3H4SE

Structure of the complex of a mitotic kinesin with its calcium binding regulator
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
107
structure length
96
Chain Sequence
b'ETKYDVEEFVSELCKGFSLLADPERHLITAESLRRNSGILGIEGMSKEDAQGMVREGDLDGDGALNQTEFCVLMVRLSPEMMEDAETWLEKALTQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kinesin-like calmodulin-binding protein
publication title Structure of the complex of a mitotic kinesin with its calcium binding regulator.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Motor protein/calcium binding protein
total genus 30
structure length 96
sequence length 107
ec nomenclature
pdb deposition date 2009-04-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3h4sE00
2LUXA 2M8UA 4AQJA 3LL8B 1RJVA 2A4JA 2NCOA 1PSRA 1WDCB 3OX6A 3SG3A 3I5IB 2K7BA 5CSJA 3DVEA 2KSPA 2E30A 1CLMA 3TUYB 1OMRA 2Y1MA 5F6TA 4MRXA 4ZCUA 1V1GA 4QJ4B 1Y1AA 2JZIA 2LP3A 1GJYA 2BCAA 4I5LB 3SG5A 3D0YB 1GGWA 1NCZA 4WRIA 1DF0B 1NUBA 3M0WA 4N1GA 2K0JA 3DF0B 1IWQA 1UHKA 2Y5IA 1MXEA 2CXJA 1BJFA 2F3YA 1IG5A 3CR4X 3OP0A 5K89A 3OX5A 1EH2A 4NDBA 1L2OC 3QRXA 1KQVA 5HLOA 2BCBA 1QVIZ 1ALVA 4GGNA 2B1UA 2JC2A 2OTGB 4TNCA 3DVKA 4DS7A 1B4CA 5JOLA 1PRWA 1QLKA 2WCEA 1CNPA 2RGIA 4PE1A 4I5KA 1X02A 1NX0A 4PE4A 1K9KA 4GGFA 3DD4A 3BQ3A 1M63B 1RWYA 1RK9A 1SPYA 3CR5X 1QLSA 2BE4A 1DJIA 1Y1UA 4YRUA 1NX3A 3I5HB 4JWQA 1PULA 3TDUA 1J7PA 1F8HA 2F3ZA 1EG3A 3BYAA 3ICBA 2KGBC 1CFCA 1JUOA 1UURA 5AANA 2KQYA 3OB1B 3EVUA 2TN4A 3NSKA 1KK7Y 4C0JA 1IH0A 3KO0A 5HYDA 3PM8A 1CMFA 1CLLA 3SG6A 2LMTA 4MRYA 4CFRA 1LA3A 4C0LA 4MLWA 1DJHA 2KFHA 1JBAA 4NDCA 4PHNA 4USLA 3VGOA 1J7RA 3KPXA 1NIWA 1DGVA 1ODBA 4A4BA 2BKHB 2L98A 3D0YA 4GBAA 3SIBA 1VRKA 4CLNA 1B7TZ 1DF0A 1G33A 2IS9A 3I5GC 4DRWA 3DF0A 3NSOA 1B8CA 3KF9A 4YGAA 4ZCVA 3PALA 1M39A 3EK4A 1IJ6A 1IJ5A 3PATA 1GGZA 4OV2A 1TNPA 1CM4A 5G08A 3PFVA 1K9PA 3IF7A 5GQQC 3A8RA 1F70A 1TIZA 1XFUO 5DKQA 1TRFA 1L2OB 4PHKA 3BUNB 2MA2A 2BBMA 4MN0A 3HX4A 4P5OE 1XFVO 1TCFA 2L0PA 3SG2A 1SL8A 3EK7A 1F71A 2VRGA 1SKTA 5KTYA 1FBVA 1YUTA 5HKYA 3GK4X 4FTGA 4OKHA 4PE0A 4XYNA 3MSEB 2K7OA 3CWGA 5BPJA 1B8RA 1NPQA 1S36A 2KDHA 3ZNIA 1SRAA 2M1KB 4A4CA 1CMGA 2I18A 5AERA 2MRDA 2K61A 4M2OA 4YGCB 4GUKA 2KAYA 1EG4A 1CLBA 1YUUA 1Y6WA 1DT7B 1M46A 2NZ0A 1E8AA 3WXAA 5AEQA 1K2HA 2O5GA 3I5FC 1AJ5A 2LM5A 2QPTA 1EJ3A 2KBMA 2ISDA 1J1EA 2PASA 5IBWA 1CM1A 3BUXB 4GPLB 5HLVA 4PHMA 1F55A 3JVTC 2E6WA 1B1GA 2BKIB 2ZNEA 4UPGA 3JTDC 3DVJA 1DGUA 1V1FA 1CTRA 1QX5B 1SYMA 1KFUS 3EKHA 4OCIA 3H4SE 1SW8A 2NLNA 4MSPA 2G2BA 3ZWHA 2Q4UA 4YGEB 4DIRA 3I5GB 2K2AA 3K21A 2O60A 2R2IA 1WLMA 2KAXA 1DJYA 2Y1NA 2HF5A 2GGMA 4L9MA 3HCMA 1YTZC 1DVIA 2LE9B 1DJGA 2BBNA 2LLTA 4YGDB 3RLZA 4PHJA 3EVRA 1YX8A 3SJSA 1A2XA 1A29A 2MLEC 2L4HA 3GK1A 1QX2A 2LMVA 4MZKA 2SCPA 2WCFA 1CB1A 2CNPA 4MZLA 3WHTB 4HRHA 1QIWA 2JRFA 4MBEA 4MVFA 1MXLC 1YR5A 3VROA 1CKKA 1QASA 1WRKA 1J7QA 2GV5A 1YX7A 4OVNF 2JULA 3SG7A 1CFDA 1MF8B 1QS7A 1PVAA 2ZN8A 1BR4B 1OZOA 4M2QA 4AOMA 2MAZA 3VRPA 4CPVA 2H2KA 1HQVA 1FF1A 1XK4A 3DVMA 3GK2A 1XFXO 5PALA 1MWNA 1F4QA 1IRJA 5DKNA 3I5FB 2L4IA 1SCMC 1ZACA 2CCMA 2BL0C 3TZ1A 1NYAA 4QJ3B 2KNEA 2KFFA 2M3WA 1S6JA 1TNQA 1XK4C 3JVTB 4GFTA 3FWCA 3O4YA 2L2EA 2M49B 3O78A 1C7VA 3AKAA 2BCXA 2D8NA 4ORAB 1DTLA 1UUSA 3LK1A 3PN7C 1AK8A 2JNXA 1CDMA 2PVBA 2M9GA 1S3PA 1CDLA 2CTNA 4ORBB 1QVIY 1JFJA 4BY5A 4YBHB 1K93D 2H61C 3A4UB 1YURA 1S5GZ 4F0ZB 2LLSA 5FYXA 1KFXS 2KYFA 4AQIA 2Y4QA 4XJKB 1SY9A 2LHLA 2LANA 2M7NA 1RECA 4QJ5B 1KK8C 1UHIA 2LP2A 3CGAA 1JC2A 1K9UA 2ZKMX 3BOWB 2PALA 2CBLA 1R6PA 1WDCC 1CFFA 2LV7A 4N1FA 2HQ8A 2L5XB 1CFPA 3KHEA 2KYCA 3CLNA 1SL9A 3BUOB 1HT9A 4YI9A 1AP4A 2LC5A 1KCYA 5HKWA 3GOFA 5B8IB 1OOJA 2FCEA 1SK6D 1C7WA 1BOCA 5I2OA 3KEVA 1N65A 4HRGA 1RROA 4BY4A 2I2RE 1QATA 1S26D 1IGVA 2F2OA 3BXKA 5CSFA 1BR1B 1NCXA 4I5NB 1AUIB 2KI4C 1B7TY 2BL0B 1MQ1A 1S6IA 2EHBA 1OE9B 1W7IB 1RFJA 2WNDA 1YVHA 2CT9A 1N0YA 2L50A 1QV1A 1KQMC 1SBJA 2JQ6A 1Y0VH 2M97A 3CS1A 2KHNA 2LVVA 5KSZA 5D69A 1QTXA 1ZUZA 2ZRTA 1LVCD 3PN7B 2FJUB 4MEWA 1OZSA 3CR2A 1GQMA 3LCPC 1JF2A 2AMIA 1FPWA 2JNFA 1QJTA 4PCWA 2JU0A 3CTNA 5KU1A 4WQ3A 1R2UA 2KBIA 3I5HC 1CDPA 2JTZA 1MR8A 2LHIA 2K8MB 2KI6C 2WORA 3FS7A 1KFUL 3LK0A 3OB2B 4XJKA 1OSAA 3RM1A 3TDIA 1LINA 2LVIA 4ORCB 2F2PA 4NQGA 5I2LA 1AHRA 2LLUA 2EGDA 1A75B 1K90D 1TCOB 3BOWA 4P2YB 1PK0D 3EKJA 1JF0A 1A03A 1DJWA 4C0KA 1YUSA 4CIDA 3E3RA 1IKUA 2ZN9A 3PSRA 3WNXB 2HQWA 2BECA 1M31A 3NSLA 4YGBB 1QX7A 1J7OA 5JJGA 2JPTA 2KI6D 2F8PA 2HETA 2OS8C 1XFWO 4IL1A 4WQ2A 2M29A 4HREE 1KK7Z 1SMGA 1H8BA 1S6CA 2I94A 5J3XA 1W7JB 2FOTA 2LMUA 3O6BA 1L7ZA 1SR6C 2Q91A 3O2PA 1SCVA 2COLB 1B9AA 3TS5C 2KI4B 1SNLA 3OHMB 3VRRA 1UHNA 5I8NA 2M0RA 1LA0A 1B47A 5AFPA 1WLZA 2MBXA 5CSNA 2M7LA 2LVJA 1KQMB 1NWDA 2MHHA 1YRUB 4NDDA 1PALA 1PSBA 1ZMZA 1Q80A 3BUMB 3IQQA 4JPZB 2ZRSA 4OR9B 5CPVA 1IQ3A 2AAOA 1BODA 1JWDA 4D1EA 1NX2A 1TN4A 1FI6A 1KWOC 3JTDB 1NCYA 1MUXA 2NCPA 1S1EA 4ETOA 2JWWA 1B8LA 2H61A 1IQ5A 1ALWA 1PVBA 1QXPA 1RTP1 3IQOA 5D7FA 4DCKA 2K7CA 1U5IB 1XYDA 4GGFC 1A75A 5TNCA 2EC6C 3WHUB 3PLFB 1OMDA 2KFGA 2G9BA 1D1OA 5I2QA 3NSIA 4PE7A 1K95A 4R1EA 1EXRA 3CZTX 2MLFC 1EL4A 2JOJA 4HSZA 1NP8A 2PSRA 4ICBA 2V53A 4N5XA 1YRTB 1KFXL 4GAOA 1ZOTB 1WRZA 2FCDA 1OQPA 1G4YR 1C07A 1UHJA 2KOTA 2JT3A 2WOSA 2JTTA 2KAVA 3F45A 2OPOA 1M45A 4JQ0D 1AJ4A 1SL7A 2GGZA 3I5IC 1MHOA 1F4OA 1QIVA 1A4PA 1DJZA 1UWOA 4M2PA 4MZJA 1AVSA 2OS8B 3LLEA 3TUYC 2PRUA 1UHHA 2WC8A 1YVLA 1TOPA 2K7DA 2M1UA 2QACA 1FI5A 2HPSA 1LKJA 1F54A 1TNXA 3TDZA 2L51A 2AUCA 3D10A 1K8UA 4FQOA 5ER5A 1N2DA 2PMYA 1G8IA 1BG1A 4U8DA 4E68A 1JFKA 1SR6B 3VRQA 3VRNA 1BLQA 3AAJA 2K2FA 2LCPA 2NXQA 3TS5B 1UP5A 4DUQA 1Y1XA 1FW4A 1NX1A 2BE6A 4CFQA 3BUWB 3AKBA 4I5JA 1SCMB 5DKRA 1K94A 5CSIA 2JT0A 2JXCA 1H4BA 1BMOA 1DJXA 1KSOA 1S5GY 3EK8A 4PDZA 3AAKA 5AXIA 2F33A 2ZFDA 2JXLA 1XVJA 2OTGC 3C1VA 1WY9A 3FWBA 2WCBA 2MJWB 1KWOB 2LUCA 4PALA 1BF5A 1XFZO 3NXAA 1XFYO 1J1DA 1JSAA 2I7AA 4YI8A 2DOQA 1U5IA 1J55A 2ZNDA 1QV0A 1XA5A 1OMVA 1K96A 1KSMA 1TNWA 4GNKB 1CDNA 5HKZA 2EC6B 2P6BB 1XO5A 3EVVA 4Q04A 2KQ6A 1BU3A 1NSHA 1LXFC 2SASA 1WRLA 5ER4X 2KGRA 3SG4A 2LAPA 3SIAA 1BT6A 2JT8A 2LVKA 1ZFSA 2LNKA 3FIAA 1KK8B 1TTXA 1DMOA
chains in the Genus database with same CATH superfamily
2LUXA 2M8UA 4AQJA 1BODA 3LL8B 1RJVA 2A4JA 2NCOA 1PSRA 1WDCB 3OX6A 3SG3A 3I5IB 2K7BA 5CSJA 3DVEA 2KPHA 2KSPA 2E30A 1CLMA 3B6XA 3OGNA 3TUYB 1OMRA 2Y1MA 3DYEA 4MRXA 5F6TA 1V1GA 4ZCUA 4QJ4B 1Y1AA 2JZIA 3IVTA 2LP3A 1GJYA 2BCAA 3PJIA 4I5LB 3SG5A 3D0YB 5I94A 1GGWA 1NCZA 4WRIA 1DF0B 1NUBA 3M0WA 4N1GA 2K0JA 3DF0B 1IWQA 1UHKA 2Y5IA 1MXEA 2CXJA 3SS4A 1BJFA 2F3YA 3K1EA 1IG5A 3CR4X 3OP0A 5K89A 3OX5A 1EH2A 4NDBA 1L2OC 3QRXA 1KQVA 5HLOA 2BCBA 1QVIZ 1ALVA 1Z2CB 4GGNA 2B1UA 2JC2A 2OTGB 4TNCA 3DVKA 4DS7A 1B4CA 5JOLA 1PRWA 1QLKA 2WCEA 1CNPA 2RGIA 4PE1A 4I5KA 1X02A 1NX0A 4PE4A 1K9KA 3UO9A 2P71A 4GGFA 3DD4A 3BQ3A 1M63B 1RWYA 1RK9A 1SPYA 4I5NB 3CR5X 1QLSA 2BE4A 1DJIA 1Y1UA 4YRUA 1NX3A 3I5HB 4JWQA 1PULA 3TDUA 1J7PA 1F8HA 2F3ZA 1EG3A 3BYAA 3D76A 2KGBC 3ICBA 1CFCA 1JUOA 1UURA 5AANA 2KQYA 3OB1B 3EVUA 2TN4A 3NSKA 1KK7Y 4C0JA 1IH0A 3KO0A 5HYDA 3PM8A 1CMFA 1CLLA 3SG6A 2LMTA 4MRYA 4CFRA 1LA3A 4C0LA 4MLWA 1DJHA 2KFHA 2WCJA 4NDCA 3DY9A 4PHNA 4USLA 3VGOA 1JBAA 1J7RA 3KPXA 1NIWA 1DGVA 1ODBA 4A4BA 2BKHB 2L98A 3D0YA 4GBAA 3SIBA 1VRKA 4CLNA 1B7TZ 1DF0A 1G33A 2IS9A 3I5GC 4DRWA 3DF0A 3D78A 3NSOA 1B8CA 3KF9A 4YGAA 4ZCVA 3PALA 1M39A 3EK4A 1IJ6A 1IJ5A 3PATA 1GGZA 4OV2A 1TNPA 1CM4A 5D3OA 5G08A 3PFVA 1K9PA 3IF7A 3B7AA 5GQQC 3A8RA 1F70A 1TIZA 1XFUO 5DKQA 1TRFA 1L2OB 4PHKA 3BUNB 1C3ZA 2BBMA 2MA2A 3HX4A 4MN0A 4P5OE 1XFVO 1TCFA 2L0PA 3SG2A 1SL8A 5FI6A 1IIOA 3EK7A 1F71A 2VRGA 1SKTA 5KTYA 1FBVA 1YUTA 5HKYA 3CZ1A 3GK4X 4FTGA 4OKHA 2QEVA 4PE0A 4XYNA 3MSEB 2K7OA 2KLEA 3CWGA 3FE6A 3BFAA 5BPJA 1B8RA 1NPQA 1S36A 2KDHA 3ZNIA 1SRAA 2M1KB 4A4CA 1CMGA 2I18A 5AERA 2MRDA 2K61A 4M2OA 4YGCB 4GUKA 1OW4A 3L4AA 2KAYA 1EG4A 3D73A 4JD9A 1YUUA 1Y6WA 3S0FA 1DT7B 1M46A 1CLBA 2NZ0A 1E8AA 3WXAA 2WC5A 5AEQA 1K2HA 1TWOA 2O5GA 3I5FC 1AJ5A 2LM5A 2QPTA 1EJ3A 2KBMA 2ISDA 1J1EA 2QDIA 2PASA 3QMEA 5IBWA 1CM1A 3BUXB 4GPLB 5HLVA 4PHMA 1F55A 3JVTC 2E6WA 1B1GA 2BKIB 2ZNEA 4UPGA 3R1VA 3JTDC 3DVJA 1DGUA 3SS3A 1V1FA 1CTRA 1QX5B 1SYMA 1KFUS 3EKHA 4OCIA 3H4SE 2GTEA 1SW8A 2NLNA 4MSPA 1Z4HA 2G2BA 3ZWHA 2L5YA 2Q4UA 4YGEB 4DIRA 3I5GB 2K2AA 3K21A 2O60A 2R2IA 1WLMA 2KAXA 1DJYA 2Y1NA 2HF5A 2GGMA 4L9MA 3HCMA 3V2LA 4INWA 2PYQA 5FI2A 1YTZC 1DVIA 2LE9B 1DJGA 2BBNA 2LLTA 1DC1A 4YGDB 3RLZA 4PHJA 3EVRA 1YX8A 3SJSA 1A2XA 1A29A 1OOFA 2MLEC 2L4HA 2KLDA 3GK1A 1QX2A 2LMVA 4MZKA 2SCPA 2WCFA 3PM2A 1CB1A 2H8VA 2CNPA 4MZLA 3WHTB 4HRHA 1QIWA 2JRFA 3FE9A 4MBEA 4MVFA 1MXLC 1YR5A 3OBVA 3VROA 1CKKA 1QASA 1WRKA 1J7QA 2GV5A 1YX7A 4OVNF 2JULA 3SG7A 1CFDA 1MF8B 1QS7A 1PVAA 2ZN8A 1BR4B 1OZOA 4M2QA 4AOMA 3NHTA 5HL1A 2MAZA 3VRPA 3CYZA 4CPVA 2H2KA 1HQVA 1FF1A 1XK4A 3DVMA 3GK2A 1XFXO 5PALA 1MWNA 1F4QA 1IRJA 5DKNA 3I5FB 2L4IA 3R72A 1SCMC 1ZACA 2CCMA 2BL0C 3TZ1A 1NYAA 4QJ3B 2KNEA 2KFFA 2M3WA 3S0GA 1S6JA 1TNQA 1XK4C 3JVTB 4GFTA 3FWCA 3O4YA 2L2EA 2M49B 3O78A 1C7VA 1DEKA 2BCXA 2D8NA 3AKAA 4ORAB 2QEBA 1DTLA 1UUSA 1SSEB 3LK1A 3PN7C 1AK8A 2JNXA 1CDMA 2PVBA 2M9GA 2JPOA 3D74A 1S3PA 1CDLA 2CTNA 4ORBB 1QVIY 1JFJA 2YGUA 4BY5A 4YBHB 1K93D 2WC6A 3Q8IA 2H61C 3A4UB 1YURA 1S5GZ 4F0ZB 2LLSA 5FYXA 2L2CA 1KFXS 2KYFA 1P28A 4AQIA 2Y4QA 4XJKB 1SY9A 2LHLA 2LANA 2M7NA 2WCLA 1RECA 4QJ5B 1KK8C 1UHIA 2LP2A 3CGAA 3CZ2A 1JC2A 1K9UA 2ZKMX 3NGVA 3BOWB 2PALA 2CBLA 1R6PA 1WDCC 1CFFA 2LV7A 4N1FA 2HQ8A 2L5XB 1CFPA 3KHEA 2BAPA 2KYCA 3CLNA 1SL9A 3BUOB 1HT9A 4YI9A 2ERBA 1AP4A 2LC5A 1KCYA 5HKWA 3GOFA 5B8IB 1OOJA 2FCEA 1SK6D 1C7WA 1BOCA 5I2OA 3KEVA 1N65A 4HRGA 1RROA 4BY4A 2I2RE 1QATA 1S26D 4INXA 3EG5B 1IGVA 2F2OA 2QEHA 3BXKA 5CSFA 1BR1B 1NCXA 3B88A 1AUIB 2KI4C 1B7TY 2BL0B 1MQ1A 1S6IA 2EHBA 1OE9B 1W7IB 1RFJA 1DQEA 2WNDA 1YVHA 2CT9A 1N0YA 2L50A 1QV1A 1KQMC 3NHIA 1SBJA 2JQ6A 1Y0VH 2M97A 3CS1A 2KHNA 2LVVA 5KSZA 3L47A 5D69A 1QTXA 1ZUZA 2ZRTA 5DICA 1LVCD 3PN7B 2FJUB 4MEWA 1OZSA 4PT1A 3CR2A 1GQMA 3LCPC 1JF2A 5FI7A 2AMIA 1FPWA 2JNFA 1QJTA 4PCWA 2JU0A 3CTNA 2WCKA 4WQ3A 5KU1A 1R2UA 2KBIA 3I5HC 1CDPA 2JTZA 1MR8A 2LHIA 2K8MB 2KI6C 2WORA 3FS7A 1KFUL 3LK0A 3OB2B 1TUZA 1OSAA 4XJKA 3RM1A 1LINA 2LVIA 3TDIA 4ORCB 2F2PA 4NQGA 5I2LA 1AHRA 2LLUA 3S0BA 2QEOA 2EGDA 1A75B 1K90D 1TCOB 3BOWA 3R1OA 1PK0D 4P2YB 3EKJA 1JF0A 1A03A 1GM0A 2FJYA 1ORGA 1DJWA 4C0KA 1YUSA 4CIDA 3E3RA 1IKUA 2ZN9A 3PSRA 3WNXB 2HQWA 2BECA 1M31A 3NSLA 4YGBB 1QX7A 1J7OA 5JJGA 2JPTA 2KI6D 2F8PA 2HETA 2OS8C 1XFWO 4IL1A 4WQ2A 2M29A 4HREE 1KK7Z 1SMGA 3DXLA 1H8BA 3L4LA 4KYNA 1S6CA 2I94A 5J3XA 1W7JB 2FOTA 2LMUA 3O6BA 1L7ZA 1SR6C 2Q91A 3O2PA 1SCVA 1JWDA 2COLB 4FQTA 1B9AA 3TS5C 2KI4B 1SNLA 3OHMB 3VRRA 1UHNA 3BFBA 2M0RA 5I8NA 1LA0A 1B47A 5AFPA 1WLZA 2MBXA 5CSNA 2M7LA 3BJHA 5EL2A 3UNWA 2LVJA 1KQMB 1NWDA 2MHHA 1YRUB 4NDDA 4JKTA 1PALA 1PSBA 1ZMZA 1XFRA 1Q80A 3BUMB 3D75A 3IQQA 2ZRSA 1T14A 1LS8A 4JPZB 2AAOA 4OR9B 5CPVA 3S0AA 1IQ3A 4D1EA 1NX2A 1TN4A 1FI6A 1KWOC 3R1PA 3JTDB 1NCYA 1MUXA 2NCPA 2PQLA 1S1EA 4ETOA 2JWWA 1B8LA 2H61A 1IQ5A 1ALWA 1OOIX 1PVBA 1QXPA 1RTP1 2WCMA 3IQOA 5D7FA 4OZDA 2K7CA 4DCKA 3FE8A 1U5IB 1XYDA 4GGFC 1A75A 5TNCA 2EC6C 3WHUB 3PLFB 1OMDA 2KFGA 2G9BA 1D1OA 5I2QA 3NSIA 4PE7A 1K95A 4R1EA 1EXRA 3CZTX 2MLFC 1EL4A 2JOJA 4HSZA 1NP8A 2PSRA 4ICBA 2V53A 4N5XA 1YRTB 1KFXL 4GAOA 1ZOTB 1WRZA 2FCDA 3D77A 1OQPA 1G4YR 1C07A 1UHJA 2KOTA 2JT3A 2WOSA 2JTTA 2KAVA 3F45A 2OPOA 1M45A 4JQ0D 1AJ4A 1SL7A 2GGZA 3I5IC 3CZ0A 1MHOA 1F4OA 1QIVA 3CABA 3RZSA 1A4PA 1DJZA 1UWOA 4M2PA 4MZJA 3S0DA 1AVSA 2OS8B 3LLEA 3TUYC 2PRUA 1UHHA 2WC8A 1YVLA 1TOPA 2K7DA 2M1UA 2QACA 1FI5A 4IJ7A 2HPSA 1LKJA 1F54A 1TNXA 2P70A 3TDZA 3B86A 1TUJA 2L51A 2AUCA 4F7FA 3D10A 1K8UA 4FQOA 5ER5A 1N2DA 2PMYA 1G8IA 1BG1A 4U8DA 4E68A 1JFKA 1SR6B 3VRQA 3VRNA 1BLQA 3AAJA 3O4XA 2K2FA 2LCPA 2NXQA 3TS5B 1UP5A 3VB1A 4DUQA 2K60A 1Y1XA 1FW4A 1NX1A 2BE6A 4CFQA 3BUWB 3AKBA 4I5JA 1SCMB 3BFHA 5DKRA 1K94A 1OOHA 5CSIA 2JT0A 1DMOA 1W9ZA 2JXCA 1H4BA 3B87A 1BMOA 1DJXA 1KSOA 1S5GY 3EK8A 4PDZA 3AAKA 5AXIA 2F33A 1QWVA 2ZFDA 2JXLA 1XVJA 2OTGC 3C1VA 1WY9A 3FWBA 2WCBA 2MJWB 3S0EA 1KWOB 2LUCA 4PALA 1BF5A 1C3YA 1XFZO 3NXAA 1XFYO 1J1DA 1JSAA 2I7AA 4YI8A 2DOQA 1U5IA 1J55A 1OOGA 1QV0A 2ZNDA 1XA5A 1OMVA 1K96A 2BNXA 3SS5A 1KSMA 1TNWA 2WCHA 3CDNA 4GNKB 5HKZA 2EC6B 2P6BB 1CDNA 1XO5A 3EVVA 4Q04A 2KQ6A 1BU3A 1NSHA 1LXFC 2SASA 1WRLA 5ER4X 1DELA 2KGRA 3SG4A 3DZTA 2LAPA 3SIAA 1BT6A 2JT8A 2LVKA 1ZFSA 2LNKA 3FIAA 1KK8B 1TTXA 3N7HA
chains in the Genus database with same CATH topology
2LUXA 2M8UA 4AQJA 3LL8B 1RJVA 2A4JA 2NCOA 1PSRA 1WDCB 3OX6A 3SG3A 3I5IB 2K7BA 5CSJA 3DVEA 2KSPA 2E30A 1CLMA 3TUYB 1OMRA 2Y1MA 5F6TA 4MRXA 4ZCUA 1V1GA 4QJ4B 1Y1AA 2JZIA 2LP3A 1GJYA 2BCAA 4I5LB 3SG5A 3D0YB 1GGWA 1NCZA 4WRIA 1DF0B 1NUBA 3M0WA 4N1GA 2K0JA 3DF0B 1IWQA 1UHKA 2Y5IA 1MXEA 2CXJA 1BJFA 2F3YA 1IG5A 3CR4X 3OP0A 5K89A 3OX5A 1EH2A 4NDBA 1L2OC 3QRXA 1KQVA 5HLOA 2BCBA 1QVIZ 1ALVA 4GGNA 2B1UA 2JC2A 2OTGB 4TNCA 3DVKA 4DS7A 1B4CA 5JOLA 1PRWA 1QLKA 2WCEA 1CNPA 2RGIA 4PE1A 4I5KA 1X02A 1NX0A 4PE4A 1K9KA 4GGFA 3DD4A 3BQ3A 1M63B 1RWYA 1RK9A 1SPYA 3CR5X 1QLSA 2BE4A 1DJIA 1Y1UA 4YRUA 1NX3A 3I5HB 4JWQA 1PULA 3TDUA 1J7PA 1F8HA 2F3ZA 1EG3A 3BYAA 3ICBA 2KGBC 1CFCA 1JUOA 1UURA 5AANA 2KQYA 3OB1B 3EVUA 2TN4A 3NSKA 1KK7Y 4C0JA 1IH0A 3KO0A 5HYDA 3PM8A 1CMFA 1CLLA 3SG6A 2LMTA 4MRYA 4CFRA 1LA3A 4C0LA 4MLWA 1DJHA 2KFHA 1JBAA 4NDCA 4PHNA 4USLA 3VGOA 1J7RA 3KPXA 1NIWA 1DGVA 1ODBA 4A4BA 2BKHB 2L98A 3D0YA 4GBAA 3SIBA 1VRKA 4CLNA 1B7TZ 1DF0A 1G33A 2IS9A 3I5GC 4DRWA 3DF0A 3NSOA 1B8CA 3KF9A 4YGAA 4ZCVA 3PALA 1M39A 3EK4A 1IJ6A 1IJ5A 3PATA 1GGZA 4OV2A 1TNPA 1CM4A 5G08A 3PFVA 1K9PA 3IF7A 5GQQC 3A8RA 1F70A 1TIZA 1XFUO 5DKQA 1TRFA 1L2OB 4PHKA 3BUNB 2MA2A 2BBMA 4MN0A 3HX4A 4P5OE 1XFVO 1TCFA 2L0PA 3SG2A 1SL8A 3EK7A 1F71A 2VRGA 1SKTA 5KTYA 1FBVA 1YUTA 5HKYA 3GK4X 4FTGA 4OKHA 4PE0A 4XYNA 3MSEB 2K7OA 3CWGA 5BPJA 1B8RA 1NPQA 1S36A 2KDHA 3ZNIA 1SRAA 2M1KB 4A4CA 1CMGA 2I18A 5AERA 2MRDA 2K61A 4M2OA 4YGCB 4GUKA 2KAYA 1EG4A 1CLBA 1YUUA 1Y6WA 1DT7B 1M46A 2NZ0A 1E8AA 3WXAA 5AEQA 1K2HA 2O5GA 3I5FC 1AJ5A 2LM5A 2QPTA 1EJ3A 2KBMA 2ISDA 1J1EA 2PASA 5IBWA 1CM1A 3BUXB 4GPLB 5HLVA 4PHMA 1F55A 3JVTC 2E6WA 1B1GA 2BKIB 2ZNEA 4UPGA 3JTDC 3DVJA 1DGUA 1V1FA 1CTRA 1QX5B 1SYMA 1KFUS 3EKHA 4OCIA 3H4SE 1SW8A 2NLNA 4MSPA 2G2BA 3ZWHA 2Q4UA 4YGEB 4DIRA 3I5GB 2K2AA 3K21A 2O60A 2R2IA 1WLMA 2KAXA 1DJYA 2Y1NA 2HF5A 2GGMA 4L9MA 3HCMA 1YTZC 1DVIA 2LE9B 1DJGA 2BBNA 2LLTA 4YGDB 3RLZA 4PHJA 3EVRA 1YX8A 3SJSA 1A2XA 1A29A 2MLEC 2L4HA 3GK1A 1QX2A 2LMVA 4MZKA 2SCPA 2WCFA 1CB1A 2CNPA 4MZLA 3WHTB 4HRHA 1QIWA 2JRFA 4MBEA 4MVFA 1MXLC 1YR5A 3VROA 1CKKA 1QASA 1WRKA 1J7QA 2GV5A 1YX7A 4OVNF 2JULA 3SG7A 1CFDA 1MF8B 1QS7A 1PVAA 2ZN8A 1BR4B 1OZOA 4M2QA 4AOMA 2MAZA 3VRPA 4CPVA 2H2KA 1HQVA 1FF1A 1XK4A 3DVMA 3GK2A 1XFXO 5PALA 1MWNA 1F4QA 1IRJA 5DKNA 3I5FB 2L4IA 1SCMC 1ZACA 2CCMA 2BL0C 3TZ1A 1NYAA 4QJ3B 2KNEA 2KFFA 2M3WA 1S6JA 1TNQA 1XK4C 3JVTB 4GFTA 3FWCA 3O4YA 2L2EA 2M49B 3O78A 1C7VA 3AKAA 2BCXA 2D8NA 4ORAB 1DTLA 1UUSA 3LK1A 3PN7C 1AK8A 2JNXA 1CDMA 2PVBA 2M9GA 1S3PA 1CDLA 2CTNA 4ORBB 1QVIY 1JFJA 4BY5A 4YBHB 1K93D 2H61C 3A4UB 1YURA 1S5GZ 4F0ZB 2LLSA 5FYXA 1KFXS 2KYFA 4AQIA 2Y4QA 4XJKB 1SY9A 2LHLA 2LANA 2M7NA 1RECA 4QJ5B 1KK8C 1UHIA 2LP2A 3CGAA 1JC2A 1K9UA 2ZKMX 3BOWB 2PALA 2CBLA 1R6PA 1WDCC 1CFFA 2LV7A 4N1FA 2HQ8A 2L5XB 1CFPA 3KHEA 2KYCA 3CLNA 1SL9A 3BUOB 1HT9A 4YI9A 1AP4A 2LC5A 1KCYA 5HKWA 3GOFA 5B8IB 1OOJA 2FCEA 1SK6D 1C7WA 1BOCA 5I2OA 3KEVA 1N65A 4HRGA 1RROA 4BY4A 2I2RE 1QATA 1S26D 1IGVA 2F2OA 3BXKA 5CSFA 1BR1B 1NCXA 4I5NB 1AUIB 2KI4C 1B7TY 2BL0B 1MQ1A 1S6IA 2EHBA 1OE9B 1W7IB 1RFJA 2WNDA 1YVHA 2CT9A 1N0YA 2L50A 1QV1A 1KQMC 1SBJA 2JQ6A 1Y0VH 2M97A 3CS1A 2KHNA 2LVVA 5KSZA 5D69A 1QTXA 1ZUZA 2ZRTA 1LVCD 3PN7B 2FJUB 4MEWA 1OZSA 3CR2A 1GQMA 3LCPC 1JF2A 2AMIA 1FPWA 2JNFA 1QJTA 4PCWA 2JU0A 3CTNA 5KU1A 4WQ3A 1R2UA 2KBIA 3I5HC 1CDPA 2JTZA 1MR8A 2LHIA 2K8MB 2KI6C 2WORA 3FS7A 1KFUL 3LK0A 3OB2B 4XJKA 1OSAA 3RM1A 3TDIA 1LINA 2LVIA 4ORCB 2F2PA 4NQGA 5I2LA 1AHRA 2LLUA 2EGDA 1A75B 1K90D 1TCOB 3BOWA 4P2YB 1PK0D 3EKJA 1JF0A 1A03A 1DJWA 4C0KA 1YUSA 4CIDA 3E3RA 1IKUA 2ZN9A 3PSRA 3WNXB 2HQWA 2BECA 1M31A 3NSLA 4YGBB 1QX7A 1J7OA 5JJGA 2JPTA 2KI6D 2F8PA 2HETA 2OS8C 1XFWO 4IL1A 4WQ2A 2M29A 4HREE 1KK7Z 1SMGA 1H8BA 1S6CA 2I94A 5J3XA 1W7JB 2FOTA 2LMUA 3O6BA 1L7ZA 1SR6C 2Q91A 3O2PA 1SCVA 2COLB 1B9AA 3TS5C 2KI4B 1SNLA 3OHMB 3VRRA 1UHNA 5I8NA 2M0RA 1LA0A 1B47A 5AFPA 1WLZA 2MBXA 5CSNA 2M7LA 2LVJA 1KQMB 1NWDA 2MHHA 1YRUB 4NDDA 1PALA 1PSBA 1ZMZA 1Q80A 3BUMB 3IQQA 4JPZB 2ZRSA 4OR9B 5CPVA 1IQ3A 2AAOA 1BODA 1JWDA 4D1EA 1NX2A 1TN4A 1FI6A 1KWOC 3JTDB 1NCYA 1MUXA 2NCPA 1S1EA 4ETOA 2JWWA 1B8LA 2H61A 1IQ5A 1ALWA 1PVBA 1QXPA 1RTP1 3IQOA 5D7FA 4DCKA 2K7CA 1U5IB 1XYDA 4GGFC 1A75A 5TNCA 2EC6C 3WHUB 3PLFB 1OMDA 2KFGA 2G9BA 1D1OA 5I2QA 3NSIA 4PE7A 1K95A 4R1EA 1EXRA 3CZTX 2MLFC 1EL4A 2JOJA 4HSZA 1NP8A 2PSRA 4ICBA 2V53A 4N5XA 1YRTB 1KFXL 4GAOA 1ZOTB 1WRZA 2FCDA 1OQPA 1G4YR 1C07A 1UHJA 2KOTA 2JT3A 2WOSA 2JTTA 2KAVA 3F45A 2OPOA 1M45A 4JQ0D 1AJ4A 1SL7A 2GGZA 3I5IC 1MHOA 1F4OA 1QIVA 1A4PA 1DJZA 1UWOA 4M2PA 4MZJA 1AVSA 2OS8B 3LLEA 3TUYC 2PRUA 1UHHA 2WC8A 1YVLA 1TOPA 2K7DA 2M1UA 2QACA 1FI5A 2HPSA 1LKJA 1F54A 1TNXA 3TDZA 2L51A 2AUCA 3D10A 1K8UA 4FQOA 5ER5A 1N2DA 2PMYA 1G8IA 1BG1A 4U8DA 4E68A 1JFKA 1SR6B 3VRQA 3VRNA 1BLQA 3AAJA 2K2FA 2LCPA 2NXQA 3TS5B 1UP5A 4DUQA 1Y1XA 1FW4A 1NX1A 2BE6A 4CFQA 3BUWB 3AKBA 4I5JA 1SCMB 5DKRA 1K94A 5CSIA 2JT0A 2JXCA 1H4BA 1BMOA 1DJXA 1KSOA 1S5GY 3EK8A 4PDZA 3AAKA 5AXIA 2F33A 2ZFDA 2JXLA 1XVJA 2OTGC 3C1VA 1WY9A 3FWBA 2WCBA 2MJWB 1KWOB 2LUCA 4PALA 1BF5A 1XFZO 3NXAA 1XFYO 1J1DA 1JSAA 2I7AA 4YI8A 2DOQA 1U5IA 1J55A 2ZNDA 1QV0A 1XA5A 1OMVA 1K96A 1KSMA 1TNWA 4GNKB 1CDNA 5HKZA 2EC6B 2P6BB 1XO5A 3EVVA 4Q04A 2KQ6A 1BU3A 1NSHA 1LXFC 2SASA 1WRLA 5ER4X 2KGRA 3SG4A 2LAPA 3SIAA 1BT6A 2JT8A 2LVKA 1ZFSA 2LNKA 3FIAA 1KK8B 1TTXA 1DMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LUX A;  2M8U A;  4AQJ A;  3LL8 B;  1RJV A;  2A4J A;  2NCO A;  1PSR A;  1WDC B;  3OX6 A;  3SG3 A;  3I5I B;  2K7B A;  5CSJ A;  3DVE A;  2KSP A;  2E30 A;  1CLM A;  3TUY B;  1OMR A;  2Y1M A;  5F6T A;  4MRX A;  4ZCU A;  1V1G A;  4QJ4 B;  1Y1A A;  2JZI A;  2LP3 A;  1GJY A;  2BCA A;  4I5L B;  3SG5 A;  3D0Y B;  1GGW A;  1NCZ A;  4WRI A;  1DF0 B;  1NUB A;  3M0W A;  4N1G A;  2K0J A;  3DF0 B;  1IWQ A;  1UHK A;  2Y5I A;  1MXE A;  2CXJ A;  1BJF A;  2F3Y A;  1IG5 A;  3CR4 X;  3OP0 A;  5K89 A;  3OX5 A;  1EH2 A;  4NDB A;  1L2O C;  3QRX A;  1KQV A;  5HLO A;  2BCB A;  1QVI Z;  1ALV A;  4GGN A;  2B1U A;  2JC2 A;  2OTG B;  4TNC A;  3DVK A;  4DS7 A;  1B4C A;  5JOL A;  1PRW A;  1QLK A;  2WCE A;  1CNP A;  2RGI A;  4PE1 A;  4I5K A;  1X02 A;  1NX0 A;  4PE4 A;  1K9K A;  4GGF A;  3DD4 A;  3BQ3 A;  1M63 B;  1RWY A;  1RK9 A;  1SPY A;  3CR5 X;  1QLS A;  2BE4 A;  1DJI A;  1Y1U A;  4YRU A;  1NX3 A;  3I5H B;  4JWQ A;  1PUL A;  3TDU A;  1J7P A;  1F8H A;  2F3Z A;  1EG3 A;  3BYA A;  3ICB A;  2KGB C;  1CFC A;  1JUO A;  1UUR A;  5AAN A;  2KQY A;  3OB1 B;  3EVU A;  2TN4 A;  3NSK A;  1KK7 Y;  4C0J A;  1IH0 A;  3KO0 A;  5HYD A;  3PM8 A;  1CMF A;  1CLL A;  3SG6 A;  2LMT A;  4MRY A;  4CFR A;  1LA3 A;  4C0L A;  4MLW A;  1DJH A;  2KFH A;  1JBA A;  4NDC A;  4PHN A;  4USL A;  3VGO A;  1J7R A;  3KPX A;  1NIW A;  1DGV A;  1ODB A;  4A4B A;  2BKH B;  2L98 A;  3D0Y A;  4GBA A;  3SIB A;  1VRK A;  4CLN A;  1B7T Z;  1DF0 A;  1G33 A;  2IS9 A;  3I5G C;  4DRW A;  3DF0 A;  3NSO A;  1B8C A;  3KF9 A;  4YGA A;  4ZCV A;  3PAL A;  1M39 A;  3EK4 A;  1IJ6 A;  1IJ5 A;  3PAT A;  1GGZ A;  4OV2 A;  1TNP A;  1CM4 A;  5G08 A;  3PFV A;  1K9P A;  3IF7 A;  5GQQ C;  3A8R A;  1F70 A;  1TIZ A;  1XFU O;  5DKQ A;  1TRF A;  1L2O B;  4PHK A;  3BUN B;  2MA2 A;  2BBM A;  4MN0 A;  3HX4 A;  4P5O E;  1XFV O;  1TCF A;  2L0P A;  3SG2 A;  1SL8 A;  3EK7 A;  1F71 A;  2VRG A;  1SKT A;  5KTY A;  1FBV A;  1YUT A;  5HKY A;  3GK4 X;  4FTG A;  4OKH A;  4PE0 A;  4XYN A;  3MSE B;  2K7O A;  3CWG A;  5BPJ A;  1B8R A;  1NPQ A;  1S36 A;  2KDH A;  3ZNI A;  1SRA A;  2M1K B;  4A4C A;  1CMG A;  2I18 A;  5AER A;  2MRD A;  2K61 A;  4M2O A;  4YGC B;  4GUK A;  2KAY A;  1EG4 A;  1CLB A;  1YUU A;  1Y6W A;  1DT7 B;  1M46 A;  2NZ0 A;  1E8A A;  3WXA A;  5AEQ A;  1K2H A;  2O5G A;  3I5F C;  1AJ5 A;  2LM5 A;  2QPT A;  1EJ3 A;  2KBM A;  2ISD A;  1J1E A;  2PAS A;  5IBW A;  1CM1 A;  3BUX B;  4GPL B;  5HLV A;  4PHM A;  1F55 A;  3JVT C;  2E6W A;  1B1G A;  2BKI B;  2ZNE A;  4UPG A;  3JTD C;  3DVJ A;  1DGU A;  1V1F A;  1CTR A;  1QX5 B;  1SYM A;  1KFU S;  3EKH A;  4OCI A;  3H4S E;  1SW8 A;  2NLN A;  4MSP A;  2G2B A;  3ZWH A;  2Q4U A;  4YGE B;  4DIR A;  3I5G B;  2K2A A;  3K21 A;  2O60 A;  2R2I A;  1WLM A;  2KAX A;  1DJY A;  2Y1N A;  2HF5 A;  2GGM A;  4L9M A;  3HCM A;  1YTZ C;  1DVI A;  2LE9 B;  1DJG A;  2BBN A;  2LLT A;  4YGD B;  3RLZ A;  4PHJ A;  3EVR A;  1YX8 A;  3SJS A;  1A2X A;  1A29 A;  2MLE C;  2L4H A;  3GK1 A;  1QX2 A;  2LMV A;  4MZK A;  2SCP A;  2WCF A;  1CB1 A;  2CNP A;  4MZL A;  3WHT B;  4HRH A;  1QIW A;  2JRF A;  4MBE A;  4MVF A;  1MXL C;  1YR5 A;  3VRO A;  1CKK A;  1QAS A;  1WRK A;  1J7Q A;  2GV5 A;  1YX7 A;  4OVN F;  2JUL A;  3SG7 A;  1CFD A;  1MF8 B;  1QS7 A;  1PVA A;  2ZN8 A;  1BR4 B;  1OZO A;  4M2Q A;  4AOM A;  2MAZ A;  3VRP A;  4CPV A;  2H2K A;  1HQV A;  1FF1 A;  1XK4 A;  3DVM A;  3GK2 A;  1XFX O;  5PAL A;  1MWN A;  1F4Q A;  1IRJ A;  5DKN A;  3I5F B;  2L4I A;  1SCM C;  1ZAC A;  2CCM A;  2BL0 C;  3TZ1 A;  1NYA A;  4QJ3 B;  2KNE A;  2KFF A;  2M3W A;  1S6J A;  1TNQ A;  1XK4 C;  3JVT B;  4GFT A;  3FWC A;  3O4Y A;  2L2E A;  2M49 B;  3O78 A;  1C7V A;  3AKA A;  2BCX A;  2D8N A;  4ORA B;  1DTL A;  1UUS A;  3LK1 A;  3PN7 C;  1AK8 A;  2JNX A;  1CDM A;  2PVB A;  2M9G A;  1S3P A;  1CDL A;  2CTN A;  4ORB B;  1QVI Y;  1JFJ A;  4BY5 A;  4YBH B;  1K93 D;  2H61 C;  3A4U B;  1YUR A;  1S5G Z;  4F0Z B;  2LLS A;  5FYX A;  1KFX S;  2KYF A;  4AQI A;  2Y4Q A;  4XJK B;  1SY9 A;  2LHL A;  2LAN A;  2M7N A;  1REC A;  4QJ5 B;  1KK8 C;  1UHI A;  2LP2 A;  3CGA A;  1JC2 A;  1K9U A;  2ZKM X;  3BOW B;  2PAL A;  2CBL A;  1R6P A;  1WDC C;  1CFF A;  2LV7 A;  4N1F A;  2HQ8 A;  2L5X B;  1CFP A;  3KHE A;  2KYC A;  3CLN A;  1SL9 A;  3BUO B;  1HT9 A;  4YI9 A;  1AP4 A;  2LC5 A;  1KCY A;  5HKW A;  3GOF A;  5B8I B;  1OOJ A;  2FCE A;  1SK6 D;  1C7W A;  1BOC A;  5I2O A;  3KEV A;  1N65 A;  4HRG A;  1RRO A;  4BY4 A;  2I2R E;  1QAT A;  1S26 D;  1IGV A;  2F2O A;  3BXK A;  5CSF A;  1BR1 B;  1NCX A;  4I5N B;  1AUI B;  2KI4 C;  1B7T Y;  2BL0 B;  1MQ1 A;  1S6I A;  2EHB A;  1OE9 B;  1W7I B;  1RFJ A;  2WND A;  1YVH A;  2CT9 A;  1N0Y A;  2L50 A;  1QV1 A;  1KQM C;  1SBJ A;  2JQ6 A;  1Y0V H;  2M97 A;  3CS1 A;  2KHN A;  2LVV A;  5KSZ A;  5D69 A;  1QTX A;  1ZUZ A;  2ZRT A;  1LVC D;  3PN7 B;  2FJU B;  4MEW A;  1OZS A;  3CR2 A;  1GQM A;  3LCP C;  1JF2 A;  2AMI A;  1FPW A;  2JNF A;  1QJT A;  4PCW A;  2JU0 A;  3CTN A;  5KU1 A;  4WQ3 A;  1R2U A;  2KBI A;  3I5H C;  1CDP A;  2JTZ A;  1MR8 A;  2LHI A;  2K8M B;  2KI6 C;  2WOR A;  3FS7 A;  1KFU L;  3LK0 A;  3OB2 B;  4XJK A;  1OSA A;  3RM1 A;  3TDI A;  1LIN A;  2LVI A;  4ORC B;  2F2P A;  4NQG A;  5I2L A;  1AHR A;  2LLU A;  2EGD A;  1A75 B;  1K90 D;  1TCO B;  3BOW A;  4P2Y B;  1PK0 D;  3EKJ A;  1JF0 A;  1A03 A;  1DJW A;  4C0K A;  1YUS A;  4CID A;  3E3R A;  1IKU A;  2ZN9 A;  3PSR A;  3WNX B;  2HQW A;  2BEC A;  1M31 A;  3NSL A;  4YGB B;  1QX7 A;  1J7O A;  5JJG A;  2JPT A;  2KI6 D;  2F8P A;  2HET A;  2OS8 C;  1XFW O;  4IL1 A;  4WQ2 A;  2M29 A;  4HRE E;  1KK7 Z;  1SMG A;  1H8B A;  1S6C A;  2I94 A;  5J3X A;  1W7J B;  2FOT A;  2LMU A;  3O6B A;  1L7Z A;  1SR6 C;  2Q91 A;  3O2P A;  1SCV A;  2COL B;  1B9A A;  3TS5 C;  2KI4 B;  1SNL A;  3OHM B;  3VRR A;  1UHN A;  5I8N A;  2M0R A;  1LA0 A;  1B47 A;  5AFP A;  1WLZ A;  2MBX A;  5CSN A;  2M7L A;  2LVJ A;  1KQM B;  1NWD A;  2MHH A;  1YRU B;  4NDD A;  1PAL A;  1PSB A;  1ZMZ A;  1Q80 A;  3BUM B;  3IQQ A;  4JPZ B;  2ZRS A;  4OR9 B;  5CPV A;  1IQ3 A;  2AAO A;  1BOD A;  1JWD A;  4D1E A;  1NX2 A;  1TN4 A;  1FI6 A;  1KWO C;  3JTD B;  1NCY A;  1MUX A;  2NCP A;  1S1E A;  4ETO A;  2JWW A;  1B8L A;  2H61 A;  1IQ5 A;  1ALW A;  1PVB A;  1QXP A;  1RTP 1;  3IQO A;  5D7F A;  4DCK A;  2K7C A;  1U5I B;  1XYD A;  4GGF C;  1A75 A;  5TNC A;  2EC6 C;  3WHU B;  3PLF B;  1OMD A;  2KFG A;  2G9B A;  1D1O A;  5I2Q A;  3NSI A;  4PE7 A;  1K95 A;  4R1E A;  1EXR A;  3CZT X;  2MLF C;  1EL4 A;  2JOJ A;  4HSZ A;  1NP8 A;  2PSR A;  4ICB A;  2V53 A;  4N5X A;  1YRT B;  1KFX L;  4GAO A;  1ZOT B;  1WRZ A;  2FCD A;  1OQP A;  1G4Y R;  1C07 A;  1UHJ A;  2KOT A;  2JT3 A;  2WOS A;  2JTT A;  2KAV A;  3F45 A;  2OPO A;  1M45 A;  4JQ0 D;  1AJ4 A;  1SL7 A;  2GGZ A;  3I5I C;  1MHO A;  1F4O A;  1QIV A;  1A4P A;  1DJZ A;  1UWO A;  4M2P A;  4MZJ A;  1AVS A;  2OS8 B;  3LLE A;  3TUY C;  2PRU A;  1UHH A;  2WC8 A;  1YVL A;  1TOP A;  2K7D A;  2M1U A;  2QAC A;  1FI5 A;  2HPS A;  1LKJ A;  1F54 A;  1TNX A;  3TDZ A;  2L51 A;  2AUC A;  3D10 A;  1K8U A;  4FQO A;  5ER5 A;  1N2D A;  2PMY A;  1G8I A;  1BG1 A;  4U8D A;  4E68 A;  1JFK A;  1SR6 B;  3VRQ A;  3VRN A;  1BLQ A;  3AAJ A;  2K2F A;  2LCP A;  2NXQ A;  3TS5 B;  1UP5 A;  4DUQ A;  1Y1X A;  1FW4 A;  1NX1 A;  2BE6 A;  4CFQ A;  3BUW B;  3AKB A;  4I5J A;  1SCM B;  5DKR A;  1K94 A;  5CSI A;  2JT0 A;  2JXC A;  1H4B A;  1BMO A;  1DJX A;  1KSO A;  1S5G Y;  3EK8 A;  4PDZ A;  3AAK A;  5AXI A;  2F33 A;  2ZFD A;  2JXL A;  1XVJ A;  2OTG C;  3C1V A;  1WY9 A;  3FWB A;  2WCB A;  2MJW B;  1KWO B;  2LUC A;  4PAL A;  1BF5 A;  1XFZ O;  3NXA A;  1XFY O;  1J1D A;  1JSA A;  2I7A A;  4YI8 A;  2DOQ A;  1U5I A;  1J55 A;  2ZND A;  1QV0 A;  1XA5 A;  1OMV A;  1K96 A;  1KSM A;  1TNW A;  4GNK B;  1CDN A;  5HKZ A;  2EC6 B;  2P6B B;  1XO5 A;  3EVV A;  4Q04 A;  2KQ6 A;  1BU3 A;  1NSH A;  1LXF C;  2SAS A;  1WRL A;  5ER4 X;  2KGR A;  3SG4 A;  2LAP A;  3SIA A;  1BT6 A;  2JT8 A;  2LVK A;  1ZFS A;  2LNK A;  3FIA A;  1KK8 B;  1TTX A;  1DMO A; 
#chains in the Genus database with same CATH topology
 2LUX A;  2M8U A;  4AQJ A;  1BOD A;  3LL8 B;  1RJV A;  2A4J A;  2NCO A;  1PSR A;  1WDC B;  3OX6 A;  3SG3 A;  3I5I B;  2K7B A;  5CSJ A;  3DVE A;  2KPH A;  2KSP A;  2E30 A;  1CLM A;  3B6X A;  3OGN A;  3TUY B;  1OMR A;  2Y1M A;  3DYE A;  4MRX A;  5F6T A;  1V1G A;  4ZCU A;  4QJ4 B;  1Y1A A;  2JZI A;  3IVT A;  2LP3 A;  1GJY A;  2BCA A;  3PJI A;  4I5L B;  3SG5 A;  3D0Y B;  5I94 A;  1GGW A;  1NCZ A;  4WRI A;  1DF0 B;  1NUB A;  3M0W A;  4N1G A;  2K0J A;  3DF0 B;  1IWQ A;  1UHK A;  2Y5I A;  1MXE A;  2CXJ A;  3SS4 A;  1BJF A;  2F3Y A;  3K1E A;  1IG5 A;  3CR4 X;  3OP0 A;  5K89 A;  3OX5 A;  1EH2 A;  4NDB A;  1L2O C;  3QRX A;  1KQV A;  5HLO A;  2BCB A;  1QVI Z;  1ALV A;  1Z2C B;  4GGN A;  2B1U A;  2JC2 A;  2OTG B;  4TNC A;  3DVK A;  4DS7 A;  1B4C A;  5JOL A;  1PRW A;  1QLK A;  2WCE A;  1CNP A;  2RGI A;  4PE1 A;  4I5K A;  1X02 A;  1NX0 A;  4PE4 A;  1K9K A;  3UO9 A;  2P71 A;  4GGF A;  3DD4 A;  3BQ3 A;  1M63 B;  1RWY A;  1RK9 A;  1SPY A;  4I5N B;  3CR5 X;  1QLS A;  2BE4 A;  1DJI A;  1Y1U A;  4YRU A;  1NX3 A;  3I5H B;  4JWQ A;  1PUL A;  3TDU A;  1J7P A;  1F8H A;  2F3Z A;  1EG3 A;  3BYA A;  3D76 A;  2KGB C;  3ICB A;  1CFC A;  1JUO A;  1UUR A;  5AAN A;  2KQY A;  3OB1 B;  3EVU A;  2TN4 A;  3NSK A;  1KK7 Y;  4C0J A;  1IH0 A;  3KO0 A;  5HYD A;  3PM8 A;  1CMF A;  1CLL A;  3SG6 A;  2LMT A;  4MRY A;  4CFR A;  1LA3 A;  4C0L A;  4MLW A;  1DJH A;  2KFH A;  2WCJ A;  4NDC A;  3DY9 A;  4PHN A;  4USL A;  3VGO A;  1JBA A;  1J7R A;  3KPX A;  1NIW A;  1DGV A;  1ODB A;  4A4B A;  2BKH B;  2L98 A;  3D0Y A;  4GBA A;  3SIB A;  1VRK A;  4CLN A;  1B7T Z;  1DF0 A;  1G33 A;  2IS9 A;  3I5G C;  4DRW A;  3DF0 A;  3D78 A;  3NSO A;  1B8C A;  3KF9 A;  4YGA A;  4ZCV A;  3PAL A;  1M39 A;  3EK4 A;  1IJ6 A;  1IJ5 A;  3PAT A;  1GGZ A;  4OV2 A;  1TNP A;  1CM4 A;  5D3O A;  5G08 A;  3PFV A;  1K9P A;  3IF7 A;  3B7A A;  5GQQ C;  3A8R A;  1F70 A;  1TIZ A;  1XFU O;  5DKQ A;  1TRF A;  1L2O B;  4PHK A;  3BUN B;  1C3Z A;  2BBM A;  2MA2 A;  3HX4 A;  4MN0 A;  4P5O E;  1XFV O;  1TCF A;  2L0P A;  3SG2 A;  1SL8 A;  5FI6 A;  1IIO A;  3EK7 A;  1F71 A;  2VRG A;  1SKT A;  5KTY A;  1FBV A;  1YUT A;  5HKY A;  3CZ1 A;  3GK4 X;  4FTG A;  4OKH A;  2QEV A;  4PE0 A;  4XYN A;  3MSE B;  2K7O A;  2KLE A;  3CWG A;  3FE6 A;  3BFA A;  5BPJ A;  1B8R A;  1NPQ A;  1S36 A;  2KDH A;  3ZNI A;  1SRA A;  2M1K B;  4A4C A;  1CMG A;  2I18 A;  5AER A;  2MRD A;  2K61 A;  4M2O A;  4YGC B;  4GUK A;  1OW4 A;  3L4A A;  2KAY A;  1EG4 A;  3D73 A;  4JD9 A;  1YUU A;  1Y6W A;  3S0F A;  1DT7 B;  1M46 A;  1CLB A;  2NZ0 A;  1E8A A;  3WXA A;  2WC5 A;  5AEQ A;  1K2H A;  1TWO A;  2O5G A;  3I5F C;  1AJ5 A;  2LM5 A;  2QPT A;  1EJ3 A;  2KBM A;  2ISD A;  1J1E A;  2QDI A;  2PAS A;  3QME A;  5IBW A;  1CM1 A;  3BUX B;  4GPL B;  5HLV A;  4PHM A;  1F55 A;  3JVT C;  2E6W A;  1B1G A;  2BKI B;  2ZNE A;  4UPG A;  3R1V A;  3JTD C;  3DVJ A;  1DGU A;  3SS3 A;  1V1F A;  1CTR A;  1QX5 B;  1SYM A;  1KFU S;  3EKH A;  4OCI A;  3H4S E;  2GTE A;  1SW8 A;  2NLN A;  4MSP A;  1Z4H A;  2G2B A;  3ZWH A;  2L5Y A;  2Q4U A;  4YGE B;  4DIR A;  3I5G B;  2K2A A;  3K21 A;  2O60 A;  2R2I A;  1WLM A;  2KAX A;  1DJY A;  2Y1N A;  2HF5 A;  2GGM A;  4L9M A;  3HCM A;  3V2L A;  4INW A;  2PYQ A;  5FI2 A;  1YTZ C;  1DVI A;  2LE9 B;  1DJG A;  2BBN A;  2LLT A;  1DC1 A;  4YGD B;  3RLZ A;  4PHJ A;  3EVR A;  1YX8 A;  3SJS A;  1A2X A;  1A29 A;  1OOF A;  2MLE C;  2L4H A;  2KLD A;  3GK1 A;  1QX2 A;  2LMV A;  4MZK A;  2SCP A;  2WCF A;  3PM2 A;  1CB1 A;  2H8V A;  2CNP A;  4MZL A;  3WHT B;  4HRH A;  1QIW A;  2JRF A;  3FE9 A;  4MBE A;  4MVF A;  1MXL C;  1YR5 A;  3OBV A;  3VRO A;  1CKK A;  1QAS A;  1WRK A;  1J7Q A;  2GV5 A;  1YX7 A;  4OVN F;  2JUL A;  3SG7 A;  1CFD A;  1MF8 B;  1QS7 A;  1PVA A;  2ZN8 A;  1BR4 B;  1OZO A;  4M2Q A;  4AOM A;  3NHT A;  5HL1 A;  2MAZ A;  3VRP A;  3CYZ A;  4CPV A;  2H2K A;  1HQV A;  1FF1 A;  1XK4 A;  3DVM A;  3GK2 A;  1XFX O;  5PAL A;  1MWN A;  1F4Q A;  1IRJ A;  5DKN A;  3I5F B;  2L4I A;  3R72 A;  1SCM C;  1ZAC A;  2CCM A;  2BL0 C;  3TZ1 A;  1NYA A;  4QJ3 B;  2KNE A;  2KFF A;  2M3W A;  3S0G A;  1S6J A;  1TNQ A;  1XK4 C;  3JVT B;  4GFT A;  3FWC A;  3O4Y A;  2L2E A;  2M49 B;  3O78 A;  1C7V A;  1DEK A;  2BCX A;  2D8N A;  3AKA A;  4ORA B;  2QEB A;  1DTL A;  1UUS A;  1SSE B;  3LK1 A;  3PN7 C;  1AK8 A;  2JNX A;  1CDM A;  2PVB A;  2M9G A;  2JPO A;  3D74 A;  1S3P A;  1CDL A;  2CTN A;  4ORB B;  1QVI Y;  1JFJ A;  2YGU A;  4BY5 A;  4YBH B;  1K93 D;  2WC6 A;  3Q8I A;  2H61 C;  3A4U B;  1YUR A;  1S5G Z;  4F0Z B;  2LLS A;  5FYX A;  2L2C A;  1KFX S;  2KYF A;  1P28 A;  4AQI A;  2Y4Q A;  4XJK B;  1SY9 A;  2LHL A;  2LAN A;  2M7N A;  2WCL A;  1REC A;  4QJ5 B;  1KK8 C;  1UHI A;  2LP2 A;  3CGA A;  3CZ2 A;  1JC2 A;  1K9U A;  2ZKM X;  3NGV A;  3BOW B;  2PAL A;  2CBL A;  1R6P A;  1WDC C;  1CFF A;  2LV7 A;  4N1F A;  2HQ8 A;  2L5X B;  1CFP A;  3KHE A;  2BAP A;  2KYC A;  3CLN A;  1SL9 A;  3BUO B;  1HT9 A;  4YI9 A;  2ERB A;  1AP4 A;  2LC5 A;  1KCY A;  5HKW A;  3GOF A;  5B8I B;  1OOJ A;  2FCE A;  1SK6 D;  1C7W A;  1BOC A;  5I2O A;  3KEV A;  1N65 A;  4HRG A;  1RRO A;  4BY4 A;  2I2R E;  1QAT A;  1S26 D;  4INX A;  3EG5 B;  1IGV A;  2F2O A;  2QEH A;  3BXK A;  5CSF A;  1BR1 B;  1NCX A;  3B88 A;  1AUI B;  2KI4 C;  1B7T Y;  2BL0 B;  1MQ1 A;  1S6I A;  2EHB A;  1OE9 B;  1W7I B;  1RFJ A;  1DQE A;  2WND A;  1YVH A;  2CT9 A;  1N0Y A;  2L50 A;  1QV1 A;  1KQM C;  3NHI A;  1SBJ A;  2JQ6 A;  1Y0V H;  2M97 A;  3CS1 A;  2KHN A;  2LVV A;  5KSZ A;  3L47 A;  5D69 A;  1QTX A;  1ZUZ A;  2ZRT A;  5DIC A;  1LVC D;  3PN7 B;  2FJU B;  4MEW A;  1OZS A;  4PT1 A;  3CR2 A;  1GQM A;  3LCP C;  1JF2 A;  5FI7 A;  2AMI A;  1FPW A;  2JNF A;  1QJT A;  4PCW A;  2JU0 A;  3CTN A;  2WCK A;  4WQ3 A;  5KU1 A;  1R2U A;  2KBI A;  3I5H C;  1CDP A;  2JTZ A;  1MR8 A;  2LHI A;  2K8M B;  2KI6 C;  2WOR A;  3FS7 A;  1KFU L;  3LK0 A;  3OB2 B;  1TUZ A;  1OSA A;  4XJK A;  3RM1 A;  1LIN A;  2LVI A;  3TDI A;  4ORC B;  2F2P A;  4NQG A;  5I2L A;  1AHR A;  2LLU A;  3S0B A;  2QEO A;  2EGD A;  1A75 B;  1K90 D;  1TCO B;  3BOW A;  3R1O A;  1PK0 D;  4P2Y B;  3EKJ A;  1JF0 A;  1A03 A;  1GM0 A;  2FJY A;  1ORG A;  1DJW A;  4C0K A;  1YUS A;  4CID A;  3E3R A;  1IKU A;  2ZN9 A;  3PSR A;  3WNX B;  2HQW A;  2BEC A;  1M31 A;  3NSL A;  4YGB B;  1QX7 A;  1J7O A;  5JJG A;  2JPT A;  2KI6 D;  2F8P A;  2HET A;  2OS8 C;  1XFW O;  4IL1 A;  4WQ2 A;  2M29 A;  4HRE E;  1KK7 Z;  1SMG A;  3DXL A;  1H8B A;  3L4L A;  4KYN A;  1S6C A;  2I94 A;  5J3X A;  1W7J B;  2FOT A;  2LMU A;  3O6B A;  1L7Z A;  1SR6 C;  2Q91 A;  3O2P A;  1SCV A;  1JWD A;  2COL B;  4FQT A;  1B9A A;  3TS5 C;  2KI4 B;  1SNL A;  3OHM B;  3VRR A;  1UHN A;  3BFB A;  2M0R A;  5I8N A;  1LA0 A;  1B47 A;  5AFP A;  1WLZ A;  2MBX A;  5CSN A;  2M7L A;  3BJH A;  5EL2 A;  3UNW A;  2LVJ A;  1KQM B;  1NWD A;  2MHH A;  1YRU B;  4NDD A;  4JKT A;  1PAL A;  1PSB A;  1ZMZ A;  1XFR A;  1Q80 A;  3BUM B;  3D75 A;  3IQQ A;  2ZRS A;  1T14 A;  1LS8 A;  4JPZ B;  2AAO A;  4OR9 B;  5CPV A;  3S0A A;  1IQ3 A;  4D1E A;  1NX2 A;  1TN4 A;  1FI6 A;  1KWO C;  3R1P A;  3JTD B;  1NCY A;  1MUX A;  2NCP A;  2PQL A;  1S1E A;  4ETO A;  2JWW A;  1B8L A;  2H61 A;  1IQ5 A;  1ALW A;  1OOI X;  1PVB A;  1QXP A;  1RTP 1;  2WCM A;  3IQO A;  5D7F A;  4OZD A;  2K7C A;  4DCK A;  3FE8 A;  1U5I B;  1XYD A;  4GGF C;  1A75 A;  5TNC A;  2EC6 C;  3WHU B;  3PLF B;  1OMD A;  2KFG A;  2G9B A;  1D1O A;  5I2Q A;  3NSI A;  4PE7 A;  1K95 A;  4R1E A;  1EXR A;  3CZT X;  2MLF C;  1EL4 A;  2JOJ A;  4HSZ A;  1NP8 A;  2PSR A;  4ICB A;  2V53 A;  4N5X A;  1YRT B;  1KFX L;  4GAO A;  1ZOT B;  1WRZ A;  2FCD A;  3D77 A;  1OQP A;  1G4Y R;  1C07 A;  1UHJ A;  2KOT A;  2JT3 A;  2WOS A;  2JTT A;  2KAV A;  3F45 A;  2OPO A;  1M45 A;  4JQ0 D;  1AJ4 A;  1SL7 A;  2GGZ A;  3I5I C;  3CZ0 A;  1MHO A;  1F4O A;  1QIV A;  3CAB A;  3RZS A;  1A4P A;  1DJZ A;  1UWO A;  4M2P A;  4MZJ A;  3S0D A;  1AVS A;  2OS8 B;  3LLE A;  3TUY C;  2PRU A;  1UHH A;  2WC8 A;  1YVL A;  1TOP A;  2K7D A;  2M1U A;  2QAC A;  1FI5 A;  4IJ7 A;  2HPS A;  1LKJ A;  1F54 A;  1TNX A;  2P70 A;  3TDZ A;  3B86 A;  1TUJ A;  2L51 A;  2AUC A;  4F7F A;  3D10 A;  1K8U A;  4FQO A;  5ER5 A;  1N2D A;  2PMY A;  1G8I A;  1BG1 A;  4U8D A;  4E68 A;  1JFK A;  1SR6 B;  3VRQ A;  3VRN A;  1BLQ A;  3AAJ A;  3O4X A;  2K2F A;  2LCP A;  2NXQ A;  3TS5 B;  1UP5 A;  3VB1 A;  4DUQ A;  2K60 A;  1Y1X A;  1FW4 A;  1NX1 A;  2BE6 A;  4CFQ A;  3BUW B;  3AKB A;  4I5J A;  1SCM B;  3BFH A;  5DKR A;  1K94 A;  1OOH A;  5CSI A;  2JT0 A;  1DMO A;  1W9Z A;  2JXC A;  1H4B A;  3B87 A;  1BMO A;  1DJX A;  1KSO A;  1S5G Y;  3EK8 A;  4PDZ A;  3AAK A;  5AXI A;  2F33 A;  1QWV A;  2ZFD A;  2JXL A;  1XVJ A;  2OTG C;  3C1V A;  1WY9 A;  3FWB A;  2WCB A;  2MJW B;  3S0E A;  1KWO B;  2LUC A;  4PAL A;  1BF5 A;  1C3Y A;  1XFZ O;  3NXA A;  1XFY O;  1J1D A;  1JSA A;  2I7A A;  4YI8 A;  2DOQ A;  1U5I A;  1J55 A;  1OOG A;  1QV0 A;  2ZND A;  1XA5 A;  1OMV A;  1K96 A;  2BNX A;  3SS5 A;  1KSM A;  1TNW A;  2WCH A;  3CDN A;  4GNK B;  5HKZ A;  2EC6 B;  2P6B B;  1CDN A;  1XO5 A;  3EVV A;  4Q04 A;  2KQ6 A;  1BU3 A;  1NSH A;  1LXF C;  2SAS A;  1WRL A;  5ER4 X;  1DEL A;  2KGR A;  3SG4 A;  3DZT A;  2LAP A;  3SIA A;  1BT6 A;  2JT8 A;  2LVK A;  1ZFS A;  2LNK A;  3FIA A;  1KK8 B;  1TTX A;  3N7H A; 
#chains in the Genus database with same CATH homology
 2LUX A;  2M8U A;  4AQJ A;  3LL8 B;  1RJV A;  2A4J A;  2NCO A;  1PSR A;  1WDC B;  3OX6 A;  3SG3 A;  3I5I B;  2K7B A;  5CSJ A;  3DVE A;  2KSP A;  2E30 A;  1CLM A;  3TUY B;  1OMR A;  2Y1M A;  5F6T A;  4MRX A;  4ZCU A;  1V1G A;  4QJ4 B;  1Y1A A;  2JZI A;  2LP3 A;  1GJY A;  2BCA A;  4I5L B;  3SG5 A;  3D0Y B;  1GGW A;  1NCZ A;  4WRI A;  1DF0 B;  1NUB A;  3M0W A;  4N1G A;  2K0J A;  3DF0 B;  1IWQ A;  1UHK A;  2Y5I A;  1MXE A;  2CXJ A;  1BJF A;  2F3Y A;  1IG5 A;  3CR4 X;  3OP0 A;  5K89 A;  3OX5 A;  1EH2 A;  4NDB A;  1L2O C;  3QRX A;  1KQV A;  5HLO A;  2BCB A;  1QVI Z;  1ALV A;  4GGN A;  2B1U A;  2JC2 A;  2OTG B;  4TNC A;  3DVK A;  4DS7 A;  1B4C A;  5JOL A;  1PRW A;  1QLK A;  2WCE A;  1CNP A;  2RGI A;  4PE1 A;  4I5K A;  1X02 A;  1NX0 A;  4PE4 A;  1K9K A;  4GGF A;  3DD4 A;  3BQ3 A;  1M63 B;  1RWY A;  1RK9 A;  1SPY A;  3CR5 X;  1QLS A;  2BE4 A;  1DJI A;  1Y1U A;  4YRU A;  1NX3 A;  3I5H B;  4JWQ A;  1PUL A;  3TDU A;  1J7P A;  1F8H A;  2F3Z A;  1EG3 A;  3BYA A;  3ICB A;  2KGB C;  1CFC A;  1JUO A;  1UUR A;  5AAN A;  2KQY A;  3OB1 B;  3EVU A;  2TN4 A;  3NSK A;  1KK7 Y;  4C0J A;  1IH0 A;  3KO0 A;  5HYD A;  3PM8 A;  1CMF A;  1CLL A;  3SG6 A;  2LMT A;  4MRY A;  4CFR A;  1LA3 A;  4C0L A;  4MLW A;  1DJH A;  2KFH A;  1JBA A;  4NDC A;  4PHN A;  4USL A;  3VGO A;  1J7R A;  3KPX A;  1NIW A;  1DGV A;  1ODB A;  4A4B A;  2BKH B;  2L98 A;  3D0Y A;  4GBA A;  3SIB A;  1VRK A;  4CLN A;  1B7T Z;  1DF0 A;  1G33 A;  2IS9 A;  3I5G C;  4DRW A;  3DF0 A;  3NSO A;  1B8C A;  3KF9 A;  4YGA A;  4ZCV A;  3PAL A;  1M39 A;  3EK4 A;  1IJ6 A;  1IJ5 A;  3PAT A;  1GGZ A;  4OV2 A;  1TNP A;  1CM4 A;  5G08 A;  3PFV A;  1K9P A;  3IF7 A;  5GQQ C;  3A8R A;  1F70 A;  1TIZ A;  1XFU O;  5DKQ A;  1TRF A;  1L2O B;  4PHK A;  3BUN B;  2MA2 A;  2BBM A;  4MN0 A;  3HX4 A;  4P5O E;  1XFV O;  1TCF A;  2L0P A;  3SG2 A;  1SL8 A;  3EK7 A;  1F71 A;  2VRG A;  1SKT A;  5KTY A;  1FBV A;  1YUT A;  5HKY A;  3GK4 X;  4FTG A;  4OKH A;  4PE0 A;  4XYN A;  3MSE B;  2K7O A;  3CWG A;  5BPJ A;  1B8R A;  1NPQ A;  1S36 A;  2KDH A;  3ZNI A;  1SRA A;  2M1K B;  4A4C A;  1CMG A;  2I18 A;  5AER A;  2MRD A;  2K61 A;  4M2O A;  4YGC B;  4GUK A;  2KAY A;  1EG4 A;  1CLB A;  1YUU A;  1Y6W A;  1DT7 B;  1M46 A;  2NZ0 A;  1E8A A;  3WXA A;  5AEQ A;  1K2H A;  2O5G A;  3I5F C;  1AJ5 A;  2LM5 A;  2QPT A;  1EJ3 A;  2KBM A;  2ISD A;  1J1E A;  2PAS A;  5IBW A;  1CM1 A;  3BUX B;  4GPL B;  5HLV A;  4PHM A;  1F55 A;  3JVT C;  2E6W A;  1B1G A;  2BKI B;  2ZNE A;  4UPG A;  3JTD C;  3DVJ A;  1DGU A;  1V1F A;  1CTR A;  1QX5 B;  1SYM A;  1KFU S;  3EKH A;  4OCI A;  3H4S E;  1SW8 A;  2NLN A;  4MSP A;  2G2B A;  3ZWH A;  2Q4U A;  4YGE B;  4DIR A;  3I5G B;  2K2A A;  3K21 A;  2O60 A;  2R2I A;  1WLM A;  2KAX A;  1DJY A;  2Y1N A;  2HF5 A;  2GGM A;  4L9M A;  3HCM A;  1YTZ C;  1DVI A;  2LE9 B;  1DJG A;  2BBN A;  2LLT A;  4YGD B;  3RLZ A;  4PHJ A;  3EVR A;  1YX8 A;  3SJS A;  1A2X A;  1A29 A;  2MLE C;  2L4H A;  3GK1 A;  1QX2 A;  2LMV A;  4MZK A;  2SCP A;  2WCF A;  1CB1 A;  2CNP A;  4MZL A;  3WHT B;  4HRH A;  1QIW A;  2JRF A;  4MBE A;  4MVF A;  1MXL C;  1YR5 A;  3VRO A;  1CKK A;  1QAS A;  1WRK A;  1J7Q A;  2GV5 A;  1YX7 A;  4OVN F;  2JUL A;  3SG7 A;  1CFD A;  1MF8 B;  1QS7 A;  1PVA A;  2ZN8 A;  1BR4 B;  1OZO A;  4M2Q A;  4AOM A;  2MAZ A;  3VRP A;  4CPV A;  2H2K A;  1HQV A;  1FF1 A;  1XK4 A;  3DVM A;  3GK2 A;  1XFX O;  5PAL A;  1MWN A;  1F4Q A;  1IRJ A;  5DKN A;  3I5F B;  2L4I A;  1SCM C;  1ZAC A;  2CCM A;  2BL0 C;  3TZ1 A;  1NYA A;  4QJ3 B;  2KNE A;  2KFF A;  2M3W A;  1S6J A;  1TNQ A;  1XK4 C;  3JVT B;  4GFT A;  3FWC A;  3O4Y A;  2L2E A;  2M49 B;  3O78 A;  1C7V A;  3AKA A;  2BCX A;  2D8N A;  4ORA B;  1DTL A;  1UUS A;  3LK1 A;  3PN7 C;  1AK8 A;  2JNX A;  1CDM A;  2PVB A;  2M9G A;  1S3P A;  1CDL A;  2CTN A;  4ORB B;  1QVI Y;  1JFJ A;  4BY5 A;  4YBH B;  1K93 D;  2H61 C;  3A4U B;  1YUR A;  1S5G Z;  4F0Z B;  2LLS A;  5FYX A;  1KFX S;  2KYF A;  4AQI A;  2Y4Q A;  4XJK B;  1SY9 A;  2LHL A;  2LAN A;  2M7N A;  1REC A;  4QJ5 B;  1KK8 C;  1UHI A;  2LP2 A;  3CGA A;  1JC2 A;  1K9U A;  2ZKM X;  3BOW B;  2PAL A;  2CBL A;  1R6P A;  1WDC C;  1CFF A;  2LV7 A;  4N1F A;  2HQ8 A;  2L5X B;  1CFP A;  3KHE A;  2KYC A;  3CLN A;  1SL9 A;  3BUO B;  1HT9 A;  4YI9 A;  1AP4 A;  2LC5 A;  1KCY A;  5HKW A;  3GOF A;  5B8I B;  1OOJ A;  2FCE A;  1SK6 D;  1C7W A;  1BOC A;  5I2O A;  3KEV A;  1N65 A;  4HRG A;  1RRO A;  4BY4 A;  2I2R E;  1QAT A;  1S26 D;  1IGV A;  2F2O A;  3BXK A;  5CSF A;  1BR1 B;  1NCX A;  4I5N B;  1AUI B;  2KI4 C;  1B7T Y;  2BL0 B;  1MQ1 A;  1S6I A;  2EHB A;  1OE9 B;  1W7I B;  1RFJ A;  2WND A;  1YVH A;  2CT9 A;  1N0Y A;  2L50 A;  1QV1 A;  1KQM C;  1SBJ A;  2JQ6 A;  1Y0V H;  2M97 A;  3CS1 A;  2KHN A;  2LVV A;  5KSZ A;  5D69 A;  1QTX A;  1ZUZ A;  2ZRT A;  1LVC D;  3PN7 B;  2FJU B;  4MEW A;  1OZS A;  3CR2 A;  1GQM A;  3LCP C;  1JF2 A;  2AMI A;  1FPW A;  2JNF A;  1QJT A;  4PCW A;  2JU0 A;  3CTN A;  5KU1 A;  4WQ3 A;  1R2U A;  2KBI A;  3I5H C;  1CDP A;  2JTZ A;  1MR8 A;  2LHI A;  2K8M B;  2KI6 C;  2WOR A;  3FS7 A;  1KFU L;  3LK0 A;  3OB2 B;  4XJK A;  1OSA A;  3RM1 A;  3TDI A;  1LIN A;  2LVI A;  4ORC B;  2F2P A;  4NQG A;  5I2L A;  1AHR A;  2LLU A;  2EGD A;  1A75 B;  1K90 D;  1TCO B;  3BOW A;  4P2Y B;  1PK0 D;  3EKJ A;  1JF0 A;  1A03 A;  1DJW A;  4C0K A;  1YUS A;  4CID A;  3E3R A;  1IKU A;  2ZN9 A;  3PSR A;  3WNX B;  2HQW A;  2BEC A;  1M31 A;  3NSL A;  4YGB B;  1QX7 A;  1J7O A;  5JJG A;  2JPT A;  2KI6 D;  2F8P A;  2HET A;  2OS8 C;  1XFW O;  4IL1 A;  4WQ2 A;  2M29 A;  4HRE E;  1KK7 Z;  1SMG A;  1H8B A;  1S6C A;  2I94 A;  5J3X A;  1W7J B;  2FOT A;  2LMU A;  3O6B A;  1L7Z A;  1SR6 C;  2Q91 A;  3O2P A;  1SCV A;  2COL B;  1B9A A;  3TS5 C;  2KI4 B;  1SNL A;  3OHM B;  3VRR A;  1UHN A;  5I8N A;  2M0R A;  1LA0 A;  1B47 A;  5AFP A;  1WLZ A;  2MBX A;  5CSN A;  2M7L A;  2LVJ A;  1KQM B;  1NWD A;  2MHH A;  1YRU B;  4NDD A;  1PAL A;  1PSB A;  1ZMZ A;  1Q80 A;  3BUM B;  3IQQ A;  4JPZ B;  2ZRS A;  4OR9 B;  5CPV A;  1IQ3 A;  2AAO A;  1BOD A;  1JWD A;  4D1E A;  1NX2 A;  1TN4 A;  1FI6 A;  1KWO C;  3JTD B;  1NCY A;  1MUX A;  2NCP A;  1S1E A;  4ETO A;  2JWW A;  1B8L A;  2H61 A;  1IQ5 A;  1ALW A;  1PVB A;  1QXP A;  1RTP 1;  3IQO A;  5D7F A;  4DCK A;  2K7C A;  1U5I B;  1XYD A;  4GGF C;  1A75 A;  5TNC A;  2EC6 C;  3WHU B;  3PLF B;  1OMD A;  2KFG A;  2G9B A;  1D1O A;  5I2Q A;  3NSI A;  4PE7 A;  1K95 A;  4R1E A;  1EXR A;  3CZT X;  2MLF C;  1EL4 A;  2JOJ A;  4HSZ A;  1NP8 A;  2PSR A;  4ICB A;  2V53 A;  4N5X A;  1YRT B;  1KFX L;  4GAO A;  1ZOT B;  1WRZ A;  2FCD A;  1OQP A;  1G4Y R;  1C07 A;  1UHJ A;  2KOT A;  2JT3 A;  2WOS A;  2JTT A;  2KAV A;  3F45 A;  2OPO A;  1M45 A;  4JQ0 D;  1AJ4 A;  1SL7 A;  2GGZ A;  3I5I C;  1MHO A;  1F4O A;  1QIV A;  1A4P A;  1DJZ A;  1UWO A;  4M2P A;  4MZJ A;  1AVS A;  2OS8 B;  3LLE A;  3TUY C;  2PRU A;  1UHH A;  2WC8 A;  1YVL A;  1TOP A;  2K7D A;  2M1U A;  2QAC A;  1FI5 A;  2HPS A;  1LKJ A;  1F54 A;  1TNX A;  3TDZ A;  2L51 A;  2AUC A;  3D10 A;  1K8U A;  4FQO A;  5ER5 A;  1N2D A;  2PMY A;  1G8I A;  1BG1 A;  4U8D A;  4E68 A;  1JFK A;  1SR6 B;  3VRQ A;  3VRN A;  1BLQ A;  3AAJ A;  2K2F A;  2LCP A;  2NXQ A;  3TS5 B;  1UP5 A;  4DUQ A;  1Y1X A;  1FW4 A;  1NX1 A;  2BE6 A;  4CFQ A;  3BUW B;  3AKB A;  4I5J A;  1SCM B;  5DKR A;  1K94 A;  5CSI A;  2JT0 A;  2JXC A;  1H4B A;  1BMO A;  1DJX A;  1KSO A;  1S5G Y;  3EK8 A;  4PDZ A;  3AAK A;  5AXI A;  2F33 A;  2ZFD A;  2JXL A;  1XVJ A;  2OTG C;  3C1V A;  1WY9 A;  3FWB A;  2WCB A;  2MJW B;  1KWO B;  2LUC A;  4PAL A;  1BF5 A;  1XFZ O;  3NXA A;  1XFY O;  1J1D A;  1JSA A;  2I7A A;  4YI8 A;  2DOQ A;  1U5I A;  1J55 A;  2ZND A;  1QV0 A;  1XA5 A;  1OMV A;  1K96 A;  1KSM A;  1TNW A;  4GNK B;  1CDN A;  5HKZ A;  2EC6 B;  2P6B B;  1XO5 A;  3EVV A;  4Q04 A;  2KQ6 A;  1BU3 A;  1NSH A;  1LXF C;  2SAS A;  1WRL A;  5ER4 X;  2KGR A;  3SG4 A;  2LAP A;  3SIA A;  1BT6 A;  2JT8 A;  2LVK A;  1ZFS A;  2LNK A;  3FIA A;  1KK8 B;  1TTX A;  1DMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...