3H4SE

Structure of the complex of a mitotic kinesin with its calcium binding regulator
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
107
structure length
96
Chain Sequence
ETKYDVEEFVSELCKGFSLLADPERHLITAESLRRNSGILGIEGMSKEDAQGMVREGDLDGDGALNQTEFCVLMVRLSPEMMEDAETWLEKALTQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kinesin-like calmodulin-binding protein
publication title Structure of the complex of a mitotic kinesin with its calcium binding regulator.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Motor protein/calcium binding protein
total genus 30
structure length 96
sequence length 107
ec nomenclature
pdb deposition date 2009-04-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3h4sE00
5GQQC 1DGVA 2HETA 1CMGA 3O6BA 2MJWB 1WRZA 5I8NA 1CDMA 1JUOA 1TNQA 2ZN9A 2JT3A 3D10A 4ICBA 1IKUA 3I5GB 1BR4B 1ZOTB 1QX5B 3PN7B 1QS7A 1TN4A 2CNPA 2EC6C 2LLTA 1K90D 3GK4X 2KGRA 1OZOA 4PE1A 1F8HA 1LKJA 2D8NA 3OP0A 1WY9A 3LCPC 4JWQA 2M0RA 1XA5A 1JC2A 3DVMA 3DF0A 3SIAA 3KO0A 1NCXA 5JJGA 2NCPA 3JVTB 4JQ0D 5ER5A 1FI5A 3KPXA 1YRUB 1S6JA 4U8DA 4M2OA 3TDZA 4IL1A 5CSNA 3OX6A 5AERA 2JRFA 1IQ3A 4PHMA 1ODBA 2JT0A 4MSPA 5G08A 1YX7A 2K7OA 1DJZA 3D0YB 1MR8A 3EVUA 1BF5A 1MF8B 2LVJA 1SRAA 1KK7Y 5I2QA 4PHKA 1K2HA 2L0PA 4MZJA 1SL9A 1XFZO 4YRUA 1NCYA 2CTNA 2KOTA 1QIWA 3I5FC 2GGMA 1SKTA 2LVIA 2NCOA 3IF7A 4DCKA 1NWDA 1Y1XA 3OX5A 3A8RA 2KI4C 1PRWA 2VRGA 1NX0A 1KQMC 2ZRSA 4BY5A 2I2RE 2PALA 1NYAA 1AJ5A 1XFUO 2ZN8A 4MRYA 1N0YA 1RTP1 2KI6D 2OS8C 3NXAA 1NSHA 1F55A 1KQMB 2M29A 1NPQA 3GK1A 4YGEB 1IQ5A 1QJTA 4CPVA 1MWNA 2Y1NA 2E30A 4USLA 1CM4A 2H2KA 1EG3A 2O5GA 1XFVO 3BOWA 3VRPA 3BUWB 2F3ZA 1WRLA 1N65A 2LMTA 1RFJA 1SCVA 3CR2A 4R1EA 3WNXB 1B1GA 3I5HB 1XFXO 2EHBA 1KSOA 2M3WA 2JNFA 1UHIA 4PHJA 4AQIA 1CKKA 3TUYB 3LK1A 4HREE 1S1EA 1QV0A 1TCOB 4P2YB 2DOQA 2HF5A 5PALA 1UUSA 1EG4A 1MUXA 3DVKA 1SCMB 1SBJA 4GBAA 2MA2A 1QLKA 3OB2B 2BKIB 4I5LB 1R6PA 3DD4A 2JPTA 3GK2A 1BR1B 5HKYA 1M39A 1A03A 1UHNA 3FWCA 1QVIY 2L2EA 1SL7A 3SG7A 1NX3A 2M1KB 1K96A 5CSJA 1CFPA 1KWOC 2ZNEA 1OE9B 4ORCB 2LUCA 2KAVA 4CIDA 1KFXL 2HPSA 5BPJA 4CLNA 1N2DA 3RLZA 1M46A 3EK8A 3VROA 2F33A 1KWOB 1UP5A 3KHEA 4A4CA 4PE7A 1LA0A 1IJ5A 2SCPA 3AAKA 2PASA 2BECA 2JZIA 4HRHA 4L9MA 5AXIA 2Y5IA 1J7RA 1GJYA 4MVFA 1YUUA 1YURA 1EL4A 3ZWHA 2KDHA 1DTLA 1WLMA 1LVCD 3I5GC 2PSRA 1XFWO 2BE6A 3BXKA 2K2AA 1B7TZ 1BU3A 5IBWA 3PN7C 1BOCA 4GAOA 1UURA 3FIAA 4A4BA 1JFKA 1DF0A 3EK4A 3EKJA 4M2PA 1S5GZ 1B47A 1YX8A 1OMDA 1OOJA 4I5JA 1M31A 1FF1A 4QJ5B 4GUKA 1DJIA 1MHOA 2JXCA 5FYXA 1KQVA 5DKRA 2Q4UA 1KFUL 1QXPA 2WCFA 3ZNIA 4HRGA 3BUNB 1C7VA 2LAPA 1XK4C 3JVTC 4PHNA 1CTRA 1K9PA 3RM1A 2FCDA 4MZKA 3PSRA 1A4PA 3JTDB 2JOJA 1CLBA 5HLOA 1DJGA 1B8CA 1DJYA 2CXJA 1XYDA 2F8PA 2JU0A 4NQGA 1FW4A 1GGWA 1K8UA 2OTGB 4GGFC 3EVRA 2Q91A 5HKZA 1BMOA 1RJVA 1MQ1A 3CS1A 3FWBA 4N1GA 1Y1UA 2MBXA 1TNXA 4PALA 2LM5A 2BCXA 2K7BA 4NDCA 1SW8A 2WORA 4OVNF 1FPWA 1JF2A 2M97A 3KF9A 1JSAA 1DJWA 4ETOA 1RECA 1S6IA 1NX2A 3I5IB 2M49B 2L5XB 2ZRTA 3WHTB 5I2OA 1AK8A 1L7ZA 1QLSA 1F4OA 3BUXB 3SG6A 1U5IB 1VRKA 3O4YA 3M0WA 1HQVA 1PSBA 1YVLA 1W7IB 4XJKB 1F54A 2LLUA 1A75A 4NDDA 1Y1AA 3LLEA 2M8UA 2NZ0A 1S26D 1ZACA 4JPZB 1CLMA 2PVBA 5HLVA 4GFTA 3BUMB 1NP8A 1TRFA 2KSPA 4PDZA 1IJ6A 5DKNA 1GQMA 4ORAB 5KTYA 2KQYA 1YRTB 1KSMA 1OMVA 1UHKA 3CR5X 1AJ4A 3I5HC 2I18A 2SASA 3IQOA 4E68A 2A4JA 3EK7A 1LA3A 1A2XA 1B8LA 3CLNA 4MN0A 3TDIA 1NCZA 2AMIA 3DVJA 1Q80A 2CT9A 3TUYC 1SMGA 2GGZA 4M2QA 3VRRA 2BKHB 1S3PA 2KBMA 2M9GA 2R2IA 3HCMA 1WDCB 1IH0A 3CWGA 2BBMA 2HQWA 1JFJA 4FTGA 1B7TY 1WRKA 2IS9A 1AP4A 1SCMC 2JWWA 2WCEA 4YGBB 2F2OA 1SNLA 4QJ3B 1QASA 2ZKMX 2WCBA 1G8IA 2L4IA 1CB1A 2K7DA 5TNCA 2WNDA 2M7LA 1XK4A 2RGIA 1B8RA 1X02A 1KFXS 1SR6B 2CCMA 2K7CA 3TZ1A 2KFGA 2B1UA 3DF0B 1SPYA 1JWDA 1S6CA 1XO5A 2LP2A 5KSZA 1K9KA 3H4SE 1KK7Z 4GGFA 4MLWA 4AOMA 1M63B 2LMUA 3D0YA 2L4HA 1D1OA 1Y6WA 4D1EA 1TOPA 2AUCA 3EVVA 1WLZA 2KFFA 3GOFA 4ORBB 4YGCB 3PM8A 2LHIA 3LK0A 2M7NA 1YTZC 3E3RA 4OV2A 3TDUA 1JBAA 1DGUA 3HX4A 2KBIA 2FCEA 4DIRA 2LE9B 2LUXA 2KAXA 1AHRA 1PULA 3CZTX 4YGAA 1BG1A 1K94A 2QACA 1V1GA 1DVIA 4MEWA 5DKQA 2FOTA 2MLFC 2K2FA 4MZLA 1NUBA 1FI6A 1KFUS 2V53A 1UHJA 2COLB 2PMYA 1K93D 1ZMZA 3O78A 5D69A 1ALWA 1L2OB 2KQ6A 1YUSA 4WRIA 3CGAA 4CFQA 3O2PA 2LCPA 1CDLA 1RWYA 1DMOA 2LANA 1JF0A 4WQ2A 1IG5A 1OZSA 1E8AA 5D7FA 4AQJA 1CFCA 1CMFA 1CFFA 3JTDC 2K61A 3BQ3A 3KEVA 4UPGA 4N1FA 2G2BA 1IWQA 2BL0B 4C0LA 4PE0A 2OPOA 2MLEC 1DJHA 2K0JA 2OTGC 4CFRA 2MRDA 1CNPA 3PFVA 1BT6A 3VGOA 4OKHA 1FBVA 3BOWB 1H4BA 1J55A 1SL8A 2WOSA 4PE4A 2LP3A 1RK9A 4FQOA 1LINA 1TTXA 1CM1A 1SK6D 2G9BA 2ZFDA 4PCWA 1G4YR 1QIVA 4C0JA 3AAJA 1UHHA 1R2UA 4OR9B 1PK0D 5AEQA 1CDPA 2JTTA 1CDNA 3PLFB 3SG3A 2TN4A 3OB1B 2E6WA 4C0KA 1PALA 3OHMB 2WC8A 2PRUA 3I5IC 1UWOA 5F6TA 5AFPA 1B9AA 1J1EA 1QV1A 1TCFA 1QTXA 4YBHB 3PALA 5JOLA 1QVIZ 4DUQA 1J7PA 3BUOB 1F70A 1BODA 4MRXA 5I2LA 1F71A 2EC6B 5CPVA 2KYCA 5AANA 2BBNA 2NLNA 1ZFSA 2GV5A 2H61C 2ZNDA 1AVSA 4GPLB 2LLSA 5HYDA 3VRNA 2BCAA 3PATA 4NDBA 1EH2A 5KU1A 2K8MB 1YR5A 4YGDB 4Q04A 5ER4X 1PSRA 2KGBC 5J3XA 3SG5A 1DJXA 3SG4A 1J7QA 1SYMA 2KAYA 2BE4A 3SG2A 1PVAA 2JNXA 2KHNA 2NXQA 4MBEA 3WXAA 3BYAA 1XVJA 4ZCUA 1IGVA 2ISDA 2LMVA 1OQPA 1WDCC 3I5FB 1DT7B 2LC5A 4DRWA 1B4CA 2I94A 3NSLA 2LVVA 2KI4B 1YUTA 1NX1A 2LVKA 1A29A 5CSIA 1SY9A 1K95A 2F2PA 1GGZA 1DF0B 4XYNA 3A4UB 4QJ4B 2L98A 3TS5C 1CFDA 1Y0VH 2OS8B 4BY4A 4YI9A 3EKHA 1MXEA 3MSEB 3NSIA 1SR6C 1S5GY 2BCBA 3AKAA 2MHHA 3TS5B 1RROA 2EGDA 3CR4X 3AKBA 4I5KA 4P5OE 3DVEA 3FS7A 4HSZA 1TIZA 1H8BA 2L50A 3SJSA 1TNWA 1M45A 2JC2A 1QX7A 3IQQA 3K21A 2LNKA 2JT8A 4WQ3A 1F4QA 1YVHA 2JQ6A 1V1FA 1ALVA 1EXRA 3LL8B 3QRXA 2QPTA 2L51A 1ZUZA 1BLQA 2KI6C 2CBLA 1MXLC 2I7AA 4YI8A 2KFHA 1QX2A 4OCIA 4DS7A 3VRQA 2KNEA 3SIBA 1U5IA 1XFYO 1W7JB 3CTNA 1NIWA 2M1UA 1C07A 2MAZA 4XJKA 3ICBA 1OSAA 4F0ZB 2H61A 4GNKB 1L2OC 3F45A 1KCYA 3NSOA 2F3YA 5K89A 1LXFC 2HQ8A 1KK8C 2AAOA 1J1DA 1CLLA 2P6BB 2Y1MA 2KYFA 1G33A 2JTZA 2O60A 4N5XA 2FJUB 1A75B 1J7OA 5HKWA 3NSKA 1EJ3A 1KK8B 2LV7A 3C1VA 2BL0C 1HT9A 2JULA 5CSFA 1TNPA 4ZCVA 1C7WA 2JXLA 4TNCA 1AUIB 2Y4QA 4GGNA 1K9UA 1OMRA 1PVBA 4I5NB 1IRJA 2LHLA 3WHUB 5B8IB 1S36A 1QATA 1BJFA
chains in the Genus database with same CATH superfamily
5GQQC 1DGVA 2HETA 1CMGA 3O6BA 3CABA 2MJWB 1WRZA 5I8NA 1CDMA 1JUOA 1TNQA 2ZN9A 2JT3A 3D10A 4ICBA 1IKUA 3I5GB 4INXA 1BR4B 1ZOTB 1QX5B 3PN7B 1QS7A 1TN4A 2CNPA 1W9ZA 2EC6C 2LLTA 1ORGA 3FE6A 1K90D 3GK4X 2KGRA 1OZOA 4PE1A 1F8HA 1LKJA 1TWOA 2D8NA 1WY9A 3OP0A 3LCPC 4JWQA 2M0RA 1XA5A 2PYQA 3DVMA 3DF0A 3SIAA 1JC2A 2QDIA 3KO0A 1NCXA 2QEBA 3L4AA 5JJGA 2NCPA 3JVTB 3NGVA 4JQ0D 5ER5A 3S0DA 1FI5A 3KPXA 1YRUB 1S6JA 4U8DA 4M2OA 3TDZA 3DXLA 4IL1A 1OOIX 5CSNA 3OX6A 5AERA 2JRFA 1IQ3A 3S0FA 4PHMA 1ODBA 2JT0A 4MSPA 5G08A 1YX7A 2K7OA 1DJZA 1OOFA 1DELA 3D0YB 1MR8A 3EVUA 1C3YA 1BF5A 1MF8B 2LVJA 1SRAA 1KK7Y 5I2QA 4PHKA 1K2HA 2L0PA 4FQTA 4MZJA 5D3OA 1SL9A 1XFZO 4YRUA 1NCYA 2CTNA 2KOTA 1QIWA 3B6XA 2GGMA 1SKTA 2LVIA 2NCOA 3I5FC 3IF7A 1NWDA 4OZDA 4DCKA 1Y1XA 3OX5A 3A8RA 2KI4C 3DZTA 1PRWA 2KPHA 2VRGA 1NX0A 1KQMC 2ZRSA 4BY5A 2I2RE 2PALA 1NYAA 1AJ5A 1XFUO 2ZN8A 4MRYA 1N0YA 2WCJA 1RTP1 2KI6D 2OS8C 3B86A 1NSHA 3NXAA 1F55A 1KQMB 2M29A 3D73A 1NPQA 3GK1A 4YGEB 1IQ5A 1QJTA 4CPVA 1MWNA 2Y1NA 1GM0A 1TUZA 2E30A 4USLA 1CM4A 2H2KA 1EG3A 2O5GA 1XFVO 3BOWA 3VRPA 2L5YA 3BUWB 2F3ZA 1WRLA 1N65A 2LMTA 1RFJA 1SCVA 3CR2A 4R1EA 3WNXB 1B1GA 3I5HB 1XFXO 2EHBA 3SS4A 1KSOA 2M3WA 2JNFA 1UHIA 4PHJA 4AQIA 3SS3A 1CKKA 3TUYB 3LK1A 4HREE 1S1EA 1QV0A 1TCOB 4P2YB 4INWA 2DOQA 2HF5A 5PALA 1UUSA 1EG4A 1MUXA 4JKTA 3DVKA 1SCMB 1SBJA 4GBAA 3R1VA 2MA2A 1OOGA 1QLKA 2BKIB 3OB2B 4I5LB 1R6PA 3DD4A 2JPTA 3GK2A 5EL2A 1BR1B 5HKYA 1M39A 3L4LA 1A03A 1UHNA 3D78A 1QVIY 3FWCA 2L2EA 1SL7A 3SG7A 1NX3A 3B7AA 2M1KB 1K96A 5CSJA 1Z2CB 1CFPA 1KWOC 2ZNEA 1OE9B 4ORCB 2LUCA 2KAVA 4CIDA 1KFXL 2HPSA 3OGNA 5BPJA 4CLNA 1N2DA 3RLZA 1M46A 3EK8A 3VROA 2F33A 1KWOB 1UP5A 3KHEA 4A4CA 4PE7A 1LA0A 1IJ5A 3IVTA 2SCPA 5HL1A 2YGUA 3AAKA 2PASA 1P28A 2BECA 2JZIA 4HRHA 4L9MA 5AXIA 2Y5IA 1J7RA 1GJYA 4MVFA 1YUUA 3FE9A 1YURA 1EL4A 3ZWHA 2H8VA 2KDHA 3BJHA 1DTLA 1WLMA 1LVCD 3I5GC 2PSRA 3PJIA 3S0GA 1XFWO 2BE6A 3BXKA 2K2AA 1B7TZ 1BU3A 5IBWA 3DYEA 3PN7C 1BOCA 4GAOA 1UURA 3FIAA 4A4BA 1JFKA 1DF0A 3EK4A 3EKJA 4M2PA 1S5GZ 1B47A 1YX8A 1OMDA 1OOJA 4I5JA 3VB1A 1M31A 1FF1A 4QJ5B 4GUKA 1DJIA 1MHOA 2JXCA 5FYXA 2GTEA 5DKRA 2Q4UA 1KFUL 1J7PA 1KQVA 1QXPA 5FI7A 2WCFA 3ZNIA 4HRGA 3BUNB 1C7VA 2LAPA 1XK4C 3JVTC 4PHNA 1CTRA 1K9PA 3D74A 3RM1A 2FCDA 4MZKA 3PSRA 3NHTA 1A4PA 3JTDB 2JOJA 1CLBA 3OBVA 5HLOA 4F7FA 1DJGA 1B8CA 1DJYA 2CXJA 1XYDA 2KLEA 2F8PA 2JU0A 4NQGA 1FW4A 1GGWA 1K8UA 2OTGB 4GGFC 3EVRA 5DICA 2Q91A 5HKZA 1BMOA 1RJVA 1MQ1A 2BNXA 3CS1A 3FWBA 4N1GA 1Y1UA 2MBXA 1TNXA 4PALA 2LM5A 2BCXA 2K7BA 4NDCA 1SW8A 2WORA 4OVNF 1FPWA 1JF2A 3N7HA 2M97A 3KF9A 1JSAA 1DJWA 4ETOA 1RECA 3EG5B 5FI6A 1S6IA 1NX2A 3I5IB 2M49B 2L5XB 3CDNA 2ZRTA 3WHTB 5I2OA 1AK8A 1L7ZA 1QLSA 1F4OA 3BUXB 3CZ0A 3SG6A 1U5IB 1VRKA 3O4YA 3M0WA 1HQVA 1PSBA 1YVLA 1W7IB 4XJKB 1F54A 2LLUA 1A75A 4NDDA 1Y1AA 3LLEA 2M8UA 2NZ0A 1S26D 1ZACA 4JPZB 1CLMA 2PVBA 5HLVA 4GFTA 3BUMB 1NP8A 1TRFA 2KSPA 1IIOA 4PDZA 1IJ6A 2QEHA 5DKNA 1GQMA 3D75A 4ORAB 5KTYA 3BFBA 2KQYA 1YRTB 1KSMA 1OMVA 1UHKA 3CR5X 1AJ4A 3I5HC 2I18A 2SASA 3NHIA 3IQOA 4E68A 2A4JA 3EK7A 1LA3A 1A2XA 1B8LA 3CLNA 4MN0A 3TDIA 1NCZA 2AMIA 2PQLA 3DVJA 1Q80A 2CT9A 3TUYC 1SMGA 2GGZA 2WC5A 4M2QA 3VRRA 2BKHB 1S3PA 2KBMA 2M9GA 1OW4A 2R2IA 3HCMA 1WDCB 1IH0A 3B88A 3CWGA 2BBMA 2HQWA 1JFJA 4FTGA 1B7TY 1WRKA 2WCHA 2IS9A 1Z4HA 1SCMC 2JWWA 1AP4A 2WCEA 1QWVA 4YGBB 2F2OA 1SNLA 4QJ3B 1QASA 2ZKMX 2WCBA 1G8IA 2L4IA 3L47A 2K7DA 5TNCA 2WNDA 2M7LA 1CB1A 1XK4A 2RGIA 3V2LA 1B8RA 1X02A 2ERBA 1KFXS 1SR6B 2CCMA 2K7CA 3TZ1A 2KFGA 2B1UA 3DF0B 1SPYA 1JWDA 1S6CA 3CZ2A 1XO5A 2LP2A 5KSZA 5I94A 1K9KA 3H4SE 1KK7Z 4GGFA 4MLWA 4AOMA 1M63B 2LMUA 3D0YA 2L4HA 1D1OA 2BAPA 1Y6WA 4D1EA 1TOPA 2AUCA 3EVVA 1WLZA 2KFFA 3GOFA 2L2CA 4ORBB 4YGCB 3PM8A 2LHIA 3LK0A 2M7NA 1YTZC 3E3RA 4OV2A 3TDUA 1F70A 1JBAA 1DGUA 3HX4A 2KBIA 2FCEA 4DIRA 2LE9B 2LUXA 2KAXA 1AHRA 1PULA 3CZTX 4YGAA 1BG1A 1K94A 2QACA 1V1GA 1DVIA 4MEWA 5DKQA 2FOTA 2MLFC 2K2FA 4MZLA 1NUBA 1FI6A 1KFUS 2V53A 1UHJA 2COLB 2PMYA 1K93D 1ZMZA 3O78A 5D69A 1ALWA 1L2OB 3PM2A 2KQ6A 1YUSA 4WRIA 3CGAA 4CFQA 2JPOA 3O2PA 2LCPA 1CDLA 1RWYA 1DMOA 2LANA 1JF0A 4WQ2A 1IG5A 1OZSA 1E8AA 5D7FA 4AQJA 1CFCA 1CMFA 1CFFA 3CYZA 2K61A 3BQ3A 3JTDC 3KEVA 4UPGA 4N1FA 2G2BA 1IWQA 2BL0B 4C0LA 2QEVA 4PE0A 2OPOA 2MLEC 1DJHA 2K0JA 2OTGC 4CFRA 2MRDA 1CNPA 3PFVA 1BT6A 3VGOA 4OKHA 1FBVA 3BOWB 1H4BA 1J55A 1SL8A 2WOSA 3B87A 4PE4A 2LP3A 1RK9A 4FQOA 1LINA 1TTXA 1CM1A 1SK6D 2G9BA 2ZFDA 4PCWA 1G4YR 1QIVA 4C0JA 3AAJA 1UHHA 1R2UA 4OR9B 1PK0D 5AEQA 1CDPA 2JTTA 1CDNA 3PLFB 3SG3A 2TN4A 3BFHA 3OB1B 1XFRA 2E6WA 4C0KA 1PALA 3OHMB 2WC8A 2PRUA 3I5IC 1UWOA 5F6TA 5FI2A 5AFPA 1B9AA 1C3ZA 1J1EA 1QV1A 1TCFA 1QTXA 4JD9A 3PALA 4YBHB 1QVIZ 5JOLA 4DUQA 3BUOB 2KLDA 1BODA 4MRXA 5I2LA 3S0AA 1F71A 2EC6B 5CPVA 1OOHA 2KYCA 2WCLA 5AANA 2BBNA 2NLNA 1ZFSA 2GV5A 2H61C 2ZNDA 1AVSA 4GPLB 2LLSA 5HYDA 3VRNA 3O4XA 1SSEB 2BCAA 3PATA 4NDBA 1EH2A 3Q8IA 5KU1A 2K8MB 3UNWA 1YR5A 4YGDB 1LS8A 4Q04A 5ER4X 1PSRA 2KGBC 3S0EA 5J3XA 3SG5A 1DJXA 3SG4A 1J7QA 1SYMA 2KAYA 2BE4A 3SG2A 1PVAA 2JNXA 2KHNA 2NXQA 4MBEA 3WXAA 3BYAA 3R1OA 2WCMA 1XVJA 4ZCUA 1IGVA 2ISDA 3DY9A 2LMVA 1OQPA 1WDCC 3I5FB 1DT7B 1DQEA 2LC5A 4DRWA 1B4CA 2I94A 3NSLA 2K60A 2LVVA 4PT1A 2KI4B 1YUTA 1NX1A 1DC1A 2LVKA 1A29A 5CSIA 1SY9A 1K95A 2F2PA 1GGZA 1DF0B 4XYNA 3A4UB 4QJ4B 2L98A 3TS5C 1CFDA 1Y0VH 2OS8B 4BY4A 4YI9A 3EKHA 1MXEA 3MSEB 3NSIA 1SR6C 1S5GY 2BCBA 3AKAA 2MHHA 4IJ7A 3TS5B 1RROA 2EGDA 3CR4X 3AKBA 4I5KA 4P5OE 3DVEA 3FS7A 4HSZA 1TIZA 3CZ1A 1H8BA 2L50A 3SJSA 1TNWA 1M45A 2JC2A 1QX7A 3IQQA 3K21A 2LNKA 2JT8A 4WQ3A 1F4QA 1YVHA 2JQ6A 1DEKA 1ALVA 1EXRA 1V1FA 3LL8B 3R72A 3BFAA 3QRXA 2QPTA 2L51A 1ZUZA 3RZSA 1BLQA 2KI6C 2CBLA 1MXLC 1TUJA 2I7AA 4YI8A 3D77A 2KFHA 1QX2A 4OCIA 4DS7A 1T14A 3S0BA 3VRQA 2KNEA 2WCKA 3R1PA 3SIBA 1U5IA 1XFYO 1W7JB 3CTNA 1NIWA 2M1UA 1C07A 2MAZA 2WC6A 4XJKA 2FJYA 3ICBA 1OSAA 4F0ZB 2H61A 4GNKB 1L2OC 3F45A 1KCYA 3NSOA 2F3YA 2P70A 1LXFC 2HQ8A 5K89A 3FE8A 1KK8C 2AAOA 1J1DA 4KYNA 1CLLA 2P6BB 2Y1MA 2KYFA 1G33A 2P71A 2JTZA 2O60A 4N5XA 2FJUB 1A75B 1J7OA 5HKWA 3NSKA 1EJ3A 1KK8B 2LV7A 3C1VA 2BL0C 3UO9A 1HT9A 2JULA 5CSFA 1TNPA 3K1EA 1C7WA 2JXLA 4TNCA 4ZCVA 1AUIB 2Y4QA 4GGNA 1K9UA 1OMRA 1PVBA 2QEOA 3D76A 1IRJA 3QMEA 4I5NB 2LHLA 3WHUB 5B8IB 1S36A 3SS5A 1QATA 1BJFA
chains in the Genus database with same CATH topology
5GQQC 1DGVA 2HETA 1CMGA 3O6BA 2MJWB 1WRZA 5I8NA 1CDMA 1JUOA 1TNQA 2ZN9A 2JT3A 3D10A 4ICBA 1IKUA 3I5GB 1BR4B 1ZOTB 1QX5B 3PN7B 1QS7A 1TN4A 2CNPA 2EC6C 2LLTA 1K90D 3GK4X 2KGRA 1OZOA 4PE1A 1F8HA 1LKJA 2D8NA 3OP0A 1WY9A 3LCPC 4JWQA 2M0RA 1XA5A 1JC2A 3DVMA 3DF0A 3SIAA 3KO0A 1NCXA 5JJGA 2NCPA 3JVTB 4JQ0D 5ER5A 1FI5A 3KPXA 1YRUB 1S6JA 4U8DA 4M2OA 3TDZA 4IL1A 5CSNA 3OX6A 5AERA 2JRFA 1IQ3A 4PHMA 1ODBA 2JT0A 4MSPA 5G08A 1YX7A 2K7OA 1DJZA 3D0YB 1MR8A 3EVUA 1BF5A 1MF8B 2LVJA 1SRAA 1KK7Y 5I2QA 4PHKA 1K2HA 2L0PA 4MZJA 1SL9A 1XFZO 4YRUA 1NCYA 2CTNA 2KOTA 1QIWA 3I5FC 2GGMA 1SKTA 2LVIA 2NCOA 3IF7A 4DCKA 1NWDA 1Y1XA 3OX5A 3A8RA 2KI4C 1PRWA 2VRGA 1NX0A 1KQMC 2ZRSA 4BY5A 2I2RE 2PALA 1NYAA 1AJ5A 1XFUO 2ZN8A 4MRYA 1N0YA 1RTP1 2KI6D 2OS8C 3NXAA 1NSHA 1F55A 1KQMB 2M29A 1NPQA 3GK1A 4YGEB 1IQ5A 1QJTA 4CPVA 1MWNA 2Y1NA 2E30A 4USLA 1CM4A 2H2KA 1EG3A 2O5GA 1XFVO 3BOWA 3VRPA 3BUWB 2F3ZA 1WRLA 1N65A 2LMTA 1RFJA 1SCVA 3CR2A 4R1EA 3WNXB 1B1GA 3I5HB 1XFXO 2EHBA 1KSOA 2M3WA 2JNFA 1UHIA 4PHJA 4AQIA 1CKKA 3TUYB 3LK1A 4HREE 1S1EA 1QV0A 1TCOB 4P2YB 2DOQA 2HF5A 5PALA 1UUSA 1EG4A 1MUXA 3DVKA 1SCMB 1SBJA 4GBAA 2MA2A 1QLKA 3OB2B 2BKIB 4I5LB 1R6PA 3DD4A 2JPTA 3GK2A 1BR1B 5HKYA 1M39A 1A03A 1UHNA 3FWCA 1QVIY 2L2EA 1SL7A 3SG7A 1NX3A 2M1KB 1K96A 5CSJA 1CFPA 1KWOC 2ZNEA 1OE9B 4ORCB 2LUCA 2KAVA 4CIDA 1KFXL 2HPSA 5BPJA 4CLNA 1N2DA 3RLZA 1M46A 3EK8A 3VROA 2F33A 1KWOB 1UP5A 3KHEA 4A4CA 4PE7A 1LA0A 1IJ5A 2SCPA 3AAKA 2PASA 2BECA 2JZIA 4HRHA 4L9MA 5AXIA 2Y5IA 1J7RA 1GJYA 4MVFA 1YUUA 1YURA 1EL4A 3ZWHA 2KDHA 1DTLA 1WLMA 1LVCD 3I5GC 2PSRA 1XFWO 2BE6A 3BXKA 2K2AA 1B7TZ 1BU3A 5IBWA 3PN7C 1BOCA 4GAOA 1UURA 3FIAA 4A4BA 1JFKA 1DF0A 3EK4A 3EKJA 4M2PA 1S5GZ 1B47A 1YX8A 1OMDA 1OOJA 4I5JA 1M31A 1FF1A 4QJ5B 4GUKA 1DJIA 1MHOA 2JXCA 5FYXA 1KQVA 5DKRA 2Q4UA 1KFUL 1QXPA 2WCFA 3ZNIA 4HRGA 3BUNB 1C7VA 2LAPA 1XK4C 3JVTC 4PHNA 1CTRA 1K9PA 3RM1A 2FCDA 4MZKA 3PSRA 1A4PA 3JTDB 2JOJA 1CLBA 5HLOA 1DJGA 1B8CA 1DJYA 2CXJA 1XYDA 2F8PA 2JU0A 4NQGA 1FW4A 1GGWA 1K8UA 2OTGB 4GGFC 3EVRA 2Q91A 5HKZA 1BMOA 1RJVA 1MQ1A 3CS1A 3FWBA 4N1GA 1Y1UA 2MBXA 1TNXA 4PALA 2LM5A 2BCXA 2K7BA 4NDCA 1SW8A 2WORA 4OVNF 1FPWA 1JF2A 2M97A 3KF9A 1JSAA 1DJWA 4ETOA 1RECA 1S6IA 1NX2A 3I5IB 2M49B 2L5XB 2ZRTA 3WHTB 5I2OA 1AK8A 1L7ZA 1QLSA 1F4OA 3BUXB 3SG6A 1U5IB 1VRKA 3O4YA 3M0WA 1HQVA 1PSBA 1YVLA 1W7IB 4XJKB 1F54A 2LLUA 1A75A 4NDDA 1Y1AA 3LLEA 2M8UA 2NZ0A 1S26D 1ZACA 4JPZB 1CLMA 2PVBA 5HLVA 4GFTA 3BUMB 1NP8A 1TRFA 2KSPA 4PDZA 1IJ6A 5DKNA 1GQMA 4ORAB 5KTYA 2KQYA 1YRTB 1KSMA 1OMVA 1UHKA 3CR5X 1AJ4A 3I5HC 2I18A 2SASA 3IQOA 4E68A 2A4JA 3EK7A 1LA3A 1A2XA 1B8LA 3CLNA 4MN0A 3TDIA 1NCZA 2AMIA 3DVJA 1Q80A 2CT9A 3TUYC 1SMGA 2GGZA 4M2QA 3VRRA 2BKHB 1S3PA 2KBMA 2M9GA 2R2IA 3HCMA 1WDCB 1IH0A 3CWGA 2BBMA 2HQWA 1JFJA 4FTGA 1B7TY 1WRKA 2IS9A 1AP4A 1SCMC 2JWWA 2WCEA 4YGBB 2F2OA 1SNLA 4QJ3B 1QASA 2ZKMX 2WCBA 1G8IA 2L4IA 1CB1A 2K7DA 5TNCA 2WNDA 2M7LA 1XK4A 2RGIA 1B8RA 1X02A 1KFXS 1SR6B 2CCMA 2K7CA 3TZ1A 2KFGA 2B1UA 3DF0B 1SPYA 1JWDA 1S6CA 1XO5A 2LP2A 5KSZA 1K9KA 3H4SE 1KK7Z 4GGFA 4MLWA 4AOMA 1M63B 2LMUA 3D0YA 2L4HA 1D1OA 1Y6WA 4D1EA 1TOPA 2AUCA 3EVVA 1WLZA 2KFFA 3GOFA 4ORBB 4YGCB 3PM8A 2LHIA 3LK0A 2M7NA 1YTZC 3E3RA 4OV2A 3TDUA 1JBAA 1DGUA 3HX4A 2KBIA 2FCEA 4DIRA 2LE9B 2LUXA 2KAXA 1AHRA 1PULA 3CZTX 4YGAA 1BG1A 1K94A 2QACA 1V1GA 1DVIA 4MEWA 5DKQA 2FOTA 2MLFC 2K2FA 4MZLA 1NUBA 1FI6A 1KFUS 2V53A 1UHJA 2COLB 2PMYA 1K93D 1ZMZA 3O78A 5D69A 1ALWA 1L2OB 2KQ6A 1YUSA 4WRIA 3CGAA 4CFQA 3O2PA 2LCPA 1CDLA 1RWYA 1DMOA 2LANA 1JF0A 4WQ2A 1IG5A 1OZSA 1E8AA 5D7FA 4AQJA 1CFCA 1CMFA 1CFFA 3JTDC 2K61A 3BQ3A 3KEVA 4UPGA 4N1FA 2G2BA 1IWQA 2BL0B 4C0LA 4PE0A 2OPOA 2MLEC 1DJHA 2K0JA 2OTGC 4CFRA 2MRDA 1CNPA 3PFVA 1BT6A 3VGOA 4OKHA 1FBVA 3BOWB 1H4BA 1J55A 1SL8A 2WOSA 4PE4A 2LP3A 1RK9A 4FQOA 1LINA 1TTXA 1CM1A 1SK6D 2G9BA 2ZFDA 4PCWA 1G4YR 1QIVA 4C0JA 3AAJA 1UHHA 1R2UA 4OR9B 1PK0D 5AEQA 1CDPA 2JTTA 1CDNA 3PLFB 3SG3A 2TN4A 3OB1B 2E6WA 4C0KA 1PALA 3OHMB 2WC8A 2PRUA 3I5IC 1UWOA 5F6TA 5AFPA 1B9AA 1J1EA 1QV1A 1TCFA 1QTXA 4YBHB 3PALA 5JOLA 1QVIZ 4DUQA 1J7PA 3BUOB 1F70A 1BODA 4MRXA 5I2LA 1F71A 2EC6B 5CPVA 2KYCA 5AANA 2BBNA 2NLNA 1ZFSA 2GV5A 2H61C 2ZNDA 1AVSA 4GPLB 2LLSA 5HYDA 3VRNA 2BCAA 3PATA 4NDBA 1EH2A 5KU1A 2K8MB 1YR5A 4YGDB 4Q04A 5ER4X 1PSRA 2KGBC 5J3XA 3SG5A 1DJXA 3SG4A 1J7QA 1SYMA 2KAYA 2BE4A 3SG2A 1PVAA 2JNXA 2KHNA 2NXQA 4MBEA 3WXAA 3BYAA 1XVJA 4ZCUA 1IGVA 2ISDA 2LMVA 1OQPA 1WDCC 3I5FB 1DT7B 2LC5A 4DRWA 1B4CA 2I94A 3NSLA 2LVVA 2KI4B 1YUTA 1NX1A 2LVKA 1A29A 5CSIA 1SY9A 1K95A 2F2PA 1GGZA 1DF0B 4XYNA 3A4UB 4QJ4B 2L98A 3TS5C 1CFDA 1Y0VH 2OS8B 4BY4A 4YI9A 3EKHA 1MXEA 3MSEB 3NSIA 1SR6C 1S5GY 2BCBA 3AKAA 2MHHA 3TS5B 1RROA 2EGDA 3CR4X 3AKBA 4I5KA 4P5OE 3DVEA 3FS7A 4HSZA 1TIZA 1H8BA 2L50A 3SJSA 1TNWA 1M45A 2JC2A 1QX7A 3IQQA 3K21A 2LNKA 2JT8A 4WQ3A 1F4QA 1YVHA 2JQ6A 1V1FA 1ALVA 1EXRA 3LL8B 3QRXA 2QPTA 2L51A 1ZUZA 1BLQA 2KI6C 2CBLA 1MXLC 2I7AA 4YI8A 2KFHA 1QX2A 4OCIA 4DS7A 3VRQA 2KNEA 3SIBA 1U5IA 1XFYO 1W7JB 3CTNA 1NIWA 2M1UA 1C07A 2MAZA 4XJKA 3ICBA 1OSAA 4F0ZB 2H61A 4GNKB 1L2OC 3F45A 1KCYA 3NSOA 2F3YA 5K89A 1LXFC 2HQ8A 1KK8C 2AAOA 1J1DA 1CLLA 2P6BB 2Y1MA 2KYFA 1G33A 2JTZA 2O60A 4N5XA 2FJUB 1A75B 1J7OA 5HKWA 3NSKA 1EJ3A 1KK8B 2LV7A 3C1VA 2BL0C 1HT9A 2JULA 5CSFA 1TNPA 4ZCVA 1C7WA 2JXLA 4TNCA 1AUIB 2Y4QA 4GGNA 1K9UA 1OMRA 1PVBA 4I5NB 1IRJA 2LHLA 3WHUB 5B8IB 1S36A 1QATA 1BJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GQQ C;  1DGV A;  2HET A;  1CMG A;  3O6B A;  2MJW B;  1WRZ A;  5I8N A;  1CDM A;  1JUO A;  1TNQ A;  2ZN9 A;  2JT3 A;  3D10 A;  4ICB A;  1IKU A;  3I5G B;  1BR4 B;  1ZOT B;  1QX5 B;  3PN7 B;  1QS7 A;  1TN4 A;  2CNP A;  2EC6 C;  2LLT A;  1K90 D;  3GK4 X;  2KGR A;  1OZO A;  4PE1 A;  1F8H A;  1LKJ A;  2D8N A;  3OP0 A;  1WY9 A;  3LCP C;  4JWQ A;  2M0R A;  1XA5 A;  1JC2 A;  3DVM A;  3DF0 A;  3SIA A;  3KO0 A;  1NCX A;  5JJG A;  2NCP A;  3JVT B;  4JQ0 D;  5ER5 A;  1FI5 A;  3KPX A;  1YRU B;  1S6J A;  4U8D A;  4M2O A;  3TDZ A;  4IL1 A;  5CSN A;  3OX6 A;  5AER A;  2JRF A;  1IQ3 A;  4PHM A;  1ODB A;  2JT0 A;  4MSP A;  5G08 A;  1YX7 A;  2K7O A;  1DJZ A;  3D0Y B;  1MR8 A;  3EVU A;  1BF5 A;  1MF8 B;  2LVJ A;  1SRA A;  1KK7 Y;  5I2Q A;  4PHK A;  1K2H A;  2L0P A;  4MZJ A;  1SL9 A;  1XFZ O;  4YRU A;  1NCY A;  2CTN A;  2KOT A;  1QIW A;  3I5F C;  2GGM A;  1SKT A;  2LVI A;  2NCO A;  3IF7 A;  4DCK A;  1NWD A;  1Y1X A;  3OX5 A;  3A8R A;  2KI4 C;  1PRW A;  2VRG A;  1NX0 A;  1KQM C;  2ZRS A;  4BY5 A;  2I2R E;  2PAL A;  1NYA A;  1AJ5 A;  1XFU O;  2ZN8 A;  4MRY A;  1N0Y A;  1RTP 1;  2KI6 D;  2OS8 C;  3NXA A;  1NSH A;  1F55 A;  1KQM B;  2M29 A;  1NPQ A;  3GK1 A;  4YGE B;  1IQ5 A;  1QJT A;  4CPV A;  1MWN A;  2Y1N A;  2E30 A;  4USL A;  1CM4 A;  2H2K A;  1EG3 A;  2O5G A;  1XFV O;  3BOW A;  3VRP A;  3BUW B;  2F3Z A;  1WRL A;  1N65 A;  2LMT A;  1RFJ A;  1SCV A;  3CR2 A;  4R1E A;  3WNX B;  1B1G A;  3I5H B;  1XFX O;  2EHB A;  1KSO A;  2M3W A;  2JNF A;  1UHI A;  4PHJ A;  4AQI A;  1CKK A;  3TUY B;  3LK1 A;  4HRE E;  1S1E A;  1QV0 A;  1TCO B;  4P2Y B;  2DOQ A;  2HF5 A;  5PAL A;  1UUS A;  1EG4 A;  1MUX A;  3DVK A;  1SCM B;  1SBJ A;  4GBA A;  2MA2 A;  1QLK A;  3OB2 B;  2BKI B;  4I5L B;  1R6P A;  3DD4 A;  2JPT A;  3GK2 A;  1BR1 B;  5HKY A;  1M39 A;  1A03 A;  1UHN A;  3FWC A;  1QVI Y;  2L2E A;  1SL7 A;  3SG7 A;  1NX3 A;  2M1K B;  1K96 A;  5CSJ A;  1CFP A;  1KWO C;  2ZNE A;  1OE9 B;  4ORC B;  2LUC A;  2KAV A;  4CID A;  1KFX L;  2HPS A;  5BPJ A;  4CLN A;  1N2D A;  3RLZ A;  1M46 A;  3EK8 A;  3VRO A;  2F33 A;  1KWO B;  1UP5 A;  3KHE A;  4A4C A;  4PE7 A;  1LA0 A;  1IJ5 A;  2SCP A;  3AAK A;  2PAS A;  2BEC A;  2JZI A;  4HRH A;  4L9M A;  5AXI A;  2Y5I A;  1J7R A;  1GJY A;  4MVF A;  1YUU A;  1YUR A;  1EL4 A;  3ZWH A;  2KDH A;  1DTL A;  1WLM A;  1LVC D;  3I5G C;  2PSR A;  1XFW O;  2BE6 A;  3BXK A;  2K2A A;  1B7T Z;  1BU3 A;  5IBW A;  3PN7 C;  1BOC A;  4GAO A;  1UUR A;  3FIA A;  4A4B A;  1JFK A;  1DF0 A;  3EK4 A;  3EKJ A;  4M2P A;  1S5G Z;  1B47 A;  1YX8 A;  1OMD A;  1OOJ A;  4I5J A;  1M31 A;  1FF1 A;  4QJ5 B;  4GUK A;  1DJI A;  1MHO A;  2JXC A;  5FYX A;  1KQV A;  5DKR A;  2Q4U A;  1KFU L;  1QXP A;  2WCF A;  3ZNI A;  4HRG A;  3BUN B;  1C7V A;  2LAP A;  1XK4 C;  3JVT C;  4PHN A;  1CTR A;  1K9P A;  3RM1 A;  2FCD A;  4MZK A;  3PSR A;  1A4P A;  3JTD B;  2JOJ A;  1CLB A;  5HLO A;  1DJG A;  1B8C A;  1DJY A;  2CXJ A;  1XYD A;  2F8P A;  2JU0 A;  4NQG A;  1FW4 A;  1GGW A;  1K8U A;  2OTG B;  4GGF C;  3EVR A;  2Q91 A;  5HKZ A;  1BMO A;  1RJV A;  1MQ1 A;  3CS1 A;  3FWB A;  4N1G A;  1Y1U A;  2MBX A;  1TNX A;  4PAL A;  2LM5 A;  2BCX A;  2K7B A;  4NDC A;  1SW8 A;  2WOR A;  4OVN F;  1FPW A;  1JF2 A;  2M97 A;  3KF9 A;  1JSA A;  1DJW A;  4ETO A;  1REC A;  1S6I A;  1NX2 A;  3I5I B;  2M49 B;  2L5X B;  2ZRT A;  3WHT B;  5I2O A;  1AK8 A;  1L7Z A;  1QLS A;  1F4O A;  3BUX B;  3SG6 A;  1U5I B;  1VRK A;  3O4Y A;  3M0W A;  1HQV A;  1PSB A;  1YVL A;  1W7I B;  4XJK B;  1F54 A;  2LLU A;  1A75 A;  4NDD A;  1Y1A A;  3LLE A;  2M8U A;  2NZ0 A;  1S26 D;  1ZAC A;  4JPZ B;  1CLM A;  2PVB A;  5HLV A;  4GFT A;  3BUM B;  1NP8 A;  1TRF A;  2KSP A;  4PDZ A;  1IJ6 A;  5DKN A;  1GQM A;  4ORA B;  5KTY A;  2KQY A;  1YRT B;  1KSM A;  1OMV A;  1UHK A;  3CR5 X;  1AJ4 A;  3I5H C;  2I18 A;  2SAS A;  3IQO A;  4E68 A;  2A4J A;  3EK7 A;  1LA3 A;  1A2X A;  1B8L A;  3CLN A;  4MN0 A;  3TDI A;  1NCZ A;  2AMI A;  3DVJ A;  1Q80 A;  2CT9 A;  3TUY C;  1SMG A;  2GGZ A;  4M2Q A;  3VRR A;  2BKH B;  1S3P A;  2KBM A;  2M9G A;  2R2I A;  3HCM A;  1WDC B;  1IH0 A;  3CWG A;  2BBM A;  2HQW A;  1JFJ A;  4FTG A;  1B7T Y;  1WRK A;  2IS9 A;  1AP4 A;  1SCM C;  2JWW A;  2WCE A;  4YGB B;  2F2O A;  1SNL A;  4QJ3 B;  1QAS A;  2ZKM X;  2WCB A;  1G8I A;  2L4I A;  1CB1 A;  2K7D A;  5TNC A;  2WND A;  2M7L A;  1XK4 A;  2RGI A;  1B8R A;  1X02 A;  1KFX S;  1SR6 B;  2CCM A;  2K7C A;  3TZ1 A;  2KFG A;  2B1U A;  3DF0 B;  1SPY A;  1JWD A;  1S6C A;  1XO5 A;  2LP2 A;  5KSZ A;  1K9K A;  3H4S E;  1KK7 Z;  4GGF A;  4MLW A;  4AOM A;  1M63 B;  2LMU A;  3D0Y A;  2L4H A;  1D1O A;  1Y6W A;  4D1E A;  1TOP A;  2AUC A;  3EVV A;  1WLZ A;  2KFF A;  3GOF A;  4ORB B;  4YGC B;  3PM8 A;  2LHI A;  3LK0 A;  2M7N A;  1YTZ C;  3E3R A;  4OV2 A;  3TDU A;  1JBA A;  1DGU A;  3HX4 A;  2KBI A;  2FCE A;  4DIR A;  2LE9 B;  2LUX A;  2KAX A;  1AHR A;  1PUL A;  3CZT X;  4YGA A;  1BG1 A;  1K94 A;  2QAC A;  1V1G A;  1DVI A;  4MEW A;  5DKQ A;  2FOT A;  2MLF C;  2K2F A;  4MZL A;  1NUB A;  1FI6 A;  1KFU S;  2V53 A;  1UHJ A;  2COL B;  2PMY A;  1K93 D;  1ZMZ A;  3O78 A;  5D69 A;  1ALW A;  1L2O B;  2KQ6 A;  1YUS A;  4WRI A;  3CGA A;  4CFQ A;  3O2P A;  2LCP A;  1CDL A;  1RWY A;  1DMO A;  2LAN A;  1JF0 A;  4WQ2 A;  1IG5 A;  1OZS A;  1E8A A;  5D7F A;  4AQJ A;  1CFC A;  1CMF A;  1CFF A;  3JTD C;  2K61 A;  3BQ3 A;  3KEV A;  4UPG A;  4N1F A;  2G2B A;  1IWQ A;  2BL0 B;  4C0L A;  4PE0 A;  2OPO A;  2MLE C;  1DJH A;  2K0J A;  2OTG C;  4CFR A;  2MRD A;  1CNP A;  3PFV A;  1BT6 A;  3VGO A;  4OKH A;  1FBV A;  3BOW B;  1H4B A;  1J55 A;  1SL8 A;  2WOS A;  4PE4 A;  2LP3 A;  1RK9 A;  4FQO A;  1LIN A;  1TTX A;  1CM1 A;  1SK6 D;  2G9B A;  2ZFD A;  4PCW A;  1G4Y R;  1QIV A;  4C0J A;  3AAJ A;  1UHH A;  1R2U A;  4OR9 B;  1PK0 D;  5AEQ A;  1CDP A;  2JTT A;  1CDN A;  3PLF B;  3SG3 A;  2TN4 A;  3OB1 B;  2E6W A;  4C0K A;  1PAL A;  3OHM B;  2WC8 A;  2PRU A;  3I5I C;  1UWO A;  5F6T A;  5AFP A;  1B9A A;  1J1E A;  1QV1 A;  1TCF A;  1QTX A;  4YBH B;  3PAL A;  5JOL A;  1QVI Z;  4DUQ A;  1J7P A;  3BUO B;  1F70 A;  1BOD A;  4MRX A;  5I2L A;  1F71 A;  2EC6 B;  5CPV A;  2KYC A;  5AAN A;  2BBN A;  2NLN A;  1ZFS A;  2GV5 A;  2H61 C;  2ZND A;  1AVS A;  4GPL B;  2LLS A;  5HYD A;  3VRN A;  2BCA A;  3PAT A;  4NDB A;  1EH2 A;  5KU1 A;  2K8M B;  1YR5 A;  4YGD B;  4Q04 A;  5ER4 X;  1PSR A;  2KGB C;  5J3X A;  3SG5 A;  1DJX A;  3SG4 A;  1J7Q A;  1SYM A;  2KAY A;  2BE4 A;  3SG2 A;  1PVA A;  2JNX A;  2KHN A;  2NXQ A;  4MBE A;  3WXA A;  3BYA A;  1XVJ A;  4ZCU A;  1IGV A;  2ISD A;  2LMV A;  1OQP A;  1WDC C;  3I5F B;  1DT7 B;  2LC5 A;  4DRW A;  1B4C A;  2I94 A;  3NSL A;  2LVV A;  2KI4 B;  1YUT A;  1NX1 A;  2LVK A;  1A29 A;  5CSI A;  1SY9 A;  1K95 A;  2F2P A;  1GGZ A;  1DF0 B;  4XYN A;  3A4U B;  4QJ4 B;  2L98 A;  3TS5 C;  1CFD A;  1Y0V H;  2OS8 B;  4BY4 A;  4YI9 A;  3EKH A;  1MXE A;  3MSE B;  3NSI A;  1SR6 C;  1S5G Y;  2BCB A;  3AKA A;  2MHH A;  3TS5 B;  1RRO A;  2EGD A;  3CR4 X;  3AKB A;  4I5K A;  4P5O E;  3DVE A;  3FS7 A;  4HSZ A;  1TIZ A;  1H8B A;  2L50 A;  3SJS A;  1TNW A;  1M45 A;  2JC2 A;  1QX7 A;  3IQQ A;  3K21 A;  2LNK A;  2JT8 A;  4WQ3 A;  1F4Q A;  1YVH A;  2JQ6 A;  1V1F A;  1ALV A;  1EXR A;  3LL8 B;  3QRX A;  2QPT A;  2L51 A;  1ZUZ A;  1BLQ A;  2KI6 C;  2CBL A;  1MXL C;  2I7A A;  4YI8 A;  2KFH A;  1QX2 A;  4OCI A;  4DS7 A;  3VRQ A;  2KNE A;  3SIB A;  1U5I A;  1XFY O;  1W7J B;  3CTN A;  1NIW A;  2M1U A;  1C07 A;  2MAZ A;  4XJK A;  3ICB A;  1OSA A;  4F0Z B;  2H61 A;  4GNK B;  1L2O C;  3F45 A;  1KCY A;  3NSO A;  2F3Y A;  5K89 A;  1LXF C;  2HQ8 A;  1KK8 C;  2AAO A;  1J1D A;  1CLL A;  2P6B B;  2Y1M A;  2KYF A;  1G33 A;  2JTZ A;  2O60 A;  4N5X A;  2FJU B;  1A75 B;  1J7O A;  5HKW A;  3NSK A;  1EJ3 A;  1KK8 B;  2LV7 A;  3C1V A;  2BL0 C;  1HT9 A;  2JUL A;  5CSF A;  1TNP A;  4ZCV A;  1C7W A;  2JXL A;  4TNC A;  1AUI B;  2Y4Q A;  4GGN A;  1K9U A;  1OMR A;  1PVB A;  4I5N B;  1IRJ A;  2LHL A;  3WHU B;  5B8I B;  1S36 A;  1QAT A;  1BJF A; 
#chains in the Genus database with same CATH topology
 5GQQ C;  1DGV A;  2HET A;  1CMG A;  3O6B A;  3CAB A;  2MJW B;  1WRZ A;  5I8N A;  1CDM A;  1JUO A;  1TNQ A;  2ZN9 A;  2JT3 A;  3D10 A;  4ICB A;  1IKU A;  3I5G B;  4INX A;  1BR4 B;  1ZOT B;  1QX5 B;  3PN7 B;  1QS7 A;  1TN4 A;  2CNP A;  1W9Z A;  2EC6 C;  2LLT A;  1ORG A;  3FE6 A;  1K90 D;  3GK4 X;  2KGR A;  1OZO A;  4PE1 A;  1F8H A;  1LKJ A;  1TWO A;  2D8N A;  1WY9 A;  3OP0 A;  3LCP C;  4JWQ A;  2M0R A;  1XA5 A;  2PYQ A;  3DVM A;  3DF0 A;  3SIA A;  1JC2 A;  2QDI A;  3KO0 A;  1NCX A;  2QEB A;  3L4A A;  5JJG A;  2NCP A;  3JVT B;  3NGV A;  4JQ0 D;  5ER5 A;  3S0D A;  1FI5 A;  3KPX A;  1YRU B;  1S6J A;  4U8D A;  4M2O A;  3TDZ A;  3DXL A;  4IL1 A;  1OOI X;  5CSN A;  3OX6 A;  5AER A;  2JRF A;  1IQ3 A;  3S0F A;  4PHM A;  1ODB A;  2JT0 A;  4MSP A;  5G08 A;  1YX7 A;  2K7O A;  1DJZ A;  1OOF A;  1DEL A;  3D0Y B;  1MR8 A;  3EVU A;  1C3Y A;  1BF5 A;  1MF8 B;  2LVJ A;  1SRA A;  1KK7 Y;  5I2Q A;  4PHK A;  1K2H A;  2L0P A;  4FQT A;  4MZJ A;  5D3O A;  1SL9 A;  1XFZ O;  4YRU A;  1NCY A;  2CTN A;  2KOT A;  1QIW A;  3B6X A;  2GGM A;  1SKT A;  2LVI A;  2NCO A;  3I5F C;  3IF7 A;  1NWD A;  4OZD A;  4DCK A;  1Y1X A;  3OX5 A;  3A8R A;  2KI4 C;  3DZT A;  1PRW A;  2KPH A;  2VRG A;  1NX0 A;  1KQM C;  2ZRS A;  4BY5 A;  2I2R E;  2PAL A;  1NYA A;  1AJ5 A;  1XFU O;  2ZN8 A;  4MRY A;  1N0Y A;  2WCJ A;  1RTP 1;  2KI6 D;  2OS8 C;  3B86 A;  1NSH A;  3NXA A;  1F55 A;  1KQM B;  2M29 A;  3D73 A;  1NPQ A;  3GK1 A;  4YGE B;  1IQ5 A;  1QJT A;  4CPV A;  1MWN A;  2Y1N A;  1GM0 A;  1TUZ A;  2E30 A;  4USL A;  1CM4 A;  2H2K A;  1EG3 A;  2O5G A;  1XFV O;  3BOW A;  3VRP A;  2L5Y A;  3BUW B;  2F3Z A;  1WRL A;  1N65 A;  2LMT A;  1RFJ A;  1SCV A;  3CR2 A;  4R1E A;  3WNX B;  1B1G A;  3I5H B;  1XFX O;  2EHB A;  3SS4 A;  1KSO A;  2M3W A;  2JNF A;  1UHI A;  4PHJ A;  4AQI A;  3SS3 A;  1CKK A;  3TUY B;  3LK1 A;  4HRE E;  1S1E A;  1QV0 A;  1TCO B;  4P2Y B;  4INW A;  2DOQ A;  2HF5 A;  5PAL A;  1UUS A;  1EG4 A;  1MUX A;  4JKT A;  3DVK A;  1SCM B;  1SBJ A;  4GBA A;  3R1V A;  2MA2 A;  1OOG A;  1QLK A;  2BKI B;  3OB2 B;  4I5L B;  1R6P A;  3DD4 A;  2JPT A;  3GK2 A;  5EL2 A;  1BR1 B;  5HKY A;  1M39 A;  3L4L A;  1A03 A;  1UHN A;  3D78 A;  1QVI Y;  3FWC A;  2L2E A;  1SL7 A;  3SG7 A;  1NX3 A;  3B7A A;  2M1K B;  1K96 A;  5CSJ A;  1Z2C B;  1CFP A;  1KWO C;  2ZNE A;  1OE9 B;  4ORC B;  2LUC A;  2KAV A;  4CID A;  1KFX L;  2HPS A;  3OGN A;  5BPJ A;  4CLN A;  1N2D A;  3RLZ A;  1M46 A;  3EK8 A;  3VRO A;  2F33 A;  1KWO B;  1UP5 A;  3KHE A;  4A4C A;  4PE7 A;  1LA0 A;  1IJ5 A;  3IVT A;  2SCP A;  5HL1 A;  2YGU A;  3AAK A;  2PAS A;  1P28 A;  2BEC A;  2JZI A;  4HRH A;  4L9M A;  5AXI A;  2Y5I A;  1J7R A;  1GJY A;  4MVF A;  1YUU A;  3FE9 A;  1YUR A;  1EL4 A;  3ZWH A;  2H8V A;  2KDH A;  3BJH A;  1DTL A;  1WLM A;  1LVC D;  3I5G C;  2PSR A;  3PJI A;  3S0G A;  1XFW O;  2BE6 A;  3BXK A;  2K2A A;  1B7T Z;  1BU3 A;  5IBW A;  3DYE A;  3PN7 C;  1BOC A;  4GAO A;  1UUR A;  3FIA A;  4A4B A;  1JFK A;  1DF0 A;  3EK4 A;  3EKJ A;  4M2P A;  1S5G Z;  1B47 A;  1YX8 A;  1OMD A;  1OOJ A;  4I5J A;  3VB1 A;  1M31 A;  1FF1 A;  4QJ5 B;  4GUK A;  1DJI A;  1MHO A;  2JXC A;  5FYX A;  2GTE A;  5DKR A;  2Q4U A;  1KFU L;  1J7P A;  1KQV A;  1QXP A;  5FI7 A;  2WCF A;  3ZNI A;  4HRG A;  3BUN B;  1C7V A;  2LAP A;  1XK4 C;  3JVT C;  4PHN A;  1CTR A;  1K9P A;  3D74 A;  3RM1 A;  2FCD A;  4MZK A;  3PSR A;  3NHT A;  1A4P A;  3JTD B;  2JOJ A;  1CLB A;  3OBV A;  5HLO A;  4F7F A;  1DJG A;  1B8C A;  1DJY A;  2CXJ A;  1XYD A;  2KLE A;  2F8P A;  2JU0 A;  4NQG A;  1FW4 A;  1GGW A;  1K8U A;  2OTG B;  4GGF C;  3EVR A;  5DIC A;  2Q91 A;  5HKZ A;  1BMO A;  1RJV A;  1MQ1 A;  2BNX A;  3CS1 A;  3FWB A;  4N1G A;  1Y1U A;  2MBX A;  1TNX A;  4PAL A;  2LM5 A;  2BCX A;  2K7B A;  4NDC A;  1SW8 A;  2WOR A;  4OVN F;  1FPW A;  1JF2 A;  3N7H A;  2M97 A;  3KF9 A;  1JSA A;  1DJW A;  4ETO A;  1REC A;  3EG5 B;  5FI6 A;  1S6I A;  1NX2 A;  3I5I B;  2M49 B;  2L5X B;  3CDN A;  2ZRT A;  3WHT B;  5I2O A;  1AK8 A;  1L7Z A;  1QLS A;  1F4O A;  3BUX B;  3CZ0 A;  3SG6 A;  1U5I B;  1VRK A;  3O4Y A;  3M0W A;  1HQV A;  1PSB A;  1YVL A;  1W7I B;  4XJK B;  1F54 A;  2LLU A;  1A75 A;  4NDD A;  1Y1A A;  3LLE A;  2M8U A;  2NZ0 A;  1S26 D;  1ZAC A;  4JPZ B;  1CLM A;  2PVB A;  5HLV A;  4GFT A;  3BUM B;  1NP8 A;  1TRF A;  2KSP A;  1IIO A;  4PDZ A;  1IJ6 A;  2QEH A;  5DKN A;  1GQM A;  3D75 A;  4ORA B;  5KTY A;  3BFB A;  2KQY A;  1YRT B;  1KSM A;  1OMV A;  1UHK A;  3CR5 X;  1AJ4 A;  3I5H C;  2I18 A;  2SAS A;  3NHI A;  3IQO A;  4E68 A;  2A4J A;  3EK7 A;  1LA3 A;  1A2X A;  1B8L A;  3CLN A;  4MN0 A;  3TDI A;  1NCZ A;  2AMI A;  2PQL A;  3DVJ A;  1Q80 A;  2CT9 A;  3TUY C;  1SMG A;  2GGZ A;  2WC5 A;  4M2Q A;  3VRR A;  2BKH B;  1S3P A;  2KBM A;  2M9G A;  1OW4 A;  2R2I A;  3HCM A;  1WDC B;  1IH0 A;  3B88 A;  3CWG A;  2BBM A;  2HQW A;  1JFJ A;  4FTG A;  1B7T Y;  1WRK A;  2WCH A;  2IS9 A;  1Z4H A;  1SCM C;  2JWW A;  1AP4 A;  2WCE A;  1QWV A;  4YGB B;  2F2O A;  1SNL A;  4QJ3 B;  1QAS A;  2ZKM X;  2WCB A;  1G8I A;  2L4I A;  3L47 A;  2K7D A;  5TNC A;  2WND A;  2M7L A;  1CB1 A;  1XK4 A;  2RGI A;  3V2L A;  1B8R A;  1X02 A;  2ERB A;  1KFX S;  1SR6 B;  2CCM A;  2K7C A;  3TZ1 A;  2KFG A;  2B1U A;  3DF0 B;  1SPY A;  1JWD A;  1S6C A;  3CZ2 A;  1XO5 A;  2LP2 A;  5KSZ A;  5I94 A;  1K9K A;  3H4S E;  1KK7 Z;  4GGF A;  4MLW A;  4AOM A;  1M63 B;  2LMU A;  3D0Y A;  2L4H A;  1D1O A;  2BAP A;  1Y6W A;  4D1E A;  1TOP A;  2AUC A;  3EVV A;  1WLZ A;  2KFF A;  3GOF A;  2L2C A;  4ORB B;  4YGC B;  3PM8 A;  2LHI A;  3LK0 A;  2M7N A;  1YTZ C;  3E3R A;  4OV2 A;  3TDU A;  1F70 A;  1JBA A;  1DGU A;  3HX4 A;  2KBI A;  2FCE A;  4DIR A;  2LE9 B;  2LUX A;  2KAX A;  1AHR A;  1PUL A;  3CZT X;  4YGA A;  1BG1 A;  1K94 A;  2QAC A;  1V1G A;  1DVI A;  4MEW A;  5DKQ A;  2FOT A;  2MLF C;  2K2F A;  4MZL A;  1NUB A;  1FI6 A;  1KFU S;  2V53 A;  1UHJ A;  2COL B;  2PMY A;  1K93 D;  1ZMZ A;  3O78 A;  5D69 A;  1ALW A;  1L2O B;  3PM2 A;  2KQ6 A;  1YUS A;  4WRI A;  3CGA A;  4CFQ A;  2JPO A;  3O2P A;  2LCP A;  1CDL A;  1RWY A;  1DMO A;  2LAN A;  1JF0 A;  4WQ2 A;  1IG5 A;  1OZS A;  1E8A A;  5D7F A;  4AQJ A;  1CFC A;  1CMF A;  1CFF A;  3CYZ A;  2K61 A;  3BQ3 A;  3JTD C;  3KEV A;  4UPG A;  4N1F A;  2G2B A;  1IWQ A;  2BL0 B;  4C0L A;  2QEV A;  4PE0 A;  2OPO A;  2MLE C;  1DJH A;  2K0J A;  2OTG C;  4CFR A;  2MRD A;  1CNP A;  3PFV A;  1BT6 A;  3VGO A;  4OKH A;  1FBV A;  3BOW B;  1H4B A;  1J55 A;  1SL8 A;  2WOS A;  3B87 A;  4PE4 A;  2LP3 A;  1RK9 A;  4FQO A;  1LIN A;  1TTX A;  1CM1 A;  1SK6 D;  2G9B A;  2ZFD A;  4PCW A;  1G4Y R;  1QIV A;  4C0J A;  3AAJ A;  1UHH A;  1R2U A;  4OR9 B;  1PK0 D;  5AEQ A;  1CDP A;  2JTT A;  1CDN A;  3PLF B;  3SG3 A;  2TN4 A;  3BFH A;  3OB1 B;  1XFR A;  2E6W A;  4C0K A;  1PAL A;  3OHM B;  2WC8 A;  2PRU A;  3I5I C;  1UWO A;  5F6T A;  5FI2 A;  5AFP A;  1B9A A;  1C3Z A;  1J1E A;  1QV1 A;  1TCF A;  1QTX A;  4JD9 A;  3PAL A;  4YBH B;  1QVI Z;  5JOL A;  4DUQ A;  3BUO B;  2KLD A;  1BOD A;  4MRX A;  5I2L A;  3S0A A;  1F71 A;  2EC6 B;  5CPV A;  1OOH A;  2KYC A;  2WCL A;  5AAN A;  2BBN A;  2NLN A;  1ZFS A;  2GV5 A;  2H61 C;  2ZND A;  1AVS A;  4GPL B;  2LLS A;  5HYD A;  3VRN A;  3O4X A;  1SSE B;  2BCA A;  3PAT A;  4NDB A;  1EH2 A;  3Q8I A;  5KU1 A;  2K8M B;  3UNW A;  1YR5 A;  4YGD B;  1LS8 A;  4Q04 A;  5ER4 X;  1PSR A;  2KGB C;  3S0E A;  5J3X A;  3SG5 A;  1DJX A;  3SG4 A;  1J7Q A;  1SYM A;  2KAY A;  2BE4 A;  3SG2 A;  1PVA A;  2JNX A;  2KHN A;  2NXQ A;  4MBE A;  3WXA A;  3BYA A;  3R1O A;  2WCM A;  1XVJ A;  4ZCU A;  1IGV A;  2ISD A;  3DY9 A;  2LMV A;  1OQP A;  1WDC C;  3I5F B;  1DT7 B;  1DQE A;  2LC5 A;  4DRW A;  1B4C A;  2I94 A;  3NSL A;  2K60 A;  2LVV A;  4PT1 A;  2KI4 B;  1YUT A;  1NX1 A;  1DC1 A;  2LVK A;  1A29 A;  5CSI A;  1SY9 A;  1K95 A;  2F2P A;  1GGZ A;  1DF0 B;  4XYN A;  3A4U B;  4QJ4 B;  2L98 A;  3TS5 C;  1CFD A;  1Y0V H;  2OS8 B;  4BY4 A;  4YI9 A;  3EKH A;  1MXE A;  3MSE B;  3NSI A;  1SR6 C;  1S5G Y;  2BCB A;  3AKA A;  2MHH A;  4IJ7 A;  3TS5 B;  1RRO A;  2EGD A;  3CR4 X;  3AKB A;  4I5K A;  4P5O E;  3DVE A;  3FS7 A;  4HSZ A;  1TIZ A;  3CZ1 A;  1H8B A;  2L50 A;  3SJS A;  1TNW A;  1M45 A;  2JC2 A;  1QX7 A;  3IQQ A;  3K21 A;  2LNK A;  2JT8 A;  4WQ3 A;  1F4Q A;  1YVH A;  2JQ6 A;  1DEK A;  1ALV A;  1EXR A;  1V1F A;  3LL8 B;  3R72 A;  3BFA A;  3QRX A;  2QPT A;  2L51 A;  1ZUZ A;  3RZS A;  1BLQ A;  2KI6 C;  2CBL A;  1MXL C;  1TUJ A;  2I7A A;  4YI8 A;  3D77 A;  2KFH A;  1QX2 A;  4OCI A;  4DS7 A;  1T14 A;  3S0B A;  3VRQ A;  2KNE A;  2WCK A;  3R1P A;  3SIB A;  1U5I A;  1XFY O;  1W7J B;  3CTN A;  1NIW A;  2M1U A;  1C07 A;  2MAZ A;  2WC6 A;  4XJK A;  2FJY A;  3ICB A;  1OSA A;  4F0Z B;  2H61 A;  4GNK B;  1L2O C;  3F45 A;  1KCY A;  3NSO A;  2F3Y A;  2P70 A;  1LXF C;  2HQ8 A;  5K89 A;  3FE8 A;  1KK8 C;  2AAO A;  1J1D A;  4KYN A;  1CLL A;  2P6B B;  2Y1M A;  2KYF A;  1G33 A;  2P71 A;  2JTZ A;  2O60 A;  4N5X A;  2FJU B;  1A75 B;  1J7O A;  5HKW A;  3NSK A;  1EJ3 A;  1KK8 B;  2LV7 A;  3C1V A;  2BL0 C;  3UO9 A;  1HT9 A;  2JUL A;  5CSF A;  1TNP A;  3K1E A;  1C7W A;  2JXL A;  4TNC A;  4ZCV A;  1AUI B;  2Y4Q A;  4GGN A;  1K9U A;  1OMR A;  1PVB A;  2QEO A;  3D76 A;  1IRJ A;  3QME A;  4I5N B;  2LHL A;  3WHU B;  5B8I B;  1S36 A;  3SS5 A;  1QAT A;  1BJF A; 
#chains in the Genus database with same CATH homology
 5GQQ C;  1DGV A;  2HET A;  1CMG A;  3O6B A;  2MJW B;  1WRZ A;  5I8N A;  1CDM A;  1JUO A;  1TNQ A;  2ZN9 A;  2JT3 A;  3D10 A;  4ICB A;  1IKU A;  3I5G B;  1BR4 B;  1ZOT B;  1QX5 B;  3PN7 B;  1QS7 A;  1TN4 A;  2CNP A;  2EC6 C;  2LLT A;  1K90 D;  3GK4 X;  2KGR A;  1OZO A;  4PE1 A;  1F8H A;  1LKJ A;  2D8N A;  3OP0 A;  1WY9 A;  3LCP C;  4JWQ A;  2M0R A;  1XA5 A;  1JC2 A;  3DVM A;  3DF0 A;  3SIA A;  3KO0 A;  1NCX A;  5JJG A;  2NCP A;  3JVT B;  4JQ0 D;  5ER5 A;  1FI5 A;  3KPX A;  1YRU B;  1S6J A;  4U8D A;  4M2O A;  3TDZ A;  4IL1 A;  5CSN A;  3OX6 A;  5AER A;  2JRF A;  1IQ3 A;  4PHM A;  1ODB A;  2JT0 A;  4MSP A;  5G08 A;  1YX7 A;  2K7O A;  1DJZ A;  3D0Y B;  1MR8 A;  3EVU A;  1BF5 A;  1MF8 B;  2LVJ A;  1SRA A;  1KK7 Y;  5I2Q A;  4PHK A;  1K2H A;  2L0P A;  4MZJ A;  1SL9 A;  1XFZ O;  4YRU A;  1NCY A;  2CTN A;  2KOT A;  1QIW A;  3I5F C;  2GGM A;  1SKT A;  2LVI A;  2NCO A;  3IF7 A;  4DCK A;  1NWD A;  1Y1X A;  3OX5 A;  3A8R A;  2KI4 C;  1PRW A;  2VRG A;  1NX0 A;  1KQM C;  2ZRS A;  4BY5 A;  2I2R E;  2PAL A;  1NYA A;  1AJ5 A;  1XFU O;  2ZN8 A;  4MRY A;  1N0Y A;  1RTP 1;  2KI6 D;  2OS8 C;  3NXA A;  1NSH A;  1F55 A;  1KQM B;  2M29 A;  1NPQ A;  3GK1 A;  4YGE B;  1IQ5 A;  1QJT A;  4CPV A;  1MWN A;  2Y1N A;  2E30 A;  4USL A;  1CM4 A;  2H2K A;  1EG3 A;  2O5G A;  1XFV O;  3BOW A;  3VRP A;  3BUW B;  2F3Z A;  1WRL A;  1N65 A;  2LMT A;  1RFJ A;  1SCV A;  3CR2 A;  4R1E A;  3WNX B;  1B1G A;  3I5H B;  1XFX O;  2EHB A;  1KSO A;  2M3W A;  2JNF A;  1UHI A;  4PHJ A;  4AQI A;  1CKK A;  3TUY B;  3LK1 A;  4HRE E;  1S1E A;  1QV0 A;  1TCO B;  4P2Y B;  2DOQ A;  2HF5 A;  5PAL A;  1UUS A;  1EG4 A;  1MUX A;  3DVK A;  1SCM B;  1SBJ A;  4GBA A;  2MA2 A;  1QLK A;  3OB2 B;  2BKI B;  4I5L B;  1R6P A;  3DD4 A;  2JPT A;  3GK2 A;  1BR1 B;  5HKY A;  1M39 A;  1A03 A;  1UHN A;  3FWC A;  1QVI Y;  2L2E A;  1SL7 A;  3SG7 A;  1NX3 A;  2M1K B;  1K96 A;  5CSJ A;  1CFP A;  1KWO C;  2ZNE A;  1OE9 B;  4ORC B;  2LUC A;  2KAV A;  4CID A;  1KFX L;  2HPS A;  5BPJ A;  4CLN A;  1N2D A;  3RLZ A;  1M46 A;  3EK8 A;  3VRO A;  2F33 A;  1KWO B;  1UP5 A;  3KHE A;  4A4C A;  4PE7 A;  1LA0 A;  1IJ5 A;  2SCP A;  3AAK A;  2PAS A;  2BEC A;  2JZI A;  4HRH A;  4L9M A;  5AXI A;  2Y5I A;  1J7R A;  1GJY A;  4MVF A;  1YUU A;  1YUR A;  1EL4 A;  3ZWH A;  2KDH A;  1DTL A;  1WLM A;  1LVC D;  3I5G C;  2PSR A;  1XFW O;  2BE6 A;  3BXK A;  2K2A A;  1B7T Z;  1BU3 A;  5IBW A;  3PN7 C;  1BOC A;  4GAO A;  1UUR A;  3FIA A;  4A4B A;  1JFK A;  1DF0 A;  3EK4 A;  3EKJ A;  4M2P A;  1S5G Z;  1B47 A;  1YX8 A;  1OMD A;  1OOJ A;  4I5J A;  1M31 A;  1FF1 A;  4QJ5 B;  4GUK A;  1DJI A;  1MHO A;  2JXC A;  5FYX A;  1KQV A;  5DKR A;  2Q4U A;  1KFU L;  1QXP A;  2WCF A;  3ZNI A;  4HRG A;  3BUN B;  1C7V A;  2LAP A;  1XK4 C;  3JVT C;  4PHN A;  1CTR A;  1K9P A;  3RM1 A;  2FCD A;  4MZK A;  3PSR A;  1A4P A;  3JTD B;  2JOJ A;  1CLB A;  5HLO A;  1DJG A;  1B8C A;  1DJY A;  2CXJ A;  1XYD A;  2F8P A;  2JU0 A;  4NQG A;  1FW4 A;  1GGW A;  1K8U A;  2OTG B;  4GGF C;  3EVR A;  2Q91 A;  5HKZ A;  1BMO A;  1RJV A;  1MQ1 A;  3CS1 A;  3FWB A;  4N1G A;  1Y1U A;  2MBX A;  1TNX A;  4PAL A;  2LM5 A;  2BCX A;  2K7B A;  4NDC A;  1SW8 A;  2WOR A;  4OVN F;  1FPW A;  1JF2 A;  2M97 A;  3KF9 A;  1JSA A;  1DJW A;  4ETO A;  1REC A;  1S6I A;  1NX2 A;  3I5I B;  2M49 B;  2L5X B;  2ZRT A;  3WHT B;  5I2O A;  1AK8 A;  1L7Z A;  1QLS A;  1F4O A;  3BUX B;  3SG6 A;  1U5I B;  1VRK A;  3O4Y A;  3M0W A;  1HQV A;  1PSB A;  1YVL A;  1W7I B;  4XJK B;  1F54 A;  2LLU A;  1A75 A;  4NDD A;  1Y1A A;  3LLE A;  2M8U A;  2NZ0 A;  1S26 D;  1ZAC A;  4JPZ B;  1CLM A;  2PVB A;  5HLV A;  4GFT A;  3BUM B;  1NP8 A;  1TRF A;  2KSP A;  4PDZ A;  1IJ6 A;  5DKN A;  1GQM A;  4ORA B;  5KTY A;  2KQY A;  1YRT B;  1KSM A;  1OMV A;  1UHK A;  3CR5 X;  1AJ4 A;  3I5H C;  2I18 A;  2SAS A;  3IQO A;  4E68 A;  2A4J A;  3EK7 A;  1LA3 A;  1A2X A;  1B8L A;  3CLN A;  4MN0 A;  3TDI A;  1NCZ A;  2AMI A;  3DVJ A;  1Q80 A;  2CT9 A;  3TUY C;  1SMG A;  2GGZ A;  4M2Q A;  3VRR A;  2BKH B;  1S3P A;  2KBM A;  2M9G A;  2R2I A;  3HCM A;  1WDC B;  1IH0 A;  3CWG A;  2BBM A;  2HQW A;  1JFJ A;  4FTG A;  1B7T Y;  1WRK A;  2IS9 A;  1AP4 A;  1SCM C;  2JWW A;  2WCE A;  4YGB B;  2F2O A;  1SNL A;  4QJ3 B;  1QAS A;  2ZKM X;  2WCB A;  1G8I A;  2L4I A;  1CB1 A;  2K7D A;  5TNC A;  2WND A;  2M7L A;  1XK4 A;  2RGI A;  1B8R A;  1X02 A;  1KFX S;  1SR6 B;  2CCM A;  2K7C A;  3TZ1 A;  2KFG A;  2B1U A;  3DF0 B;  1SPY A;  1JWD A;  1S6C A;  1XO5 A;  2LP2 A;  5KSZ A;  1K9K A;  3H4S E;  1KK7 Z;  4GGF A;  4MLW A;  4AOM A;  1M63 B;  2LMU A;  3D0Y A;  2L4H A;  1D1O A;  1Y6W A;  4D1E A;  1TOP A;  2AUC A;  3EVV A;  1WLZ A;  2KFF A;  3GOF A;  4ORB B;  4YGC B;  3PM8 A;  2LHI A;  3LK0 A;  2M7N A;  1YTZ C;  3E3R A;  4OV2 A;  3TDU A;  1JBA A;  1DGU A;  3HX4 A;  2KBI A;  2FCE A;  4DIR A;  2LE9 B;  2LUX A;  2KAX A;  1AHR A;  1PUL A;  3CZT X;  4YGA A;  1BG1 A;  1K94 A;  2QAC A;  1V1G A;  1DVI A;  4MEW A;  5DKQ A;  2FOT A;  2MLF C;  2K2F A;  4MZL A;  1NUB A;  1FI6 A;  1KFU S;  2V53 A;  1UHJ A;  2COL B;  2PMY A;  1K93 D;  1ZMZ A;  3O78 A;  5D69 A;  1ALW A;  1L2O B;  2KQ6 A;  1YUS A;  4WRI A;  3CGA A;  4CFQ A;  3O2P A;  2LCP A;  1CDL A;  1RWY A;  1DMO A;  2LAN A;  1JF0 A;  4WQ2 A;  1IG5 A;  1OZS A;  1E8A A;  5D7F A;  4AQJ A;  1CFC A;  1CMF A;  1CFF A;  3JTD C;  2K61 A;  3BQ3 A;  3KEV A;  4UPG A;  4N1F A;  2G2B A;  1IWQ A;  2BL0 B;  4C0L A;  4PE0 A;  2OPO A;  2MLE C;  1DJH A;  2K0J A;  2OTG C;  4CFR A;  2MRD A;  1CNP A;  3PFV A;  1BT6 A;  3VGO A;  4OKH A;  1FBV A;  3BOW B;  1H4B A;  1J55 A;  1SL8 A;  2WOS A;  4PE4 A;  2LP3 A;  1RK9 A;  4FQO A;  1LIN A;  1TTX A;  1CM1 A;  1SK6 D;  2G9B A;  2ZFD A;  4PCW A;  1G4Y R;  1QIV A;  4C0J A;  3AAJ A;  1UHH A;  1R2U A;  4OR9 B;  1PK0 D;  5AEQ A;  1CDP A;  2JTT A;  1CDN A;  3PLF B;  3SG3 A;  2TN4 A;  3OB1 B;  2E6W A;  4C0K A;  1PAL A;  3OHM B;  2WC8 A;  2PRU A;  3I5I C;  1UWO A;  5F6T A;  5AFP A;  1B9A A;  1J1E A;  1QV1 A;  1TCF A;  1QTX A;  4YBH B;  3PAL A;  5JOL A;  1QVI Z;  4DUQ A;  1J7P A;  3BUO B;  1F70 A;  1BOD A;  4MRX A;  5I2L A;  1F71 A;  2EC6 B;  5CPV A;  2KYC A;  5AAN A;  2BBN A;  2NLN A;  1ZFS A;  2GV5 A;  2H61 C;  2ZND A;  1AVS A;  4GPL B;  2LLS A;  5HYD A;  3VRN A;  2BCA A;  3PAT A;  4NDB A;  1EH2 A;  5KU1 A;  2K8M B;  1YR5 A;  4YGD B;  4Q04 A;  5ER4 X;  1PSR A;  2KGB C;  5J3X A;  3SG5 A;  1DJX A;  3SG4 A;  1J7Q A;  1SYM A;  2KAY A;  2BE4 A;  3SG2 A;  1PVA A;  2JNX A;  2KHN A;  2NXQ A;  4MBE A;  3WXA A;  3BYA A;  1XVJ A;  4ZCU A;  1IGV A;  2ISD A;  2LMV A;  1OQP A;  1WDC C;  3I5F B;  1DT7 B;  2LC5 A;  4DRW A;  1B4C A;  2I94 A;  3NSL A;  2LVV A;  2KI4 B;  1YUT A;  1NX1 A;  2LVK A;  1A29 A;  5CSI A;  1SY9 A;  1K95 A;  2F2P A;  1GGZ A;  1DF0 B;  4XYN A;  3A4U B;  4QJ4 B;  2L98 A;  3TS5 C;  1CFD A;  1Y0V H;  2OS8 B;  4BY4 A;  4YI9 A;  3EKH A;  1MXE A;  3MSE B;  3NSI A;  1SR6 C;  1S5G Y;  2BCB A;  3AKA A;  2MHH A;  3TS5 B;  1RRO A;  2EGD A;  3CR4 X;  3AKB A;  4I5K A;  4P5O E;  3DVE A;  3FS7 A;  4HSZ A;  1TIZ A;  1H8B A;  2L50 A;  3SJS A;  1TNW A;  1M45 A;  2JC2 A;  1QX7 A;  3IQQ A;  3K21 A;  2LNK A;  2JT8 A;  4WQ3 A;  1F4Q A;  1YVH A;  2JQ6 A;  1V1F A;  1ALV A;  1EXR A;  3LL8 B;  3QRX A;  2QPT A;  2L51 A;  1ZUZ A;  1BLQ A;  2KI6 C;  2CBL A;  1MXL C;  2I7A A;  4YI8 A;  2KFH A;  1QX2 A;  4OCI A;  4DS7 A;  3VRQ A;  2KNE A;  3SIB A;  1U5I A;  1XFY O;  1W7J B;  3CTN A;  1NIW A;  2M1U A;  1C07 A;  2MAZ A;  4XJK A;  3ICB A;  1OSA A;  4F0Z B;  2H61 A;  4GNK B;  1L2O C;  3F45 A;  1KCY A;  3NSO A;  2F3Y A;  5K89 A;  1LXF C;  2HQ8 A;  1KK8 C;  2AAO A;  1J1D A;  1CLL A;  2P6B B;  2Y1M A;  2KYF A;  1G33 A;  2JTZ A;  2O60 A;  4N5X A;  2FJU B;  1A75 B;  1J7O A;  5HKW A;  3NSK A;  1EJ3 A;  1KK8 B;  2LV7 A;  3C1V A;  2BL0 C;  1HT9 A;  2JUL A;  5CSF A;  1TNP A;  4ZCV A;  1C7W A;  2JXL A;  4TNC A;  1AUI B;  2Y4Q A;  4GGN A;  1K9U A;  1OMR A;  1PVB A;  4I5N B;  1IRJ A;  2LHL A;  3WHU B;  5B8I B;  1S36 A;  1QAT A;  1BJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...