3I5FB

Crystal structure of squid mg.adp myosin s1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
145
structure length
145
Chain Sequence
RVKLSQRQMQELKEAFTMIDQDRDGFIGMEDLKDMFSSLGRVPPDDELNAMLKECPGQLNFTAFLTLFGEKVSGTDPEDALRNAFSMFDEDGQGFIPEDYLKDLLENMGDNFSKEEIKNVWKDAPLKNKQFNYNKMVDIKGKAED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain isoform A
publication title Rigor-like structures from muscle myosins reveal key mechanical elements in the transduction pathways of this allosteric motor.
pubmed doi rcsb
molecule tags Contractile protein
total genus 28
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2009-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3i5fB02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3i5fB01
1XVJA 3O6BA 1MHOA 1N2DA 2L4HA 2CXJA 5JOLA 5I8NA 1RROA 5FYXA 1LKJA 1SRAA 1JC2A 3BQ3A 1JWDA 1CLBA 3C1VA 3MSEB 5HLVA 2MA2A 4ORAB 2F8PA 2JRFA 3SG3A 3JTDC 2LUCA 1XFYO 2M0RA 2RGIA 1NX1A 2GGZA 2WCBA 3BUMB 3EVVA 3VRPA 1AK8A 1BU3A 2KAYA 3CTNA 3WHTB 1S6IA 1XFXO 3FWCA 2BL0B 1S26D 3AKAA 1OOJA 1TCOB 2LNKA 1XA5A 1U5IA 2H61C 4YI8A 2M7LA 1QATA 3I5HB 4ORCB 1ODBA 2L2EA 2L0PA 1OE9B 3NSIA 1M46A 4Q04A 1IJ5A 1WLZA 1B8CA 2BKIB 2G2BA 1WRLA 4YRUA 2K2FA 1IKUA 1DJYA 1S3PA 2V53A 4JWQA 2K7CA 2BCAA 4TNCA 4NDDA 5I2QA 1JBAA 1UURA 1QLKA 2F3YA 3PN7C 3HX4A 3CR2A 3TS5B 4I5NB 3EKJA 1DJGA 2L51A 1KQMB 2NZ0A 1ZUZA 2JT3A 1S6JA 2LHLA 2BE4A 3A8RA 1OMRA 4I5KA 3SIBA 1E8AA 1RJVA 1NSHA 2JZIA 2LP2A 3SG5A 2KI6D 1M31A 2KI6C 1LXFC 1F55A 1CFDA 2KFGA 1C7WA 1TCFA 1DJWA 1CNPA 2PVBA 4BY5A 1PVBA 3I5IC 1SMGA 1HQVA 2PALA 2KSPA 2ZNDA 4FTGA 1J7OA 3DVKA 1DJZA 2HQ8A 1DGUA 4MZLA 5K89A 1MF8B 1CLMA 3AKBA 4GGFA 4NQGA 1CKKA 1F70A 1KK7Y 5BPJA 1IGVA 1SL8A 4IL1A 3VRNA 1YRTB 3WXAA 3OX6A 5HKYA 3PALA 3O4YA 1BLQA 2AMIA 4QJ4B 2LC5A 5HKWA 2JC2A 4JQ0D 1OMDA 1LVCD 4N5XA 2B1UA 2PASA 1QXPA 3LK0A 1SY9A 3NSOA 2M97A 2KBMA 1W7JB 4MBEA 1KQVA 2BL0C 1TIZA 3LK1A 2JT0A 2TN4A 2LVKA 1B8RA 3D10A 1NX3A 2M8UA 3IQOA 4FQOA 5GQQC 1XFZO 4ZCUA 1BG1A 4OV2A 1B7TY 1J7PA 3DF0A 1JSAA 2BBNA 2AAOA 2E6WA 1F4QA 4NDBA 1Y1XA 1PSBA 1GQMA 1QVIY 4A4BA 1OZSA 3GK4X 2FJUB 1TN4A 4PHJA 1DF0A 3GK2A 2IS9A 1SNLA 1V1FA 1M45A 2O5GA 4PE7A 4R1EA 1KFUS 2A4JA 5J3XA 1XFUO 5D69A 1FPWA 2K2AA 2LVJA 1RFJA 1LINA 2QACA 5HKZA 3CR4X 3TS5C 1AUIB 4MEWA 1ZOTB 1GGWA 1Y1UA 1KQMC 2FOTA 1B47A 2JU0A 1Y0VH 5PALA 4PHMA 3BXKA 1L7ZA 3I5IB 4CPVA 1K9UA 1NYAA 1YVLA 4YI9A 3DD4A 4DS7A 4YGCB 1A75A 1KSOA 4M2OA 2WCEA 1K8UA 2K61A 3CLNA 2WORA 1D1OA 1ZFSA 2LCPA 3D0YB 1WY9A 4GAOA 2COLB 2JTZA 2JXCA 1XK4C 2KGBC 3FIAA 1K9KA 4M2QA 2M7NA 2BKHB 1EG3A 2LE9B 4PCWA 1IQ5A 2EGDA 2P6BB 2G9BA 5HLOA 1XO5A 2CT9A 3PSRA 4HRGA 1QVIZ 1DGVA 1UHIA 3KHEA 3KO0A 3BUXB 3NSKA 2MBXA 2JTTA 1BF5A 1G8IA 2ZNEA 1CDNA 2ZRSA 4WRIA 1C07A 2LMTA 5DKRA 1TOPA 1DVIA 1MUXA 3O78A 1TRFA 2VRGA 1KFXS 3RM1A 3PM8A 4U8DA 5TNCA 1MWNA 2GV5A 2Y1MA 1R2UA 4P2YB 4XYNA 1CM4A 1QASA 2BBMA 1H4BA 2JQ6A 1GJYA 3DVJA 4ORBB 3I5FB 1RK9A 3EVRA 2PMYA 3QRXA 3TDIA 1G4YR 1J7RA 2K7OA 4GUKA 1QX5B 2Y5IA 1IQ3A 1UUSA 4DUQA 3TDZA 3VRQA 1S1EA 1MXEA 1JF2A 3JVTC 4CIDA 3CZTX 1S5GY 3OHMB 1JUOA 1KWOB 2KDHA 1L2OC 3BOWA 4HREE 3PFVA 1CMFA 2H61A 3GOFA 1TTXA 2R2IA 3LCPC 4XJKA 4N1FA 1MR8A 1UHHA 3CR5X 4GFTA 1CB1A 3OB2B 3K21A 4L9MA 1RWYA 1XYDA 3SG7A 1QX2A 1A75B 5DKNA 2CNPA 3F45A 4OKHA 1H8BA 1AHRA 1C7VA 2LUXA 2SCPA 1F71A 1K90D 4C0JA 1SL9A 1K2HA 4DCKA 1CM1A 1TNWA 3VRRA 2Q4UA 1B4CA 2I18A 2M29A 1OSAA 3LL8B 2JNFA 3EKHA 5CSIA 5F6TA 2HPSA 5D7FA 1ALVA 1BOCA 1J1DA 1IRJA 4OR9B 1PK0D 1EG4A 1BODA 4GGNA 1F54A 2LLTA 4I5JA 1GGZA 2KNEA 2FCEA 1U5IB 2JPTA 4OCIA 3KF9A 4M2PA 2NCPA 1DT7B 2F2OA 1CMGA 1KFUL 4PHKA 2M9GA 2LM5A 3HCMA 3DVEA 3ZNIA 4CFQA 1K94A 2ZN9A 5AXIA 4PDZA 1AJ5A 3PATA 2WCFA 3JVTB 1A4PA 1SKTA 2KYFA 5JJGA 3SIAA 2M1KB 3KEVA 1FI6A 2JWWA 2L4IA 3SJSA 1L2OB 2D8NA 1JF0A 2MLEC 2OPOA 1B8LA 3I5FC 1QJTA 1EXRA 2JNXA 4GPLB 4PALA 2KHNA 1FW4A 1SR6B 1J55A 1EL4A 1F4OA 2M49B 3VGOA 1RECA 2LV7A 2LAPA 1KK7Z 3AAKA 1HT9A 1OMVA 3CGAA 3O2PA 2K7BA 1EH2A 4PHNA 2F33A 2BE6A 1KWOC 2KAXA 5CSJA 2KAVA 4YGDB 1F8HA 1LA0A 5AERA 2SASA 2K8MB 1PVAA 1WLMA 2KGRA 1K93D 4HRHA 2NCOA 5HYDA 1KFXL 1YR5A 1CFFA 2ISDA 2HETA 1BR4B 1YRUB 1NWDA 2CTNA 2K7DA 2MJWB 3A4UB 4UPGA 1PSRA 1FF1A 2EC6B 3GK1A 1QS7A 2QPTA 1SW8A 1IJ6A 3AAJA 4BY4A 1DJXA 1KCYA 2NLNA 2BCXA 1TNXA 1B7TZ 3I5GC 2MLFC 1DJHA 2HF5A 4QJ3B 2M1UA 2L5XB 3CS1A 2LLSA 1G33A 1FI5A 3KPXA 5I2OA 3SG6A 1MQ1A 1BMOA 1XFWO 1IWQA 1OQPA 2F2PA 1NX2A 3WNXB 2LMUA 4F0ZB 1IH0A 3M0WA 1SPYA 3EVUA 5CSNA 1BT6A 1XK4A 1YTZC 2KI4C 1AVSA 1ZACA 2LVIA 2WNDA 1SYMA 3SG2A 1YUSA 1W7IB 2KFFA 2H2KA 2F3ZA 3RLZA 4WQ3A 3DF0B 5B8IB 4MZKA 1PULA 1SL7A 4MZJA 1CFPA 1UHJA 4GNKB 1DF0B 5AEQA 2K0JA 2L50A 1KK8B 4A4CA 2EHBA 2HQWA 4DRWA 2WC8A 1JFJA 1CLLA 2KFHA 2DOQA 2NXQA 4I5LB 2CBLA 1QLSA 4MVFA 1CDPA 3IF7A 1NUBA 4CFRA 1SCMC 5ER4X 1BJFA 1YURA 1B1GA 1NCZA 3TZ1A 1A03A 2I94A 1QIWA 1K95A 3NSLA 4USLA 1YX8A 2PRUA 2Q91A 4MN0A 1SR6C 1CTRA 1NCXA 1QIVA 2WOSA 4CLNA 2MRDA 2ZN8A 1DJIA 2LMVA 4N1GA 2KQ6A 5CSFA 3WHUB 2JULA 4PE4A 2E30A 1B9AA 1UHKA 1K9PA 2JT8A 3I5GB 1QTXA 5ER5A 1PALA 1BR1B 3TUYB 2I7AA 3OB1B 1J1EA 4C0LA 4QJ5B 2LANA 1X02A 2OTGB 2ZFDA 1Q80A 3EK8A 1SCVA 2KOTA 3E3RA 1RTP1 4MLWA 2EC6C 1UHNA 1WDCC 4YBHB 1N0YA 4MRXA 1ZMZA 4YGAA 1S5GZ 1PRWA 4GGFC 1OZOA 1QV1A 2OS8C 4NDCA 1NIWA 1XFVO 2KI4B 1K96A 1V1GA 2LHIA 2KQYA 3EK4A 3ICBA 3OX5A 4WQ2A 1NCYA 1MXLC 1M39A 4PE1A 4OVNF 5I2LA 1AP4A 1AJ4A 2Y1NA 3BUOB 3JTDB 1TNPA 4AOMA 3IQQA 2LLUA 1Y1AA 1Y6WA 4PE0A 5KU1A 4AQJA 1YVHA 5AANA 2BCBA 1N65A 3D0YA 3PLFB 2O60A 2I2RE 3FWBA 1SBJA 3OP0A 3CWGA 3SG4A 1SCMB 1YUTA 3BOWB 1EJ3A 1DMOA 4XJKB 1A29A 2CCMA 1M63B 3FS7A 2JXLA 4AQIA 3BYAA 4E68A 5IBWA 3ZWHA 2PSRA 1R6PA 1LA3A 2L98A 3BUNB 1S6CA 5G08A 4MSPA 3EK7A 1KK8C 2LP3A 2GGMA 3DVMA 4P5OE 1FBVA 1UWOA 4JPZB 1VRKA 1JFKA 2LVVA 2ZRTA 3H4SE 1NPQA 1WRKA 2AUCA 1TNQA 3PN7B 1A2XA 3I5HC 3TDUA 3NXAA 2Y4QA 4ETOA 1NX0A 2ZKMX 4C0KA 5AFPA 4ICBA 2MAZA 5CPVA 1YUUA 2MHHA 1QV0A 4MRYA 5KTYA 1YX7A 1IG5A 1WRZA 4GBAA 4YGBB 1WDCB 3BUWB 1J7QA 1S36A 4YGEB 1ALWA 2KYCA 2OS8B 4D1EA 1UP5A 5DKQA 1CDMA 3VROA 3TUYC 2JOJA 1DTLA 2M3WA 4HSZA 4ZCVA 2FCDA 2KBIA 4DIRA 1CFCA 2OTGC 5KSZA 2BECA 1CDLA 3LLEA 1KSMA 1NP8A 1QX7A 1SK6D
chains in the Genus database with same CATH superfamily
2P70A 1XVJA 2KPHA 3O6BA 1MHOA 1N2DA 2WCHA 2L4HA 2CXJA 5JOLA 2QEOA 5I8NA 3R72A 1RROA 5FYXA 1LKJA 1SRAA 2L2CA 1JC2A 3BQ3A 1JWDA 1CLBA 3C1VA 3MSEB 5HLVA 2MA2A 4ORAB 2F8PA 1OOHA 2JRFA 3JTDC 3SG3A 2LUCA 1XFYO 2M0RA 2P71A 4PT1A 2RGIA 3L4LA 1NX1A 3D78A 2GGZA 2WCBA 3BUMB 3EVVA 3S0DA 3VRPA 1BU3A 2KAYA 1AK8A 3CTNA 3WHTB 1S6IA 1XFXO 3FWCA 2BL0B 1S26D 3AKAA 3CZ2A 1OOJA 1TCOB 2LNKA 4INXA 1XA5A 1U5IA 2H61C 4YI8A 2M7LA 1QATA 3I5HB 4ORCB 1ODBA 2L2EA 2L0PA 1OE9B 3NSIA 1M46A 4Q04A 1IJ5A 1WLZA 1B8CA 2BKIB 2FJYA 2G2BA 1WRLA 4YRUA 2K2FA 1IKUA 1DJYA 1S3PA 2V53A 4JWQA 3IVTA 1OOIX 2BCAA 2K7CA 4TNCA 4NDDA 5DICA 5I2QA 1JBAA 1UURA 1QLKA 2F3YA 3PN7C 3HX4A 3CR2A 3TS5B 4I5NB 3EKJA 1DJGA 2L51A 1KQMB 2NZ0A 1ZUZA 2JT3A 1S6JA 2LHLA 2BE4A 2WC6A 5D3OA 3A8RA 3OGNA 2KLDA 3D75A 4KYNA 1OMRA 4I5KA 3SIBA 1E8AA 1RJVA 1NSHA 1OOGA 2JZIA 2LP2A 3SG5A 2KI6D 1M31A 2KI6C 1LXFC 1F55A 1CFDA 2KFGA 3Q8IA 2JPOA 1C7WA 1TCFA 1DJWA 1CNPA 2PVBA 4BY5A 1PVBA 3I5IC 3NGVA 1SMGA 1HQVA 2PALA 1TWOA 3CDNA 2KSPA 2ZNDA 4FTGA 1J7OA 3DVKA 1DJZA 2HQ8A 1DGUA 3R1OA 3NHTA 4MZLA 5K89A 1MF8B 1CLMA 1OOFA 3AKBA 4GGFA 4NQGA 3RZSA 1KK7Y 1CKKA 1F70A 5BPJA 1IGVA 1SL8A 4IL1A 3VRNA 5EL2A 1YRTB 3WXAA 3OX6A 5HKYA 3BFBA 3PALA 2GTEA 3O4YA 1BLQA 2AMIA 4QJ4B 2LC5A 5HKWA 2JC2A 4JQ0D 1OMDA 2WCKA 1LVCD 4N5XA 2B1UA 2PASA 1QXPA 3LK0A 1SY9A 3NSOA 2M97A 2KBMA 1W7JB 4MBEA 4F7FA 1KQVA 2BL0C 1TIZA 3LK1A 2JT0A 2TN4A 2LVKA 3CABA 2QEVA 1B8RA 3D10A 1NX3A 2M8UA 3IQOA 4FQOA 5GQQC 1XFZO 4ZCUA 1BG1A 4OV2A 1B7TY 1J7PA 3DF0A 1JSAA 2BBNA 2AAOA 3BFAA 2E6WA 1F4QA 4NDBA 1Y1XA 1PSBA 1GQMA 1QVIY 3D74A 4A4BA 1OZSA 5FI7A 3S0EA 3GK4X 2FJUB 1TN4A 3DZTA 1DF0A 3D73A 3GK2A 4PHJA 2IS9A 1SNLA 1V1FA 1M45A 2O5GA 4PE7A 4R1EA 3FE8A 1KFUS 2A4JA 5J3XA 1XFUO 5D69A 1FPWA 2K2AA 2LVJA 1RFJA 1LINA 2QACA 5HKZA 3CR4X 3TS5C 1AUIB 4MEWA 1ZOTB 1GGWA 1Y1UA 1KQMC 2FOTA 1B47A 2JU0A 1Y0VH 5PALA 4PHMA 1DC1A 3BXKA 5HL1A 1L7ZA 3I5IB 4CPVA 1K9UA 1DQEA 1NYAA 1YVLA 4YI9A 3DD4A 4DS7A 4YGCB 1A75A 2PQLA 1KSOA 4M2OA 2WCEA 1K8UA 2K61A 3CLNA 2WORA 1D1OA 1ZFSA 2LCPA 3D0YB 1WY9A 4GAOA 2COLB 2JTZA 2JXCA 1XK4C 2KGBC 3FIAA 1K9KA 4M2QA 5I94A 2M7NA 2BKHB 1EG3A 2LE9B 4PCWA 1IQ5A 2EGDA 2P6BB 2G9BA 5HLOA 1XO5A 2CT9A 3PSRA 4HRGA 1QVIZ 1DGVA 1UHIA 3KHEA 3KO0A 3BUXB 3NSKA 2MBXA 2JTTA 1BF5A 1G8IA 2ZNEA 1CDNA 2ZRSA 4WRIA 1C07A 1T14A 2LMTA 5DKRA 1TOPA 1DVIA 1MUXA 3O78A 1TRFA 2VRGA 1KFXS 3RM1A 3PM8A 3DY9A 4U8DA 5TNCA 1MWNA 2GV5A 2Y1MA 1R2UA 4P2YB 4XYNA 1CM4A 1QASA 2BBMA 1H4BA 2JQ6A 1GJYA 3DVJA 4ORBB 2ERBA 1XFRA 1RK9A 3EVRA 3I5FB 1P28A 2PMYA 3QRXA 3TDIA 1G4YR 1J7RA 3CYZA 2K7OA 4GUKA 1QX5B 2Y5IA 1IQ3A 1UUSA 4DUQA 3TDZA 2H8VA 3VRQA 1S1EA 1MXEA 1JF2A 1OW4A 3JVTC 3L4AA 3CZTX 2PYQA 3UNWA 4CIDA 1S5GY 3OHMB 1JUOA 1KWOB 2KDHA 1L2OC 3BOWA 4HREE 3PFVA 1CMFA 2H61A 3GOFA 1TTXA 2R2IA 3LCPC 4XJKA 4N1FA 3SS3A 1MR8A 1UHHA 3CR5X 4GFTA 1CB1A 1W9ZA 3OB2B 3K21A 4L9MA 1RWYA 3B86A 1TUJA 2YGUA 1XYDA 3SG7A 1QX2A 1A75B 5DKNA 2CNPA 1SSEB 3F45A 4OKHA 1H8BA 1AHRA 1C7VA 5FI6A 2LUXA 2SCPA 1F71A 1K90D 4C0JA 1SL9A 2QEHA 1K2HA 4DCKA 1CM1A 2WCMA 1TNWA 3VRRA 2Q4UA 1B4CA 2I18A 2M29A 2QDIA 1OSAA 3LL8B 2JNFA 3S0AA 3EKHA 5CSIA 5F6TA 2HPSA 5D7FA 1ALVA 1BOCA 1J1DA 1IRJA 4OR9B 1PK0D 1EG4A 1BODA 4GGNA 1F54A 2LLTA 4I5JA 1GGZA 2KNEA 2FCEA 2WC5A 1U5IB 2JPTA 4OCIA 3KF9A 4M2PA 2NCPA 1DT7B 3PJIA 2F2OA 1CMGA 1KFUL 4PHKA 4IJ7A 2M9GA 2LM5A 3HCMA 3DVEA 3ZNIA 4CFQA 1K94A 2ZN9A 5AXIA 2QEBA 4PDZA 1AJ5A 3PATA 2WCFA 3JVTB 1A4PA 1SKTA 2KYFA 5FI2A 5JJGA 3SIAA 2M1KB 3KEVA 1FI6A 2JWWA 3PM2A 2L4IA 3SJSA 1L2OB 2D8NA 1JF0A 2MLEC 2OPOA 1B8LA 3I5FC 1QJTA 1EXRA 2JNXA 4GPLB 1DEKA 3S0GA 4PALA 2KHNA 1FW4A 1SR6B 1J55A 1EL4A 1F4OA 2M49B 3VGOA 1RECA 2LV7A 2LAPA 1KK7Z 3AAKA 1HT9A 1OMVA 3CGAA 3O2PA 3UO9A 2K7BA 1EH2A 4PHNA 2F33A 2BE6A 1KWOC 2KAXA 2KLEA 3D76A 5CSJA 2KAVA 4YGDB 1F8HA 1LA0A 5AERA 2SASA 2K8MB 1PVAA 3SS5A 1WLMA 2KGRA 1K93D 4HRHA 2NCOA 5HYDA 1KFXL 1YR5A 1CFFA 2ISDA 2HETA 1BR4B 1YRUB 1NWDA 2CTNA 2K7DA 2MJWB 2BAPA 3A4UB 4UPGA 1PSRA 1FF1A 2EC6B 3GK1A 1QS7A 2QPTA 1SW8A 1IJ6A 3AAJA 4BY4A 1DJXA 1KCYA 1TUZA 2NLNA 2BCXA 1TNXA 1B7TZ 3CZ1A 3I5GC 2MLFC 1DJHA 2HF5A 4QJ3B 3L47A 2M1UA 2L5XB 3CS1A 1Z2CB 2LLSA 1G33A 1FI5A 3KPXA 5I2OA 3SG6A 1MQ1A 1BMOA 1XFWO 1IWQA 1OQPA 2F2PA 1NX2A 2WCLA 2LMUA 3WNXB 4OZDA 4F0ZB 1IH0A 3M0WA 1SPYA 3EVUA 5CSNA 1BT6A 1XK4A 1YTZC 2KI4C 1AVSA 1ZACA 2LVIA 2WNDA 1SYMA 3SG2A 1YUSA 1W7IB 2KFFA 3FE6A 2H2KA 2F3ZA 3DYEA 3RLZA 4WQ3A 3DF0B 5B8IB 3R1VA 3R1PA 4MZKA 1PULA 1SL7A 4MZJA 3DXLA 1CFPA 1UHJA 3EG5B 4GNKB 1DF0B 1Z4HA 5AEQA 2K0JA 2L50A 1KK8B 4A4CA 2EHBA 2HQWA 4DRWA 2WC8A 1JFJA 1CLLA 2KFHA 2DOQA 2NXQA 4I5LB 2CBLA 1QLSA 4MVFA 1CDPA 3IF7A 4INWA 1NUBA 4CFRA 1SCMC 5ER4X 1BJFA 1YURA 1B1GA 1NCZA 3TZ1A 1A03A 2I94A 1QIWA 1C3ZA 1K95A 3NSLA 4USLA 1YX8A 2PRUA 2Q91A 4MN0A 1SR6C 1CTRA 2BNXA 1NCXA 1QIVA 2WOSA 4CLNA 2MRDA 2ZN8A 1DJIA 2LMVA 4N1GA 2KQ6A 3B6XA 5CSFA 3WHUB 2JULA 4PE4A 2E30A 3SS4A 1B9AA 1UHKA 1K9PA 2JT8A 3I5GB 1QTXA 5ER5A 1PALA 1BR1B 3TUYB 1QWVA 2I7AA 3OB1B 3D77A 1J1EA 3S0BA 4C0LA 4QJ5B 1LS8A 2LANA 1X02A 2OTGB 2ZFDA 1Q80A 3EK8A 3V2LA 3O4XA 1SCVA 2KOTA 3E3RA 1RTP1 4MLWA 2EC6C 1UHNA 1WDCC 4YBHB 1N0YA 4MRXA 1ZMZA 4YGAA 1S5GZ 1PRWA 3B88A 1OZOA 4GGFC 1QV1A 2OS8C 4NDCA 1NIWA 1XFVO 2KI4B 1DELA 1K96A 1V1GA 2KQYA 2LHIA 3EK4A 3ICBA 3OX5A 4WQ2A 1NCYA 1MXLC 3BJHA 1M39A 4PE1A 4OVNF 5I2LA 1AP4A 1C3YA 1AJ4A 2Y1NA 3BUOB 3JTDB 3QMEA 1TNPA 4JKTA 4AOMA 3IQQA 2LLUA 3K1EA 1Y1AA 1Y6WA 4PE0A 5KU1A 4AQJA 1YVHA 5AANA 2BCBA 1N65A 3D0YA 3PLFB 2O60A 2WCJA 3B87A 2I2RE 3FWBA 1SBJA 3OP0A 3CWGA 3SG4A 1SCMB 1YUTA 3BOWB 1EJ3A 1DMOA 4XJKB 1A29A 3S0FA 2CCMA 1M63B 3FS7A 2JXLA 4AQIA 3BYAA 4E68A 5IBWA 3ZWHA 2PSRA 1R6PA 1LA3A 2L98A 3BUNB 1S6CA 3NHIA 4MSPA 5G08A 3EK7A 1KK8C 2LP3A 2GGMA 3DVMA 4P5OE 1FBVA 1UWOA 4JPZB 3B7AA 1VRKA 1JFKA 2LVVA 2L5YA 2ZRTA 3H4SE 1NPQA 3BFHA 1WRKA 2AUCA 1TNQA 3PN7B 1A2XA 3I5HC 3TDUA 3NXAA 2Y4QA 4ETOA 1NX0A 2ZKMX 2K60A 3N7HA 4C0KA 5AFPA 1IIOA 4ICBA 2MAZA 5CPVA 1YUUA 3VB1A 2MHHA 1QV0A 3CZ0A 1ORGA 4MRYA 5KTYA 4FQTA 1YX7A 1IG5A 1WRZA 4GBAA 4YGBB 1GM0A 1WDCB 3BUWB 1J7QA 1S36A 4YGEB 1ALWA 2KYCA 2OS8B 4D1EA 1UP5A 5DKQA 1CDMA 3VROA 3TUYC 2JOJA 1DTLA 2M3WA 4HSZA 4ZCVA 2FCDA 2KBIA 4DIRA 1CFCA 2OTGC 5KSZA 2BECA 3OBVA 1CDLA 3LLEA 1KSMA 4JD9A 1NP8A 1QX7A 1SK6D 3FE9A
chains in the Genus database with same CATH topology
1XVJA 3O6BA 1MHOA 1N2DA 2L4HA 2CXJA 5JOLA 5I8NA 1RROA 5FYXA 1LKJA 1SRAA 1JC2A 3BQ3A 1JWDA 1CLBA 3C1VA 3MSEB 5HLVA 2MA2A 4ORAB 2F8PA 2JRFA 3SG3A 3JTDC 2LUCA 1XFYO 2M0RA 2RGIA 1NX1A 2GGZA 2WCBA 3BUMB 3EVVA 3VRPA 1AK8A 1BU3A 2KAYA 3CTNA 3WHTB 1S6IA 1XFXO 3FWCA 2BL0B 1S26D 3AKAA 1OOJA 1TCOB 2LNKA 1XA5A 1U5IA 2H61C 4YI8A 2M7LA 1QATA 3I5HB 4ORCB 1ODBA 2L2EA 2L0PA 1OE9B 3NSIA 1M46A 4Q04A 1IJ5A 1WLZA 1B8CA 2BKIB 2G2BA 1WRLA 4YRUA 2K2FA 1IKUA 1DJYA 1S3PA 2V53A 4JWQA 2K7CA 2BCAA 4TNCA 4NDDA 5I2QA 1JBAA 1UURA 1QLKA 2F3YA 3PN7C 3HX4A 3CR2A 3TS5B 4I5NB 3EKJA 1DJGA 2L51A 1KQMB 2NZ0A 1ZUZA 2JT3A 1S6JA 2LHLA 2BE4A 3A8RA 1OMRA 4I5KA 3SIBA 1E8AA 1RJVA 1NSHA 2JZIA 2LP2A 3SG5A 2KI6D 1M31A 2KI6C 1LXFC 1F55A 1CFDA 2KFGA 1C7WA 1TCFA 1DJWA 1CNPA 2PVBA 4BY5A 1PVBA 3I5IC 1SMGA 1HQVA 2PALA 2KSPA 2ZNDA 4FTGA 1J7OA 3DVKA 1DJZA 2HQ8A 1DGUA 4MZLA 5K89A 1MF8B 1CLMA 3AKBA 4GGFA 4NQGA 1CKKA 1F70A 1KK7Y 5BPJA 1IGVA 1SL8A 4IL1A 3VRNA 1YRTB 3WXAA 3OX6A 5HKYA 3PALA 3O4YA 1BLQA 2AMIA 4QJ4B 2LC5A 5HKWA 2JC2A 4JQ0D 1OMDA 1LVCD 4N5XA 2B1UA 2PASA 1QXPA 3LK0A 1SY9A 3NSOA 2M97A 2KBMA 1W7JB 4MBEA 1KQVA 2BL0C 1TIZA 3LK1A 2JT0A 2TN4A 2LVKA 1B8RA 3D10A 1NX3A 2M8UA 3IQOA 4FQOA 5GQQC 1XFZO 4ZCUA 1BG1A 4OV2A 1B7TY 1J7PA 3DF0A 1JSAA 2BBNA 2AAOA 2E6WA 1F4QA 4NDBA 1Y1XA 1PSBA 1GQMA 1QVIY 4A4BA 1OZSA 3GK4X 2FJUB 1TN4A 4PHJA 1DF0A 3GK2A 2IS9A 1SNLA 1V1FA 1M45A 2O5GA 4PE7A 4R1EA 1KFUS 2A4JA 5J3XA 1XFUO 5D69A 1FPWA 2K2AA 2LVJA 1RFJA 1LINA 2QACA 5HKZA 3CR4X 3TS5C 1AUIB 4MEWA 1ZOTB 1GGWA 1Y1UA 1KQMC 2FOTA 1B47A 2JU0A 1Y0VH 5PALA 4PHMA 3BXKA 1L7ZA 3I5IB 4CPVA 1K9UA 1NYAA 1YVLA 4YI9A 3DD4A 4DS7A 4YGCB 1A75A 1KSOA 4M2OA 2WCEA 1K8UA 2K61A 3CLNA 2WORA 1D1OA 1ZFSA 2LCPA 3D0YB 1WY9A 4GAOA 2COLB 2JTZA 2JXCA 1XK4C 2KGBC 3FIAA 1K9KA 4M2QA 2M7NA 2BKHB 1EG3A 2LE9B 4PCWA 1IQ5A 2EGDA 2P6BB 2G9BA 5HLOA 1XO5A 2CT9A 3PSRA 4HRGA 1QVIZ 1DGVA 1UHIA 3KHEA 3KO0A 3BUXB 3NSKA 2MBXA 2JTTA 1BF5A 1G8IA 2ZNEA 1CDNA 2ZRSA 4WRIA 1C07A 2LMTA 5DKRA 1TOPA 1DVIA 1MUXA 3O78A 1TRFA 2VRGA 1KFXS 3RM1A 3PM8A 4U8DA 5TNCA 1MWNA 2GV5A 2Y1MA 1R2UA 4P2YB 4XYNA 1CM4A 1QASA 2BBMA 1H4BA 2JQ6A 1GJYA 3DVJA 4ORBB 3I5FB 1RK9A 3EVRA 2PMYA 3QRXA 3TDIA 1G4YR 1J7RA 2K7OA 4GUKA 1QX5B 2Y5IA 1IQ3A 1UUSA 4DUQA 3TDZA 3VRQA 1S1EA 1MXEA 1JF2A 3JVTC 4CIDA 3CZTX 1S5GY 3OHMB 1JUOA 1KWOB 2KDHA 1L2OC 3BOWA 4HREE 3PFVA 1CMFA 2H61A 3GOFA 1TTXA 2R2IA 3LCPC 4XJKA 4N1FA 1MR8A 1UHHA 3CR5X 4GFTA 1CB1A 3OB2B 3K21A 4L9MA 1RWYA 1XYDA 3SG7A 1QX2A 1A75B 5DKNA 2CNPA 3F45A 4OKHA 1H8BA 1AHRA 1C7VA 2LUXA 2SCPA 1F71A 1K90D 4C0JA 1SL9A 1K2HA 4DCKA 1CM1A 1TNWA 3VRRA 2Q4UA 1B4CA 2I18A 2M29A 1OSAA 3LL8B 2JNFA 3EKHA 5CSIA 5F6TA 2HPSA 5D7FA 1ALVA 1BOCA 1J1DA 1IRJA 4OR9B 1PK0D 1EG4A 1BODA 4GGNA 1F54A 2LLTA 4I5JA 1GGZA 2KNEA 2FCEA 1U5IB 2JPTA 4OCIA 3KF9A 4M2PA 2NCPA 1DT7B 2F2OA 1CMGA 1KFUL 4PHKA 2M9GA 2LM5A 3HCMA 3DVEA 3ZNIA 4CFQA 1K94A 2ZN9A 5AXIA 4PDZA 1AJ5A 3PATA 2WCFA 3JVTB 1A4PA 1SKTA 2KYFA 5JJGA 3SIAA 2M1KB 3KEVA 1FI6A 2JWWA 2L4IA 3SJSA 1L2OB 2D8NA 1JF0A 2MLEC 2OPOA 1B8LA 3I5FC 1QJTA 1EXRA 2JNXA 4GPLB 4PALA 2KHNA 1FW4A 1SR6B 1J55A 1EL4A 1F4OA 2M49B 3VGOA 1RECA 2LV7A 2LAPA 1KK7Z 3AAKA 1HT9A 1OMVA 3CGAA 3O2PA 2K7BA 1EH2A 4PHNA 2F33A 2BE6A 1KWOC 2KAXA 5CSJA 2KAVA 4YGDB 1F8HA 1LA0A 5AERA 2SASA 2K8MB 1PVAA 1WLMA 2KGRA 1K93D 4HRHA 2NCOA 5HYDA 1KFXL 1YR5A 1CFFA 2ISDA 2HETA 1BR4B 1YRUB 1NWDA 2CTNA 2K7DA 2MJWB 3A4UB 4UPGA 1PSRA 1FF1A 2EC6B 3GK1A 1QS7A 2QPTA 1SW8A 1IJ6A 3AAJA 4BY4A 1DJXA 1KCYA 2NLNA 2BCXA 1TNXA 1B7TZ 3I5GC 2MLFC 1DJHA 2HF5A 4QJ3B 2M1UA 2L5XB 3CS1A 2LLSA 1G33A 1FI5A 3KPXA 5I2OA 3SG6A 1MQ1A 1BMOA 1XFWO 1IWQA 1OQPA 2F2PA 1NX2A 3WNXB 2LMUA 4F0ZB 1IH0A 3M0WA 1SPYA 3EVUA 5CSNA 1BT6A 1XK4A 1YTZC 2KI4C 1AVSA 1ZACA 2LVIA 2WNDA 1SYMA 3SG2A 1YUSA 1W7IB 2KFFA 2H2KA 2F3ZA 3RLZA 4WQ3A 3DF0B 5B8IB 4MZKA 1PULA 1SL7A 4MZJA 1CFPA 1UHJA 4GNKB 1DF0B 5AEQA 2K0JA 2L50A 1KK8B 4A4CA 2EHBA 2HQWA 4DRWA 2WC8A 1JFJA 1CLLA 2KFHA 2DOQA 2NXQA 4I5LB 2CBLA 1QLSA 4MVFA 1CDPA 3IF7A 1NUBA 4CFRA 1SCMC 5ER4X 1BJFA 1YURA 1B1GA 1NCZA 3TZ1A 1A03A 2I94A 1QIWA 1K95A 3NSLA 4USLA 1YX8A 2PRUA 2Q91A 4MN0A 1SR6C 1CTRA 1NCXA 1QIVA 2WOSA 4CLNA 2MRDA 2ZN8A 1DJIA 2LMVA 4N1GA 2KQ6A 5CSFA 3WHUB 2JULA 4PE4A 2E30A 1B9AA 1UHKA 1K9PA 2JT8A 3I5GB 1QTXA 5ER5A 1PALA 1BR1B 3TUYB 2I7AA 3OB1B 1J1EA 4C0LA 4QJ5B 2LANA 1X02A 2OTGB 2ZFDA 1Q80A 3EK8A 1SCVA 2KOTA 3E3RA 1RTP1 4MLWA 2EC6C 1UHNA 1WDCC 4YBHB 1N0YA 4MRXA 1ZMZA 4YGAA 1S5GZ 1PRWA 4GGFC 1OZOA 1QV1A 2OS8C 4NDCA 1NIWA 1XFVO 2KI4B 1K96A 1V1GA 2LHIA 2KQYA 3EK4A 3ICBA 3OX5A 4WQ2A 1NCYA 1MXLC 1M39A 4PE1A 4OVNF 5I2LA 1AP4A 1AJ4A 2Y1NA 3BUOB 3JTDB 1TNPA 4AOMA 3IQQA 2LLUA 1Y1AA 1Y6WA 4PE0A 5KU1A 4AQJA 1YVHA 5AANA 2BCBA 1N65A 3D0YA 3PLFB 2O60A 2I2RE 3FWBA 1SBJA 3OP0A 3CWGA 3SG4A 1SCMB 1YUTA 3BOWB 1EJ3A 1DMOA 4XJKB 1A29A 2CCMA 1M63B 3FS7A 2JXLA 4AQIA 3BYAA 4E68A 5IBWA 3ZWHA 2PSRA 1R6PA 1LA3A 2L98A 3BUNB 1S6CA 5G08A 4MSPA 3EK7A 1KK8C 2LP3A 2GGMA 3DVMA 4P5OE 1FBVA 1UWOA 4JPZB 1VRKA 1JFKA 2LVVA 2ZRTA 3H4SE 1NPQA 1WRKA 2AUCA 1TNQA 3PN7B 1A2XA 3I5HC 3TDUA 3NXAA 2Y4QA 4ETOA 1NX0A 2ZKMX 4C0KA 5AFPA 4ICBA 2MAZA 5CPVA 1YUUA 2MHHA 1QV0A 4MRYA 5KTYA 1YX7A 1IG5A 1WRZA 4GBAA 4YGBB 1WDCB 3BUWB 1J7QA 1S36A 4YGEB 1ALWA 2KYCA 2OS8B 4D1EA 1UP5A 5DKQA 1CDMA 3VROA 3TUYC 2JOJA 1DTLA 2M3WA 4HSZA 4ZCVA 2FCDA 2KBIA 4DIRA 1CFCA 2OTGC 5KSZA 2BECA 1CDLA 3LLEA 1KSMA 1NP8A 1QX7A 1SK6D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XVJ A;  3O6B A;  1MHO A;  1N2D A;  2L4H A;  2CXJ A;  5JOL A;  5I8N A;  1RRO A;  5FYX A;  1LKJ A;  1SRA A;  1JC2 A;  3BQ3 A;  1JWD A;  1CLB A;  3C1V A;  3MSE B;  5HLV A;  2MA2 A;  4ORA B;  2F8P A;  2JRF A;  3SG3 A;  3JTD C;  2LUC A;  1XFY O;  2M0R A;  2RGI A;  1NX1 A;  2GGZ A;  2WCB A;  3BUM B;  3EVV A;  3VRP A;  1AK8 A;  1BU3 A;  2KAY A;  3CTN A;  3WHT B;  1S6I A;  1XFX O;  3FWC A;  2BL0 B;  1S26 D;  3AKA A;  1OOJ A;  1TCO B;  2LNK A;  1XA5 A;  1U5I A;  2H61 C;  4YI8 A;  2M7L A;  1QAT A;  3I5H B;  4ORC B;  1ODB A;  2L2E A;  2L0P A;  1OE9 B;  3NSI A;  1M46 A;  4Q04 A;  1IJ5 A;  1WLZ A;  1B8C A;  2BKI B;  2G2B A;  1WRL A;  4YRU A;  2K2F A;  1IKU A;  1DJY A;  1S3P A;  2V53 A;  4JWQ A;  2K7C A;  2BCA A;  4TNC A;  4NDD A;  5I2Q A;  1JBA A;  1UUR A;  1QLK A;  2F3Y A;  3PN7 C;  3HX4 A;  3CR2 A;  3TS5 B;  4I5N B;  3EKJ A;  1DJG A;  2L51 A;  1KQM B;  2NZ0 A;  1ZUZ A;  2JT3 A;  1S6J A;  2LHL A;  2BE4 A;  3A8R A;  1OMR A;  4I5K A;  3SIB A;  1E8A A;  1RJV A;  1NSH A;  2JZI A;  2LP2 A;  3SG5 A;  2KI6 D;  1M31 A;  2KI6 C;  1LXF C;  1F55 A;  1CFD A;  2KFG A;  1C7W A;  1TCF A;  1DJW A;  1CNP A;  2PVB A;  4BY5 A;  1PVB A;  3I5I C;  1SMG A;  1HQV A;  2PAL A;  2KSP A;  2ZND A;  4FTG A;  1J7O A;  3DVK A;  1DJZ A;  2HQ8 A;  1DGU A;  4MZL A;  5K89 A;  1MF8 B;  1CLM A;  3AKB A;  4GGF A;  4NQG A;  1CKK A;  1F70 A;  1KK7 Y;  5BPJ A;  1IGV A;  1SL8 A;  4IL1 A;  3VRN A;  1YRT B;  3WXA A;  3OX6 A;  5HKY A;  3PAL A;  3O4Y A;  1BLQ A;  2AMI A;  4QJ4 B;  2LC5 A;  5HKW A;  2JC2 A;  4JQ0 D;  1OMD A;  1LVC D;  4N5X A;  2B1U A;  2PAS A;  1QXP A;  3LK0 A;  1SY9 A;  3NSO A;  2M97 A;  2KBM A;  1W7J B;  4MBE A;  1KQV A;  2BL0 C;  1TIZ A;  3LK1 A;  2JT0 A;  2TN4 A;  2LVK A;  1B8R A;  3D10 A;  1NX3 A;  2M8U A;  3IQO A;  4FQO A;  5GQQ C;  1XFZ O;  4ZCU A;  1BG1 A;  4OV2 A;  1B7T Y;  1J7P A;  3DF0 A;  1JSA A;  2BBN A;  2AAO A;  2E6W A;  1F4Q A;  4NDB A;  1Y1X A;  1PSB A;  1GQM A;  1QVI Y;  4A4B A;  1OZS A;  3GK4 X;  2FJU B;  1TN4 A;  4PHJ A;  1DF0 A;  3GK2 A;  2IS9 A;  1SNL A;  1V1F A;  1M45 A;  2O5G A;  4PE7 A;  4R1E A;  1KFU S;  2A4J A;  5J3X A;  1XFU O;  5D69 A;  1FPW A;  2K2A A;  2LVJ A;  1RFJ A;  1LIN A;  2QAC A;  5HKZ A;  3CR4 X;  3TS5 C;  1AUI B;  4MEW A;  1ZOT B;  1GGW A;  1Y1U A;  1KQM C;  2FOT A;  1B47 A;  2JU0 A;  1Y0V H;  5PAL A;  4PHM A;  3BXK A;  1L7Z A;  3I5I B;  4CPV A;  1K9U A;  1NYA A;  1YVL A;  4YI9 A;  3DD4 A;  4DS7 A;  4YGC B;  1A75 A;  1KSO A;  4M2O A;  2WCE A;  1K8U A;  2K61 A;  3CLN A;  2WOR A;  1D1O A;  1ZFS A;  2LCP A;  3D0Y B;  1WY9 A;  4GAO A;  2COL B;  2JTZ A;  2JXC A;  1XK4 C;  2KGB C;  3FIA A;  1K9K A;  4M2Q A;  2M7N A;  2BKH B;  1EG3 A;  2LE9 B;  4PCW A;  1IQ5 A;  2EGD A;  2P6B B;  2G9B A;  5HLO A;  1XO5 A;  2CT9 A;  3PSR A;  4HRG A;  1QVI Z;  1DGV A;  1UHI A;  3KHE A;  3KO0 A;  3BUX B;  3NSK A;  2MBX A;  2JTT A;  1BF5 A;  1G8I A;  2ZNE A;  1CDN A;  2ZRS A;  4WRI A;  1C07 A;  2LMT A;  5DKR A;  1TOP A;  1DVI A;  1MUX A;  3O78 A;  1TRF A;  2VRG A;  1KFX S;  3RM1 A;  3PM8 A;  4U8D A;  5TNC A;  1MWN A;  2GV5 A;  2Y1M A;  1R2U A;  4P2Y B;  4XYN A;  1CM4 A;  1QAS A;  2BBM A;  1H4B A;  2JQ6 A;  1GJY A;  3DVJ A;  4ORB B;  3I5F B;  1RK9 A;  3EVR A;  2PMY A;  3QRX A;  3TDI A;  1G4Y R;  1J7R A;  2K7O A;  4GUK A;  1QX5 B;  2Y5I A;  1IQ3 A;  1UUS A;  4DUQ A;  3TDZ A;  3VRQ A;  1S1E A;  1MXE A;  1JF2 A;  3JVT C;  4CID A;  3CZT X;  1S5G Y;  3OHM B;  1JUO A;  1KWO B;  2KDH A;  1L2O C;  3BOW A;  4HRE E;  3PFV A;  1CMF A;  2H61 A;  3GOF A;  1TTX A;  2R2I A;  3LCP C;  4XJK A;  4N1F A;  1MR8 A;  1UHH A;  3CR5 X;  4GFT A;  1CB1 A;  3OB2 B;  3K21 A;  4L9M A;  1RWY A;  1XYD A;  3SG7 A;  1QX2 A;  1A75 B;  5DKN A;  2CNP A;  3F45 A;  4OKH A;  1H8B A;  1AHR A;  1C7V A;  2LUX A;  2SCP A;  1F71 A;  1K90 D;  4C0J A;  1SL9 A;  1K2H A;  4DCK A;  1CM1 A;  1TNW A;  3VRR A;  2Q4U A;  1B4C A;  2I18 A;  2M29 A;  1OSA A;  3LL8 B;  2JNF A;  3EKH A;  5CSI A;  5F6T A;  2HPS A;  5D7F A;  1ALV A;  1BOC A;  1J1D A;  1IRJ A;  4OR9 B;  1PK0 D;  1EG4 A;  1BOD A;  4GGN A;  1F54 A;  2LLT A;  4I5J A;  1GGZ A;  2KNE A;  2FCE A;  1U5I B;  2JPT A;  4OCI A;  3KF9 A;  4M2P A;  2NCP A;  1DT7 B;  2F2O A;  1CMG A;  1KFU L;  4PHK A;  2M9G A;  2LM5 A;  3HCM A;  3DVE A;  3ZNI A;  4CFQ A;  1K94 A;  2ZN9 A;  5AXI A;  4PDZ A;  1AJ5 A;  3PAT A;  2WCF A;  3JVT B;  1A4P A;  1SKT A;  2KYF A;  5JJG A;  3SIA A;  2M1K B;  3KEV A;  1FI6 A;  2JWW A;  2L4I A;  3SJS A;  1L2O B;  2D8N A;  1JF0 A;  2MLE C;  2OPO A;  1B8L A;  3I5F C;  1QJT A;  1EXR A;  2JNX A;  4GPL B;  4PAL A;  2KHN A;  1FW4 A;  1SR6 B;  1J55 A;  1EL4 A;  1F4O A;  2M49 B;  3VGO A;  1REC A;  2LV7 A;  2LAP A;  1KK7 Z;  3AAK A;  1HT9 A;  1OMV A;  3CGA A;  3O2P A;  2K7B A;  1EH2 A;  4PHN A;  2F33 A;  2BE6 A;  1KWO C;  2KAX A;  5CSJ A;  2KAV A;  4YGD B;  1F8H A;  1LA0 A;  5AER A;  2SAS A;  2K8M B;  1PVA A;  1WLM A;  2KGR A;  1K93 D;  4HRH A;  2NCO A;  5HYD A;  1KFX L;  1YR5 A;  1CFF A;  2ISD A;  2HET A;  1BR4 B;  1YRU B;  1NWD A;  2CTN A;  2K7D A;  2MJW B;  3A4U B;  4UPG A;  1PSR A;  1FF1 A;  2EC6 B;  3GK1 A;  1QS7 A;  2QPT A;  1SW8 A;  1IJ6 A;  3AAJ A;  4BY4 A;  1DJX A;  1KCY A;  2NLN A;  2BCX A;  1TNX A;  1B7T Z;  3I5G C;  2MLF C;  1DJH A;  2HF5 A;  4QJ3 B;  2M1U A;  2L5X B;  3CS1 A;  2LLS A;  1G33 A;  1FI5 A;  3KPX A;  5I2O A;  3SG6 A;  1MQ1 A;  1BMO A;  1XFW O;  1IWQ A;  1OQP A;  2F2P A;  1NX2 A;  3WNX B;  2LMU A;  4F0Z B;  1IH0 A;  3M0W A;  1SPY A;  3EVU A;  5CSN A;  1BT6 A;  1XK4 A;  1YTZ C;  2KI4 C;  1AVS A;  1ZAC A;  2LVI A;  2WND A;  1SYM A;  3SG2 A;  1YUS A;  1W7I B;  2KFF A;  2H2K A;  2F3Z A;  3RLZ A;  4WQ3 A;  3DF0 B;  5B8I B;  4MZK A;  1PUL A;  1SL7 A;  4MZJ A;  1CFP A;  1UHJ A;  4GNK B;  1DF0 B;  5AEQ A;  2K0J A;  2L50 A;  1KK8 B;  4A4C A;  2EHB A;  2HQW A;  4DRW A;  2WC8 A;  1JFJ A;  1CLL A;  2KFH A;  2DOQ A;  2NXQ A;  4I5L B;  2CBL A;  1QLS A;  4MVF A;  1CDP A;  3IF7 A;  1NUB A;  4CFR A;  1SCM C;  5ER4 X;  1BJF A;  1YUR A;  1B1G A;  1NCZ A;  3TZ1 A;  1A03 A;  2I94 A;  1QIW A;  1K95 A;  3NSL A;  4USL A;  1YX8 A;  2PRU A;  2Q91 A;  4MN0 A;  1SR6 C;  1CTR A;  1NCX A;  1QIV A;  2WOS A;  4CLN A;  2MRD A;  2ZN8 A;  1DJI A;  2LMV A;  4N1G A;  2KQ6 A;  5CSF A;  3WHU B;  2JUL A;  4PE4 A;  2E30 A;  1B9A A;  1UHK A;  1K9P A;  2JT8 A;  3I5G B;  1QTX A;  5ER5 A;  1PAL A;  1BR1 B;  3TUY B;  2I7A A;  3OB1 B;  1J1E A;  4C0L A;  4QJ5 B;  2LAN A;  1X02 A;  2OTG B;  2ZFD A;  1Q80 A;  3EK8 A;  1SCV A;  2KOT A;  3E3R A;  1RTP 1;  4MLW A;  2EC6 C;  1UHN A;  1WDC C;  4YBH B;  1N0Y A;  4MRX A;  1ZMZ A;  4YGA A;  1S5G Z;  1PRW A;  4GGF C;  1OZO A;  1QV1 A;  2OS8 C;  4NDC A;  1NIW A;  1XFV O;  2KI4 B;  1K96 A;  1V1G A;  2LHI A;  2KQY A;  3EK4 A;  3ICB A;  3OX5 A;  4WQ2 A;  1NCY A;  1MXL C;  1M39 A;  4PE1 A;  4OVN F;  5I2L A;  1AP4 A;  1AJ4 A;  2Y1N A;  3BUO B;  3JTD B;  1TNP A;  4AOM A;  3IQQ A;  2LLU A;  1Y1A A;  1Y6W A;  4PE0 A;  5KU1 A;  4AQJ A;  1YVH A;  5AAN A;  2BCB A;  1N65 A;  3D0Y A;  3PLF B;  2O60 A;  2I2R E;  3FWB A;  1SBJ A;  3OP0 A;  3CWG A;  3SG4 A;  1SCM B;  1YUT A;  3BOW B;  1EJ3 A;  1DMO A;  4XJK B;  1A29 A;  2CCM A;  1M63 B;  3FS7 A;  2JXL A;  4AQI A;  3BYA A;  4E68 A;  5IBW A;  3ZWH A;  2PSR A;  1R6P A;  1LA3 A;  2L98 A;  3BUN B;  1S6C A;  5G08 A;  4MSP A;  3EK7 A;  1KK8 C;  2LP3 A;  2GGM A;  3DVM A;  4P5O E;  1FBV A;  1UWO A;  4JPZ B;  1VRK A;  1JFK A;  2LVV A;  2ZRT A;  3H4S E;  1NPQ A;  1WRK A;  2AUC A;  1TNQ A;  3PN7 B;  1A2X A;  3I5H C;  3TDU A;  3NXA A;  2Y4Q A;  4ETO A;  1NX0 A;  2ZKM X;  4C0K A;  5AFP A;  4ICB A;  2MAZ A;  5CPV A;  1YUU A;  2MHH A;  1QV0 A;  4MRY A;  5KTY A;  1YX7 A;  1IG5 A;  1WRZ A;  4GBA A;  4YGB B;  1WDC B;  3BUW B;  1J7Q A;  1S36 A;  4YGE B;  1ALW A;  2KYC A;  2OS8 B;  4D1E A;  1UP5 A;  5DKQ A;  1CDM A;  3VRO A;  3TUY C;  2JOJ A;  1DTL A;  2M3W A;  4HSZ A;  4ZCV A;  2FCD A;  2KBI A;  4DIR A;  1CFC A;  2OTG C;  5KSZ A;  2BEC A;  1CDL A;  3LLE A;  1KSM A;  1NP8 A;  1QX7 A;  1SK6 D; 
#chains in the Genus database with same CATH topology
 2P70 A;  1XVJ A;  2KPH A;  3O6B A;  1MHO A;  1N2D A;  2WCH A;  2L4H A;  2CXJ A;  5JOL A;  2QEO A;  5I8N A;  3R72 A;  1RRO A;  5FYX A;  1LKJ A;  1SRA A;  2L2C A;  1JC2 A;  3BQ3 A;  1JWD A;  1CLB A;  3C1V A;  3MSE B;  5HLV A;  2MA2 A;  4ORA B;  2F8P A;  1OOH A;  2JRF A;  3JTD C;  3SG3 A;  2LUC A;  1XFY O;  2M0R A;  2P71 A;  4PT1 A;  2RGI A;  3L4L A;  1NX1 A;  3D78 A;  2GGZ A;  2WCB A;  3BUM B;  3EVV A;  3S0D A;  3VRP A;  1BU3 A;  2KAY A;  1AK8 A;  3CTN A;  3WHT B;  1S6I A;  1XFX O;  3FWC A;  2BL0 B;  1S26 D;  3AKA A;  3CZ2 A;  1OOJ A;  1TCO B;  2LNK A;  4INX A;  1XA5 A;  1U5I A;  2H61 C;  4YI8 A;  2M7L A;  1QAT A;  3I5H B;  4ORC B;  1ODB A;  2L2E A;  2L0P A;  1OE9 B;  3NSI A;  1M46 A;  4Q04 A;  1IJ5 A;  1WLZ A;  1B8C A;  2BKI B;  2FJY A;  2G2B A;  1WRL A;  4YRU A;  2K2F A;  1IKU A;  1DJY A;  1S3P A;  2V53 A;  4JWQ A;  3IVT A;  1OOI X;  2BCA A;  2K7C A;  4TNC A;  4NDD A;  5DIC A;  5I2Q A;  1JBA A;  1UUR A;  1QLK A;  2F3Y A;  3PN7 C;  3HX4 A;  3CR2 A;  3TS5 B;  4I5N B;  3EKJ A;  1DJG A;  2L51 A;  1KQM B;  2NZ0 A;  1ZUZ A;  2JT3 A;  1S6J A;  2LHL A;  2BE4 A;  2WC6 A;  5D3O A;  3A8R A;  3OGN A;  2KLD A;  3D75 A;  4KYN A;  1OMR A;  4I5K A;  3SIB A;  1E8A A;  1RJV A;  1NSH A;  1OOG A;  2JZI A;  2LP2 A;  3SG5 A;  2KI6 D;  1M31 A;  2KI6 C;  1LXF C;  1F55 A;  1CFD A;  2KFG A;  3Q8I A;  2JPO A;  1C7W A;  1TCF A;  1DJW A;  1CNP A;  2PVB A;  4BY5 A;  1PVB A;  3I5I C;  3NGV A;  1SMG A;  1HQV A;  2PAL A;  1TWO A;  3CDN A;  2KSP A;  2ZND A;  4FTG A;  1J7O A;  3DVK A;  1DJZ A;  2HQ8 A;  1DGU A;  3R1O A;  3NHT A;  4MZL A;  5K89 A;  1MF8 B;  1CLM A;  1OOF A;  3AKB A;  4GGF A;  4NQG A;  3RZS A;  1KK7 Y;  1CKK A;  1F70 A;  5BPJ A;  1IGV A;  1SL8 A;  4IL1 A;  3VRN A;  5EL2 A;  1YRT B;  3WXA A;  3OX6 A;  5HKY A;  3BFB A;  3PAL A;  2GTE A;  3O4Y A;  1BLQ A;  2AMI A;  4QJ4 B;  2LC5 A;  5HKW A;  2JC2 A;  4JQ0 D;  1OMD A;  2WCK A;  1LVC D;  4N5X A;  2B1U A;  2PAS A;  1QXP A;  3LK0 A;  1SY9 A;  3NSO A;  2M97 A;  2KBM A;  1W7J B;  4MBE A;  4F7F A;  1KQV A;  2BL0 C;  1TIZ A;  3LK1 A;  2JT0 A;  2TN4 A;  2LVK A;  3CAB A;  2QEV A;  1B8R A;  3D10 A;  1NX3 A;  2M8U A;  3IQO A;  4FQO A;  5GQQ C;  1XFZ O;  4ZCU A;  1BG1 A;  4OV2 A;  1B7T Y;  1J7P A;  3DF0 A;  1JSA A;  2BBN A;  2AAO A;  3BFA A;  2E6W A;  1F4Q A;  4NDB A;  1Y1X A;  1PSB A;  1GQM A;  1QVI Y;  3D74 A;  4A4B A;  1OZS A;  5FI7 A;  3S0E A;  3GK4 X;  2FJU B;  1TN4 A;  3DZT A;  1DF0 A;  3D73 A;  3GK2 A;  4PHJ A;  2IS9 A;  1SNL A;  1V1F A;  1M45 A;  2O5G A;  4PE7 A;  4R1E A;  3FE8 A;  1KFU S;  2A4J A;  5J3X A;  1XFU O;  5D69 A;  1FPW A;  2K2A A;  2LVJ A;  1RFJ A;  1LIN A;  2QAC A;  5HKZ A;  3CR4 X;  3TS5 C;  1AUI B;  4MEW A;  1ZOT B;  1GGW A;  1Y1U A;  1KQM C;  2FOT A;  1B47 A;  2JU0 A;  1Y0V H;  5PAL A;  4PHM A;  1DC1 A;  3BXK A;  5HL1 A;  1L7Z A;  3I5I B;  4CPV A;  1K9U A;  1DQE A;  1NYA A;  1YVL A;  4YI9 A;  3DD4 A;  4DS7 A;  4YGC B;  1A75 A;  2PQL A;  1KSO A;  4M2O A;  2WCE A;  1K8U A;  2K61 A;  3CLN A;  2WOR A;  1D1O A;  1ZFS A;  2LCP A;  3D0Y B;  1WY9 A;  4GAO A;  2COL B;  2JTZ A;  2JXC A;  1XK4 C;  2KGB C;  3FIA A;  1K9K A;  4M2Q A;  5I94 A;  2M7N A;  2BKH B;  1EG3 A;  2LE9 B;  4PCW A;  1IQ5 A;  2EGD A;  2P6B B;  2G9B A;  5HLO A;  1XO5 A;  2CT9 A;  3PSR A;  4HRG A;  1QVI Z;  1DGV A;  1UHI A;  3KHE A;  3KO0 A;  3BUX B;  3NSK A;  2MBX A;  2JTT A;  1BF5 A;  1G8I A;  2ZNE A;  1CDN A;  2ZRS A;  4WRI A;  1C07 A;  1T14 A;  2LMT A;  5DKR A;  1TOP A;  1DVI A;  1MUX A;  3O78 A;  1TRF A;  2VRG A;  1KFX S;  3RM1 A;  3PM8 A;  3DY9 A;  4U8D A;  5TNC A;  1MWN A;  2GV5 A;  2Y1M A;  1R2U A;  4P2Y B;  4XYN A;  1CM4 A;  1QAS A;  2BBM A;  1H4B A;  2JQ6 A;  1GJY A;  3DVJ A;  4ORB B;  2ERB A;  1XFR A;  1RK9 A;  3EVR A;  3I5F B;  1P28 A;  2PMY A;  3QRX A;  3TDI A;  1G4Y R;  1J7R A;  3CYZ A;  2K7O A;  4GUK A;  1QX5 B;  2Y5I A;  1IQ3 A;  1UUS A;  4DUQ A;  3TDZ A;  2H8V A;  3VRQ A;  1S1E A;  1MXE A;  1JF2 A;  1OW4 A;  3JVT C;  3L4A A;  3CZT X;  2PYQ A;  3UNW A;  4CID A;  1S5G Y;  3OHM B;  1JUO A;  1KWO B;  2KDH A;  1L2O C;  3BOW A;  4HRE E;  3PFV A;  1CMF A;  2H61 A;  3GOF A;  1TTX A;  2R2I A;  3LCP C;  4XJK A;  4N1F A;  3SS3 A;  1MR8 A;  1UHH A;  3CR5 X;  4GFT A;  1CB1 A;  1W9Z A;  3OB2 B;  3K21 A;  4L9M A;  1RWY A;  3B86 A;  1TUJ A;  2YGU A;  1XYD A;  3SG7 A;  1QX2 A;  1A75 B;  5DKN A;  2CNP A;  1SSE B;  3F45 A;  4OKH A;  1H8B A;  1AHR A;  1C7V A;  5FI6 A;  2LUX A;  2SCP A;  1F71 A;  1K90 D;  4C0J A;  1SL9 A;  2QEH A;  1K2H A;  4DCK A;  1CM1 A;  2WCM A;  1TNW A;  3VRR A;  2Q4U A;  1B4C A;  2I18 A;  2M29 A;  2QDI A;  1OSA A;  3LL8 B;  2JNF A;  3S0A A;  3EKH A;  5CSI A;  5F6T A;  2HPS A;  5D7F A;  1ALV A;  1BOC A;  1J1D A;  1IRJ A;  4OR9 B;  1PK0 D;  1EG4 A;  1BOD A;  4GGN A;  1F54 A;  2LLT A;  4I5J A;  1GGZ A;  2KNE A;  2FCE A;  2WC5 A;  1U5I B;  2JPT A;  4OCI A;  3KF9 A;  4M2P A;  2NCP A;  1DT7 B;  3PJI A;  2F2O A;  1CMG A;  1KFU L;  4PHK A;  4IJ7 A;  2M9G A;  2LM5 A;  3HCM A;  3DVE A;  3ZNI A;  4CFQ A;  1K94 A;  2ZN9 A;  5AXI A;  2QEB A;  4PDZ A;  1AJ5 A;  3PAT A;  2WCF A;  3JVT B;  1A4P A;  1SKT A;  2KYF A;  5FI2 A;  5JJG A;  3SIA A;  2M1K B;  3KEV A;  1FI6 A;  2JWW A;  3PM2 A;  2L4I A;  3SJS A;  1L2O B;  2D8N A;  1JF0 A;  2MLE C;  2OPO A;  1B8L A;  3I5F C;  1QJT A;  1EXR A;  2JNX A;  4GPL B;  1DEK A;  3S0G A;  4PAL A;  2KHN A;  1FW4 A;  1SR6 B;  1J55 A;  1EL4 A;  1F4O A;  2M49 B;  3VGO A;  1REC A;  2LV7 A;  2LAP A;  1KK7 Z;  3AAK A;  1HT9 A;  1OMV A;  3CGA A;  3O2P A;  3UO9 A;  2K7B A;  1EH2 A;  4PHN A;  2F33 A;  2BE6 A;  1KWO C;  2KAX A;  2KLE A;  3D76 A;  5CSJ A;  2KAV A;  4YGD B;  1F8H A;  1LA0 A;  5AER A;  2SAS A;  2K8M B;  1PVA A;  3SS5 A;  1WLM A;  2KGR A;  1K93 D;  4HRH A;  2NCO A;  5HYD A;  1KFX L;  1YR5 A;  1CFF A;  2ISD A;  2HET A;  1BR4 B;  1YRU B;  1NWD A;  2CTN A;  2K7D A;  2MJW B;  2BAP A;  3A4U B;  4UPG A;  1PSR A;  1FF1 A;  2EC6 B;  3GK1 A;  1QS7 A;  2QPT A;  1SW8 A;  1IJ6 A;  3AAJ A;  4BY4 A;  1DJX A;  1KCY A;  1TUZ A;  2NLN A;  2BCX A;  1TNX A;  1B7T Z;  3CZ1 A;  3I5G C;  2MLF C;  1DJH A;  2HF5 A;  4QJ3 B;  3L47 A;  2M1U A;  2L5X B;  3CS1 A;  1Z2C B;  2LLS A;  1G33 A;  1FI5 A;  3KPX A;  5I2O A;  3SG6 A;  1MQ1 A;  1BMO A;  1XFW O;  1IWQ A;  1OQP A;  2F2P A;  1NX2 A;  2WCL A;  2LMU A;  3WNX B;  4OZD A;  4F0Z B;  1IH0 A;  3M0W A;  1SPY A;  3EVU A;  5CSN A;  1BT6 A;  1XK4 A;  1YTZ C;  2KI4 C;  1AVS A;  1ZAC A;  2LVI A;  2WND A;  1SYM A;  3SG2 A;  1YUS A;  1W7I B;  2KFF A;  3FE6 A;  2H2K A;  2F3Z A;  3DYE A;  3RLZ A;  4WQ3 A;  3DF0 B;  5B8I B;  3R1V A;  3R1P A;  4MZK A;  1PUL A;  1SL7 A;  4MZJ A;  3DXL A;  1CFP A;  1UHJ A;  3EG5 B;  4GNK B;  1DF0 B;  1Z4H A;  5AEQ A;  2K0J A;  2L50 A;  1KK8 B;  4A4C A;  2EHB A;  2HQW A;  4DRW A;  2WC8 A;  1JFJ A;  1CLL A;  2KFH A;  2DOQ A;  2NXQ A;  4I5L B;  2CBL A;  1QLS A;  4MVF A;  1CDP A;  3IF7 A;  4INW A;  1NUB A;  4CFR A;  1SCM C;  5ER4 X;  1BJF A;  1YUR A;  1B1G A;  1NCZ A;  3TZ1 A;  1A03 A;  2I94 A;  1QIW A;  1C3Z A;  1K95 A;  3NSL A;  4USL A;  1YX8 A;  2PRU A;  2Q91 A;  4MN0 A;  1SR6 C;  1CTR A;  2BNX A;  1NCX A;  1QIV A;  2WOS A;  4CLN A;  2MRD A;  2ZN8 A;  1DJI A;  2LMV A;  4N1G A;  2KQ6 A;  3B6X A;  5CSF A;  3WHU B;  2JUL A;  4PE4 A;  2E30 A;  3SS4 A;  1B9A A;  1UHK A;  1K9P A;  2JT8 A;  3I5G B;  1QTX A;  5ER5 A;  1PAL A;  1BR1 B;  3TUY B;  1QWV A;  2I7A A;  3OB1 B;  3D77 A;  1J1E A;  3S0B A;  4C0L A;  4QJ5 B;  1LS8 A;  2LAN A;  1X02 A;  2OTG B;  2ZFD A;  1Q80 A;  3EK8 A;  3V2L A;  3O4X A;  1SCV A;  2KOT A;  3E3R A;  1RTP 1;  4MLW A;  2EC6 C;  1UHN A;  1WDC C;  4YBH B;  1N0Y A;  4MRX A;  1ZMZ A;  4YGA A;  1S5G Z;  1PRW A;  3B88 A;  1OZO A;  4GGF C;  1QV1 A;  2OS8 C;  4NDC A;  1NIW A;  1XFV O;  2KI4 B;  1DEL A;  1K96 A;  1V1G A;  2KQY A;  2LHI A;  3EK4 A;  3ICB A;  3OX5 A;  4WQ2 A;  1NCY A;  1MXL C;  3BJH A;  1M39 A;  4PE1 A;  4OVN F;  5I2L A;  1AP4 A;  1C3Y A;  1AJ4 A;  2Y1N A;  3BUO B;  3JTD B;  3QME A;  1TNP A;  4JKT A;  4AOM A;  3IQQ A;  2LLU A;  3K1E A;  1Y1A A;  1Y6W A;  4PE0 A;  5KU1 A;  4AQJ A;  1YVH A;  5AAN A;  2BCB A;  1N65 A;  3D0Y A;  3PLF B;  2O60 A;  2WCJ A;  3B87 A;  2I2R E;  3FWB A;  1SBJ A;  3OP0 A;  3CWG A;  3SG4 A;  1SCM B;  1YUT A;  3BOW B;  1EJ3 A;  1DMO A;  4XJK B;  1A29 A;  3S0F A;  2CCM A;  1M63 B;  3FS7 A;  2JXL A;  4AQI A;  3BYA A;  4E68 A;  5IBW A;  3ZWH A;  2PSR A;  1R6P A;  1LA3 A;  2L98 A;  3BUN B;  1S6C A;  3NHI A;  4MSP A;  5G08 A;  3EK7 A;  1KK8 C;  2LP3 A;  2GGM A;  3DVM A;  4P5O E;  1FBV A;  1UWO A;  4JPZ B;  3B7A A;  1VRK A;  1JFK A;  2LVV A;  2L5Y A;  2ZRT A;  3H4S E;  1NPQ A;  3BFH A;  1WRK A;  2AUC A;  1TNQ A;  3PN7 B;  1A2X A;  3I5H C;  3TDU A;  3NXA A;  2Y4Q A;  4ETO A;  1NX0 A;  2ZKM X;  2K60 A;  3N7H A;  4C0K A;  5AFP A;  1IIO A;  4ICB A;  2MAZ A;  5CPV A;  1YUU A;  3VB1 A;  2MHH A;  1QV0 A;  3CZ0 A;  1ORG A;  4MRY A;  5KTY A;  4FQT A;  1YX7 A;  1IG5 A;  1WRZ A;  4GBA A;  4YGB B;  1GM0 A;  1WDC B;  3BUW B;  1J7Q A;  1S36 A;  4YGE B;  1ALW A;  2KYC A;  2OS8 B;  4D1E A;  1UP5 A;  5DKQ A;  1CDM A;  3VRO A;  3TUY C;  2JOJ A;  1DTL A;  2M3W A;  4HSZ A;  4ZCV A;  2FCD A;  2KBI A;  4DIR A;  1CFC A;  2OTG C;  5KSZ A;  2BEC A;  3OBV A;  1CDL A;  3LLE A;  1KSM A;  4JD9 A;  1NP8 A;  1QX7 A;  1SK6 D;  3FE9 A; 
#chains in the Genus database with same CATH homology
 1XVJ A;  3O6B A;  1MHO A;  1N2D A;  2L4H A;  2CXJ A;  5JOL A;  5I8N A;  1RRO A;  5FYX A;  1LKJ A;  1SRA A;  1JC2 A;  3BQ3 A;  1JWD A;  1CLB A;  3C1V A;  3MSE B;  5HLV A;  2MA2 A;  4ORA B;  2F8P A;  2JRF A;  3SG3 A;  3JTD C;  2LUC A;  1XFY O;  2M0R A;  2RGI A;  1NX1 A;  2GGZ A;  2WCB A;  3BUM B;  3EVV A;  3VRP A;  1AK8 A;  1BU3 A;  2KAY A;  3CTN A;  3WHT B;  1S6I A;  1XFX O;  3FWC A;  2BL0 B;  1S26 D;  3AKA A;  1OOJ A;  1TCO B;  2LNK A;  1XA5 A;  1U5I A;  2H61 C;  4YI8 A;  2M7L A;  1QAT A;  3I5H B;  4ORC B;  1ODB A;  2L2E A;  2L0P A;  1OE9 B;  3NSI A;  1M46 A;  4Q04 A;  1IJ5 A;  1WLZ A;  1B8C A;  2BKI B;  2G2B A;  1WRL A;  4YRU A;  2K2F A;  1IKU A;  1DJY A;  1S3P A;  2V53 A;  4JWQ A;  2K7C A;  2BCA A;  4TNC A;  4NDD A;  5I2Q A;  1JBA A;  1UUR A;  1QLK A;  2F3Y A;  3PN7 C;  3HX4 A;  3CR2 A;  3TS5 B;  4I5N B;  3EKJ A;  1DJG A;  2L51 A;  1KQM B;  2NZ0 A;  1ZUZ A;  2JT3 A;  1S6J A;  2LHL A;  2BE4 A;  3A8R A;  1OMR A;  4I5K A;  3SIB A;  1E8A A;  1RJV A;  1NSH A;  2JZI A;  2LP2 A;  3SG5 A;  2KI6 D;  1M31 A;  2KI6 C;  1LXF C;  1F55 A;  1CFD A;  2KFG A;  1C7W A;  1TCF A;  1DJW A;  1CNP A;  2PVB A;  4BY5 A;  1PVB A;  3I5I C;  1SMG A;  1HQV A;  2PAL A;  2KSP A;  2ZND A;  4FTG A;  1J7O A;  3DVK A;  1DJZ A;  2HQ8 A;  1DGU A;  4MZL A;  5K89 A;  1MF8 B;  1CLM A;  3AKB A;  4GGF A;  4NQG A;  1CKK A;  1F70 A;  1KK7 Y;  5BPJ A;  1IGV A;  1SL8 A;  4IL1 A;  3VRN A;  1YRT B;  3WXA A;  3OX6 A;  5HKY A;  3PAL A;  3O4Y A;  1BLQ A;  2AMI A;  4QJ4 B;  2LC5 A;  5HKW A;  2JC2 A;  4JQ0 D;  1OMD A;  1LVC D;  4N5X A;  2B1U A;  2PAS A;  1QXP A;  3LK0 A;  1SY9 A;  3NSO A;  2M97 A;  2KBM A;  1W7J B;  4MBE A;  1KQV A;  2BL0 C;  1TIZ A;  3LK1 A;  2JT0 A;  2TN4 A;  2LVK A;  1B8R A;  3D10 A;  1NX3 A;  2M8U A;  3IQO A;  4FQO A;  5GQQ C;  1XFZ O;  4ZCU A;  1BG1 A;  4OV2 A;  1B7T Y;  1J7P A;  3DF0 A;  1JSA A;  2BBN A;  2AAO A;  2E6W A;  1F4Q A;  4NDB A;  1Y1X A;  1PSB A;  1GQM A;  1QVI Y;  4A4B A;  1OZS A;  3GK4 X;  2FJU B;  1TN4 A;  4PHJ A;  1DF0 A;  3GK2 A;  2IS9 A;  1SNL A;  1V1F A;  1M45 A;  2O5G A;  4PE7 A;  4R1E A;  1KFU S;  2A4J A;  5J3X A;  1XFU O;  5D69 A;  1FPW A;  2K2A A;  2LVJ A;  1RFJ A;  1LIN A;  2QAC A;  5HKZ A;  3CR4 X;  3TS5 C;  1AUI B;  4MEW A;  1ZOT B;  1GGW A;  1Y1U A;  1KQM C;  2FOT A;  1B47 A;  2JU0 A;  1Y0V H;  5PAL A;  4PHM A;  3BXK A;  1L7Z A;  3I5I B;  4CPV A;  1K9U A;  1NYA A;  1YVL A;  4YI9 A;  3DD4 A;  4DS7 A;  4YGC B;  1A75 A;  1KSO A;  4M2O A;  2WCE A;  1K8U A;  2K61 A;  3CLN A;  2WOR A;  1D1O A;  1ZFS A;  2LCP A;  3D0Y B;  1WY9 A;  4GAO A;  2COL B;  2JTZ A;  2JXC A;  1XK4 C;  2KGB C;  3FIA A;  1K9K A;  4M2Q A;  2M7N A;  2BKH B;  1EG3 A;  2LE9 B;  4PCW A;  1IQ5 A;  2EGD A;  2P6B B;  2G9B A;  5HLO A;  1XO5 A;  2CT9 A;  3PSR A;  4HRG A;  1QVI Z;  1DGV A;  1UHI A;  3KHE A;  3KO0 A;  3BUX B;  3NSK A;  2MBX A;  2JTT A;  1BF5 A;  1G8I A;  2ZNE A;  1CDN A;  2ZRS A;  4WRI A;  1C07 A;  2LMT A;  5DKR A;  1TOP A;  1DVI A;  1MUX A;  3O78 A;  1TRF A;  2VRG A;  1KFX S;  3RM1 A;  3PM8 A;  4U8D A;  5TNC A;  1MWN A;  2GV5 A;  2Y1M A;  1R2U A;  4P2Y B;  4XYN A;  1CM4 A;  1QAS A;  2BBM A;  1H4B A;  2JQ6 A;  1GJY A;  3DVJ A;  4ORB B;  3I5F B;  1RK9 A;  3EVR A;  2PMY A;  3QRX A;  3TDI A;  1G4Y R;  1J7R A;  2K7O A;  4GUK A;  1QX5 B;  2Y5I A;  1IQ3 A;  1UUS A;  4DUQ A;  3TDZ A;  3VRQ A;  1S1E A;  1MXE A;  1JF2 A;  3JVT C;  4CID A;  3CZT X;  1S5G Y;  3OHM B;  1JUO A;  1KWO B;  2KDH A;  1L2O C;  3BOW A;  4HRE E;  3PFV A;  1CMF A;  2H61 A;  3GOF A;  1TTX A;  2R2I A;  3LCP C;  4XJK A;  4N1F A;  1MR8 A;  1UHH A;  3CR5 X;  4GFT A;  1CB1 A;  3OB2 B;  3K21 A;  4L9M A;  1RWY A;  1XYD A;  3SG7 A;  1QX2 A;  1A75 B;  5DKN A;  2CNP A;  3F45 A;  4OKH A;  1H8B A;  1AHR A;  1C7V A;  2LUX A;  2SCP A;  1F71 A;  1K90 D;  4C0J A;  1SL9 A;  1K2H A;  4DCK A;  1CM1 A;  1TNW A;  3VRR A;  2Q4U A;  1B4C A;  2I18 A;  2M29 A;  1OSA A;  3LL8 B;  2JNF A;  3EKH A;  5CSI A;  5F6T A;  2HPS A;  5D7F A;  1ALV A;  1BOC A;  1J1D A;  1IRJ A;  4OR9 B;  1PK0 D;  1EG4 A;  1BOD A;  4GGN A;  1F54 A;  2LLT A;  4I5J A;  1GGZ A;  2KNE A;  2FCE A;  1U5I B;  2JPT A;  4OCI A;  3KF9 A;  4M2P A;  2NCP A;  1DT7 B;  2F2O A;  1CMG A;  1KFU L;  4PHK A;  2M9G A;  2LM5 A;  3HCM A;  3DVE A;  3ZNI A;  4CFQ A;  1K94 A;  2ZN9 A;  5AXI A;  4PDZ A;  1AJ5 A;  3PAT A;  2WCF A;  3JVT B;  1A4P A;  1SKT A;  2KYF A;  5JJG A;  3SIA A;  2M1K B;  3KEV A;  1FI6 A;  2JWW A;  2L4I A;  3SJS A;  1L2O B;  2D8N A;  1JF0 A;  2MLE C;  2OPO A;  1B8L A;  3I5F C;  1QJT A;  1EXR A;  2JNX A;  4GPL B;  4PAL A;  2KHN A;  1FW4 A;  1SR6 B;  1J55 A;  1EL4 A;  1F4O A;  2M49 B;  3VGO A;  1REC A;  2LV7 A;  2LAP A;  1KK7 Z;  3AAK A;  1HT9 A;  1OMV A;  3CGA A;  3O2P A;  2K7B A;  1EH2 A;  4PHN A;  2F33 A;  2BE6 A;  1KWO C;  2KAX A;  5CSJ A;  2KAV A;  4YGD B;  1F8H A;  1LA0 A;  5AER A;  2SAS A;  2K8M B;  1PVA A;  1WLM A;  2KGR A;  1K93 D;  4HRH A;  2NCO A;  5HYD A;  1KFX L;  1YR5 A;  1CFF A;  2ISD A;  2HET A;  1BR4 B;  1YRU B;  1NWD A;  2CTN A;  2K7D A;  2MJW B;  3A4U B;  4UPG A;  1PSR A;  1FF1 A;  2EC6 B;  3GK1 A;  1QS7 A;  2QPT A;  1SW8 A;  1IJ6 A;  3AAJ A;  4BY4 A;  1DJX A;  1KCY A;  2NLN A;  2BCX A;  1TNX A;  1B7T Z;  3I5G C;  2MLF C;  1DJH A;  2HF5 A;  4QJ3 B;  2M1U A;  2L5X B;  3CS1 A;  2LLS A;  1G33 A;  1FI5 A;  3KPX A;  5I2O A;  3SG6 A;  1MQ1 A;  1BMO A;  1XFW O;  1IWQ A;  1OQP A;  2F2P A;  1NX2 A;  3WNX B;  2LMU A;  4F0Z B;  1IH0 A;  3M0W A;  1SPY A;  3EVU A;  5CSN A;  1BT6 A;  1XK4 A;  1YTZ C;  2KI4 C;  1AVS A;  1ZAC A;  2LVI A;  2WND A;  1SYM A;  3SG2 A;  1YUS A;  1W7I B;  2KFF A;  2H2K A;  2F3Z A;  3RLZ A;  4WQ3 A;  3DF0 B;  5B8I B;  4MZK A;  1PUL A;  1SL7 A;  4MZJ A;  1CFP A;  1UHJ A;  4GNK B;  1DF0 B;  5AEQ A;  2K0J A;  2L50 A;  1KK8 B;  4A4C A;  2EHB A;  2HQW A;  4DRW A;  2WC8 A;  1JFJ A;  1CLL A;  2KFH A;  2DOQ A;  2NXQ A;  4I5L B;  2CBL A;  1QLS A;  4MVF A;  1CDP A;  3IF7 A;  1NUB A;  4CFR A;  1SCM C;  5ER4 X;  1BJF A;  1YUR A;  1B1G A;  1NCZ A;  3TZ1 A;  1A03 A;  2I94 A;  1QIW A;  1K95 A;  3NSL A;  4USL A;  1YX8 A;  2PRU A;  2Q91 A;  4MN0 A;  1SR6 C;  1CTR A;  1NCX A;  1QIV A;  2WOS A;  4CLN A;  2MRD A;  2ZN8 A;  1DJI A;  2LMV A;  4N1G A;  2KQ6 A;  5CSF A;  3WHU B;  2JUL A;  4PE4 A;  2E30 A;  1B9A A;  1UHK A;  1K9P A;  2JT8 A;  3I5G B;  1QTX A;  5ER5 A;  1PAL A;  1BR1 B;  3TUY B;  2I7A A;  3OB1 B;  1J1E A;  4C0L A;  4QJ5 B;  2LAN A;  1X02 A;  2OTG B;  2ZFD A;  1Q80 A;  3EK8 A;  1SCV A;  2KOT A;  3E3R A;  1RTP 1;  4MLW A;  2EC6 C;  1UHN A;  1WDC C;  4YBH B;  1N0Y A;  4MRX A;  1ZMZ A;  4YGA A;  1S5G Z;  1PRW A;  4GGF C;  1OZO A;  1QV1 A;  2OS8 C;  4NDC A;  1NIW A;  1XFV O;  2KI4 B;  1K96 A;  1V1G A;  2LHI A;  2KQY A;  3EK4 A;  3ICB A;  3OX5 A;  4WQ2 A;  1NCY A;  1MXL C;  1M39 A;  4PE1 A;  4OVN F;  5I2L A;  1AP4 A;  1AJ4 A;  2Y1N A;  3BUO B;  3JTD B;  1TNP A;  4AOM A;  3IQQ A;  2LLU A;  1Y1A A;  1Y6W A;  4PE0 A;  5KU1 A;  4AQJ A;  1YVH A;  5AAN A;  2BCB A;  1N65 A;  3D0Y A;  3PLF B;  2O60 A;  2I2R E;  3FWB A;  1SBJ A;  3OP0 A;  3CWG A;  3SG4 A;  1SCM B;  1YUT A;  3BOW B;  1EJ3 A;  1DMO A;  4XJK B;  1A29 A;  2CCM A;  1M63 B;  3FS7 A;  2JXL A;  4AQI A;  3BYA A;  4E68 A;  5IBW A;  3ZWH A;  2PSR A;  1R6P A;  1LA3 A;  2L98 A;  3BUN B;  1S6C A;  5G08 A;  4MSP A;  3EK7 A;  1KK8 C;  2LP3 A;  2GGM A;  3DVM A;  4P5O E;  1FBV A;  1UWO A;  4JPZ B;  1VRK A;  1JFK A;  2LVV A;  2ZRT A;  3H4S E;  1NPQ A;  1WRK A;  2AUC A;  1TNQ A;  3PN7 B;  1A2X A;  3I5H C;  3TDU A;  3NXA A;  2Y4Q A;  4ETO A;  1NX0 A;  2ZKM X;  4C0K A;  5AFP A;  4ICB A;  2MAZ A;  5CPV A;  1YUU A;  2MHH A;  1QV0 A;  4MRY A;  5KTY A;  1YX7 A;  1IG5 A;  1WRZ A;  4GBA A;  4YGB B;  1WDC B;  3BUW B;  1J7Q A;  1S36 A;  4YGE B;  1ALW A;  2KYC A;  2OS8 B;  4D1E A;  1UP5 A;  5DKQ A;  1CDM A;  3VRO A;  3TUY C;  2JOJ A;  1DTL A;  2M3W A;  4HSZ A;  4ZCV A;  2FCD A;  2KBI A;  4DIR A;  1CFC A;  2OTG C;  5KSZ A;  2BEC A;  1CDL A;  3LLE A;  1KSM A;  1NP8 A;  1QX7 A;  1SK6 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...