3I5FB

Crystal structure of squid mg.adp myosin s1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
145
structure length
145
Chain Sequence
b'RVKLSQRQMQELKEAFTMIDQDRDGFIGMEDLKDMFSSLGRVPPDDELNAMLKECPGQLNFTAFLTLFGEKVSGTDPEDALRNAFSMFDEDGQGFIPEDYLKDLLENMGDNFSKEEIKNVWKDAPLKNKQFNYNKMVDIKGKAED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain isoform A
publication title Rigor-like structures from muscle myosins reveal key mechanical elements in the transduction pathways of this allosteric motor.
pubmed doi rcsb
molecule tags Contractile protein
total genus 28
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2009-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3i5fB02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3i5fB01
3JVTC 1SMGA 1RJVA 3AAKA 1ZFSA 4WQ3A 2RGIA 5K89A 1BU3A 1QVIY 2CT9A 2PRUA 2CBLA 2MBXA 2L4HA 2BE6A 1G8IA 1N0YA 2PSRA 3VRQA 2V53A 2BKIB 2LNKA 4PALA 1QJTA 1DTLA 1SCMC 5D7FA 1NX3A 2M3WA 1NYAA 3ZNIA 4CPVA 2JOJA 4IL1A 1QIWA 2JC2A 2LE9B 1K93D 2L5XB 3PSRA 1JBAA 4MBEA 2NLNA 4XJKB 4YBHB 2KQYA 2EC6C 2AAOA 2K61A 3OB2B 4C0JA 1KQMB 4I5KA 1F55A 4M2PA 3OX5A 1QV1A 1S1EA 1SL7A 2KI4B 1XK4A 4PE7A 2JT3A 3I5FC 1FI6A 1Y1UA 4CLNA 1W7JB 3EK7A 2M7LA 5KTYA 4N5XA 1SKTA 4NDDA 1QX7A 2L51A 2ZRTA 1QTXA 1EH2A 2LVJA 1DVIA 1CLBA 1JSAA 3PN7C 1GJYA 4TNCA 1BR1B 1FW4A 2K2FA 1KFUS 1OMDA 3TS5C 1S6IA 5BPJA 3I5IC 2L0PA 1UHNA 3CLNA 2M8UA 2WCBA 3H4SE 1CLMA 1YRTB 1MXEA 2EC6B 2QACA 3VRRA 5I2OA 1WDCC 2ZRSA 2BL0C 1QLKA 1U5IB 1J1EA 3OX6A 1SR6B 1OOJA 1AUIB 1OQPA 2GV5A 1Y1XA 1K94A 2ZN9A 4HSZA 4NDBA 1W7IB 2M7NA 3ZWHA 2WORA 3O78A 2CNPA 2LVIA 4PCWA 4MLWA 2Y4QA 2B1UA 3I5FB 3DF0A 1DJIA 2LAPA 4DRWA 2F2PA 4YGCB 2O60A 2SASA 2ZNEA 2K7DA 1YVLA 2LMTA 4U8DA 3I5HB 3C1VA 1IRJA 1G33A 2F8PA 2JTTA 2MLFC 1CFCA 2GGMA 1EG4A 2M97A 1SL8A 4OVNF 4MEWA 4A4BA 1AJ5A 1DMOA 3GK2A 2OS8B 3FIAA 1KK8C 5AERA 1Q80A 2I2RE 4HRHA 1PULA 1Y0VH 1YTZC 1UHIA 4DUQA 1DJGA 2BE4A 4MRYA 3DVMA 4CFRA 3RM1A 1AVSA 3PALA 2BECA 3EVRA 1UUSA 3SG7A 2NXQA 2I7AA 1OE9B 3SG5A 1PVBA 1B8LA 1S5GY 2COLB 1UP5A 4DIRA 4F0ZB 2L4IA 3K21A 2A4JA 4GGNA 1N65A 1QASA 1KFXL 1NCZA 2M9GA 3EVUA 1DJXA 2K7OA 2I18A 2EHBA 1N2DA 2KYFA 1QS7A 1B8RA 3SG3A 3WHUB 5I2LA 2KNEA 1S26D 1QXPA 2JZIA 1JFKA 1XFYO 3EK8A 1FBVA 2K2AA 2PMYA 1IKUA 2WCFA 3IF7A 4A4CA 1WLZA 2OTGB 1CMGA 4YGAA 3CR5X 2K0JA 1M39A 1UHHA 3BYAA 2D8NA 5J3XA 3AAJA 1K9KA 1JF2A 1ZACA 4YGBB 1BMOA 1LINA 1YR5A 1SL9A 3CR2A 1DJWA 1XFXO 1E8AA 1NX2A 1B7TZ 2BKHB 2JQ6A 1KQMC 1CM4A 2LP2A 4PE4A 1YX7A 2ZNDA 1L2OB 5AANA 2KI4C 2KFGA 2BBMA 2PVBA 3D0YB 4YI9A 2KSPA 1IJ6A 1KQVA 3CR4X 4WQ2A 2FCEA 1WLMA 1NX0A 4BY5A 5KU1A 2Q4UA 3BUOB 1K96A 1IQ3A 4UPGA 1V1FA 1CTRA 1H4BA 2FCDA 1F8HA 1BF5A 1S36A 3KEVA 3LK0A 5JJGA 1NIWA 1D1OA 1BJFA 1F4QA 2CTNA 2LVVA 2M49B 2M1UA 2K7CA 5CSNA 1TN4A 1KK7Z 4PHMA 2LUXA 1OZSA 5I2QA 4AQJA 2K7BA 2MAZA 1TCFA 2O5GA 2OPOA 3DF0B 4MZKA 1DGUA 5AXIA 4P2YB 4ORBB 2DOQA 1J1DA 1YX8A 3ICBA 3NSLA 2LC5A 1HQVA 1SR6C 1LVCD 2Q91A 1LA3A 1HT9A 3LCPC 1SRAA 4QJ3B 3LL8B 1XFZO 2LUCA 3PM8A 5GQQC 1MF8B 2P6BB 1B4CA 1NCXA 2M0RA 5I8NA 1WY9A 4HRGA 4AOMA 1XO5A 4YRUA 3I5HC 1BODA 1BG1A 4GGFC 1S6CA 1RECA 1FI5A 3M0WA 1JUOA 2OS8C 4GPLB 4ZCUA 4JWQA 2H61A 4N1FA 1DJHA 1A29A 1XFWO 2JNFA 3VRPA 1DT7B 3EKJA 1M45A 2MA2A 5DKNA 4I5NB 3EKHA 1LKJA 3TZ1A 1KWOB 4ORCB 1YUSA 3DVKA 1QVIZ 2F2OA 2ZKMX 1RTP1 3FS7A 5CSIA 2Y1NA 2TN4A 2KQ6A 1CDLA 3IQOA 1L7ZA 1ZMZA 2JXCA 2KAVA 4PDZA 2PASA 2JWWA 5IBWA 3BUWB 2ZN8A 3FWBA 2OTGC 4YI8A 1PSRA 2AMIA 1KFUL 1XK4C 3CS1A 1K2HA 2BCBA 2KGRA 4JQ0D 2KDHA 1X02A 2HPSA 3FWCA 2MLEC 3D10A 2M29A 1OZOA 1CFPA 4CFQA 4M2OA 1WRKA 2KHNA 2LANA 3OP0A 1ODBA 4XJKA 1CDNA 1BOCA 2FJUB 4OCIA 3BUXB 1L2OC 2JULA 1TTXA 2BBNA 2MRDA 3PATA 1B1GA 2R2IA 1CNPA 2CXJA 3LK1A 1SW8A 1BR4B 3PFVA 4QJ4B 4MSPA 2L2EA 3F45A 1TNXA 1UWOA 4OR9B 1QIVA 1M46A 5DKRA 5B8IB 3NSIA 1DGVA 1TIZA 1F71A 3WNXB 2LLUA 3AKBA 3GK4X 4DS7A 3TDZA 3VROA 2KOTA 2H2KA 4MZJA 1NSHA 2KBIA 3BUMB 1PSBA 2HF5A 4PE1A 3NSOA 3KF9A 1XYDA 1IQ5A 1J55A 1TNWA 3QRXA 1K9UA 1C07A 2LHIA 3BQ3A 1F70A 1EG3A 3CTNA 1QX5B 1KSOA 4E68A 1J7RA 3NSKA 2JXLA 3KPXA 2JPTA 1SPYA 1ALWA 1CKKA 5AFPA 1EXRA 3LLEA 2WNDA 1U5IA 1C7VA 3GOFA 1J7PA 1NUBA 3PLFB 5DKQA 2G9BA 5KSZA 1OSAA 1PK0D 3GK1A 2F3YA 1K8UA 3EK4A 2NCOA 1IGVA 1NP8A 2E6WA 3BXKA 3IQQA 5JOLA 2JT0A 2IS9A 5ER4X 1MUXA 1DJZA 1J7QA 4C0KA 2G2BA 2LP3A 1MXLC 5CSJA 2L50A 2ISDA 3VRNA 1FPWA 1MQ1A 3SIAA 4GBAA 1TNPA 1DF0A 3EVVA 2LVKA 1AK8A 2GGZA 3E3RA 5TNCA 2VRGA 2MJWB 1CB1A 1S5GZ 3CZTX 3I5GB 3DVJA 4R1EA 1JF0A 2NCPA 1KWOC 2CCMA 4PE0A 1JWDA 4MVFA 1CDPA 2E30A 1GGZA 1SNLA 1EL4A 3DD4A 1PALA 1BLQA 4FTGA 1GGWA 3AKAA 4GFTA 1CFFA 1LXFC 2BCXA 3OB1B 5HLVA 3HX4A 4MRXA 2PALA 1YUTA 2JT8A 2KI6C 4PHJA 2Y1MA 3OHMB 1S6JA 3SIBA 3TUYB 2LLSA 4MN0A 1ZOTB 4ZCVA 1R2UA 4I5JA 2AUCA 3BOWA 5HKZA 1Y1AA 2F33A 1CFDA 2KFHA 3JTDB 4P5OE 3O2PA 4M2QA 4WRIA 1J7OA 3A8RA 3KHEA 3JVTB 1G4YR 2LV7A 1F4OA 2QPTA 5HKWA 1WRZA 2M1KB 4YGDB 1IH0A 1IJ5A 1QLSA 2KAXA 3RLZA 1NWDA 1TOPA 1SY9A 1AP4A 4YGEB 1A75A 1YRUB 1XA5A 1KSMA 1M31A 1NPQA 1RFJA 1OMRA 1RK9A 2LMVA 2JU0A 3D0YA 4XYNA 1SCMB 1C7WA 1BT6A 2FOTA 2L98A 3SJSA 4GAOA 2NZ0A 4GNKB 2KYCA 1AJ4A 2JNXA 1SK6D 2WC8A 3HCMA 1CM1A 1PVAA 3MSEB 1LA0A 1VRKA 4N1GA 1RROA 1B7TY 4NDCA 3VGOA 4C0LA 3SG6A 2WOSA 1KFXS 2KBMA 2JTZA 1Y6WA 2LM5A 4GUKA 3TDIA 4QJ5B 4BY4A 3SG2A 5HYDA 1H8BA 2HQWA 1CDMA 1S3PA 4ORAB 1GQMA 1ALVA 1DJYA 1MHOA 3O4YA 5PALA 5CSFA 2ZFDA 2MHHA 4JPZB 1TNQA 3CGAA 3PN7B 1PRWA 5HLOA 1K95A 3BUNB 3A4UB 1MWNA 2H61C 1OMVA 3TS5B 5CPVA 1RWYA 2Y5IA 4PHNA 2LMUA 4ICBA 4AQIA 1CLLA 2SCPA 1KK7Y 1A4PA 2JRFA 1DF0B 3I5IB 1K9PA 2I94A 4PHKA 1KCYA 4L9MA 2HETA 3CWGA 1SYMA 2F3ZA 2KAYA 1WDCB 2WCEA 2EGDA 2BL0B 3WXAA 4DCKA 4ETOA 1EJ3A 1TCOB 1NCYA 2LCPA 1YVHA 3KO0A 1XFVO 1CMFA 3NXAA 3TDUA 1A03A 4CIDA 4USLA 1QV0A 1UURA 5ER5A 2K8MB 3I5GC 1QATA 1YURA 1B8CA 1WRLA 4I5LB 1UHJA 1MR8A 4OV2A 5FYXA 1XFUO 2KI6D 1A2XA 2KGBC 3BOWB 3DVEA 1IG5A 2LHLA 2KFFA 4D1EA 1FF1A 1F54A 1K90D 1AHRA 3WHTB 1V1GA 4Q04A 4MZLA 1KK8B 5HKYA 1JFJA 1M63B 2HQ8A 1B47A 5F6TA 3SG4A 1QX2A 5G08A 3TUYC 1NX1A 4HREE 1ZUZA 4OKHA 1YUUA 2BCAA 1XVJA 3O6BA 4FQOA 1JC2A 1TRFA 5AEQA 1SBJA 2LLTA 3JTDC 4GGFA 1A75B 1IWQA 1UHKA 5D69A 1SCVA 4NQGA 1B9AA 1R6PA
chains in the Genus database with same CATH superfamily
2YGUA 3JVTC 1SMGA 1RJVA 3AAKA 1ZFSA 4WQ3A 2RGIA 5K89A 1BU3A 3NGVA 1QVIY 2CT9A 2PRUA 3S0AA 2CBLA 2MBXA 2L4HA 2PQLA 3R1PA 2BE6A 3EG5B 1G8IA 1N0YA 2PSRA 3VRQA 2V53A 2BKIB 3S0GA 2LNKA 4PALA 1QJTA 1DTLA 1SCMC 1OOHA 2L5YA 5D7FA 1NX3A 2M3WA 1NYAA 3S0DA 3ZNIA 4CPVA 2JOJA 4IL1A 4KYNA 1QIWA 2JC2A 2LE9B 2QEOA 1K93D 1W9ZA 2L5XB 3OBVA 3PSRA 1JBAA 4MBEA 2NLNA 4XJKB 4YBHB 2KQYA 2EC6C 2AAOA 2K61A 3OB2B 4C0JA 3QMEA 1KQMB 3B86A 4I5KA 1F55A 4M2PA 3OX5A 1QV1A 5HL1A 1S1EA 1SL7A 2BNXA 1XK4A 2KI4B 4PE7A 2JT3A 2KLEA 3I5FC 1FI6A 1Y1UA 2QEHA 4CLNA 1W7JB 3EK7A 2M7LA 5KTYA 2BAPA 4N5XA 1SKTA 4NDDA 1QX7A 2L51A 2ZRTA 1QTXA 1EH2A 2LVJA 3D77A 3S0BA 2QEVA 1DVIA 1CLBA 1JSAA 3PN7C 1GJYA 4TNCA 1BR1B 1FW4A 2K2FA 1KFUS 1OMDA 3TS5C 1S6IA 5BPJA 3I5IC 2L0PA 1UHNA 3CLNA 2M8UA 3FE6A 2WCBA 2WC6A 3H4SE 1CLMA 1YRTB 1MXEA 2EC6B 2QACA 3VRRA 5I2OA 1WDCC 2ZRSA 2BL0C 1QLKA 1U5IB 1J1EA 3FE9A 3OX6A 1SR6B 1OOJA 1AUIB 1OQPA 1Z2CB 1Y1XA 1K94A 2GV5A 2ZN9A 4HSZA 1W7IB 2M7NA 3ZWHA 2WORA 3O78A 2CNPA 2LVIA 4PCWA 4MLWA 2Y4QA 2B1UA 3I5FB 3DF0A 1DJIA 2LAPA 4DRWA 2F2PA 4YGCB 2O60A 2QEBA 2SASA 2ZNEA 2K7DA 1YVLA 2LMTA 4U8DA 3I5HB 3C1VA 3DY9A 1IRJA 1G33A 2F8PA 2JTTA 2MLFC 1CFCA 2GGMA 1EG4A 2M97A 1SL8A 4OVNF 4MEWA 4A4BA 1AJ5A 1DMOA 3GK2A 2OS8B 3B88A 3FIAA 1KK8C 5AERA 1Q80A 3B7AA 3L4AA 2I2RE 4HRHA 1OOIX 1PULA 1Y0VH 1YTZC 1UHIA 4DUQA 3L4LA 1DJGA 4JD9A 2BE4A 4MRYA 3DVMA 3UNWA 4CFRA 3RM1A 1AVSA 3PALA 3B6XA 2BECA 3S0EA 3EVRA 1UUSA 4FQTA 2NXQA 2I7AA 1OE9B 3SG7A 3SG5A 1PVBA 1B8LA 1S5GY 2COLB 1UP5A 4DIRA 4F0ZB 2L4IA 3K21A 2A4JA 4GGNA 1N65A 1QASA 1KFXL 1NCZA 2M9GA 3EVUA 1DJXA 2K7OA 2I18A 2EHBA 1N2DA 2KYFA 2WCHA 1QS7A 1B8RA 3SG3A 3WHUB 5I2LA 2KNEA 1S26D 1QXPA 2JZIA 1JFKA 1XFYO 3EK8A 1FBVA 2K2AA 2PMYA 1IKUA 2WCFA 3IF7A 4A4CA 1WLZA 2OTGB 1CMGA 4YGAA 3CR5X 2K0JA 1M39A 1UHHA 3BYAA 2D8NA 5J3XA 3AAJA 1K9KA 1JF2A 1ZACA 4YGBB 1BMOA 1LINA 1YR5A 1SL9A 3CR2A 1DJWA 1XFXO 1E8AA 1NX2A 1B7TZ 2BKHB 2JQ6A 1KQMC 1CM4A 2LP2A 4PE4A 1YX7A 2ZNDA 1L2OB 5AANA 2KI4C 2KFGA 2BBMA 2PVBA 3D0YB 4YI9A 2KSPA 1IJ6A 1KQVA 4INWA 3CR4X 4WQ2A 2FCEA 2L2CA 1WLMA 1NX0A 4BY5A 5KU1A 2Q4UA 3BUOB 1K96A 1IQ3A 4UPGA 1V1FA 1CTRA 2WCKA 1H4BA 2FCDA 2FJYA 1BF5A 1S36A 3KEVA 3LK0A 1F8HA 5JJGA 1NIWA 1D1OA 1BJFA 1F4QA 1TWOA 2CTNA 2LVVA 2WCJA 2M49B 2M1UA 1OOFA 1T14A 2K7CA 5CSNA 3R72A 1TN4A 1KK7Z 4PHMA 2LUXA 1OZSA 5I2QA 4AQJA 2K7BA 2MAZA 1TCFA 2O5GA 2OPOA 3DF0B 4MZKA 1DGUA 5AXIA 5D3OA 4P2YB 4ORBB 2DOQA 1J1DA 3RZSA 1YX8A 3S0FA 3ICBA 3NSLA 2LC5A 1HQVA 1SR6C 1LVCD 1OOGA 2Q91A 4NDBA 1LA3A 1HT9A 3LCPC 1C3YA 1SRAA 3CDNA 4QJ3B 5EL2A 3SS3A 1ORGA 3LL8B 1XFZO 2LUCA 3PM8A 5GQQC 1MF8B 2P6BB 1B4CA 1NCXA 2M0RA 5I8NA 1WY9A 4HRGA 2KLDA 4AOMA 1XO5A 4YRUA 3I5HC 1BODA 1TUJA 1BG1A 4GGFC 1S6CA 1RECA 1FI5A 3M0WA 1JUOA 2OS8C 4GPLB 4ZCUA 3D74A 4JWQA 2H61A 4N1FA 1DJHA 1A29A 1XFWO 2JNFA 3BFAA 3SS4A 3VRPA 1DT7B 3EKJA 1M45A 2MA2A 5DKNA 4I5NB 1LS8A 3EKHA 1LKJA 3TZ1A 2GTEA 1KWOB 4ORCB 1YUSA 3DVKA 1QVIZ 2F2OA 2ZKMX 1RTP1 3FS7A 5CSIA 3BJHA 2Y1NA 2TN4A 2KQ6A 3IVTA 1CDLA 3IQOA 3CZ2A 1L7ZA 1ZMZA 2JXCA 2KAVA 4PDZA 2PASA 2JWWA 5IBWA 3BUWB 2ZN8A 3FWBA 2OTGC 4YI8A 1PSRA 2AMIA 1KFUL 1XK4C 3CS1A 3K1EA 1K2HA 2BCBA 2KGRA 4JQ0D 2KDHA 1X02A 2HPSA 3FWCA 2MLEC 3D10A 2M29A 1OZOA 1CFPA 4CFQA 1GM0A 4M2OA 1WRKA 2KHNA 2LANA 3O4XA 1C3ZA 3OP0A 1ODBA 4XJKA 1CDNA 1BOCA 2FJUB 4OCIA 4F7FA 3BUXB 1L2OC 2JULA 1TTXA 2BBNA 2MRDA 3PATA 1B1GA 2R2IA 1CNPA 2CXJA 3LK1A 1SW8A 1BR4B 3PFVA 5FI2A 4QJ4B 4MSPA 2L2EA 3F45A 1TNXA 1UWOA 4OR9B 1QIVA 1P28A 5DICA 1M46A 5DKRA 5B8IB 3NSIA 1DGVA 1TIZA 1F71A 3WNXB 2LLUA 3AKBA 3GK4X 4DS7A 3TDZA 5FI7A 3VROA 2KOTA 2H2KA 4MZJA 2WCLA 1NSHA 2KBIA 3BUMB 1PSBA 2HF5A 4PE1A 3NSOA 3KF9A 1XYDA 1IQ5A 1J55A 1TNWA 3CYZA 1K9UA 3QRXA 1C07A 4IJ7A 2LHIA 3BQ3A 1F70A 1EG3A 3CTNA 1QX5B 1KSOA 4E68A 1J7RA 3NSKA 2JXLA 3KPXA 2JPTA 1SPYA 1ALWA 1CKKA 5AFPA 1EXRA 3LLEA 2WNDA 1U5IA 1C7VA 3GOFA 1J7PA 1NUBA 3PLFB 5DKQA 2G9BA 1DQEA 5KSZA 3D76A 1OSAA 1PK0D 3GK1A 2F3YA 1K8UA 3N7HA 3EK4A 2NCOA 1IGVA 1NP8A 2E6WA 2ERBA 3BXKA 3IQQA 2JT0A 2IS9A 5JOLA 5ER4X 1MUXA 1DJZA 1J7QA 4C0KA 2G2BA 2LP3A 1MXLC 5CSJA 2L50A 2ISDA 3VRNA 1FPWA 1MQ1A 3SIAA 4GBAA 3PJIA 1TNPA 1DF0A 3EVVA 2LVKA 1DC1A 1AK8A 2GGZA 3E3RA 5TNCA 2VRGA 2MJWB 1CB1A 1S5GZ 3CZTX 3I5GB 3BFHA 3DVJA 1DEKA 1JF0A 4R1EA 2NCPA 1KWOC 3V2LA 2CCMA 1Z4HA 4PE0A 4MVFA 1JWDA 1IIOA 1CDPA 2E30A 1GGZA 1SNLA 3OGNA 1EL4A 2P70A 3DD4A 1PALA 3D73A 1BLQA 4FTGA 1GGWA 3AKAA 4GFTA 2WCMA 1CFFA 1LXFC 2BCXA 3OB1B 5HLVA 3HX4A 4MRXA 2PALA 1OW4A 1YUTA 2JT8A 2KI6C 4PHJA 2Y1MA 3OHMB 1S6JA 3SIBA 3TUYB 2LLSA 3FE8A 4MN0A 1ZOTB 4ZCVA 1R2UA 4I5JA 2AUCA 3BOWA 5HKZA 1Y1AA 2F33A 1CFDA 2KFHA 3JTDB 5I94A 3R1OA 3O2PA 4M2QA 4P5OE 4WRIA 1J7OA 3A8RA 3KHEA 3JVTB 1G4YR 3B87A 2LV7A 1F4OA 2QPTA 5HKWA 1WRZA 2M1KB 4YGDB 1IH0A 1IJ5A 1QLSA 2KAXA 3RLZA 1NWDA 1TOPA 1SY9A 1AP4A 4YGEB 1A75A 1YRUB 4JKTA 1XA5A 2P71A 1KSMA 1M31A 1NPQA 1RFJA 1OMRA 1RK9A 2LMVA 3D78A 2JU0A 3D0YA 4XYNA 3BFBA 1SCMB 1C7WA 1BT6A 2FOTA 2L98A 3SJSA 4GAOA 2NZ0A 4GNKB 3Q8IA 1QWVA 1XFRA 1AJ4A 2KYCA 2JNXA 1SK6D 2WC8A 3NHTA 3DXLA 3HCMA 1CM1A 1PVAA 3MSEB 1LA0A 1VRKA 4PT1A 3VB1A 4N1GA 1RROA 1B7TY 4OZDA 4NDCA 3VGOA 4C0LA 3SG6A 2WOSA 1KFXS 2KBMA 2JTZA 1Y6WA 2LM5A 4GUKA 3TDIA 4QJ5B 4BY4A 3SG2A 3PM2A 5HYDA 1H8BA 2HQWA 1CDMA 1S3PA 3D75A 3UO9A 4ORAB 1GQMA 1ALVA 1DJYA 1MHOA 3NHIA 3O4YA 5PALA 5CSFA 2ZFDA 2MHHA 4JPZB 1TNQA 3CGAA 3SS5A 3DZTA 3PN7B 1PRWA 5HLOA 1K95A 2K60A 3A4UB 1MWNA 3BUNB 4INXA 2H61C 1OMVA 3TS5B 5CPVA 1RWYA 2Y5IA 4PHNA 2LMUA 4ICBA 4AQIA 2JPOA 1CLLA 2SCPA 1KK7Y 1A4PA 2JRFA 1DF0B 3I5IB 3CABA 1K9PA 2I94A 4PHKA 1KCYA 4L9MA 2HETA 3CWGA 1SYMA 2PYQA 2F3ZA 2KAYA 1WDCB 2WCEA 2EGDA 2BL0B 3WXAA 1TUZA 4DCKA 2KPHA 1EJ3A 1TCOB 1NCYA 2LCPA 3CZ1A 4ETOA 1YVHA 3KO0A 1XFVO 1CMFA 3NXAA 3TDUA 1A03A 4CIDA 4USLA 1QV0A 1UURA 5ER5A 2K8MB 1SSEB 5FI6A 1DELA 3I5GC 1QATA 1YURA 1B8CA 1WRLA 4I5LB 1UHJA 1MR8A 4OV2A 5FYXA 1XFUO 2KI6D 2QDIA 3L47A 1A2XA 2KGBC 3BOWB 3DVEA 1IG5A 2LHLA 2KFFA 4D1EA 1FF1A 1F54A 1K90D 2H8VA 1AHRA 3WHTB 3CZ0A 1V1GA 4Q04A 4MZLA 1KK8B 5HKYA 1JFJA 1M63B 2HQ8A 2WC5A 1B47A 3DYEA 5F6TA 3SG4A 1QX2A 3R1VA 5G08A 3TUYC 1NX1A 4HREE 1ZUZA 4OKHA 1YUUA 2BCAA 1XVJA 3O6BA 4FQOA 1JC2A 1TRFA 5AEQA 1SBJA 2LLTA 3JTDC 4GGFA 1A75B 1IWQA 1UHKA 5D69A 1SCVA 4NQGA 1B9AA 1R6PA
chains in the Genus database with same CATH topology
3JVTC 1SMGA 1RJVA 3AAKA 1ZFSA 4WQ3A 2RGIA 5K89A 1BU3A 1QVIY 2CT9A 2PRUA 2CBLA 2MBXA 2L4HA 2BE6A 1G8IA 1N0YA 2PSRA 3VRQA 2V53A 2BKIB 2LNKA 4PALA 1QJTA 1DTLA 1SCMC 5D7FA 1NX3A 2M3WA 1NYAA 3ZNIA 4CPVA 2JOJA 4IL1A 1QIWA 2JC2A 2LE9B 1K93D 2L5XB 3PSRA 1JBAA 4MBEA 2NLNA 4XJKB 4YBHB 2KQYA 2EC6C 2AAOA 2K61A 3OB2B 4C0JA 1KQMB 4I5KA 1F55A 4M2PA 3OX5A 1QV1A 1S1EA 1SL7A 2KI4B 1XK4A 4PE7A 2JT3A 3I5FC 1FI6A 1Y1UA 4CLNA 1W7JB 3EK7A 2M7LA 5KTYA 4N5XA 1SKTA 4NDDA 1QX7A 2L51A 2ZRTA 1QTXA 1EH2A 2LVJA 1DVIA 1CLBA 1JSAA 3PN7C 1GJYA 4TNCA 1BR1B 1FW4A 2K2FA 1KFUS 1OMDA 3TS5C 1S6IA 5BPJA 3I5IC 2L0PA 1UHNA 3CLNA 2M8UA 2WCBA 3H4SE 1CLMA 1YRTB 1MXEA 2EC6B 2QACA 3VRRA 5I2OA 1WDCC 2ZRSA 2BL0C 1QLKA 1U5IB 1J1EA 3OX6A 1SR6B 1OOJA 1AUIB 1OQPA 2GV5A 1Y1XA 1K94A 2ZN9A 4HSZA 4NDBA 1W7IB 2M7NA 3ZWHA 2WORA 3O78A 2CNPA 2LVIA 4PCWA 4MLWA 2Y4QA 2B1UA 3I5FB 3DF0A 1DJIA 2LAPA 4DRWA 2F2PA 4YGCB 2O60A 2SASA 2ZNEA 2K7DA 1YVLA 2LMTA 4U8DA 3I5HB 3C1VA 1IRJA 1G33A 2F8PA 2JTTA 2MLFC 1CFCA 2GGMA 1EG4A 2M97A 1SL8A 4OVNF 4MEWA 4A4BA 1AJ5A 1DMOA 3GK2A 2OS8B 3FIAA 1KK8C 5AERA 1Q80A 2I2RE 4HRHA 1PULA 1Y0VH 1YTZC 1UHIA 4DUQA 1DJGA 2BE4A 4MRYA 3DVMA 4CFRA 3RM1A 1AVSA 3PALA 2BECA 3EVRA 1UUSA 3SG7A 2NXQA 2I7AA 1OE9B 3SG5A 1PVBA 1B8LA 1S5GY 2COLB 1UP5A 4DIRA 4F0ZB 2L4IA 3K21A 2A4JA 4GGNA 1N65A 1QASA 1KFXL 1NCZA 2M9GA 3EVUA 1DJXA 2K7OA 2I18A 2EHBA 1N2DA 2KYFA 1QS7A 1B8RA 3SG3A 3WHUB 5I2LA 2KNEA 1S26D 1QXPA 2JZIA 1JFKA 1XFYO 3EK8A 1FBVA 2K2AA 2PMYA 1IKUA 2WCFA 3IF7A 4A4CA 1WLZA 2OTGB 1CMGA 4YGAA 3CR5X 2K0JA 1M39A 1UHHA 3BYAA 2D8NA 5J3XA 3AAJA 1K9KA 1JF2A 1ZACA 4YGBB 1BMOA 1LINA 1YR5A 1SL9A 3CR2A 1DJWA 1XFXO 1E8AA 1NX2A 1B7TZ 2BKHB 2JQ6A 1KQMC 1CM4A 2LP2A 4PE4A 1YX7A 2ZNDA 1L2OB 5AANA 2KI4C 2KFGA 2BBMA 2PVBA 3D0YB 4YI9A 2KSPA 1IJ6A 1KQVA 3CR4X 4WQ2A 2FCEA 1WLMA 1NX0A 4BY5A 5KU1A 2Q4UA 3BUOB 1K96A 1IQ3A 4UPGA 1V1FA 1CTRA 1H4BA 2FCDA 1F8HA 1BF5A 1S36A 3KEVA 3LK0A 5JJGA 1NIWA 1D1OA 1BJFA 1F4QA 2CTNA 2LVVA 2M49B 2M1UA 2K7CA 5CSNA 1TN4A 1KK7Z 4PHMA 2LUXA 1OZSA 5I2QA 4AQJA 2K7BA 2MAZA 1TCFA 2O5GA 2OPOA 3DF0B 4MZKA 1DGUA 5AXIA 4P2YB 4ORBB 2DOQA 1J1DA 1YX8A 3ICBA 3NSLA 2LC5A 1HQVA 1SR6C 1LVCD 2Q91A 1LA3A 1HT9A 3LCPC 1SRAA 4QJ3B 3LL8B 1XFZO 2LUCA 3PM8A 5GQQC 1MF8B 2P6BB 1B4CA 1NCXA 2M0RA 5I8NA 1WY9A 4HRGA 4AOMA 1XO5A 4YRUA 3I5HC 1BODA 1BG1A 4GGFC 1S6CA 1RECA 1FI5A 3M0WA 1JUOA 2OS8C 4GPLB 4ZCUA 4JWQA 2H61A 4N1FA 1DJHA 1A29A 1XFWO 2JNFA 3VRPA 1DT7B 3EKJA 1M45A 2MA2A 5DKNA 4I5NB 3EKHA 1LKJA 3TZ1A 1KWOB 4ORCB 1YUSA 3DVKA 1QVIZ 2F2OA 2ZKMX 1RTP1 3FS7A 5CSIA 2Y1NA 2TN4A 2KQ6A 1CDLA 3IQOA 1L7ZA 1ZMZA 2JXCA 2KAVA 4PDZA 2PASA 2JWWA 5IBWA 3BUWB 2ZN8A 3FWBA 2OTGC 4YI8A 1PSRA 2AMIA 1KFUL 1XK4C 3CS1A 1K2HA 2BCBA 2KGRA 4JQ0D 2KDHA 1X02A 2HPSA 3FWCA 2MLEC 3D10A 2M29A 1OZOA 1CFPA 4CFQA 4M2OA 1WRKA 2KHNA 2LANA 3OP0A 1ODBA 4XJKA 1CDNA 1BOCA 2FJUB 4OCIA 3BUXB 1L2OC 2JULA 1TTXA 2BBNA 2MRDA 3PATA 1B1GA 2R2IA 1CNPA 2CXJA 3LK1A 1SW8A 1BR4B 3PFVA 4QJ4B 4MSPA 2L2EA 3F45A 1TNXA 1UWOA 4OR9B 1QIVA 1M46A 5DKRA 5B8IB 3NSIA 1DGVA 1TIZA 1F71A 3WNXB 2LLUA 3AKBA 3GK4X 4DS7A 3TDZA 3VROA 2KOTA 2H2KA 4MZJA 1NSHA 2KBIA 3BUMB 1PSBA 2HF5A 4PE1A 3NSOA 3KF9A 1XYDA 1IQ5A 1J55A 1TNWA 3QRXA 1K9UA 1C07A 2LHIA 3BQ3A 1F70A 1EG3A 3CTNA 1QX5B 1KSOA 4E68A 1J7RA 3NSKA 2JXLA 3KPXA 2JPTA 1SPYA 1ALWA 1CKKA 5AFPA 1EXRA 3LLEA 2WNDA 1U5IA 1C7VA 3GOFA 1J7PA 1NUBA 3PLFB 5DKQA 2G9BA 5KSZA 1OSAA 1PK0D 3GK1A 2F3YA 1K8UA 3EK4A 2NCOA 1IGVA 1NP8A 2E6WA 3BXKA 3IQQA 5JOLA 2JT0A 2IS9A 5ER4X 1MUXA 1DJZA 1J7QA 4C0KA 2G2BA 2LP3A 1MXLC 5CSJA 2L50A 2ISDA 3VRNA 1FPWA 1MQ1A 3SIAA 4GBAA 1TNPA 1DF0A 3EVVA 2LVKA 1AK8A 2GGZA 3E3RA 5TNCA 2VRGA 2MJWB 1CB1A 1S5GZ 3CZTX 3I5GB 3DVJA 4R1EA 1JF0A 2NCPA 1KWOC 2CCMA 4PE0A 1JWDA 4MVFA 1CDPA 2E30A 1GGZA 1SNLA 1EL4A 3DD4A 1PALA 1BLQA 4FTGA 1GGWA 3AKAA 4GFTA 1CFFA 1LXFC 2BCXA 3OB1B 5HLVA 3HX4A 4MRXA 2PALA 1YUTA 2JT8A 2KI6C 4PHJA 2Y1MA 3OHMB 1S6JA 3SIBA 3TUYB 2LLSA 4MN0A 1ZOTB 4ZCVA 1R2UA 4I5JA 2AUCA 3BOWA 5HKZA 1Y1AA 2F33A 1CFDA 2KFHA 3JTDB 4P5OE 3O2PA 4M2QA 4WRIA 1J7OA 3A8RA 3KHEA 3JVTB 1G4YR 2LV7A 1F4OA 2QPTA 5HKWA 1WRZA 2M1KB 4YGDB 1IH0A 1IJ5A 1QLSA 2KAXA 3RLZA 1NWDA 1TOPA 1SY9A 1AP4A 4YGEB 1A75A 1YRUB 1XA5A 1KSMA 1M31A 1NPQA 1RFJA 1OMRA 1RK9A 2LMVA 2JU0A 3D0YA 4XYNA 1SCMB 1C7WA 1BT6A 2FOTA 2L98A 3SJSA 4GAOA 2NZ0A 4GNKB 2KYCA 1AJ4A 2JNXA 1SK6D 2WC8A 3HCMA 1CM1A 1PVAA 3MSEB 1LA0A 1VRKA 4N1GA 1RROA 1B7TY 4NDCA 3VGOA 4C0LA 3SG6A 2WOSA 1KFXS 2KBMA 2JTZA 1Y6WA 2LM5A 4GUKA 3TDIA 4QJ5B 4BY4A 3SG2A 5HYDA 1H8BA 2HQWA 1CDMA 1S3PA 4ORAB 1GQMA 1ALVA 1DJYA 1MHOA 3O4YA 5PALA 5CSFA 2ZFDA 2MHHA 4JPZB 1TNQA 3CGAA 3PN7B 1PRWA 5HLOA 1K95A 3BUNB 3A4UB 1MWNA 2H61C 1OMVA 3TS5B 5CPVA 1RWYA 2Y5IA 4PHNA 2LMUA 4ICBA 4AQIA 1CLLA 2SCPA 1KK7Y 1A4PA 2JRFA 1DF0B 3I5IB 1K9PA 2I94A 4PHKA 1KCYA 4L9MA 2HETA 3CWGA 1SYMA 2F3ZA 2KAYA 1WDCB 2WCEA 2EGDA 2BL0B 3WXAA 4DCKA 4ETOA 1EJ3A 1TCOB 1NCYA 2LCPA 1YVHA 3KO0A 1XFVO 1CMFA 3NXAA 3TDUA 1A03A 4CIDA 4USLA 1QV0A 1UURA 5ER5A 2K8MB 3I5GC 1QATA 1YURA 1B8CA 1WRLA 4I5LB 1UHJA 1MR8A 4OV2A 5FYXA 1XFUO 2KI6D 1A2XA 2KGBC 3BOWB 3DVEA 1IG5A 2LHLA 2KFFA 4D1EA 1FF1A 1F54A 1K90D 1AHRA 3WHTB 1V1GA 4Q04A 4MZLA 1KK8B 5HKYA 1JFJA 1M63B 2HQ8A 1B47A 5F6TA 3SG4A 1QX2A 5G08A 3TUYC 1NX1A 4HREE 1ZUZA 4OKHA 1YUUA 2BCAA 1XVJA 3O6BA 4FQOA 1JC2A 1TRFA 5AEQA 1SBJA 2LLTA 3JTDC 4GGFA 1A75B 1IWQA 1UHKA 5D69A 1SCVA 4NQGA 1B9AA 1R6PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JVT C;  1SMG A;  1RJV A;  3AAK A;  1ZFS A;  4WQ3 A;  2RGI A;  5K89 A;  1BU3 A;  1QVI Y;  2CT9 A;  2PRU A;  2CBL A;  2MBX A;  2L4H A;  2BE6 A;  1G8I A;  1N0Y A;  2PSR A;  3VRQ A;  2V53 A;  2BKI B;  2LNK A;  4PAL A;  1QJT A;  1DTL A;  1SCM C;  5D7F A;  1NX3 A;  2M3W A;  1NYA A;  3ZNI A;  4CPV A;  2JOJ A;  4IL1 A;  1QIW A;  2JC2 A;  2LE9 B;  1K93 D;  2L5X B;  3PSR A;  1JBA A;  4MBE A;  2NLN A;  4XJK B;  4YBH B;  2KQY A;  2EC6 C;  2AAO A;  2K61 A;  3OB2 B;  4C0J A;  1KQM B;  4I5K A;  1F55 A;  4M2P A;  3OX5 A;  1QV1 A;  1S1E A;  1SL7 A;  2KI4 B;  1XK4 A;  4PE7 A;  2JT3 A;  3I5F C;  1FI6 A;  1Y1U A;  4CLN A;  1W7J B;  3EK7 A;  2M7L A;  5KTY A;  4N5X A;  1SKT A;  4NDD A;  1QX7 A;  2L51 A;  2ZRT A;  1QTX A;  1EH2 A;  2LVJ A;  1DVI A;  1CLB A;  1JSA A;  3PN7 C;  1GJY A;  4TNC A;  1BR1 B;  1FW4 A;  2K2F A;  1KFU S;  1OMD A;  3TS5 C;  1S6I A;  5BPJ A;  3I5I C;  2L0P A;  1UHN A;  3CLN A;  2M8U A;  2WCB A;  3H4S E;  1CLM A;  1YRT B;  1MXE A;  2EC6 B;  2QAC A;  3VRR A;  5I2O A;  1WDC C;  2ZRS A;  2BL0 C;  1QLK A;  1U5I B;  1J1E A;  3OX6 A;  1SR6 B;  1OOJ A;  1AUI B;  1OQP A;  2GV5 A;  1Y1X A;  1K94 A;  2ZN9 A;  4HSZ A;  4NDB A;  1W7I B;  2M7N A;  3ZWH A;  2WOR A;  3O78 A;  2CNP A;  2LVI A;  4PCW A;  4MLW A;  2Y4Q A;  2B1U A;  3I5F B;  3DF0 A;  1DJI A;  2LAP A;  4DRW A;  2F2P A;  4YGC B;  2O60 A;  2SAS A;  2ZNE A;  2K7D A;  1YVL A;  2LMT A;  4U8D A;  3I5H B;  3C1V A;  1IRJ A;  1G33 A;  2F8P A;  2JTT A;  2MLF C;  1CFC A;  2GGM A;  1EG4 A;  2M97 A;  1SL8 A;  4OVN F;  4MEW A;  4A4B A;  1AJ5 A;  1DMO A;  3GK2 A;  2OS8 B;  3FIA A;  1KK8 C;  5AER A;  1Q80 A;  2I2R E;  4HRH A;  1PUL A;  1Y0V H;  1YTZ C;  1UHI A;  4DUQ A;  1DJG A;  2BE4 A;  4MRY A;  3DVM A;  4CFR A;  3RM1 A;  1AVS A;  3PAL A;  2BEC A;  3EVR A;  1UUS A;  3SG7 A;  2NXQ A;  2I7A A;  1OE9 B;  3SG5 A;  1PVB A;  1B8L A;  1S5G Y;  2COL B;  1UP5 A;  4DIR A;  4F0Z B;  2L4I A;  3K21 A;  2A4J A;  4GGN A;  1N65 A;  1QAS A;  1KFX L;  1NCZ A;  2M9G A;  3EVU A;  1DJX A;  2K7O A;  2I18 A;  2EHB A;  1N2D A;  2KYF A;  1QS7 A;  1B8R A;  3SG3 A;  3WHU B;  5I2L A;  2KNE A;  1S26 D;  1QXP A;  2JZI A;  1JFK A;  1XFY O;  3EK8 A;  1FBV A;  2K2A A;  2PMY A;  1IKU A;  2WCF A;  3IF7 A;  4A4C A;  1WLZ A;  2OTG B;  1CMG A;  4YGA A;  3CR5 X;  2K0J A;  1M39 A;  1UHH A;  3BYA A;  2D8N A;  5J3X A;  3AAJ A;  1K9K A;  1JF2 A;  1ZAC A;  4YGB B;  1BMO A;  1LIN A;  1YR5 A;  1SL9 A;  3CR2 A;  1DJW A;  1XFX O;  1E8A A;  1NX2 A;  1B7T Z;  2BKH B;  2JQ6 A;  1KQM C;  1CM4 A;  2LP2 A;  4PE4 A;  1YX7 A;  2ZND A;  1L2O B;  5AAN A;  2KI4 C;  2KFG A;  2BBM A;  2PVB A;  3D0Y B;  4YI9 A;  2KSP A;  1IJ6 A;  1KQV A;  3CR4 X;  4WQ2 A;  2FCE A;  1WLM A;  1NX0 A;  4BY5 A;  5KU1 A;  2Q4U A;  3BUO B;  1K96 A;  1IQ3 A;  4UPG A;  1V1F A;  1CTR A;  1H4B A;  2FCD A;  1F8H A;  1BF5 A;  1S36 A;  3KEV A;  3LK0 A;  5JJG A;  1NIW A;  1D1O A;  1BJF A;  1F4Q A;  2CTN A;  2LVV A;  2M49 B;  2M1U A;  2K7C A;  5CSN A;  1TN4 A;  1KK7 Z;  4PHM A;  2LUX A;  1OZS A;  5I2Q A;  4AQJ A;  2K7B A;  2MAZ A;  1TCF A;  2O5G A;  2OPO A;  3DF0 B;  4MZK A;  1DGU A;  5AXI A;  4P2Y B;  4ORB B;  2DOQ A;  1J1D A;  1YX8 A;  3ICB A;  3NSL A;  2LC5 A;  1HQV A;  1SR6 C;  1LVC D;  2Q91 A;  1LA3 A;  1HT9 A;  3LCP C;  1SRA A;  4QJ3 B;  3LL8 B;  1XFZ O;  2LUC A;  3PM8 A;  5GQQ C;  1MF8 B;  2P6B B;  1B4C A;  1NCX A;  2M0R A;  5I8N A;  1WY9 A;  4HRG A;  4AOM A;  1XO5 A;  4YRU A;  3I5H C;  1BOD A;  1BG1 A;  4GGF C;  1S6C A;  1REC A;  1FI5 A;  3M0W A;  1JUO A;  2OS8 C;  4GPL B;  4ZCU A;  4JWQ A;  2H61 A;  4N1F A;  1DJH A;  1A29 A;  1XFW O;  2JNF A;  3VRP A;  1DT7 B;  3EKJ A;  1M45 A;  2MA2 A;  5DKN A;  4I5N B;  3EKH A;  1LKJ A;  3TZ1 A;  1KWO B;  4ORC B;  1YUS A;  3DVK A;  1QVI Z;  2F2O A;  2ZKM X;  1RTP 1;  3FS7 A;  5CSI A;  2Y1N A;  2TN4 A;  2KQ6 A;  1CDL A;  3IQO A;  1L7Z A;  1ZMZ A;  2JXC A;  2KAV A;  4PDZ A;  2PAS A;  2JWW A;  5IBW A;  3BUW B;  2ZN8 A;  3FWB A;  2OTG C;  4YI8 A;  1PSR A;  2AMI A;  1KFU L;  1XK4 C;  3CS1 A;  1K2H A;  2BCB A;  2KGR A;  4JQ0 D;  2KDH A;  1X02 A;  2HPS A;  3FWC A;  2MLE C;  3D10 A;  2M29 A;  1OZO A;  1CFP A;  4CFQ A;  4M2O A;  1WRK A;  2KHN A;  2LAN A;  3OP0 A;  1ODB A;  4XJK A;  1CDN A;  1BOC A;  2FJU B;  4OCI A;  3BUX B;  1L2O C;  2JUL A;  1TTX A;  2BBN A;  2MRD A;  3PAT A;  1B1G A;  2R2I A;  1CNP A;  2CXJ A;  3LK1 A;  1SW8 A;  1BR4 B;  3PFV A;  4QJ4 B;  4MSP A;  2L2E A;  3F45 A;  1TNX A;  1UWO A;  4OR9 B;  1QIV A;  1M46 A;  5DKR A;  5B8I B;  3NSI A;  1DGV A;  1TIZ A;  1F71 A;  3WNX B;  2LLU A;  3AKB A;  3GK4 X;  4DS7 A;  3TDZ A;  3VRO A;  2KOT A;  2H2K A;  4MZJ A;  1NSH A;  2KBI A;  3BUM B;  1PSB A;  2HF5 A;  4PE1 A;  3NSO A;  3KF9 A;  1XYD A;  1IQ5 A;  1J55 A;  1TNW A;  3QRX A;  1K9U A;  1C07 A;  2LHI A;  3BQ3 A;  1F70 A;  1EG3 A;  3CTN A;  1QX5 B;  1KSO A;  4E68 A;  1J7R A;  3NSK A;  2JXL A;  3KPX A;  2JPT A;  1SPY A;  1ALW A;  1CKK A;  5AFP A;  1EXR A;  3LLE A;  2WND A;  1U5I A;  1C7V A;  3GOF A;  1J7P A;  1NUB A;  3PLF B;  5DKQ A;  2G9B A;  5KSZ A;  1OSA A;  1PK0 D;  3GK1 A;  2F3Y A;  1K8U A;  3EK4 A;  2NCO A;  1IGV A;  1NP8 A;  2E6W A;  3BXK A;  3IQQ A;  5JOL A;  2JT0 A;  2IS9 A;  5ER4 X;  1MUX A;  1DJZ A;  1J7Q A;  4C0K A;  2G2B A;  2LP3 A;  1MXL C;  5CSJ A;  2L50 A;  2ISD A;  3VRN A;  1FPW A;  1MQ1 A;  3SIA A;  4GBA A;  1TNP A;  1DF0 A;  3EVV A;  2LVK A;  1AK8 A;  2GGZ A;  3E3R A;  5TNC A;  2VRG A;  2MJW B;  1CB1 A;  1S5G Z;  3CZT X;  3I5G B;  3DVJ A;  4R1E A;  1JF0 A;  2NCP A;  1KWO C;  2CCM A;  4PE0 A;  1JWD A;  4MVF A;  1CDP A;  2E30 A;  1GGZ A;  1SNL A;  1EL4 A;  3DD4 A;  1PAL A;  1BLQ A;  4FTG A;  1GGW A;  3AKA A;  4GFT A;  1CFF A;  1LXF C;  2BCX A;  3OB1 B;  5HLV A;  3HX4 A;  4MRX A;  2PAL A;  1YUT A;  2JT8 A;  2KI6 C;  4PHJ A;  2Y1M A;  3OHM B;  1S6J A;  3SIB A;  3TUY B;  2LLS A;  4MN0 A;  1ZOT B;  4ZCV A;  1R2U A;  4I5J A;  2AUC A;  3BOW A;  5HKZ A;  1Y1A A;  2F33 A;  1CFD A;  2KFH A;  3JTD B;  4P5O E;  3O2P A;  4M2Q A;  4WRI A;  1J7O A;  3A8R A;  3KHE A;  3JVT B;  1G4Y R;  2LV7 A;  1F4O A;  2QPT A;  5HKW A;  1WRZ A;  2M1K B;  4YGD B;  1IH0 A;  1IJ5 A;  1QLS A;  2KAX A;  3RLZ A;  1NWD A;  1TOP A;  1SY9 A;  1AP4 A;  4YGE B;  1A75 A;  1YRU B;  1XA5 A;  1KSM A;  1M31 A;  1NPQ A;  1RFJ A;  1OMR A;  1RK9 A;  2LMV A;  2JU0 A;  3D0Y A;  4XYN A;  1SCM B;  1C7W A;  1BT6 A;  2FOT A;  2L98 A;  3SJS A;  4GAO A;  2NZ0 A;  4GNK B;  2KYC A;  1AJ4 A;  2JNX A;  1SK6 D;  2WC8 A;  3HCM A;  1CM1 A;  1PVA A;  3MSE B;  1LA0 A;  1VRK A;  4N1G A;  1RRO A;  1B7T Y;  4NDC A;  3VGO A;  4C0L A;  3SG6 A;  2WOS A;  1KFX S;  2KBM A;  2JTZ A;  1Y6W A;  2LM5 A;  4GUK A;  3TDI A;  4QJ5 B;  4BY4 A;  3SG2 A;  5HYD A;  1H8B A;  2HQW A;  1CDM A;  1S3P A;  4ORA B;  1GQM A;  1ALV A;  1DJY A;  1MHO A;  3O4Y A;  5PAL A;  5CSF A;  2ZFD A;  2MHH A;  4JPZ B;  1TNQ A;  3CGA A;  3PN7 B;  1PRW A;  5HLO A;  1K95 A;  3BUN B;  3A4U B;  1MWN A;  2H61 C;  1OMV A;  3TS5 B;  5CPV A;  1RWY A;  2Y5I A;  4PHN A;  2LMU A;  4ICB A;  4AQI A;  1CLL A;  2SCP A;  1KK7 Y;  1A4P A;  2JRF A;  1DF0 B;  3I5I B;  1K9P A;  2I94 A;  4PHK A;  1KCY A;  4L9M A;  2HET A;  3CWG A;  1SYM A;  2F3Z A;  2KAY A;  1WDC B;  2WCE A;  2EGD A;  2BL0 B;  3WXA A;  4DCK A;  4ETO A;  1EJ3 A;  1TCO B;  1NCY A;  2LCP A;  1YVH A;  3KO0 A;  1XFV O;  1CMF A;  3NXA A;  3TDU A;  1A03 A;  4CID A;  4USL A;  1QV0 A;  1UUR A;  5ER5 A;  2K8M B;  3I5G C;  1QAT A;  1YUR A;  1B8C A;  1WRL A;  4I5L B;  1UHJ A;  1MR8 A;  4OV2 A;  5FYX A;  1XFU O;  2KI6 D;  1A2X A;  2KGB C;  3BOW B;  3DVE A;  1IG5 A;  2LHL A;  2KFF A;  4D1E A;  1FF1 A;  1F54 A;  1K90 D;  1AHR A;  3WHT B;  1V1G A;  4Q04 A;  4MZL A;  1KK8 B;  5HKY A;  1JFJ A;  1M63 B;  2HQ8 A;  1B47 A;  5F6T A;  3SG4 A;  1QX2 A;  5G08 A;  3TUY C;  1NX1 A;  4HRE E;  1ZUZ A;  4OKH A;  1YUU A;  2BCA A;  1XVJ A;  3O6B A;  4FQO A;  1JC2 A;  1TRF A;  5AEQ A;  1SBJ A;  2LLT A;  3JTD C;  4GGF A;  1A75 B;  1IWQ A;  1UHK A;  5D69 A;  1SCV A;  4NQG A;  1B9A A;  1R6P A; 
#chains in the Genus database with same CATH topology
 2YGU A;  3JVT C;  1SMG A;  1RJV A;  3AAK A;  1ZFS A;  4WQ3 A;  2RGI A;  5K89 A;  1BU3 A;  3NGV A;  1QVI Y;  2CT9 A;  2PRU A;  3S0A A;  2CBL A;  2MBX A;  2L4H A;  2PQL A;  3R1P A;  2BE6 A;  3EG5 B;  1G8I A;  1N0Y A;  2PSR A;  3VRQ A;  2V53 A;  2BKI B;  3S0G A;  2LNK A;  4PAL A;  1QJT A;  1DTL A;  1SCM C;  1OOH A;  2L5Y A;  5D7F A;  1NX3 A;  2M3W A;  1NYA A;  3S0D A;  3ZNI A;  4CPV A;  2JOJ A;  4IL1 A;  4KYN A;  1QIW A;  2JC2 A;  2LE9 B;  2QEO A;  1K93 D;  1W9Z A;  2L5X B;  3OBV A;  3PSR A;  1JBA A;  4MBE A;  2NLN A;  4XJK B;  4YBH B;  2KQY A;  2EC6 C;  2AAO A;  2K61 A;  3OB2 B;  4C0J A;  3QME A;  1KQM B;  3B86 A;  4I5K A;  1F55 A;  4M2P A;  3OX5 A;  1QV1 A;  5HL1 A;  1S1E A;  1SL7 A;  2BNX A;  1XK4 A;  2KI4 B;  4PE7 A;  2JT3 A;  2KLE A;  3I5F C;  1FI6 A;  1Y1U A;  2QEH A;  4CLN A;  1W7J B;  3EK7 A;  2M7L A;  5KTY A;  2BAP A;  4N5X A;  1SKT A;  4NDD A;  1QX7 A;  2L51 A;  2ZRT A;  1QTX A;  1EH2 A;  2LVJ A;  3D77 A;  3S0B A;  2QEV A;  1DVI A;  1CLB A;  1JSA A;  3PN7 C;  1GJY A;  4TNC A;  1BR1 B;  1FW4 A;  2K2F A;  1KFU S;  1OMD A;  3TS5 C;  1S6I A;  5BPJ A;  3I5I C;  2L0P A;  1UHN A;  3CLN A;  2M8U A;  3FE6 A;  2WCB A;  2WC6 A;  3H4S E;  1CLM A;  1YRT B;  1MXE A;  2EC6 B;  2QAC A;  3VRR A;  5I2O A;  1WDC C;  2ZRS A;  2BL0 C;  1QLK A;  1U5I B;  1J1E A;  3FE9 A;  3OX6 A;  1SR6 B;  1OOJ A;  1AUI B;  1OQP A;  1Z2C B;  1Y1X A;  1K94 A;  2GV5 A;  2ZN9 A;  4HSZ A;  1W7I B;  2M7N A;  3ZWH A;  2WOR A;  3O78 A;  2CNP A;  2LVI A;  4PCW A;  4MLW A;  2Y4Q A;  2B1U A;  3I5F B;  3DF0 A;  1DJI A;  2LAP A;  4DRW A;  2F2P A;  4YGC B;  2O60 A;  2QEB A;  2SAS A;  2ZNE A;  2K7D A;  1YVL A;  2LMT A;  4U8D A;  3I5H B;  3C1V A;  3DY9 A;  1IRJ A;  1G33 A;  2F8P A;  2JTT A;  2MLF C;  1CFC A;  2GGM A;  1EG4 A;  2M97 A;  1SL8 A;  4OVN F;  4MEW A;  4A4B A;  1AJ5 A;  1DMO A;  3GK2 A;  2OS8 B;  3B88 A;  3FIA A;  1KK8 C;  5AER A;  1Q80 A;  3B7A A;  3L4A A;  2I2R E;  4HRH A;  1OOI X;  1PUL A;  1Y0V H;  1YTZ C;  1UHI A;  4DUQ A;  3L4L A;  1DJG A;  4JD9 A;  2BE4 A;  4MRY A;  3DVM A;  3UNW A;  4CFR A;  3RM1 A;  1AVS A;  3PAL A;  3B6X A;  2BEC A;  3S0E A;  3EVR A;  1UUS A;  4FQT A;  2NXQ A;  2I7A A;  1OE9 B;  3SG7 A;  3SG5 A;  1PVB A;  1B8L A;  1S5G Y;  2COL B;  1UP5 A;  4DIR A;  4F0Z B;  2L4I A;  3K21 A;  2A4J A;  4GGN A;  1N65 A;  1QAS A;  1KFX L;  1NCZ A;  2M9G A;  3EVU A;  1DJX A;  2K7O A;  2I18 A;  2EHB A;  1N2D A;  2KYF A;  2WCH A;  1QS7 A;  1B8R A;  3SG3 A;  3WHU B;  5I2L A;  2KNE A;  1S26 D;  1QXP A;  2JZI A;  1JFK A;  1XFY O;  3EK8 A;  1FBV A;  2K2A A;  2PMY A;  1IKU A;  2WCF A;  3IF7 A;  4A4C A;  1WLZ A;  2OTG B;  1CMG A;  4YGA A;  3CR5 X;  2K0J A;  1M39 A;  1UHH A;  3BYA A;  2D8N A;  5J3X A;  3AAJ A;  1K9K A;  1JF2 A;  1ZAC A;  4YGB B;  1BMO A;  1LIN A;  1YR5 A;  1SL9 A;  3CR2 A;  1DJW A;  1XFX O;  1E8A A;  1NX2 A;  1B7T Z;  2BKH B;  2JQ6 A;  1KQM C;  1CM4 A;  2LP2 A;  4PE4 A;  1YX7 A;  2ZND A;  1L2O B;  5AAN A;  2KI4 C;  2KFG A;  2BBM A;  2PVB A;  3D0Y B;  4YI9 A;  2KSP A;  1IJ6 A;  1KQV A;  4INW A;  3CR4 X;  4WQ2 A;  2FCE A;  2L2C A;  1WLM A;  1NX0 A;  4BY5 A;  5KU1 A;  2Q4U A;  3BUO B;  1K96 A;  1IQ3 A;  4UPG A;  1V1F A;  1CTR A;  2WCK A;  1H4B A;  2FCD A;  2FJY A;  1BF5 A;  1S36 A;  3KEV A;  3LK0 A;  1F8H A;  5JJG A;  1NIW A;  1D1O A;  1BJF A;  1F4Q A;  1TWO A;  2CTN A;  2LVV A;  2WCJ A;  2M49 B;  2M1U A;  1OOF A;  1T14 A;  2K7C A;  5CSN A;  3R72 A;  1TN4 A;  1KK7 Z;  4PHM A;  2LUX A;  1OZS A;  5I2Q A;  4AQJ A;  2K7B A;  2MAZ A;  1TCF A;  2O5G A;  2OPO A;  3DF0 B;  4MZK A;  1DGU A;  5AXI A;  5D3O A;  4P2Y B;  4ORB B;  2DOQ A;  1J1D A;  3RZS A;  1YX8 A;  3S0F A;  3ICB A;  3NSL A;  2LC5 A;  1HQV A;  1SR6 C;  1LVC D;  1OOG A;  2Q91 A;  4NDB A;  1LA3 A;  1HT9 A;  3LCP C;  1C3Y A;  1SRA A;  3CDN A;  4QJ3 B;  5EL2 A;  3SS3 A;  1ORG A;  3LL8 B;  1XFZ O;  2LUC A;  3PM8 A;  5GQQ C;  1MF8 B;  2P6B B;  1B4C A;  1NCX A;  2M0R A;  5I8N A;  1WY9 A;  4HRG A;  2KLD A;  4AOM A;  1XO5 A;  4YRU A;  3I5H C;  1BOD A;  1TUJ A;  1BG1 A;  4GGF C;  1S6C A;  1REC A;  1FI5 A;  3M0W A;  1JUO A;  2OS8 C;  4GPL B;  4ZCU A;  3D74 A;  4JWQ A;  2H61 A;  4N1F A;  1DJH A;  1A29 A;  1XFW O;  2JNF A;  3BFA A;  3SS4 A;  3VRP A;  1DT7 B;  3EKJ A;  1M45 A;  2MA2 A;  5DKN A;  4I5N B;  1LS8 A;  3EKH A;  1LKJ A;  3TZ1 A;  2GTE A;  1KWO B;  4ORC B;  1YUS A;  3DVK A;  1QVI Z;  2F2O A;  2ZKM X;  1RTP 1;  3FS7 A;  5CSI A;  3BJH A;  2Y1N A;  2TN4 A;  2KQ6 A;  3IVT A;  1CDL A;  3IQO A;  3CZ2 A;  1L7Z A;  1ZMZ A;  2JXC A;  2KAV A;  4PDZ A;  2PAS A;  2JWW A;  5IBW A;  3BUW B;  2ZN8 A;  3FWB A;  2OTG C;  4YI8 A;  1PSR A;  2AMI A;  1KFU L;  1XK4 C;  3CS1 A;  3K1E A;  1K2H A;  2BCB A;  2KGR A;  4JQ0 D;  2KDH A;  1X02 A;  2HPS A;  3FWC A;  2MLE C;  3D10 A;  2M29 A;  1OZO A;  1CFP A;  4CFQ A;  1GM0 A;  4M2O A;  1WRK A;  2KHN A;  2LAN A;  3O4X A;  1C3Z A;  3OP0 A;  1ODB A;  4XJK A;  1CDN A;  1BOC A;  2FJU B;  4OCI A;  4F7F A;  3BUX B;  1L2O C;  2JUL A;  1TTX A;  2BBN A;  2MRD A;  3PAT A;  1B1G A;  2R2I A;  1CNP A;  2CXJ A;  3LK1 A;  1SW8 A;  1BR4 B;  3PFV A;  5FI2 A;  4QJ4 B;  4MSP A;  2L2E A;  3F45 A;  1TNX A;  1UWO A;  4OR9 B;  1QIV A;  1P28 A;  5DIC A;  1M46 A;  5DKR A;  5B8I B;  3NSI A;  1DGV A;  1TIZ A;  1F71 A;  3WNX B;  2LLU A;  3AKB A;  3GK4 X;  4DS7 A;  3TDZ A;  5FI7 A;  3VRO A;  2KOT A;  2H2K A;  4MZJ A;  2WCL A;  1NSH A;  2KBI A;  3BUM B;  1PSB A;  2HF5 A;  4PE1 A;  3NSO A;  3KF9 A;  1XYD A;  1IQ5 A;  1J55 A;  1TNW A;  3CYZ A;  1K9U A;  3QRX A;  1C07 A;  4IJ7 A;  2LHI A;  3BQ3 A;  1F70 A;  1EG3 A;  3CTN A;  1QX5 B;  1KSO A;  4E68 A;  1J7R A;  3NSK A;  2JXL A;  3KPX A;  2JPT A;  1SPY A;  1ALW A;  1CKK A;  5AFP A;  1EXR A;  3LLE A;  2WND A;  1U5I A;  1C7V A;  3GOF A;  1J7P A;  1NUB A;  3PLF B;  5DKQ A;  2G9B A;  1DQE A;  5KSZ A;  3D76 A;  1OSA A;  1PK0 D;  3GK1 A;  2F3Y A;  1K8U A;  3N7H A;  3EK4 A;  2NCO A;  1IGV A;  1NP8 A;  2E6W A;  2ERB A;  3BXK A;  3IQQ A;  2JT0 A;  2IS9 A;  5JOL A;  5ER4 X;  1MUX A;  1DJZ A;  1J7Q A;  4C0K A;  2G2B A;  2LP3 A;  1MXL C;  5CSJ A;  2L50 A;  2ISD A;  3VRN A;  1FPW A;  1MQ1 A;  3SIA A;  4GBA A;  3PJI A;  1TNP A;  1DF0 A;  3EVV A;  2LVK A;  1DC1 A;  1AK8 A;  2GGZ A;  3E3R A;  5TNC A;  2VRG A;  2MJW B;  1CB1 A;  1S5G Z;  3CZT X;  3I5G B;  3BFH A;  3DVJ A;  1DEK A;  1JF0 A;  4R1E A;  2NCP A;  1KWO C;  3V2L A;  2CCM A;  1Z4H A;  4PE0 A;  4MVF A;  1JWD A;  1IIO A;  1CDP A;  2E30 A;  1GGZ A;  1SNL A;  3OGN A;  1EL4 A;  2P70 A;  3DD4 A;  1PAL A;  3D73 A;  1BLQ A;  4FTG A;  1GGW A;  3AKA A;  4GFT A;  2WCM A;  1CFF A;  1LXF C;  2BCX A;  3OB1 B;  5HLV A;  3HX4 A;  4MRX A;  2PAL A;  1OW4 A;  1YUT A;  2JT8 A;  2KI6 C;  4PHJ A;  2Y1M A;  3OHM B;  1S6J A;  3SIB A;  3TUY B;  2LLS A;  3FE8 A;  4MN0 A;  1ZOT B;  4ZCV A;  1R2U A;  4I5J A;  2AUC A;  3BOW A;  5HKZ A;  1Y1A A;  2F33 A;  1CFD A;  2KFH A;  3JTD B;  5I94 A;  3R1O A;  3O2P A;  4M2Q A;  4P5O E;  4WRI A;  1J7O A;  3A8R A;  3KHE A;  3JVT B;  1G4Y R;  3B87 A;  2LV7 A;  1F4O A;  2QPT A;  5HKW A;  1WRZ A;  2M1K B;  4YGD B;  1IH0 A;  1IJ5 A;  1QLS A;  2KAX A;  3RLZ A;  1NWD A;  1TOP A;  1SY9 A;  1AP4 A;  4YGE B;  1A75 A;  1YRU B;  4JKT A;  1XA5 A;  2P71 A;  1KSM A;  1M31 A;  1NPQ A;  1RFJ A;  1OMR A;  1RK9 A;  2LMV A;  3D78 A;  2JU0 A;  3D0Y A;  4XYN A;  3BFB A;  1SCM B;  1C7W A;  1BT6 A;  2FOT A;  2L98 A;  3SJS A;  4GAO A;  2NZ0 A;  4GNK B;  3Q8I A;  1QWV A;  1XFR A;  1AJ4 A;  2KYC A;  2JNX A;  1SK6 D;  2WC8 A;  3NHT A;  3DXL A;  3HCM A;  1CM1 A;  1PVA A;  3MSE B;  1LA0 A;  1VRK A;  4PT1 A;  3VB1 A;  4N1G A;  1RRO A;  1B7T Y;  4OZD A;  4NDC A;  3VGO A;  4C0L A;  3SG6 A;  2WOS A;  1KFX S;  2KBM A;  2JTZ A;  1Y6W A;  2LM5 A;  4GUK A;  3TDI A;  4QJ5 B;  4BY4 A;  3SG2 A;  3PM2 A;  5HYD A;  1H8B A;  2HQW A;  1CDM A;  1S3P A;  3D75 A;  3UO9 A;  4ORA B;  1GQM A;  1ALV A;  1DJY A;  1MHO A;  3NHI A;  3O4Y A;  5PAL A;  5CSF A;  2ZFD A;  2MHH A;  4JPZ B;  1TNQ A;  3CGA A;  3SS5 A;  3DZT A;  3PN7 B;  1PRW A;  5HLO A;  1K95 A;  2K60 A;  3A4U B;  1MWN A;  3BUN B;  4INX A;  2H61 C;  1OMV A;  3TS5 B;  5CPV A;  1RWY A;  2Y5I A;  4PHN A;  2LMU A;  4ICB A;  4AQI A;  2JPO A;  1CLL A;  2SCP A;  1KK7 Y;  1A4P A;  2JRF A;  1DF0 B;  3I5I B;  3CAB A;  1K9P A;  2I94 A;  4PHK A;  1KCY A;  4L9M A;  2HET A;  3CWG A;  1SYM A;  2PYQ A;  2F3Z A;  2KAY A;  1WDC B;  2WCE A;  2EGD A;  2BL0 B;  3WXA A;  1TUZ A;  4DCK A;  2KPH A;  1EJ3 A;  1TCO B;  1NCY A;  2LCP A;  3CZ1 A;  4ETO A;  1YVH A;  3KO0 A;  1XFV O;  1CMF A;  3NXA A;  3TDU A;  1A03 A;  4CID A;  4USL A;  1QV0 A;  1UUR A;  5ER5 A;  2K8M B;  1SSE B;  5FI6 A;  1DEL A;  3I5G C;  1QAT A;  1YUR A;  1B8C A;  1WRL A;  4I5L B;  1UHJ A;  1MR8 A;  4OV2 A;  5FYX A;  1XFU O;  2KI6 D;  2QDI A;  3L47 A;  1A2X A;  2KGB C;  3BOW B;  3DVE A;  1IG5 A;  2LHL A;  2KFF A;  4D1E A;  1FF1 A;  1F54 A;  1K90 D;  2H8V A;  1AHR A;  3WHT B;  3CZ0 A;  1V1G A;  4Q04 A;  4MZL A;  1KK8 B;  5HKY A;  1JFJ A;  1M63 B;  2HQ8 A;  2WC5 A;  1B47 A;  3DYE A;  5F6T A;  3SG4 A;  1QX2 A;  3R1V A;  5G08 A;  3TUY C;  1NX1 A;  4HRE E;  1ZUZ A;  4OKH A;  1YUU A;  2BCA A;  1XVJ A;  3O6B A;  4FQO A;  1JC2 A;  1TRF A;  5AEQ A;  1SBJ A;  2LLT A;  3JTD C;  4GGF A;  1A75 B;  1IWQ A;  1UHK A;  5D69 A;  1SCV A;  4NQG A;  1B9A A;  1R6P A; 
#chains in the Genus database with same CATH homology
 3JVT C;  1SMG A;  1RJV A;  3AAK A;  1ZFS A;  4WQ3 A;  2RGI A;  5K89 A;  1BU3 A;  1QVI Y;  2CT9 A;  2PRU A;  2CBL A;  2MBX A;  2L4H A;  2BE6 A;  1G8I A;  1N0Y A;  2PSR A;  3VRQ A;  2V53 A;  2BKI B;  2LNK A;  4PAL A;  1QJT A;  1DTL A;  1SCM C;  5D7F A;  1NX3 A;  2M3W A;  1NYA A;  3ZNI A;  4CPV A;  2JOJ A;  4IL1 A;  1QIW A;  2JC2 A;  2LE9 B;  1K93 D;  2L5X B;  3PSR A;  1JBA A;  4MBE A;  2NLN A;  4XJK B;  4YBH B;  2KQY A;  2EC6 C;  2AAO A;  2K61 A;  3OB2 B;  4C0J A;  1KQM B;  4I5K A;  1F55 A;  4M2P A;  3OX5 A;  1QV1 A;  1S1E A;  1SL7 A;  2KI4 B;  1XK4 A;  4PE7 A;  2JT3 A;  3I5F C;  1FI6 A;  1Y1U A;  4CLN A;  1W7J B;  3EK7 A;  2M7L A;  5KTY A;  4N5X A;  1SKT A;  4NDD A;  1QX7 A;  2L51 A;  2ZRT A;  1QTX A;  1EH2 A;  2LVJ A;  1DVI A;  1CLB A;  1JSA A;  3PN7 C;  1GJY A;  4TNC A;  1BR1 B;  1FW4 A;  2K2F A;  1KFU S;  1OMD A;  3TS5 C;  1S6I A;  5BPJ A;  3I5I C;  2L0P A;  1UHN A;  3CLN A;  2M8U A;  2WCB A;  3H4S E;  1CLM A;  1YRT B;  1MXE A;  2EC6 B;  2QAC A;  3VRR A;  5I2O A;  1WDC C;  2ZRS A;  2BL0 C;  1QLK A;  1U5I B;  1J1E A;  3OX6 A;  1SR6 B;  1OOJ A;  1AUI B;  1OQP A;  2GV5 A;  1Y1X A;  1K94 A;  2ZN9 A;  4HSZ A;  4NDB A;  1W7I B;  2M7N A;  3ZWH A;  2WOR A;  3O78 A;  2CNP A;  2LVI A;  4PCW A;  4MLW A;  2Y4Q A;  2B1U A;  3I5F B;  3DF0 A;  1DJI A;  2LAP A;  4DRW A;  2F2P A;  4YGC B;  2O60 A;  2SAS A;  2ZNE A;  2K7D A;  1YVL A;  2LMT A;  4U8D A;  3I5H B;  3C1V A;  1IRJ A;  1G33 A;  2F8P A;  2JTT A;  2MLF C;  1CFC A;  2GGM A;  1EG4 A;  2M97 A;  1SL8 A;  4OVN F;  4MEW A;  4A4B A;  1AJ5 A;  1DMO A;  3GK2 A;  2OS8 B;  3FIA A;  1KK8 C;  5AER A;  1Q80 A;  2I2R E;  4HRH A;  1PUL A;  1Y0V H;  1YTZ C;  1UHI A;  4DUQ A;  1DJG A;  2BE4 A;  4MRY A;  3DVM A;  4CFR A;  3RM1 A;  1AVS A;  3PAL A;  2BEC A;  3EVR A;  1UUS A;  3SG7 A;  2NXQ A;  2I7A A;  1OE9 B;  3SG5 A;  1PVB A;  1B8L A;  1S5G Y;  2COL B;  1UP5 A;  4DIR A;  4F0Z B;  2L4I A;  3K21 A;  2A4J A;  4GGN A;  1N65 A;  1QAS A;  1KFX L;  1NCZ A;  2M9G A;  3EVU A;  1DJX A;  2K7O A;  2I18 A;  2EHB A;  1N2D A;  2KYF A;  1QS7 A;  1B8R A;  3SG3 A;  3WHU B;  5I2L A;  2KNE A;  1S26 D;  1QXP A;  2JZI A;  1JFK A;  1XFY O;  3EK8 A;  1FBV A;  2K2A A;  2PMY A;  1IKU A;  2WCF A;  3IF7 A;  4A4C A;  1WLZ A;  2OTG B;  1CMG A;  4YGA A;  3CR5 X;  2K0J A;  1M39 A;  1UHH A;  3BYA A;  2D8N A;  5J3X A;  3AAJ A;  1K9K A;  1JF2 A;  1ZAC A;  4YGB B;  1BMO A;  1LIN A;  1YR5 A;  1SL9 A;  3CR2 A;  1DJW A;  1XFX O;  1E8A A;  1NX2 A;  1B7T Z;  2BKH B;  2JQ6 A;  1KQM C;  1CM4 A;  2LP2 A;  4PE4 A;  1YX7 A;  2ZND A;  1L2O B;  5AAN A;  2KI4 C;  2KFG A;  2BBM A;  2PVB A;  3D0Y B;  4YI9 A;  2KSP A;  1IJ6 A;  1KQV A;  3CR4 X;  4WQ2 A;  2FCE A;  1WLM A;  1NX0 A;  4BY5 A;  5KU1 A;  2Q4U A;  3BUO B;  1K96 A;  1IQ3 A;  4UPG A;  1V1F A;  1CTR A;  1H4B A;  2FCD A;  1F8H A;  1BF5 A;  1S36 A;  3KEV A;  3LK0 A;  5JJG A;  1NIW A;  1D1O A;  1BJF A;  1F4Q A;  2CTN A;  2LVV A;  2M49 B;  2M1U A;  2K7C A;  5CSN A;  1TN4 A;  1KK7 Z;  4PHM A;  2LUX A;  1OZS A;  5I2Q A;  4AQJ A;  2K7B A;  2MAZ A;  1TCF A;  2O5G A;  2OPO A;  3DF0 B;  4MZK A;  1DGU A;  5AXI A;  4P2Y B;  4ORB B;  2DOQ A;  1J1D A;  1YX8 A;  3ICB A;  3NSL A;  2LC5 A;  1HQV A;  1SR6 C;  1LVC D;  2Q91 A;  1LA3 A;  1HT9 A;  3LCP C;  1SRA A;  4QJ3 B;  3LL8 B;  1XFZ O;  2LUC A;  3PM8 A;  5GQQ C;  1MF8 B;  2P6B B;  1B4C A;  1NCX A;  2M0R A;  5I8N A;  1WY9 A;  4HRG A;  4AOM A;  1XO5 A;  4YRU A;  3I5H C;  1BOD A;  1BG1 A;  4GGF C;  1S6C A;  1REC A;  1FI5 A;  3M0W A;  1JUO A;  2OS8 C;  4GPL B;  4ZCU A;  4JWQ A;  2H61 A;  4N1F A;  1DJH A;  1A29 A;  1XFW O;  2JNF A;  3VRP A;  1DT7 B;  3EKJ A;  1M45 A;  2MA2 A;  5DKN A;  4I5N B;  3EKH A;  1LKJ A;  3TZ1 A;  1KWO B;  4ORC B;  1YUS A;  3DVK A;  1QVI Z;  2F2O A;  2ZKM X;  1RTP 1;  3FS7 A;  5CSI A;  2Y1N A;  2TN4 A;  2KQ6 A;  1CDL A;  3IQO A;  1L7Z A;  1ZMZ A;  2JXC A;  2KAV A;  4PDZ A;  2PAS A;  2JWW A;  5IBW A;  3BUW B;  2ZN8 A;  3FWB A;  2OTG C;  4YI8 A;  1PSR A;  2AMI A;  1KFU L;  1XK4 C;  3CS1 A;  1K2H A;  2BCB A;  2KGR A;  4JQ0 D;  2KDH A;  1X02 A;  2HPS A;  3FWC A;  2MLE C;  3D10 A;  2M29 A;  1OZO A;  1CFP A;  4CFQ A;  4M2O A;  1WRK A;  2KHN A;  2LAN A;  3OP0 A;  1ODB A;  4XJK A;  1CDN A;  1BOC A;  2FJU B;  4OCI A;  3BUX B;  1L2O C;  2JUL A;  1TTX A;  2BBN A;  2MRD A;  3PAT A;  1B1G A;  2R2I A;  1CNP A;  2CXJ A;  3LK1 A;  1SW8 A;  1BR4 B;  3PFV A;  4QJ4 B;  4MSP A;  2L2E A;  3F45 A;  1TNX A;  1UWO A;  4OR9 B;  1QIV A;  1M46 A;  5DKR A;  5B8I B;  3NSI A;  1DGV A;  1TIZ A;  1F71 A;  3WNX B;  2LLU A;  3AKB A;  3GK4 X;  4DS7 A;  3TDZ A;  3VRO A;  2KOT A;  2H2K A;  4MZJ A;  1NSH A;  2KBI A;  3BUM B;  1PSB A;  2HF5 A;  4PE1 A;  3NSO A;  3KF9 A;  1XYD A;  1IQ5 A;  1J55 A;  1TNW A;  3QRX A;  1K9U A;  1C07 A;  2LHI A;  3BQ3 A;  1F70 A;  1EG3 A;  3CTN A;  1QX5 B;  1KSO A;  4E68 A;  1J7R A;  3NSK A;  2JXL A;  3KPX A;  2JPT A;  1SPY A;  1ALW A;  1CKK A;  5AFP A;  1EXR A;  3LLE A;  2WND A;  1U5I A;  1C7V A;  3GOF A;  1J7P A;  1NUB A;  3PLF B;  5DKQ A;  2G9B A;  5KSZ A;  1OSA A;  1PK0 D;  3GK1 A;  2F3Y A;  1K8U A;  3EK4 A;  2NCO A;  1IGV A;  1NP8 A;  2E6W A;  3BXK A;  3IQQ A;  5JOL A;  2JT0 A;  2IS9 A;  5ER4 X;  1MUX A;  1DJZ A;  1J7Q A;  4C0K A;  2G2B A;  2LP3 A;  1MXL C;  5CSJ A;  2L50 A;  2ISD A;  3VRN A;  1FPW A;  1MQ1 A;  3SIA A;  4GBA A;  1TNP A;  1DF0 A;  3EVV A;  2LVK A;  1AK8 A;  2GGZ A;  3E3R A;  5TNC A;  2VRG A;  2MJW B;  1CB1 A;  1S5G Z;  3CZT X;  3I5G B;  3DVJ A;  4R1E A;  1JF0 A;  2NCP A;  1KWO C;  2CCM A;  4PE0 A;  1JWD A;  4MVF A;  1CDP A;  2E30 A;  1GGZ A;  1SNL A;  1EL4 A;  3DD4 A;  1PAL A;  1BLQ A;  4FTG A;  1GGW A;  3AKA A;  4GFT A;  1CFF A;  1LXF C;  2BCX A;  3OB1 B;  5HLV A;  3HX4 A;  4MRX A;  2PAL A;  1YUT A;  2JT8 A;  2KI6 C;  4PHJ A;  2Y1M A;  3OHM B;  1S6J A;  3SIB A;  3TUY B;  2LLS A;  4MN0 A;  1ZOT B;  4ZCV A;  1R2U A;  4I5J A;  2AUC A;  3BOW A;  5HKZ A;  1Y1A A;  2F33 A;  1CFD A;  2KFH A;  3JTD B;  4P5O E;  3O2P A;  4M2Q A;  4WRI A;  1J7O A;  3A8R A;  3KHE A;  3JVT B;  1G4Y R;  2LV7 A;  1F4O A;  2QPT A;  5HKW A;  1WRZ A;  2M1K B;  4YGD B;  1IH0 A;  1IJ5 A;  1QLS A;  2KAX A;  3RLZ A;  1NWD A;  1TOP A;  1SY9 A;  1AP4 A;  4YGE B;  1A75 A;  1YRU B;  1XA5 A;  1KSM A;  1M31 A;  1NPQ A;  1RFJ A;  1OMR A;  1RK9 A;  2LMV A;  2JU0 A;  3D0Y A;  4XYN A;  1SCM B;  1C7W A;  1BT6 A;  2FOT A;  2L98 A;  3SJS A;  4GAO A;  2NZ0 A;  4GNK B;  2KYC A;  1AJ4 A;  2JNX A;  1SK6 D;  2WC8 A;  3HCM A;  1CM1 A;  1PVA A;  3MSE B;  1LA0 A;  1VRK A;  4N1G A;  1RRO A;  1B7T Y;  4NDC A;  3VGO A;  4C0L A;  3SG6 A;  2WOS A;  1KFX S;  2KBM A;  2JTZ A;  1Y6W A;  2LM5 A;  4GUK A;  3TDI A;  4QJ5 B;  4BY4 A;  3SG2 A;  5HYD A;  1H8B A;  2HQW A;  1CDM A;  1S3P A;  4ORA B;  1GQM A;  1ALV A;  1DJY A;  1MHO A;  3O4Y A;  5PAL A;  5CSF A;  2ZFD A;  2MHH A;  4JPZ B;  1TNQ A;  3CGA A;  3PN7 B;  1PRW A;  5HLO A;  1K95 A;  3BUN B;  3A4U B;  1MWN A;  2H61 C;  1OMV A;  3TS5 B;  5CPV A;  1RWY A;  2Y5I A;  4PHN A;  2LMU A;  4ICB A;  4AQI A;  1CLL A;  2SCP A;  1KK7 Y;  1A4P A;  2JRF A;  1DF0 B;  3I5I B;  1K9P A;  2I94 A;  4PHK A;  1KCY A;  4L9M A;  2HET A;  3CWG A;  1SYM A;  2F3Z A;  2KAY A;  1WDC B;  2WCE A;  2EGD A;  2BL0 B;  3WXA A;  4DCK A;  4ETO A;  1EJ3 A;  1TCO B;  1NCY A;  2LCP A;  1YVH A;  3KO0 A;  1XFV O;  1CMF A;  3NXA A;  3TDU A;  1A03 A;  4CID A;  4USL A;  1QV0 A;  1UUR A;  5ER5 A;  2K8M B;  3I5G C;  1QAT A;  1YUR A;  1B8C A;  1WRL A;  4I5L B;  1UHJ A;  1MR8 A;  4OV2 A;  5FYX A;  1XFU O;  2KI6 D;  1A2X A;  2KGB C;  3BOW B;  3DVE A;  1IG5 A;  2LHL A;  2KFF A;  4D1E A;  1FF1 A;  1F54 A;  1K90 D;  1AHR A;  3WHT B;  1V1G A;  4Q04 A;  4MZL A;  1KK8 B;  5HKY A;  1JFJ A;  1M63 B;  2HQ8 A;  1B47 A;  5F6T A;  3SG4 A;  1QX2 A;  5G08 A;  3TUY C;  1NX1 A;  4HRE E;  1ZUZ A;  4OKH A;  1YUU A;  2BCA A;  1XVJ A;  3O6B A;  4FQO A;  1JC2 A;  1TRF A;  5AEQ A;  1SBJ A;  2LLT A;  3JTD C;  4GGF A;  1A75 B;  1IWQ A;  1UHK A;  5D69 A;  1SCV A;  4NQG A;  1B9A A;  1R6P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...