1F4QA

Crystal structure of apo grancalcin
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
165
structure length
161
Chain Sequence
SVYTYFSAVAGQDGEVDAEELQRCLTQSGINGTYSPFSLETCRIMIAMLDRDHTGKMGFNAFKELWAALNAWKENFMTVDGTVEHHELRQAIGLMGYRLSPQTLTTIVKRYSKNGRIFFDDYVACCVKLRALTDFFKKRDHLQQGSADFIYDDFLQGTMAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords GRANCALCIN
publication title Crystal structure of human grancalcin, a member of the penta-EF-hand protein family.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 161
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1f4qA00
4YGEB 1WLZA 2H61C 2JQ6A 2COLB 3SIBA 2NLNA 3CS1A 1ZMZA 1XK4C 3HX4A 1CM1A 4I5JA 5K89A 1B8LA 2HQWA 1WLMA 1WDCC 2JT3A 3PLFB 3EVUA 1S26D 4OCIA 2L5XB 4OR9B 2ZFDA 3NSOA 3M0WA 4PHMA 5ER4X 3RLZA 1M46A 1R6PA 1S1EA 1RTP1 4WQ2A 1DGVA 4BY4A 5JJGA 1SMGA 2Y1MA 1QASA 1EXRA 1VRKA 1ZFSA 1IQ3A 2NCPA 2KYCA 1QTXA 1PSRA 1WY9A 3KEVA 2KGRA 2KHNA 3CTNA 3TUYC 1KK7Y 2LMVA 2M3WA 2JU0A 1Q80A 2G9BA 1TIZA 2BL0C 1K95A 1BODA 1SL9A 2F2OA 1DJHA 2KI6D 3LL8B 1YUTA 1XFZO 1K2HA 2PRUA 1XFVO 4DUQA 1DJYA 1NX3A 1E8AA 1UHNA 3EKHA 2CBLA 2HPSA 5AANA 2MAZA 4GNKB 1A75A 2L51A 1CDNA 2EC6B 2LM5A 2PVBA 1CTRA 2SASA 4NQGA 1CM4A 1DGUA 1FF1A 3TDUA 3PN7B 1CB1A 2LVVA 1N65A 2PASA 3BXKA 4P2YB 1ZACA 3NSIA 1PULA 2Q4UA 1TNPA 3WNXB 4GGFC 2MA2A 2F2PA 3VRQA 5FYXA 4FQOA 2KSPA 4MZKA 5KSZA 3HCMA 2BCXA 4MBEA 1NP8A 2KQ6A 1IRJA 5CSIA 1S5GY 3IQQA 1SBJA 2CNPA 2ZRTA 1ALVA 1KQMC 3KO0A 1UWOA 1KK8C 1PK0D 1K96A 2K7DA 3EKJA 1JFJA 2QACA 1QJTA 4MVFA 3CR5X 3NSKA 3EVRA 1F71A 1B9AA 2LNKA 1RROA 1LA3A 4DCKA 1OZSA 2F33A 2M7NA 2KFFA 2KI6C 1PVAA 2KI4C 3OX5A 1EG4A 1UHHA 1G4YR 4U8DA 4MZLA 5CSNA 3DF0B 4YI9A 1CKKA 2ZRSA 3VROA 1L7ZA 3FIAA 1J7QA 4CIDA 1PRWA 4CPVA 3JTDC 1BR1B 3QRXA 4CFQA 3CLNA 4ORCB 4Q04A 4PHJA 5AERA 5KU1A 4L9MA 1NX1A 1BMOA 1SNLA 2F8PA 4WQ3A 4N1FA 2BKIB 2K7CA 3SIAA 1AK8A 2CCMA 1J7PA 2WC8A 1AHRA 5F6TA 4A4CA 1LA0A 3EK4A 2LLUA 1TN4A 2LC5A 2LUXA 4C0LA 3SG5A 3OX6A 2KBMA 4YI8A 3ZWHA 2BE4A 2SCPA 5AXIA 1C7VA 1U5IA 4OVNF 2EGDA 3F45A 3PFVA 1QVIZ 1SYMA 3PATA 4JWQA 5HKYA 1IG5A 3CZTX 2TN4A 4ZCUA 2M1KB 1K93D 2JTTA 1K90D 1EJ3A 1KWOC 1F4QA 1NPQA 1FI6A 2KQYA 1U5IB 3OB1B 4HRHA 1J1DA 3I5FC 2Y4QA 1SK6D 2MJWB 1GGZA 3DVKA 4PE4A 1TTXA 3DVJA 3CR2A 4HREE 4ORAB 4DRWA 1NCYA 3VRRA 3FWCA 2L2EA 1Y6WA 2EHBA 4JQ0D 1CLMA 1QLKA 2KAYA 4PHKA 2LCPA 2V53A 1ALWA 1B4CA 2K61A 5HLOA 1L2OB 2WORA 4UPGA 1J7OA 1JC2A 3I5IB 1CLBA 1PVBA 3DD4A 1QATA 2BBNA 2KAXA 3EVVA 3SG2A 4GUKA 1F70A 5B8IB 1XFYO 3BOWB 2L0PA 2LLTA 5BPJA 2K8MB 1LKJA 1B1GA 3FS7A 2KDHA 2LVKA 1PALA 1Y1AA 3E3RA 2BE6A 1YRTB 1B8CA 4F0ZB 3OHMB 1OZOA 4PE1A 1CLLA 1NX0A 3WHTB 1YUSA 2GGZA 1W7JB 3GK1A 4GPLB 4OV2A 2K2FA 3TS5B 2HF5A 4IL1A 1XO5A 4XJKB 3VRNA 1ZUZA 5G08A 2EC6C 4GAOA 4D1EA 1IJ5A 2MHHA 1AJ5A 1RECA 2JZIA 3BUXB 1MR8A 2M29A 2LMTA 2K2AA 3PN7C 1AVSA 2KOTA 3BUWB 2JTZA 3I5HB 1CMFA 1H4BA 4YBHB 1S6CA 3I5GB 5PALA 2G2BA 2CXJA 2LV7A 5GQQC 1IKUA 3D0YB 1DMOA 2ZN9A 2M1UA 2AMIA 1QVIY 1AUIB 4M2OA 1NYAA 1KCYA 1QX2A 1V1GA 2Q91A 1N2DA 1GGWA 1MHOA 5I8NA 5IBWA 5HYDA 2OS8B 3C1VA 2WNDA 3DF0A 1KSMA 1TRFA 4AQJA 1BLQA 2BCBA 4PALA 2GGMA 1CFFA 5I2LA 1PSBA 3EK7A 4YGDB 4WRIA 5DKQA 2A4JA 3EK8A 4PHNA 4YRUA 1B47A 3BUMB 2MBXA 1MF8B 4C0JA 2F3YA 4CLNA 1CDMA 1KSOA 2KAVA 3O4YA 1XA5A 4MEWA 1OE9B 2PALA 1LXFC 1SPYA 2FCEA 4MZJA 2KNEA 1X02A 5D69A 1QIVA 3SG6A 1SCVA 1K9PA 3VGOA 1QXPA 2JNXA 1W7IB 3O2PA 4XYNA 4ZCVA 4ICBA 4PE0A 3SG7A 3PM8A 1ODBA 1SW8A 1K8UA 1YUUA 1UP5A 1IQ5A 1OMRA 2GV5A 4MRXA 2P6BB 1BF5A 1HQVA 1GJYA 3IQOA 1SL8A 3KPXA 1NCXA 1XYDA 3LK1A 3GK2A 1JWDA 1KFUL 2KFHA 4CFRA 2MLFC 1RK9A 1QV0A 1QS7A 3AAJA 3LCPC 1F54A 1Y1UA 1YR5A 4M2PA 5ER5A 2CTNA 5TNCA 1DJIA 2KBIA 2KFGA 3A4UB 5I2OA 2O5GA 3TZ1A 2M49B 1QV1A 1DF0A 3WXAA 4AQIA 1QX5B 1HT9A 1SR6B 1SY9A 2I18A 2L4IA 2WCBA 1NUBA 1A29A 1BG1A 5JOLA 3ZNIA 4I5LB 4TNCA 4C0KA 2DOQA 1TOPA 1S6IA 2B1UA 1D1OA 1EH2A 3JVTB 2LLSA 1N0YA 4NDDA 4GFTA 2R2IA 1DJGA 1QIWA 1DF0B 4YGBB 1UHKA 2JXLA 1KFXL 1BR4B 4MRYA 4N5XA 2I7AA 4JPZB 2O60A 1NX2A 2ZNEA 3NXAA 2BBMA 2I94A 1CFDA 3BOWA 1DJZA 1J55A 3A8RA 4PE7A 1XK4A 4NDCA 2OTGB 1MWNA 3BYAA 1L2OC 1MUXA 2JOJA 2E30A 2WCFA 1IH0A 1KFUS 3I5IC 2OPOA 3D10A 1C07A 1JF2A 2LVJA 1V1FA 1G8IA 1UUSA 1OMVA 1WDCB 2FJUB 3BUOB 1K9UA 4N1GA 2Y1NA 1WRLA 2JPTA 1UURA 1M45A 4I5KA 4DS7A 2Y5IA 4XJKA 2K7BA 1LVCD 1NCZA 1MQ1A 1XFWO 2D8NA 3IF7A 4NDBA 2KYFA 4PCWA 4AOMA 2FOTA 2CT9A 1OOJA 1TCFA 3OP0A 1RWYA 1CMGA 4I5NB 4HRGA 3CR4X 5HLVA 4GBAA 5AEQA 1A03A 1KFXS 2RGIA 3K21A 2LE9B 3KF9A 1IWQA 1SCMB 2BECA 3TS5C 1YVLA 4GGNA 3WHUB 3PSRA 1MXLC 2JULA 3O6BA 1SCMC 1WRKA 2K0JA 3H4SE 2MRDA 3TDZA 3RM1A 3D0YA 4HSZA 1S6JA 2L98A 3TUYB 1NIWA 2M0RA 2ZKMX 1MXEA 1XFXO 4P5OE 1TNQA 1B7TY 1JF0A 2NXQA 1S36A 2BL0B 2MLEC 2PMYA 3SJSA 5DKRA 2ZN8A 4PDZA 2HQ8A 1AJ4A 1OSAA 3AKBA 3I5HC 5AFPA 1M31A 2JNFA 1K94A 5CSJA 4ETOA 2JC2A 3DVMA 2NCOA 1BT6A 2IS9A 3I5GC 4GGFA 1F8HA 5KTYA 1M63B 3FWBA 2BCAA 4M2QA 5CSFA 2E6WA 1YX7A 1DT7B 1FW4A 2OS8C 1QLSA 2F3ZA 2JT8A 2JWWA 2WCEA 3AKAA 1DJXA 1XFUO 4E68A 1NWDA 5DKNA 2L4HA 3DVEA 2LP3A 2JT0A 1A75B 3ICBA 5HKWA 1J7RA 2PSRA 1YX8A 2VRGA 3GK4X 2I2RE 3BUNB 4BY5A 1J1EA 2BKHB 4OKHA 1RFJA 1JFKA 1EL4A 1H8BA 3OB2B 1SKTA 1GQMA 1M39A 1WRZA 1KQMB 1QX7A 1KQVA 1KK8B 4FTGA 1IGVA 2QPTA 1JUOA 2AUCA 1YTZC 2KGBC 1CFCA 3LLEA 2LMUA 1CDPA 3NSLA 1JSAA 1TNWA 1Y0VH 2KI4B 2M97A 1XVJA 3LK0A 2HETA 1B7TZ 1KK7Z 4QJ3B 3TDIA 2LAPA 1EG3A 1ZOTB 1CDLA 1SL7A 3JTDB 4YGAA 2M9GA 1S3PA 1AP4A 1FPWA 2LVIA 5I2QA 1TCOB 2FCDA 1BU3A 1G33A 4QJ5B 1YVHA 1OQPA 1YRUB 1DVIA 3CGAA 3O78A 2K7OA 1FI5A 4USLA 1YURA 1RJVA 5D7FA 4R1EA 1SR6C 4MN0A 1JBAA 3KHEA 1IJ6A 4ORBB 1CNPA 3SG4A 2LANA 2AAOA 5CPVA 1DTLA 3AAKA 4A4BA 1Y1XA 1C7WA 1UHJA 1F4OA 2JXCA 4MLWA 1UHIA 2L50A 2LP2A 5HKZA 3JVTC 1TNXA 3VRPA 1A2XA 4MSPA 1BOCA 3PALA 2LHLA 2WOSA 1CFPA 1K9KA 1A4PA 3BQ3A 2ISDA 1F55A 5J3XA 3CWGA 1B8RA 2H61A 2M8UA 4DIRA 1FBVA 2NZ0A 3SG3A 2ZNDA 1DJWA 1R2UA 2M7LA 1LINA 1SRAA 4QJ4B 1KWOB 2OTGC 1S5GZ 2JRFA 1BJFA 2LHIA 1NSHA 1OMDA 2H2KA 3GOFA 3I5FB 3MSEB 2LUCA 4YGCB
chains in the Genus database with same CATH superfamily
1Z2CB 1WLZA 2H61C 2JQ6A 3R1PA 2COLB 4YGEB 3SIBA 2NLNA 3CS1A 1ZMZA 1XK4C 3HX4A 1CM1A 4I5JA 5K89A 1B8LA 2HQWA 1WLMA 1WDCC 3D73A 2JT3A 3PLFB 3EVUA 1S26D 4OCIA 2L5XB 4OR9B 3FE6A 2ZFDA 3B88A 3NSOA 3M0WA 4PHMA 5ER4X 3RLZA 1W9ZA 1M46A 1R6PA 1S1EA 1RTP1 4WQ2A 3O4XA 1DGVA 4BY4A 5JJGA 2ERBA 1SMGA 2Y1MA 1QASA 1EXRA 1VRKA 1ZFSA 1IQ3A 2NCPA 2KYCA 1QTXA 1PSRA 1WY9A 3KEVA 2KGRA 4FQTA 2KHNA 3D76A 3CTNA 3TUYC 1KK7Y 2LMVA 2M3WA 2JU0A 4INXA 1TWOA 1Q80A 2G9BA 1TIZA 3B7AA 1K95A 2BL0C 1BODA 1SL9A 2F2OA 1DJHA 2KI6D 3LL8B 1YUTA 1XFZO 1K2HA 2PRUA 1XFVO 2P70A 3BFAA 2PYQA 4DUQA 1DJYA 1NX3A 1E8AA 1UHNA 3EKHA 2CBLA 2HPSA 5AANA 2MAZA 3V2LA 4GNKB 3SS5A 1A75A 2L51A 1CDNA 2EC6B 2LM5A 2PVBA 1CTRA 2SASA 4NQGA 2WCLA 1CM4A 1DGUA 3FE9A 1GM0A 3DXLA 3OGNA 1FF1A 2QEOA 3TDUA 3PN7B 1CB1A 2LVVA 1N65A 2PASA 3BXKA 4P2YB 1ZACA 1Z4HA 3NSIA 1PULA 2Q4UA 1TNPA 3WNXB 4GGFC 2MA2A 2F2PA 3BFBA 3L47A 2P71A 3CZ1A 1TUJA 3VRQA 5FYXA 1IIOA 4FQOA 2KSPA 5DICA 4MZKA 5KSZA 3HCMA 3PM2A 2BCXA 4MBEA 1NP8A 3D77A 2KQ6A 3S0DA 1IRJA 5CSIA 3PJIA 1S5GY 3IQQA 3S0GA 1SBJA 2CNPA 2ZRTA 1ALVA 1KQMC 3KO0A 1UWOA 3NGVA 1KK8C 1PK0D 1K96A 2K7DA 3EKJA 1JFJA 2QACA 1QJTA 4MVFA 3CR5X 3NSKA 3EVRA 1F71A 1B9AA 2LNKA 1OOGA 1RROA 1LA3A 3S0AA 4DCKA 1OZSA 2F33A 2M7NA 2KFFA 5I94A 3NHTA 2KI6C 1PVAA 2KI4C 3OX5A 1EG4A 1UHHA 1G4YR 3DYEA 4U8DA 2QEBA 3DZTA 4INWA 3DF0B 4MZLA 4YI9A 5CSNA 1CKKA 2ZRSA 3VROA 1L7ZA 3FIAA 1J7QA 4CIDA 3UNWA 5HL1A 1PRWA 4CPVA 3JTDC 1BR1B 3QRXA 4CFQA 3CLNA 2WCMA 3QMEA 4ORCB 4PHJA 4Q04A 5AERA 5KU1A 4L9MA 2KPHA 1NX1A 1BMOA 1SNLA 2F8PA 4WQ3A 4N1FA 3B86A 2BKIB 2K7CA 5FI7A 3SIAA 2CCMA 1AK8A 1J7PA 2WC8A 1AHRA 1OOFA 5F6TA 4A4CA 1LA0A 3EK4A 2LLUA 1TN4A 2LC5A 2LUXA 4C0LA 3SG5A 2K60A 3OX6A 3R1OA 2KBMA 4YI8A 3ZWHA 2BE4A 2SCPA 5AXIA 1C7VA 1U5IA 4OVNF 4IJ7A 2EGDA 3F45A 3PFVA 1QVIZ 1SYMA 3PATA 4JWQA 5HKYA 1IG5A 3CZTX 2TN4A 4ZCUA 2M1KB 1K93D 2JTTA 1K90D 2GTEA 1EJ3A 3RZSA 1KWOC 1F4QA 1NPQA 1FI6A 2KQYA 1U5IB 3OB1B 4HRHA 1J1DA 3I5FC 2Y4QA 1SK6D 3BJHA 5D3OA 2MJWB 1GGZA 3DVKA 4PE4A 2WCJA 1TTXA 3DVJA 3CR2A 4HREE 4ORAB 4DRWA 1NCYA 1LS8A 3VRRA 3FWCA 2L2EA 1Y6WA 2EHBA 4JQ0D 1CLMA 1QLKA 2KAYA 4PHKA 2LCPA 2V53A 1ALWA 1T14A 1B4CA 2K61A 5HLOA 1L2OB 2WORA 4UPGA 3N7HA 1J7OA 1JC2A 3I5IB 3S0FA 1CLBA 1PVBA 3DD4A 1QATA 2BBNA 2KAXA 3EVVA 3SG2A 4GUKA 1F70A 5B8IB 1XFYO 3BOWB 2L0PA 2LLTA 3B6XA 2K8MB 1LKJA 5BPJA 1B1GA 3FS7A 2KDHA 2LVKA 1PALA 1Y1AA 3E3RA 2BE6A 2PQLA 1DEKA 1YRTB 3Q8IA 1B8CA 4F0ZB 3OHMB 1OZOA 4PE1A 1CLLA 1NX0A 3WHTB 1YUSA 2GGZA 1W7JB 3GK1A 4GPLB 4OV2A 2YGUA 2K2FA 3TS5B 2HF5A 4IL1A 1XO5A 4XJKB 3DY9A 3VRNA 3NHIA 1ZUZA 1P28A 5G08A 2EC6C 4GAOA 2H8VA 4D1EA 1IJ5A 2MHHA 1AJ5A 1RECA 2JZIA 3BUXB 1MR8A 2M29A 2LMTA 2K2AA 1OW4A 3PN7C 1AVSA 3S0BA 2KOTA 3BUWB 2JTZA 3I5HB 1CMFA 5FI2A 1H4BA 4YBHB 1S6CA 3I5GB 5PALA 2G2BA 2CXJA 2LV7A 5GQQC 1IKUA 3D0YB 1DMOA 2ZN9A 2M1UA 2AMIA 1QVIY 1AUIB 4M2OA 1NYAA 1KCYA 1QX2A 1V1GA 2Q91A 1N2DA 3R72A 1MHOA 1GGWA 2L2CA 5I8NA 5IBWA 5HYDA 2OS8B 3B87A 3C1VA 2WNDA 3DF0A 1KSMA 1TRFA 4KYNA 3D75A 4AQJA 1BLQA 3UO9A 3CYZA 2BCBA 4PALA 2GGMA 1CFFA 3K1EA 5I2LA 1PSBA 3EK7A 4YGDB 4WRIA 5DKQA 2A4JA 3EK8A 4PHNA 4YRUA 1B47A 3BUMB 2MBXA 1MF8B 4C0JA 2F3YA 4CLNA 1CDMA 1KSOA 2KAVA 3O4YA 1XA5A 4MEWA 1OE9B 2PALA 1LXFC 1SPYA 2FCEA 4MZJA 2KNEA 1X02A 5D69A 1QIVA 3SG6A 1SCVA 1K9PA 5EL2A 3VGOA 1QXPA 2JNXA 1W7IB 3O2PA 4XYNA 4ZCVA 4ICBA 4PE0A 3SG7A 3PM8A 1ODBA 1SW8A 1K8UA 1YUUA 4F7FA 1UP5A 1IQ5A 1OMRA 2GV5A 4MRXA 2P6BB 1BF5A 1HQVA 1GJYA 1OOHA 1SL8A 3IQOA 3CDNA 3KPXA 1NCXA 1XYDA 3LK1A 3GK2A 1JWDA 2WCHA 1KFUL 2KFHA 4CFRA 2MLFC 1RK9A 1QV0A 1QS7A 3AAJA 3LCPC 3S0EA 1Y1UA 1YR5A 4M2PA 5ER5A 1F54A 2CTNA 5TNCA 1DJIA 2KBIA 2KFGA 3A4UB 5I2OA 2O5GA 3TZ1A 2M49B 1QV1A 1DF0A 3WXAA 4AQIA 1QX5B 1HT9A 1SR6B 1SY9A 2I18A 2L4IA 2WCBA 1NUBA 1A29A 1BG1A 5JOLA 3ZNIA 4I5LB 2FJYA 4TNCA 2DOQA 4C0KA 1TOPA 1S6IA 2B1UA 1D1OA 1EH2A 3JVTB 2LLSA 1N0YA 1TUZA 4NDDA 3CABA 2R2IA 4GFTA 1DJGA 1QIWA 1DF0B 4YGBB 1UHKA 2JXLA 1KFXL 1BR4B 3OBVA 4MRYA 4N5XA 2I7AA 4JPZB 2O60A 1NX2A 2ZNEA 3NXAA 2BAPA 2BBMA 2I94A 1CFDA 3BOWA 1DJZA 1J55A 3A8RA 4JKTA 4PE7A 1XK4A 3EG5B 4NDCA 2OTGB 1MWNA 3BYAA 1L2OC 1MUXA 2JOJA 3BFHA 4PT1A 3IVTA 2KLEA 2E30A 2WCFA 1IH0A 1KFUS 3D78A 3I5IC 2OPOA 2WC6A 3D10A 1C07A 1JF2A 2LVJA 1V1FA 1UUSA 1G8IA 1OMVA 1WDCB 2FJUB 3BUOB 1K9UA 4N1GA 2Y1NA 1WRLA 2JPTA 1UURA 1M45A 4I5KA 4DS7A 2Y5IA 4XJKA 2K7BA 1LVCD 1NCZA 1MQ1A 1XFWO 2D8NA 3IF7A 3L4AA 4NDBA 2KYFA 4PCWA 4AOMA 2FOTA 2CT9A 1OOJA 1TCFA 3OP0A 1RWYA 1CMGA 4I5NB 4HRGA 3CR4X 5HLVA 4GBAA 5AEQA 1A03A 1KFXS 2RGIA 3K21A 2LE9B 3KF9A 1IWQA 1SCMB 2BECA 3TS5C 1YVLA 4GGNA 3WHUB 3PSRA 1MXLC 2JULA 3O6BA 1SCMC 1WRKA 2K0JA 3H4SE 2MRDA 3TDZA 3RM1A 3D0YA 4HSZA 1S6JA 2L98A 3TUYB 1NIWA 2M0RA 2ZKMX 1MXEA 1XFXO 4P5OE 1TNQA 2QDIA 4OZDA 1B7TY 1JF0A 3R1VA 2NXQA 1S36A 2BL0B 2MLEC 2PMYA 3SJSA 5DKRA 2ZN8A 4PDZA 1XFRA 2HQ8A 1AJ4A 1OSAA 3AKBA 3I5HC 5AFPA 1M31A 2JNFA 1K94A 2JPOA 5CSJA 2JC2A 3DVMA 4ETOA 2NCOA 1BT6A 2IS9A 3I5GC 4GGFA 1F8HA 5KTYA 2WCKA 1M63B 3D74A 3FWBA 2BCAA 4M2QA 5CSFA 2E6WA 1YX7A 1DT7B 1FW4A 2OS8C 2L5YA 1QLSA 2F3ZA 2JT8A 2JWWA 2WCEA 3AKAA 1DJXA 1XFUO 4E68A 1NWDA 5DKNA 1QWVA 2L4HA 1DELA 3DVEA 2LP3A 2JT0A 1A75B 3ICBA 5HKWA 1J7RA 2PSRA 1YX8A 2VRGA 3GK4X 2I2RE 3BUNB 5FI6A 4BY5A 1J1EA 2BKHB 1C3ZA 4OKHA 1RFJA 1JFKA 1EL4A 1H8BA 3OB2B 1C3YA 1SKTA 1GQMA 1OOIX 1M39A 1WRZA 3FE8A 3CZ0A 1KQMB 1QX7A 1KQVA 1KK8B 4FTGA 1IGVA 2QPTA 1JUOA 2AUCA 1YTZC 2KGBC 1CFCA 3LLEA 2LMUA 1CDPA 3NSLA 1JSAA 1TNWA 1Y0VH 2KI4B 2M97A 2BNXA 1XVJA 3VB1A 3LK0A 2HETA 1B7TZ 1KK7Z 4QJ3B 3TDIA 2LAPA 1EG3A 3L4LA 2KLDA 1ZOTB 1CDLA 1SL7A 3JTDB 4YGAA 2M9GA 1S3PA 1AP4A 1FPWA 2LVIA 5I2QA 1TCOB 2FCDA 1BU3A 1G33A 4QJ5B 1YVHA 1OQPA 1YRUB 1DVIA 3CGAA 3O78A 2K7OA 1FI5A 4USLA 2WC5A 2QEHA 1YURA 1RJVA 5D7FA 3CZ2A 4R1EA 4JD9A 1SR6C 4MN0A 1JBAA 3KHEA 1IJ6A 4ORBB 1CNPA 3SG4A 2LANA 2AAOA 5CPVA 1DTLA 3AAKA 4A4BA 1ORGA 1Y1XA 1C7WA 1UHJA 1F4OA 1SSEB 2JXCA 4MLWA 1UHIA 2L50A 2LP2A 5HKZA 3JVTC 1TNXA 3VRPA 1A2XA 4MSPA 1BOCA 2QEVA 2LHLA 2WOSA 3PALA 1CFPA 1K9KA 1A4PA 3BQ3A 2ISDA 1F55A 5J3XA 3CWGA 1B8RA 2H61A 2M8UA 4DIRA 1FBVA 2NZ0A 3SG3A 2ZNDA 1DJWA 1R2UA 2M7LA 1LINA 1SRAA 1DC1A 4QJ4B 1KWOB 2OTGC 1S5GZ 1DQEA 2JRFA 1BJFA 3SS4A 2LHIA 1NSHA 1OMDA 2H2KA 3GOFA 3I5FB 3MSEB 2LUCA 3SS3A 4YGCB
chains in the Genus database with same CATH topology
4YGEB 1WLZA 2H61C 2JQ6A 2COLB 3SIBA 2NLNA 3CS1A 1ZMZA 1XK4C 3HX4A 1CM1A 4I5JA 5K89A 1B8LA 2HQWA 1WLMA 1WDCC 2JT3A 3PLFB 3EVUA 1S26D 4OCIA 2L5XB 4OR9B 2ZFDA 3NSOA 3M0WA 4PHMA 5ER4X 3RLZA 1M46A 1R6PA 1S1EA 1RTP1 4WQ2A 1DGVA 4BY4A 5JJGA 1SMGA 2Y1MA 1QASA 1EXRA 1VRKA 1ZFSA 1IQ3A 2NCPA 2KYCA 1QTXA 1PSRA 1WY9A 3KEVA 2KGRA 2KHNA 3CTNA 3TUYC 1KK7Y 2LMVA 2M3WA 2JU0A 1Q80A 2G9BA 1TIZA 2BL0C 1K95A 1BODA 1SL9A 2F2OA 1DJHA 2KI6D 3LL8B 1YUTA 1XFZO 1K2HA 2PRUA 1XFVO 4DUQA 1DJYA 1NX3A 1E8AA 1UHNA 3EKHA 2CBLA 2HPSA 5AANA 2MAZA 4GNKB 1A75A 2L51A 1CDNA 2EC6B 2LM5A 2PVBA 1CTRA 2SASA 4NQGA 1CM4A 1DGUA 1FF1A 3TDUA 3PN7B 1CB1A 2LVVA 1N65A 2PASA 3BXKA 4P2YB 1ZACA 3NSIA 1PULA 2Q4UA 1TNPA 3WNXB 4GGFC 2MA2A 2F2PA 3VRQA 5FYXA 4FQOA 2KSPA 4MZKA 5KSZA 3HCMA 2BCXA 4MBEA 1NP8A 2KQ6A 1IRJA 5CSIA 1S5GY 3IQQA 1SBJA 2CNPA 2ZRTA 1ALVA 1KQMC 3KO0A 1UWOA 1KK8C 1PK0D 1K96A 2K7DA 3EKJA 1JFJA 2QACA 1QJTA 4MVFA 3CR5X 3NSKA 3EVRA 1F71A 1B9AA 2LNKA 1RROA 1LA3A 4DCKA 1OZSA 2F33A 2M7NA 2KFFA 2KI6C 1PVAA 2KI4C 3OX5A 1EG4A 1UHHA 1G4YR 4U8DA 4MZLA 5CSNA 3DF0B 4YI9A 1CKKA 2ZRSA 3VROA 1L7ZA 3FIAA 1J7QA 4CIDA 1PRWA 4CPVA 3JTDC 1BR1B 3QRXA 4CFQA 3CLNA 4ORCB 4Q04A 4PHJA 5AERA 5KU1A 4L9MA 1NX1A 1BMOA 1SNLA 2F8PA 4WQ3A 4N1FA 2BKIB 2K7CA 3SIAA 1AK8A 2CCMA 1J7PA 2WC8A 1AHRA 5F6TA 4A4CA 1LA0A 3EK4A 2LLUA 1TN4A 2LC5A 2LUXA 4C0LA 3SG5A 3OX6A 2KBMA 4YI8A 3ZWHA 2BE4A 2SCPA 5AXIA 1C7VA 1U5IA 4OVNF 2EGDA 3F45A 3PFVA 1QVIZ 1SYMA 3PATA 4JWQA 5HKYA 1IG5A 3CZTX 2TN4A 4ZCUA 2M1KB 1K93D 2JTTA 1K90D 1EJ3A 1KWOC 1F4QA 1NPQA 1FI6A 2KQYA 1U5IB 3OB1B 4HRHA 1J1DA 3I5FC 2Y4QA 1SK6D 2MJWB 1GGZA 3DVKA 4PE4A 1TTXA 3DVJA 3CR2A 4HREE 4ORAB 4DRWA 1NCYA 3VRRA 3FWCA 2L2EA 1Y6WA 2EHBA 4JQ0D 1CLMA 1QLKA 2KAYA 4PHKA 2LCPA 2V53A 1ALWA 1B4CA 2K61A 5HLOA 1L2OB 2WORA 4UPGA 1J7OA 1JC2A 3I5IB 1CLBA 1PVBA 3DD4A 1QATA 2BBNA 2KAXA 3EVVA 3SG2A 4GUKA 1F70A 5B8IB 1XFYO 3BOWB 2L0PA 2LLTA 5BPJA 2K8MB 1LKJA 1B1GA 3FS7A 2KDHA 2LVKA 1PALA 1Y1AA 3E3RA 2BE6A 1YRTB 1B8CA 4F0ZB 3OHMB 1OZOA 4PE1A 1CLLA 1NX0A 3WHTB 1YUSA 2GGZA 1W7JB 3GK1A 4GPLB 4OV2A 2K2FA 3TS5B 2HF5A 4IL1A 1XO5A 4XJKB 3VRNA 1ZUZA 5G08A 2EC6C 4GAOA 4D1EA 1IJ5A 2MHHA 1AJ5A 1RECA 2JZIA 3BUXB 1MR8A 2M29A 2LMTA 2K2AA 3PN7C 1AVSA 2KOTA 3BUWB 2JTZA 3I5HB 1CMFA 1H4BA 4YBHB 1S6CA 3I5GB 5PALA 2G2BA 2CXJA 2LV7A 5GQQC 1IKUA 3D0YB 1DMOA 2ZN9A 2M1UA 2AMIA 1QVIY 1AUIB 4M2OA 1NYAA 1KCYA 1QX2A 1V1GA 2Q91A 1N2DA 1GGWA 1MHOA 5I8NA 5IBWA 5HYDA 2OS8B 3C1VA 2WNDA 3DF0A 1KSMA 1TRFA 4AQJA 1BLQA 2BCBA 4PALA 2GGMA 1CFFA 5I2LA 1PSBA 3EK7A 4YGDB 4WRIA 5DKQA 2A4JA 3EK8A 4PHNA 4YRUA 1B47A 3BUMB 2MBXA 1MF8B 4C0JA 2F3YA 4CLNA 1CDMA 1KSOA 2KAVA 3O4YA 1XA5A 4MEWA 1OE9B 2PALA 1LXFC 1SPYA 2FCEA 4MZJA 2KNEA 1X02A 5D69A 1QIVA 3SG6A 1SCVA 1K9PA 3VGOA 1QXPA 2JNXA 1W7IB 3O2PA 4XYNA 4ZCVA 4ICBA 4PE0A 3SG7A 3PM8A 1ODBA 1SW8A 1K8UA 1YUUA 1UP5A 1IQ5A 1OMRA 2GV5A 4MRXA 2P6BB 1BF5A 1HQVA 1GJYA 3IQOA 1SL8A 3KPXA 1NCXA 1XYDA 3LK1A 3GK2A 1JWDA 1KFUL 2KFHA 4CFRA 2MLFC 1RK9A 1QV0A 1QS7A 3AAJA 3LCPC 1F54A 1Y1UA 1YR5A 4M2PA 5ER5A 2CTNA 5TNCA 1DJIA 2KBIA 2KFGA 3A4UB 5I2OA 2O5GA 3TZ1A 2M49B 1QV1A 1DF0A 3WXAA 4AQIA 1QX5B 1HT9A 1SR6B 1SY9A 2I18A 2L4IA 2WCBA 1NUBA 1A29A 1BG1A 5JOLA 3ZNIA 4I5LB 4TNCA 4C0KA 2DOQA 1TOPA 1S6IA 2B1UA 1D1OA 1EH2A 3JVTB 2LLSA 1N0YA 4NDDA 4GFTA 2R2IA 1DJGA 1QIWA 1DF0B 4YGBB 1UHKA 2JXLA 1KFXL 1BR4B 4MRYA 4N5XA 2I7AA 4JPZB 2O60A 1NX2A 2ZNEA 3NXAA 2BBMA 2I94A 1CFDA 3BOWA 1DJZA 1J55A 3A8RA 4PE7A 1XK4A 4NDCA 2OTGB 1MWNA 3BYAA 1L2OC 1MUXA 2JOJA 2E30A 2WCFA 1IH0A 1KFUS 3I5IC 2OPOA 3D10A 1C07A 1JF2A 2LVJA 1V1FA 1G8IA 1UUSA 1OMVA 1WDCB 2FJUB 3BUOB 1K9UA 4N1GA 2Y1NA 1WRLA 2JPTA 1UURA 1M45A 4I5KA 4DS7A 2Y5IA 4XJKA 2K7BA 1LVCD 1NCZA 1MQ1A 1XFWO 2D8NA 3IF7A 4NDBA 2KYFA 4PCWA 4AOMA 2FOTA 2CT9A 1OOJA 1TCFA 3OP0A 1RWYA 1CMGA 4I5NB 4HRGA 3CR4X 5HLVA 4GBAA 5AEQA 1A03A 1KFXS 2RGIA 3K21A 2LE9B 3KF9A 1IWQA 1SCMB 2BECA 3TS5C 1YVLA 4GGNA 3WHUB 3PSRA 1MXLC 2JULA 3O6BA 1SCMC 1WRKA 2K0JA 3H4SE 2MRDA 3TDZA 3RM1A 3D0YA 4HSZA 1S6JA 2L98A 3TUYB 1NIWA 2M0RA 2ZKMX 1MXEA 1XFXO 4P5OE 1TNQA 1B7TY 1JF0A 2NXQA 1S36A 2BL0B 2MLEC 2PMYA 3SJSA 5DKRA 2ZN8A 4PDZA 2HQ8A 1AJ4A 1OSAA 3AKBA 3I5HC 5AFPA 1M31A 2JNFA 1K94A 5CSJA 4ETOA 2JC2A 3DVMA 2NCOA 1BT6A 2IS9A 3I5GC 4GGFA 1F8HA 5KTYA 1M63B 3FWBA 2BCAA 4M2QA 5CSFA 2E6WA 1YX7A 1DT7B 1FW4A 2OS8C 1QLSA 2F3ZA 2JT8A 2JWWA 2WCEA 3AKAA 1DJXA 1XFUO 4E68A 1NWDA 5DKNA 2L4HA 3DVEA 2LP3A 2JT0A 1A75B 3ICBA 5HKWA 1J7RA 2PSRA 1YX8A 2VRGA 3GK4X 2I2RE 3BUNB 4BY5A 1J1EA 2BKHB 4OKHA 1RFJA 1JFKA 1EL4A 1H8BA 3OB2B 1SKTA 1GQMA 1M39A 1WRZA 1KQMB 1QX7A 1KQVA 1KK8B 4FTGA 1IGVA 2QPTA 1JUOA 2AUCA 1YTZC 2KGBC 1CFCA 3LLEA 2LMUA 1CDPA 3NSLA 1JSAA 1TNWA 1Y0VH 2KI4B 2M97A 1XVJA 3LK0A 2HETA 1B7TZ 1KK7Z 4QJ3B 3TDIA 2LAPA 1EG3A 1ZOTB 1CDLA 1SL7A 3JTDB 4YGAA 2M9GA 1S3PA 1AP4A 1FPWA 2LVIA 5I2QA 1TCOB 2FCDA 1BU3A 1G33A 4QJ5B 1YVHA 1OQPA 1YRUB 1DVIA 3CGAA 3O78A 2K7OA 1FI5A 4USLA 1YURA 1RJVA 5D7FA 4R1EA 1SR6C 4MN0A 1JBAA 3KHEA 1IJ6A 4ORBB 1CNPA 3SG4A 2LANA 2AAOA 5CPVA 1DTLA 3AAKA 4A4BA 1Y1XA 1C7WA 1UHJA 1F4OA 2JXCA 4MLWA 1UHIA 2L50A 2LP2A 5HKZA 3JVTC 1TNXA 3VRPA 1A2XA 4MSPA 1BOCA 3PALA 2LHLA 2WOSA 1CFPA 1K9KA 1A4PA 3BQ3A 2ISDA 1F55A 5J3XA 3CWGA 1B8RA 2H61A 2M8UA 4DIRA 1FBVA 2NZ0A 3SG3A 2ZNDA 1DJWA 1R2UA 2M7LA 1LINA 1SRAA 4QJ4B 1KWOB 2OTGC 1S5GZ 2JRFA 1BJFA 2LHIA 1NSHA 1OMDA 2H2KA 3GOFA 3I5FB 3MSEB 2LUCA 4YGCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YGE B;  1WLZ A;  2H61 C;  2JQ6 A;  2COL B;  3SIB A;  2NLN A;  3CS1 A;  1ZMZ A;  1XK4 C;  3HX4 A;  1CM1 A;  4I5J A;  5K89 A;  1B8L A;  2HQW A;  1WLM A;  1WDC C;  2JT3 A;  3PLF B;  3EVU A;  1S26 D;  4OCI A;  2L5X B;  4OR9 B;  2ZFD A;  3NSO A;  3M0W A;  4PHM A;  5ER4 X;  3RLZ A;  1M46 A;  1R6P A;  1S1E A;  1RTP 1;  4WQ2 A;  1DGV A;  4BY4 A;  5JJG A;  1SMG A;  2Y1M A;  1QAS A;  1EXR A;  1VRK A;  1ZFS A;  1IQ3 A;  2NCP A;  2KYC A;  1QTX A;  1PSR A;  1WY9 A;  3KEV A;  2KGR A;  2KHN A;  3CTN A;  3TUY C;  1KK7 Y;  2LMV A;  2M3W A;  2JU0 A;  1Q80 A;  2G9B A;  1TIZ A;  2BL0 C;  1K95 A;  1BOD A;  1SL9 A;  2F2O A;  1DJH A;  2KI6 D;  3LL8 B;  1YUT A;  1XFZ O;  1K2H A;  2PRU A;  1XFV O;  4DUQ A;  1DJY A;  1NX3 A;  1E8A A;  1UHN A;  3EKH A;  2CBL A;  2HPS A;  5AAN A;  2MAZ A;  4GNK B;  1A75 A;  2L51 A;  1CDN A;  2EC6 B;  2LM5 A;  2PVB A;  1CTR A;  2SAS A;  4NQG A;  1CM4 A;  1DGU A;  1FF1 A;  3TDU A;  3PN7 B;  1CB1 A;  2LVV A;  1N65 A;  2PAS A;  3BXK A;  4P2Y B;  1ZAC A;  3NSI A;  1PUL A;  2Q4U A;  1TNP A;  3WNX B;  4GGF C;  2MA2 A;  2F2P A;  3VRQ A;  5FYX A;  4FQO A;  2KSP A;  4MZK A;  5KSZ A;  3HCM A;  2BCX A;  4MBE A;  1NP8 A;  2KQ6 A;  1IRJ A;  5CSI A;  1S5G Y;  3IQQ A;  1SBJ A;  2CNP A;  2ZRT A;  1ALV A;  1KQM C;  3KO0 A;  1UWO A;  1KK8 C;  1PK0 D;  1K96 A;  2K7D A;  3EKJ A;  1JFJ A;  2QAC A;  1QJT A;  4MVF A;  3CR5 X;  3NSK A;  3EVR A;  1F71 A;  1B9A A;  2LNK A;  1RRO A;  1LA3 A;  4DCK A;  1OZS A;  2F33 A;  2M7N A;  2KFF A;  2KI6 C;  1PVA A;  2KI4 C;  3OX5 A;  1EG4 A;  1UHH A;  1G4Y R;  4U8D A;  4MZL A;  5CSN A;  3DF0 B;  4YI9 A;  1CKK A;  2ZRS A;  3VRO A;  1L7Z A;  3FIA A;  1J7Q A;  4CID A;  1PRW A;  4CPV A;  3JTD C;  1BR1 B;  3QRX A;  4CFQ A;  3CLN A;  4ORC B;  4Q04 A;  4PHJ A;  5AER A;  5KU1 A;  4L9M A;  1NX1 A;  1BMO A;  1SNL A;  2F8P A;  4WQ3 A;  4N1F A;  2BKI B;  2K7C A;  3SIA A;  1AK8 A;  2CCM A;  1J7P A;  2WC8 A;  1AHR A;  5F6T A;  4A4C A;  1LA0 A;  3EK4 A;  2LLU A;  1TN4 A;  2LC5 A;  2LUX A;  4C0L A;  3SG5 A;  3OX6 A;  2KBM A;  4YI8 A;  3ZWH A;  2BE4 A;  2SCP A;  5AXI A;  1C7V A;  1U5I A;  4OVN F;  2EGD A;  3F45 A;  3PFV A;  1QVI Z;  1SYM A;  3PAT A;  4JWQ A;  5HKY A;  1IG5 A;  3CZT X;  2TN4 A;  4ZCU A;  2M1K B;  1K93 D;  2JTT A;  1K90 D;  1EJ3 A;  1KWO C;  1F4Q A;  1NPQ A;  1FI6 A;  2KQY A;  1U5I B;  3OB1 B;  4HRH A;  1J1D A;  3I5F C;  2Y4Q A;  1SK6 D;  2MJW B;  1GGZ A;  3DVK A;  4PE4 A;  1TTX A;  3DVJ A;  3CR2 A;  4HRE E;  4ORA B;  4DRW A;  1NCY A;  3VRR A;  3FWC A;  2L2E A;  1Y6W A;  2EHB A;  4JQ0 D;  1CLM A;  1QLK A;  2KAY A;  4PHK A;  2LCP A;  2V53 A;  1ALW A;  1B4C A;  2K61 A;  5HLO A;  1L2O B;  2WOR A;  4UPG A;  1J7O A;  1JC2 A;  3I5I B;  1CLB A;  1PVB A;  3DD4 A;  1QAT A;  2BBN A;  2KAX A;  3EVV A;  3SG2 A;  4GUK A;  1F70 A;  5B8I B;  1XFY O;  3BOW B;  2L0P A;  2LLT A;  5BPJ A;  2K8M B;  1LKJ A;  1B1G A;  3FS7 A;  2KDH A;  2LVK A;  1PAL A;  1Y1A A;  3E3R A;  2BE6 A;  1YRT B;  1B8C A;  4F0Z B;  3OHM B;  1OZO A;  4PE1 A;  1CLL A;  1NX0 A;  3WHT B;  1YUS A;  2GGZ A;  1W7J B;  3GK1 A;  4GPL B;  4OV2 A;  2K2F A;  3TS5 B;  2HF5 A;  4IL1 A;  1XO5 A;  4XJK B;  3VRN A;  1ZUZ A;  5G08 A;  2EC6 C;  4GAO A;  4D1E A;  1IJ5 A;  2MHH A;  1AJ5 A;  1REC A;  2JZI A;  3BUX B;  1MR8 A;  2M29 A;  2LMT A;  2K2A A;  3PN7 C;  1AVS A;  2KOT A;  3BUW B;  2JTZ A;  3I5H B;  1CMF A;  1H4B A;  4YBH B;  1S6C A;  3I5G B;  5PAL A;  2G2B A;  2CXJ A;  2LV7 A;  5GQQ C;  1IKU A;  3D0Y B;  1DMO A;  2ZN9 A;  2M1U A;  2AMI A;  1QVI Y;  1AUI B;  4M2O A;  1NYA A;  1KCY A;  1QX2 A;  1V1G A;  2Q91 A;  1N2D A;  1GGW A;  1MHO A;  5I8N A;  5IBW A;  5HYD A;  2OS8 B;  3C1V A;  2WND A;  3DF0 A;  1KSM A;  1TRF A;  4AQJ A;  1BLQ A;  2BCB A;  4PAL A;  2GGM A;  1CFF A;  5I2L A;  1PSB A;  3EK7 A;  4YGD B;  4WRI A;  5DKQ A;  2A4J A;  3EK8 A;  4PHN A;  4YRU A;  1B47 A;  3BUM B;  2MBX A;  1MF8 B;  4C0J A;  2F3Y A;  4CLN A;  1CDM A;  1KSO A;  2KAV A;  3O4Y A;  1XA5 A;  4MEW A;  1OE9 B;  2PAL A;  1LXF C;  1SPY A;  2FCE A;  4MZJ A;  2KNE A;  1X02 A;  5D69 A;  1QIV A;  3SG6 A;  1SCV A;  1K9P A;  3VGO A;  1QXP A;  2JNX A;  1W7I B;  3O2P A;  4XYN A;  4ZCV A;  4ICB A;  4PE0 A;  3SG7 A;  3PM8 A;  1ODB A;  1SW8 A;  1K8U A;  1YUU A;  1UP5 A;  1IQ5 A;  1OMR A;  2GV5 A;  4MRX A;  2P6B B;  1BF5 A;  1HQV A;  1GJY A;  3IQO A;  1SL8 A;  3KPX A;  1NCX A;  1XYD A;  3LK1 A;  3GK2 A;  1JWD A;  1KFU L;  2KFH A;  4CFR A;  2MLF C;  1RK9 A;  1QV0 A;  1QS7 A;  3AAJ A;  3LCP C;  1F54 A;  1Y1U A;  1YR5 A;  4M2P A;  5ER5 A;  2CTN A;  5TNC A;  1DJI A;  2KBI A;  2KFG A;  3A4U B;  5I2O A;  2O5G A;  3TZ1 A;  2M49 B;  1QV1 A;  1DF0 A;  3WXA A;  4AQI A;  1QX5 B;  1HT9 A;  1SR6 B;  1SY9 A;  2I18 A;  2L4I A;  2WCB A;  1NUB A;  1A29 A;  1BG1 A;  5JOL A;  3ZNI A;  4I5L B;  4TNC A;  4C0K A;  2DOQ A;  1TOP A;  1S6I A;  2B1U A;  1D1O A;  1EH2 A;  3JVT B;  2LLS A;  1N0Y A;  4NDD A;  4GFT A;  2R2I A;  1DJG A;  1QIW A;  1DF0 B;  4YGB B;  1UHK A;  2JXL A;  1KFX L;  1BR4 B;  4MRY A;  4N5X A;  2I7A A;  4JPZ B;  2O60 A;  1NX2 A;  2ZNE A;  3NXA A;  2BBM A;  2I94 A;  1CFD A;  3BOW A;  1DJZ A;  1J55 A;  3A8R A;  4PE7 A;  1XK4 A;  4NDC A;  2OTG B;  1MWN A;  3BYA A;  1L2O C;  1MUX A;  2JOJ A;  2E30 A;  2WCF A;  1IH0 A;  1KFU S;  3I5I C;  2OPO A;  3D10 A;  1C07 A;  1JF2 A;  2LVJ A;  1V1F A;  1G8I A;  1UUS A;  1OMV A;  1WDC B;  2FJU B;  3BUO B;  1K9U A;  4N1G A;  2Y1N A;  1WRL A;  2JPT A;  1UUR A;  1M45 A;  4I5K A;  4DS7 A;  2Y5I A;  4XJK A;  2K7B A;  1LVC D;  1NCZ A;  1MQ1 A;  1XFW O;  2D8N A;  3IF7 A;  4NDB A;  2KYF A;  4PCW A;  4AOM A;  2FOT A;  2CT9 A;  1OOJ A;  1TCF A;  3OP0 A;  1RWY A;  1CMG A;  4I5N B;  4HRG A;  3CR4 X;  5HLV A;  4GBA A;  5AEQ A;  1A03 A;  1KFX S;  2RGI A;  3K21 A;  2LE9 B;  3KF9 A;  1IWQ A;  1SCM B;  2BEC A;  3TS5 C;  1YVL A;  4GGN A;  3WHU B;  3PSR A;  1MXL C;  2JUL A;  3O6B A;  1SCM C;  1WRK A;  2K0J A;  3H4S E;  2MRD A;  3TDZ A;  3RM1 A;  3D0Y A;  4HSZ A;  1S6J A;  2L98 A;  3TUY B;  1NIW A;  2M0R A;  2ZKM X;  1MXE A;  1XFX O;  4P5O E;  1TNQ A;  1B7T Y;  1JF0 A;  2NXQ A;  1S36 A;  2BL0 B;  2MLE C;  2PMY A;  3SJS A;  5DKR A;  2ZN8 A;  4PDZ A;  2HQ8 A;  1AJ4 A;  1OSA A;  3AKB A;  3I5H C;  5AFP A;  1M31 A;  2JNF A;  1K94 A;  5CSJ A;  4ETO A;  2JC2 A;  3DVM A;  2NCO A;  1BT6 A;  2IS9 A;  3I5G C;  4GGF A;  1F8H A;  5KTY A;  1M63 B;  3FWB A;  2BCA A;  4M2Q A;  5CSF A;  2E6W A;  1YX7 A;  1DT7 B;  1FW4 A;  2OS8 C;  1QLS A;  2F3Z A;  2JT8 A;  2JWW A;  2WCE A;  3AKA A;  1DJX A;  1XFU O;  4E68 A;  1NWD A;  5DKN A;  2L4H A;  3DVE A;  2LP3 A;  2JT0 A;  1A75 B;  3ICB A;  5HKW A;  1J7R A;  2PSR A;  1YX8 A;  2VRG A;  3GK4 X;  2I2R E;  3BUN B;  4BY5 A;  1J1E A;  2BKH B;  4OKH A;  1RFJ A;  1JFK A;  1EL4 A;  1H8B A;  3OB2 B;  1SKT A;  1GQM A;  1M39 A;  1WRZ A;  1KQM B;  1QX7 A;  1KQV A;  1KK8 B;  4FTG A;  1IGV A;  2QPT A;  1JUO A;  2AUC A;  1YTZ C;  2KGB C;  1CFC A;  3LLE A;  2LMU A;  1CDP A;  3NSL A;  1JSA A;  1TNW A;  1Y0V H;  2KI4 B;  2M97 A;  1XVJ A;  3LK0 A;  2HET A;  1B7T Z;  1KK7 Z;  4QJ3 B;  3TDI A;  2LAP A;  1EG3 A;  1ZOT B;  1CDL A;  1SL7 A;  3JTD B;  4YGA A;  2M9G A;  1S3P A;  1AP4 A;  1FPW A;  2LVI A;  5I2Q A;  1TCO B;  2FCD A;  1BU3 A;  1G33 A;  4QJ5 B;  1YVH A;  1OQP A;  1YRU B;  1DVI A;  3CGA A;  3O78 A;  2K7O A;  1FI5 A;  4USL A;  1YUR A;  1RJV A;  5D7F A;  4R1E A;  1SR6 C;  4MN0 A;  1JBA A;  3KHE A;  1IJ6 A;  4ORB B;  1CNP A;  3SG4 A;  2LAN A;  2AAO A;  5CPV A;  1DTL A;  3AAK A;  4A4B A;  1Y1X A;  1C7W A;  1UHJ A;  1F4O A;  2JXC A;  4MLW A;  1UHI A;  2L50 A;  2LP2 A;  5HKZ A;  3JVT C;  1TNX A;  3VRP A;  1A2X A;  4MSP A;  1BOC A;  3PAL A;  2LHL A;  2WOS A;  1CFP A;  1K9K A;  1A4P A;  3BQ3 A;  2ISD A;  1F55 A;  5J3X A;  3CWG A;  1B8R A;  2H61 A;  2M8U A;  4DIR A;  1FBV A;  2NZ0 A;  3SG3 A;  2ZND A;  1DJW A;  1R2U A;  2M7L A;  1LIN A;  1SRA A;  4QJ4 B;  1KWO B;  2OTG C;  1S5G Z;  2JRF A;  1BJF A;  2LHI A;  1NSH A;  1OMD A;  2H2K A;  3GOF A;  3I5F B;  3MSE B;  2LUC A;  4YGC B; 
#chains in the Genus database with same CATH topology
 1Z2C B;  1WLZ A;  2H61 C;  2JQ6 A;  3R1P A;  2COL B;  4YGE B;  3SIB A;  2NLN A;  3CS1 A;  1ZMZ A;  1XK4 C;  3HX4 A;  1CM1 A;  4I5J A;  5K89 A;  1B8L A;  2HQW A;  1WLM A;  1WDC C;  3D73 A;  2JT3 A;  3PLF B;  3EVU A;  1S26 D;  4OCI A;  2L5X B;  4OR9 B;  3FE6 A;  2ZFD A;  3B88 A;  3NSO A;  3M0W A;  4PHM A;  5ER4 X;  3RLZ A;  1W9Z A;  1M46 A;  1R6P A;  1S1E A;  1RTP 1;  4WQ2 A;  3O4X A;  1DGV A;  4BY4 A;  5JJG A;  2ERB A;  1SMG A;  2Y1M A;  1QAS A;  1EXR A;  1VRK A;  1ZFS A;  1IQ3 A;  2NCP A;  2KYC A;  1QTX A;  1PSR A;  1WY9 A;  3KEV A;  2KGR A;  4FQT A;  2KHN A;  3D76 A;  3CTN A;  3TUY C;  1KK7 Y;  2LMV A;  2M3W A;  2JU0 A;  4INX A;  1TWO A;  1Q80 A;  2G9B A;  1TIZ A;  3B7A A;  1K95 A;  2BL0 C;  1BOD A;  1SL9 A;  2F2O A;  1DJH A;  2KI6 D;  3LL8 B;  1YUT A;  1XFZ O;  1K2H A;  2PRU A;  1XFV O;  2P70 A;  3BFA A;  2PYQ A;  4DUQ A;  1DJY A;  1NX3 A;  1E8A A;  1UHN A;  3EKH A;  2CBL A;  2HPS A;  5AAN A;  2MAZ A;  3V2L A;  4GNK B;  3SS5 A;  1A75 A;  2L51 A;  1CDN A;  2EC6 B;  2LM5 A;  2PVB A;  1CTR A;  2SAS A;  4NQG A;  2WCL A;  1CM4 A;  1DGU A;  3FE9 A;  1GM0 A;  3DXL A;  3OGN A;  1FF1 A;  2QEO A;  3TDU A;  3PN7 B;  1CB1 A;  2LVV A;  1N65 A;  2PAS A;  3BXK A;  4P2Y B;  1ZAC A;  1Z4H A;  3NSI A;  1PUL A;  2Q4U A;  1TNP A;  3WNX B;  4GGF C;  2MA2 A;  2F2P A;  3BFB A;  3L47 A;  2P71 A;  3CZ1 A;  1TUJ A;  3VRQ A;  5FYX A;  1IIO A;  4FQO A;  2KSP A;  5DIC A;  4MZK A;  5KSZ A;  3HCM A;  3PM2 A;  2BCX A;  4MBE A;  1NP8 A;  3D77 A;  2KQ6 A;  3S0D A;  1IRJ A;  5CSI A;  3PJI A;  1S5G Y;  3IQQ A;  3S0G A;  1SBJ A;  2CNP A;  2ZRT A;  1ALV A;  1KQM C;  3KO0 A;  1UWO A;  3NGV A;  1KK8 C;  1PK0 D;  1K96 A;  2K7D A;  3EKJ A;  1JFJ A;  2QAC A;  1QJT A;  4MVF A;  3CR5 X;  3NSK A;  3EVR A;  1F71 A;  1B9A A;  2LNK A;  1OOG A;  1RRO A;  1LA3 A;  3S0A A;  4DCK A;  1OZS A;  2F33 A;  2M7N A;  2KFF A;  5I94 A;  3NHT A;  2KI6 C;  1PVA A;  2KI4 C;  3OX5 A;  1EG4 A;  1UHH A;  1G4Y R;  3DYE A;  4U8D A;  2QEB A;  3DZT A;  4INW A;  3DF0 B;  4MZL A;  4YI9 A;  5CSN A;  1CKK A;  2ZRS A;  3VRO A;  1L7Z A;  3FIA A;  1J7Q A;  4CID A;  3UNW A;  5HL1 A;  1PRW A;  4CPV A;  3JTD C;  1BR1 B;  3QRX A;  4CFQ A;  3CLN A;  2WCM A;  3QME A;  4ORC B;  4PHJ A;  4Q04 A;  5AER A;  5KU1 A;  4L9M A;  2KPH A;  1NX1 A;  1BMO A;  1SNL A;  2F8P A;  4WQ3 A;  4N1F A;  3B86 A;  2BKI B;  2K7C A;  5FI7 A;  3SIA A;  2CCM A;  1AK8 A;  1J7P A;  2WC8 A;  1AHR A;  1OOF A;  5F6T A;  4A4C A;  1LA0 A;  3EK4 A;  2LLU A;  1TN4 A;  2LC5 A;  2LUX A;  4C0L A;  3SG5 A;  2K60 A;  3OX6 A;  3R1O A;  2KBM A;  4YI8 A;  3ZWH A;  2BE4 A;  2SCP A;  5AXI A;  1C7V A;  1U5I A;  4OVN F;  4IJ7 A;  2EGD A;  3F45 A;  3PFV A;  1QVI Z;  1SYM A;  3PAT A;  4JWQ A;  5HKY A;  1IG5 A;  3CZT X;  2TN4 A;  4ZCU A;  2M1K B;  1K93 D;  2JTT A;  1K90 D;  2GTE A;  1EJ3 A;  3RZS A;  1KWO C;  1F4Q A;  1NPQ A;  1FI6 A;  2KQY A;  1U5I B;  3OB1 B;  4HRH A;  1J1D A;  3I5F C;  2Y4Q A;  1SK6 D;  3BJH A;  5D3O A;  2MJW B;  1GGZ A;  3DVK A;  4PE4 A;  2WCJ A;  1TTX A;  3DVJ A;  3CR2 A;  4HRE E;  4ORA B;  4DRW A;  1NCY A;  1LS8 A;  3VRR A;  3FWC A;  2L2E A;  1Y6W A;  2EHB A;  4JQ0 D;  1CLM A;  1QLK A;  2KAY A;  4PHK A;  2LCP A;  2V53 A;  1ALW A;  1T14 A;  1B4C A;  2K61 A;  5HLO A;  1L2O B;  2WOR A;  4UPG A;  3N7H A;  1J7O A;  1JC2 A;  3I5I B;  3S0F A;  1CLB A;  1PVB A;  3DD4 A;  1QAT A;  2BBN A;  2KAX A;  3EVV A;  3SG2 A;  4GUK A;  1F70 A;  5B8I B;  1XFY O;  3BOW B;  2L0P A;  2LLT A;  3B6X A;  2K8M B;  1LKJ A;  5BPJ A;  1B1G A;  3FS7 A;  2KDH A;  2LVK A;  1PAL A;  1Y1A A;  3E3R A;  2BE6 A;  2PQL A;  1DEK A;  1YRT B;  3Q8I A;  1B8C A;  4F0Z B;  3OHM B;  1OZO A;  4PE1 A;  1CLL A;  1NX0 A;  3WHT B;  1YUS A;  2GGZ A;  1W7J B;  3GK1 A;  4GPL B;  4OV2 A;  2YGU A;  2K2F A;  3TS5 B;  2HF5 A;  4IL1 A;  1XO5 A;  4XJK B;  3DY9 A;  3VRN A;  3NHI A;  1ZUZ A;  1P28 A;  5G08 A;  2EC6 C;  4GAO A;  2H8V A;  4D1E A;  1IJ5 A;  2MHH A;  1AJ5 A;  1REC A;  2JZI A;  3BUX B;  1MR8 A;  2M29 A;  2LMT A;  2K2A A;  1OW4 A;  3PN7 C;  1AVS A;  3S0B A;  2KOT A;  3BUW B;  2JTZ A;  3I5H B;  1CMF A;  5FI2 A;  1H4B A;  4YBH B;  1S6C A;  3I5G B;  5PAL A;  2G2B A;  2CXJ A;  2LV7 A;  5GQQ C;  1IKU A;  3D0Y B;  1DMO A;  2ZN9 A;  2M1U A;  2AMI A;  1QVI Y;  1AUI B;  4M2O A;  1NYA A;  1KCY A;  1QX2 A;  1V1G A;  2Q91 A;  1N2D A;  3R72 A;  1MHO A;  1GGW A;  2L2C A;  5I8N A;  5IBW A;  5HYD A;  2OS8 B;  3B87 A;  3C1V A;  2WND A;  3DF0 A;  1KSM A;  1TRF A;  4KYN A;  3D75 A;  4AQJ A;  1BLQ A;  3UO9 A;  3CYZ A;  2BCB A;  4PAL A;  2GGM A;  1CFF A;  3K1E A;  5I2L A;  1PSB A;  3EK7 A;  4YGD B;  4WRI A;  5DKQ A;  2A4J A;  3EK8 A;  4PHN A;  4YRU A;  1B47 A;  3BUM B;  2MBX A;  1MF8 B;  4C0J A;  2F3Y A;  4CLN A;  1CDM A;  1KSO A;  2KAV A;  3O4Y A;  1XA5 A;  4MEW A;  1OE9 B;  2PAL A;  1LXF C;  1SPY A;  2FCE A;  4MZJ A;  2KNE A;  1X02 A;  5D69 A;  1QIV A;  3SG6 A;  1SCV A;  1K9P A;  5EL2 A;  3VGO A;  1QXP A;  2JNX A;  1W7I B;  3O2P A;  4XYN A;  4ZCV A;  4ICB A;  4PE0 A;  3SG7 A;  3PM8 A;  1ODB A;  1SW8 A;  1K8U A;  1YUU A;  4F7F A;  1UP5 A;  1IQ5 A;  1OMR A;  2GV5 A;  4MRX A;  2P6B B;  1BF5 A;  1HQV A;  1GJY A;  1OOH A;  1SL8 A;  3IQO A;  3CDN A;  3KPX A;  1NCX A;  1XYD A;  3LK1 A;  3GK2 A;  1JWD A;  2WCH A;  1KFU L;  2KFH A;  4CFR A;  2MLF C;  1RK9 A;  1QV0 A;  1QS7 A;  3AAJ A;  3LCP C;  3S0E A;  1Y1U A;  1YR5 A;  4M2P A;  5ER5 A;  1F54 A;  2CTN A;  5TNC A;  1DJI A;  2KBI A;  2KFG A;  3A4U B;  5I2O A;  2O5G A;  3TZ1 A;  2M49 B;  1QV1 A;  1DF0 A;  3WXA A;  4AQI A;  1QX5 B;  1HT9 A;  1SR6 B;  1SY9 A;  2I18 A;  2L4I A;  2WCB A;  1NUB A;  1A29 A;  1BG1 A;  5JOL A;  3ZNI A;  4I5L B;  2FJY A;  4TNC A;  2DOQ A;  4C0K A;  1TOP A;  1S6I A;  2B1U A;  1D1O A;  1EH2 A;  3JVT B;  2LLS A;  1N0Y A;  1TUZ A;  4NDD A;  3CAB A;  2R2I A;  4GFT A;  1DJG A;  1QIW A;  1DF0 B;  4YGB B;  1UHK A;  2JXL A;  1KFX L;  1BR4 B;  3OBV A;  4MRY A;  4N5X A;  2I7A A;  4JPZ B;  2O60 A;  1NX2 A;  2ZNE A;  3NXA A;  2BAP A;  2BBM A;  2I94 A;  1CFD A;  3BOW A;  1DJZ A;  1J55 A;  3A8R A;  4JKT A;  4PE7 A;  1XK4 A;  3EG5 B;  4NDC A;  2OTG B;  1MWN A;  3BYA A;  1L2O C;  1MUX A;  2JOJ A;  3BFH A;  4PT1 A;  3IVT A;  2KLE A;  2E30 A;  2WCF A;  1IH0 A;  1KFU S;  3D78 A;  3I5I C;  2OPO A;  2WC6 A;  3D10 A;  1C07 A;  1JF2 A;  2LVJ A;  1V1F A;  1UUS A;  1G8I A;  1OMV A;  1WDC B;  2FJU B;  3BUO B;  1K9U A;  4N1G A;  2Y1N A;  1WRL A;  2JPT A;  1UUR A;  1M45 A;  4I5K A;  4DS7 A;  2Y5I A;  4XJK A;  2K7B A;  1LVC D;  1NCZ A;  1MQ1 A;  1XFW O;  2D8N A;  3IF7 A;  3L4A A;  4NDB A;  2KYF A;  4PCW A;  4AOM A;  2FOT A;  2CT9 A;  1OOJ A;  1TCF A;  3OP0 A;  1RWY A;  1CMG A;  4I5N B;  4HRG A;  3CR4 X;  5HLV A;  4GBA A;  5AEQ A;  1A03 A;  1KFX S;  2RGI A;  3K21 A;  2LE9 B;  3KF9 A;  1IWQ A;  1SCM B;  2BEC A;  3TS5 C;  1YVL A;  4GGN A;  3WHU B;  3PSR A;  1MXL C;  2JUL A;  3O6B A;  1SCM C;  1WRK A;  2K0J A;  3H4S E;  2MRD A;  3TDZ A;  3RM1 A;  3D0Y A;  4HSZ A;  1S6J A;  2L98 A;  3TUY B;  1NIW A;  2M0R A;  2ZKM X;  1MXE A;  1XFX O;  4P5O E;  1TNQ A;  2QDI A;  4OZD A;  1B7T Y;  1JF0 A;  3R1V A;  2NXQ A;  1S36 A;  2BL0 B;  2MLE C;  2PMY A;  3SJS A;  5DKR A;  2ZN8 A;  4PDZ A;  1XFR A;  2HQ8 A;  1AJ4 A;  1OSA A;  3AKB A;  3I5H C;  5AFP A;  1M31 A;  2JNF A;  1K94 A;  2JPO A;  5CSJ A;  2JC2 A;  3DVM A;  4ETO A;  2NCO A;  1BT6 A;  2IS9 A;  3I5G C;  4GGF A;  1F8H A;  5KTY A;  2WCK A;  1M63 B;  3D74 A;  3FWB A;  2BCA A;  4M2Q A;  5CSF A;  2E6W A;  1YX7 A;  1DT7 B;  1FW4 A;  2OS8 C;  2L5Y A;  1QLS A;  2F3Z A;  2JT8 A;  2JWW A;  2WCE A;  3AKA A;  1DJX A;  1XFU O;  4E68 A;  1NWD A;  5DKN A;  1QWV A;  2L4H A;  1DEL A;  3DVE A;  2LP3 A;  2JT0 A;  1A75 B;  3ICB A;  5HKW A;  1J7R A;  2PSR A;  1YX8 A;  2VRG A;  3GK4 X;  2I2R E;  3BUN B;  5FI6 A;  4BY5 A;  1J1E A;  2BKH B;  1C3Z A;  4OKH A;  1RFJ A;  1JFK A;  1EL4 A;  1H8B A;  3OB2 B;  1C3Y A;  1SKT A;  1GQM A;  1OOI X;  1M39 A;  1WRZ A;  3FE8 A;  3CZ0 A;  1KQM B;  1QX7 A;  1KQV A;  1KK8 B;  4FTG A;  1IGV A;  2QPT A;  1JUO A;  2AUC A;  1YTZ C;  2KGB C;  1CFC A;  3LLE A;  2LMU A;  1CDP A;  3NSL A;  1JSA A;  1TNW A;  1Y0V H;  2KI4 B;  2M97 A;  2BNX A;  1XVJ A;  3VB1 A;  3LK0 A;  2HET A;  1B7T Z;  1KK7 Z;  4QJ3 B;  3TDI A;  2LAP A;  1EG3 A;  3L4L A;  2KLD A;  1ZOT B;  1CDL A;  1SL7 A;  3JTD B;  4YGA A;  2M9G A;  1S3P A;  1AP4 A;  1FPW A;  2LVI A;  5I2Q A;  1TCO B;  2FCD A;  1BU3 A;  1G33 A;  4QJ5 B;  1YVH A;  1OQP A;  1YRU B;  1DVI A;  3CGA A;  3O78 A;  2K7O A;  1FI5 A;  4USL A;  2WC5 A;  2QEH A;  1YUR A;  1RJV A;  5D7F A;  3CZ2 A;  4R1E A;  4JD9 A;  1SR6 C;  4MN0 A;  1JBA A;  3KHE A;  1IJ6 A;  4ORB B;  1CNP A;  3SG4 A;  2LAN A;  2AAO A;  5CPV A;  1DTL A;  3AAK A;  4A4B A;  1ORG A;  1Y1X A;  1C7W A;  1UHJ A;  1F4O A;  1SSE B;  2JXC A;  4MLW A;  1UHI A;  2L50 A;  2LP2 A;  5HKZ A;  3JVT C;  1TNX A;  3VRP A;  1A2X A;  4MSP A;  1BOC A;  2QEV A;  2LHL A;  2WOS A;  3PAL A;  1CFP A;  1K9K A;  1A4P A;  3BQ3 A;  2ISD A;  1F55 A;  5J3X A;  3CWG A;  1B8R A;  2H61 A;  2M8U A;  4DIR A;  1FBV A;  2NZ0 A;  3SG3 A;  2ZND A;  1DJW A;  1R2U A;  2M7L A;  1LIN A;  1SRA A;  1DC1 A;  4QJ4 B;  1KWO B;  2OTG C;  1S5G Z;  1DQE A;  2JRF A;  1BJF A;  3SS4 A;  2LHI A;  1NSH A;  1OMD A;  2H2K A;  3GOF A;  3I5F B;  3MSE B;  2LUC A;  3SS3 A;  4YGC B; 
#chains in the Genus database with same CATH homology
 4YGE B;  1WLZ A;  2H61 C;  2JQ6 A;  2COL B;  3SIB A;  2NLN A;  3CS1 A;  1ZMZ A;  1XK4 C;  3HX4 A;  1CM1 A;  4I5J A;  5K89 A;  1B8L A;  2HQW A;  1WLM A;  1WDC C;  2JT3 A;  3PLF B;  3EVU A;  1S26 D;  4OCI A;  2L5X B;  4OR9 B;  2ZFD A;  3NSO A;  3M0W A;  4PHM A;  5ER4 X;  3RLZ A;  1M46 A;  1R6P A;  1S1E A;  1RTP 1;  4WQ2 A;  1DGV A;  4BY4 A;  5JJG A;  1SMG A;  2Y1M A;  1QAS A;  1EXR A;  1VRK A;  1ZFS A;  1IQ3 A;  2NCP A;  2KYC A;  1QTX A;  1PSR A;  1WY9 A;  3KEV A;  2KGR A;  2KHN A;  3CTN A;  3TUY C;  1KK7 Y;  2LMV A;  2M3W A;  2JU0 A;  1Q80 A;  2G9B A;  1TIZ A;  2BL0 C;  1K95 A;  1BOD A;  1SL9 A;  2F2O A;  1DJH A;  2KI6 D;  3LL8 B;  1YUT A;  1XFZ O;  1K2H A;  2PRU A;  1XFV O;  4DUQ A;  1DJY A;  1NX3 A;  1E8A A;  1UHN A;  3EKH A;  2CBL A;  2HPS A;  5AAN A;  2MAZ A;  4GNK B;  1A75 A;  2L51 A;  1CDN A;  2EC6 B;  2LM5 A;  2PVB A;  1CTR A;  2SAS A;  4NQG A;  1CM4 A;  1DGU A;  1FF1 A;  3TDU A;  3PN7 B;  1CB1 A;  2LVV A;  1N65 A;  2PAS A;  3BXK A;  4P2Y B;  1ZAC A;  3NSI A;  1PUL A;  2Q4U A;  1TNP A;  3WNX B;  4GGF C;  2MA2 A;  2F2P A;  3VRQ A;  5FYX A;  4FQO A;  2KSP A;  4MZK A;  5KSZ A;  3HCM A;  2BCX A;  4MBE A;  1NP8 A;  2KQ6 A;  1IRJ A;  5CSI A;  1S5G Y;  3IQQ A;  1SBJ A;  2CNP A;  2ZRT A;  1ALV A;  1KQM C;  3KO0 A;  1UWO A;  1KK8 C;  1PK0 D;  1K96 A;  2K7D A;  3EKJ A;  1JFJ A;  2QAC A;  1QJT A;  4MVF A;  3CR5 X;  3NSK A;  3EVR A;  1F71 A;  1B9A A;  2LNK A;  1RRO A;  1LA3 A;  4DCK A;  1OZS A;  2F33 A;  2M7N A;  2KFF A;  2KI6 C;  1PVA A;  2KI4 C;  3OX5 A;  1EG4 A;  1UHH A;  1G4Y R;  4U8D A;  4MZL A;  5CSN A;  3DF0 B;  4YI9 A;  1CKK A;  2ZRS A;  3VRO A;  1L7Z A;  3FIA A;  1J7Q A;  4CID A;  1PRW A;  4CPV A;  3JTD C;  1BR1 B;  3QRX A;  4CFQ A;  3CLN A;  4ORC B;  4Q04 A;  4PHJ A;  5AER A;  5KU1 A;  4L9M A;  1NX1 A;  1BMO A;  1SNL A;  2F8P A;  4WQ3 A;  4N1F A;  2BKI B;  2K7C A;  3SIA A;  1AK8 A;  2CCM A;  1J7P A;  2WC8 A;  1AHR A;  5F6T A;  4A4C A;  1LA0 A;  3EK4 A;  2LLU A;  1TN4 A;  2LC5 A;  2LUX A;  4C0L A;  3SG5 A;  3OX6 A;  2KBM A;  4YI8 A;  3ZWH A;  2BE4 A;  2SCP A;  5AXI A;  1C7V A;  1U5I A;  4OVN F;  2EGD A;  3F45 A;  3PFV A;  1QVI Z;  1SYM A;  3PAT A;  4JWQ A;  5HKY A;  1IG5 A;  3CZT X;  2TN4 A;  4ZCU A;  2M1K B;  1K93 D;  2JTT A;  1K90 D;  1EJ3 A;  1KWO C;  1F4Q A;  1NPQ A;  1FI6 A;  2KQY A;  1U5I B;  3OB1 B;  4HRH A;  1J1D A;  3I5F C;  2Y4Q A;  1SK6 D;  2MJW B;  1GGZ A;  3DVK A;  4PE4 A;  1TTX A;  3DVJ A;  3CR2 A;  4HRE E;  4ORA B;  4DRW A;  1NCY A;  3VRR A;  3FWC A;  2L2E A;  1Y6W A;  2EHB A;  4JQ0 D;  1CLM A;  1QLK A;  2KAY A;  4PHK A;  2LCP A;  2V53 A;  1ALW A;  1B4C A;  2K61 A;  5HLO A;  1L2O B;  2WOR A;  4UPG A;  1J7O A;  1JC2 A;  3I5I B;  1CLB A;  1PVB A;  3DD4 A;  1QAT A;  2BBN A;  2KAX A;  3EVV A;  3SG2 A;  4GUK A;  1F70 A;  5B8I B;  1XFY O;  3BOW B;  2L0P A;  2LLT A;  5BPJ A;  2K8M B;  1LKJ A;  1B1G A;  3FS7 A;  2KDH A;  2LVK A;  1PAL A;  1Y1A A;  3E3R A;  2BE6 A;  1YRT B;  1B8C A;  4F0Z B;  3OHM B;  1OZO A;  4PE1 A;  1CLL A;  1NX0 A;  3WHT B;  1YUS A;  2GGZ A;  1W7J B;  3GK1 A;  4GPL B;  4OV2 A;  2K2F A;  3TS5 B;  2HF5 A;  4IL1 A;  1XO5 A;  4XJK B;  3VRN A;  1ZUZ A;  5G08 A;  2EC6 C;  4GAO A;  4D1E A;  1IJ5 A;  2MHH A;  1AJ5 A;  1REC A;  2JZI A;  3BUX B;  1MR8 A;  2M29 A;  2LMT A;  2K2A A;  3PN7 C;  1AVS A;  2KOT A;  3BUW B;  2JTZ A;  3I5H B;  1CMF A;  1H4B A;  4YBH B;  1S6C A;  3I5G B;  5PAL A;  2G2B A;  2CXJ A;  2LV7 A;  5GQQ C;  1IKU A;  3D0Y B;  1DMO A;  2ZN9 A;  2M1U A;  2AMI A;  1QVI Y;  1AUI B;  4M2O A;  1NYA A;  1KCY A;  1QX2 A;  1V1G A;  2Q91 A;  1N2D A;  1GGW A;  1MHO A;  5I8N A;  5IBW A;  5HYD A;  2OS8 B;  3C1V A;  2WND A;  3DF0 A;  1KSM A;  1TRF A;  4AQJ A;  1BLQ A;  2BCB A;  4PAL A;  2GGM A;  1CFF A;  5I2L A;  1PSB A;  3EK7 A;  4YGD B;  4WRI A;  5DKQ A;  2A4J A;  3EK8 A;  4PHN A;  4YRU A;  1B47 A;  3BUM B;  2MBX A;  1MF8 B;  4C0J A;  2F3Y A;  4CLN A;  1CDM A;  1KSO A;  2KAV A;  3O4Y A;  1XA5 A;  4MEW A;  1OE9 B;  2PAL A;  1LXF C;  1SPY A;  2FCE A;  4MZJ A;  2KNE A;  1X02 A;  5D69 A;  1QIV A;  3SG6 A;  1SCV A;  1K9P A;  3VGO A;  1QXP A;  2JNX A;  1W7I B;  3O2P A;  4XYN A;  4ZCV A;  4ICB A;  4PE0 A;  3SG7 A;  3PM8 A;  1ODB A;  1SW8 A;  1K8U A;  1YUU A;  1UP5 A;  1IQ5 A;  1OMR A;  2GV5 A;  4MRX A;  2P6B B;  1BF5 A;  1HQV A;  1GJY A;  3IQO A;  1SL8 A;  3KPX A;  1NCX A;  1XYD A;  3LK1 A;  3GK2 A;  1JWD A;  1KFU L;  2KFH A;  4CFR A;  2MLF C;  1RK9 A;  1QV0 A;  1QS7 A;  3AAJ A;  3LCP C;  1F54 A;  1Y1U A;  1YR5 A;  4M2P A;  5ER5 A;  2CTN A;  5TNC A;  1DJI A;  2KBI A;  2KFG A;  3A4U B;  5I2O A;  2O5G A;  3TZ1 A;  2M49 B;  1QV1 A;  1DF0 A;  3WXA A;  4AQI A;  1QX5 B;  1HT9 A;  1SR6 B;  1SY9 A;  2I18 A;  2L4I A;  2WCB A;  1NUB A;  1A29 A;  1BG1 A;  5JOL A;  3ZNI A;  4I5L B;  4TNC A;  4C0K A;  2DOQ A;  1TOP A;  1S6I A;  2B1U A;  1D1O A;  1EH2 A;  3JVT B;  2LLS A;  1N0Y A;  4NDD A;  4GFT A;  2R2I A;  1DJG A;  1QIW A;  1DF0 B;  4YGB B;  1UHK A;  2JXL A;  1KFX L;  1BR4 B;  4MRY A;  4N5X A;  2I7A A;  4JPZ B;  2O60 A;  1NX2 A;  2ZNE A;  3NXA A;  2BBM A;  2I94 A;  1CFD A;  3BOW A;  1DJZ A;  1J55 A;  3A8R A;  4PE7 A;  1XK4 A;  4NDC A;  2OTG B;  1MWN A;  3BYA A;  1L2O C;  1MUX A;  2JOJ A;  2E30 A;  2WCF A;  1IH0 A;  1KFU S;  3I5I C;  2OPO A;  3D10 A;  1C07 A;  1JF2 A;  2LVJ A;  1V1F A;  1G8I A;  1UUS A;  1OMV A;  1WDC B;  2FJU B;  3BUO B;  1K9U A;  4N1G A;  2Y1N A;  1WRL A;  2JPT A;  1UUR A;  1M45 A;  4I5K A;  4DS7 A;  2Y5I A;  4XJK A;  2K7B A;  1LVC D;  1NCZ A;  1MQ1 A;  1XFW O;  2D8N A;  3IF7 A;  4NDB A;  2KYF A;  4PCW A;  4AOM A;  2FOT A;  2CT9 A;  1OOJ A;  1TCF A;  3OP0 A;  1RWY A;  1CMG A;  4I5N B;  4HRG A;  3CR4 X;  5HLV A;  4GBA A;  5AEQ A;  1A03 A;  1KFX S;  2RGI A;  3K21 A;  2LE9 B;  3KF9 A;  1IWQ A;  1SCM B;  2BEC A;  3TS5 C;  1YVL A;  4GGN A;  3WHU B;  3PSR A;  1MXL C;  2JUL A;  3O6B A;  1SCM C;  1WRK A;  2K0J A;  3H4S E;  2MRD A;  3TDZ A;  3RM1 A;  3D0Y A;  4HSZ A;  1S6J A;  2L98 A;  3TUY B;  1NIW A;  2M0R A;  2ZKM X;  1MXE A;  1XFX O;  4P5O E;  1TNQ A;  1B7T Y;  1JF0 A;  2NXQ A;  1S36 A;  2BL0 B;  2MLE C;  2PMY A;  3SJS A;  5DKR A;  2ZN8 A;  4PDZ A;  2HQ8 A;  1AJ4 A;  1OSA A;  3AKB A;  3I5H C;  5AFP A;  1M31 A;  2JNF A;  1K94 A;  5CSJ A;  4ETO A;  2JC2 A;  3DVM A;  2NCO A;  1BT6 A;  2IS9 A;  3I5G C;  4GGF A;  1F8H A;  5KTY A;  1M63 B;  3FWB A;  2BCA A;  4M2Q A;  5CSF A;  2E6W A;  1YX7 A;  1DT7 B;  1FW4 A;  2OS8 C;  1QLS A;  2F3Z A;  2JT8 A;  2JWW A;  2WCE A;  3AKA A;  1DJX A;  1XFU O;  4E68 A;  1NWD A;  5DKN A;  2L4H A;  3DVE A;  2LP3 A;  2JT0 A;  1A75 B;  3ICB A;  5HKW A;  1J7R A;  2PSR A;  1YX8 A;  2VRG A;  3GK4 X;  2I2R E;  3BUN B;  4BY5 A;  1J1E A;  2BKH B;  4OKH A;  1RFJ A;  1JFK A;  1EL4 A;  1H8B A;  3OB2 B;  1SKT A;  1GQM A;  1M39 A;  1WRZ A;  1KQM B;  1QX7 A;  1KQV A;  1KK8 B;  4FTG A;  1IGV A;  2QPT A;  1JUO A;  2AUC A;  1YTZ C;  2KGB C;  1CFC A;  3LLE A;  2LMU A;  1CDP A;  3NSL A;  1JSA A;  1TNW A;  1Y0V H;  2KI4 B;  2M97 A;  1XVJ A;  3LK0 A;  2HET A;  1B7T Z;  1KK7 Z;  4QJ3 B;  3TDI A;  2LAP A;  1EG3 A;  1ZOT B;  1CDL A;  1SL7 A;  3JTD B;  4YGA A;  2M9G A;  1S3P A;  1AP4 A;  1FPW A;  2LVI A;  5I2Q A;  1TCO B;  2FCD A;  1BU3 A;  1G33 A;  4QJ5 B;  1YVH A;  1OQP A;  1YRU B;  1DVI A;  3CGA A;  3O78 A;  2K7O A;  1FI5 A;  4USL A;  1YUR A;  1RJV A;  5D7F A;  4R1E A;  1SR6 C;  4MN0 A;  1JBA A;  3KHE A;  1IJ6 A;  4ORB B;  1CNP A;  3SG4 A;  2LAN A;  2AAO A;  5CPV A;  1DTL A;  3AAK A;  4A4B A;  1Y1X A;  1C7W A;  1UHJ A;  1F4O A;  2JXC A;  4MLW A;  1UHI A;  2L50 A;  2LP2 A;  5HKZ A;  3JVT C;  1TNX A;  3VRP A;  1A2X A;  4MSP A;  1BOC A;  3PAL A;  2LHL A;  2WOS A;  1CFP A;  1K9K A;  1A4P A;  3BQ3 A;  2ISD A;  1F55 A;  5J3X A;  3CWG A;  1B8R A;  2H61 A;  2M8U A;  4DIR A;  1FBV A;  2NZ0 A;  3SG3 A;  2ZND A;  1DJW A;  1R2U A;  2M7L A;  1LIN A;  1SRA A;  4QJ4 B;  1KWO B;  2OTG C;  1S5G Z;  2JRF A;  1BJF A;  2LHI A;  1NSH A;  1OMD A;  2H2K A;  3GOF A;  3I5F B;  3MSE B;  2LUC A;  4YGC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...