3I5FB

Crystal structure of squid mg.adp myosin s1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
145
structure length
145
Chain Sequence
RVKLSQRQMQELKEAFTMIDQDRDGFIGMEDLKDMFSSLGRVPPDDELNAMLKECPGQLNFTAFLTLFGEKVSGTDPEDALRNAFSMFDEDGQGFIPEDYLKDLLENMGDNFSKEEIKNVWKDAPLKNKQFNYNKMVDIKGKAED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain isoform A
publication title Rigor-like structures from muscle myosins reveal key mechanical elements in the transduction pathways of this allosteric motor.
pubmed doi rcsb
molecule tags Contractile protein
total genus 28
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2009-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3i5fB02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3i5fB01
1LVCD 1OSAA 1B4CA 5KTYA 1QIVA 1JSAA 1NX0A 1AHRA 1CNPA 1SCMC 1JBAA 2JNXA 3F45A 1XFWO 1DF0B 2L51A 1G33A 2ZNEA 5F6TA 2NLNA 1NCXA 2I94A 2JTTA 2LM5A 1J7RA 3VRNA 3K21A 5CSIA 1KQVA 1KQMB 1BR4B 1SMGA 1UHIA 2AUCA 5J3XA 4JWQA 2IS9A 3TDUA 1K90D 1QLSA 2SCPA 2EHBA 1S36A 2L5XB 4WRIA 1OOJA 2KI4C 1KWOC 1DJZA 1BT6A 2M7NA 3I5GB 1DJGA 3BUXB 4MRXA 3A8RA 3KPXA 5AEQA 1QVIZ 2E30A 1MUXA 5DKNA 3NSKA 4CLNA 1AJ5A 1NCYA 5AFPA 5FYXA 2KAVA 2JXLA 1F71A 4CFRA 2BECA 4N1GA 1L2OC 4BY4A 4QJ4B 2BCXA 2I2RE 1A75A 2NCOA 2JPTA 2H2KA 3GOFA 2KBMA 2JT3A 2MJWB 1CB1A 1BJFA 1YURA 4NDBA 1Y1AA 2LUXA 1LA0A 2JXCA 1QIWA 1TTXA 1XFUO 2M1KB 1TNWA 1AK8A 1RK9A 3I5HC 3AKAA 1A29A 4D1EA 1DJYA 1BF5A 1V1FA 2LVJA 4I5JA 3CLNA 1C07A 5ER4X 4AQJA 3WHTB 1K9PA 4A4BA 5IBWA 1B7TY 3ICBA 3MSEB 4HRGA 1SCMB 4DCKA 1WLMA 2KYFA 4QJ3B 1CM1A 1AJ4A 4IL1A 3NSLA 2BBMA 1TCFA 3OP0A 4M2PA 2AMIA 1XFVO 3DF0A 3PFVA 4YBHB 4DRWA 1DJIA 1ALVA 3LLEA 1JFJA 1S1EA 1J7OA 1Y1UA 1FI6A 1CDMA 2Y4QA 1B1GA 3TS5C 3NXAA 4GAOA 1F8HA 1WY9A 2WCBA 3QRXA 3AAKA 1YVHA 2F2PA 2R2IA 1JUOA 1YX7A 2BKHB 4DS7A 2KI4B 1KWOB 2Y1NA 2ZN9A 5PALA 1Q80A 1DTLA 1KSOA 3PN7C 2JT8A 2KDHA 1KK7Z 1CTRA 1K8UA 1QXPA 4ICBA 4MZJA 4CPVA 3GK4X 1XFZO 4PE7A 1UP5A 1FW4A 1QTXA 1TIZA 3DVEA 1K9KA 2L4HA 2MAZA 1NX2A 2HF5A 1B8LA 1L2OB 1MQ1A 2K7OA 1WLZA 4M2QA 5KU1A 1KFUS 2L4IA 1XFXO 3A4UB 2JT0A 1KCYA 3BXKA 3VRRA 2LP3A 2WCFA 2LV7A 3JTDC 1GGZA 1R2UA 3VRPA 1Y0VH 1NX1A 4XJKA 1CMGA 2KGRA 2M8UA 3EK8A 1SL9A 2O60A 3E3RA 3I5HB 2FJUB 4OKHA 1AVSA 1ZFSA 1F70A 5CSFA 2KYCA 2NXQA 2KAYA 4OCIA 1IG5A 2MRDA 3TZ1A 5HKZA 1LINA 4GGNA 4GGFA 1UHJA 1DF0A 2KNEA 2KGBC 1YX8A 2M1UA 2AAOA 2TN4A 2WC8A 1M45A 1DJWA 2GV5A 1E8AA 4FTGA 4CIDA 1EH2A 1XFYO 1FPWA 1OE9B 1WRKA 1OMVA 1QV0A 1C7WA 1K94A 4F0ZB 1JWDA 3VGOA 1CDPA 3D10A 1N2DA 2LVIA 1D1OA 1XK4C 1KSMA 1RWYA 1MHOA 2LC5A 4MBEA 1FBVA 1TOPA 4YGDB 3O2PA 3TDIA 3PN7B 1S3PA 1CLLA 2QACA 4USLA 2KI6D 1LKJA 2PSRA 1AP4A 2MLFC 2RGIA 2WOSA 3NSIA 1UURA 1K9UA 4OR9B 3SG5A 5I2OA 1B7TZ 1IWQA 1QX2A 5HKWA 3DD4A 1YUUA 1CFPA 5K89A 1XA5A 4YI8A 4GUKA 1K95A 4PE0A 2LNKA 2PASA 2KSPA 1QJTA 1EG4A 1IGVA 1YRUB 1EL4A 1W7IB 2M29A 4GBAA 3WNXB 2H61C 2A4JA 2LLSA 2L2EA 2LVKA 3PSRA 2I18A 5B8IB 2PRUA 3OX6A 4P2YB 2CXJA 1KFUL 1WRZA 3JTDB 4YGEB 3JVTC 1NSHA 4ZCVA 2BCBA 4WQ3A 4AOMA 2BL0C 4Q04A 1IKUA 2G2BA 2JWWA 1DJXA 2Q91A 2HETA 1PVBA 2JRFA 3BOWB 1KFXS 2GGZA 3CS1A 1B8CA 2JZIA 3OB1B 5HKYA 1N0YA 4C0LA 4YRUA 1YUSA 5CSNA 1NYAA 1SPYA 4DUQA 1N65A 1F54A 1KK8C 3EK4A 1QX5B 2JU0A 1IQ3A 1XVJA 1U5IB 4HSZA 1BLQA 1HT9A 1R6PA 2BE6A 1PSRA 2F8PA 2KQ6A 2PALA 1IQ5A 1PULA 2Y1MA 2WNDA 1PK0D 4JPZB 1SKTA 3D0YB 3EVVA 3ZNIA 1OMDA 3OX5A 2V53A 1S6CA 4BY5A 1MR8A 1OMRA 3EKHA 4HRHA 2KQYA 1B9AA 2FOTA 3O4YA 1QVIY 1SRAA 3SJSA 3HX4A 5TNCA 2K7DA 1F4QA 2M3WA 1ALWA 1M46A 3FIAA 2MA2A 3DVMA 1CDNA 1SR6C 4MRYA 3SIBA 3LK1A 1WDCC 1BR1B 2K7CA 3TUYC 2M9GA 5HLOA 2K0JA 3PALA 3BUNB 4C0JA 2NCPA 2LMUA 1VRKA 2JULA 1NIWA 3I5IC 4YI9A 4P5OE 1B47A 2LLUA 1CKKA 5JJGA 2ZRTA 5G08A 2KI6C 1S5GY 3SG4A 4DIRA 3BUOB 3M0WA 1CLMA 3JVTB 2LANA 2ISDA 1GGWA 2BL0B 2CCMA 3SG7A 1QATA 1DT7B 1F55A 1NWDA 1ZUZA 1CFFA 4U8DA 1HQVA 2EGDA 2LUCA 1MXLC 2WORA 1X02A 3FWCA 1YR5A 2K8MB 2LMTA 1BU3A 2KOTA 1NP8A 1OZOA 2G9BA 2E6WA 4MLWA 1JFKA 2P6BB 1DJHA 2K2FA 3HCMA 1F4OA 3SIAA 1UUSA 4C0KA 1IRJA 1K96A 3CZTX 1KFXL 1ODBA 5HYDA 2OPOA 4PHNA 1EJ3A 1YVLA 2EC6C 2JQ6A 1TNPA 1KK8B 1JC2A 2PMYA 2LHIA 1YUTA 4WQ2A 3IF7A 1GJYA 1J55A 4PDZA 3KF9A 5D7FA 2BBNA 2JOJA 3TS5B 4JQ0D 2HPSA 3H4SE 2KFHA 1KK7Y 1BG1A 4MZKA 1QV1A 1DGUA 2BKIB 2HQ8A 1QS7A 1A03A 2JC2A 1J1EA 5DKRA 2LHLA 1SW8A 4N5XA 2LP2A 2ZFDA 1ZMZA 5CPVA 1AUIB 1SL8A 4TNCA 4ZCUA 2NZ0A 1SR6B 3CR5X 3EVUA 1BMOA 4HREE 4I5LB 1WDCB 2FCEA 2OTGC 3BUMB 4MN0A 3TUYB 1CDLA 4R1EA 1K93D 2LVVA 3LK0A 2M0RA 1J7PA 1UWOA 1SCVA 2ZRSA 1QX7A 3IQOA 1ZACA 2OS8C 3KO0A 5I2LA 3SG2A 2LMVA 3I5IB 2F33A 4NDCA 2M7LA 5HLVA 1DMOA 1J1DA 4E68A 2KFFA 4ETOA 3CR2A 2F3YA 1S6JA 2K61A 2MBXA 5BPJA 1BODA 3GK2A 1TN4A 2KHNA 5AANA 1M39A 2D8NA 4YGAA 2F3ZA 3RLZA 1LXFC 1YRTB 4PHKA 4UPGA 4PHMA 2JNFA 2HQWA 3I5FC 2BE4A 1CLBA 2B1UA 3BOWA 1XO5A 1W7JB 2LCPA 5I2QA 1UHNA 1CFCA 1SYMA 2GGMA 1WRLA 3EKJA 4CFQA 3CR4X 2LLTA 1RTP1 1EG3A 3FWBA 3OB2B 1C7VA 1NCZA 1QASA 1BOCA 1A4PA 1V1GA 2QPTA 1SL7A 1SY9A 2WCEA 1U5IA 1CMFA 2EC6B 5D69A 1ZOTB 3LCPC 3WHUB 1LA3A 1A75B 1IJ6A 3GK1A 3TDZA 2JTZA 2K7BA 3D0YA 4ORBB 1K2HA 4I5NB 4PE1A 1XK4A 1PSBA 2CBLA 4MEWA 4NQGA 1H4BA 1S5GZ 1TCOB 3SG6A 1UHKA 4MSPA 1SBJA 3CWGA 2KFGA 1RJVA 3O6BA 3OHMB 1XYDA 4QJ5B 2LAPA 4YGBB 3KHEA 3C1VA 3EK7A 2ZNDA 2L0PA 1CM4A 1JF2A 2MLEC 1G8IA 3SG3A 1UHHA 3NSOA 4GPLB 1GQMA 3BYAA 4OV2A 3EVRA 1FF1A 2OTGB 3KEVA 5AXIA 1FI5A 1DGVA 4GGFC 1Y6WA 1TNQA 4PCWA 1M63B 1CFDA 2OS8B 4ORCB 4FQOA 4XYNA 3VRQA 1MF8B 2F2OA 2H61A 1OZSA 4N1FA 1RROA 3DF0B 4ORAB 1B8RA 3DVKA 2KBIA 1L7ZA 2LE9B 4PE4A 1PRWA 1S26D 1YTZC 1KQMC 2ZKMX 3ZWHA 1SK6D 1EXRA 1MXEA 2BCAA 2I7AA 2SASA 2FCDA 4M2OA 3AKBA 5DKQA 4AQIA 1M31A 1PALA 1S6IA 1RECA 2ZN8A 3PATA 5CSJA 4GFTA 2MHHA 3CGAA 3WXAA 1H8BA 5I8NA 1PVAA 2Q4UA 3I5GC 3DVJA 1NUBA 3I5FB 5ER5A 2L98A 3CTNA 2CNPA 1MWNA 3PM8A 1SNLA 3PLFB 4I5KA 2CTNA 2Y5IA 2L50A 1G4YR 3AAJA 4GNKB 4A4CA 1NX3A 2M97A 2VRGA 4MZLA 1Y1XA 3IQQA 3VROA 1IH0A 2M49B 2COLB 1NPQA 1QLKA 5GQQC 2PVBA 5AERA 1A2XA 4YGCB 2CT9A 1TRFA 4L9MA 1J7QA 3FS7A 4OVNF 1JF0A 4NDDA 1DVIA 2K2AA 3O78A 3BQ3A 5KSZA 4PALA 4PHJA 1RFJA 2KAXA 2DOQA 1OQPA 3LL8B 1IJ5A 5JOLA 1TNXA 4XJKB 2O5GA 3BUWB 3RM1A 4MVFA
chains in the Genus database with same CATH superfamily
1LVCD 1OSAA 1B4CA 5KTYA 1QIVA 1DELA 1JSAA 3NHTA 1NX0A 1AHRA 1CNPA 1SCMC 1JBAA 2JNXA 3F45A 3SS5A 1XFWO 1DF0B 2L51A 2QEBA 1G33A 2ZNEA 5F6TA 2NLNA 1NCXA 2I94A 3B7AA 2JTTA 2LM5A 1J7RA 3VRNA 3K21A 5CSIA 3CZ0A 1KQVA 1KQMB 1UHIA 1BR4B 1SMGA 2AUCA 5J3XA 4JWQA 2IS9A 3TDUA 1K90D 1QLSA 2SCPA 2EHBA 1S36A 2L5XB 4WRIA 3S0DA 1OOJA 2KI4C 1KWOC 1DJZA 1BT6A 2M7NA 3I5GB 1DJGA 3BUXB 1IIOA 4MRXA 3A8RA 3KPXA 3CYZA 5AEQA 1QVIZ 2E30A 1MUXA 5DKNA 3L4LA 3EG5B 4F7FA 3NSKA 2WCMA 4CLNA 1AJ5A 1NCYA 5AFPA 5FYXA 2KAVA 2JXLA 1F71A 4CFRA 2BECA 4N1GA 1L2OC 4BY4A 4QJ4B 2BCXA 2PQLA 2I2RE 1A75A 2NCOA 1DC1A 2JPTA 2H2KA 3GOFA 2KBMA 2JT3A 2MJWB 1CB1A 1BJFA 1YURA 3L47A 4NDBA 1Y1AA 2LUXA 1LA0A 2JXCA 1QIWA 1TTXA 1XFUO 2M1KB 1TNWA 3SS3A 1RK9A 3I5HC 1AK8A 3AKAA 1A29A 4D1EA 1DJYA 1BF5A 1SSEB 1V1FA 2LVJA 3NGVA 4I5JA 3CLNA 1C07A 5ER4X 4AQJA 3WHTB 1K9PA 3BFAA 4A4BA 5IBWA 1B7TY 3ICBA 3MSEB 4HRGA 1SCMB 4DCKA 1WLMA 2KYFA 4QJ3B 1CM1A 1AJ4A 4IL1A 3NSLA 2BBMA 2QEOA 1TCFA 3OP0A 4M2PA 2AMIA 1XFVO 3DF0A 3PFVA 4YBHB 4DRWA 1DJIA 1ALVA 3LLEA 1JFJA 1S1EA 1J7OA 1Y1UA 1FI6A 1CDMA 2Y4QA 1B1GA 3TS5C 3NXAA 4GAOA 1F8HA 1QWVA 1WY9A 3B87A 2WCBA 2L2CA 3PJIA 3QRXA 3AAKA 1YVHA 2F2PA 2R2IA 1C3YA 1JUOA 1YX7A 2BKHB 1Z2CB 4DS7A 2KI4B 1KWOB 2Y1NA 2ZN9A 3K1EA 5PALA 1Q80A 1DTLA 1KSOA 1OOHA 3PN7C 2JT8A 2KDHA 1KK7Z 1CTRA 1OW4A 2JPOA 1K8UA 1QXPA 4ICBA 4MZJA 3UO9A 4CPVA 3GK4X 1XFZO 4PT1A 2KLEA 4PE7A 1UP5A 3S0GA 1FW4A 1QTXA 3R1OA 1TIZA 3DVEA 1K9KA 3D74A 2L4HA 2MAZA 2WCJA 1NX2A 3D76A 2HF5A 1B8LA 1L2OB 1MQ1A 2K7OA 1WLZA 1GM0A 4M2QA 5KU1A 1KFUS 2L4IA 1XFXO 1P28A 2WC5A 4INWA 3A4UB 2JT0A 1KCYA 3BXKA 3VRRA 2LP3A 2WCFA 2LV7A 3JTDC 1GGZA 1R2UA 3VRPA 1Y0VH 1NX1A 2ERBA 4XJKA 2KGRA 2M8UA 3EK8A 1SL9A 2O60A 3E3RA 3I5HB 2FJUB 3S0FA 4OKHA 1AVSA 1ZFSA 1F70A 5CSFA 2KYCA 2NXQA 3CABA 2KAYA 2FJYA 4OCIA 1IG5A 2MRDA 3TZ1A 1DQEA 5HKZA 1LINA 4GGNA 4GGFA 1UHJA 1DF0A 2KNEA 2KGBC 2WCLA 1YX8A 2M1UA 2AAOA 2TN4A 2WC8A 1M45A 1DJWA 2GV5A 1E8AA 1W9ZA 4FQTA 4FTGA 4CIDA 1EH2A 1XFYO 1FPWA 1OE9B 1WRKA 1OMVA 3B88A 1QV0A 1C7WA 1K94A 4F0ZB 1JWDA 3VGOA 1CDPA 3D10A 1N2DA 2LVIA 1D1OA 1XK4C 1KSMA 1RWYA 1MHOA 1OOFA 2LC5A 4MBEA 1FBVA 1TOPA 4YGDB 3O2PA 3TDIA 3PN7B 1S3PA 1CLLA 3DY9A 2QACA 4USLA 2KI6D 1LKJA 2PSRA 1AP4A 2MLFC 2RGIA 2KPHA 2P70A 2WOSA 3NSIA 1UURA 1K9UA 4OR9B 3SG5A 5I2OA 1B7TZ 1IWQA 1QX2A 5HKWA 3DD4A 1YUUA 1CFPA 5K89A 1XA5A 4YI8A 4GUKA 4CFQA 1K95A 4PE0A 2LNKA 2PASA 2KSPA 1QJTA 1EG4A 1IGVA 1YRUB 2BNXA 1EL4A 1W7IB 2M29A 4GBAA 3WNXB 2H61C 1DEKA 2A4JA 2L2EA 2LLSA 2LVKA 2I18A 3PSRA 2PRUA 3OX6A 5B8IB 4JD9A 4P2YB 2CXJA 1KFUL 1WRZA 3JTDB 3FE9A 3JVTC 1NSHA 4YGEB 1Z4HA 4ZCVA 2BCBA 4WQ3A 5EL2A 4AOMA 3L4AA 2BL0C 4Q04A 1IKUA 2G2BA 2JWWA 1DJXA 2Q91A 2HETA 1PVBA 2JRFA 2QEHA 4INXA 3BOWB 1KFXS 2GGZA 3CS1A 1B8CA 2JZIA 3OB1B 5HKYA 1N0YA 4C0LA 1T14A 4YRUA 2QDIA 1YUSA 5CSNA 1NYAA 1SPYA 4DUQA 1N65A 1F54A 1KK8C 3EK4A 1QX5B 2JU0A 3DXLA 1XVJA 1U5IB 1TUZA 4HSZA 1IQ3A 1BLQA 1HT9A 1R6PA 2BE6A 1PSRA 2F8PA 2KQ6A 2PALA 1IQ5A 1PULA 2Y1MA 2WNDA 1PK0D 3S0BA 3S0AA 4JPZB 1SKTA 3D0YB 3DZTA 3EVVA 3ZNIA 1OMDA 3OX5A 2V53A 1S6CA 4BY5A 1MR8A 1OMRA 1ORGA 3EKHA 4HRHA 2KQYA 1B9AA 2FOTA 3O4YA 1QVIY 1SRAA 3SJSA 3HX4A 5TNCA 2K7DA 1F4QA 2M3WA 1ALWA 1M46A 2H8VA 2MA2A 3FIAA 3DVMA 2WCKA 1CDNA 1SR6C 4MRYA 3SIBA 1TWOA 1WDCC 1BR1B 2K7CA 3LK1A 5D3OA 3TUYC 2M9GA 5HLOA 2K0JA 3PALA 3NHIA 3BUNB 3V2LA 4C0JA 2NCPA 2LMUA 1VRKA 2JULA 1NIWA 3I5IC 4YI9A 4P5OE 1B47A 2LLUA 1CKKA 5JJGA 2ZRTA 5G08A 3R1VA 2KI6C 1S5GY 3SG4A 3D78A 4DIRA 3BUOB 3M0WA 1CLMA 3JVTB 2LANA 2ISDA 1GGWA 2BL0B 2CCMA 3SG7A 1QATA 1DT7B 1F55A 1NWDA 1ZUZA 1CFFA 4U8DA 1HQVA 2EGDA 2LUCA 1MXLC 2WORA 1X02A 3FWCA 1YR5A 2K8MB 5I94A 2LMTA 1BU3A 2KOTA 1NP8A 3CZ1A 1OZOA 2G9BA 2E6WA 4MLWA 1JFKA 2P6BB 1DJHA 2K2FA 3HCMA 1F4OA 3SIAA 1UUSA 4C0KA 1IRJA 1K96A 3CZTX 1KFXL 1ODBA 5HYDA 2OPOA 4PHNA 1EJ3A 1YVLA 2EC6C 2JQ6A 1TNPA 1KK8B 3R1PA 1JC2A 2PMYA 2LHIA 1YUTA 4WQ2A 1LS8A 1GJYA 3IF7A 1J55A 4PDZA 3KF9A 5D7FA 2BBNA 2JOJA 3TS5B 4JQ0D 2HPSA 3H4SE 2KFHA 1KK7Y 1BG1A 1XFRA 3FE6A 1QV1A 1DGUA 2BKIB 2HQ8A 1QS7A 4MZKA 5HL1A 2JC2A 1A03A 1J1EA 5DKRA 2LHLA 1SW8A 4N5XA 2LP2A 3R72A 2ZFDA 1ZMZA 5CPVA 1AUIB 1SL8A 4TNCA 4ZCUA 2NZ0A 2PYQA 1SR6B 3CR5X 3EVUA 1BMOA 4HREE 4I5LB 1WDCB 2FCEA 2OTGC 3BUMB 3CZ2A 4MN0A 1CDLA 3TUYB 4R1EA 1K93D 2LVVA 3LK0A 3B6XA 5FI7A 2M0RA 1J7PA 1UWOA 3S0EA 1SCVA 2ZRSA 1QX7A 3IQOA 1ZACA 2OS8C 3KO0A 3D77A 5I2LA 2LMVA 3I5IB 2F33A 3SG2A 4NDCA 2M7LA 5HLVA 1DMOA 1J1DA 4E68A 2KFFA 4ETOA 1CMGA 3FE8A 3CR2A 2F3YA 1S6JA 2K61A 2MBXA 5BPJA 1BODA 3GK2A 1TN4A 2KHNA 3BFHA 1M39A 5AANA 2D8NA 2P71A 4YGAA 2F3ZA 3RLZA 3QMEA 1OOGA 1LXFC 1YRTB 4PHKA 4UPGA 4PHMA 2JNFA 2HQWA 3I5FC 2BE4A 1CLBA 2B1UA 2K60A 3BOWA 1XO5A 1W7JB 2LCPA 5I2QA 1UHNA 1CFCA 1SYMA 2GGMA 1WRLA 3EKJA 3OBVA 3CR4X 2LLTA 3D75A 1RTP1 1EG3A 3FWBA 3OB2B 1C7VA 1NCZA 1QASA 1BOCA 1A4PA 1V1GA 2QPTA 3B86A 2WC6A 1SL7A 1TUJA 1SY9A 2WCEA 3CDNA 1U5IA 1CMFA 2EC6B 5D69A 1ZOTB 3LCPC 3WHUB 3UNWA 1LA3A 1A75B 1IJ6A 3GK1A 3TDZA 2JTZA 2K7BA 3D0YA 4ORBB 1K2HA 4I5NB 4PE1A 1XK4A 1PSBA 2CBLA 4MEWA 4NQGA 1H4BA 1S5GZ 1TCOB 3SG6A 3IVTA 1UHKA 4MSPA 1SBJA 3N7HA 3CWGA 2KFGA 1RJVA 3O6BA 3OHMB 1XYDA 4QJ5B 2LAPA 4YGBB 3KHEA 3C1VA 3EK7A 2ZNDA 2L0PA 1CM4A 1JF2A 2MLEC 1G8IA 3SG3A 1UHHA 3NSOA 4GPLB 1GQMA 3BYAA 4OV2A 3BJHA 3EVRA 1FF1A 2OTGB 3KEVA 5AXIA 3PM2A 1FI5A 1DGVA 2BAPA 4GGFC 1Y6WA 1TNQA 4PCWA 1M63B 1CFDA 2OS8B 4ORCB 4FQOA 4XYNA 1OOIX 3VRQA 1MF8B 2F2OA 2H61A 1OZSA 4N1FA 1RROA 3DF0B 4ORAB 1B8RA 3DVKA 2KBIA 1L7ZA 2LE9B 2KLDA 4PE4A 1PRWA 1S26D 4OZDA 1YTZC 1KQMC 2ZKMX 3ZWHA 1SK6D 1EXRA 1MXEA 2BCAA 2I7AA 2SASA 2FCDA 4M2OA 3AKBA 5DKQA 4AQIA 1M31A 3RZSA 1PALA 1S6IA 1RECA 2GTEA 2ZN8A 3PATA 4IJ7A 5CSJA 4GFTA 3VB1A 2MHHA 3CGAA 3WXAA 1H8BA 5I8NA 1PVAA 2Q4UA 3I5GC 3DVJA 1NUBA 3I5FB 5ER5A 2L98A 3CTNA 2CNPA 1MWNA 3PM8A 5FI2A 1SNLA 3PLFB 4I5KA 3O4XA 2CTNA 2Y5IA 2L50A 1G4YR 3AAJA 4GNKB 4A4CA 1NX3A 2M97A 3Q8IA 2VRGA 4MZLA 1Y1XA 3IQQA 3VROA 1IH0A 2M49B 2L5YA 2COLB 1NPQA 4JKTA 1QLKA 5GQQC 2PVBA 5AERA 2WCHA 3DYEA 1A2XA 4KYNA 2CT9A 4YGCB 1TRFA 4L9MA 1J7QA 3FS7A 5FI6A 4OVNF 1JF0A 4NDDA 1C3ZA 2YGUA 1DVIA 2K2AA 3O78A 3BQ3A 3D73A 5KSZA 3SS4A 2QEVA 4PALA 4PHJA 1RFJA 3BFBA 2KAXA 2DOQA 5DICA 1OQPA 3LL8B 1IJ5A 5JOLA 1TNXA 4XJKB 2O5GA 3BUWB 3RM1A 4MVFA 3OGNA
chains in the Genus database with same CATH topology
1LVCD 1OSAA 1B4CA 5KTYA 1QIVA 1JSAA 1NX0A 1AHRA 1CNPA 1SCMC 1JBAA 2JNXA 3F45A 1XFWO 1DF0B 2L51A 1G33A 2ZNEA 5F6TA 2NLNA 1NCXA 2I94A 2JTTA 2LM5A 1J7RA 3VRNA 3K21A 5CSIA 1KQVA 1KQMB 1BR4B 1SMGA 1UHIA 2AUCA 5J3XA 4JWQA 2IS9A 3TDUA 1K90D 1QLSA 2SCPA 2EHBA 1S36A 2L5XB 4WRIA 1OOJA 2KI4C 1KWOC 1DJZA 1BT6A 2M7NA 3I5GB 1DJGA 3BUXB 4MRXA 3A8RA 3KPXA 5AEQA 1QVIZ 2E30A 1MUXA 5DKNA 3NSKA 4CLNA 1AJ5A 1NCYA 5AFPA 5FYXA 2KAVA 2JXLA 1F71A 4CFRA 2BECA 4N1GA 1L2OC 4BY4A 4QJ4B 2BCXA 2I2RE 1A75A 2NCOA 2JPTA 2H2KA 3GOFA 2KBMA 2JT3A 2MJWB 1CB1A 1BJFA 1YURA 4NDBA 1Y1AA 2LUXA 1LA0A 2JXCA 1QIWA 1TTXA 1XFUO 2M1KB 1TNWA 1AK8A 1RK9A 3I5HC 3AKAA 1A29A 4D1EA 1DJYA 1BF5A 1V1FA 2LVJA 4I5JA 3CLNA 1C07A 5ER4X 4AQJA 3WHTB 1K9PA 4A4BA 5IBWA 1B7TY 3ICBA 3MSEB 4HRGA 1SCMB 4DCKA 1WLMA 2KYFA 4QJ3B 1CM1A 1AJ4A 4IL1A 3NSLA 2BBMA 1TCFA 3OP0A 4M2PA 2AMIA 1XFVO 3DF0A 3PFVA 4YBHB 4DRWA 1DJIA 1ALVA 3LLEA 1JFJA 1S1EA 1J7OA 1Y1UA 1FI6A 1CDMA 2Y4QA 1B1GA 3TS5C 3NXAA 4GAOA 1F8HA 1WY9A 2WCBA 3QRXA 3AAKA 1YVHA 2F2PA 2R2IA 1JUOA 1YX7A 2BKHB 4DS7A 2KI4B 1KWOB 2Y1NA 2ZN9A 5PALA 1Q80A 1DTLA 1KSOA 3PN7C 2JT8A 2KDHA 1KK7Z 1CTRA 1K8UA 1QXPA 4ICBA 4MZJA 4CPVA 3GK4X 1XFZO 4PE7A 1UP5A 1FW4A 1QTXA 1TIZA 3DVEA 1K9KA 2L4HA 2MAZA 1NX2A 2HF5A 1B8LA 1L2OB 1MQ1A 2K7OA 1WLZA 4M2QA 5KU1A 1KFUS 2L4IA 1XFXO 3A4UB 2JT0A 1KCYA 3BXKA 3VRRA 2LP3A 2WCFA 2LV7A 3JTDC 1GGZA 1R2UA 3VRPA 1Y0VH 1NX1A 4XJKA 1CMGA 2KGRA 2M8UA 3EK8A 1SL9A 2O60A 3E3RA 3I5HB 2FJUB 4OKHA 1AVSA 1ZFSA 1F70A 5CSFA 2KYCA 2NXQA 2KAYA 4OCIA 1IG5A 2MRDA 3TZ1A 5HKZA 1LINA 4GGNA 4GGFA 1UHJA 1DF0A 2KNEA 2KGBC 1YX8A 2M1UA 2AAOA 2TN4A 2WC8A 1M45A 1DJWA 2GV5A 1E8AA 4FTGA 4CIDA 1EH2A 1XFYO 1FPWA 1OE9B 1WRKA 1OMVA 1QV0A 1C7WA 1K94A 4F0ZB 1JWDA 3VGOA 1CDPA 3D10A 1N2DA 2LVIA 1D1OA 1XK4C 1KSMA 1RWYA 1MHOA 2LC5A 4MBEA 1FBVA 1TOPA 4YGDB 3O2PA 3TDIA 3PN7B 1S3PA 1CLLA 2QACA 4USLA 2KI6D 1LKJA 2PSRA 1AP4A 2MLFC 2RGIA 2WOSA 3NSIA 1UURA 1K9UA 4OR9B 3SG5A 5I2OA 1B7TZ 1IWQA 1QX2A 5HKWA 3DD4A 1YUUA 1CFPA 5K89A 1XA5A 4YI8A 4GUKA 1K95A 4PE0A 2LNKA 2PASA 2KSPA 1QJTA 1EG4A 1IGVA 1YRUB 1EL4A 1W7IB 2M29A 4GBAA 3WNXB 2H61C 2A4JA 2LLSA 2L2EA 2LVKA 3PSRA 2I18A 5B8IB 2PRUA 3OX6A 4P2YB 2CXJA 1KFUL 1WRZA 3JTDB 4YGEB 3JVTC 1NSHA 4ZCVA 2BCBA 4WQ3A 4AOMA 2BL0C 4Q04A 1IKUA 2G2BA 2JWWA 1DJXA 2Q91A 2HETA 1PVBA 2JRFA 3BOWB 1KFXS 2GGZA 3CS1A 1B8CA 2JZIA 3OB1B 5HKYA 1N0YA 4C0LA 4YRUA 1YUSA 5CSNA 1NYAA 1SPYA 4DUQA 1N65A 1F54A 1KK8C 3EK4A 1QX5B 2JU0A 1IQ3A 1XVJA 1U5IB 4HSZA 1BLQA 1HT9A 1R6PA 2BE6A 1PSRA 2F8PA 2KQ6A 2PALA 1IQ5A 1PULA 2Y1MA 2WNDA 1PK0D 4JPZB 1SKTA 3D0YB 3EVVA 3ZNIA 1OMDA 3OX5A 2V53A 1S6CA 4BY5A 1MR8A 1OMRA 3EKHA 4HRHA 2KQYA 1B9AA 2FOTA 3O4YA 1QVIY 1SRAA 3SJSA 3HX4A 5TNCA 2K7DA 1F4QA 2M3WA 1ALWA 1M46A 3FIAA 2MA2A 3DVMA 1CDNA 1SR6C 4MRYA 3SIBA 3LK1A 1WDCC 1BR1B 2K7CA 3TUYC 2M9GA 5HLOA 2K0JA 3PALA 3BUNB 4C0JA 2NCPA 2LMUA 1VRKA 2JULA 1NIWA 3I5IC 4YI9A 4P5OE 1B47A 2LLUA 1CKKA 5JJGA 2ZRTA 5G08A 2KI6C 1S5GY 3SG4A 4DIRA 3BUOB 3M0WA 1CLMA 3JVTB 2LANA 2ISDA 1GGWA 2BL0B 2CCMA 3SG7A 1QATA 1DT7B 1F55A 1NWDA 1ZUZA 1CFFA 4U8DA 1HQVA 2EGDA 2LUCA 1MXLC 2WORA 1X02A 3FWCA 1YR5A 2K8MB 2LMTA 1BU3A 2KOTA 1NP8A 1OZOA 2G9BA 2E6WA 4MLWA 1JFKA 2P6BB 1DJHA 2K2FA 3HCMA 1F4OA 3SIAA 1UUSA 4C0KA 1IRJA 1K96A 3CZTX 1KFXL 1ODBA 5HYDA 2OPOA 4PHNA 1EJ3A 1YVLA 2EC6C 2JQ6A 1TNPA 1KK8B 1JC2A 2PMYA 2LHIA 1YUTA 4WQ2A 3IF7A 1GJYA 1J55A 4PDZA 3KF9A 5D7FA 2BBNA 2JOJA 3TS5B 4JQ0D 2HPSA 3H4SE 2KFHA 1KK7Y 1BG1A 4MZKA 1QV1A 1DGUA 2BKIB 2HQ8A 1QS7A 1A03A 2JC2A 1J1EA 5DKRA 2LHLA 1SW8A 4N5XA 2LP2A 2ZFDA 1ZMZA 5CPVA 1AUIB 1SL8A 4TNCA 4ZCUA 2NZ0A 1SR6B 3CR5X 3EVUA 1BMOA 4HREE 4I5LB 1WDCB 2FCEA 2OTGC 3BUMB 4MN0A 3TUYB 1CDLA 4R1EA 1K93D 2LVVA 3LK0A 2M0RA 1J7PA 1UWOA 1SCVA 2ZRSA 1QX7A 3IQOA 1ZACA 2OS8C 3KO0A 5I2LA 3SG2A 2LMVA 3I5IB 2F33A 4NDCA 2M7LA 5HLVA 1DMOA 1J1DA 4E68A 2KFFA 4ETOA 3CR2A 2F3YA 1S6JA 2K61A 2MBXA 5BPJA 1BODA 3GK2A 1TN4A 2KHNA 5AANA 1M39A 2D8NA 4YGAA 2F3ZA 3RLZA 1LXFC 1YRTB 4PHKA 4UPGA 4PHMA 2JNFA 2HQWA 3I5FC 2BE4A 1CLBA 2B1UA 3BOWA 1XO5A 1W7JB 2LCPA 5I2QA 1UHNA 1CFCA 1SYMA 2GGMA 1WRLA 3EKJA 4CFQA 3CR4X 2LLTA 1RTP1 1EG3A 3FWBA 3OB2B 1C7VA 1NCZA 1QASA 1BOCA 1A4PA 1V1GA 2QPTA 1SL7A 1SY9A 2WCEA 1U5IA 1CMFA 2EC6B 5D69A 1ZOTB 3LCPC 3WHUB 1LA3A 1A75B 1IJ6A 3GK1A 3TDZA 2JTZA 2K7BA 3D0YA 4ORBB 1K2HA 4I5NB 4PE1A 1XK4A 1PSBA 2CBLA 4MEWA 4NQGA 1H4BA 1S5GZ 1TCOB 3SG6A 1UHKA 4MSPA 1SBJA 3CWGA 2KFGA 1RJVA 3O6BA 3OHMB 1XYDA 4QJ5B 2LAPA 4YGBB 3KHEA 3C1VA 3EK7A 2ZNDA 2L0PA 1CM4A 1JF2A 2MLEC 1G8IA 3SG3A 1UHHA 3NSOA 4GPLB 1GQMA 3BYAA 4OV2A 3EVRA 1FF1A 2OTGB 3KEVA 5AXIA 1FI5A 1DGVA 4GGFC 1Y6WA 1TNQA 4PCWA 1M63B 1CFDA 2OS8B 4ORCB 4FQOA 4XYNA 3VRQA 1MF8B 2F2OA 2H61A 1OZSA 4N1FA 1RROA 3DF0B 4ORAB 1B8RA 3DVKA 2KBIA 1L7ZA 2LE9B 4PE4A 1PRWA 1S26D 1YTZC 1KQMC 2ZKMX 3ZWHA 1SK6D 1EXRA 1MXEA 2BCAA 2I7AA 2SASA 2FCDA 4M2OA 3AKBA 5DKQA 4AQIA 1M31A 1PALA 1S6IA 1RECA 2ZN8A 3PATA 5CSJA 4GFTA 2MHHA 3CGAA 3WXAA 1H8BA 5I8NA 1PVAA 2Q4UA 3I5GC 3DVJA 1NUBA 3I5FB 5ER5A 2L98A 3CTNA 2CNPA 1MWNA 3PM8A 1SNLA 3PLFB 4I5KA 2CTNA 2Y5IA 2L50A 1G4YR 3AAJA 4GNKB 4A4CA 1NX3A 2M97A 2VRGA 4MZLA 1Y1XA 3IQQA 3VROA 1IH0A 2M49B 2COLB 1NPQA 1QLKA 5GQQC 2PVBA 5AERA 1A2XA 4YGCB 2CT9A 1TRFA 4L9MA 1J7QA 3FS7A 4OVNF 1JF0A 4NDDA 1DVIA 2K2AA 3O78A 3BQ3A 5KSZA 4PALA 4PHJA 1RFJA 2KAXA 2DOQA 1OQPA 3LL8B 1IJ5A 5JOLA 1TNXA 4XJKB 2O5GA 3BUWB 3RM1A 4MVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LVC D;  1OSA A;  1B4C A;  5KTY A;  1QIV A;  1JSA A;  1NX0 A;  1AHR A;  1CNP A;  1SCM C;  1JBA A;  2JNX A;  3F45 A;  1XFW O;  1DF0 B;  2L51 A;  1G33 A;  2ZNE A;  5F6T A;  2NLN A;  1NCX A;  2I94 A;  2JTT A;  2LM5 A;  1J7R A;  3VRN A;  3K21 A;  5CSI A;  1KQV A;  1KQM B;  1BR4 B;  1SMG A;  1UHI A;  2AUC A;  5J3X A;  4JWQ A;  2IS9 A;  3TDU A;  1K90 D;  1QLS A;  2SCP A;  2EHB A;  1S36 A;  2L5X B;  4WRI A;  1OOJ A;  2KI4 C;  1KWO C;  1DJZ A;  1BT6 A;  2M7N A;  3I5G B;  1DJG A;  3BUX B;  4MRX A;  3A8R A;  3KPX A;  5AEQ A;  1QVI Z;  2E30 A;  1MUX A;  5DKN A;  3NSK A;  4CLN A;  1AJ5 A;  1NCY A;  5AFP A;  5FYX A;  2KAV A;  2JXL A;  1F71 A;  4CFR A;  2BEC A;  4N1G A;  1L2O C;  4BY4 A;  4QJ4 B;  2BCX A;  2I2R E;  1A75 A;  2NCO A;  2JPT A;  2H2K A;  3GOF A;  2KBM A;  2JT3 A;  2MJW B;  1CB1 A;  1BJF A;  1YUR A;  4NDB A;  1Y1A A;  2LUX A;  1LA0 A;  2JXC A;  1QIW A;  1TTX A;  1XFU O;  2M1K B;  1TNW A;  1AK8 A;  1RK9 A;  3I5H C;  3AKA A;  1A29 A;  4D1E A;  1DJY A;  1BF5 A;  1V1F A;  2LVJ A;  4I5J A;  3CLN A;  1C07 A;  5ER4 X;  4AQJ A;  3WHT B;  1K9P A;  4A4B A;  5IBW A;  1B7T Y;  3ICB A;  3MSE B;  4HRG A;  1SCM B;  4DCK A;  1WLM A;  2KYF A;  4QJ3 B;  1CM1 A;  1AJ4 A;  4IL1 A;  3NSL A;  2BBM A;  1TCF A;  3OP0 A;  4M2P A;  2AMI A;  1XFV O;  3DF0 A;  3PFV A;  4YBH B;  4DRW A;  1DJI A;  1ALV A;  3LLE A;  1JFJ A;  1S1E A;  1J7O A;  1Y1U A;  1FI6 A;  1CDM A;  2Y4Q A;  1B1G A;  3TS5 C;  3NXA A;  4GAO A;  1F8H A;  1WY9 A;  2WCB A;  3QRX A;  3AAK A;  1YVH A;  2F2P A;  2R2I A;  1JUO A;  1YX7 A;  2BKH B;  4DS7 A;  2KI4 B;  1KWO B;  2Y1N A;  2ZN9 A;  5PAL A;  1Q80 A;  1DTL A;  1KSO A;  3PN7 C;  2JT8 A;  2KDH A;  1KK7 Z;  1CTR A;  1K8U A;  1QXP A;  4ICB A;  4MZJ A;  4CPV A;  3GK4 X;  1XFZ O;  4PE7 A;  1UP5 A;  1FW4 A;  1QTX A;  1TIZ A;  3DVE A;  1K9K A;  2L4H A;  2MAZ A;  1NX2 A;  2HF5 A;  1B8L A;  1L2O B;  1MQ1 A;  2K7O A;  1WLZ A;  4M2Q A;  5KU1 A;  1KFU S;  2L4I A;  1XFX O;  3A4U B;  2JT0 A;  1KCY A;  3BXK A;  3VRR A;  2LP3 A;  2WCF A;  2LV7 A;  3JTD C;  1GGZ A;  1R2U A;  3VRP A;  1Y0V H;  1NX1 A;  4XJK A;  1CMG A;  2KGR A;  2M8U A;  3EK8 A;  1SL9 A;  2O60 A;  3E3R A;  3I5H B;  2FJU B;  4OKH A;  1AVS A;  1ZFS A;  1F70 A;  5CSF A;  2KYC A;  2NXQ A;  2KAY A;  4OCI A;  1IG5 A;  2MRD A;  3TZ1 A;  5HKZ A;  1LIN A;  4GGN A;  4GGF A;  1UHJ A;  1DF0 A;  2KNE A;  2KGB C;  1YX8 A;  2M1U A;  2AAO A;  2TN4 A;  2WC8 A;  1M45 A;  1DJW A;  2GV5 A;  1E8A A;  4FTG A;  4CID A;  1EH2 A;  1XFY O;  1FPW A;  1OE9 B;  1WRK A;  1OMV A;  1QV0 A;  1C7W A;  1K94 A;  4F0Z B;  1JWD A;  3VGO A;  1CDP A;  3D10 A;  1N2D A;  2LVI A;  1D1O A;  1XK4 C;  1KSM A;  1RWY A;  1MHO A;  2LC5 A;  4MBE A;  1FBV A;  1TOP A;  4YGD B;  3O2P A;  3TDI A;  3PN7 B;  1S3P A;  1CLL A;  2QAC A;  4USL A;  2KI6 D;  1LKJ A;  2PSR A;  1AP4 A;  2MLF C;  2RGI A;  2WOS A;  3NSI A;  1UUR A;  1K9U A;  4OR9 B;  3SG5 A;  5I2O A;  1B7T Z;  1IWQ A;  1QX2 A;  5HKW A;  3DD4 A;  1YUU A;  1CFP A;  5K89 A;  1XA5 A;  4YI8 A;  4GUK A;  1K95 A;  4PE0 A;  2LNK A;  2PAS A;  2KSP A;  1QJT A;  1EG4 A;  1IGV A;  1YRU B;  1EL4 A;  1W7I B;  2M29 A;  4GBA A;  3WNX B;  2H61 C;  2A4J A;  2LLS A;  2L2E A;  2LVK A;  3PSR A;  2I18 A;  5B8I B;  2PRU A;  3OX6 A;  4P2Y B;  2CXJ A;  1KFU L;  1WRZ A;  3JTD B;  4YGE B;  3JVT C;  1NSH A;  4ZCV A;  2BCB A;  4WQ3 A;  4AOM A;  2BL0 C;  4Q04 A;  1IKU A;  2G2B A;  2JWW A;  1DJX A;  2Q91 A;  2HET A;  1PVB A;  2JRF A;  3BOW B;  1KFX S;  2GGZ A;  3CS1 A;  1B8C A;  2JZI A;  3OB1 B;  5HKY A;  1N0Y A;  4C0L A;  4YRU A;  1YUS A;  5CSN A;  1NYA A;  1SPY A;  4DUQ A;  1N65 A;  1F54 A;  1KK8 C;  3EK4 A;  1QX5 B;  2JU0 A;  1IQ3 A;  1XVJ A;  1U5I B;  4HSZ A;  1BLQ A;  1HT9 A;  1R6P A;  2BE6 A;  1PSR A;  2F8P A;  2KQ6 A;  2PAL A;  1IQ5 A;  1PUL A;  2Y1M A;  2WND A;  1PK0 D;  4JPZ B;  1SKT A;  3D0Y B;  3EVV A;  3ZNI A;  1OMD A;  3OX5 A;  2V53 A;  1S6C A;  4BY5 A;  1MR8 A;  1OMR A;  3EKH A;  4HRH A;  2KQY A;  1B9A A;  2FOT A;  3O4Y A;  1QVI Y;  1SRA A;  3SJS A;  3HX4 A;  5TNC A;  2K7D A;  1F4Q A;  2M3W A;  1ALW A;  1M46 A;  3FIA A;  2MA2 A;  3DVM A;  1CDN A;  1SR6 C;  4MRY A;  3SIB A;  3LK1 A;  1WDC C;  1BR1 B;  2K7C A;  3TUY C;  2M9G A;  5HLO A;  2K0J A;  3PAL A;  3BUN B;  4C0J A;  2NCP A;  2LMU A;  1VRK A;  2JUL A;  1NIW A;  3I5I C;  4YI9 A;  4P5O E;  1B47 A;  2LLU A;  1CKK A;  5JJG A;  2ZRT A;  5G08 A;  2KI6 C;  1S5G Y;  3SG4 A;  4DIR A;  3BUO B;  3M0W A;  1CLM A;  3JVT B;  2LAN A;  2ISD A;  1GGW A;  2BL0 B;  2CCM A;  3SG7 A;  1QAT A;  1DT7 B;  1F55 A;  1NWD A;  1ZUZ A;  1CFF A;  4U8D A;  1HQV A;  2EGD A;  2LUC A;  1MXL C;  2WOR A;  1X02 A;  3FWC A;  1YR5 A;  2K8M B;  2LMT A;  1BU3 A;  2KOT A;  1NP8 A;  1OZO A;  2G9B A;  2E6W A;  4MLW A;  1JFK A;  2P6B B;  1DJH A;  2K2F A;  3HCM A;  1F4O A;  3SIA A;  1UUS A;  4C0K A;  1IRJ A;  1K96 A;  3CZT X;  1KFX L;  1ODB A;  5HYD A;  2OPO A;  4PHN A;  1EJ3 A;  1YVL A;  2EC6 C;  2JQ6 A;  1TNP A;  1KK8 B;  1JC2 A;  2PMY A;  2LHI A;  1YUT A;  4WQ2 A;  3IF7 A;  1GJY A;  1J55 A;  4PDZ A;  3KF9 A;  5D7F A;  2BBN A;  2JOJ A;  3TS5 B;  4JQ0 D;  2HPS A;  3H4S E;  2KFH A;  1KK7 Y;  1BG1 A;  4MZK A;  1QV1 A;  1DGU A;  2BKI B;  2HQ8 A;  1QS7 A;  1A03 A;  2JC2 A;  1J1E A;  5DKR A;  2LHL A;  1SW8 A;  4N5X A;  2LP2 A;  2ZFD A;  1ZMZ A;  5CPV A;  1AUI B;  1SL8 A;  4TNC A;  4ZCU A;  2NZ0 A;  1SR6 B;  3CR5 X;  3EVU A;  1BMO A;  4HRE E;  4I5L B;  1WDC B;  2FCE A;  2OTG C;  3BUM B;  4MN0 A;  3TUY B;  1CDL A;  4R1E A;  1K93 D;  2LVV A;  3LK0 A;  2M0R A;  1J7P A;  1UWO A;  1SCV A;  2ZRS A;  1QX7 A;  3IQO A;  1ZAC A;  2OS8 C;  3KO0 A;  5I2L A;  3SG2 A;  2LMV A;  3I5I B;  2F33 A;  4NDC A;  2M7L A;  5HLV A;  1DMO A;  1J1D A;  4E68 A;  2KFF A;  4ETO A;  3CR2 A;  2F3Y A;  1S6J A;  2K61 A;  2MBX A;  5BPJ A;  1BOD A;  3GK2 A;  1TN4 A;  2KHN A;  5AAN A;  1M39 A;  2D8N A;  4YGA A;  2F3Z A;  3RLZ A;  1LXF C;  1YRT B;  4PHK A;  4UPG A;  4PHM A;  2JNF A;  2HQW A;  3I5F C;  2BE4 A;  1CLB A;  2B1U A;  3BOW A;  1XO5 A;  1W7J B;  2LCP A;  5I2Q A;  1UHN A;  1CFC A;  1SYM A;  2GGM A;  1WRL A;  3EKJ A;  4CFQ A;  3CR4 X;  2LLT A;  1RTP 1;  1EG3 A;  3FWB A;  3OB2 B;  1C7V A;  1NCZ A;  1QAS A;  1BOC A;  1A4P A;  1V1G A;  2QPT A;  1SL7 A;  1SY9 A;  2WCE A;  1U5I A;  1CMF A;  2EC6 B;  5D69 A;  1ZOT B;  3LCP C;  3WHU B;  1LA3 A;  1A75 B;  1IJ6 A;  3GK1 A;  3TDZ A;  2JTZ A;  2K7B A;  3D0Y A;  4ORB B;  1K2H A;  4I5N B;  4PE1 A;  1XK4 A;  1PSB A;  2CBL A;  4MEW A;  4NQG A;  1H4B A;  1S5G Z;  1TCO B;  3SG6 A;  1UHK A;  4MSP A;  1SBJ A;  3CWG A;  2KFG A;  1RJV A;  3O6B A;  3OHM B;  1XYD A;  4QJ5 B;  2LAP A;  4YGB B;  3KHE A;  3C1V A;  3EK7 A;  2ZND A;  2L0P A;  1CM4 A;  1JF2 A;  2MLE C;  1G8I A;  3SG3 A;  1UHH A;  3NSO A;  4GPL B;  1GQM A;  3BYA A;  4OV2 A;  3EVR A;  1FF1 A;  2OTG B;  3KEV A;  5AXI A;  1FI5 A;  1DGV A;  4GGF C;  1Y6W A;  1TNQ A;  4PCW A;  1M63 B;  1CFD A;  2OS8 B;  4ORC B;  4FQO A;  4XYN A;  3VRQ A;  1MF8 B;  2F2O A;  2H61 A;  1OZS A;  4N1F A;  1RRO A;  3DF0 B;  4ORA B;  1B8R A;  3DVK A;  2KBI A;  1L7Z A;  2LE9 B;  4PE4 A;  1PRW A;  1S26 D;  1YTZ C;  1KQM C;  2ZKM X;  3ZWH A;  1SK6 D;  1EXR A;  1MXE A;  2BCA A;  2I7A A;  2SAS A;  2FCD A;  4M2O A;  3AKB A;  5DKQ A;  4AQI A;  1M31 A;  1PAL A;  1S6I A;  1REC A;  2ZN8 A;  3PAT A;  5CSJ A;  4GFT A;  2MHH A;  3CGA A;  3WXA A;  1H8B A;  5I8N A;  1PVA A;  2Q4U A;  3I5G C;  3DVJ A;  1NUB A;  3I5F B;  5ER5 A;  2L98 A;  3CTN A;  2CNP A;  1MWN A;  3PM8 A;  1SNL A;  3PLF B;  4I5K A;  2CTN A;  2Y5I A;  2L50 A;  1G4Y R;  3AAJ A;  4GNK B;  4A4C A;  1NX3 A;  2M97 A;  2VRG A;  4MZL A;  1Y1X A;  3IQQ A;  3VRO A;  1IH0 A;  2M49 B;  2COL B;  1NPQ A;  1QLK A;  5GQQ C;  2PVB A;  5AER A;  1A2X A;  4YGC B;  2CT9 A;  1TRF A;  4L9M A;  1J7Q A;  3FS7 A;  4OVN F;  1JF0 A;  4NDD A;  1DVI A;  2K2A A;  3O78 A;  3BQ3 A;  5KSZ A;  4PAL A;  4PHJ A;  1RFJ A;  2KAX A;  2DOQ A;  1OQP A;  3LL8 B;  1IJ5 A;  5JOL A;  1TNX A;  4XJK B;  2O5G A;  3BUW B;  3RM1 A;  4MVF A; 
#chains in the Genus database with same CATH topology
 1LVC D;  1OSA A;  1B4C A;  5KTY A;  1QIV A;  1DEL A;  1JSA A;  3NHT A;  1NX0 A;  1AHR A;  1CNP A;  1SCM C;  1JBA A;  2JNX A;  3F45 A;  3SS5 A;  1XFW O;  1DF0 B;  2L51 A;  2QEB A;  1G33 A;  2ZNE A;  5F6T A;  2NLN A;  1NCX A;  2I94 A;  3B7A A;  2JTT A;  2LM5 A;  1J7R A;  3VRN A;  3K21 A;  5CSI A;  3CZ0 A;  1KQV A;  1KQM B;  1UHI A;  1BR4 B;  1SMG A;  2AUC A;  5J3X A;  4JWQ A;  2IS9 A;  3TDU A;  1K90 D;  1QLS A;  2SCP A;  2EHB A;  1S36 A;  2L5X B;  4WRI A;  3S0D A;  1OOJ A;  2KI4 C;  1KWO C;  1DJZ A;  1BT6 A;  2M7N A;  3I5G B;  1DJG A;  3BUX B;  1IIO A;  4MRX A;  3A8R A;  3KPX A;  3CYZ A;  5AEQ A;  1QVI Z;  2E30 A;  1MUX A;  5DKN A;  3L4L A;  3EG5 B;  4F7F A;  3NSK A;  2WCM A;  4CLN A;  1AJ5 A;  1NCY A;  5AFP A;  5FYX A;  2KAV A;  2JXL A;  1F71 A;  4CFR A;  2BEC A;  4N1G A;  1L2O C;  4BY4 A;  4QJ4 B;  2BCX A;  2PQL A;  2I2R E;  1A75 A;  2NCO A;  1DC1 A;  2JPT A;  2H2K A;  3GOF A;  2KBM A;  2JT3 A;  2MJW B;  1CB1 A;  1BJF A;  1YUR A;  3L47 A;  4NDB A;  1Y1A A;  2LUX A;  1LA0 A;  2JXC A;  1QIW A;  1TTX A;  1XFU O;  2M1K B;  1TNW A;  3SS3 A;  1RK9 A;  3I5H C;  1AK8 A;  3AKA A;  1A29 A;  4D1E A;  1DJY A;  1BF5 A;  1SSE B;  1V1F A;  2LVJ A;  3NGV A;  4I5J A;  3CLN A;  1C07 A;  5ER4 X;  4AQJ A;  3WHT B;  1K9P A;  3BFA A;  4A4B A;  5IBW A;  1B7T Y;  3ICB A;  3MSE B;  4HRG A;  1SCM B;  4DCK A;  1WLM A;  2KYF A;  4QJ3 B;  1CM1 A;  1AJ4 A;  4IL1 A;  3NSL A;  2BBM A;  2QEO A;  1TCF A;  3OP0 A;  4M2P A;  2AMI A;  1XFV O;  3DF0 A;  3PFV A;  4YBH B;  4DRW A;  1DJI A;  1ALV A;  3LLE A;  1JFJ A;  1S1E A;  1J7O A;  1Y1U A;  1FI6 A;  1CDM A;  2Y4Q A;  1B1G A;  3TS5 C;  3NXA A;  4GAO A;  1F8H A;  1QWV A;  1WY9 A;  3B87 A;  2WCB A;  2L2C A;  3PJI A;  3QRX A;  3AAK A;  1YVH A;  2F2P A;  2R2I A;  1C3Y A;  1JUO A;  1YX7 A;  2BKH B;  1Z2C B;  4DS7 A;  2KI4 B;  1KWO B;  2Y1N A;  2ZN9 A;  3K1E A;  5PAL A;  1Q80 A;  1DTL A;  1KSO A;  1OOH A;  3PN7 C;  2JT8 A;  2KDH A;  1KK7 Z;  1CTR A;  1OW4 A;  2JPO A;  1K8U A;  1QXP A;  4ICB A;  4MZJ A;  3UO9 A;  4CPV A;  3GK4 X;  1XFZ O;  4PT1 A;  2KLE A;  4PE7 A;  1UP5 A;  3S0G A;  1FW4 A;  1QTX A;  3R1O A;  1TIZ A;  3DVE A;  1K9K A;  3D74 A;  2L4H A;  2MAZ A;  2WCJ A;  1NX2 A;  3D76 A;  2HF5 A;  1B8L A;  1L2O B;  1MQ1 A;  2K7O A;  1WLZ A;  1GM0 A;  4M2Q A;  5KU1 A;  1KFU S;  2L4I A;  1XFX O;  1P28 A;  2WC5 A;  4INW A;  3A4U B;  2JT0 A;  1KCY A;  3BXK A;  3VRR A;  2LP3 A;  2WCF A;  2LV7 A;  3JTD C;  1GGZ A;  1R2U A;  3VRP A;  1Y0V H;  1NX1 A;  2ERB A;  4XJK A;  2KGR A;  2M8U A;  3EK8 A;  1SL9 A;  2O60 A;  3E3R A;  3I5H B;  2FJU B;  3S0F A;  4OKH A;  1AVS A;  1ZFS A;  1F70 A;  5CSF A;  2KYC A;  2NXQ A;  3CAB A;  2KAY A;  2FJY A;  4OCI A;  1IG5 A;  2MRD A;  3TZ1 A;  1DQE A;  5HKZ A;  1LIN A;  4GGN A;  4GGF A;  1UHJ A;  1DF0 A;  2KNE A;  2KGB C;  2WCL A;  1YX8 A;  2M1U A;  2AAO A;  2TN4 A;  2WC8 A;  1M45 A;  1DJW A;  2GV5 A;  1E8A A;  1W9Z A;  4FQT A;  4FTG A;  4CID A;  1EH2 A;  1XFY O;  1FPW A;  1OE9 B;  1WRK A;  1OMV A;  3B88 A;  1QV0 A;  1C7W A;  1K94 A;  4F0Z B;  1JWD A;  3VGO A;  1CDP A;  3D10 A;  1N2D A;  2LVI A;  1D1O A;  1XK4 C;  1KSM A;  1RWY A;  1MHO A;  1OOF A;  2LC5 A;  4MBE A;  1FBV A;  1TOP A;  4YGD B;  3O2P A;  3TDI A;  3PN7 B;  1S3P A;  1CLL A;  3DY9 A;  2QAC A;  4USL A;  2KI6 D;  1LKJ A;  2PSR A;  1AP4 A;  2MLF C;  2RGI A;  2KPH A;  2P70 A;  2WOS A;  3NSI A;  1UUR A;  1K9U A;  4OR9 B;  3SG5 A;  5I2O A;  1B7T Z;  1IWQ A;  1QX2 A;  5HKW A;  3DD4 A;  1YUU A;  1CFP A;  5K89 A;  1XA5 A;  4YI8 A;  4GUK A;  4CFQ A;  1K95 A;  4PE0 A;  2LNK A;  2PAS A;  2KSP A;  1QJT A;  1EG4 A;  1IGV A;  1YRU B;  2BNX A;  1EL4 A;  1W7I B;  2M29 A;  4GBA A;  3WNX B;  2H61 C;  1DEK A;  2A4J A;  2L2E A;  2LLS A;  2LVK A;  2I18 A;  3PSR A;  2PRU A;  3OX6 A;  5B8I B;  4JD9 A;  4P2Y B;  2CXJ A;  1KFU L;  1WRZ A;  3JTD B;  3FE9 A;  3JVT C;  1NSH A;  4YGE B;  1Z4H A;  4ZCV A;  2BCB A;  4WQ3 A;  5EL2 A;  4AOM A;  3L4A A;  2BL0 C;  4Q04 A;  1IKU A;  2G2B A;  2JWW A;  1DJX A;  2Q91 A;  2HET A;  1PVB A;  2JRF A;  2QEH A;  4INX A;  3BOW B;  1KFX S;  2GGZ A;  3CS1 A;  1B8C A;  2JZI A;  3OB1 B;  5HKY A;  1N0Y A;  4C0L A;  1T14 A;  4YRU A;  2QDI A;  1YUS A;  5CSN A;  1NYA A;  1SPY A;  4DUQ A;  1N65 A;  1F54 A;  1KK8 C;  3EK4 A;  1QX5 B;  2JU0 A;  3DXL A;  1XVJ A;  1U5I B;  1TUZ A;  4HSZ A;  1IQ3 A;  1BLQ A;  1HT9 A;  1R6P A;  2BE6 A;  1PSR A;  2F8P A;  2KQ6 A;  2PAL A;  1IQ5 A;  1PUL A;  2Y1M A;  2WND A;  1PK0 D;  3S0B A;  3S0A A;  4JPZ B;  1SKT A;  3D0Y B;  3DZT A;  3EVV A;  3ZNI A;  1OMD A;  3OX5 A;  2V53 A;  1S6C A;  4BY5 A;  1MR8 A;  1OMR A;  1ORG A;  3EKH A;  4HRH A;  2KQY A;  1B9A A;  2FOT A;  3O4Y A;  1QVI Y;  1SRA A;  3SJS A;  3HX4 A;  5TNC A;  2K7D A;  1F4Q A;  2M3W A;  1ALW A;  1M46 A;  2H8V A;  2MA2 A;  3FIA A;  3DVM A;  2WCK A;  1CDN A;  1SR6 C;  4MRY A;  3SIB A;  1TWO A;  1WDC C;  1BR1 B;  2K7C A;  3LK1 A;  5D3O A;  3TUY C;  2M9G A;  5HLO A;  2K0J A;  3PAL A;  3NHI A;  3BUN B;  3V2L A;  4C0J A;  2NCP A;  2LMU A;  1VRK A;  2JUL A;  1NIW A;  3I5I C;  4YI9 A;  4P5O E;  1B47 A;  2LLU A;  1CKK A;  5JJG A;  2ZRT A;  5G08 A;  3R1V A;  2KI6 C;  1S5G Y;  3SG4 A;  3D78 A;  4DIR A;  3BUO B;  3M0W A;  1CLM A;  3JVT B;  2LAN A;  2ISD A;  1GGW A;  2BL0 B;  2CCM A;  3SG7 A;  1QAT A;  1DT7 B;  1F55 A;  1NWD A;  1ZUZ A;  1CFF A;  4U8D A;  1HQV A;  2EGD A;  2LUC A;  1MXL C;  2WOR A;  1X02 A;  3FWC A;  1YR5 A;  2K8M B;  5I94 A;  2LMT A;  1BU3 A;  2KOT A;  1NP8 A;  3CZ1 A;  1OZO A;  2G9B A;  2E6W A;  4MLW A;  1JFK A;  2P6B B;  1DJH A;  2K2F A;  3HCM A;  1F4O A;  3SIA A;  1UUS A;  4C0K A;  1IRJ A;  1K96 A;  3CZT X;  1KFX L;  1ODB A;  5HYD A;  2OPO A;  4PHN A;  1EJ3 A;  1YVL A;  2EC6 C;  2JQ6 A;  1TNP A;  1KK8 B;  3R1P A;  1JC2 A;  2PMY A;  2LHI A;  1YUT A;  4WQ2 A;  1LS8 A;  1GJY A;  3IF7 A;  1J55 A;  4PDZ A;  3KF9 A;  5D7F A;  2BBN A;  2JOJ A;  3TS5 B;  4JQ0 D;  2HPS A;  3H4S E;  2KFH A;  1KK7 Y;  1BG1 A;  1XFR A;  3FE6 A;  1QV1 A;  1DGU A;  2BKI B;  2HQ8 A;  1QS7 A;  4MZK A;  5HL1 A;  2JC2 A;  1A03 A;  1J1E A;  5DKR A;  2LHL A;  1SW8 A;  4N5X A;  2LP2 A;  3R72 A;  2ZFD A;  1ZMZ A;  5CPV A;  1AUI B;  1SL8 A;  4TNC A;  4ZCU A;  2NZ0 A;  2PYQ A;  1SR6 B;  3CR5 X;  3EVU A;  1BMO A;  4HRE E;  4I5L B;  1WDC B;  2FCE A;  2OTG C;  3BUM B;  3CZ2 A;  4MN0 A;  1CDL A;  3TUY B;  4R1E A;  1K93 D;  2LVV A;  3LK0 A;  3B6X A;  5FI7 A;  2M0R A;  1J7P A;  1UWO A;  3S0E A;  1SCV A;  2ZRS A;  1QX7 A;  3IQO A;  1ZAC A;  2OS8 C;  3KO0 A;  3D77 A;  5I2L A;  2LMV A;  3I5I B;  2F33 A;  3SG2 A;  4NDC A;  2M7L A;  5HLV A;  1DMO A;  1J1D A;  4E68 A;  2KFF A;  4ETO A;  1CMG A;  3FE8 A;  3CR2 A;  2F3Y A;  1S6J A;  2K61 A;  2MBX A;  5BPJ A;  1BOD A;  3GK2 A;  1TN4 A;  2KHN A;  3BFH A;  1M39 A;  5AAN A;  2D8N A;  2P71 A;  4YGA A;  2F3Z A;  3RLZ A;  3QME A;  1OOG A;  1LXF C;  1YRT B;  4PHK A;  4UPG A;  4PHM A;  2JNF A;  2HQW A;  3I5F C;  2BE4 A;  1CLB A;  2B1U A;  2K60 A;  3BOW A;  1XO5 A;  1W7J B;  2LCP A;  5I2Q A;  1UHN A;  1CFC A;  1SYM A;  2GGM A;  1WRL A;  3EKJ A;  3OBV A;  3CR4 X;  2LLT A;  3D75 A;  1RTP 1;  1EG3 A;  3FWB A;  3OB2 B;  1C7V A;  1NCZ A;  1QAS A;  1BOC A;  1A4P A;  1V1G A;  2QPT A;  3B86 A;  2WC6 A;  1SL7 A;  1TUJ A;  1SY9 A;  2WCE A;  3CDN A;  1U5I A;  1CMF A;  2EC6 B;  5D69 A;  1ZOT B;  3LCP C;  3WHU B;  3UNW A;  1LA3 A;  1A75 B;  1IJ6 A;  3GK1 A;  3TDZ A;  2JTZ A;  2K7B A;  3D0Y A;  4ORB B;  1K2H A;  4I5N B;  4PE1 A;  1XK4 A;  1PSB A;  2CBL A;  4MEW A;  4NQG A;  1H4B A;  1S5G Z;  1TCO B;  3SG6 A;  3IVT A;  1UHK A;  4MSP A;  1SBJ A;  3N7H A;  3CWG A;  2KFG A;  1RJV A;  3O6B A;  3OHM B;  1XYD A;  4QJ5 B;  2LAP A;  4YGB B;  3KHE A;  3C1V A;  3EK7 A;  2ZND A;  2L0P A;  1CM4 A;  1JF2 A;  2MLE C;  1G8I A;  3SG3 A;  1UHH A;  3NSO A;  4GPL B;  1GQM A;  3BYA A;  4OV2 A;  3BJH A;  3EVR A;  1FF1 A;  2OTG B;  3KEV A;  5AXI A;  3PM2 A;  1FI5 A;  1DGV A;  2BAP A;  4GGF C;  1Y6W A;  1TNQ A;  4PCW A;  1M63 B;  1CFD A;  2OS8 B;  4ORC B;  4FQO A;  4XYN A;  1OOI X;  3VRQ A;  1MF8 B;  2F2O A;  2H61 A;  1OZS A;  4N1F A;  1RRO A;  3DF0 B;  4ORA B;  1B8R A;  3DVK A;  2KBI A;  1L7Z A;  2LE9 B;  2KLD A;  4PE4 A;  1PRW A;  1S26 D;  4OZD A;  1YTZ C;  1KQM C;  2ZKM X;  3ZWH A;  1SK6 D;  1EXR A;  1MXE A;  2BCA A;  2I7A A;  2SAS A;  2FCD A;  4M2O A;  3AKB A;  5DKQ A;  4AQI A;  1M31 A;  3RZS A;  1PAL A;  1S6I A;  1REC A;  2GTE A;  2ZN8 A;  3PAT A;  4IJ7 A;  5CSJ A;  4GFT A;  3VB1 A;  2MHH A;  3CGA A;  3WXA A;  1H8B A;  5I8N A;  1PVA A;  2Q4U A;  3I5G C;  3DVJ A;  1NUB A;  3I5F B;  5ER5 A;  2L98 A;  3CTN A;  2CNP A;  1MWN A;  3PM8 A;  5FI2 A;  1SNL A;  3PLF B;  4I5K A;  3O4X A;  2CTN A;  2Y5I A;  2L50 A;  1G4Y R;  3AAJ A;  4GNK B;  4A4C A;  1NX3 A;  2M97 A;  3Q8I A;  2VRG A;  4MZL A;  1Y1X A;  3IQQ A;  3VRO A;  1IH0 A;  2M49 B;  2L5Y A;  2COL B;  1NPQ A;  4JKT A;  1QLK A;  5GQQ C;  2PVB A;  5AER A;  2WCH A;  3DYE A;  1A2X A;  4KYN A;  2CT9 A;  4YGC B;  1TRF A;  4L9M A;  1J7Q A;  3FS7 A;  5FI6 A;  4OVN F;  1JF0 A;  4NDD A;  1C3Z A;  2YGU A;  1DVI A;  2K2A A;  3O78 A;  3BQ3 A;  3D73 A;  5KSZ A;  3SS4 A;  2QEV A;  4PAL A;  4PHJ A;  1RFJ A;  3BFB A;  2KAX A;  2DOQ A;  5DIC A;  1OQP A;  3LL8 B;  1IJ5 A;  5JOL A;  1TNX A;  4XJK B;  2O5G A;  3BUW B;  3RM1 A;  4MVF A;  3OGN A; 
#chains in the Genus database with same CATH homology
 1LVC D;  1OSA A;  1B4C A;  5KTY A;  1QIV A;  1JSA A;  1NX0 A;  1AHR A;  1CNP A;  1SCM C;  1JBA A;  2JNX A;  3F45 A;  1XFW O;  1DF0 B;  2L51 A;  1G33 A;  2ZNE A;  5F6T A;  2NLN A;  1NCX A;  2I94 A;  2JTT A;  2LM5 A;  1J7R A;  3VRN A;  3K21 A;  5CSI A;  1KQV A;  1KQM B;  1BR4 B;  1SMG A;  1UHI A;  2AUC A;  5J3X A;  4JWQ A;  2IS9 A;  3TDU A;  1K90 D;  1QLS A;  2SCP A;  2EHB A;  1S36 A;  2L5X B;  4WRI A;  1OOJ A;  2KI4 C;  1KWO C;  1DJZ A;  1BT6 A;  2M7N A;  3I5G B;  1DJG A;  3BUX B;  4MRX A;  3A8R A;  3KPX A;  5AEQ A;  1QVI Z;  2E30 A;  1MUX A;  5DKN A;  3NSK A;  4CLN A;  1AJ5 A;  1NCY A;  5AFP A;  5FYX A;  2KAV A;  2JXL A;  1F71 A;  4CFR A;  2BEC A;  4N1G A;  1L2O C;  4BY4 A;  4QJ4 B;  2BCX A;  2I2R E;  1A75 A;  2NCO A;  2JPT A;  2H2K A;  3GOF A;  2KBM A;  2JT3 A;  2MJW B;  1CB1 A;  1BJF A;  1YUR A;  4NDB A;  1Y1A A;  2LUX A;  1LA0 A;  2JXC A;  1QIW A;  1TTX A;  1XFU O;  2M1K B;  1TNW A;  1AK8 A;  1RK9 A;  3I5H C;  3AKA A;  1A29 A;  4D1E A;  1DJY A;  1BF5 A;  1V1F A;  2LVJ A;  4I5J A;  3CLN A;  1C07 A;  5ER4 X;  4AQJ A;  3WHT B;  1K9P A;  4A4B A;  5IBW A;  1B7T Y;  3ICB A;  3MSE B;  4HRG A;  1SCM B;  4DCK A;  1WLM A;  2KYF A;  4QJ3 B;  1CM1 A;  1AJ4 A;  4IL1 A;  3NSL A;  2BBM A;  1TCF A;  3OP0 A;  4M2P A;  2AMI A;  1XFV O;  3DF0 A;  3PFV A;  4YBH B;  4DRW A;  1DJI A;  1ALV A;  3LLE A;  1JFJ A;  1S1E A;  1J7O A;  1Y1U A;  1FI6 A;  1CDM A;  2Y4Q A;  1B1G A;  3TS5 C;  3NXA A;  4GAO A;  1F8H A;  1WY9 A;  2WCB A;  3QRX A;  3AAK A;  1YVH A;  2F2P A;  2R2I A;  1JUO A;  1YX7 A;  2BKH B;  4DS7 A;  2KI4 B;  1KWO B;  2Y1N A;  2ZN9 A;  5PAL A;  1Q80 A;  1DTL A;  1KSO A;  3PN7 C;  2JT8 A;  2KDH A;  1KK7 Z;  1CTR A;  1K8U A;  1QXP A;  4ICB A;  4MZJ A;  4CPV A;  3GK4 X;  1XFZ O;  4PE7 A;  1UP5 A;  1FW4 A;  1QTX A;  1TIZ A;  3DVE A;  1K9K A;  2L4H A;  2MAZ A;  1NX2 A;  2HF5 A;  1B8L A;  1L2O B;  1MQ1 A;  2K7O A;  1WLZ A;  4M2Q A;  5KU1 A;  1KFU S;  2L4I A;  1XFX O;  3A4U B;  2JT0 A;  1KCY A;  3BXK A;  3VRR A;  2LP3 A;  2WCF A;  2LV7 A;  3JTD C;  1GGZ A;  1R2U A;  3VRP A;  1Y0V H;  1NX1 A;  4XJK A;  1CMG A;  2KGR A;  2M8U A;  3EK8 A;  1SL9 A;  2O60 A;  3E3R A;  3I5H B;  2FJU B;  4OKH A;  1AVS A;  1ZFS A;  1F70 A;  5CSF A;  2KYC A;  2NXQ A;  2KAY A;  4OCI A;  1IG5 A;  2MRD A;  3TZ1 A;  5HKZ A;  1LIN A;  4GGN A;  4GGF A;  1UHJ A;  1DF0 A;  2KNE A;  2KGB C;  1YX8 A;  2M1U A;  2AAO A;  2TN4 A;  2WC8 A;  1M45 A;  1DJW A;  2GV5 A;  1E8A A;  4FTG A;  4CID A;  1EH2 A;  1XFY O;  1FPW A;  1OE9 B;  1WRK A;  1OMV A;  1QV0 A;  1C7W A;  1K94 A;  4F0Z B;  1JWD A;  3VGO A;  1CDP A;  3D10 A;  1N2D A;  2LVI A;  1D1O A;  1XK4 C;  1KSM A;  1RWY A;  1MHO A;  2LC5 A;  4MBE A;  1FBV A;  1TOP A;  4YGD B;  3O2P A;  3TDI A;  3PN7 B;  1S3P A;  1CLL A;  2QAC A;  4USL A;  2KI6 D;  1LKJ A;  2PSR A;  1AP4 A;  2MLF C;  2RGI A;  2WOS A;  3NSI A;  1UUR A;  1K9U A;  4OR9 B;  3SG5 A;  5I2O A;  1B7T Z;  1IWQ A;  1QX2 A;  5HKW A;  3DD4 A;  1YUU A;  1CFP A;  5K89 A;  1XA5 A;  4YI8 A;  4GUK A;  1K95 A;  4PE0 A;  2LNK A;  2PAS A;  2KSP A;  1QJT A;  1EG4 A;  1IGV A;  1YRU B;  1EL4 A;  1W7I B;  2M29 A;  4GBA A;  3WNX B;  2H61 C;  2A4J A;  2LLS A;  2L2E A;  2LVK A;  3PSR A;  2I18 A;  5B8I B;  2PRU A;  3OX6 A;  4P2Y B;  2CXJ A;  1KFU L;  1WRZ A;  3JTD B;  4YGE B;  3JVT C;  1NSH A;  4ZCV A;  2BCB A;  4WQ3 A;  4AOM A;  2BL0 C;  4Q04 A;  1IKU A;  2G2B A;  2JWW A;  1DJX A;  2Q91 A;  2HET A;  1PVB A;  2JRF A;  3BOW B;  1KFX S;  2GGZ A;  3CS1 A;  1B8C A;  2JZI A;  3OB1 B;  5HKY A;  1N0Y A;  4C0L A;  4YRU A;  1YUS A;  5CSN A;  1NYA A;  1SPY A;  4DUQ A;  1N65 A;  1F54 A;  1KK8 C;  3EK4 A;  1QX5 B;  2JU0 A;  1IQ3 A;  1XVJ A;  1U5I B;  4HSZ A;  1BLQ A;  1HT9 A;  1R6P A;  2BE6 A;  1PSR A;  2F8P A;  2KQ6 A;  2PAL A;  1IQ5 A;  1PUL A;  2Y1M A;  2WND A;  1PK0 D;  4JPZ B;  1SKT A;  3D0Y B;  3EVV A;  3ZNI A;  1OMD A;  3OX5 A;  2V53 A;  1S6C A;  4BY5 A;  1MR8 A;  1OMR A;  3EKH A;  4HRH A;  2KQY A;  1B9A A;  2FOT A;  3O4Y A;  1QVI Y;  1SRA A;  3SJS A;  3HX4 A;  5TNC A;  2K7D A;  1F4Q A;  2M3W A;  1ALW A;  1M46 A;  3FIA A;  2MA2 A;  3DVM A;  1CDN A;  1SR6 C;  4MRY A;  3SIB A;  3LK1 A;  1WDC C;  1BR1 B;  2K7C A;  3TUY C;  2M9G A;  5HLO A;  2K0J A;  3PAL A;  3BUN B;  4C0J A;  2NCP A;  2LMU A;  1VRK A;  2JUL A;  1NIW A;  3I5I C;  4YI9 A;  4P5O E;  1B47 A;  2LLU A;  1CKK A;  5JJG A;  2ZRT A;  5G08 A;  2KI6 C;  1S5G Y;  3SG4 A;  4DIR A;  3BUO B;  3M0W A;  1CLM A;  3JVT B;  2LAN A;  2ISD A;  1GGW A;  2BL0 B;  2CCM A;  3SG7 A;  1QAT A;  1DT7 B;  1F55 A;  1NWD A;  1ZUZ A;  1CFF A;  4U8D A;  1HQV A;  2EGD A;  2LUC A;  1MXL C;  2WOR A;  1X02 A;  3FWC A;  1YR5 A;  2K8M B;  2LMT A;  1BU3 A;  2KOT A;  1NP8 A;  1OZO A;  2G9B A;  2E6W A;  4MLW A;  1JFK A;  2P6B B;  1DJH A;  2K2F A;  3HCM A;  1F4O A;  3SIA A;  1UUS A;  4C0K A;  1IRJ A;  1K96 A;  3CZT X;  1KFX L;  1ODB A;  5HYD A;  2OPO A;  4PHN A;  1EJ3 A;  1YVL A;  2EC6 C;  2JQ6 A;  1TNP A;  1KK8 B;  1JC2 A;  2PMY A;  2LHI A;  1YUT A;  4WQ2 A;  3IF7 A;  1GJY A;  1J55 A;  4PDZ A;  3KF9 A;  5D7F A;  2BBN A;  2JOJ A;  3TS5 B;  4JQ0 D;  2HPS A;  3H4S E;  2KFH A;  1KK7 Y;  1BG1 A;  4MZK A;  1QV1 A;  1DGU A;  2BKI B;  2HQ8 A;  1QS7 A;  1A03 A;  2JC2 A;  1J1E A;  5DKR A;  2LHL A;  1SW8 A;  4N5X A;  2LP2 A;  2ZFD A;  1ZMZ A;  5CPV A;  1AUI B;  1SL8 A;  4TNC A;  4ZCU A;  2NZ0 A;  1SR6 B;  3CR5 X;  3EVU A;  1BMO A;  4HRE E;  4I5L B;  1WDC B;  2FCE A;  2OTG C;  3BUM B;  4MN0 A;  3TUY B;  1CDL A;  4R1E A;  1K93 D;  2LVV A;  3LK0 A;  2M0R A;  1J7P A;  1UWO A;  1SCV A;  2ZRS A;  1QX7 A;  3IQO A;  1ZAC A;  2OS8 C;  3KO0 A;  5I2L A;  3SG2 A;  2LMV A;  3I5I B;  2F33 A;  4NDC A;  2M7L A;  5HLV A;  1DMO A;  1J1D A;  4E68 A;  2KFF A;  4ETO A;  3CR2 A;  2F3Y A;  1S6J A;  2K61 A;  2MBX A;  5BPJ A;  1BOD A;  3GK2 A;  1TN4 A;  2KHN A;  5AAN A;  1M39 A;  2D8N A;  4YGA A;  2F3Z A;  3RLZ A;  1LXF C;  1YRT B;  4PHK A;  4UPG A;  4PHM A;  2JNF A;  2HQW A;  3I5F C;  2BE4 A;  1CLB A;  2B1U A;  3BOW A;  1XO5 A;  1W7J B;  2LCP A;  5I2Q A;  1UHN A;  1CFC A;  1SYM A;  2GGM A;  1WRL A;  3EKJ A;  4CFQ A;  3CR4 X;  2LLT A;  1RTP 1;  1EG3 A;  3FWB A;  3OB2 B;  1C7V A;  1NCZ A;  1QAS A;  1BOC A;  1A4P A;  1V1G A;  2QPT A;  1SL7 A;  1SY9 A;  2WCE A;  1U5I A;  1CMF A;  2EC6 B;  5D69 A;  1ZOT B;  3LCP C;  3WHU B;  1LA3 A;  1A75 B;  1IJ6 A;  3GK1 A;  3TDZ A;  2JTZ A;  2K7B A;  3D0Y A;  4ORB B;  1K2H A;  4I5N B;  4PE1 A;  1XK4 A;  1PSB A;  2CBL A;  4MEW A;  4NQG A;  1H4B A;  1S5G Z;  1TCO B;  3SG6 A;  1UHK A;  4MSP A;  1SBJ A;  3CWG A;  2KFG A;  1RJV A;  3O6B A;  3OHM B;  1XYD A;  4QJ5 B;  2LAP A;  4YGB B;  3KHE A;  3C1V A;  3EK7 A;  2ZND A;  2L0P A;  1CM4 A;  1JF2 A;  2MLE C;  1G8I A;  3SG3 A;  1UHH A;  3NSO A;  4GPL B;  1GQM A;  3BYA A;  4OV2 A;  3EVR A;  1FF1 A;  2OTG B;  3KEV A;  5AXI A;  1FI5 A;  1DGV A;  4GGF C;  1Y6W A;  1TNQ A;  4PCW A;  1M63 B;  1CFD A;  2OS8 B;  4ORC B;  4FQO A;  4XYN A;  3VRQ A;  1MF8 B;  2F2O A;  2H61 A;  1OZS A;  4N1F A;  1RRO A;  3DF0 B;  4ORA B;  1B8R A;  3DVK A;  2KBI A;  1L7Z A;  2LE9 B;  4PE4 A;  1PRW A;  1S26 D;  1YTZ C;  1KQM C;  2ZKM X;  3ZWH A;  1SK6 D;  1EXR A;  1MXE A;  2BCA A;  2I7A A;  2SAS A;  2FCD A;  4M2O A;  3AKB A;  5DKQ A;  4AQI A;  1M31 A;  1PAL A;  1S6I A;  1REC A;  2ZN8 A;  3PAT A;  5CSJ A;  4GFT A;  2MHH A;  3CGA A;  3WXA A;  1H8B A;  5I8N A;  1PVA A;  2Q4U A;  3I5G C;  3DVJ A;  1NUB A;  3I5F B;  5ER5 A;  2L98 A;  3CTN A;  2CNP A;  1MWN A;  3PM8 A;  1SNL A;  3PLF B;  4I5K A;  2CTN A;  2Y5I A;  2L50 A;  1G4Y R;  3AAJ A;  4GNK B;  4A4C A;  1NX3 A;  2M97 A;  2VRG A;  4MZL A;  1Y1X A;  3IQQ A;  3VRO A;  1IH0 A;  2M49 B;  2COL B;  1NPQ A;  1QLK A;  5GQQ C;  2PVB A;  5AER A;  1A2X A;  4YGC B;  2CT9 A;  1TRF A;  4L9M A;  1J7Q A;  3FS7 A;  4OVN F;  1JF0 A;  4NDD A;  1DVI A;  2K2A A;  3O78 A;  3BQ3 A;  5KSZ A;  4PAL A;  4PHJ A;  1RFJ A;  2KAX A;  2DOQ A;  1OQP A;  3LL8 B;  1IJ5 A;  5JOL A;  1TNX A;  4XJK B;  2O5G A;  3BUW B;  3RM1 A;  4MVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...