI2A 1WRKA 1IQ3A 3EG5B 1GM0A 1KK7Y 1ZOTB 4HRGA 2HQ8A 4A4BA 1JFJA 1SL8A 3D75A 1W9ZA 2FJUB 3PN7C 1WLZA 2KYFA 3VRQA 4MRXA 4DCKA 4R1EA 4USLA 1QX7A 3WHUB 1DT7B 1NX1A 2LMUA 5HLVA 2FCDA 4OZDA 2JTTA 4MSPA 2Y4QA 1K9PA 4YGBB 5HKWA 3R72A 1LVCD 2BECA 1CM1A 1F8HA 2EC6C 3JVTB 4M2QA 2HETA 2MAZA 1SPYA 1F54A 1NIWA 1S5GZ 2ERBA 2JT8A 4XJKB 3CZ2A 3S0FA 2WCFA 2L2EA 3S0BA 3NSIA 2TN4A 4DUQA 2O5GA 5F6TA 1EJ3A 5AFPA 3TUYC 2E30A 1FW4A 2KFHA 2KBMA 1EG3A 3DVMA 4WQ3A 1S6JA 5JJGA 1FF1A 1DJZA 2E6WA 3CS1A 1CFDA 1Y6WA 3LK1A 1B9AA 1G33A 1PK0D 3EVUA 3QRXA 1PSBA 3RLZA 1OOJA 3Q8IA 3DVJA 1WLMA 5D69A 2K60A 1SCMC 2NXQA 3O6BA 4WRIA 2GGZA 1M63B 2H2KA 1YX8A 3S0EA 1RWYA 1QXPA 2KFFA 1MUXA 5FYXA 1OZSA 2K7OA 2JU0A 1BR1B 3D76A 4I5LB 1XK4A 4PHNA 1CDNA 2CCMA 2LHLA 3JTDC 1AHRA 4IL1A 2KOTA 1RK9A 4YGDB 1BF5A 1SY9A 1UURA 5DKNA 2MLEC 1UHKA 1TNXA 1CNPA 1B7TY 4OVNF 5HYDA 1CMFA 2LMVA 4DS7A 1K8UA 2CTNA 3OBVA 1OMRA 3DXLA 3CYZA 1OZOA 3L4AA 3PJIA 1B8CA 2K61A 1D1OA 1IRJA 2L5XB 1HQVA 3CTNA 1K96A 2BBMA 1EH2A 4GGFA 4PALA 5CSFA 1LINA 2OS8C 3BFAA 2L4IA 1FBVA 1S6IA 3A4UB 3R1OA 3B88A 4ORBB 1JF0A 3CZTX 1K95A 1U5IB 2QEBA 4ICBA 4HSZA 4Q04A 1CFFA 1CM4A 1RTP1 1Z4HA 2WCMA 1PULA 1KFUL 4MEWA 1PRWA 1X02A 1OOHA 2JWWA 3AKBA 2FOTA 2ZRTA 1NX3A 2LMTA 3I5HC 2M7NA 2Q4UA 1QV1A 3R1PA 1M46A 3FWCA 1AJ4A 4MLWA 1G8IA 4PHMA 3BYAA 4QJ5B 1XFRA 1BR4B 1QX2A 3PN7B 4N5XA 1YVLA 1J7PA 1RJVA 3O4XA 3FE8A 1SBJA 3IF7A 1IGVA 1CLLA 3V2LA 1XFZO 1CDLA 1DEKA 3FWBA 2KI6C 1JF2A 3IQQA 4GUKA 2DOQA 2KNEA 1SR6B 1XFVO 3KO0A 4D1EA 1QX5B 4YRUA 3CZ0A 3SS5A 3SIAA 1KFXL 2K0JA 2LHIA 4F0ZB 3NSOA 1AK8A 2M29A 3DYEA 4FQOA 5AERA 2F2OA 1IG5A 2ZN8A 3VB1A 3D0YA 1XFUO 4ZCVA 4U8DA 3TUYB 1BODA 1A75B 5I2OA 1R6PA 2KQYA 3OGNA 1F4OA 2O60A 1ODBA 3GK2A 1JBAA 1A29A 1S6CA 1SL7A 2WOSA 2PSRA 5I2QA 4E68A 2RGIA 1FPWA 1XK4C 1XYDA 2HPSA 1TNPA 3LL8B 1SYMA 1DQEA 5KTYA 3ZNIA 1OQPA 1CFCA 1XFWO 2PASA 1GJYA 1J7OA 1FI5A 1C7WA 3TDUA 2NCOA 2PRUA 3EKJA 1NX2A 2KDHA 1K9UA 3D73A 4GFTA 2K2FA 1JSAA 2KHNA 3JTDB 3L4LA 4NQGA 3RZSA 2K7BA 1OOIX 2KAVA 2LVIA 5D7FA 3D10A 4P2YB 1MWNA 1F4QA 1DF0A 3BUXB 1SKTA 4YGEB 1IJ5A 3DF0A 3SG3A 4F7FA 3LK0A 3BFBA 1PVAA 1SW8A 1L2OB 3EK7A 4CFQA 2BNXA 3WNXB 5CSJA 4FTGA 2Y1MA 4ZCUA 1M45A 3OP0A 2AAOA 2OS8B 4TNCA 2F3YA 2HQWA 2LC5A 3HCMA 1NX0A 4YGAA 1PALA 1OSAA 3I5GC 4NDBA 4CIDA 1SR6C 1QLSA 2BKIB 2KLDA 4N1GA 3AAKA 4I5JA 1S3PA 2NZ0A 3CABA 3I5FB 1QVIY 1V1GA 1UHIA 2KAXA 3BXKA 3I5HB 1TWOA 4JPZB 2WC5A 3PALA 1RFJA 2CBLA 1IJ6A 1Y1AA 2JOJA 5ER4X 4QJ4B 1SMGA 2MLFC 4MZJA 4AQJA 1QJTA 4ORAB 3BOWA 1QV0A 3QMEA 2LUCA
chains in the Genus database with same CATH topology
3KEVA 1QATA 2G2BA 2NCPA 3LLEA 1SCVA 1CDPA 1NPQA 4GGNA 2JQ6A 2JXLA 2KSPA 4MZKA 1CTRA 3M0WA 2LCPA 5CSIA 3VROA 1K90D 3VRPA 2EGDA 1OMVA 1NWDA 2ISDA 1DJHA 3BQ3A 1EG4A 2I18A 2ZFDA 2M3WA 2CXJA 4PE1A 3RM1A 2CT9A 3DVKA 2MHHA 4C0KA 5ER5A 2BCAA 2AMIA 4A4CA 2P6BB 2OPOA 3E3RA 1JUOA 1L2OC 1YTZC 2L0PA 4C0JA 1AP4A 4L9MA 1YURA 2G9BA 2KYCA 2WCEA 1M31A 5PALA 3IQOA 2M1KB 2ZN9A 4AQIA 2JC2A 2LE9B 2BCXA 2GGMA 2HF5A 4AOMA 4CLNA 2KI4B 4PCWA 1F55A 1K94A 1CDMA 1BLQA 1XFYO 1NCYA 1DGVA 2PALA 3I5FC 1UWOA 3KF9A 1J55A 2JTZA 3CR5X 1AVSA 3LCPC 3TS5C 1XA5A 3A8RA 1TRFA 3K21A 2EHBA 5AXIA 1IQ5A 1KK7Z 2ZRSA 2LVJA 1ALWA 4MZLA 2LM5A 3KPXA 3SG7A 3I5GB 1QIVA 2L51A 1S5GY 1J1EA 1A4PA 1XVJA 1ZUZA 1TNQA 4I5KA 2A4JA 4NDDA 2M9GA 2LV7A 1A03A 2F8PA 2JPTA 1HT9A 2M0RA 3OB2B 3HX4A 4YGCB 5K89A 4JWQA 2Q91A 1LXFC 4M2OA 1NYAA 4XYNA 5HKZA 1Q80A 4CFRA 1DJYA 1PSRA 2K7DA 3D0YB 1EXRA 1BOCA 1A2XA 1SL9A 1S26D 3OHMB 1TTXA 3MSEB 1J1DA 4QJ3B 1Y0VH 1K93D 1BT6A 1DVIA 3CGAA 5G08A 2JNFA 2KI4C 1Y1UA 1K2HA 1QASA 1MR8A 2K8MB 3PLFB 4P5OE 1J7QA 2IS9A 2MJWB 1UHNA 3NSLA 2PMYA 4MBEA 4GGFC 1V1FA 1B7TZ 1YR5A 2ZNDA 4ETOA 2ZKMX 1ZFSA 2I94A 2LLTA 4BY4A 1DGUA 1KK8B 3EK4A 5B8IB 3CWGA 3PFVA 4C0LA 3PATA 1DF0B 1FI6A 2LP3A 3GK1A 1YVHA 3DF0B 2LVVA 1KWOC 1C07A 1DMOA 3OX5A 1W7IB 2BE4A 1QS7A 1TNWA 2F3ZA 1XO5A 4OV2A 2L98A 2BL0B 5DKQA 1TCFA 1KQVA 4PHJA 4PE0A 3I5IC 3TS5B 2NLNA 4XJKA 1KSMA 1YRTB 2MA2A 5HKYA 1E8AA 1UHHA 2BKHB 2AUCA 3TDZA 2QPTA 2SCPA 2M8UA 4WQ2A 5CSNA 2H61A 1SRAA 2B1UA 3H4SE 2BE6A 1CB1A 2JZIA 4ORCB 1TIZA 1TN4A 1EL4A 1N65A 1BJFA 2LAPA 2R2IA 5I2LA 1OMDA 2JT3A 2BBNA 2WC8A 1DJGA 3C1VA 1MQ1A 4OCIA 1LKJA 2LUXA 5AEQA 4U8DA 2K7CA 3BUMB 1B47A 2V53A 3EKHA 1NCZA 3BOWB 3O4YA 4N1FA 4JQ0D 3ZWHA 1QTXA 1WRLA 2F2PA 1ZACA 1C7VA 1PVBA 2K2AA 1YUTA 1GGZA 1YX7A 5AANA 3TDIA 1UHJA 3CR4X 4CPVA 3CR2A 4MRYA 1CLMA 1F70A 2KI6D 3SJSA 4NDCA 1KQMC 2Y1NA 4GBAA 1BU3A 1TOPA 3GK4X 1KK8C 4M2PA 1CMGA 2JT0A 2JRFA 1WDCC 1CKKA 1CFPA 3OB1B 1JFKA 1DTLA 4BY5A 3WXAA 4YBHB 1B8LA 4HRHA 5JOLA 2OTGC 5KU1A 2QACA 1GGWA 5TNCA 1MXEA 1IH0A 5J3XA 2FCEA 2KQ6A 1B4CA 5DKRA 1UUSA 2I2RE 1RROA 4GNKB 2F33A 1U5IA 2LVKA 3VRRA 2BL0C 4HREE 1IKUA 4DIRA 4OKHA 3SIBA 4UPGA 2M49B 3WHTB 1NUBA 1YUSA 1AJ5A 3FIAA 2LLUA 2WORA 5I8NA 3OX6A 1BG1A 1DJIA 1IWQA 3DVEA 4MN0A 1ZMZA 1B1GA 1UP5A 3O78A 2VRGA 4PE7A 2M97A 2KAYA 2M7LA 2KGBC 2SASA 1QLKA 3ICBA 1ALVA 3JVTC 2WCBA 1NCXA 1KSOA 1KCYA 2JXCA 1KWOB 1XFXO 1BMOA 1VRKA 3SG6A 2L50A 4I5NB 3VGOA 2D8NA 1RECA 1JWDA 3DD4A 2H61C 1QVIZ 1SNLA 1N2DA 2KBIA 1WRZA 4PDZA 3EVRA 4YI8A 3TZ1A 3I5IB 1F71A 4YI9A 2BCBA 2WNDA 2I7AA 1DJWA 1KFUS 5CPVA 1S1EA 1MHOA 2JULA 1GQMA 4GAOA 1A75A 3NXAA 4DRWA 3AAJA 1R2UA 1JC2A 2MRDA 1QIWA 1W7JB 2EC6B 2LP2A 3BUNB 3VRNA 1H8BA 2L4HA 1S36A 3BUWB 1SK6D 3KHEA 4PE4A 2GV5A 3GOFA 3SG2A 1AUIB 5HLOA 2MBXA 2KGRA 1YUUA 3PM8A 2M1UA 5KSZA 2KFGA 3EK8A 1KFXS 2LNKA 1CLBA 3NSKA 1L7ZA 3CLNA 1K9KA 1N0YA 2JNXA 4PHKA 1MF8B 4OR9B 2COLB 1B8RA 1SCMB 1NSHA 1NP8A 3AKAA 1KQMB 1LA3A 1G4YR 3SG4A 3EVVA 2PVBA 1OE9B 1WDCB 2Y5IA 2ZNEA 5IBWA 1WY9A 1M39A 2CNPA 1J7RA 1MXLC 4MVFA 4GPLB 1Y1XA 2OTGB 2LANA 1TCOB 5GQQC 1DJXA 3O2PA 1YRUB 3F45A 3PSRA 3BUOB 1LA0A 3SG5A 5BPJA 1H4BA 3FS7A 2LLSA 1WRKA 1IQ3A 1KK7Y 1ZOTB 4HRGA 2HQ8A 4A4BA 1JFJA 1SL8A 2FJUB 3PN7C 1WLZA 2KYFA 3VRQA 4MRXA 4DCKA 4R1EA 4USLA 1QX7A 3WHUB 1DT7B 1NX1A 2LMUA 5HLVA 2FCDA 2JTTA 4MSPA 2Y4QA 1K9PA 4YGBB 5HKWA 1LVCD 2BECA 1CM1A 1F8HA 2EC6C 3JVTB 4M2QA 2HETA 2MAZA 1SPYA 1F54A 1NIWA 1S5GZ 2JT8A 4XJKB 2WCFA 2L2EA 3NSIA 2TN4A 4DUQA 2O5GA 5F6TA 1EJ3A 5AFPA 3TUYC 2E30A 1FW4A 2KFHA 2KBMA 1EG3A 3DVMA 4WQ3A 1S6JA 5JJGA 1FF1A 1DJZA 2E6WA 3CS1A 1CFDA 1Y6WA 3LK1A 1B9AA 1G33A 1PK0D 3EVUA 3QRXA 1PSBA 3RLZA 1OOJA 3DVJA 1WLMA 5D69A 1SCMC 2NXQA 3O6BA 4WRIA 2GGZA 1M63B 2H2KA 1YX8A 1RWYA 1QXPA 2KFFA 1MUXA 5FYXA 1OZSA 2K7OA 2JU0A 1BR1B 4I5LB 1XK4A 4PHNA 1CDNA 2CCMA 2LHLA 3JTDC 1AHRA 4IL1A 2KOTA 1RK9A 4YGDB 1BF5A 1SY9A 1UURA 5DKNA 2MLEC 1UHKA 1TNXA 1CNPA 1B7TY 4OVNF 5HYDA 1CMFA 2LMVA 4DS7A 1K8UA 2CTNA 1OMRA 1OZOA 1B8CA 2K61A 1D1OA 1IRJA 2L5XB 1HQVA 3CTNA 1K96A 2BBMA 1EH2A 4GGFA 4PALA 5CSFA 1LINA 2OS8C 2L4IA 1FBVA 1S6IA 3A4UB 4ORBB 1JF0A 3CZTX 1K95A 1U5IB 4ICBA 4HSZA 4Q04A 1CFFA 1CM4A 1RTP1 4MEWA 1PULA 1KFUL 1PRWA 1X02A 2JWWA 3AKBA 2FOTA 2ZRTA 1NX3A 2LMTA 3I5HC 2M7NA 2Q4UA 1QV1A 1M46A 3FWCA 1AJ4A 4MLWA 1G8IA 4PHMA 3BYAA 4QJ5B 1BR4B 1QX2A 3PN7B 4N5XA 1YVLA 1J7PA 1RJVA 1SBJA 3IF7A 1IGVA 1CLLA 1XFZO 1CDLA 3FWBA 2KI6C 1JF2A 3IQQA 4GUKA 2DOQA 2KNEA 1SR6B 1XFVO 3KO0A 4D1EA 1QX5B 4YRUA 3SIAA 1KFXL 2K0JA 2LHIA 4F0ZB 3NSOA 1AK8A 2M29A 4FQOA 5AERA 2F2OA 1IG5A 2ZN8A 3D0YA 1XFUO 4ZCVA 3TUYB 1BODA 1A75B 5I2OA 1R6PA 2KQYA 1F4OA 2O60A 1ODBA 3GK2A 1JBAA 1A29A 1S6CA 1SL7A 2WOSA 2PSRA 5I2QA 4E68A 2RGIA 1FPWA 1XK4C 1XYDA 2HPSA 1TNPA 3LL8B 1SYMA 5KTYA 3ZNIA 1OQPA 1CFCA 1XFWO 2PASA 1GJYA 1J7OA 1FI5A 1C7WA 3TDUA 2NCOA 2PRUA 3EKJA 1NX2A 2KDHA 1K9UA 4GFTA 1JSAA 2K2FA 2KHNA 3JTDB 4NQGA 2K7BA 2KAVA 2LVIA 5D7FA 3D10A 4P2YB 1MWNA 1F4QA 1DF0A 3BUXB 1SKTA 4YGEB 1IJ5A 3DF0A 3SG3A 3LK0A 4CFQA 1PVAA 1SW8A 1L2OB 3EK7A 3WNXB 5CSJA 4FTGA 2Y1MA 4ZCUA 1M45A 3OP0A 2AAOA 2OS8B 4TNCA 2F3YA 2HQWA 2LC5A 3HCMA 1NX0A 4YGAA 1PALA 1OSAA 3I5GC 4NDBA 4CIDA 1SR6C 1QLSA 2BKIB 4N1GA 3AAKA 4I5JA 1S3PA 2NZ0A 3I5FB 1QVIY 1V1GA 1UHIA 2KAXA 3BXKA 3I5HB 4JPZB 3PALA 1RFJA 2CBLA 1IJ6A 1Y1AA 2JOJA 5ER4X 4QJ4B 1SMGA 2MLFC 4MZJA 4AQJA 1QJTA 4ORAB 3BOWA 1QV0A 2LUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KEV A;  1QAT A;  2G2B A;  2NCP A;  3LLE A;  1SCV A;  1CDP A;  1NPQ A;  4GGN A;  2JQ6 A;  2JXL A;  2KSP A;  4MZK A;  1CTR A;  3M0W A;  2LCP A;  5CSI A;  3VRO A;  1K90 D;  3VRP A;  2EGD A;  1OMV A;  1NWD A;  2ISD A;  1DJH A;  3BQ3 A;  1EG4 A;  2I18 A;  2ZFD A;  2M3W A;  2CXJ A;  4PE1 A;  3RM1 A;  2CT9 A;  3DVK A;  2MHH A;  4C0K A;  5ER5 A;  2BCA A;  2AMI A;  4A4C A;  2P6B B;  2OPO A;  3E3R A;  1JUO A;  1L2O C;  1YTZ C;  2L0P A;  4C0J A;  1AP4 A;  4L9M A;  1YUR A;  2G9B A;  2KYC A;  2WCE A;  1M31 A;  5PAL A;  3IQO A;  2M1K B;  2ZN9 A;  4AQI A;  2JC2 A;  2LE9 B;  2BCX A;  2GGM A;  2HF5 A;  4AOM A;  4CLN A;  2KI4 B;  4PCW A;  1F55 A;  1K94 A;  1CDM A;  1BLQ A;  1XFY O;  1NCY A;  1DGV A;  2PAL A;  3I5F C;  1UWO A;  3KF9 A;  1J55 A;  2JTZ A;  3CR5 X;  1AVS A;  3LCP C;  3TS5 C;  1XA5 A;  3A8R A;  1TRF A;  3K21 A;  2EHB A;  5AXI A;  1IQ5 A;  1KK7 Z;  2ZRS A;  2LVJ A;  1ALW A;  4MZL A;  2LM5 A;  3KPX A;  3SG7 A;  3I5G B;  1QIV A;  2L51 A;  1S5G Y;  1J1E A;  1A4P A;  1XVJ A;  1ZUZ A;  1TNQ A;  4I5K A;  2A4J A;  4NDD A;  2M9G A;  2LV7 A;  1A03 A;  2F8P A;  2JPT A;  1HT9 A;  2M0R A;  3OB2 B;  3HX4 A;  4YGC B;  5K89 A;  4JWQ A;  2Q91 A;  1LXF C;  4M2O A;  1NYA A;  4XYN A;  5HKZ A;  1Q80 A;  4CFR A;  1DJY A;  1PSR A;  2K7D A;  3D0Y B;  1EXR A;  1BOC A;  1A2X A;  1SL9 A;  1S26 D;  3OHM B;  1TTX A;  3MSE B;  1J1D A;  4QJ3 B;  1Y0V H;  1K93 D;  1BT6 A;  1DVI A;  3CGA A;  5G08 A;  2JNF A;  2KI4 C;  1Y1U A;  1K2H A;  1QAS A;  1MR8 A;  2K8M B;  3PLF B;  4P5O E;  1J7Q A;  2IS9 A;  2MJW B;  1UHN A;  3NSL A;  2PMY A;  4MBE A;  4GGF C;  1V1F A;  1B7T Z;  1YR5 A;  2ZND A;  4ETO A;  2ZKM X;  1ZFS A;  2I94 A;  2LLT A;  4BY4 A;  1DGU A;  1KK8 B;  3EK4 A;  5B8I B;  3CWG A;  3PFV A;  4C0L A;  3PAT A;  1DF0 B;  1FI6 A;  2LP3 A;  3GK1 A;  1YVH A;  3DF0 B;  2LVV A;  1KWO C;  1C07 A;  1DMO A;  3OX5 A;  1W7I B;  2BE4 A;  1QS7 A;  1TNW A;  2F3Z A;  1XO5 A;  4OV2 A;  2L98 A;  2BL0 B;  5DKQ A;  1TCF A;  1KQV A;  4PHJ A;  4PE0 A;  3I5I C;  3TS5 B;  2NLN A;  4XJK A;  1KSM A;  1YRT B;  2MA2 A;  5HKY A;  1E8A A;  1UHH A;  2BKH B;  2AUC A;  3TDZ A;  2QPT A;  2SCP A;  2M8U A;  4WQ2 A;  5CSN A;  2H61 A;  1SRA A;  2B1U A;  3H4S E;  2BE6 A;  1CB1 A;  2JZI A;  4ORC B;  1TIZ A;  1TN4 A;  1EL4 A;  1N65 A;  1BJF A;  2LAP A;  2R2I A;  5I2L A;  1OMD A;  2JT3 A;  2BBN A;  2WC8 A;  1DJG A;  3C1V A;  1MQ1 A;  4OCI A;  1LKJ A;  2LUX A;  5AEQ A;  4U8D A;  2K7C A;  3BUM B;  1B47 A;  2V53 A;  3EKH A;  1NCZ A;  3BOW B;  3O4Y A;  4N1F A;  4JQ0 D;  3ZWH A;  1QTX A;  1WRL A;  2F2P A;  1ZAC A;  1C7V A;  1PVB A;  2K2A A;  1YUT A;  1GGZ A;  1YX7 A;  5AAN A;  3TDI A;  1UHJ A;  3CR4 X;  4CPV A;  3CR2 A;  4MRY A;  1CLM A;  1F70 A;  2KI6 D;  3SJS A;  4NDC A;  1KQM C;  2Y1N A;  4GBA A;  1BU3 A;  1TOP A;  3GK4 X;  1KK8 C;  4M2P A;  1CMG A;  2JT0 A;  2JRF A;  1WDC C;  1CKK A;  1CFP A;  3OB1 B;  1JFK A;  1DTL A;  4BY5 A;  3WXA A;  4YBH B;  1B8L A;  4HRH A;  5JOL A;  2OTG C;  5KU1 A;  2QAC A;  1GGW A;  5TNC A;  1MXE A;  1IH0 A;  5J3X A;  2FCE A;  2KQ6 A;  1B4C A;  5DKR A;  1UUS A;  2I2R E;  1RRO A;  4GNK B;  2F33 A;  1U5I A;  2LVK A;  3VRR A;  2BL0 C;  4HRE E;  1IKU A;  4DIR A;  4OKH A;  3SIB A;  4UPG A;  2M49 B;  3WHT B;  1NUB A;  1YUS A;  1AJ5 A;  3FIA A;  2LLU A;  2WOR A;  5I8N A;  3OX6 A;  1BG1 A;  1DJI A;  1IWQ A;  3DVE A;  4MN0 A;  1ZMZ A;  1B1G A;  1UP5 A;  3O78 A;  2VRG A;  4PE7 A;  2M97 A;  2KAY A;  2M7L A;  2KGB C;  2SAS A;  1QLK A;  3ICB A;  1ALV A;  3JVT C;  2WCB A;  1NCX A;  1KSO A;  1KCY A;  2JXC A;  1KWO B;  1XFX O;  1BMO A;  1VRK A;  3SG6 A;  2L50 A;  4I5N B;  3VGO A;  2D8N A;  1REC A;  1JWD A;  3DD4 A;  2H61 C;  1QVI Z;  1SNL A;  1N2D A;  2KBI A;  1WRZ A;  4PDZ A;  3EVR A;  4YI8 A;  3TZ1 A;  3I5I B;  1F71 A;  4YI9 A;  2BCB A;  2WND A;  2I7A A;  1DJW A;  1KFU S;  5CPV A;  1S1E A;  1MHO A;  2JUL A;  1GQM A;  4GAO A;  1A75 A;  3NXA A;  4DRW A;  3AAJ A;  1R2U A;  1JC2 A;  2MRD A;  1QIW A;  1W7J B;  2EC6 B;  2LP2 A;  3BUN B;  3VRN A;  1H8B A;  2L4H A;  1S36 A;  3BUW B;  1SK6 D;  3KHE A;  4PE4 A;  2GV5 A;  3GOF A;  3SG2 A;  1AUI B;  5HLO A;  2MBX A;  2KGR A;  1YUU A;  3PM8 A;  2M1U A;  5KSZ A;  2KFG A;  3EK8 A;  1KFX S;  2LNK A;  1CLB A;  3NSK A;  1L7Z A;  3CLN A;  1K9K A;  1N0Y A;  2JNX A;  4PHK A;  1MF8 B;  4OR9 B;  2COL B;  1B8R A;  1SCM B;  1NSH A;  1NP8 A;  3AKA A;  1KQM B;  1LA3 A;  1G4Y R;  3SG4 A;  3EVV A;  2PVB A;  1OE9 B;  1WDC B;  2Y5I A;  2ZNE A;  5IBW A;  1WY9 A;  1M39 A;  2CNP A;  1J7R A;  1MXL C;  4MVF A;  4GPL B;  1Y1X A;  2OTG B;  2LAN A;  1TCO B;  5GQQ C;  1DJX A;  3O2P A;  1YRU B;  3F45 A;  3PSR A;  3BUO B;  1LA0 A;  3SG5 A;  5BPJ A;  1H4B A;  3FS7 A;  2LLS A;  1WRK A;  1IQ3 A;  1KK7 Y;  1ZOT B;  4HRG A;  2HQ8 A;  4A4B A;  1JFJ A;  1SL8 A;  2FJU B;  3PN7 C;  1WLZ A;  2KYF A;  3VRQ A;  4MRX A;  4DCK A;  4R1E A;  4USL A;  1QX7 A;  3WHU B;  1DT7 B;  1NX1 A;  2LMU A;  5HLV A;  2FCD A;  2JTT A;  4MSP A;  2Y4Q A;  1K9P A;  4YGB B;  5HKW A;  1LVC D;  2BEC A;  1CM1 A;  1F8H A;  2EC6 C;  3JVT B;  4M2Q A;  2HET A;  2MAZ A;  1SPY A;  1F54 A;  1NIW A;  1S5G Z;  2JT8 A;  4XJK B;  2WCF A;  2L2E A;  3NSI A;  2TN4 A;  4DUQ A;  2O5G A;  5F6T A;  1EJ3 A;  5AFP A;  3TUY C;  2E30 A;  1FW4 A;  2KFH A;  2KBM A;  1EG3 A;  3DVM A;  4WQ3 A;  1S6J A;  5JJG A;  1FF1 A;  1DJZ A;  2E6W A;  3CS1 A;  1CFD A;  1Y6W A;  3LK1 A;  1B9A A;  1G33 A;  1PK0 D;  3EVU A;  3QRX A;  1PSB A;  3RLZ A;  1OOJ A;  3DVJ A;  1WLM A;  5D69 A;  1SCM C;  2NXQ A;  3O6B A;  4WRI A;  2GGZ A;  1M63 B;  2H2K A;  1YX8 A;  1RWY A;  1QXP A;  2KFF A;  1MUX A;  5FYX A;  1OZS A;  2K7O A;  2JU0 A;  1BR1 B;  4I5L B;  1XK4 A;  4PHN A;  1CDN A;  2CCM A;  2LHL A;  3JTD C;  1AHR A;  4IL1 A;  2KOT A;  1RK9 A;  4YGD B;  1BF5 A;  1SY9 A;  1UUR A;  5DKN A;  2MLE C;  1UHK A;  1TNX A;  1CNP A;  1B7T Y;  4OVN F;  5HYD A;  1CMF A;  2LMV A;  4DS7 A;  1K8U A;  2CTN A;  1OMR A;  1OZO A;  1B8C A;  2K61 A;  1D1O A;  1IRJ A;  2L5X B;  1HQV A;  3CTN A;  1K96 A;  2BBM A;  1EH2 A;  4GGF A;  4PAL A;  5CSF A;  1LIN A;  2OS8 C;  2L4I A;  1FBV A;  1S6I A;  3A4U B;  4ORB B;  1JF0 A;  3CZT X;  1K95 A;  1U5I B;  4ICB A;  4HSZ A;  4Q04 A;  1CFF A;  1CM4 A;  1RTP 1;  4MEW A;  1PUL A;  1KFU L;  1PRW A;  1X02 A;  2JWW A;  3AKB A;  2FOT A;  2ZRT A;  1NX3 A;  2LMT A;  3I5H C;  2M7N A;  2Q4U A;  1QV1 A;  1M46 A;  3FWC A;  1AJ4 A;  4MLW A;  1G8I A;  4PHM A;  3BYA A;  4QJ5 B;  1BR4 B;  1QX2 A;  3PN7 B;  4N5X A;  1YVL A;  1J7P A;  1RJV A;  1SBJ A;  3IF7 A;  1IGV A;  1CLL A;  1XFZ O;  1CDL A;  3FWB A;  2KI6 C;  1JF2 A;  3IQQ A;  4GUK A;  2DOQ A;  2KNE A;  1SR6 B;  1XFV O;  3KO0 A;  4D1E A;  1QX5 B;  4YRU A;  3SIA A;  1KFX L;  2K0J A;  2LHI A;  4F0Z B;  3NSO A;  1AK8 A;  2M29 A;  4FQO A;  5AER A;  2F2O A;  1IG5 A;  2ZN8 A;  3D0Y A;  1XFU O;  4ZCV A;  3TUY B;  1BOD A;  1A75 B;  5I2O A;  1R6P A;  2KQY A;  1F4O A;  2O60 A;  1ODB A;  3GK2 A;  1JBA A;  1A29 A;  1S6C A;  1SL7 A;  2WOS A;  2PSR A;  5I2Q A;  4E68 A;  2RGI A;  1FPW A;  1XK4 C;  1XYD A;  2HPS A;  1TNP A;  3LL8 B;  1SYM A;  5KTY A;  3ZNI A;  1OQP A;  1CFC A;  1XFW O;  2PAS A;  1GJY A;  1J7O A;  1FI5 A;  1C7W A;  3TDU A;  2NCO A;  2PRU A;  3EKJ A;  1NX2 A;  2KDH A;  1K9U A;  4GFT A;  1JSA A;  2K2F A;  2KHN A;  3JTD B;  4NQG A;  2K7B A;  2KAV A;  2LVI A;  5D7F A;  3D10 A;  4P2Y B;  1MWN A;  1F4Q A;  1DF0 A;  3BUX B;  1SKT A;  4YGE B;  1IJ5 A;  3DF0 A;  3SG3 A;  3LK0 A;  4CFQ A;  1PVA A;  1SW8 A;  1L2O B;  3EK7 A;  3WNX B;  5CSJ A;  4FTG A;  2Y1M A;  4ZCU A;  1M45 A;  3OP0 A;  2AAO A;  2OS8 B;  4TNC A;  2F3Y A;  2HQW A;  2LC5 A;  3HCM A;  1NX0 A;  4YGA A;  1PAL A;  1OSA A;  3I5G C;  4NDB A;  4CID A;  1SR6 C;  1QLS A;  2BKI B;  4N1G A;  3AAK A;  4I5J A;  1S3P A;  2NZ0 A;  3I5F B;  1QVI Y;  1V1G A;  1UHI A;  2KAX A;  3BXK A;  3I5H B;  4JPZ B;  3PAL A;  1RFJ A;  2CBL A;  1IJ6 A;  1Y1A A;  2JOJ A;  5ER4 X;  4QJ4 B;  1SMG A;  2MLF C;  4MZJ A;  4AQJ A;  1QJT A;  4ORA B;  3BOW A;  1QV0 A;  2LUC A; 
#chains in the Genus database with same CATH topology
 2L5Y A;  3KEV A;  1QAT A;  2G2B A;  2NCP A;  3LLE A;  1SCV A;  1CDP A;  1NPQ A;  4GGN A;  5FI7 A;  2QDI A;  2JQ6 A;  2JXL A;  2KSP A;  2QEH A;  4MZK A;  2FJY A;  1CTR A;  3M0W A;  2LCP A;  5CSI A;  1SSE B;  3VRO A;  1K90 D;  3VRP A;  2EGD A;  1LS8 A;  1NWD A;  1OMV A;  2ISD A;  1DJH A;  3BQ3 A;  1EG4 A;  2I18 A;  2ZFD A;  1TUJ A;  2M3W A;  2CXJ A;  4PE1 A;  3B86 A;  3RM1 A;  2CT9 A;  3DVK A;  2MHH A;  4C0K A;  5ER5 A;  2BCA A;  2AMI A;  4A4C A;  2P6B B;  2PYQ A;  2OPO A;  3E3R A;  1JUO A;  1L2O C;  1YTZ C;  2L0P A;  4C0J A;  1AP4 A;  4L9M A;  2YGU A;  1YUR A;  2G9B A;  2KYC A;  2WCE A;  1M31 A;  4IJ7 A;  5PAL A;  3IQO A;  3S0D A;  2M1K B;  2ZN9 A;  4AQI A;  2JC2 A;  2LE9 B;  2BCX A;  2GGM A;  2HF5 A;  4AOM A;  4CLN A;  2KI4 B;  4PCW A;  1F55 A;  1K94 A;  1CDM A;  1BLQ A;  1XFY O;  1NCY A;  1DGV A;  3BFH A;  2PAL A;  3I5F C;  1UWO A;  3KF9 A;  1J55 A;  2JTZ A;  3CR5 X;  1AVS A;  3LCP C;  3TS5 C;  3B7A A;  1XA5 A;  5D3O A;  3A8R A;  1TRF A;  3K21 A;  2EHB A;  2KPH A;  5DIC A;  5AXI A;  1IQ5 A;  1KK7 Z;  2ZRS A;  2LVJ A;  1ALW A;  4MZL A;  2LM5 A;  3KPX A;  3SG7 A;  2KLE A;  3I5G B;  1ORG A;  1QIV A;  2L51 A;  1S5G Y;  1J1E A;  1A4P A;  1XVJ A;  3N7H A;  1P28 A;  1TNQ A;  1ZUZ A;  4I5K A;  2A4J A;  5HL1 A;  4NDD A;  2M9G A;  2LV7 A;  1IIO A;  1A03 A;  2F8P A;  2JPT A;  3L47 A;  1HT9 A;  2M0R A;  3OB2 B;  5EL2 A;  3HX4 A;  4YGC B;  5K89 A;  2BAP A;  3D78 A;  4JWQ A;  4FQT A;  2Q91 A;  1LXF C;  4M2O A;  1NYA A;  4XYN A;  5HKZ A;  5I94 A;  1Q80 A;  4CFR A;  1DJY A;  1PSR A;  2K7D A;  3D0Y B;  1EXR A;  1BOC A;  1A2X A;  1SL9 A;  1S26 D;  3OHM B;  1TTX A;  3MSE B;  1J1D A;  4QJ3 B;  1Y0V H;  1K93 D;  1BT6 A;  1DVI A;  3CGA A;  4INX A;  5G08 A;  2JNF A;  2P71 A;  2KI4 C;  1Y1U A;  1K2H A;  1QAS A;  1MR8 A;  2GTE A;  2K8M B;  3BJH A;  3PLF B;  4P5O E;  2IS9 A;  2MJW B;  1UHN A;  3NSL A;  2PMY A;  3B6X A;  4MBE A;  4GGF C;  1V1F A;  4INW A;  1B7T Z;  1YR5 A;  2ZND A;  4ETO A;  2ZKM X;  1ZFS A;  2I94 A;  2LLT A;  4BY4 A;  3S0A A;  1DGU A;  1KK8 B;  3EK4 A;  3IVT A;  5B8I B;  3CWG A;  3PFV A;  4C0L A;  3PAT A;  1OW4 A;  1DF0 B;  1FI6 A;  2LP3 A;  2L2C A;  3GK1 A;  1YVH A;  3DF0 B;  2LVV A;  1T14 A;  1KWO C;  1C07 A;  1DMO A;  3OX5 A;  1W7I B;  3UO9 A;  2QEO A;  2BE4 A;  3B87 A;  1QS7 A;  1TNW A;  2F3Z A;  1DEL A;  1XO5 A;  4OV2 A;  2L98 A;  2BL0 B;  5DKQ A;  1TCF A;  1KQV A;  2PQL A;  4PHJ A;  4PE0 A;  3I5I C;  3TS5 B;  2NLN A;  4XJK A;  1KSM A;  3S0G A;  1YRT B;  2MA2 A;  5HKY A;  1E8A A;  1UHH A;  2AUC A;  2BKH B;  3TDZ A;  2QPT A;  3CDN A;  2SCP A;  2M8U A;  4WQ2 A;  5CSN A;  2H61 A;  1SRA A;  2B1U A;  3H4S E;  2BE6 A;  1CB1 A;  2JZI A;  4ORC B;  1TIZ A;  4JKT A;  1TN4 A;  1EL4 A;  1N65 A;  1BJF A;  2LAP A;  2R2I A;  5I2L A;  1OMD A;  2JT3 A;  2BBN A;  2WC8 A;  1DJG A;  3C1V A;  1MQ1 A;  3DY9 A;  1LKJ A;  2LUX A;  3D74 A;  4OCI A;  5AEQ A;  2WC6 A;  2K7C A;  3BUM B;  1B47 A;  2V53 A;  3EKH A;  1NCZ A;  3BOW B;  3O4Y A;  4N1F A;  4JQ0 D;  3ZWH A;  1QTX A;  1WRL A;  2F2P A;  1ZAC A;  1C7V A;  1PVB A;  2K2A A;  1YUT A;  1GGZ A;  1YX7 A;  3D77 A;  5AAN A;  3TDI A;  1C3Y A;  1UHJ A;  3CR4 X;  4CPV A;  3R1V A;  3CR2 A;  4MRY A;  1CLM A;  1F70 A;  2KI6 D;  3SJS A;  4NDC A;  2WCH A;  1KQM C;  2Y1N A;  4GBA A;  1BU3 A;  1TOP A;  3GK4 X;  3NGV A;  1KK8 C;  4M2P A;  1CMG A;  2JT0 A;  2JRF A;  1WDC C;  1CKK A;  1CFP A;  3OB1 B;  1JFK A;  1DTL A;  4BY5 A;  3WXA A;  4YBH B;  4JD9 A;  1B8L A;  1C3Z A;  4HRH A;  5JOL A;  2OTG C;  5KU1 A;  2QAC A;  1GGW A;  5TNC A;  1MXE A;  1IH0 A;  5J3X A;  2FCE A;  2KQ6 A;  1B4C A;  5DKR A;  1UUS A;  2I2R E;  1RRO A;  4GNK B;  1QWV A;  2F33 A;  1U5I A;  2LVK A;  3VRR A;  2BL0 C;  4HRE E;  1IKU A;  4DIR A;  4OKH A;  3SIB A;  4UPG A;  2M49 B;  3WHT B;  1NUB A;  1YUS A;  2WCJ A;  1AJ5 A;  3FIA A;  2LLU A;  2WOR A;  5I8N A;  3OX6 A;  1BG1 A;  1DJI A;  1IWQ A;  3NHT A;  3NHI A;  3SS4 A;  3DVE A;  2P70 A;  4MN0 A;  1ZMZ A;  4PT1 A;  1B1G A;  1UP5 A;  3O78 A;  2VRG A;  4PE7 A;  2M97 A;  2KAY A;  2M7L A;  3SS3 A;  2KGB C;  3UNW A;  2SAS A;  1QLK A;  3CZ1 A;  1ALV A;  3ICB A;  3JVT C;  2WCB A;  4KYN A;  1NCX A;  1KSO A;  1KCY A;  2JXC A;  1KWO B;  1XFX O;  3DZT A;  1BMO A;  1VRK A;  3SG6 A;  2L50 A;  4I5N B;  3VGO A;  2D8N A;  1REC A;  1JWD A;  3DD4 A;  2H61 C;  1QVI Z;  3PM2 A;  1SNL A;  1N2D A;  2KBI A;  1WRZ A;  4PDZ A;  3EVR A;  4YI8 A;  3TZ1 A;  3I5I B;  1F71 A;  4YI9 A;  2BCB A;  2WND A;  2I7A A;  1DJW A;  1KFU S;  5CPV A;  1S1E A;  1MHO A;  2JUL A;  1OOF A;  1GQM A;  4GAO A;  1A75 A;  3NXA A;  4DRW A;  3AAJ A;  1R2U A;  1JC2 A;  2WCK A;  2MRD A;  3FE6 A;  1QIW A;  1OOG A;  1W7J B;  2EC6 B;  2LP2 A;  3BUN B;  3VRN A;  1H8B A;  2L4H A;  1S36 A;  3BUW B;  1SK6 D;  3KHE A;  4PE4 A;  2GV5 A;  3GOF A;  3SG2 A;  1AUI B;  5HLO A;  2MBX A;  2KGR A;  1TUZ A;  1YUU A;  2JPO A;  3PM8 A;  3FE9 A;  2M1U A;  5KSZ A;  2KFG A;  3EK8 A;  1KFX S;  2LNK A;  1CLB A;  3NSK A;  1L7Z A;  3CLN A;  1K9K A;  1N0Y A;  2JNX A;  2QEV A;  4PHK A;  1MF8 B;  4OR9 B;  2COL B;  1B8R A;  1SCM B;  1NSH A;  1NP8 A;  3AKA A;  1KQM B;  1LA3 A;  3K1E A;  1J7Q A;  1G4Y R;  3SG4 A;  3EVV A;  2PVB A;  1OE9 B;  1WDC B;  2Y5I A;  2ZNE A;  5IBW A;  1WY9 A;  1M39 A;  2CNP A;  1J7R A;  1MXL C;  4MVF A;  4GPL B;  1Y1X A;  1Z2C B;  2OTG B;  2LAN A;  1TCO B;  5GQQ C;  1DJX A;  3O2P A;  2H8V A;  1YRU B;  3F45 A;  3PSR A;  5FI6 A;  3BUO B;  1LA0 A;  3SG5 A;  1DC1 A;  5BPJ A;  2WCL A;  1H4B A;  3FS7 A;  2LLS A;  5FI2 A;  1WRK A;  1IQ3 A;  3EG5 B;  1GM0 A;  1KK7 Y;  1ZOT B;  4HRG A;  2HQ8 A;  4A4B A;  1JFJ A;  1SL8 A;  3D75 A;  1W9Z A;  2FJU B;  3PN7 C;  1WLZ A;  2KYF A;  3VRQ A;  4MRX A;  4DCK A;  4R1E A;  4USL A;  1QX7 A;  3WHU B;  1DT7 B;  1NX1 A;  2LMU A;  5HLV A;  2FCD A;  4OZD A;  2JTT A;  4MSP A;  2Y4Q A;  1K9P A;  4YGB B;  5HKW A;  3R72 A;  1LVC D;  2BEC A;  1CM1 A;  1F8H A;  2EC6 C;  3JVT B;  4M2Q A;  2HET A;  2MAZ A;  1SPY A;  1F54 A;  1NIW A;  1S5G Z;  2ERB A;  2JT8 A;  4XJK B;  3CZ2 A;  3S0F A;  2WCF A;  2L2E A;  3S0B A;  3NSI A;  2TN4 A;  4DUQ A;  2O5G A;  5F6T A;  1EJ3 A;  5AFP A;  3TUY C;  2E30 A;  1FW4 A;  2KFH A;  2KBM A;  1EG3 A;  3DVM A;  4WQ3 A;  1S6J A;  5JJG A;  1FF1 A;  1DJZ A;  2E6W A;  3CS1 A;  1CFD A;  1Y6W A;  3LK1 A;  1B9A A;  1G33 A;  1PK0 D;  3EVU A;  3QRX A;  1PSB A;  3RLZ A;  1OOJ A;  3Q8I A;  3DVJ A;  1WLM A;  5D69 A;  2K60 A;  1SCM C;  2NXQ A;  3O6B A;  4WRI A;  2GGZ A;  1M63 B;  2H2K A;  1YX8 A;  3S0E A;  1RWY A;  1QXP A;  2KFF A;  1MUX A;  5FYX A;  1OZS A;  2K7O A;  2JU0 A;  1BR1 B;  3D76 A;  4I5L B;  1XK4 A;  4PHN A;  1CDN A;  2CCM A;  2LHL A;  3JTD C;  1AHR A;  4IL1 A;  2KOT A;  1RK9 A;  4YGD B;  1BF5 A;  1SY9 A;  1UUR A;  5DKN A;  2MLE C;  1UHK A;  1TNX A;  1CNP A;  1B7T Y;  4OVN F;  5HYD A;  1CMF A;  2LMV A;  4DS7 A;  1K8U A;  2CTN A;  3OBV A;  1OMR A;  3DXL A;  3CYZ A;  1OZO A;  3L4A A;  3PJI A;  1B8C A;  2K61 A;  1D1O A;  1IRJ A;  2L5X B;  1HQV A;  3CTN A;  1K96 A;  2BBM A;  1EH2 A;  4GGF A;  4PAL A;  5CSF A;  1LIN A;  2OS8 C;  3BFA A;  2L4I A;  1FBV A;  1S6I A;  3A4U B;  3R1O A;  3B88 A;  4ORB B;  1JF0 A;  3CZT X;  1K95 A;  1U5I B;  2QEB A;  4ICB A;  4HSZ A;  4Q04 A;  1CFF A;  1CM4 A;  1RTP 1;  1Z4H A;  2WCM A;  1PUL A;  1KFU L;  4MEW A;  1PRW A;  1X02 A;  1OOH A;  2JWW A;  3AKB A;  2FOT A;  2ZRT A;  1NX3 A;  2LMT A;  3I5H C;  2M7N A;  2Q4U A;  1QV1 A;  3R1P A;  1M46 A;  3FWC A;  1AJ4 A;  4MLW A;  1G8I A;  4PHM A;  3BYA A;  4QJ5 B;  1XFR A;  1BR4 B;  1QX2 A;  3PN7 B;  4N5X A;  1YVL A;  1J7P A;  1RJV A;  3O4X A;  3FE8 A;  1SBJ A;  3IF7 A;  1IGV A;  1CLL A;  3V2L A;  1XFZ O;  1CDL A;  1DEK A;  3FWB A;  2KI6 C;  1JF2 A;  3IQQ A;  4GUK A;  2DOQ A;  2KNE A;  1SR6 B;  1XFV O;  3KO0 A;  4D1E A;  1QX5 B;  4YRU A;  3CZ0 A;  3SS5 A;  3SIA A;  1KFX L;  2K0J A;  2LHI A;  4F0Z B;  3NSO A;  1AK8 A;  2M29 A;  3DYE A;  4FQO A;  5AER A;  2F2O A;  1IG5 A;  2ZN8 A;  3VB1 A;  3D0Y A;  1XFU O;  4ZCV A;  4U8D A;  3TUY B;  1BOD A;  1A75 B;  5I2O A;  1R6P A;  2KQY A;  3OGN A;  1F4O A;  2O60 A;  1ODB A;  3GK2 A;  1JBA A;  1A29 A;  1S6C A;  1SL7 A;  2WOS A;  2PSR A;  5I2Q A;  4E68 A;  2RGI A;  1FPW A;  1XK4 C;  1XYD A;  2HPS A;  1TNP A;  3LL8 B;  1SYM A;  1DQE A;  5KTY A;  3ZNI A;  1OQP A;  1CFC A;  1XFW O;  2PAS A;  1GJY A;  1J7O A;  1FI5 A;  1C7W A;  3TDU A;  2NCO A;  2PRU A;  3EKJ A;  1NX2 A;  2KDH A;  1K9U A;  3D73 A;  4GFT A;  2K2F A;  1JSA A;  2KHN A;  3JTD B;  3L4L A;  4NQG A;  3RZS A;  2K7B A;  1OOI X;  2KAV A;  2LVI A;  5D7F A;  3D10 A;  4P2Y B;  1MWN A;  1F4Q A;  1DF0 A;  3BUX B;  1SKT A;  4YGE B;  1IJ5 A;  3DF0 A;  3SG3 A;  4F7F A;  3LK0 A;  3BFB A;  1PVA A;  1SW8 A;  1L2O B;  3EK7 A;  4CFQ A;  2BNX A;  3WNX B;  5CSJ A;  4FTG A;  2Y1M A;  4ZCU A;  1M45 A;  3OP0 A;  2AAO A;  2OS8 B;  4TNC A;  2F3Y A;  2HQW A;  2LC5 A;  3HCM A;  1NX0 A;  4YGA A;  1PAL A;  1OSA A;  3I5G C;  4NDB A;  4CID A;  1SR6 C;  1QLS A;  2BKI B;  2KLD A;  4N1G A;  3AAK A;  4I5J A;  1S3P A;  2NZ0 A;  3CAB A;  3I5F B;  1QVI Y;  1V1G A;  1UHI A;  2KAX A;  3BXK A;  3I5H B;  1TWO A;  4JPZ B;  2WC5 A;  3PAL A;  1RFJ A;  2CBL A;  1IJ6 A;  1Y1A A;  2JOJ A;  5ER4 X;  4QJ4 B;  1SMG A;  2MLF C;  4MZJ A;  4AQJ A;  1QJT A;  4ORA B;  3BOW A;  1QV0 A;  3QME A;  2LUC A; 
#chains in the Genus database with same CATH homology
 3KEV A;  1QAT A;  2G2B A;  2NCP A;  3LLE A;  1SCV A;  1CDP A;  1NPQ A;  4GGN A;  2JQ6 A;  2JXL A;  2KSP A;  4MZK A;  1CTR A;  3M0W A;  2LCP A;  5CSI A;  3VRO A;  1K90 D;  3VRP A;  2EGD A;  1OMV A;  1NWD A;  2ISD A;  1DJH A;  3BQ3 A;  1EG4 A;  2I18 A;  2ZFD A;  2M3W A;  2CXJ A;  4PE1 A;  3RM1 A;  2CT9 A;  3DVK A;  2MHH A;  4C0K A;  5ER5 A;  2BCA A;  2AMI A;  4A4C A;  2P6B B;  2OPO A;  3E3R A;  1JUO A;  1L2O C;  1YTZ C;  2L0P A;  4C0J A;  1AP4 A;  4L9M A;  1YUR A;  2G9B A;  2KYC A;  2WCE A;  1M31 A;  5PAL A;  3IQO A;  2M1K B;  2ZN9 A;  4AQI A;  2JC2 A;  2LE9 B;  2BCX A;  2GGM A;  2HF5 A;  4AOM A;  4CLN A;  2KI4 B;  4PCW A;  1F55 A;  1K94 A;  1CDM A;  1BLQ A;  1XFY O;  1NCY A;  1DGV A;  2PAL A;  3I5F C;  1UWO A;  3KF9 A;  1J55 A;  2JTZ A;  3CR5 X;  1AVS A;  3LCP C;  3TS5 C;  1XA5 A;  3A8R A;  1TRF A;  3K21 A;  2EHB A;  5AXI A;  1IQ5 A;  1KK7 Z;  2ZRS A;  2LVJ A;  1ALW A;  4MZL A;  2LM5 A;  3KPX A;  3SG7 A;  3I5G B;  1QIV A;  2L51 A;  1S5G Y;  1J1E A;  1A4P A;  1XVJ A;  1ZUZ A;  1TNQ A;  4I5K A;  2A4J A;  4NDD A;  2M9G A;  2LV7 A;  1A03 A;  2F8P A;  2JPT A;  1HT9 A;  2M0R A;  3OB2 B;  3HX4 A;  4YGC B;  5K89 A;  4JWQ A;  2Q91 A;  1LXF C;  4M2O A;  1NYA A;  4XYN A;  5HKZ A;  1Q80 A;  4CFR A;  1DJY A;  1PSR A;  2K7D A;  3D0Y B;  1EXR A;  1BOC A;  1A2X A;  1SL9 A;  1S26 D;  3OHM B;  1TTX A;  3MSE B;  1J1D A;  4QJ3 B;  1Y0V H;  1K93 D;  1BT6 A;  1DVI A;  3CGA A;  5G08 A;  2JNF A;  2KI4 C;  1Y1U A;  1K2H A;  1QAS A;  1MR8 A;  2K8M B;  3PLF B;  4P5O E;  1J7Q A;  2IS9 A;  2MJW B;  1UHN A;  3NSL A;  2PMY A;  4MBE A;  4GGF C;  1V1F A;  1B7T Z;  1YR5 A;  2ZND A;  4ETO A;  2ZKM X;  1ZFS A;  2I94 A;  2LLT A;  4BY4 A;  1DGU A;  1KK8 B;  3EK4 A;  5B8I B;  3CWG A;  3PFV A;  4C0L A;  3PAT A;  1DF0 B;  1FI6 A;  2LP3 A;  3GK1 A;  1YVH A;  3DF0 B;  2LVV A;  1KWO C;  1C07 A;  1DMO A;  3OX5 A;  1W7I B;  2BE4 A;  1QS7 A;  1TNW A;  2F3Z A;  1XO5 A;  4OV2 A;  2L98 A;  2BL0 B;  5DKQ A;  1TCF A;  1KQV A;  4PHJ A;  4PE0 A;  3I5I C;  3TS5 B;  2NLN A;  4XJK A;  1KSM A;  1YRT B;  2MA2 A;  5HKY A;  1E8A A;  1UHH A;  2BKH B;  2AUC A;  3TDZ A;  2QPT A;  2SCP A;  2M8U A;  4WQ2 A;  5CSN A;  2H61 A;  1SRA A;  2B1U A;  3H4S E;  2BE6 A;  1CB1 A;  2JZI A;  4ORC B;  1TIZ A;  1TN4 A;  1EL4 A;  1N65 A;  1BJF A;  2LAP A;  2R2I A;  5I2L A;  1OMD A;  2JT3 A;  2BBN A;  2WC8 A;  1DJG A;  3C1V A;  1MQ1 A;  4OCI A;  1LKJ A;  2LUX A;  5AEQ A;  4U8D A;  2K7C A;  3BUM B;  1B47 A;  2V53 A;  3EKH A;  1NCZ A;  3BOW B;  3O4Y A;  4N1F A;  4JQ0 D;  3ZWH A;  1QTX A;  1WRL A;  2F2P A;  1ZAC A;  1C7V A;  1PVB A;  2K2A A;  1YUT A;  1GGZ A;  1YX7 A;  5AAN A;  3TDI A;  1UHJ A;  3CR4 X;  4CPV A;  3CR2 A;  4MRY A;  1CLM A;  1F70 A;  2KI6 D;  3SJS A;  4NDC A;  1KQM C;  2Y1N A;  4GBA A;  1BU3 A;  1TOP A;  3GK4 X;  1KK8 C;  4M2P A;  1CMG A;  2JT0 A;  2JRF A;  1WDC C;  1CKK A;  1CFP A;  3OB1 B;  1JFK A;  1DTL A;  4BY5 A;  3WXA A;  4YBH B;  1B8L A;  4HRH A;  5JOL A;  2OTG C;  5KU1 A;  2QAC A;  1GGW A;  5TNC A;  1MXE A;  1IH0 A;  5J3X A;  2FCE A;  2KQ6 A;  1B4C A;  5DKR A;  1UUS A;  2I2R E;  1RRO A;  4GNK B;  2F33 A;  1U5I A;  2LVK A;  3VRR A;  2BL0 C;  4HRE E;  1IKU A;  4DIR A;  4OKH A;  3SIB A;  4UPG A;  2M49 B;  3WHT B;  1NUB A;  1YUS A;  1AJ5 A;  3FIA A;  2LLU A;  2WOR A;  5I8N A;  3OX6 A;  1BG1 A;  1DJI A;  1IWQ A;  3DVE A;  4MN0 A;  1ZMZ A;  1B1G A;  1UP5 A;  3O78 A;  2VRG A;  4PE7 A;  2M97 A;  2KAY A;  2M7L A;  2KGB C;  2SAS A;  1QLK A;  3ICB A;  1ALV A;  3JVT C;  2WCB A;  1NCX A;  1KSO A;  1KCY A;  2JXC A;  1KWO B;  1XFX O;  1BMO A;  1VRK A;  3SG6 A;  2L50 A;  4I5N B;  3VGO A;  2D8N A;  1REC A;  1JWD A;  3DD4 A;  2H61 C;  1QVI Z;  1SNL A;  1N2D A;  2KBI A;  1WRZ A;  4PDZ A;  3EVR A;  4YI8 A;  3TZ1 A;  3I5I B;  1F71 A;  4YI9 A;  2BCB A;  2WND A;  2I7A A;  1DJW A;  1KFU S;  5CPV A;  1S1E A;  1MHO A;  2JUL A;  1GQM A;  4GAO A;  1A75 A;  3NXA A;  4DRW A;  3AAJ A;  1R2U A;  1JC2 A;  2MRD A;  1QIW A;  1W7J B;  2EC6 B;  2LP2 A;  3BUN B;  3VRN A;  1H8B A;  2L4H A;  1S36 A;  3BUW B;  1SK6 D;  3KHE A;  4PE4 A;  2GV5 A;  3GOF A;  3SG2 A;  1AUI B;  5HLO A;  2MBX A;  2KGR A;  1YUU A;  3PM8 A;  2M1U A;  5KSZ A;  2KFG A;  3EK8 A;  1KFX S;  2LNK A;  1CLB A;  3NSK A;  1L7Z A;  3CLN A;  1K9K A;  1N0Y A;  2JNX A;  4PHK A;  1MF8 B;  4OR9 B;  2COL B;  1B8R A;  1SCM B;  1NSH A;  1NP8 A;  3AKA A;  1KQM B;  1LA3 A;  1G4Y R;  3SG4 A;  3EVV A;  2PVB A;  1OE9 B;  1WDC B;  2Y5I A;  2ZNE A;  5IBW A;  1WY9 A;  1M39 A;  2CNP A;  1J7R A;  1MXL C;  4MVF A;  4GPL B;  1Y1X A;  2OTG B;  2LAN A;  1TCO B;  5GQQ C;  1DJX A;  3O2P A;  1YRU B;  3F45 A;  3PSR A;  3BUO B;  1LA0 A;  3SG5 A;  5BPJ A;  1H4B A;  3FS7 A;  2LLS A;  1WRK A;  1IQ3 A;  1KK7 Y;  1ZOT B;  4HRG A;  2HQ8 A;  4A4B A;  1JFJ A;  1SL8 A;  2FJU B;  3PN7 C;  1WLZ A;  2KYF A;  3VRQ A;  4MRX A;  4DCK A;  4R1E A;  4USL A;  1QX7 A;  3WHU B;  1DT7 B;  1NX1 A;  2LMU A;  5HLV A;  2FCD A;  2JTT A;  4MSP A;  2Y4Q A;  1K9P A;  4YGB B;  5HKW A;  1LVC D;  2BEC A;  1CM1 A;  1F8H A;  2EC6 C;  3JVT B;  4M2Q A;  2HET A;  2MAZ A;  1SPY A;  1F54 A;  1NIW A;  1S5G Z;  2JT8 A;  4XJK B;  2WCF A;  2L2E A;  3NSI A;  2TN4 A;  4DUQ A;  2O5G A;  5F6T A;  1EJ3 A;  5AFP A;  3TUY C;  2E30 A;  1FW4 A;  2KFH A;  2KBM A;  1EG3 A;  3DVM A;  4WQ3 A;  1S6J A;  5JJG A;  1FF1 A;  1DJZ A;  2E6W A;  3CS1 A;  1CFD A;  1Y6W A;  3LK1 A;  1B9A A;  1G33 A;  1PK0 D;  3EVU A;  3QRX A;  1PSB A;  3RLZ A;  1OOJ A;  3DVJ A;  1WLM A;  5D69 A;  1SCM C;  2NXQ A;  3O6B A;  4WRI A;  2GGZ A;  1M63 B;  2H2K A;  1YX8 A;  1RWY A;  1QXP A;  2KFF A;  1MUX A;  5FYX A;  1OZS A;  2K7O A;  2JU0 A;  1BR1 B;  4I5L B;  1XK4 A;  4PHN A;  1CDN A;  2CCM A;  2LHL A;  3JTD C;  1AHR A;  4IL1 A;  2KOT A;  1RK9 A;  4YGD B;  1BF5 A;  1SY9 A;  1UUR A;  5DKN A;  2MLE C;  1UHK A;  1TNX A;  1CNP A;  1B7T Y;  4OVN F;  5HYD A;  1CMF A;  2LMV A;  4DS7 A;  1K8U A;  2CTN A;  1OMR A;  1OZO A;  1B8C A;  2K61 A;  1D1O A;  1IRJ A;  2L5X B;  1HQV A;  3CTN A;  1K96 A;  2BBM A;  1EH2 A;  4GGF A;  4PAL A;  5CSF A;  1LIN A;  2OS8 C;  2L4I A;  1FBV A;  1S6I A;  3A4U B;  4ORB B;  1JF0 A;  3CZT X;  1K95 A;  1U5I B;  4ICB A;  4HSZ A;  4Q04 A;  1CFF A;  1CM4 A;  1RTP 1;  4MEW A;  1PUL A;  1KFU L;  1PRW A;  1X02 A;  2JWW A;  3AKB A;  2FOT A;  2ZRT A;  1NX3 A;  2LMT A;  3I5H C;  2M7N A;  2Q4U A;  1QV1 A;  1M46 A;  3FWC A;  1AJ4 A;  4MLW A;  1G8I A;  4PHM A;  3BYA A;  4QJ5 B;  1BR4 B;  1QX2 A;  3PN7 B;  4N5X A;  1YVL A;  1J7P A;  1RJV A;  1SBJ A;  3IF7 A;  1IGV A;  1CLL A;  1XFZ O;  1CDL A;  3FWB A;  2KI6 C;  1JF2 A;  3IQQ A;  4GUK A;  2DOQ A;  2KNE A;  1SR6 B;  1XFV O;  3KO0 A;  4D1E A;  1QX5 B;  4YRU A;  3SIA A;  1KFX L;  2K0J A;  2LHI A;  4F0Z B;  3NSO A;  1AK8 A;  2M29 A;  4FQO A;  5AER A;  2F2O A;  1IG5 A;  2ZN8 A;  3D0Y A;  1XFU O;  4ZCV A;  3TUY B;  1BOD A;  1A75 B;  5I2O A;  1R6P A;  2KQY A;  1F4O A;  2O60 A;  1ODB A;  3GK2 A;  1JBA A;  1A29 A;  1S6C A;  1SL7 A;  2WOS A;  2PSR A;  5I2Q A;  4E68 A;  2RGI A;  1FPW A;  1XK4 C;  1XYD A;  2HPS A;  1TNP A;  3LL8 B;  1SYM A;  5KTY A;  3ZNI A;  1OQP A;  1CFC A;  1XFW O;  2PAS A;  1GJY A;  1J7O A;  1FI5 A;  1C7W A;  3TDU A;  2NCO A;  2PRU A;  3EKJ A;  1NX2 A;  2KDH A;  1K9U A;  4GFT A;  1JSA A;  2K2F A;  2KHN A;  3JTD B;  4NQG A;  2K7B A;  2KAV A;  2LVI A;  5D7F A;  3D10 A;  4P2Y B;  1MWN A;  1F4Q A;  1DF0 A;  3BUX B;  1SKT A;  4YGE B;  1IJ5 A;  3DF0 A;  3SG3 A;  3LK0 A;  4CFQ A;  1PVA A;  1SW8 A;  1L2O B;  3EK7 A;  3WNX B;  5CSJ A;  4FTG A;  2Y1M A;  4ZCU A;  1M45 A;  3OP0 A;  2AAO A;  2OS8 B;  4TNC A;  2F3Y A;  2HQW A;  2LC5 A;  3HCM A;  1NX0 A;  4YGA A;  1PAL A;  1OSA A;  3I5G C;  4NDB A;  4CID A;  1SR6 C;  1QLS A;  2BKI B;  4N1G A;  3AAK A;  4I5J A;  1S3P A;  2NZ0 A;  3I5F B;  1QVI Y;  1V1G A;  1UHI A;  2KAX A;  3BXK A;  3I5H B;  4JPZ B;  3PAL A;  1RFJ A;  2CBL A;  1IJ6 A;  1Y1A A;  2JOJ A;  5ER4 X;  4QJ4 B;  1SMG A;  2MLF C;  4MZJ A;  4AQJ A;  1QJT A;  4ORA B;  3BOW A;  1QV0 A;  2LUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...