3H4SE

Structure of the complex of a mitotic kinesin with its calcium binding regulator
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
107
structure length
96
Chain Sequence
ETKYDVEEFVSELCKGFSLLADPERHLITAESLRRNSGILGIEGMSKEDAQGMVREGDLDGDGALNQTEFCVLMVRLSPEMMEDAETWLEKALTQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Motor protein/calcium binding protein
molecule keywords Kinesin-like calmodulin-binding protein
publication title Structure of the complex of a mitotic kinesin with its calcium binding regulator.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 30
structure length 96
sequence length 107
ec nomenclature
pdb deposition date 2009-04-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3h4sE00
1JFJA 1S6CA 1FI5A 3DVJA 2L50A 1SNLA 5ER5A 2F3ZA 4QJ3B 1U5IB 2LV7A 1NX1A 2LMUA 4P5OE 2F3YA 2F2OA 5DKRA 5I8NA 2CCMA 1JF2A 3JTDB 3EK7A 1NCXA 2HPSA 1JSAA 1TNPA 2KAVA 1Y6WA 2WORA 2LLSA 1TNXA 2R2IA 3LK0A 2FOTA 3TS5C 2CXJA 3D10A 1KFXL 1OMDA 4XYNA 2LHLA 3NXAA 2NZ0A 2KI6C 2CNPA 1X02A 1C7VA 1DTLA 1N65A 3VRNA 3AKAA 1EG4A 2M1KB 1L2OB 1BLQA 1JWDA 2WC8A 2JZIA 2AAOA 1DVIA 3EK4A 2CBLA 2KGBC 1KSMA 3O78A 2LMVA 1C07A 4WRIA 1EJ3A 3TUYC 2JRFA 1OE9B 2K7BA 3K21A 3KPXA 4HRHA 3GOFA 1FI6A 1KK7Y 1ZFSA 4R1EA 4QJ4B 3KO0A 1S6IA 1RFJA 1LA3A 1RTP1 1SCMB 1W7JB 1NPQA 2M97A 4DRWA 2BECA 1D1OA 2A4JA 2EHBA 1KK7Z 1IH0A 3WXAA 1E8AA 1QS7A 1ZMZA 3EKHA 3PATA 1B8RA 3OX6A 1Y1AA 2KFGA 2LLTA 4NDCA 5DKNA 4A4BA 1BG1A 4ZCVA 2F2PA 1M39A 1CMFA 1RECA 1W7IB 3BUXB 3EK8A 3FWBA 1A4PA 3VGOA 2Q91A 3I5FC 4YI9A 4CPVA 3I5HB 2FJUB 5PALA 1XO5A 2JOJA 2G9BA 4ZCUA 5CSNA 4AQJA 1WY9A 1CNPA 5CSIA 3H4SE 1J1EA 1OOJA 4YGDB 1YUTA 2RGIA 3ZWHA 1JC2A 2L4IA 2M7NA 1NX0A 3I5GC 2ZNDA 1NSHA 2KFFA 2HQWA 1SRAA 4PHNA 1CDLA 5CSFA 2KOTA 4NQGA 4YGAA 2JULA 1NP8A 2DOQA 3PN7B 4FQOA 1EG3A 1SL7A 2LUXA 3SG5A 2GGZA 3IQQA 3KEVA 3LL8B 4N1FA 1K2HA 5JOLA 4XJKB 1DJHA 2VRGA 1OSAA 3PALA 1CFFA 1K9KA 1TTXA 1TNQA 2K7CA 4U8DA 1XFYO 1SY9A 1YRTB 3SG4A 1N2DA 1NCYA 1R2UA 3JVTB 1PALA 2PASA 2G2BA 2BE4A 2HF5A 4OV2A 2H61A 1SR6B 3D0YA 2OTGB 4MSPA 1MUXA 2NLNA 3O6BA 2KI4C 3PLFB 1IKUA 1ZUZA 4HSZA 1MXLC 5I2LA 1C7WA 3SG3A 5KTYA 2JT8A 1KQMB 2KSPA 1DJWA 5AFPA 4PALA 1SL8A 4BY5A 1G4YR 5KU1A 2L0PA 1IJ5A 1QX7A 3I5HC 4MRXA 1LKJA 4PHMA 4YGCB 5J3XA 1DF0B 4ETOA 2MJWB 1YUSA 3PM8A 2O5GA 1OQPA 2PALA 1H8BA 1KQVA 1TN4A 2M8UA 2LHIA 3WNXB 1J1DA 4GUKA 2JXLA 3TDZA 1NWDA 3BUWB 2EC6B 3CR5X 2FCEA 2H61C 1IWQA 5HLOA 2B1UA 3PN7C 1OMRA 4FTGA 2Y4QA 5FYXA 4HRGA 4GNKB 3BQ3A 1UP5A 2SASA 1BT6A 1F54A 1UHJA 1B8LA 1SMGA 2M49B 4I5KA 4MRYA 3EVVA 5CSJA 3TZ1A 1DT7B 1CMGA 1B7TY 3VROA 1OZSA 1QX5B 4MVFA 1FW4A 4PE0A 1F8HA 1KFUS 1NX2A 3M0WA 4Q04A 5KSZA 1BODA 1LINA 3IF7A 4IL1A 1YR5A 2LM5A 1YURA 3JVTC 1PVAA 3I5IC 1CLBA 1HQVA 1XFWO 2Y1MA 1B7TZ 3AAKA 1S6JA 2OS8C 4N1GA 4MN0A 2OTGC 2BE6A 5AANA 3SIBA 1KK8C 1M63B 2PSRA 2L5XB 1U5IA 2I94A 1DJXA 1XFVO 2BKIB 1LVCD 1KQMC 3QRXA 5GQQC 3OB2B 5AEQA 2JXCA 2QPTA 2ZFDA 1UWOA 1WDCC 2JT0A 2BKHB 4ORAB 1J7PA 1B9AA 1XVJA 1QLSA 3SG7A 2MLFC 4C0LA 1TNWA 1J7RA 1SYMA 3KHEA 3AKBA 1CFPA 1CDPA 2MA2A 4P2YB 1DGUA 1QIVA 2BBMA 4AOMA 4C0KA 1RK9A 4MZKA 2BCAA 1MQ1A 1ZOTB 2PVBA 2D8NA 1WRZA 3NSKA 1BU3A 5D69A 4PHKA 4PDZA 1RROA 2K8MB 3OP0A 1CKKA 1A2XA 1J7OA 4MZJA 3BOWB 2K0JA 5AXIA 2LVKA 1ALWA 3MSEB 2MLEC 5I2OA 5BPJA 1QIWA 3DVMA 1DMOA 1F4OA 3BUNB 5HKWA 2KGRA 3EVUA 2L98A 3CLNA 3WHTB 2BL0B 3JTDC 1FF1A 4JPZB 1XA5A 2TN4A 2WCFA 1QLKA 1CM4A 1KWOB 1UHNA 3E3RA 3TDUA 5HLVA 4NDDA 2KYFA 1DGVA 1BF5A 1SK6D 2F33A 1NIWA 2LLUA 1ALVA 3DF0B 3PFVA 2LC5A 1EL4A 3IQOA 2JQ6A 3GK1A 1L2OC 2F8PA 1MR8A 1S26D 2IS9A 3ZNIA 4M2PA 2M7LA 1KFXS 1CFCA 2CT9A 2K61A 2LP2A 3LK1A 2LP3A 1K9PA 4YGBB 3CTNA 1TCOB 5JJGA 4OCIA 1PULA 1M31A 3RM1A 1SCMC 1SBJA 1UHIA 1UUSA 1XYDA 2I18A 1ODBA 1YVHA 2LUCA 1Y1XA 2LMTA 4PHJA 3CS1A 2JNXA 1QVIY 4D1EA 1SW8A 3LLEA 2E6WA 3C1VA 2AUCA 2EGDA 2BCXA 1F55A 3A8RA 3SG2A 1KCYA 4XJKA 3FIAA 2M1UA 2H2KA 2O60A 1QVIZ 4E68A 4GGNA 3A4UB 2BBNA 1R6PA 2JPTA 2M0RA 4M2QA 2JWWA 1A75A 5DKQA 1K9UA 2KAXA 2M9GA 3WHUB 1XFZO 2LNKA 4JWQA 1XK4C 3TS5B 4CFQA 1QTXA 1K94A 1V1FA 1JFKA 1NUBA 1Y0VH 4MZLA 2Q4UA 2SCPA 2ZKMX 3CGAA 4PE1A 1BOCA 1NCZA 1UHHA 5K89A 4ORBB 1CB1A 1H4BA 1N0YA 1TOPA 4OR9B 2MAZA 3TDIA 3ICBA 3HX4A 2ISDA 1OMVA 2NXQA 1IQ5A 5HYDA 1BJFA 1DJIA 5HKZA 2K7OA 1BMOA 3TUYB 2WOSA 1RJVA 1WRLA 2I7AA 4CIDA 2ZN8A 4PCWA 4CLNA 4OKHA 2QACA 4WQ3A 4GGFA 5HKYA 3BUOB 1K93D 1OZOA 1SR6C 2KBIA 4YI8A 4CFRA 2ZRSA 3DD4A 2P6BB 1LA0A 1QX2A 1QV0A 1EXRA 1GQMA 3CZTX 3GK4X 3NSLA 2K2FA 3I5FB 1JF0A 1L7ZA 1AJ4A 2I2RE 3AAJA 4GBAA 4GPLB 1QASA 3VRRA 4F0ZB 1B8CA 2MHHA 2COLB 1GGWA 4YBHB 2NCPA 1BR1B 1BR4B 2FCDA 1JUOA 2JU0A 4ORCB 1DJZA 4DCKA 2JT3A 3I5GB 2LVJA 1S36A 1XFUO 1IGVA 2LVVA 1B4CA 4GGFC 1VRKA 1PVBA 2EC6C 3SG6A 2LAPA 3NSIA 3CWGA 1MHOA 4ICBA 1A29A 1XFXO 1YTZC 2WCBA 4TNCA 5B8IB 4OVNF 4QJ5B 1K8UA 3F45A 2KQYA 3OHMB 5ER4X 1J55A 2GGMA 2KFHA 4MLWA 2KI6D 2JNFA 1AJ5A 3NSOA 2L4HA 3BOWA 2BCBA 2HQ8A 3RLZA 4USLA 1DJGA 2KI4B 4I5LB 1S5GY 1YRUB 2GV5A 5IBWA 1NX3A 1CTRA 1V1GA 2KBMA 4DUQA 1AHRA 1QV1A 1DJYA 1S5GZ 2HETA 4JQ0D 2AMIA 1AP4A 3BXKA 1XK4A 4MBEA 1MF8B 3EVRA 4C0JA 1TRFA 4I5NB 1J7QA 1AUIB 4GAOA 2KNEA 5D7FA 4AQIA 1Q80A 2JTTA 1QATA 3DF0A 1SKTA 4A4CA 1G33A 4N5XA 1GJYA 1UHKA 2KQ6A 1SL9A 3CR2A 4YRUA 4WQ2A 1KFUL 2Y1NA 3BUMB 1B47A 1CLMA 1TCFA 2KHNA 2NCOA 2ZRTA 3BYAA 1AVSA 4PE7A 2L2EA 1KSOA 4YGEB 5TNCA 3PSRA 2V53A 1HT9A 3D0YB 1YX8A 2KYCA 3DVEA 1K96A 1LXFC 4MEWA 4I5JA 2LANA 3OB1B 1RWYA 4GFTA 5G08A 1JBAA 1WLMA 1Y1UA 2M3WA 1G8IA 1S3PA 1PSBA 1PK0D 3FS7A 2MRDA 2BL0C 3O2PA 4L9MA 2E30A 2K7DA 2LE9B 2MBXA 1FPWA 1GGZA 1K95A 2JC2A 2LVIA 3DVKA 3OX5A 1CFDA 1KWOC 1A75B 3VRPA 4NDBA 3HCMA 1CDNA 3I5IB 1F4QA 3LCPC 2KAYA 1B1GA 2PRUA 1CLLA 2K2AA 1PRWA 5CPVA 1PSRA 1EH2A 2OS8B 1CM1A 1YVLA 1YX7A 3SIAA 1MWNA 3O4YA 5I2QA 1A03A 1TIZA 2WCEA 1KK8B 1IQ3A 2KDHA 2M29A 4PE4A 1S1EA 4BY4A 1YUUA 2JTZA 2PMYA 4DS7A 1UURA 1IJ6A 1QXPA 1K90D 4UPGA 1IG5A 2Y5IA 1WRKA 1CDMA 1WDCB 1QJTA 3EKJA 2CTNA 1MXEA 5F6TA 1M46A 2LCPA 3CR4X 1F71A 1IRJA 4M2OA 1DF0A 4DIRA 1SCVA 2WNDA 3VRQA 5AERA 2L51A 3KF9A 3GK2A 1FBVA 4HREE 2OPOA 1AK8A 2ZNEA 1F70A 1WLZA 1NYAA 1SPYA 1ZACA 3FWCA 3SJSA 1M45A 2ZN9A
chains in the Genus database with same CATH superfamily
1JFJA 1S6CA 1FI5A 3EG5B 3DVJA 2L50A 3CDNA 1SNLA 5ER5A 2PQLA 2F3ZA 4QJ3B 1U5IB 3S0FA 2LV7A 1NX1A 2LMUA 4P5OE 2F3YA 2F2OA 5DKRA 5I8NA 2CCMA 2QEOA 1JF2A 3JTDB 3EK7A 1NCXA 2HPSA 1JSAA 1TNPA 2KAVA 1Y6WA 2WORA 2LLSA 1TNXA 2R2IA 3LK0A 3DXLA 2FOTA 3TS5C 2CXJA 3D10A 2P70A 1KFXL 1OMDA 1W9ZA 4XYNA 3BFHA 3NGVA 2LHLA 3NXAA 2NZ0A 2KI6C 2CNPA 1X02A 1C7VA 1DTLA 1N65A 3L4AA 3VRNA 3AKAA 1EG4A 2M1KB 1L2OB 1BLQA 1JWDA 2WC8A 2JZIA 2AAOA 1DVIA 3EK4A 2CBLA 2KGBC 1KSMA 2KPHA 3O78A 2LMVA 3DY9A 1C07A 4WRIA 1EJ3A 3TUYC 2JRFA 1OE9B 2K7BA 3K21A 3KPXA 4HRHA 3GOFA 1FI6A 1KK7Y 1ZFSA 4R1EA 4QJ4B 3KO0A 1S6IA 1RFJA 1LA3A 1LS8A 1RTP1 1SCMB 1W7JB 1NPQA 2KLEA 2M97A 2BECA 4DRWA 1D1OA 2A4JA 2EHBA 1KK7Z 1IH0A 3WXAA 1E8AA 1QS7A 1ZMZA 3EKHA 3PATA 1B8RA 3OX6A 1Y1AA 2KFGA 2LLTA 4NDCA 5DKNA 4A4BA 1BG1A 2QEVA 4ZCVA 2F2PA 1M39A 3D75A 1CMFA 1RECA 1W7IB 3BUXB 3EK8A 3FWBA 4OZDA 1A4PA 3SS4A 3VGOA 2Q91A 3CABA 3I5FC 4YI9A 5FI6A 4CPVA 3I5HB 2FJUB 5PALA 1XO5A 2YGUA 3VB1A 5FI7A 2JOJA 2G9BA 4ZCUA 5CSNA 4AQJA 1WY9A 1CNPA 5CSIA 1T14A 1DQEA 1J1EA 1OOJA 3H4SE 4YGDB 1YUTA 2RGIA 3ZWHA 1JC2A 2L4IA 2M7NA 1NX0A 2WC6A 3I5GC 2ZNDA 1NSHA 2KFFA 2HQWA 1SRAA 4PHNA 1CDLA 3L4LA 5CSFA 3K1EA 2KOTA 4NQGA 4YGAA 2JULA 1NP8A 2DOQA 3PN7B 4FQOA 1EG3A 1SL7A 2BAPA 2LUXA 3SG5A 2GGZA 3IQQA 3NHTA 3V2LA 2JPOA 4F7FA 3KEVA 3LL8B 4N1FA 1K2HA 5JOLA 4XJKB 5DICA 1DJHA 2VRGA 1OSAA 3PALA 1CFFA 1K9KA 1TTXA 1TNQA 2K7CA 4U8DA 2K60A 1XFYO 1SY9A 1YRTB 2KLDA 1N2DA 2WCHA 3B6XA 4JKTA 3SG4A 1NCYA 1R2UA 3JVTB 1PALA 2PASA 2G2BA 2BE4A 2HF5A 4OV2A 2H61A 1SR6B 3D0YA 2OTGB 4MSPA 3B7AA 1MUXA 2NLNA 3O6BA 2KI4C 3PLFB 3L47A 1ZUZA 1IKUA 4HSZA 1MXLC 5I2LA 1C7WA 3SG3A 5KTYA 1TWOA 1KQMB 2JT8A 2KSPA 5I94A 1DJWA 5AFPA 4PALA 1SL8A 4BY5A 1G4YR 5KU1A 2L0PA 1IJ5A 1QX7A 3I5HC 4MRXA 1LKJA 4PHMA 3PJIA 3R1VA 4YGCB 5J3XA 1DF0B 3FE9A 3R1PA 2MJWB 4ETOA 1YUSA 3PM8A 2O5GA 1OQPA 2PALA 1H8BA 1KQVA 1TN4A 2M8UA 2LHIA 3WNXB 1J1DA 4GUKA 2JXLA 3TDZA 1NWDA 3BUWB 2EC6B 3OBVA 3CR5X 2FCEA 2H61C 1IWQA 2QDIA 2B1UA 3PN7C 1OMRA 4FTGA 2Y4QA 5FYXA 4HRGA 5HLOA 4GNKB 3BQ3A 3NHIA 1UP5A 2SASA 1BT6A 1F54A 1UHJA 3FE6A 1B8LA 1SMGA 2M49B 4I5KA 4MRYA 3EVVA 5CSJA 3TZ1A 1DT7B 1CMGA 1B7TY 3VROA 1OZSA 1QX5B 4MVFA 1FW4A 2BNXA 3CZ0A 1KFUS 1NX2A 3M0WA 4PE0A 4Q04A 5KSZA 1BODA 1F8HA 1DEKA 1LINA 3IF7A 4IL1A 1YR5A 2LM5A 1YURA 3JVTC 3PM2A 1PVAA 3I5IC 3O4XA 1HQVA 1XFWO 1CLBA 2Y1MA 1B7TZ 3AAKA 1S6JA 2OS8C 4N1GA 4MN0A 2OTGC 2BE6A 5AANA 3SIBA 1KK8C 1M63B 2PSRA 2L5XB 1U5IA 2I94A 1DJXA 1XFVO 2BKIB 1LVCD 1KQMC 3QRXA 5GQQC 3OB2B 5AEQA 2JXCA 2QPTA 2ZFDA 1UWOA 1WDCC 2JT0A 2BKHB 4ORAB 1J7PA 1B9AA 2PYQA 3S0BA 1XVJA 1QLSA 3SG7A 1OOFA 2MLFC 4C0LA 1TNWA 1J7RA 1SYMA 3KHEA 3AKBA 1CFPA 1CDPA 2MA2A 4P2YB 1DGUA 1QIVA 2BBMA 4AOMA 4C0KA 1RK9A 4MZKA 2BCAA 1MQ1A 1ZOTB 2H8VA 2PVBA 2D8NA 1WRZA 3IVTA 3NSKA 5D3OA 1BU3A 5D69A 4PHKA 4PDZA 1RROA 2K8MB 3OP0A 1CKKA 1A2XA 1J7OA 4MZJA 3BOWB 2K0JA 5AXIA 2LVKA 1ALWA 3MSEB 2MLEC 5I2OA 5BPJA 1QIWA 3DVMA 1DMOA 1F4OA 3N7HA 3BUNB 5HKWA 2KGRA 3S0DA 3EVUA 2L98A 3CLNA 3WHTB 2BL0B 3JTDC 1FF1A 4JPZB 1XA5A 2TN4A 2WCFA 1QLKA 1CM4A 1KWOB 1UHNA 3E3RA 3TDUA 5HLVA 4NDDA 2KYFA 1DGVA 1BF5A 1SK6D 2F33A 1NIWA 2LLUA 1ALVA 3DF0B 3PFVA 2LC5A 1EL4A 3IQOA 2JQ6A 1TUJA 3GK1A 1L2OC 2F8PA 1MR8A 1XFRA 1S26D 2IS9A 3ZNIA 4M2PA 2M7LA 1KFXS 1CFCA 2CT9A 2K61A 2LP2A 3LK1A 2LP3A 1K9PA 4YGBB 3CTNA 1TCOB 5JJGA 4OCIA 1PULA 1M31A 3RM1A 1SCMC 1SBJA 1UHIA 1UUSA 1XYDA 2I18A 1ODBA 1YVHA 2LUCA 1Y1XA 2LMTA 4PHJA 3CS1A 2JNXA 1QVIY 4D1EA 1SW8A 1Z4HA 3LLEA 2E6WA 3C1VA 2AUCA 2EGDA 2BCXA 1F55A 3A8RA 3SG2A 1KCYA 4XJKA 3FIAA 2M1UA 2H2KA 2O60A 1QVIZ 5EL2A 4E68A 4GGNA 3A4UB 2BBNA 1R6PA 2JPTA 2M0RA 4M2QA 2JWWA 1A75A 5DKQA 1K9UA 2KAXA 2M9GA 3WHUB 1XFZO 3CZ1A 2LNKA 3SS3A 4JWQA 1XK4C 3TS5B 4CFQA 1QTXA 2WCLA 1K94A 1V1FA 1JFKA 1NUBA 1Y0VH 4MZLA 2Q4UA 2SCPA 2ZKMX 3CGAA 4PE1A 1BOCA 1NCZA 1UHHA 5K89A 4ORBB 1GM0A 1CB1A 1H4BA 3B88A 4INXA 1N0YA 1TOPA 4OR9B 2MAZA 3TDIA 3ICBA 3HX4A 2ISDA 1OMVA 2NXQA 1IQ5A 5HYDA 4IJ7A 3B87A 1BJFA 1DJIA 5HKZA 2K7OA 1BMOA 3S0GA 3TUYB 2WOSA 1RJVA 1WRLA 2I7AA 4CIDA 2ZN8A 4PCWA 4CLNA 4OKHA 1OOGA 2QACA 4WQ3A 4GGFA 5HKYA 3BUOB 1K93D 1OZOA 1SR6C 2KBIA 4YI8A 4CFRA 2ZRSA 3DD4A 2P6BB 1LA0A 3D74A 1QX2A 1QV0A 1EXRA 1GQMA 4JD9A 2FJYA 3CZTX 3GK4X 2WCJA 2WCMA 3NSLA 2K2FA 3I5FB 1JF0A 1L7ZA 1AJ4A 2I2RE 3AAJA 3R1OA 4GBAA 4GPLB 1QASA 2ERBA 2WCKA 3VRRA 1ORGA 4F0ZB 3D76A 1B8CA 2MHHA 2COLB 1GGWA 2QEBA 4YBHB 2NCPA 1BR1B 1BR4B 2FCDA 1JUOA 2JU0A 4FQTA 2L2CA 3CYZA 4ORCB 1DJZA 4DCKA 2JT3A 3I5GB 2LVJA 3BJHA 1S36A 1XFUO 1IGVA 2LVVA 1B4CA 4GGFC 1VRKA 1PVBA 2EC6C 3SG6A 3D73A 3DZTA 2LAPA 3NSIA 5HL1A 3CWGA 1MHOA 4ICBA 1A29A 1XFXO 1YTZC 2WCBA 3QMEA 4TNCA 1OW4A 5B8IB 3UO9A 4PT1A 4OVNF 4QJ5B 1K8UA 3F45A 2KQYA 3OHMB 2L5YA 5ER4X 1J55A 2GGMA 2KFHA 4MLWA 2KI6D 2JNFA 1AJ5A 3NSOA 3R72A 2L4HA 3BOWA 2BCBA 2HQ8A 3RLZA 3D77A 4USLA 1DJGA 2KI4B 5FI2A 4I5LB 1S5GY 1YRUB 3DYEA 2GV5A 5IBWA 3RZSA 1NX3A 1CTRA 1V1GA 2KBMA 4DUQA 3S0EA 1AHRA 1QV1A 4KYNA 1DJYA 1S5GZ 2HETA 4JQ0D 2AMIA 4INWA 1AP4A 3BXKA 3D78A 1XK4A 4MBEA 1MF8B 3EVRA 4C0JA 1TRFA 1Z2CB 2WC5A 4I5NB 1J7QA 1AUIB 4GAOA 2KNEA 5D7FA 4AQIA 1Q80A 2JTTA 1QATA 3DF0A 1SKTA 4A4CA 1G33A 4N5XA 1GJYA 1UHKA 2KQ6A 1SL9A 3CR2A 4YRUA 4WQ2A 1KFUL 2Y1NA 3BUMB 1B47A 1CLMA 1TCFA 2KHNA 2NCOA 2ZRTA 3BYAA 1AVSA 4PE7A 2L2EA 1KSOA 3BFBA 4YGEB 5TNCA 3UNWA 3PSRA 2V53A 1DC1A 1HT9A 3D0YB 1YX8A 2P71A 2KYCA 3DVEA 2QEHA 2GTEA 1K96A 1LXFC 1TUZA 3B86A 3BFAA 4MEWA 4I5JA 2LANA 3OB1B 1RWYA 4GFTA 5G08A 1JBAA 1WLMA 1Y1UA 2M3WA 1G8IA 1S3PA 1PSBA 1P28A 1PK0D 3FS7A 2MRDA 2BL0C 3O2PA 3Q8IA 4L9MA 2E30A 2K7DA 3OGNA 2LE9B 2MBXA 1FPWA 1GGZA 1K95A 1OOHA 2JC2A 2LVIA 3DVKA 1CFDA 1KWOC 1A75B 3OX5A 4NDBA 3VRPA 3HCMA 1CDNA 3I5IB 1F4QA 3LCPC 2KAYA 1OOIX 1B1GA 2PRUA 1CLLA 1SSEB 1PRWA 2K2AA 1PSRA 5CPVA 1EH2A 2OS8B 1CM1A 1YVLA 1YX7A 3SIAA 1MWNA 3O4YA 5I2QA 1A03A 1TIZA 2WCEA 1KK8B 1C3YA 1IQ3A 2KDHA 2M29A 4PE4A 1S1EA 4BY4A 1YUUA 2JTZA 2PMYA 4DS7A 1UURA 1IJ6A 1QXPA 1K90D 4UPGA 1IG5A 2Y5IA 1WRKA 1CDMA 1WDCB 1QJTA 3EKJA 2CTNA 1MXEA 5F6TA 1M46A 3CZ2A 2LCPA 3CR4X 1F71A 1DELA 1IRJA 4M2OA 1DF0A 4DIRA 1SCVA 2WNDA 3VRQA 5AERA 2L51A 3FE8A 3GK2A 3KF9A 1FBVA 4HREE 3SS5A 2OPOA 1AK8A 2ZNEA 1F70A 1WLZA 1C3ZA 1NYAA 1SPYA 1ZACA 3FWCA 3SJSA 1IIOA 1M45A 2ZN9A 1QWVA 3S0AA
chains in the Genus database with same CATH topology
1JFJA 1S6CA 1FI5A 3DVJA 2L50A 1SNLA 5ER5A 2F3ZA 4QJ3B 1U5IB 2LV7A 1NX1A 2LMUA 4P5OE 2F3YA 2F2OA 5DKRA 5I8NA 2CCMA 1JF2A 3JTDB 3EK7A 1NCXA 2HPSA 1JSAA 1TNPA 2KAVA 1Y6WA 2WORA 2LLSA 1TNXA 2R2IA 3LK0A 2FOTA 3TS5C 2CXJA 3D10A 1KFXL 1OMDA 4XYNA 2LHLA 3NXAA 2NZ0A 2KI6C 2CNPA 1X02A 1C7VA 1DTLA 1N65A 3VRNA 3AKAA 1EG4A 2M1KB 1L2OB 1BLQA 1JWDA 2WC8A 2JZIA 2AAOA 1DVIA 3EK4A 2CBLA 2KGBC 1KSMA 3O78A 2LMVA 1C07A 4WRIA 1EJ3A 3TUYC 2JRFA 1OE9B 2K7BA 3K21A 3KPXA 4HRHA 3GOFA 1FI6A 1KK7Y 1ZFSA 4R1EA 4QJ4B 3KO0A 1S6IA 1RFJA 1LA3A 1RTP1 1SCMB 1W7JB 1NPQA 2M97A 4DRWA 2BECA 1D1OA 2A4JA 2EHBA 1KK7Z 1IH0A 3WXAA 1E8AA 1QS7A 1ZMZA 3EKHA 3PATA 1B8RA 3OX6A 1Y1AA 2KFGA 2LLTA 4NDCA 5DKNA 4A4BA 1BG1A 4ZCVA 2F2PA 1M39A 1CMFA 1RECA 1W7IB 3BUXB 3EK8A 3FWBA 1A4PA 3VGOA 2Q91A 3I5FC 4YI9A 4CPVA 3I5HB 2FJUB 5PALA 1XO5A 2JOJA 2G9BA 4ZCUA 5CSNA 4AQJA 1WY9A 1CNPA 5CSIA 3H4SE 1J1EA 1OOJA 4YGDB 1YUTA 2RGIA 3ZWHA 1JC2A 2L4IA 2M7NA 1NX0A 3I5GC 2ZNDA 1NSHA 2KFFA 2HQWA 1SRAA 4PHNA 1CDLA 5CSFA 2KOTA 4NQGA 4YGAA 2JULA 1NP8A 2DOQA 3PN7B 4FQOA 1EG3A 1SL7A 2LUXA 3SG5A 2GGZA 3IQQA 3KEVA 3LL8B 4N1FA 1K2HA 5JOLA 4XJKB 1DJHA 2VRGA 1OSAA 3PALA 1CFFA 1K9KA 1TTXA 1TNQA 2K7CA 4U8DA 1XFYO 1SY9A 1YRTB 3SG4A 1N2DA 1NCYA 1R2UA 3JVTB 1PALA 2PASA 2G2BA 2BE4A 2HF5A 4OV2A 2H61A 1SR6B 3D0YA 2OTGB 4MSPA 1MUXA 2NLNA 3O6BA 2KI4C 3PLFB 1IKUA 1ZUZA 4HSZA 1MXLC 5I2LA 1C7WA 3SG3A 5KTYA 2JT8A 1KQMB 2KSPA 1DJWA 5AFPA 4PALA 1SL8A 4BY5A 1G4YR 5KU1A 2L0PA 1IJ5A 1QX7A 3I5HC 4MRXA 1LKJA 4PHMA 4YGCB 5J3XA 1DF0B 4ETOA 2MJWB 1YUSA 3PM8A 2O5GA 1OQPA 2PALA 1H8BA 1KQVA 1TN4A 2M8UA 2LHIA 3WNXB 1J1DA 4GUKA 2JXLA 3TDZA 1NWDA 3BUWB 2EC6B 3CR5X 2FCEA 2H61C 1IWQA 5HLOA 2B1UA 3PN7C 1OMRA 4FTGA 2Y4QA 5FYXA 4HRGA 4GNKB 3BQ3A 1UP5A 2SASA 1BT6A 1F54A 1UHJA 1B8LA 1SMGA 2M49B 4I5KA 4MRYA 3EVVA 5CSJA 3TZ1A 1DT7B 1CMGA 1B7TY 3VROA 1OZSA 1QX5B 4MVFA 1FW4A 4PE0A 1F8HA 1KFUS 1NX2A 3M0WA 4Q04A 5KSZA 1BODA 1LINA 3IF7A 4IL1A 1YR5A 2LM5A 1YURA 3JVTC 1PVAA 3I5IC 1CLBA 1HQVA 1XFWO 2Y1MA 1B7TZ 3AAKA 1S6JA 2OS8C 4N1GA 4MN0A 2OTGC 2BE6A 5AANA 3SIBA 1KK8C 1M63B 2PSRA 2L5XB 1U5IA 2I94A 1DJXA 1XFVO 2BKIB 1LVCD 1KQMC 3QRXA 5GQQC 3OB2B 5AEQA 2JXCA 2QPTA 2ZFDA 1UWOA 1WDCC 2JT0A 2BKHB 4ORAB 1J7PA 1B9AA 1XVJA 1QLSA 3SG7A 2MLFC 4C0LA 1TNWA 1J7RA 1SYMA 3KHEA 3AKBA 1CFPA 1CDPA 2MA2A 4P2YB 1DGUA 1QIVA 2BBMA 4AOMA 4C0KA 1RK9A 4MZKA 2BCAA 1MQ1A 1ZOTB 2PVBA 2D8NA 1WRZA 3NSKA 1BU3A 5D69A 4PHKA 4PDZA 1RROA 2K8MB 3OP0A 1CKKA 1A2XA 1J7OA 4MZJA 3BOWB 2K0JA 5AXIA 2LVKA 1ALWA 3MSEB 2MLEC 5I2OA 5BPJA 1QIWA 3DVMA 1DMOA 1F4OA 3BUNB 5HKWA 2KGRA 3EVUA 2L98A 3CLNA 3WHTB 2BL0B 3JTDC 1FF1A 4JPZB 1XA5A 2TN4A 2WCFA 1QLKA 1CM4A 1KWOB 1UHNA 3E3RA 3TDUA 5HLVA 4NDDA 2KYFA 1DGVA 1BF5A 1SK6D 2F33A 1NIWA 2LLUA 1ALVA 3DF0B 3PFVA 2LC5A 1EL4A 3IQOA 2JQ6A 3GK1A 1L2OC 2F8PA 1MR8A 1S26D 2IS9A 3ZNIA 4M2PA 2M7LA 1KFXS 1CFCA 2CT9A 2K61A 2LP2A 3LK1A 2LP3A 1K9PA 4YGBB 3CTNA 1TCOB 5JJGA 4OCIA 1PULA 1M31A 3RM1A 1SCMC 1SBJA 1UHIA 1UUSA 1XYDA 2I18A 1ODBA 1YVHA 2LUCA 1Y1XA 2LMTA 4PHJA 3CS1A 2JNXA 1QVIY 4D1EA 1SW8A 3LLEA 2E6WA 3C1VA 2AUCA 2EGDA 2BCXA 1F55A 3A8RA 3SG2A 1KCYA 4XJKA 3FIAA 2M1UA 2H2KA 2O60A 1QVIZ 4E68A 4GGNA 3A4UB 2BBNA 1R6PA 2JPTA 2M0RA 4M2QA 2JWWA 1A75A 5DKQA 1K9UA 2KAXA 2M9GA 3WHUB 1XFZO 2LNKA 4JWQA 1XK4C 3TS5B 4CFQA 1QTXA 1K94A 1V1FA 1JFKA 1NUBA 1Y0VH 4MZLA 2Q4UA 2SCPA 2ZKMX 3CGAA 4PE1A 1BOCA 1NCZA 1UHHA 5K89A 4ORBB 1CB1A 1H4BA 1N0YA 1TOPA 4OR9B 2MAZA 3TDIA 3ICBA 3HX4A 2ISDA 1OMVA 2NXQA 1IQ5A 5HYDA 1BJFA 1DJIA 5HKZA 2K7OA 1BMOA 3TUYB 2WOSA 1RJVA 1WRLA 2I7AA 4CIDA 2ZN8A 4PCWA 4CLNA 4OKHA 2QACA 4WQ3A 4GGFA 5HKYA 3BUOB 1K93D 1OZOA 1SR6C 2KBIA 4YI8A 4CFRA 2ZRSA 3DD4A 2P6BB 1LA0A 1QX2A 1QV0A 1EXRA 1GQMA 3CZTX 3GK4X 3NSLA 2K2FA 3I5FB 1JF0A 1L7ZA 1AJ4A 2I2RE 3AAJA 4GBAA 4GPLB 1QASA 3VRRA 4F0ZB 1B8CA 2MHHA 2COLB 1GGWA 4YBHB 2NCPA 1BR1B 1BR4B 2FCDA 1JUOA 2JU0A 4ORCB 1DJZA 4DCKA 2JT3A 3I5GB 2LVJA 1S36A 1XFUO 1IGVA 2LVVA 1B4CA 4GGFC 1VRKA 1PVBA 2EC6C 3SG6A 2LAPA 3NSIA 3CWGA 1MHOA 4ICBA 1A29A 1XFXO 1YTZC 2WCBA 4TNCA 5B8IB 4OVNF 4QJ5B 1K8UA 3F45A 2KQYA 3OHMB 5ER4X 1J55A 2GGMA 2KFHA 4MLWA 2KI6D 2JNFA 1AJ5A 3NSOA 2L4HA 3BOWA 2BCBA 2HQ8A 3RLZA 4USLA 1DJGA 2KI4B 4I5LB 1S5GY 1YRUB 2GV5A 5IBWA 1NX3A 1CTRA 1V1GA 2KBMA 4DUQA 1AHRA 1QV1A 1DJYA 1S5GZ 2HETA 4JQ0D 2AMIA 1AP4A 3BXKA 1XK4A 4MBEA 1MF8B 3EVRA 4C0JA 1TRFA 4I5NB 1J7QA 1AUIB 4GAOA 2KNEA 5D7FA 4AQIA 1Q80A 2JTTA 1QATA 3DF0A 1SKTA 4A4CA 1G33A 4N5XA 1GJYA 1UHKA 2KQ6A 1SL9A 3CR2A 4YRUA 4WQ2A 1KFUL 2Y1NA 3BUMB 1B47A 1CLMA 1TCFA 2KHNA 2NCOA 2ZRTA 3BYAA 1AVSA 4PE7A 2L2EA 1KSOA 4YGEB 5TNCA 3PSRA 2V53A 1HT9A 3D0YB 1YX8A 2KYCA 3DVEA 1K96A 1LXFC 4MEWA 4I5JA 2LANA 3OB1B 1RWYA 4GFTA 5G08A 1JBAA 1WLMA 1Y1UA 2M3WA 1G8IA 1S3PA 1PSBA 1PK0D 3FS7A 2MRDA 2BL0C 3O2PA 4L9MA 2E30A 2K7DA 2LE9B 2MBXA 1FPWA 1GGZA 1K95A 2JC2A 2LVIA 3DVKA 3OX5A 1CFDA 1KWOC 1A75B 3VRPA 4NDBA 3HCMA 1CDNA 3I5IB 1F4QA 3LCPC 2KAYA 1B1GA 2PRUA 1CLLA 2K2AA 1PRWA 5CPVA 1PSRA 1EH2A 2OS8B 1CM1A 1YVLA 1YX7A 3SIAA 1MWNA 3O4YA 5I2QA 1A03A 1TIZA 2WCEA 1KK8B 1IQ3A 2KDHA 2M29A 4PE4A 1S1EA 4BY4A 1YUUA 2JTZA 2PMYA 4DS7A 1UURA 1IJ6A 1QXPA 1K90D 4UPGA 1IG5A 2Y5IA 1WRKA 1CDMA 1WDCB 1QJTA 3EKJA 2CTNA 1MXEA 5F6TA 1M46A 2LCPA 3CR4X 1F71A 1IRJA 4M2OA 1DF0A 4DIRA 1SCVA 2WNDA 3VRQA 5AERA 2L51A 3KF9A 3GK2A 1FBVA 4HREE 2OPOA 1AK8A 2ZNEA 1F70A 1WLZA 1NYAA 1SPYA 1ZACA 3FWCA 3SJSA 1M45A 2ZN9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JFJ A;  1S6C A;  1FI5 A;  3DVJ A;  2L50 A;  1SNL A;  5ER5 A;  2F3Z A;  4QJ3 B;  1U5I B;  2LV7 A;  1NX1 A;  2LMU A;  4P5O E;  2F3Y A;  2F2O A;  5DKR A;  5I8N A;  2CCM A;  1JF2 A;  3JTD B;  3EK7 A;  1NCX A;  2HPS A;  1JSA A;  1TNP A;  2KAV A;  1Y6W A;  2WOR A;  2LLS A;  1TNX A;  2R2I A;  3LK0 A;  2FOT A;  3TS5 C;  2CXJ A;  3D10 A;  1KFX L;  1OMD A;  4XYN A;  2LHL A;  3NXA A;  2NZ0 A;  2KI6 C;  2CNP A;  1X02 A;  1C7V A;  1DTL A;  1N65 A;  3VRN A;  3AKA A;  1EG4 A;  2M1K B;  1L2O B;  1BLQ A;  1JWD A;  2WC8 A;  2JZI A;  2AAO A;  1DVI A;  3EK4 A;  2CBL A;  2KGB C;  1KSM A;  3O78 A;  2LMV A;  1C07 A;  4WRI A;  1EJ3 A;  3TUY C;  2JRF A;  1OE9 B;  2K7B A;  3K21 A;  3KPX A;  4HRH A;  3GOF A;  1FI6 A;  1KK7 Y;  1ZFS A;  4R1E A;  4QJ4 B;  3KO0 A;  1S6I A;  1RFJ A;  1LA3 A;  1RTP 1;  1SCM B;  1W7J B;  1NPQ A;  2M97 A;  4DRW A;  2BEC A;  1D1O A;  2A4J A;  2EHB A;  1KK7 Z;  1IH0 A;  3WXA A;  1E8A A;  1QS7 A;  1ZMZ A;  3EKH A;  3PAT A;  1B8R A;  3OX6 A;  1Y1A A;  2KFG A;  2LLT A;  4NDC A;  5DKN A;  4A4B A;  1BG1 A;  4ZCV A;  2F2P A;  1M39 A;  1CMF A;  1REC A;  1W7I B;  3BUX B;  3EK8 A;  3FWB A;  1A4P A;  3VGO A;  2Q91 A;  3I5F C;  4YI9 A;  4CPV A;  3I5H B;  2FJU B;  5PAL A;  1XO5 A;  2JOJ A;  2G9B A;  4ZCU A;  5CSN A;  4AQJ A;  1WY9 A;  1CNP A;  5CSI A;  3H4S E;  1J1E A;  1OOJ A;  4YGD B;  1YUT A;  2RGI A;  3ZWH A;  1JC2 A;  2L4I A;  2M7N A;  1NX0 A;  3I5G C;  2ZND A;  1NSH A;  2KFF A;  2HQW A;  1SRA A;  4PHN A;  1CDL A;  5CSF A;  2KOT A;  4NQG A;  4YGA A;  2JUL A;  1NP8 A;  2DOQ A;  3PN7 B;  4FQO A;  1EG3 A;  1SL7 A;  2LUX A;  3SG5 A;  2GGZ A;  3IQQ A;  3KEV A;  3LL8 B;  4N1F A;  1K2H A;  5JOL A;  4XJK B;  1DJH A;  2VRG A;  1OSA A;  3PAL A;  1CFF A;  1K9K A;  1TTX A;  1TNQ A;  2K7C A;  4U8D A;  1XFY O;  1SY9 A;  1YRT B;  3SG4 A;  1N2D A;  1NCY A;  1R2U A;  3JVT B;  1PAL A;  2PAS A;  2G2B A;  2BE4 A;  2HF5 A;  4OV2 A;  2H61 A;  1SR6 B;  3D0Y A;  2OTG B;  4MSP A;  1MUX A;  2NLN A;  3O6B A;  2KI4 C;  3PLF B;  1IKU A;  1ZUZ A;  4HSZ A;  1MXL C;  5I2L A;  1C7W A;  3SG3 A;  5KTY A;  2JT8 A;  1KQM B;  2KSP A;  1DJW A;  5AFP A;  4PAL A;  1SL8 A;  4BY5 A;  1G4Y R;  5KU1 A;  2L0P A;  1IJ5 A;  1QX7 A;  3I5H C;  4MRX A;  1LKJ A;  4PHM A;  4YGC B;  5J3X A;  1DF0 B;  4ETO A;  2MJW B;  1YUS A;  3PM8 A;  2O5G A;  1OQP A;  2PAL A;  1H8B A;  1KQV A;  1TN4 A;  2M8U A;  2LHI A;  3WNX B;  1J1D A;  4GUK A;  2JXL A;  3TDZ A;  1NWD A;  3BUW B;  2EC6 B;  3CR5 X;  2FCE A;  2H61 C;  1IWQ A;  5HLO A;  2B1U A;  3PN7 C;  1OMR A;  4FTG A;  2Y4Q A;  5FYX A;  4HRG A;  4GNK B;  3BQ3 A;  1UP5 A;  2SAS A;  1BT6 A;  1F54 A;  1UHJ A;  1B8L A;  1SMG A;  2M49 B;  4I5K A;  4MRY A;  3EVV A;  5CSJ A;  3TZ1 A;  1DT7 B;  1CMG A;  1B7T Y;  3VRO A;  1OZS A;  1QX5 B;  4MVF A;  1FW4 A;  4PE0 A;  1F8H A;  1KFU S;  1NX2 A;  3M0W A;  4Q04 A;  5KSZ A;  1BOD A;  1LIN A;  3IF7 A;  4IL1 A;  1YR5 A;  2LM5 A;  1YUR A;  3JVT C;  1PVA A;  3I5I C;  1CLB A;  1HQV A;  1XFW O;  2Y1M A;  1B7T Z;  3AAK A;  1S6J A;  2OS8 C;  4N1G A;  4MN0 A;  2OTG C;  2BE6 A;  5AAN A;  3SIB A;  1KK8 C;  1M63 B;  2PSR A;  2L5X B;  1U5I A;  2I94 A;  1DJX A;  1XFV O;  2BKI B;  1LVC D;  1KQM C;  3QRX A;  5GQQ C;  3OB2 B;  5AEQ A;  2JXC A;  2QPT A;  2ZFD A;  1UWO A;  1WDC C;  2JT0 A;  2BKH B;  4ORA B;  1J7P A;  1B9A A;  1XVJ A;  1QLS A;  3SG7 A;  2MLF C;  4C0L A;  1TNW A;  1J7R A;  1SYM A;  3KHE A;  3AKB A;  1CFP A;  1CDP A;  2MA2 A;  4P2Y B;  1DGU A;  1QIV A;  2BBM A;  4AOM A;  4C0K A;  1RK9 A;  4MZK A;  2BCA A;  1MQ1 A;  1ZOT B;  2PVB A;  2D8N A;  1WRZ A;  3NSK A;  1BU3 A;  5D69 A;  4PHK A;  4PDZ A;  1RRO A;  2K8M B;  3OP0 A;  1CKK A;  1A2X A;  1J7O A;  4MZJ A;  3BOW B;  2K0J A;  5AXI A;  2LVK A;  1ALW A;  3MSE B;  2MLE C;  5I2O A;  5BPJ A;  1QIW A;  3DVM A;  1DMO A;  1F4O A;  3BUN B;  5HKW A;  2KGR A;  3EVU A;  2L98 A;  3CLN A;  3WHT B;  2BL0 B;  3JTD C;  1FF1 A;  4JPZ B;  1XA5 A;  2TN4 A;  2WCF A;  1QLK A;  1CM4 A;  1KWO B;  1UHN A;  3E3R A;  3TDU A;  5HLV A;  4NDD A;  2KYF A;  1DGV A;  1BF5 A;  1SK6 D;  2F33 A;  1NIW A;  2LLU A;  1ALV A;  3DF0 B;  3PFV A;  2LC5 A;  1EL4 A;  3IQO A;  2JQ6 A;  3GK1 A;  1L2O C;  2F8P A;  1MR8 A;  1S26 D;  2IS9 A;  3ZNI A;  4M2P A;  2M7L A;  1KFX S;  1CFC A;  2CT9 A;  2K61 A;  2LP2 A;  3LK1 A;  2LP3 A;  1K9P A;  4YGB B;  3CTN A;  1TCO B;  5JJG A;  4OCI A;  1PUL A;  1M31 A;  3RM1 A;  1SCM C;  1SBJ A;  1UHI A;  1UUS A;  1XYD A;  2I18 A;  1ODB A;  1YVH A;  2LUC A;  1Y1X A;  2LMT A;  4PHJ A;  3CS1 A;  2JNX A;  1QVI Y;  4D1E A;  1SW8 A;  3LLE A;  2E6W A;  3C1V A;  2AUC A;  2EGD A;  2BCX A;  1F55 A;  3A8R A;  3SG2 A;  1KCY A;  4XJK A;  3FIA A;  2M1U A;  2H2K A;  2O60 A;  1QVI Z;  4E68 A;  4GGN A;  3A4U B;  2BBN A;  1R6P A;  2JPT A;  2M0R A;  4M2Q A;  2JWW A;  1A75 A;  5DKQ A;  1K9U A;  2KAX A;  2M9G A;  3WHU B;  1XFZ O;  2LNK A;  4JWQ A;  1XK4 C;  3TS5 B;  4CFQ A;  1QTX A;  1K94 A;  1V1F A;  1JFK A;  1NUB A;  1Y0V H;  4MZL A;  2Q4U A;  2SCP A;  2ZKM X;  3CGA A;  4PE1 A;  1BOC A;  1NCZ A;  1UHH A;  5K89 A;  4ORB B;  1CB1 A;  1H4B A;  1N0Y A;  1TOP A;  4OR9 B;  2MAZ A;  3TDI A;  3ICB A;  3HX4 A;  2ISD A;  1OMV A;  2NXQ A;  1IQ5 A;  5HYD A;  1BJF A;  1DJI A;  5HKZ A;  2K7O A;  1BMO A;  3TUY B;  2WOS A;  1RJV A;  1WRL A;  2I7A A;  4CID A;  2ZN8 A;  4PCW A;  4CLN A;  4OKH A;  2QAC A;  4WQ3 A;  4GGF A;  5HKY A;  3BUO B;  1K93 D;  1OZO A;  1SR6 C;  2KBI A;  4YI8 A;  4CFR A;  2ZRS A;  3DD4 A;  2P6B B;  1LA0 A;  1QX2 A;  1QV0 A;  1EXR A;  1GQM A;  3CZT X;  3GK4 X;  3NSL A;  2K2F A;  3I5F B;  1JF0 A;  1L7Z A;  1AJ4 A;  2I2R E;  3AAJ A;  4GBA A;  4GPL B;  1QAS A;  3VRR A;  4F0Z B;  1B8C A;  2MHH A;  2COL B;  1GGW A;  4YBH B;  2NCP A;  1BR1 B;  1BR4 B;  2FCD A;  1JUO A;  2JU0 A;  4ORC B;  1DJZ A;  4DCK A;  2JT3 A;  3I5G B;  2LVJ A;  1S36 A;  1XFU O;  1IGV A;  2LVV A;  1B4C A;  4GGF C;  1VRK A;  1PVB A;  2EC6 C;  3SG6 A;  2LAP A;  3NSI A;  3CWG A;  1MHO A;  4ICB A;  1A29 A;  1XFX O;  1YTZ C;  2WCB A;  4TNC A;  5B8I B;  4OVN F;  4QJ5 B;  1K8U A;  3F45 A;  2KQY A;  3OHM B;  5ER4 X;  1J55 A;  2GGM A;  2KFH A;  4MLW A;  2KI6 D;  2JNF A;  1AJ5 A;  3NSO A;  2L4H A;  3BOW A;  2BCB A;  2HQ8 A;  3RLZ A;  4USL A;  1DJG A;  2KI4 B;  4I5L B;  1S5G Y;  1YRU B;  2GV5 A;  5IBW A;  1NX3 A;  1CTR A;  1V1G A;  2KBM A;  4DUQ A;  1AHR A;  1QV1 A;  1DJY A;  1S5G Z;  2HET A;  4JQ0 D;  2AMI A;  1AP4 A;  3BXK A;  1XK4 A;  4MBE A;  1MF8 B;  3EVR A;  4C0J A;  1TRF A;  4I5N B;  1J7Q A;  1AUI B;  4GAO A;  2KNE A;  5D7F A;  4AQI A;  1Q80 A;  2JTT A;  1QAT A;  3DF0 A;  1SKT A;  4A4C A;  1G33 A;  4N5X A;  1GJY A;  1UHK A;  2KQ6 A;  1SL9 A;  3CR2 A;  4YRU A;  4WQ2 A;  1KFU L;  2Y1N A;  3BUM B;  1B47 A;  1CLM A;  1TCF A;  2KHN A;  2NCO A;  2ZRT A;  3BYA A;  1AVS A;  4PE7 A;  2L2E A;  1KSO A;  4YGE B;  5TNC A;  3PSR A;  2V53 A;  1HT9 A;  3D0Y B;  1YX8 A;  2KYC A;  3DVE A;  1K96 A;  1LXF C;  4MEW A;  4I5J A;  2LAN A;  3OB1 B;  1RWY A;  4GFT A;  5G08 A;  1JBA A;  1WLM A;  1Y1U A;  2M3W A;  1G8I A;  1S3P A;  1PSB A;  1PK0 D;  3FS7 A;  2MRD A;  2BL0 C;  3O2P A;  4L9M A;  2E30 A;  2K7D A;  2LE9 B;  2MBX A;  1FPW A;  1GGZ A;  1K95 A;  2JC2 A;  2LVI A;  3DVK A;  3OX5 A;  1CFD A;  1KWO C;  1A75 B;  3VRP A;  4NDB A;  3HCM A;  1CDN A;  3I5I B;  1F4Q A;  3LCP C;  2KAY A;  1B1G A;  2PRU A;  1CLL A;  2K2A A;  1PRW A;  5CPV A;  1PSR A;  1EH2 A;  2OS8 B;  1CM1 A;  1YVL A;  1YX7 A;  3SIA A;  1MWN A;  3O4Y A;  5I2Q A;  1A03 A;  1TIZ A;  2WCE A;  1KK8 B;  1IQ3 A;  2KDH A;  2M29 A;  4PE4 A;  1S1E A;  4BY4 A;  1YUU A;  2JTZ A;  2PMY A;  4DS7 A;  1UUR A;  1IJ6 A;  1QXP A;  1K90 D;  4UPG A;  1IG5 A;  2Y5I A;  1WRK A;  1CDM A;  1WDC B;  1QJT A;  3EKJ A;  2CTN A;  1MXE A;  5F6T A;  1M46 A;  2LCP A;  3CR4 X;  1F71 A;  1IRJ A;  4M2O A;  1DF0 A;  4DIR A;  1SCV A;  2WND A;  3VRQ A;  5AER A;  2L51 A;  3KF9 A;  3GK2 A;  1FBV A;  4HRE E;  2OPO A;  1AK8 A;  2ZNE A;  1F70 A;  1WLZ A;  1NYA A;  1SPY A;  1ZAC A;  3FWC A;  3SJS A;  1M45 A;  2ZN9 A; 
#chains in the Genus database with same CATH topology
 1JFJ A;  1S6C A;  1FI5 A;  3EG5 B;  3DVJ A;  2L50 A;  3CDN A;  1SNL A;  5ER5 A;  2PQL A;  2F3Z A;  4QJ3 B;  1U5I B;  3S0F A;  2LV7 A;  1NX1 A;  2LMU A;  4P5O E;  2F3Y A;  2F2O A;  5DKR A;  5I8N A;  2CCM A;  2QEO A;  1JF2 A;  3JTD B;  3EK7 A;  1NCX A;  2HPS A;  1JSA A;  1TNP A;  2KAV A;  1Y6W A;  2WOR A;  2LLS A;  1TNX A;  2R2I A;  3LK0 A;  3DXL A;  2FOT A;  3TS5 C;  2CXJ A;  3D10 A;  2P70 A;  1KFX L;  1OMD A;  1W9Z A;  4XYN A;  3BFH A;  3NGV A;  2LHL A;  3NXA A;  2NZ0 A;  2KI6 C;  2CNP A;  1X02 A;  1C7V A;  1DTL A;  1N65 A;  3L4A A;  3VRN A;  3AKA A;  1EG4 A;  2M1K B;  1L2O B;  1BLQ A;  1JWD A;  2WC8 A;  2JZI A;  2AAO A;  1DVI A;  3EK4 A;  2CBL A;  2KGB C;  1KSM A;  2KPH A;  3O78 A;  2LMV A;  3DY9 A;  1C07 A;  4WRI A;  1EJ3 A;  3TUY C;  2JRF A;  1OE9 B;  2K7B A;  3K21 A;  3KPX A;  4HRH A;  3GOF A;  1FI6 A;  1KK7 Y;  1ZFS A;  4R1E A;  4QJ4 B;  3KO0 A;  1S6I A;  1RFJ A;  1LA3 A;  1LS8 A;  1RTP 1;  1SCM B;  1W7J B;  1NPQ A;  2KLE A;  2M97 A;  2BEC A;  4DRW A;  1D1O A;  2A4J A;  2EHB A;  1KK7 Z;  1IH0 A;  3WXA A;  1E8A A;  1QS7 A;  1ZMZ A;  3EKH A;  3PAT A;  1B8R A;  3OX6 A;  1Y1A A;  2KFG A;  2LLT A;  4NDC A;  5DKN A;  4A4B A;  1BG1 A;  2QEV A;  4ZCV A;  2F2P A;  1M39 A;  3D75 A;  1CMF A;  1REC A;  1W7I B;  3BUX B;  3EK8 A;  3FWB A;  4OZD A;  1A4P A;  3SS4 A;  3VGO A;  2Q91 A;  3CAB A;  3I5F C;  4YI9 A;  5FI6 A;  4CPV A;  3I5H B;  2FJU B;  5PAL A;  1XO5 A;  2YGU A;  3VB1 A;  5FI7 A;  2JOJ A;  2G9B A;  4ZCU A;  5CSN A;  4AQJ A;  1WY9 A;  1CNP A;  5CSI A;  1T14 A;  1DQE A;  1J1E A;  1OOJ A;  3H4S E;  4YGD B;  1YUT A;  2RGI A;  3ZWH A;  1JC2 A;  2L4I A;  2M7N A;  1NX0 A;  2WC6 A;  3I5G C;  2ZND A;  1NSH A;  2KFF A;  2HQW A;  1SRA A;  4PHN A;  1CDL A;  3L4L A;  5CSF A;  3K1E A;  2KOT A;  4NQG A;  4YGA A;  2JUL A;  1NP8 A;  2DOQ A;  3PN7 B;  4FQO A;  1EG3 A;  1SL7 A;  2BAP A;  2LUX A;  3SG5 A;  2GGZ A;  3IQQ A;  3NHT A;  3V2L A;  2JPO A;  4F7F A;  3KEV A;  3LL8 B;  4N1F A;  1K2H A;  5JOL A;  4XJK B;  5DIC A;  1DJH A;  2VRG A;  1OSA A;  3PAL A;  1CFF A;  1K9K A;  1TTX A;  1TNQ A;  2K7C A;  4U8D A;  2K60 A;  1XFY O;  1SY9 A;  1YRT B;  2KLD A;  1N2D A;  2WCH A;  3B6X A;  4JKT A;  3SG4 A;  1NCY A;  1R2U A;  3JVT B;  1PAL A;  2PAS A;  2G2B A;  2BE4 A;  2HF5 A;  4OV2 A;  2H61 A;  1SR6 B;  3D0Y A;  2OTG B;  4MSP A;  3B7A A;  1MUX A;  2NLN A;  3O6B A;  2KI4 C;  3PLF B;  3L47 A;  1ZUZ A;  1IKU A;  4HSZ A;  1MXL C;  5I2L A;  1C7W A;  3SG3 A;  5KTY A;  1TWO A;  1KQM B;  2JT8 A;  2KSP A;  5I94 A;  1DJW A;  5AFP A;  4PAL A;  1SL8 A;  4BY5 A;  1G4Y R;  5KU1 A;  2L0P A;  1IJ5 A;  1QX7 A;  3I5H C;  4MRX A;  1LKJ A;  4PHM A;  3PJI A;  3R1V A;  4YGC B;  5J3X A;  1DF0 B;  3FE9 A;  3R1P A;  2MJW B;  4ETO A;  1YUS A;  3PM8 A;  2O5G A;  1OQP A;  2PAL A;  1H8B A;  1KQV A;  1TN4 A;  2M8U A;  2LHI A;  3WNX B;  1J1D A;  4GUK A;  2JXL A;  3TDZ A;  1NWD A;  3BUW B;  2EC6 B;  3OBV A;  3CR5 X;  2FCE A;  2H61 C;  1IWQ A;  2QDI A;  2B1U A;  3PN7 C;  1OMR A;  4FTG A;  2Y4Q A;  5FYX A;  4HRG A;  5HLO A;  4GNK B;  3BQ3 A;  3NHI A;  1UP5 A;  2SAS A;  1BT6 A;  1F54 A;  1UHJ A;  3FE6 A;  1B8L A;  1SMG A;  2M49 B;  4I5K A;  4MRY A;  3EVV A;  5CSJ A;  3TZ1 A;  1DT7 B;  1CMG A;  1B7T Y;  3VRO A;  1OZS A;  1QX5 B;  4MVF A;  1FW4 A;  2BNX A;  3CZ0 A;  1KFU S;  1NX2 A;  3M0W A;  4PE0 A;  4Q04 A;  5KSZ A;  1BOD A;  1F8H A;  1DEK A;  1LIN A;  3IF7 A;  4IL1 A;  1YR5 A;  2LM5 A;  1YUR A;  3JVT C;  3PM2 A;  1PVA A;  3I5I C;  3O4X A;  1HQV A;  1XFW O;  1CLB A;  2Y1M A;  1B7T Z;  3AAK A;  1S6J A;  2OS8 C;  4N1G A;  4MN0 A;  2OTG C;  2BE6 A;  5AAN A;  3SIB A;  1KK8 C;  1M63 B;  2PSR A;  2L5X B;  1U5I A;  2I94 A;  1DJX A;  1XFV O;  2BKI B;  1LVC D;  1KQM C;  3QRX A;  5GQQ C;  3OB2 B;  5AEQ A;  2JXC A;  2QPT A;  2ZFD A;  1UWO A;  1WDC C;  2JT0 A;  2BKH B;  4ORA B;  1J7P A;  1B9A A;  2PYQ A;  3S0B A;  1XVJ A;  1QLS A;  3SG7 A;  1OOF A;  2MLF C;  4C0L A;  1TNW A;  1J7R A;  1SYM A;  3KHE A;  3AKB A;  1CFP A;  1CDP A;  2MA2 A;  4P2Y B;  1DGU A;  1QIV A;  2BBM A;  4AOM A;  4C0K A;  1RK9 A;  4MZK A;  2BCA A;  1MQ1 A;  1ZOT B;  2H8V A;  2PVB A;  2D8N A;  1WRZ A;  3IVT A;  3NSK A;  5D3O A;  1BU3 A;  5D69 A;  4PHK A;  4PDZ A;  1RRO A;  2K8M B;  3OP0 A;  1CKK A;  1A2X A;  1J7O A;  4MZJ A;  3BOW B;  2K0J A;  5AXI A;  2LVK A;  1ALW A;  3MSE B;  2MLE C;  5I2O A;  5BPJ A;  1QIW A;  3DVM A;  1DMO A;  1F4O A;  3N7H A;  3BUN B;  5HKW A;  2KGR A;  3S0D A;  3EVU A;  2L98 A;  3CLN A;  3WHT B;  2BL0 B;  3JTD C;  1FF1 A;  4JPZ B;  1XA5 A;  2TN4 A;  2WCF A;  1QLK A;  1CM4 A;  1KWO B;  1UHN A;  3E3R A;  3TDU A;  5HLV A;  4NDD A;  2KYF A;  1DGV A;  1BF5 A;  1SK6 D;  2F33 A;  1NIW A;  2LLU A;  1ALV A;  3DF0 B;  3PFV A;  2LC5 A;  1EL4 A;  3IQO A;  2JQ6 A;  1TUJ A;  3GK1 A;  1L2O C;  2F8P A;  1MR8 A;  1XFR A;  1S26 D;  2IS9 A;  3ZNI A;  4M2P A;  2M7L A;  1KFX S;  1CFC A;  2CT9 A;  2K61 A;  2LP2 A;  3LK1 A;  2LP3 A;  1K9P A;  4YGB B;  3CTN A;  1TCO B;  5JJG A;  4OCI A;  1PUL A;  1M31 A;  3RM1 A;  1SCM C;  1SBJ A;  1UHI A;  1UUS A;  1XYD A;  2I18 A;  1ODB A;  1YVH A;  2LUC A;  1Y1X A;  2LMT A;  4PHJ A;  3CS1 A;  2JNX A;  1QVI Y;  4D1E A;  1SW8 A;  1Z4H A;  3LLE A;  2E6W A;  3C1V A;  2AUC A;  2EGD A;  2BCX A;  1F55 A;  3A8R A;  3SG2 A;  1KCY A;  4XJK A;  3FIA A;  2M1U A;  2H2K A;  2O60 A;  1QVI Z;  5EL2 A;  4E68 A;  4GGN A;  3A4U B;  2BBN A;  1R6P A;  2JPT A;  2M0R A;  4M2Q A;  2JWW A;  1A75 A;  5DKQ A;  1K9U A;  2KAX A;  2M9G A;  3WHU B;  1XFZ O;  3CZ1 A;  2LNK A;  3SS3 A;  4JWQ A;  1XK4 C;  3TS5 B;  4CFQ A;  1QTX A;  2WCL A;  1K94 A;  1V1F A;  1JFK A;  1NUB A;  1Y0V H;  4MZL A;  2Q4U A;  2SCP A;  2ZKM X;  3CGA A;  4PE1 A;  1BOC A;  1NCZ A;  1UHH A;  5K89 A;  4ORB B;  1GM0 A;  1CB1 A;  1H4B A;  3B88 A;  4INX A;  1N0Y A;  1TOP A;  4OR9 B;  2MAZ A;  3TDI A;  3ICB A;  3HX4 A;  2ISD A;  1OMV A;  2NXQ A;  1IQ5 A;  5HYD A;  4IJ7 A;  3B87 A;  1BJF A;  1DJI A;  5HKZ A;  2K7O A;  1BMO A;  3S0G A;  3TUY B;  2WOS A;  1RJV A;  1WRL A;  2I7A A;  4CID A;  2ZN8 A;  4PCW A;  4CLN A;  4OKH A;  1OOG A;  2QAC A;  4WQ3 A;  4GGF A;  5HKY A;  3BUO B;  1K93 D;  1OZO A;  1SR6 C;  2KBI A;  4YI8 A;  4CFR A;  2ZRS A;  3DD4 A;  2P6B B;  1LA0 A;  3D74 A;  1QX2 A;  1QV0 A;  1EXR A;  1GQM A;  4JD9 A;  2FJY A;  3CZT X;  3GK4 X;  2WCJ A;  2WCM A;  3NSL A;  2K2F A;  3I5F B;  1JF0 A;  1L7Z A;  1AJ4 A;  2I2R E;  3AAJ A;  3R1O A;  4GBA A;  4GPL B;  1QAS A;  2ERB A;  2WCK A;  3VRR A;  1ORG A;  4F0Z B;  3D76 A;  1B8C A;  2MHH A;  2COL B;  1GGW A;  2QEB A;  4YBH B;  2NCP A;  1BR1 B;  1BR4 B;  2FCD A;  1JUO A;  2JU0 A;  4FQT A;  2L2C A;  3CYZ A;  4ORC B;  1DJZ A;  4DCK A;  2JT3 A;  3I5G B;  2LVJ A;  3BJH A;  1S36 A;  1XFU O;  1IGV A;  2LVV A;  1B4C A;  4GGF C;  1VRK A;  1PVB A;  2EC6 C;  3SG6 A;  3D73 A;  3DZT A;  2LAP A;  3NSI A;  5HL1 A;  3CWG A;  1MHO A;  4ICB A;  1A29 A;  1XFX O;  1YTZ C;  2WCB A;  3QME A;  4TNC A;  1OW4 A;  5B8I B;  3UO9 A;  4PT1 A;  4OVN F;  4QJ5 B;  1K8U A;  3F45 A;  2KQY A;  3OHM B;  2L5Y A;  5ER4 X;  1J55 A;  2GGM A;  2KFH A;  4MLW A;  2KI6 D;  2JNF A;  1AJ5 A;  3NSO A;  3R72 A;  2L4H A;  3BOW A;  2BCB A;  2HQ8 A;  3RLZ A;  3D77 A;  4USL A;  1DJG A;  2KI4 B;  5FI2 A;  4I5L B;  1S5G Y;  1YRU B;  3DYE A;  2GV5 A;  5IBW A;  3RZS A;  1NX3 A;  1CTR A;  1V1G A;  2KBM A;  4DUQ A;  3S0E A;  1AHR A;  1QV1 A;  4KYN A;  1DJY A;  1S5G Z;  2HET A;  4JQ0 D;  2AMI A;  4INW A;  1AP4 A;  3BXK A;  3D78 A;  1XK4 A;  4MBE A;  1MF8 B;  3EVR A;  4C0J A;  1TRF A;  1Z2C B;  2WC5 A;  4I5N B;  1J7Q A;  1AUI B;  4GAO A;  2KNE A;  5D7F A;  4AQI A;  1Q80 A;  2JTT A;  1QAT A;  3DF0 A;  1SKT A;  4A4C A;  1G33 A;  4N5X A;  1GJY A;  1UHK A;  2KQ6 A;  1SL9 A;  3CR2 A;  4YRU A;  4WQ2 A;  1KFU L;  2Y1N A;  3BUM B;  1B47 A;  1CLM A;  1TCF A;  2KHN A;  2NCO A;  2ZRT A;  3BYA A;  1AVS A;  4PE7 A;  2L2E A;  1KSO A;  3BFB A;  4YGE B;  5TNC A;  3UNW A;  3PSR A;  2V53 A;  1DC1 A;  1HT9 A;  3D0Y B;  1YX8 A;  2P71 A;  2KYC A;  3DVE A;  2QEH A;  2GTE A;  1K96 A;  1LXF C;  1TUZ A;  3B86 A;  3BFA A;  4MEW A;  4I5J A;  2LAN A;  3OB1 B;  1RWY A;  4GFT A;  5G08 A;  1JBA A;  1WLM A;  1Y1U A;  2M3W A;  1G8I A;  1S3P A;  1PSB A;  1P28 A;  1PK0 D;  3FS7 A;  2MRD A;  2BL0 C;  3O2P A;  3Q8I A;  4L9M A;  2E30 A;  2K7D A;  3OGN A;  2LE9 B;  2MBX A;  1FPW A;  1GGZ A;  1K95 A;  1OOH A;  2JC2 A;  2LVI A;  3DVK A;  1CFD A;  1KWO C;  1A75 B;  3OX5 A;  4NDB A;  3VRP A;  3HCM A;  1CDN A;  3I5I B;  1F4Q A;  3LCP C;  2KAY A;  1OOI X;  1B1G A;  2PRU A;  1CLL A;  1SSE B;  1PRW A;  2K2A A;  1PSR A;  5CPV A;  1EH2 A;  2OS8 B;  1CM1 A;  1YVL A;  1YX7 A;  3SIA A;  1MWN A;  3O4Y A;  5I2Q A;  1A03 A;  1TIZ A;  2WCE A;  1KK8 B;  1C3Y A;  1IQ3 A;  2KDH A;  2M29 A;  4PE4 A;  1S1E A;  4BY4 A;  1YUU A;  2JTZ A;  2PMY A;  4DS7 A;  1UUR A;  1IJ6 A;  1QXP A;  1K90 D;  4UPG A;  1IG5 A;  2Y5I A;  1WRK A;  1CDM A;  1WDC B;  1QJT A;  3EKJ A;  2CTN A;  1MXE A;  5F6T A;  1M46 A;  3CZ2 A;  2LCP A;  3CR4 X;  1F71 A;  1DEL A;  1IRJ A;  4M2O A;  1DF0 A;  4DIR A;  1SCV A;  2WND A;  3VRQ A;  5AER A;  2L51 A;  3FE8 A;  3GK2 A;  3KF9 A;  1FBV A;  4HRE E;  3SS5 A;  2OPO A;  1AK8 A;  2ZNE A;  1F70 A;  1WLZ A;  1C3Z A;  1NYA A;  1SPY A;  1ZAC A;  3FWC A;  3SJS A;  1IIO A;  1M45 A;  2ZN9 A;  1QWV A;  3S0A A; 
#chains in the Genus database with same CATH homology
 1JFJ A;  1S6C A;  1FI5 A;  3DVJ A;  2L50 A;  1SNL A;  5ER5 A;  2F3Z A;  4QJ3 B;  1U5I B;  2LV7 A;  1NX1 A;  2LMU A;  4P5O E;  2F3Y A;  2F2O A;  5DKR A;  5I8N A;  2CCM A;  1JF2 A;  3JTD B;  3EK7 A;  1NCX A;  2HPS A;  1JSA A;  1TNP A;  2KAV A;  1Y6W A;  2WOR A;  2LLS A;  1TNX A;  2R2I A;  3LK0 A;  2FOT A;  3TS5 C;  2CXJ A;  3D10 A;  1KFX L;  1OMD A;  4XYN A;  2LHL A;  3NXA A;  2NZ0 A;  2KI6 C;  2CNP A;  1X02 A;  1C7V A;  1DTL A;  1N65 A;  3VRN A;  3AKA A;  1EG4 A;  2M1K B;  1L2O B;  1BLQ A;  1JWD A;  2WC8 A;  2JZI A;  2AAO A;  1DVI A;  3EK4 A;  2CBL A;  2KGB C;  1KSM A;  3O78 A;  2LMV A;  1C07 A;  4WRI A;  1EJ3 A;  3TUY C;  2JRF A;  1OE9 B;  2K7B A;  3K21 A;  3KPX A;  4HRH A;  3GOF A;  1FI6 A;  1KK7 Y;  1ZFS A;  4R1E A;  4QJ4 B;  3KO0 A;  1S6I A;  1RFJ A;  1LA3 A;  1RTP 1;  1SCM B;  1W7J B;  1NPQ A;  2M97 A;  4DRW A;  2BEC A;  1D1O A;  2A4J A;  2EHB A;  1KK7 Z;  1IH0 A;  3WXA A;  1E8A A;  1QS7 A;  1ZMZ A;  3EKH A;  3PAT A;  1B8R A;  3OX6 A;  1Y1A A;  2KFG A;  2LLT A;  4NDC A;  5DKN A;  4A4B A;  1BG1 A;  4ZCV A;  2F2P A;  1M39 A;  1CMF A;  1REC A;  1W7I B;  3BUX B;  3EK8 A;  3FWB A;  1A4P A;  3VGO A;  2Q91 A;  3I5F C;  4YI9 A;  4CPV A;  3I5H B;  2FJU B;  5PAL A;  1XO5 A;  2JOJ A;  2G9B A;  4ZCU A;  5CSN A;  4AQJ A;  1WY9 A;  1CNP A;  5CSI A;  3H4S E;  1J1E A;  1OOJ A;  4YGD B;  1YUT A;  2RGI A;  3ZWH A;  1JC2 A;  2L4I A;  2M7N A;  1NX0 A;  3I5G C;  2ZND A;  1NSH A;  2KFF A;  2HQW A;  1SRA A;  4PHN A;  1CDL A;  5CSF A;  2KOT A;  4NQG A;  4YGA A;  2JUL A;  1NP8 A;  2DOQ A;  3PN7 B;  4FQO A;  1EG3 A;  1SL7 A;  2LUX A;  3SG5 A;  2GGZ A;  3IQQ A;  3KEV A;  3LL8 B;  4N1F A;  1K2H A;  5JOL A;  4XJK B;  1DJH A;  2VRG A;  1OSA A;  3PAL A;  1CFF A;  1K9K A;  1TTX A;  1TNQ A;  2K7C A;  4U8D A;  1XFY O;  1SY9 A;  1YRT B;  3SG4 A;  1N2D A;  1NCY A;  1R2U A;  3JVT B;  1PAL A;  2PAS A;  2G2B A;  2BE4 A;  2HF5 A;  4OV2 A;  2H61 A;  1SR6 B;  3D0Y A;  2OTG B;  4MSP A;  1MUX A;  2NLN A;  3O6B A;  2KI4 C;  3PLF B;  1IKU A;  1ZUZ A;  4HSZ A;  1MXL C;  5I2L A;  1C7W A;  3SG3 A;  5KTY A;  2JT8 A;  1KQM B;  2KSP A;  1DJW A;  5AFP A;  4PAL A;  1SL8 A;  4BY5 A;  1G4Y R;  5KU1 A;  2L0P A;  1IJ5 A;  1QX7 A;  3I5H C;  4MRX A;  1LKJ A;  4PHM A;  4YGC B;  5J3X A;  1DF0 B;  4ETO A;  2MJW B;  1YUS A;  3PM8 A;  2O5G A;  1OQP A;  2PAL A;  1H8B A;  1KQV A;  1TN4 A;  2M8U A;  2LHI A;  3WNX B;  1J1D A;  4GUK A;  2JXL A;  3TDZ A;  1NWD A;  3BUW B;  2EC6 B;  3CR5 X;  2FCE A;  2H61 C;  1IWQ A;  5HLO A;  2B1U A;  3PN7 C;  1OMR A;  4FTG A;  2Y4Q A;  5FYX A;  4HRG A;  4GNK B;  3BQ3 A;  1UP5 A;  2SAS A;  1BT6 A;  1F54 A;  1UHJ A;  1B8L A;  1SMG A;  2M49 B;  4I5K A;  4MRY A;  3EVV A;  5CSJ A;  3TZ1 A;  1DT7 B;  1CMG A;  1B7T Y;  3VRO A;  1OZS A;  1QX5 B;  4MVF A;  1FW4 A;  4PE0 A;  1F8H A;  1KFU S;  1NX2 A;  3M0W A;  4Q04 A;  5KSZ A;  1BOD A;  1LIN A;  3IF7 A;  4IL1 A;  1YR5 A;  2LM5 A;  1YUR A;  3JVT C;  1PVA A;  3I5I C;  1CLB A;  1HQV A;  1XFW O;  2Y1M A;  1B7T Z;  3AAK A;  1S6J A;  2OS8 C;  4N1G A;  4MN0 A;  2OTG C;  2BE6 A;  5AAN A;  3SIB A;  1KK8 C;  1M63 B;  2PSR A;  2L5X B;  1U5I A;  2I94 A;  1DJX A;  1XFV O;  2BKI B;  1LVC D;  1KQM C;  3QRX A;  5GQQ C;  3OB2 B;  5AEQ A;  2JXC A;  2QPT A;  2ZFD A;  1UWO A;  1WDC C;  2JT0 A;  2BKH B;  4ORA B;  1J7P A;  1B9A A;  1XVJ A;  1QLS A;  3SG7 A;  2MLF C;  4C0L A;  1TNW A;  1J7R A;  1SYM A;  3KHE A;  3AKB A;  1CFP A;  1CDP A;  2MA2 A;  4P2Y B;  1DGU A;  1QIV A;  2BBM A;  4AOM A;  4C0K A;  1RK9 A;  4MZK A;  2BCA A;  1MQ1 A;  1ZOT B;  2PVB A;  2D8N A;  1WRZ A;  3NSK A;  1BU3 A;  5D69 A;  4PHK A;  4PDZ A;  1RRO A;  2K8M B;  3OP0 A;  1CKK A;  1A2X A;  1J7O A;  4MZJ A;  3BOW B;  2K0J A;  5AXI A;  2LVK A;  1ALW A;  3MSE B;  2MLE C;  5I2O A;  5BPJ A;  1QIW A;  3DVM A;  1DMO A;  1F4O A;  3BUN B;  5HKW A;  2KGR A;  3EVU A;  2L98 A;  3CLN A;  3WHT B;  2BL0 B;  3JTD C;  1FF1 A;  4JPZ B;  1XA5 A;  2TN4 A;  2WCF A;  1QLK A;  1CM4 A;  1KWO B;  1UHN A;  3E3R A;  3TDU A;  5HLV A;  4NDD A;  2KYF A;  1DGV A;  1BF5 A;  1SK6 D;  2F33 A;  1NIW A;  2LLU A;  1ALV A;  3DF0 B;  3PFV A;  2LC5 A;  1EL4 A;  3IQO A;  2JQ6 A;  3GK1 A;  1L2O C;  2F8P A;  1MR8 A;  1S26 D;  2IS9 A;  3ZNI A;  4M2P A;  2M7L A;  1KFX S;  1CFC A;  2CT9 A;  2K61 A;  2LP2 A;  3LK1 A;  2LP3 A;  1K9P A;  4YGB B;  3CTN A;  1TCO B;  5JJG A;  4OCI A;  1PUL A;  1M31 A;  3RM1 A;  1SCM C;  1SBJ A;  1UHI A;  1UUS A;  1XYD A;  2I18 A;  1ODB A;  1YVH A;  2LUC A;  1Y1X A;  2LMT A;  4PHJ A;  3CS1 A;  2JNX A;  1QVI Y;  4D1E A;  1SW8 A;  3LLE A;  2E6W A;  3C1V A;  2AUC A;  2EGD A;  2BCX A;  1F55 A;  3A8R A;  3SG2 A;  1KCY A;  4XJK A;  3FIA A;  2M1U A;  2H2K A;  2O60 A;  1QVI Z;  4E68 A;  4GGN A;  3A4U B;  2BBN A;  1R6P A;  2JPT A;  2M0R A;  4M2Q A;  2JWW A;  1A75 A;  5DKQ A;  1K9U A;  2KAX A;  2M9G A;  3WHU B;  1XFZ O;  2LNK A;  4JWQ A;  1XK4 C;  3TS5 B;  4CFQ A;  1QTX A;  1K94 A;  1V1F A;  1JFK A;  1NUB A;  1Y0V H;  4MZL A;  2Q4U A;  2SCP A;  2ZKM X;  3CGA A;  4PE1 A;  1BOC A;  1NCZ A;  1UHH A;  5K89 A;  4ORB B;  1CB1 A;  1H4B A;  1N0Y A;  1TOP A;  4OR9 B;  2MAZ A;  3TDI A;  3ICB A;  3HX4 A;  2ISD A;  1OMV A;  2NXQ A;  1IQ5 A;  5HYD A;  1BJF A;  1DJI A;  5HKZ A;  2K7O A;  1BMO A;  3TUY B;  2WOS A;  1RJV A;  1WRL A;  2I7A A;  4CID A;  2ZN8 A;  4PCW A;  4CLN A;  4OKH A;  2QAC A;  4WQ3 A;  4GGF A;  5HKY A;  3BUO B;  1K93 D;  1OZO A;  1SR6 C;  2KBI A;  4YI8 A;  4CFR A;  2ZRS A;  3DD4 A;  2P6B B;  1LA0 A;  1QX2 A;  1QV0 A;  1EXR A;  1GQM A;  3CZT X;  3GK4 X;  3NSL A;  2K2F A;  3I5F B;  1JF0 A;  1L7Z A;  1AJ4 A;  2I2R E;  3AAJ A;  4GBA A;  4GPL B;  1QAS A;  3VRR A;  4F0Z B;  1B8C A;  2MHH A;  2COL B;  1GGW A;  4YBH B;  2NCP A;  1BR1 B;  1BR4 B;  2FCD A;  1JUO A;  2JU0 A;  4ORC B;  1DJZ A;  4DCK A;  2JT3 A;  3I5G B;  2LVJ A;  1S36 A;  1XFU O;  1IGV A;  2LVV A;  1B4C A;  4GGF C;  1VRK A;  1PVB A;  2EC6 C;  3SG6 A;  2LAP A;  3NSI A;  3CWG A;  1MHO A;  4ICB A;  1A29 A;  1XFX O;  1YTZ C;  2WCB A;  4TNC A;  5B8I B;  4OVN F;  4QJ5 B;  1K8U A;  3F45 A;  2KQY A;  3OHM B;  5ER4 X;  1J55 A;  2GGM A;  2KFH A;  4MLW A;  2KI6 D;  2JNF A;  1AJ5 A;  3NSO A;  2L4H A;  3BOW A;  2BCB A;  2HQ8 A;  3RLZ A;  4USL A;  1DJG A;  2KI4 B;  4I5L B;  1S5G Y;  1YRU B;  2GV5 A;  5IBW A;  1NX3 A;  1CTR A;  1V1G A;  2KBM A;  4DUQ A;  1AHR A;  1QV1 A;  1DJY A;  1S5G Z;  2HET A;  4JQ0 D;  2AMI A;  1AP4 A;  3BXK A;  1XK4 A;  4MBE A;  1MF8 B;  3EVR A;  4C0J A;  1TRF A;  4I5N B;  1J7Q A;  1AUI B;  4GAO A;  2KNE A;  5D7F A;  4AQI A;  1Q80 A;  2JTT A;  1QAT A;  3DF0 A;  1SKT A;  4A4C A;  1G33 A;  4N5X A;  1GJY A;  1UHK A;  2KQ6 A;  1SL9 A;  3CR2 A;  4YRU A;  4WQ2 A;  1KFU L;  2Y1N A;  3BUM B;  1B47 A;  1CLM A;  1TCF A;  2KHN A;  2NCO A;  2ZRT A;  3BYA A;  1AVS A;  4PE7 A;  2L2E A;  1KSO A;  4YGE B;  5TNC A;  3PSR A;  2V53 A;  1HT9 A;  3D0Y B;  1YX8 A;  2KYC A;  3DVE A;  1K96 A;  1LXF C;  4MEW A;  4I5J A;  2LAN A;  3OB1 B;  1RWY A;  4GFT A;  5G08 A;  1JBA A;  1WLM A;  1Y1U A;  2M3W A;  1G8I A;  1S3P A;  1PSB A;  1PK0 D;  3FS7 A;  2MRD A;  2BL0 C;  3O2P A;  4L9M A;  2E30 A;  2K7D A;  2LE9 B;  2MBX A;  1FPW A;  1GGZ A;  1K95 A;  2JC2 A;  2LVI A;  3DVK A;  3OX5 A;  1CFD A;  1KWO C;  1A75 B;  3VRP A;  4NDB A;  3HCM A;  1CDN A;  3I5I B;  1F4Q A;  3LCP C;  2KAY A;  1B1G A;  2PRU A;  1CLL A;  2K2A A;  1PRW A;  5CPV A;  1PSR A;  1EH2 A;  2OS8 B;  1CM1 A;  1YVL A;  1YX7 A;  3SIA A;  1MWN A;  3O4Y A;  5I2Q A;  1A03 A;  1TIZ A;  2WCE A;  1KK8 B;  1IQ3 A;  2KDH A;  2M29 A;  4PE4 A;  1S1E A;  4BY4 A;  1YUU A;  2JTZ A;  2PMY A;  4DS7 A;  1UUR A;  1IJ6 A;  1QXP A;  1K90 D;  4UPG A;  1IG5 A;  2Y5I A;  1WRK A;  1CDM A;  1WDC B;  1QJT A;  3EKJ A;  2CTN A;  1MXE A;  5F6T A;  1M46 A;  2LCP A;  3CR4 X;  1F71 A;  1IRJ A;  4M2O A;  1DF0 A;  4DIR A;  1SCV A;  2WND A;  3VRQ A;  5AER A;  2L51 A;  3KF9 A;  3GK2 A;  1FBV A;  4HRE E;  2OPO A;  1AK8 A;  2ZNE A;  1F70 A;  1WLZ A;  1NYA A;  1SPY A;  1ZAC A;  3FWC A;  3SJS A;  1M45 A;  2ZN9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...