1SR6B

Structure of nucleotide-free scallop myosin s1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
144
structure length
144
Chain Sequence
PQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKGSGEEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain, striated muscle
publication title Myosin subfragment 1 structures reveal a partially bound nucleotide and a complex salt bridge that helps couple nucleotide and actin binding.
pubmed doi rcsb
molecule tags Contractile protein
total genus 18
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2004-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1sr6B01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1sr6B02
1W7JB 2JZIA 2CXJA 4BY4A 2MLFC 1G33A 2Y1NA 3DF0A 1JBAA 4BY5A 1SBJA 1K9UA 1V1FA 1CB1A 3PATA 1KFXS 1IWQA 1C7WA 1DMOA 4OR9B 5G08A 4AQJA 3EKHA 1CFCA 1G4YR 1C07A 1SY9A 2LHIA 5KSZA 4YGEB 4QJ5B 1BLQA 3BUWB 3I5GC 1FBVA 2BECA 4N1GA 1CM4A 3KHEA 2KBMA 5JJGA 2FCEA 1JUOA 2KAVA 3CGAA 4M2QA 4NDDA 3WHUB 1KCYA 2CCMA 4PE4A 1XK4A 2CNPA 2LLUA 2LV7A 5F6TA 5IBWA 1N0YA 3EVUA 3BUNB 4OKHA 1IKUA 1F4OA 2E6WA 1KQVA 1JF0A 1KFUS 4N5XA 1WY9A 3GK2A 1TCFA 1DGUA 4IL1A 5HLOA 1J7QA 1OOJA 2AUCA 1SNLA 4PE0A 3VRPA 2OTGC 1U5IA 4YI8A 1AP4A 1KK7Y 1ALWA 1B7TZ 1QVIZ 4DUQA 4JWQA 1HT9A 1YRTB 3TDUA 1DGVA 1XO5A 1NCYA 1XYDA 5D69A 1XVJA 3FIAA 1J7OA 1BT6A 1NX1A 1MR8A 2JRFA 3DF0B 4HRGA 1FPWA 4JPZB 3GK1A 3QRXA 1YUTA 3DVMA 1KK8B 1QASA 3C1VA 1F4QA 3SG7A 1DF0A 2AAOA 1CMFA 1MXEA 2LP2A 4USLA 2LVVA 1MWNA 3OB2B 2V53A 3NSIA 3PFVA 1K9PA 1CFDA 3H4SE 2E30A 1SR6B 4GPLB 1TNWA 3IQOA 1FI6A 3DVEA 4DCKA 1QXPA 1K93D 1A4PA 1WRKA 2JWWA 2FJUB 3NXAA 3PALA 1M45A 3SG2A 2I18A 1K8UA 3AAKA 4HSZA 1EG4A 2ZRSA 2K7OA 1EJ3A 3O6BA 1ODBA 2O60A 3M0WA 2ZKMX 3CLNA 4YBHB 1BR1B 1QLSA 3LLEA 3I5FC 1QIWA 1NX2A 3LL8B 5ER5A 2LHLA 1S6CA 1WLMA 1ZOTB 1DT7B 1SL8A 3EKJA 5HLVA 1AHRA 1QX7A 2HF5A 2L51A 4F0ZB 1CFPA 1B8RA 1QIVA 2L5XB 2LMVA 1NIWA 2BKHB 4FQOA 1UURA 3CR5X 3K21A 1IJ5A 1DF0B 1NCXA 2BL0C 3A4UB 1PRWA 1B8LA 2MLEC 1EG3A 1CLMA 4NDCA 2M97A 3NSLA 2LVIA 1KSMA 1DJZA 2M29A 1OZSA 1K94A 5DKNA 1SCMB 2JOJA 2K8MB 2LLSA 3CR2A 2JULA 2VRGA 2K2AA 2OS8B 4YI9A 3TS5B 2DOQA 2M7NA 5CSNA 3DVKA 3VROA 1CM1A 1OMDA 1QV1A 1XFXO 1ZFSA 1RTP1 1RECA 2LUXA 1TNXA 1CDLA 4N1FA 1KSOA 1AK8A 1WDCC 1YX7A 1A2XA 1J55A 2KDHA 3KPXA 3IQQA 3MSEB 3PN7C 3VRNA 1F71A 5KTYA 2CT9A 2MA2A 1R2UA 4P2YB 1NCZA 1KWOC 4YGCB 3TZ1A 3ZWHA 4CFQA 1DTLA 1NSHA 2QACA 1K2HA 1J1EA 2BCBA 1TOPA 1B9AA 1MHOA 4AOMA 4MRXA 1WLZA 2CBLA 2KAXA 2BE6A 3EVVA 3F45A 4WQ3A 3EVRA 1GGZA 1PVAA 2KHNA 4GGFC 3JVTB 1YVHA 1JSAA 2F2OA 1YRUB 3KF9A 2K0JA 3FS7A 1A29A 4ICBA 1M46A 1N65A 3I5HC 4I5NB 3LK1A 2KBIA 1HQVA 3PSRA 1JFJA 1S1EA 2GGZA 2M3WA 1TNQA 2MBXA 1QV0A 1IRJA 2EHBA 2L50A 2K2FA 2KYFA 5I2LA 1BR4B 2NCOA 3DD4A 4PE1A 1SL9A 1SK6D 5AFPA 2BE4A 4WQ2A 2WNDA 3BUMB 1DJYA 5B8IB 2BBMA 5I2QA 2PVBA 2LM5A 3D10A 2M1KB 2JTTA 3RM1A 1S26D 1QATA 1SW8A 3A8RA 1TNPA 3SJSA 4OCIA 1AJ4A 4MZLA 3TDIA 1RFJA 2GV5A 2KSPA 3OB1B 3TUYB 2K7BA 1LINA 3ZNIA 3D0YA 1M31A 1BU3A 1QJTA 1L2OB 2KI4B 4C0KA 2MRDA 1PK0D 3O2PA 2JQ6A 1XFUO 1ZMZA 1XFYO 2I2RE 2PMYA 3HX4A 3ICBA 4GBAA 2SCPA 1MXLC 1AUIB 1EL4A 1B47A 2LMUA 4PE7A 1IH0A 2HQ8A 1NYAA 1OMVA 3FWBA 5CSIA 1F54A 1L7ZA 2P6BB 3BOWA 1PULA 1Y0VH 2JT3A 1KQMB 2SASA 2TN4A 1OZOA 2R2IA 3EK8A 1Y6WA 4M2OA 3CR4X 1FW4A 1M63B 4C0LA 3EK4A 2WOSA 1UWOA 2PASA 2L0PA 4TNCA 2KYCA 1V1GA 4XJKA 1KK7Z 4I5KA 1DJGA 2LVJA 4JQ0D 2OPOA 4YGBB 3EK7A 5CPVA 1X02A 1ZUZA 1KFXL 2EC6C 1KK8C 4YGDB 1DVIA 3RLZA 2CTNA 1BMOA 2LE9B 3AKAA 4PHMA 3IF7A 2I94A 2MHHA 1GJYA 4YRUA 3E3RA 4E68A 3D0YB 2K7DA 1SYMA 1F55A 4I5JA 1D1OA 1G8IA 4XYNA 4ZCVA 1IG5A 2LCPA 1XK4C 3O78A 5PALA 1SR6C 4CFRA 3I5FB 2HETA 4MZKA 1CLBA 2HQWA 1S6IA 1KFUL 1TRFA 2H2KA 1Y1AA 1AVSA 3AKBA 1IJ6A 1EH2A 2BCAA 1UHHA 2JNXA 2LAPA 3BOWB 2KGRA 4MEWA 5CSJA 1J7PA 2KOTA 1RWYA 1YVLA 4A4CA 1UHJA 2LLTA 1XFWO 2AMIA 2K61A 1BOCA 4OVNF 1NUBA 1MF8B 3I5IC 1F70A 1NX3A 4XJKB 4WRIA 2F33A 4FTGA 1A75A 3SIAA 1LKJA 2JPTA 2LP3A 1QX5B 2JT0A 5AERA 2KFHA 4NQGA 1YURA 1K96A 2ISDA 1WDCB 1ALVA 5FYXA 2PRUA 3JTDB 1YUUA 2F3ZA 3TDZA 2JTZA 1S5GY 1SCMC 1UUSA 4C0JA 2OS8C 2PALA 2G9BA 3KO0A 4PDZA 5AXIA 3TS5C 4HRHA 1KWOB 1K95A 1B1GA 2M7LA 1PSRA 2M9GA 1UP5A 5DKQA 1TN4A 2L4HA 2I7AA 1SKTA 2FCDA 2WCFA 4MRYA 1SPYA 4GUKA 2KAYA 4ZCUA 1CNPA 5D7FA 1CDMA 1WRZA 1CLLA 2COLB 2Q91A 1CKKA 2D8NA 1CMGA 3SG3A 3PLFB 2IS9A 4A4BA 2WCBA 1CFFA 1Q80A 1C7VA 1OSAA 1WRLA 3PM8A 3I5HB 4D1EA 2ZNDA 2F3YA 5HKWA 4GGNA 4GNKB 1MQ1A 1A75B 3AAJA 1Y1XA 4DIRA 2NZ0A 3O4YA 4QJ4B 3JVTC 3WNXB 3I5GB 3BYAA 4OV2A 2M8UA 2KFGA 1EXRA 1DJIA 2B1UA 1LVCD 1UHIA 2LANA 1QX2A 4DS7A 2JT8A 4Q04A 1B7TY 1QVIY 2F8PA 2H61C 2BBNA 4I5LB 4P5OE 4PALA 1N2DA 2KNEA 2ZRTA 1RROA 2A4JA 4U8DA 5I2OA 4MZJA 2NCPA 2OTGB 4ORBB 2LMTA 4HREE 3OX6A 1CDNA 1DJWA 1SMGA 1NPQA 5KU1A 2PSRA 1S36A 5K89A 1J7RA 2M0RA 1XA5A 3WHTB 1H4BA 3SG6A 4UPGA 1H8BA 1FF1A 2F2PA 1FI5A 1IQ5A 2GGMA 2Y4QA 3OHMB 1OMRA 2LC5A 4DRWA 1OE9B 2KQYA 2WCEA 5J3XA 5I8NA 3TUYC 1SL7A 3BUXB 1B8CA 1PSBA 3CZTX 1ZACA 5CSFA 1TIZA 1L2OC 2KI4C 3CWGA 2O5GA 5GQQC 2NLNA 2FOTA 1LA3A 3VRQA 1GGWA 2KI6D 1E8AA 2Y5IA 3VGOA 2KI6C 1MUXA 1CTRA 3LCPC 3GK4X 4PHNA 3BUOB 1JFKA 2G2BA 1QS7A 1YR5A 1KQMC 2EC6B 2JXLA 3OX5A 3VRRA 3GOFA 4CLNA 3BQ3A 1K9KA 1S6JA 3DVJA 2LUCA 4GFTA 2JU0A 4NDBA 3OP0A 3LK0A 1UHKA 4QJ3B 1B4CA 1DJHA 4MN0A 4PHKA 4CPVA 1CDPA 2L2EA 2MJWB 4MBEA 3WXAA 1QTXA 3SIBA 2NXQA 1YUSA 5HKZA 1JWDA 4GGFA 2M49B 1U5IB 3HCMA 1AJ5A 2BL0B 1BJFA 1BODA 2WORA 1NWDA 4L9MA 2KFFA 2JXCA 5TNCA 3NSKA 3I5IB 1K90D 2JNFA 2ZNEA 5ER4X 2RGIA 1TTXA 2K7CA 1BF5A 3NSOA 3CTNA 2ZN9A 4AQIA 1IQ3A 2M1UA 4PCWA 2L98A 4YGAA 3KEVA 2ZFDA 3BXKA 1JF2A 1NX0A 2Y1MA 2JC2A 2KQ6A 1F8HA 1XFZO 1SRAA 4MSPA 1W7IB 3PN7B 1J1DA 4ORCB 4CIDA 2MAZA 5BPJA 5AEQA 2H61A 1S3PA 5DKRA 1IGVA 2BKIB 2HPSA 5JOLA 2EGDA 4MVFA 1SCVA 1LA0A 2L4IA 2LNKA 4ORAB 1Y1UA 1XFVO 1VRKA 3JTDC 4R1EA 2KGBC 5HKYA 1R6PA 1GQMA 4ETOA 5HYDA 2BCXA 1PVBA 2WC8A 3SG4A 4PHJA 3FWCA 2QPTA 2LVKA 3CS1A 1A03A 1JC2A 1BG1A 1TCOB 4MLWA 1DJXA 1LXFC 2ZN8A 1PALA 1S5GZ 1NP8A 1UHNA 1YX8A 5AANA 4GAOA 1RK9A 1M39A 1RJVA 4M2PA 1OQPA 3SG5A 1QLKA 2Q4UA 1YTZC
chains in the Genus database with same CATH superfamily
4JKTA 1W7JB 2JZIA 2CXJA 4BY4A 2MLFC 1G33A 2Y1NA 3DF0A 1JBAA 4BY5A 1SBJA 1K9UA 1V1FA 1CB1A 3PATA 1KFXS 1IWQA 1C7WA 3BFAA 1DMOA 4OR9B 5G08A 2WCJA 4AQJA 3EKHA 1CFCA 1G4YR 2WC5A 1C07A 1SY9A 2LHIA 5KSZA 4YGEB 4QJ5B 1BLQA 3BUWB 1Z2CB 1OOGA 3I5GC 5D3OA 1FBVA 2BECA 4N1GA 1CM4A 3KHEA 2KBMA 5JJGA 2FCEA 1JUOA 2KAVA 3CGAA 4M2QA 4NDDA 3WHUB 1KCYA 2CCMA 4PE4A 1XK4A 2CNPA 2LLUA 2LV7A 5F6TA 5IBWA 1N0YA 3EVUA 3BUNB 4OKHA 1IKUA 1F4OA 2E6WA 1KQVA 3D76A 1JF0A 1KFUS 2ERBA 4N5XA 1WY9A 3SS3A 3GK2A 1TCFA 1DGUA 1DQEA 4IL1A 5HLOA 5HL1A 1J7QA 1OOJA 2AUCA 1SNLA 4PE0A 3VRPA 2OTGC 1U5IA 4YI8A 3S0EA 1AP4A 1KK7Y 1ALWA 1B7TZ 1QVIZ 4DUQA 4JWQA 1HT9A 1YRTB 3TDUA 1DGVA 1XO5A 3DYEA 1NCYA 1XYDA 5D69A 1XVJA 3FIAA 1J7OA 1BT6A 1NX1A 1MR8A 2JRFA 3DF0B 4HRGA 1FPWA 4JPZB 2KPHA 3GK1A 3QRXA 1YUTA 3DVMA 1KK8B 1QASA 3C1VA 1F4QA 3SG7A 1DF0A 2AAOA 1TUJA 1CMFA 1MXEA 4INXA 2LP2A 4USLA 2LVVA 1MWNA 3OB2B 2V53A 3OBVA 3NSIA 3PFVA 1K9PA 1CFDA 1ORGA 3H4SE 2E30A 1SR6B 4GPLB 1TNWA 3IQOA 1FI6A 3DVEA 3CYZA 4DCKA 1QXPA 1K93D 1A4PA 1WRKA 2JWWA 2FJUB 3NXAA 3PALA 4KYNA 1M45A 3SG2A 2I18A 1K8UA 3AAKA 4HSZA 1EG4A 2ZRSA 2K7OA 1EJ3A 3L4LA 3O6BA 4PT1A 1ODBA 2O60A 3M0WA 2ZKMX 3CLNA 4YBHB 1BR1B 1QLSA 3LLEA 3I5FC 1QIWA 1NX2A 3LL8B 5ER5A 2LHLA 1OOFA 1S6CA 1WLMA 1ZOTB 1DT7B 1SL8A 3EKJA 5HLVA 3SS5A 1AHRA 1QX7A 2HF5A 2L51A 4F0ZB 2P71A 1CFPA 1B8RA 1QIVA 2L5XB 2LMVA 1NIWA 3FE8A 2BKHB 4FQOA 1UURA 3CR5X 3K21A 1IJ5A 1DF0B 1NCXA 2BL0C 3A4UB 1PRWA 1B8LA 2MLEC 1EG3A 1CLMA 4INWA 2M97A 2QEHA 3NSLA 4NDCA 2LVIA 1KSMA 1DJZA 2M29A 1OZSA 1K94A 2QDIA 1SCMB 2JOJA 2K8MB 2LLSA 3CR2A 2JULA 2VRGA 2K2AA 2OS8B 2P70A 4YI9A 3TS5B 2DOQA 2M7NA 5CSNA 3DVKA 3FE9A 3VROA 1CM1A 1OMDA 1QV1A 1XFXO 1ZFSA 2PQLA 1RTP1 1RECA 3SS4A 2LUXA 1TNXA 1CDLA 4N1FA 3S0FA 1KSOA 1AK8A 1WDCC 1YX7A 1A2XA 1J55A 2GTEA 2KDHA 3IQQA 3KPXA 3MSEB 3PN7C 3VRNA 1F71A 4JD9A 5KTYA 3D74A 2CT9A 3B6XA 2MA2A 1R2UA 4P2YB 1NCZA 1KWOC 4YGCB 3TZ1A 3O4XA 3ZWHA 4CFQA 1DTLA 1NSHA 2QACA 1K2HA 1J1EA 2KLEA 2BCBA 1TOPA 1B9AA 1MHOA 4AOMA 4MRXA 1WLZA 2CBLA 2KAXA 2BE6A 3EVVA 3F45A 4WQ3A 3EVRA 1GGZA 1PVAA 2KHNA 3D75A 4GGFC 3JVTB 1YVHA 1JSAA 2F2OA 1YRUB 3KF9A 2K0JA 3R72A 3FS7A 1A29A 4ICBA 3UNWA 1M46A 1N65A 3I5HC 4I5NB 3LK1A 2KBIA 1HQVA 3PSRA 2FJYA 2KLDA 1JFJA 1S1EA 2GGZA 2M3WA 1TNQA 3DY9A 2MBXA 1QV0A 1IRJA 2EHBA 2L50A 2K2FA 2KYFA 5I2LA 1BR4B 2NCOA 3CDNA 3DD4A 4PE1A 1SL9A 1SK6D 5AFPA 2BE4A 3CABA 1C3YA 4WQ2A 2WNDA 4OZDA 3BUMB 1DJYA 5B8IB 2BBMA 5I2QA 2PVBA 2LM5A 3D10A 2M1KB 2JTTA 3RM1A 1OW4A 1S26D 1QATA 1SW8A 3A8RA 1TNPA 3SJSA 2L2CA 1AJ4A 4OCIA 4MZLA 3TDIA 1RFJA 2GV5A 2KSPA 3OB1B 3TUYB 2K7BA 1LINA 3ZNIA 3D0YA 1M31A 3D77A 1BU3A 1QJTA 1L2OB 3K1EA 2KI4B 4C0KA 2MRDA 1PK0D 3O2PA 2JQ6A 1XFUO 1ZMZA 1XFYO 2I2RE 2PMYA 3HX4A 3ICBA 4GBAA 2SCPA 1MXLC 1AUIB 1EL4A 1T14A 1B47A 2LMUA 4PE7A 1IH0A 2HQ8A 1NYAA 1OMVA 3FWBA 5CSIA 1F54A 1L7ZA 2P6BB 3BOWA 3B88A 1PULA 1Y0VH 2JT3A 1KQMB 2SASA 3DXLA 2TN4A 1OZOA 2R2IA 3EK8A 1Y6WA 4M2OA 2BNXA 3CR4X 1OOIX 1FW4A 1M63B 4C0LA 3EK4A 2BAPA 2WOSA 1UWOA 2PASA 2L0PA 4TNCA 2KYCA 3BFHA 1V1GA 4XJKA 1KK7Z 4I5KA 1DJGA 2LVJA 4JQ0D 2OPOA 4YGBB 3EK7A 5CPVA 2H8VA 1X02A 1ZUZA 1KFXL 2EC6C 1KK8C 4YGDB 1DVIA 3RLZA 2CTNA 1BMOA 2LE9B 3AKAA 4PHMA 3CZ1A 1SSEB 3IF7A 3NHTA 2I94A 2MHHA 1GJYA 3D78A 4IJ7A 4YRUA 3E3RA 4E68A 3D0YB 3R1PA 2K7DA 1SYMA 1F55A 3B87A 3PJIA 4I5JA 1D1OA 1G8IA 4XYNA 5FI2A 4ZCVA 1IG5A 2LCPA 1XK4C 3O78A 5PALA 1TUZA 1SR6C 1XFRA 3I5FB 4CFRA 2HETA 4MZKA 1CLBA 2HQWA 1S6IA 1KFUL 1TRFA 2H2KA 1Y1AA 3R1VA 1AVSA 3AKBA 1IJ6A 1EH2A 2BCAA 1UHHA 2JNXA 2LAPA 3BOWB 2KGRA 4MEWA 5CSJA 1J7PA 2KOTA 1LS8A 1RWYA 1DEKA 1YVLA 3QMEA 4A4CA 1UHJA 2LLTA 1XFWO 2AMIA 2K61A 1BOCA 4OVNF 1NUBA 1MF8B 3I5IC 1F70A 1NX3A 4XJKB 4WRIA 2F33A 3S0DA 2WCMA 2L5YA 1A75A 4FTGA 3SIAA 1LKJA 2JPTA 2LP3A 1QX5B 2JT0A 5AERA 2KFHA 4NQGA 1YURA 1K96A 2PYQA 2ISDA 3Q8IA 1WDCB 1ALVA 5DKNA 2PRUA 3D73A 5FYXA 3JTDB 1YUUA 2F3ZA 3TDZA 2JTZA 1S5GY 1SCMC 1UUSA 4C0JA 2OS8C 2PALA 2G9BA 3KO0A 3CZ0A 4PDZA 5AXIA 3TS5C 4HRHA 1KWOB 1K95A 1B1GA 2M7LA 1PSRA 2M9GA 1UP5A 5DKQA 1TN4A 2L4HA 2I7AA 1SKTA 3OGNA 2FCDA 2WCFA 4MRYA 1SPYA 4GUKA 2KAYA 4ZCUA 2QEBA 1CNPA 5D7FA 1CDMA 1WRZA 1CLLA 2COLB 2Q91A 1CKKA 2D8NA 1CMGA 3SG3A 3PLFB 2IS9A 4A4BA 2WCBA 1CFFA 1Q80A 1C7VA 1OSAA 1WRLA 1DELA 3PM8A 2YGUA 3I5HB 4D1EA 2JPOA 2ZNDA 2F3YA 2QEVA 3NGVA 5HKWA 4GGNA 4GNKB 1MQ1A 1A75B 3AAJA 1OOHA 1Y1XA 3BJHA 2NZ0A 4DIRA 1DC1A 3O4YA 4QJ4B 3JVTC 3L47A 5FI6A 3I5GB 3WNXB 3BYAA 4OV2A 2M8UA 3V2LA 2KFGA 1EXRA 1DJIA 2B1UA 1LVCD 1UHIA 2LANA 1QX2A 4DS7A 4FQTA 2JT8A 4Q04A 1B7TY 1QVIY 2F8PA 2H61C 2BBNA 4I5LB 4P5OE 4PALA 1N2DA 2KNEA 2ZRTA 1RROA 2A4JA 4U8DA 5I2OA 4MZJA 1C3ZA 2NCPA 2OTGB 5FI7A 3IVTA 1GM0A 3L4AA 4ORBB 2LMTA 4HREE 2WCKA 3OX6A 1CDNA 1DJWA 1SMGA 1NPQA 3S0GA 2PSRA 1S36A 5K89A 1J7RA 2M0RA 5KU1A 1XA5A 3WHTB 3R1OA 1H4BA 3SG6A 4UPGA 1H8BA 1FF1A 2F2PA 1FI5A 1IQ5A 2GGMA 2Y4QA 2WC6A 1OMRA 2LC5A 3OHMB 4DRWA 1OE9B 2KQYA 1IIOA 2WCEA 5J3XA 5I8NA 3TUYC 1SL7A 3BUXB 1B8CA 1PSBA 3CZTX 1ZACA 5CSFA 1TIZA 1L2OC 3S0AA 2KI4C 3CWGA 2O5GA 5GQQC 2NLNA 2FOTA 1LA3A 3VRQA 1GGWA 2KI6D 1E8AA 2Y5IA 3VGOA 2KI6C 1MUXA 1CTRA 3LCPC 3GK4X 4PHNA 3BUOB 1JFKA 2G2BA 1QS7A 1YR5A 3PM2A 1KQMC 2EC6B 2JXLA 3OX5A 3VRRA 3GOFA 4CLNA 3BFBA 3BQ3A 1K9KA 1S6JA 3DVJA 2QEOA 2LUCA 4GFTA 2JU0A 4NDBA 3OP0A 3LK0A 1UHKA 4QJ3B 1B4CA 1DJHA 4MN0A 4PHKA 3NHIA 1W9ZA 4CPVA 1CDPA 2L2EA 2MJWB 4MBEA 1Z4HA 5DICA 3WXAA 1QTXA 3SIBA 2NXQA 1YUSA 5HKZA 1JWDA 4GGFA 2M49B 1U5IB 3HCMA 1AJ5A 2BL0B 1BJFA 1BODA 3UO9A 2WORA 1NWDA 4L9MA 2KFFA 2JXCA 5TNCA 3NSKA 3I5IB 1TWOA 1K90D 2JNFA 2WCHA 2ZNEA 5I94A 5ER4X 1P28A 2RGIA 1TTXA 2K7CA 1BF5A 3NSOA 3CTNA 2ZN9A 4AQIA 1IQ3A 2M1UA 4PCWA 2L98A 4YGAA 3KEVA 2ZFDA 3S0BA 3BXKA 1JF2A 3RZSA 1NX0A 2Y1MA 5EL2A 2JC2A 2KQ6A 1F8HA 1XFZO 1SRAA 4MSPA 1W7IB 3DZTA 3PN7B 1J1DA 4ORCB 4CIDA 3B86A 2MAZA 5BPJA 3FE6A 5AEQA 2H61A 1S3PA 5DKRA 1IGVA 2BKIB 2HPSA 5JOLA 2EGDA 4MVFA 1SCVA 2WCLA 1LA0A 2L4IA 3CZ2A 2LNKA 4ORAB 1Y1UA 1XFVO 1VRKA 3JTDC 4R1EA 2KGBC 5HKYA 1R6PA 1GQMA 4ETOA 5HYDA 2BCXA 1QWVA 1PVBA 3B7AA 2WC8A 3SG4A 4PHJA 3FWCA 3VB1A 2QPTA 2K60A 2LVKA 3CS1A 1A03A 1JC2A 1BG1A 1TCOB 4MLWA 1DJXA 1LXFC 2ZN8A 1PALA 1S5GZ 1NP8A 1UHNA 1YX8A 5AANA 4GAOA 1RK9A 1M39A 1RJVA 4M2PA 3EG5B 3N7HA 1OQPA 3SG5A 1QLKA 2Q4UA 1YTZC 4F7FA
chains in the Genus database with same CATH topology
1W7JB 2JZIA 2CXJA 4BY4A 2MLFC 1G33A 2Y1NA 3DF0A 1JBAA 4BY5A 1SBJA 1K9UA 1V1FA 1CB1A 3PATA 1KFXS 1IWQA 1C7WA 1DMOA 4OR9B 5G08A 4AQJA 3EKHA 1CFCA 1G4YR 1C07A 1SY9A 2LHIA 5KSZA 4YGEB 4QJ5B 1BLQA 3BUWB 3I5GC 1FBVA 2BECA 4N1GA 1CM4A 3KHEA 2KBMA 5JJGA 2FCEA 1JUOA 2KAVA 3CGAA 4M2QA 4NDDA 3WHUB 1KCYA 2CCMA 4PE4A 1XK4A 2CNPA 2LLUA 2LV7A 5F6TA 5IBWA 1N0YA 3EVUA 3BUNB 4OKHA 1IKUA 1F4OA 2E6WA 1KQVA 1JF0A 1KFUS 4N5XA 1WY9A 3GK2A 1TCFA 1DGUA 4IL1A 5HLOA 1J7QA 1OOJA 2AUCA 1SNLA 4PE0A 3VRPA 2OTGC 1U5IA 4YI8A 1AP4A 1KK7Y 1ALWA 1B7TZ 1QVIZ 4DUQA 4JWQA 1HT9A 1YRTB 3TDUA 1DGVA 1XO5A 1NCYA 1XYDA 5D69A 1XVJA 3FIAA 1J7OA 1BT6A 1NX1A 1MR8A 2JRFA 3DF0B 4HRGA 1FPWA 4JPZB 3GK1A 3QRXA 1YUTA 3DVMA 1KK8B 1QASA 3C1VA 1F4QA 3SG7A 1DF0A 2AAOA 1CMFA 1MXEA 2LP2A 4USLA 2LVVA 1MWNA 3OB2B 2V53A 3NSIA 3PFVA 1K9PA 1CFDA 3H4SE 2E30A 1SR6B 4GPLB 1TNWA 3IQOA 1FI6A 3DVEA 4DCKA 1QXPA 1K93D 1A4PA 1WRKA 2JWWA 2FJUB 3NXAA 3PALA 1M45A 3SG2A 2I18A 1K8UA 3AAKA 4HSZA 1EG4A 2ZRSA 2K7OA 1EJ3A 3O6BA 1ODBA 2O60A 3M0WA 2ZKMX 3CLNA 4YBHB 1BR1B 1QLSA 3LLEA 3I5FC 1QIWA 1NX2A 3LL8B 5ER5A 2LHLA 1S6CA 1WLMA 1ZOTB 1DT7B 1SL8A 3EKJA 5HLVA 1AHRA 1QX7A 2HF5A 2L51A 4F0ZB 1CFPA 1B8RA 1QIVA 2L5XB 2LMVA 1NIWA 2BKHB 4FQOA 1UURA 3CR5X 3K21A 1IJ5A 1DF0B 1NCXA 2BL0C 3A4UB 1PRWA 1B8LA 2MLEC 1EG3A 1CLMA 4NDCA 2M97A 3NSLA 2LVIA 1KSMA 1DJZA 2M29A 1OZSA 1K94A 5DKNA 1SCMB 2JOJA 2K8MB 2LLSA 3CR2A 2JULA 2VRGA 2K2AA 2OS8B 4YI9A 3TS5B 2DOQA 2M7NA 5CSNA 3DVKA 3VROA 1CM1A 1OMDA 1QV1A 1XFXO 1ZFSA 1RTP1 1RECA 2LUXA 1TNXA 1CDLA 4N1FA 1KSOA 1AK8A 1WDCC 1YX7A 1A2XA 1J55A 2KDHA 3KPXA 3IQQA 3MSEB 3PN7C 3VRNA 1F71A 5KTYA 2CT9A 2MA2A 1R2UA 4P2YB 1NCZA 1KWOC 4YGCB 3TZ1A 3ZWHA 4CFQA 1DTLA 1NSHA 2QACA 1K2HA 1J1EA 2BCBA 1TOPA 1B9AA 1MHOA 4AOMA 4MRXA 1WLZA 2CBLA 2KAXA 2BE6A 3EVVA 3F45A 4WQ3A 3EVRA 1GGZA 1PVAA 2KHNA 4GGFC 3JVTB 1YVHA 1JSAA 2F2OA 1YRUB 3KF9A 2K0JA 3FS7A 1A29A 4ICBA 1M46A 1N65A 3I5HC 4I5NB 3LK1A 2KBIA 1HQVA 3PSRA 1JFJA 1S1EA 2GGZA 2M3WA 1TNQA 2MBXA 1QV0A 1IRJA 2EHBA 2L50A 2K2FA 2KYFA 5I2LA 1BR4B 2NCOA 3DD4A 4PE1A 1SL9A 1SK6D 5AFPA 2BE4A 4WQ2A 2WNDA 3BUMB 1DJYA 5B8IB 2BBMA 5I2QA 2PVBA 2LM5A 3D10A 2M1KB 2JTTA 3RM1A 1S26D 1QATA 1SW8A 3A8RA 1TNPA 3SJSA 4OCIA 1AJ4A 4MZLA 3TDIA 1RFJA 2GV5A 2KSPA 3OB1B 3TUYB 2K7BA 1LINA 3ZNIA 3D0YA 1M31A 1BU3A 1QJTA 1L2OB 2KI4B 4C0KA 2MRDA 1PK0D 3O2PA 2JQ6A 1XFUO 1ZMZA 1XFYO 2I2RE 2PMYA 3HX4A 3ICBA 4GBAA 2SCPA 1MXLC 1AUIB 1EL4A 1B47A 2LMUA 4PE7A 1IH0A 2HQ8A 1NYAA 1OMVA 3FWBA 5CSIA 1F54A 1L7ZA 2P6BB 3BOWA 1PULA 1Y0VH 2JT3A 1KQMB 2SASA 2TN4A 1OZOA 2R2IA 3EK8A 1Y6WA 4M2OA 3CR4X 1FW4A 1M63B 4C0LA 3EK4A 2WOSA 1UWOA 2PASA 2L0PA 4TNCA 2KYCA 1V1GA 4XJKA 1KK7Z 4I5KA 1DJGA 2LVJA 4JQ0D 2OPOA 4YGBB 3EK7A 5CPVA 1X02A 1ZUZA 1KFXL 2EC6C 1KK8C 4YGDB 1DVIA 3RLZA 2CTNA 1BMOA 2LE9B 3AKAA 4PHMA 3IF7A 2I94A 2MHHA 1GJYA 4YRUA 3E3RA 4E68A 3D0YB 2K7DA 1SYMA 1F55A 4I5JA 1D1OA 1G8IA 4XYNA 4ZCVA 1IG5A 2LCPA 1XK4C 3O78A 5PALA 1SR6C 4CFRA 3I5FB 2HETA 4MZKA 1CLBA 2HQWA 1S6IA 1KFUL 1TRFA 2H2KA 1Y1AA 1AVSA 3AKBA 1IJ6A 1EH2A 2BCAA 1UHHA 2JNXA 2LAPA 3BOWB 2KGRA 4MEWA 5CSJA 1J7PA 2KOTA 1RWYA 1YVLA 4A4CA 1UHJA 2LLTA 1XFWO 2AMIA 2K61A 1BOCA 4OVNF 1NUBA 1MF8B 3I5IC 1F70A 1NX3A 4XJKB 4WRIA 2F33A 4FTGA 1A75A 3SIAA 1LKJA 2JPTA 2LP3A 1QX5B 2JT0A 5AERA 2KFHA 4NQGA 1YURA 1K96A 2ISDA 1WDCB 1ALVA 5FYXA 2PRUA 3JTDB 1YUUA 2F3ZA 3TDZA 2JTZA 1S5GY 1SCMC 1UUSA 4C0JA 2OS8C 2PALA 2G9BA 3KO0A 4PDZA 5AXIA 3TS5C 4HRHA 1KWOB 1K95A 1B1GA 2M7LA 1PSRA 2M9GA 1UP5A 5DKQA 1TN4A 2L4HA 2I7AA 1SKTA 2FCDA 2WCFA 4MRYA 1SPYA 4GUKA 2KAYA 4ZCUA 1CNPA 5D7FA 1CDMA 1WRZA 1CLLA 2COLB 2Q91A 1CKKA 2D8NA 1CMGA 3SG3A 3PLFB 2IS9A 4A4BA 2WCBA 1CFFA 1Q80A 1C7VA 1OSAA 1WRLA 3PM8A 3I5HB 4D1EA 2ZNDA 2F3YA 5HKWA 4GGNA 4GNKB 1MQ1A 1A75B 3AAJA 1Y1XA 4DIRA 2NZ0A 3O4YA 4QJ4B 3JVTC 3WNXB 3I5GB 3BYAA 4OV2A 2M8UA 2KFGA 1EXRA 1DJIA 2B1UA 1LVCD 1UHIA 2LANA 1QX2A 4DS7A 2JT8A 4Q04A 1B7TY 1QVIY 2F8PA 2H61C 2BBNA 4I5LB 4P5OE 4PALA 1N2DA 2KNEA 2ZRTA 1RROA 2A4JA 4U8DA 5I2OA 4MZJA 2NCPA 2OTGB 4ORBB 2LMTA 4HREE 3OX6A 1CDNA 1DJWA 1SMGA 1NPQA 5KU1A 2PSRA 1S36A 5K89A 1J7RA 2M0RA 1XA5A 3WHTB 1H4BA 3SG6A 4UPGA 1H8BA 1FF1A 2F2PA 1FI5A 1IQ5A 2GGMA 2Y4QA 3OHMB 1OMRA 2LC5A 4DRWA 1OE9B 2KQYA 2WCEA 5J3XA 5I8NA 3TUYC 1SL7A 3BUXB 1B8CA 1PSBA 3CZTX 1ZACA 5CSFA 1TIZA 1L2OC 2KI4C 3CWGA 2O5GA 5GQQC 2NLNA 2FOTA 1LA3A 3VRQA 1GGWA 2KI6D 1E8AA 2Y5IA 3VGOA 2KI6C 1MUXA 1CTRA 3LCPC 3GK4X 4PHNA 3BUOB 1JFKA 2G2BA 1QS7A 1YR5A 1KQMC 2EC6B 2JXLA 3OX5A 3VRRA 3GOFA 4CLNA 3BQ3A 1K9KA 1S6JA 3DVJA 2LUCA 4GFTA 2JU0A 4NDBA 3OP0A 3LK0A 1UHKA 4QJ3B 1B4CA 1DJHA 4MN0A 4PHKA 4CPVA 1CDPA 2L2EA 2MJWB 4MBEA 3WXAA 1QTXA 3SIBA 2NXQA 1YUSA 5HKZA 1JWDA 4GGFA 2M49B 1U5IB 3HCMA 1AJ5A 2BL0B 1BJFA 1BODA 2WORA 1NWDA 4L9MA 2KFFA 2JXCA 5TNCA 3NSKA 3I5IB 1K90D 2JNFA 2ZNEA 5ER4X 2RGIA 1TTXA 2K7CA 1BF5A 3NSOA 3CTNA 2ZN9A 4AQIA 1IQ3A 2M1UA 4PCWA 2L98A 4YGAA 3KEVA 2ZFDA 3BXKA 1JF2A 1NX0A 2Y1MA 2JC2A 2KQ6A 1F8HA 1XFZO 1SRAA 4MSPA 1W7IB 3PN7B 1J1DA 4ORCB 4CIDA 2MAZA 5BPJA 5AEQA 2H61A 1S3PA 5DKRA 1IGVA 2BKIB 2HPSA 5JOLA 2EGDA 4MVFA 1SCVA 1LA0A 2L4IA 2LNKA 4ORAB 1Y1UA 1XFVO 1VRKA 3JTDC 4R1EA 2KGBC 5HKYA 1R6PA 1GQMA 4ETOA 5HYDA 2BCXA 1PVBA 2WC8A 3SG4A 4PHJA 3FWCA 2QPTA 2LVKA 3CS1A 1A03A 1JC2A 1BG1A 1TCOB 4MLWA 1DJXA 1LXFC 2ZN8A 1PALA 1S5GZ 1NP8A 1UHNA 1YX8A 5AANA 4GAOA 1RK9A 1M39A 1RJVA 4M2PA 1OQPA 3SG5A 1QLKA 2Q4UA 1YTZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W7J B;  2JZI A;  2CXJ A;  4BY4 A;  2MLF C;  1G33 A;  2Y1N A;  3DF0 A;  1JBA A;  4BY5 A;  1SBJ A;  1K9U A;  1V1F A;  1CB1 A;  3PAT A;  1KFX S;  1IWQ A;  1C7W A;  1DMO A;  4OR9 B;  5G08 A;  4AQJ A;  3EKH A;  1CFC A;  1G4Y R;  1C07 A;  1SY9 A;  2LHI A;  5KSZ A;  4YGE B;  4QJ5 B;  1BLQ A;  3BUW B;  3I5G C;  1FBV A;  2BEC A;  4N1G A;  1CM4 A;  3KHE A;  2KBM A;  5JJG A;  2FCE A;  1JUO A;  2KAV A;  3CGA A;  4M2Q A;  4NDD A;  3WHU B;  1KCY A;  2CCM A;  4PE4 A;  1XK4 A;  2CNP A;  2LLU A;  2LV7 A;  5F6T A;  5IBW A;  1N0Y A;  3EVU A;  3BUN B;  4OKH A;  1IKU A;  1F4O A;  2E6W A;  1KQV A;  1JF0 A;  1KFU S;  4N5X A;  1WY9 A;  3GK2 A;  1TCF A;  1DGU A;  4IL1 A;  5HLO A;  1J7Q A;  1OOJ A;  2AUC A;  1SNL A;  4PE0 A;  3VRP A;  2OTG C;  1U5I A;  4YI8 A;  1AP4 A;  1KK7 Y;  1ALW A;  1B7T Z;  1QVI Z;  4DUQ A;  4JWQ A;  1HT9 A;  1YRT B;  3TDU A;  1DGV A;  1XO5 A;  1NCY A;  1XYD A;  5D69 A;  1XVJ A;  3FIA A;  1J7O A;  1BT6 A;  1NX1 A;  1MR8 A;  2JRF A;  3DF0 B;  4HRG A;  1FPW A;  4JPZ B;  3GK1 A;  3QRX A;  1YUT A;  3DVM A;  1KK8 B;  1QAS A;  3C1V A;  1F4Q A;  3SG7 A;  1DF0 A;  2AAO A;  1CMF A;  1MXE A;  2LP2 A;  4USL A;  2LVV A;  1MWN A;  3OB2 B;  2V53 A;  3NSI A;  3PFV A;  1K9P A;  1CFD A;  3H4S E;  2E30 A;  1SR6 B;  4GPL B;  1TNW A;  3IQO A;  1FI6 A;  3DVE A;  4DCK A;  1QXP A;  1K93 D;  1A4P A;  1WRK A;  2JWW A;  2FJU B;  3NXA A;  3PAL A;  1M45 A;  3SG2 A;  2I18 A;  1K8U A;  3AAK A;  4HSZ A;  1EG4 A;  2ZRS A;  2K7O A;  1EJ3 A;  3O6B A;  1ODB A;  2O60 A;  3M0W A;  2ZKM X;  3CLN A;  4YBH B;  1BR1 B;  1QLS A;  3LLE A;  3I5F C;  1QIW A;  1NX2 A;  3LL8 B;  5ER5 A;  2LHL A;  1S6C A;  1WLM A;  1ZOT B;  1DT7 B;  1SL8 A;  3EKJ A;  5HLV A;  1AHR A;  1QX7 A;  2HF5 A;  2L51 A;  4F0Z B;  1CFP A;  1B8R A;  1QIV A;  2L5X B;  2LMV A;  1NIW A;  2BKH B;  4FQO A;  1UUR A;  3CR5 X;  3K21 A;  1IJ5 A;  1DF0 B;  1NCX A;  2BL0 C;  3A4U B;  1PRW A;  1B8L A;  2MLE C;  1EG3 A;  1CLM A;  4NDC A;  2M97 A;  3NSL A;  2LVI A;  1KSM A;  1DJZ A;  2M29 A;  1OZS A;  1K94 A;  5DKN A;  1SCM B;  2JOJ A;  2K8M B;  2LLS A;  3CR2 A;  2JUL A;  2VRG A;  2K2A A;  2OS8 B;  4YI9 A;  3TS5 B;  2DOQ A;  2M7N A;  5CSN A;  3DVK A;  3VRO A;  1CM1 A;  1OMD A;  1QV1 A;  1XFX O;  1ZFS A;  1RTP 1;  1REC A;  2LUX A;  1TNX A;  1CDL A;  4N1F A;  1KSO A;  1AK8 A;  1WDC C;  1YX7 A;  1A2X A;  1J55 A;  2KDH A;  3KPX A;  3IQQ A;  3MSE B;  3PN7 C;  3VRN A;  1F71 A;  5KTY A;  2CT9 A;  2MA2 A;  1R2U A;  4P2Y B;  1NCZ A;  1KWO C;  4YGC B;  3TZ1 A;  3ZWH A;  4CFQ A;  1DTL A;  1NSH A;  2QAC A;  1K2H A;  1J1E A;  2BCB A;  1TOP A;  1B9A A;  1MHO A;  4AOM A;  4MRX A;  1WLZ A;  2CBL A;  2KAX A;  2BE6 A;  3EVV A;  3F45 A;  4WQ3 A;  3EVR A;  1GGZ A;  1PVA A;  2KHN A;  4GGF C;  3JVT B;  1YVH A;  1JSA A;  2F2O A;  1YRU B;  3KF9 A;  2K0J A;  3FS7 A;  1A29 A;  4ICB A;  1M46 A;  1N65 A;  3I5H C;  4I5N B;  3LK1 A;  2KBI A;  1HQV A;  3PSR A;  1JFJ A;  1S1E A;  2GGZ A;  2M3W A;  1TNQ A;  2MBX A;  1QV0 A;  1IRJ A;  2EHB A;  2L50 A;  2K2F A;  2KYF A;  5I2L A;  1BR4 B;  2NCO A;  3DD4 A;  4PE1 A;  1SL9 A;  1SK6 D;  5AFP A;  2BE4 A;  4WQ2 A;  2WND A;  3BUM B;  1DJY A;  5B8I B;  2BBM A;  5I2Q A;  2PVB A;  2LM5 A;  3D10 A;  2M1K B;  2JTT A;  3RM1 A;  1S26 D;  1QAT A;  1SW8 A;  3A8R A;  1TNP A;  3SJS A;  4OCI A;  1AJ4 A;  4MZL A;  3TDI A;  1RFJ A;  2GV5 A;  2KSP A;  3OB1 B;  3TUY B;  2K7B A;  1LIN A;  3ZNI A;  3D0Y A;  1M31 A;  1BU3 A;  1QJT A;  1L2O B;  2KI4 B;  4C0K A;  2MRD A;  1PK0 D;  3O2P A;  2JQ6 A;  1XFU O;  1ZMZ A;  1XFY O;  2I2R E;  2PMY A;  3HX4 A;  3ICB A;  4GBA A;  2SCP A;  1MXL C;  1AUI B;  1EL4 A;  1B47 A;  2LMU A;  4PE7 A;  1IH0 A;  2HQ8 A;  1NYA A;  1OMV A;  3FWB A;  5CSI A;  1F54 A;  1L7Z A;  2P6B B;  3BOW A;  1PUL A;  1Y0V H;  2JT3 A;  1KQM B;  2SAS A;  2TN4 A;  1OZO A;  2R2I A;  3EK8 A;  1Y6W A;  4M2O A;  3CR4 X;  1FW4 A;  1M63 B;  4C0L A;  3EK4 A;  2WOS A;  1UWO A;  2PAS A;  2L0P A;  4TNC A;  2KYC A;  1V1G A;  4XJK A;  1KK7 Z;  4I5K A;  1DJG A;  2LVJ A;  4JQ0 D;  2OPO A;  4YGB B;  3EK7 A;  5CPV A;  1X02 A;  1ZUZ A;  1KFX L;  2EC6 C;  1KK8 C;  4YGD B;  1DVI A;  3RLZ A;  2CTN A;  1BMO A;  2LE9 B;  3AKA A;  4PHM A;  3IF7 A;  2I94 A;  2MHH A;  1GJY A;  4YRU A;  3E3R A;  4E68 A;  3D0Y B;  2K7D A;  1SYM A;  1F55 A;  4I5J A;  1D1O A;  1G8I A;  4XYN A;  4ZCV A;  1IG5 A;  2LCP A;  1XK4 C;  3O78 A;  5PAL A;  1SR6 C;  4CFR A;  3I5F B;  2HET A;  4MZK A;  1CLB A;  2HQW A;  1S6I A;  1KFU L;  1TRF A;  2H2K A;  1Y1A A;  1AVS A;  3AKB A;  1IJ6 A;  1EH2 A;  2BCA A;  1UHH A;  2JNX A;  2LAP A;  3BOW B;  2KGR A;  4MEW A;  5CSJ A;  1J7P A;  2KOT A;  1RWY A;  1YVL A;  4A4C A;  1UHJ A;  2LLT A;  1XFW O;  2AMI A;  2K61 A;  1BOC A;  4OVN F;  1NUB A;  1MF8 B;  3I5I C;  1F70 A;  1NX3 A;  4XJK B;  4WRI A;  2F33 A;  4FTG A;  1A75 A;  3SIA A;  1LKJ A;  2JPT A;  2LP3 A;  1QX5 B;  2JT0 A;  5AER A;  2KFH A;  4NQG A;  1YUR A;  1K96 A;  2ISD A;  1WDC B;  1ALV A;  5FYX A;  2PRU A;  3JTD B;  1YUU A;  2F3Z A;  3TDZ A;  2JTZ A;  1S5G Y;  1SCM C;  1UUS A;  4C0J A;  2OS8 C;  2PAL A;  2G9B A;  3KO0 A;  4PDZ A;  5AXI A;  3TS5 C;  4HRH A;  1KWO B;  1K95 A;  1B1G A;  2M7L A;  1PSR A;  2M9G A;  1UP5 A;  5DKQ A;  1TN4 A;  2L4H A;  2I7A A;  1SKT A;  2FCD A;  2WCF A;  4MRY A;  1SPY A;  4GUK A;  2KAY A;  4ZCU A;  1CNP A;  5D7F A;  1CDM A;  1WRZ A;  1CLL A;  2COL B;  2Q91 A;  1CKK A;  2D8N A;  1CMG A;  3SG3 A;  3PLF B;  2IS9 A;  4A4B A;  2WCB A;  1CFF A;  1Q80 A;  1C7V A;  1OSA A;  1WRL A;  3PM8 A;  3I5H B;  4D1E A;  2ZND A;  2F3Y A;  5HKW A;  4GGN A;  4GNK B;  1MQ1 A;  1A75 B;  3AAJ A;  1Y1X A;  4DIR A;  2NZ0 A;  3O4Y A;  4QJ4 B;  3JVT C;  3WNX B;  3I5G B;  3BYA A;  4OV2 A;  2M8U A;  2KFG A;  1EXR A;  1DJI A;  2B1U A;  1LVC D;  1UHI A;  2LAN A;  1QX2 A;  4DS7 A;  2JT8 A;  4Q04 A;  1B7T Y;  1QVI Y;  2F8P A;  2H61 C;  2BBN A;  4I5L B;  4P5O E;  4PAL A;  1N2D A;  2KNE A;  2ZRT A;  1RRO A;  2A4J A;  4U8D A;  5I2O A;  4MZJ A;  2NCP A;  2OTG B;  4ORB B;  2LMT A;  4HRE E;  3OX6 A;  1CDN A;  1DJW A;  1SMG A;  1NPQ A;  5KU1 A;  2PSR A;  1S36 A;  5K89 A;  1J7R A;  2M0R A;  1XA5 A;  3WHT B;  1H4B A;  3SG6 A;  4UPG A;  1H8B A;  1FF1 A;  2F2P A;  1FI5 A;  1IQ5 A;  2GGM A;  2Y4Q A;  3OHM B;  1OMR A;  2LC5 A;  4DRW A;  1OE9 B;  2KQY A;  2WCE A;  5J3X A;  5I8N A;  3TUY C;  1SL7 A;  3BUX B;  1B8C A;  1PSB A;  3CZT X;  1ZAC A;  5CSF A;  1TIZ A;  1L2O C;  2KI4 C;  3CWG A;  2O5G A;  5GQQ C;  2NLN A;  2FOT A;  1LA3 A;  3VRQ A;  1GGW A;  2KI6 D;  1E8A A;  2Y5I A;  3VGO A;  2KI6 C;  1MUX A;  1CTR A;  3LCP C;  3GK4 X;  4PHN A;  3BUO B;  1JFK A;  2G2B A;  1QS7 A;  1YR5 A;  1KQM C;  2EC6 B;  2JXL A;  3OX5 A;  3VRR A;  3GOF A;  4CLN A;  3BQ3 A;  1K9K A;  1S6J A;  3DVJ A;  2LUC A;  4GFT A;  2JU0 A;  4NDB A;  3OP0 A;  3LK0 A;  1UHK A;  4QJ3 B;  1B4C A;  1DJH A;  4MN0 A;  4PHK A;  4CPV A;  1CDP A;  2L2E A;  2MJW B;  4MBE A;  3WXA A;  1QTX A;  3SIB A;  2NXQ A;  1YUS A;  5HKZ A;  1JWD A;  4GGF A;  2M49 B;  1U5I B;  3HCM A;  1AJ5 A;  2BL0 B;  1BJF A;  1BOD A;  2WOR A;  1NWD A;  4L9M A;  2KFF A;  2JXC A;  5TNC A;  3NSK A;  3I5I B;  1K90 D;  2JNF A;  2ZNE A;  5ER4 X;  2RGI A;  1TTX A;  2K7C A;  1BF5 A;  3NSO A;  3CTN A;  2ZN9 A;  4AQI A;  1IQ3 A;  2M1U A;  4PCW A;  2L98 A;  4YGA A;  3KEV A;  2ZFD A;  3BXK A;  1JF2 A;  1NX0 A;  2Y1M A;  2JC2 A;  2KQ6 A;  1F8H A;  1XFZ O;  1SRA A;  4MSP A;  1W7I B;  3PN7 B;  1J1D A;  4ORC B;  4CID A;  2MAZ A;  5BPJ A;  5AEQ A;  2H61 A;  1S3P A;  5DKR A;  1IGV A;  2BKI B;  2HPS A;  5JOL A;  2EGD A;  4MVF A;  1SCV A;  1LA0 A;  2L4I A;  2LNK A;  4ORA B;  1Y1U A;  1XFV O;  1VRK A;  3JTD C;  4R1E A;  2KGB C;  5HKY A;  1R6P A;  1GQM A;  4ETO A;  5HYD A;  2BCX A;  1PVB A;  2WC8 A;  3SG4 A;  4PHJ A;  3FWC A;  2QPT A;  2LVK A;  3CS1 A;  1A03 A;  1JC2 A;  1BG1 A;  1TCO B;  4MLW A;  1DJX A;  1LXF C;  2ZN8 A;  1PAL A;  1S5G Z;  1NP8 A;  1UHN A;  1YX8 A;  5AAN A;  4GAO A;  1RK9 A;  1M39 A;  1RJV A;  4M2P A;  1OQP A;  3SG5 A;  1QLK A;  2Q4U A;  1YTZ C; 
#chains in the Genus database with same CATH topology
 4JKT A;  1W7J B;  2JZI A;  2CXJ A;  4BY4 A;  2MLF C;  1G33 A;  2Y1N A;  3DF0 A;  1JBA A;  4BY5 A;  1SBJ A;  1K9U A;  1V1F A;  1CB1 A;  3PAT A;  1KFX S;  1IWQ A;  1C7W A;  3BFA A;  1DMO A;  4OR9 B;  5G08 A;  2WCJ A;  4AQJ A;  3EKH A;  1CFC A;  1G4Y R;  2WC5 A;  1C07 A;  1SY9 A;  2LHI A;  5KSZ A;  4YGE B;  4QJ5 B;  1BLQ A;  3BUW B;  1Z2C B;  1OOG A;  3I5G C;  5D3O A;  1FBV A;  2BEC A;  4N1G A;  1CM4 A;  3KHE A;  2KBM A;  5JJG A;  2FCE A;  1JUO A;  2KAV A;  3CGA A;  4M2Q A;  4NDD A;  3WHU B;  1KCY A;  2CCM A;  4PE4 A;  1XK4 A;  2CNP A;  2LLU A;  2LV7 A;  5F6T A;  5IBW A;  1N0Y A;  3EVU A;  3BUN B;  4OKH A;  1IKU A;  1F4O A;  2E6W A;  1KQV A;  3D76 A;  1JF0 A;  1KFU S;  2ERB A;  4N5X A;  1WY9 A;  3SS3 A;  3GK2 A;  1TCF A;  1DGU A;  1DQE A;  4IL1 A;  5HLO A;  5HL1 A;  1J7Q A;  1OOJ A;  2AUC A;  1SNL A;  4PE0 A;  3VRP A;  2OTG C;  1U5I A;  4YI8 A;  3S0E A;  1AP4 A;  1KK7 Y;  1ALW A;  1B7T Z;  1QVI Z;  4DUQ A;  4JWQ A;  1HT9 A;  1YRT B;  3TDU A;  1DGV A;  1XO5 A;  3DYE A;  1NCY A;  1XYD A;  5D69 A;  1XVJ A;  3FIA A;  1J7O A;  1BT6 A;  1NX1 A;  1MR8 A;  2JRF A;  3DF0 B;  4HRG A;  1FPW A;  4JPZ B;  2KPH A;  3GK1 A;  3QRX A;  1YUT A;  3DVM A;  1KK8 B;  1QAS A;  3C1V A;  1F4Q A;  3SG7 A;  1DF0 A;  2AAO A;  1TUJ A;  1CMF A;  1MXE A;  4INX A;  2LP2 A;  4USL A;  2LVV A;  1MWN A;  3OB2 B;  2V53 A;  3OBV A;  3NSI A;  3PFV A;  1K9P A;  1CFD A;  1ORG A;  3H4S E;  2E30 A;  1SR6 B;  4GPL B;  1TNW A;  3IQO A;  1FI6 A;  3DVE A;  3CYZ A;  4DCK A;  1QXP A;  1K93 D;  1A4P A;  1WRK A;  2JWW A;  2FJU B;  3NXA A;  3PAL A;  4KYN A;  1M45 A;  3SG2 A;  2I18 A;  1K8U A;  3AAK A;  4HSZ A;  1EG4 A;  2ZRS A;  2K7O A;  1EJ3 A;  3L4L A;  3O6B A;  4PT1 A;  1ODB A;  2O60 A;  3M0W A;  2ZKM X;  3CLN A;  4YBH B;  1BR1 B;  1QLS A;  3LLE A;  3I5F C;  1QIW A;  1NX2 A;  3LL8 B;  5ER5 A;  2LHL A;  1OOF A;  1S6C A;  1WLM A;  1ZOT B;  1DT7 B;  1SL8 A;  3EKJ A;  5HLV A;  3SS5 A;  1AHR A;  1QX7 A;  2HF5 A;  2L51 A;  4F0Z B;  2P71 A;  1CFP A;  1B8R A;  1QIV A;  2L5X B;  2LMV A;  1NIW A;  3FE8 A;  2BKH B;  4FQO A;  1UUR A;  3CR5 X;  3K21 A;  1IJ5 A;  1DF0 B;  1NCX A;  2BL0 C;  3A4U B;  1PRW A;  1B8L A;  2MLE C;  1EG3 A;  1CLM A;  4INW A;  2M97 A;  2QEH A;  3NSL A;  4NDC A;  2LVI A;  1KSM A;  1DJZ A;  2M29 A;  1OZS A;  1K94 A;  2QDI A;  1SCM B;  2JOJ A;  2K8M B;  2LLS A;  3CR2 A;  2JUL A;  2VRG A;  2K2A A;  2OS8 B;  2P70 A;  4YI9 A;  3TS5 B;  2DOQ A;  2M7N A;  5CSN A;  3DVK A;  3FE9 A;  3VRO A;  1CM1 A;  1OMD A;  1QV1 A;  1XFX O;  1ZFS A;  2PQL A;  1RTP 1;  1REC A;  3SS4 A;  2LUX A;  1TNX A;  1CDL A;  4N1F A;  3S0F A;  1KSO A;  1AK8 A;  1WDC C;  1YX7 A;  1A2X A;  1J55 A;  2GTE A;  2KDH A;  3IQQ A;  3KPX A;  3MSE B;  3PN7 C;  3VRN A;  1F71 A;  4JD9 A;  5KTY A;  3D74 A;  2CT9 A;  3B6X A;  2MA2 A;  1R2U A;  4P2Y B;  1NCZ A;  1KWO C;  4YGC B;  3TZ1 A;  3O4X A;  3ZWH A;  4CFQ A;  1DTL A;  1NSH A;  2QAC A;  1K2H A;  1J1E A;  2KLE A;  2BCB A;  1TOP A;  1B9A A;  1MHO A;  4AOM A;  4MRX A;  1WLZ A;  2CBL A;  2KAX A;  2BE6 A;  3EVV A;  3F45 A;  4WQ3 A;  3EVR A;  1GGZ A;  1PVA A;  2KHN A;  3D75 A;  4GGF C;  3JVT B;  1YVH A;  1JSA A;  2F2O A;  1YRU B;  3KF9 A;  2K0J A;  3R72 A;  3FS7 A;  1A29 A;  4ICB A;  3UNW A;  1M46 A;  1N65 A;  3I5H C;  4I5N B;  3LK1 A;  2KBI A;  1HQV A;  3PSR A;  2FJY A;  2KLD A;  1JFJ A;  1S1E A;  2GGZ A;  2M3W A;  1TNQ A;  3DY9 A;  2MBX A;  1QV0 A;  1IRJ A;  2EHB A;  2L50 A;  2K2F A;  2KYF A;  5I2L A;  1BR4 B;  2NCO A;  3CDN A;  3DD4 A;  4PE1 A;  1SL9 A;  1SK6 D;  5AFP A;  2BE4 A;  3CAB A;  1C3Y A;  4WQ2 A;  2WND A;  4OZD A;  3BUM B;  1DJY A;  5B8I B;  2BBM A;  5I2Q A;  2PVB A;  2LM5 A;  3D10 A;  2M1K B;  2JTT A;  3RM1 A;  1OW4 A;  1S26 D;  1QAT A;  1SW8 A;  3A8R A;  1TNP A;  3SJS A;  2L2C A;  1AJ4 A;  4OCI A;  4MZL A;  3TDI A;  1RFJ A;  2GV5 A;  2KSP A;  3OB1 B;  3TUY B;  2K7B A;  1LIN A;  3ZNI A;  3D0Y A;  1M31 A;  3D77 A;  1BU3 A;  1QJT A;  1L2O B;  3K1E A;  2KI4 B;  4C0K A;  2MRD A;  1PK0 D;  3O2P A;  2JQ6 A;  1XFU O;  1ZMZ A;  1XFY O;  2I2R E;  2PMY A;  3HX4 A;  3ICB A;  4GBA A;  2SCP A;  1MXL C;  1AUI B;  1EL4 A;  1T14 A;  1B47 A;  2LMU A;  4PE7 A;  1IH0 A;  2HQ8 A;  1NYA A;  1OMV A;  3FWB A;  5CSI A;  1F54 A;  1L7Z A;  2P6B B;  3BOW A;  3B88 A;  1PUL A;  1Y0V H;  2JT3 A;  1KQM B;  2SAS A;  3DXL A;  2TN4 A;  1OZO A;  2R2I A;  3EK8 A;  1Y6W A;  4M2O A;  2BNX A;  3CR4 X;  1OOI X;  1FW4 A;  1M63 B;  4C0L A;  3EK4 A;  2BAP A;  2WOS A;  1UWO A;  2PAS A;  2L0P A;  4TNC A;  2KYC A;  3BFH A;  1V1G A;  4XJK A;  1KK7 Z;  4I5K A;  1DJG A;  2LVJ A;  4JQ0 D;  2OPO A;  4YGB B;  3EK7 A;  5CPV A;  2H8V A;  1X02 A;  1ZUZ A;  1KFX L;  2EC6 C;  1KK8 C;  4YGD B;  1DVI A;  3RLZ A;  2CTN A;  1BMO A;  2LE9 B;  3AKA A;  4PHM A;  3CZ1 A;  1SSE B;  3IF7 A;  3NHT A;  2I94 A;  2MHH A;  1GJY A;  3D78 A;  4IJ7 A;  4YRU A;  3E3R A;  4E68 A;  3D0Y B;  3R1P A;  2K7D A;  1SYM A;  1F55 A;  3B87 A;  3PJI A;  4I5J A;  1D1O A;  1G8I A;  4XYN A;  5FI2 A;  4ZCV A;  1IG5 A;  2LCP A;  1XK4 C;  3O78 A;  5PAL A;  1TUZ A;  1SR6 C;  1XFR A;  3I5F B;  4CFR A;  2HET A;  4MZK A;  1CLB A;  2HQW A;  1S6I A;  1KFU L;  1TRF A;  2H2K A;  1Y1A A;  3R1V A;  1AVS A;  3AKB A;  1IJ6 A;  1EH2 A;  2BCA A;  1UHH A;  2JNX A;  2LAP A;  3BOW B;  2KGR A;  4MEW A;  5CSJ A;  1J7P A;  2KOT A;  1LS8 A;  1RWY A;  1DEK A;  1YVL A;  3QME A;  4A4C A;  1UHJ A;  2LLT A;  1XFW O;  2AMI A;  2K61 A;  1BOC A;  4OVN F;  1NUB A;  1MF8 B;  3I5I C;  1F70 A;  1NX3 A;  4XJK B;  4WRI A;  2F33 A;  3S0D A;  2WCM A;  2L5Y A;  1A75 A;  4FTG A;  3SIA A;  1LKJ A;  2JPT A;  2LP3 A;  1QX5 B;  2JT0 A;  5AER A;  2KFH A;  4NQG A;  1YUR A;  1K96 A;  2PYQ A;  2ISD A;  3Q8I A;  1WDC B;  1ALV A;  5DKN A;  2PRU A;  3D73 A;  5FYX A;  3JTD B;  1YUU A;  2F3Z A;  3TDZ A;  2JTZ A;  1S5G Y;  1SCM C;  1UUS A;  4C0J A;  2OS8 C;  2PAL A;  2G9B A;  3KO0 A;  3CZ0 A;  4PDZ A;  5AXI A;  3TS5 C;  4HRH A;  1KWO B;  1K95 A;  1B1G A;  2M7L A;  1PSR A;  2M9G A;  1UP5 A;  5DKQ A;  1TN4 A;  2L4H A;  2I7A A;  1SKT A;  3OGN A;  2FCD A;  2WCF A;  4MRY A;  1SPY A;  4GUK A;  2KAY A;  4ZCU A;  2QEB A;  1CNP A;  5D7F A;  1CDM A;  1WRZ A;  1CLL A;  2COL B;  2Q91 A;  1CKK A;  2D8N A;  1CMG A;  3SG3 A;  3PLF B;  2IS9 A;  4A4B A;  2WCB A;  1CFF A;  1Q80 A;  1C7V A;  1OSA A;  1WRL A;  1DEL A;  3PM8 A;  2YGU A;  3I5H B;  4D1E A;  2JPO A;  2ZND A;  2F3Y A;  2QEV A;  3NGV A;  5HKW A;  4GGN A;  4GNK B;  1MQ1 A;  1A75 B;  3AAJ A;  1OOH A;  1Y1X A;  3BJH A;  2NZ0 A;  4DIR A;  1DC1 A;  3O4Y A;  4QJ4 B;  3JVT C;  3L47 A;  5FI6 A;  3I5G B;  3WNX B;  3BYA A;  4OV2 A;  2M8U A;  3V2L A;  2KFG A;  1EXR A;  1DJI A;  2B1U A;  1LVC D;  1UHI A;  2LAN A;  1QX2 A;  4DS7 A;  4FQT A;  2JT8 A;  4Q04 A;  1B7T Y;  1QVI Y;  2F8P A;  2H61 C;  2BBN A;  4I5L B;  4P5O E;  4PAL A;  1N2D A;  2KNE A;  2ZRT A;  1RRO A;  2A4J A;  4U8D A;  5I2O A;  4MZJ A;  1C3Z A;  2NCP A;  2OTG B;  5FI7 A;  3IVT A;  1GM0 A;  3L4A A;  4ORB B;  2LMT A;  4HRE E;  2WCK A;  3OX6 A;  1CDN A;  1DJW A;  1SMG A;  1NPQ A;  3S0G A;  2PSR A;  1S36 A;  5K89 A;  1J7R A;  2M0R A;  5KU1 A;  1XA5 A;  3WHT B;  3R1O A;  1H4B A;  3SG6 A;  4UPG A;  1H8B A;  1FF1 A;  2F2P A;  1FI5 A;  1IQ5 A;  2GGM A;  2Y4Q A;  2WC6 A;  1OMR A;  2LC5 A;  3OHM B;  4DRW A;  1OE9 B;  2KQY A;  1IIO A;  2WCE A;  5J3X A;  5I8N A;  3TUY C;  1SL7 A;  3BUX B;  1B8C A;  1PSB A;  3CZT X;  1ZAC A;  5CSF A;  1TIZ A;  1L2O C;  3S0A A;  2KI4 C;  3CWG A;  2O5G A;  5GQQ C;  2NLN A;  2FOT A;  1LA3 A;  3VRQ A;  1GGW A;  2KI6 D;  1E8A A;  2Y5I A;  3VGO A;  2KI6 C;  1MUX A;  1CTR A;  3LCP C;  3GK4 X;  4PHN A;  3BUO B;  1JFK A;  2G2B A;  1QS7 A;  1YR5 A;  3PM2 A;  1KQM C;  2EC6 B;  2JXL A;  3OX5 A;  3VRR A;  3GOF A;  4CLN A;  3BFB A;  3BQ3 A;  1K9K A;  1S6J A;  3DVJ A;  2QEO A;  2LUC A;  4GFT A;  2JU0 A;  4NDB A;  3OP0 A;  3LK0 A;  1UHK A;  4QJ3 B;  1B4C A;  1DJH A;  4MN0 A;  4PHK A;  3NHI A;  1W9Z A;  4CPV A;  1CDP A;  2L2E A;  2MJW B;  4MBE A;  1Z4H A;  5DIC A;  3WXA A;  1QTX A;  3SIB A;  2NXQ A;  1YUS A;  5HKZ A;  1JWD A;  4GGF A;  2M49 B;  1U5I B;  3HCM A;  1AJ5 A;  2BL0 B;  1BJF A;  1BOD A;  3UO9 A;  2WOR A;  1NWD A;  4L9M A;  2KFF A;  2JXC A;  5TNC A;  3NSK A;  3I5I B;  1TWO A;  1K90 D;  2JNF A;  2WCH A;  2ZNE A;  5I94 A;  5ER4 X;  1P28 A;  2RGI A;  1TTX A;  2K7C A;  1BF5 A;  3NSO A;  3CTN A;  2ZN9 A;  4AQI A;  1IQ3 A;  2M1U A;  4PCW A;  2L98 A;  4YGA A;  3KEV A;  2ZFD A;  3S0B A;  3BXK A;  1JF2 A;  3RZS A;  1NX0 A;  2Y1M A;  5EL2 A;  2JC2 A;  2KQ6 A;  1F8H A;  1XFZ O;  1SRA A;  4MSP A;  1W7I B;  3DZT A;  3PN7 B;  1J1D A;  4ORC B;  4CID A;  3B86 A;  2MAZ A;  5BPJ A;  3FE6 A;  5AEQ A;  2H61 A;  1S3P A;  5DKR A;  1IGV A;  2BKI B;  2HPS A;  5JOL A;  2EGD A;  4MVF A;  1SCV A;  2WCL A;  1LA0 A;  2L4I A;  3CZ2 A;  2LNK A;  4ORA B;  1Y1U A;  1XFV O;  1VRK A;  3JTD C;  4R1E A;  2KGB C;  5HKY A;  1R6P A;  1GQM A;  4ETO A;  5HYD A;  2BCX A;  1QWV A;  1PVB A;  3B7A A;  2WC8 A;  3SG4 A;  4PHJ A;  3FWC A;  3VB1 A;  2QPT A;  2K60 A;  2LVK A;  3CS1 A;  1A03 A;  1JC2 A;  1BG1 A;  1TCO B;  4MLW A;  1DJX A;  1LXF C;  2ZN8 A;  1PAL A;  1S5G Z;  1NP8 A;  1UHN A;  1YX8 A;  5AAN A;  4GAO A;  1RK9 A;  1M39 A;  1RJV A;  4M2P A;  3EG5 B;  3N7H A;  1OQP A;  3SG5 A;  1QLK A;  2Q4U A;  1YTZ C;  4F7F A; 
#chains in the Genus database with same CATH homology
 1W7J B;  2JZI A;  2CXJ A;  4BY4 A;  2MLF C;  1G33 A;  2Y1N A;  3DF0 A;  1JBA A;  4BY5 A;  1SBJ A;  1K9U A;  1V1F A;  1CB1 A;  3PAT A;  1KFX S;  1IWQ A;  1C7W A;  1DMO A;  4OR9 B;  5G08 A;  4AQJ A;  3EKH A;  1CFC A;  1G4Y R;  1C07 A;  1SY9 A;  2LHI A;  5KSZ A;  4YGE B;  4QJ5 B;  1BLQ A;  3BUW B;  3I5G C;  1FBV A;  2BEC A;  4N1G A;  1CM4 A;  3KHE A;  2KBM A;  5JJG A;  2FCE A;  1JUO A;  2KAV A;  3CGA A;  4M2Q A;  4NDD A;  3WHU B;  1KCY A;  2CCM A;  4PE4 A;  1XK4 A;  2CNP A;  2LLU A;  2LV7 A;  5F6T A;  5IBW A;  1N0Y A;  3EVU A;  3BUN B;  4OKH A;  1IKU A;  1F4O A;  2E6W A;  1KQV A;  1JF0 A;  1KFU S;  4N5X A;  1WY9 A;  3GK2 A;  1TCF A;  1DGU A;  4IL1 A;  5HLO A;  1J7Q A;  1OOJ A;  2AUC A;  1SNL A;  4PE0 A;  3VRP A;  2OTG C;  1U5I A;  4YI8 A;  1AP4 A;  1KK7 Y;  1ALW A;  1B7T Z;  1QVI Z;  4DUQ A;  4JWQ A;  1HT9 A;  1YRT B;  3TDU A;  1DGV A;  1XO5 A;  1NCY A;  1XYD A;  5D69 A;  1XVJ A;  3FIA A;  1J7O A;  1BT6 A;  1NX1 A;  1MR8 A;  2JRF A;  3DF0 B;  4HRG A;  1FPW A;  4JPZ B;  3GK1 A;  3QRX A;  1YUT A;  3DVM A;  1KK8 B;  1QAS A;  3C1V A;  1F4Q A;  3SG7 A;  1DF0 A;  2AAO A;  1CMF A;  1MXE A;  2LP2 A;  4USL A;  2LVV A;  1MWN A;  3OB2 B;  2V53 A;  3NSI A;  3PFV A;  1K9P A;  1CFD A;  3H4S E;  2E30 A;  1SR6 B;  4GPL B;  1TNW A;  3IQO A;  1FI6 A;  3DVE A;  4DCK A;  1QXP A;  1K93 D;  1A4P A;  1WRK A;  2JWW A;  2FJU B;  3NXA A;  3PAL A;  1M45 A;  3SG2 A;  2I18 A;  1K8U A;  3AAK A;  4HSZ A;  1EG4 A;  2ZRS A;  2K7O A;  1EJ3 A;  3O6B A;  1ODB A;  2O60 A;  3M0W A;  2ZKM X;  3CLN A;  4YBH B;  1BR1 B;  1QLS A;  3LLE A;  3I5F C;  1QIW A;  1NX2 A;  3LL8 B;  5ER5 A;  2LHL A;  1S6C A;  1WLM A;  1ZOT B;  1DT7 B;  1SL8 A;  3EKJ A;  5HLV A;  1AHR A;  1QX7 A;  2HF5 A;  2L51 A;  4F0Z B;  1CFP A;  1B8R A;  1QIV A;  2L5X B;  2LMV A;  1NIW A;  2BKH B;  4FQO A;  1UUR A;  3CR5 X;  3K21 A;  1IJ5 A;  1DF0 B;  1NCX A;  2BL0 C;  3A4U B;  1PRW A;  1B8L A;  2MLE C;  1EG3 A;  1CLM A;  4NDC A;  2M97 A;  3NSL A;  2LVI A;  1KSM A;  1DJZ A;  2M29 A;  1OZS A;  1K94 A;  5DKN A;  1SCM B;  2JOJ A;  2K8M B;  2LLS A;  3CR2 A;  2JUL A;  2VRG A;  2K2A A;  2OS8 B;  4YI9 A;  3TS5 B;  2DOQ A;  2M7N A;  5CSN A;  3DVK A;  3VRO A;  1CM1 A;  1OMD A;  1QV1 A;  1XFX O;  1ZFS A;  1RTP 1;  1REC A;  2LUX A;  1TNX A;  1CDL A;  4N1F A;  1KSO A;  1AK8 A;  1WDC C;  1YX7 A;  1A2X A;  1J55 A;  2KDH A;  3KPX A;  3IQQ A;  3MSE B;  3PN7 C;  3VRN A;  1F71 A;  5KTY A;  2CT9 A;  2MA2 A;  1R2U A;  4P2Y B;  1NCZ A;  1KWO C;  4YGC B;  3TZ1 A;  3ZWH A;  4CFQ A;  1DTL A;  1NSH A;  2QAC A;  1K2H A;  1J1E A;  2BCB A;  1TOP A;  1B9A A;  1MHO A;  4AOM A;  4MRX A;  1WLZ A;  2CBL A;  2KAX A;  2BE6 A;  3EVV A;  3F45 A;  4WQ3 A;  3EVR A;  1GGZ A;  1PVA A;  2KHN A;  4GGF C;  3JVT B;  1YVH A;  1JSA A;  2F2O A;  1YRU B;  3KF9 A;  2K0J A;  3FS7 A;  1A29 A;  4ICB A;  1M46 A;  1N65 A;  3I5H C;  4I5N B;  3LK1 A;  2KBI A;  1HQV A;  3PSR A;  1JFJ A;  1S1E A;  2GGZ A;  2M3W A;  1TNQ A;  2MBX A;  1QV0 A;  1IRJ A;  2EHB A;  2L50 A;  2K2F A;  2KYF A;  5I2L A;  1BR4 B;  2NCO A;  3DD4 A;  4PE1 A;  1SL9 A;  1SK6 D;  5AFP A;  2BE4 A;  4WQ2 A;  2WND A;  3BUM B;  1DJY A;  5B8I B;  2BBM A;  5I2Q A;  2PVB A;  2LM5 A;  3D10 A;  2M1K B;  2JTT A;  3RM1 A;  1S26 D;  1QAT A;  1SW8 A;  3A8R A;  1TNP A;  3SJS A;  4OCI A;  1AJ4 A;  4MZL A;  3TDI A;  1RFJ A;  2GV5 A;  2KSP A;  3OB1 B;  3TUY B;  2K7B A;  1LIN A;  3ZNI A;  3D0Y A;  1M31 A;  1BU3 A;  1QJT A;  1L2O B;  2KI4 B;  4C0K A;  2MRD A;  1PK0 D;  3O2P A;  2JQ6 A;  1XFU O;  1ZMZ A;  1XFY O;  2I2R E;  2PMY A;  3HX4 A;  3ICB A;  4GBA A;  2SCP A;  1MXL C;  1AUI B;  1EL4 A;  1B47 A;  2LMU A;  4PE7 A;  1IH0 A;  2HQ8 A;  1NYA A;  1OMV A;  3FWB A;  5CSI A;  1F54 A;  1L7Z A;  2P6B B;  3BOW A;  1PUL A;  1Y0V H;  2JT3 A;  1KQM B;  2SAS A;  2TN4 A;  1OZO A;  2R2I A;  3EK8 A;  1Y6W A;  4M2O A;  3CR4 X;  1FW4 A;  1M63 B;  4C0L A;  3EK4 A;  2WOS A;  1UWO A;  2PAS A;  2L0P A;  4TNC A;  2KYC A;  1V1G A;  4XJK A;  1KK7 Z;  4I5K A;  1DJG A;  2LVJ A;  4JQ0 D;  2OPO A;  4YGB B;  3EK7 A;  5CPV A;  1X02 A;  1ZUZ A;  1KFX L;  2EC6 C;  1KK8 C;  4YGD B;  1DVI A;  3RLZ A;  2CTN A;  1BMO A;  2LE9 B;  3AKA A;  4PHM A;  3IF7 A;  2I94 A;  2MHH A;  1GJY A;  4YRU A;  3E3R A;  4E68 A;  3D0Y B;  2K7D A;  1SYM A;  1F55 A;  4I5J A;  1D1O A;  1G8I A;  4XYN A;  4ZCV A;  1IG5 A;  2LCP A;  1XK4 C;  3O78 A;  5PAL A;  1SR6 C;  4CFR A;  3I5F B;  2HET A;  4MZK A;  1CLB A;  2HQW A;  1S6I A;  1KFU L;  1TRF A;  2H2K A;  1Y1A A;  1AVS A;  3AKB A;  1IJ6 A;  1EH2 A;  2BCA A;  1UHH A;  2JNX A;  2LAP A;  3BOW B;  2KGR A;  4MEW A;  5CSJ A;  1J7P A;  2KOT A;  1RWY A;  1YVL A;  4A4C A;  1UHJ A;  2LLT A;  1XFW O;  2AMI A;  2K61 A;  1BOC A;  4OVN F;  1NUB A;  1MF8 B;  3I5I C;  1F70 A;  1NX3 A;  4XJK B;  4WRI A;  2F33 A;  4FTG A;  1A75 A;  3SIA A;  1LKJ A;  2JPT A;  2LP3 A;  1QX5 B;  2JT0 A;  5AER A;  2KFH A;  4NQG A;  1YUR A;  1K96 A;  2ISD A;  1WDC B;  1ALV A;  5FYX A;  2PRU A;  3JTD B;  1YUU A;  2F3Z A;  3TDZ A;  2JTZ A;  1S5G Y;  1SCM C;  1UUS A;  4C0J A;  2OS8 C;  2PAL A;  2G9B A;  3KO0 A;  4PDZ A;  5AXI A;  3TS5 C;  4HRH A;  1KWO B;  1K95 A;  1B1G A;  2M7L A;  1PSR A;  2M9G A;  1UP5 A;  5DKQ A;  1TN4 A;  2L4H A;  2I7A A;  1SKT A;  2FCD A;  2WCF A;  4MRY A;  1SPY A;  4GUK A;  2KAY A;  4ZCU A;  1CNP A;  5D7F A;  1CDM A;  1WRZ A;  1CLL A;  2COL B;  2Q91 A;  1CKK A;  2D8N A;  1CMG A;  3SG3 A;  3PLF B;  2IS9 A;  4A4B A;  2WCB A;  1CFF A;  1Q80 A;  1C7V A;  1OSA A;  1WRL A;  3PM8 A;  3I5H B;  4D1E A;  2ZND A;  2F3Y A;  5HKW A;  4GGN A;  4GNK B;  1MQ1 A;  1A75 B;  3AAJ A;  1Y1X A;  4DIR A;  2NZ0 A;  3O4Y A;  4QJ4 B;  3JVT C;  3WNX B;  3I5G B;  3BYA A;  4OV2 A;  2M8U A;  2KFG A;  1EXR A;  1DJI A;  2B1U A;  1LVC D;  1UHI A;  2LAN A;  1QX2 A;  4DS7 A;  2JT8 A;  4Q04 A;  1B7T Y;  1QVI Y;  2F8P A;  2H61 C;  2BBN A;  4I5L B;  4P5O E;  4PAL A;  1N2D A;  2KNE A;  2ZRT A;  1RRO A;  2A4J A;  4U8D A;  5I2O A;  4MZJ A;  2NCP A;  2OTG B;  4ORB B;  2LMT A;  4HRE E;  3OX6 A;  1CDN A;  1DJW A;  1SMG A;  1NPQ A;  5KU1 A;  2PSR A;  1S36 A;  5K89 A;  1J7R A;  2M0R A;  1XA5 A;  3WHT B;  1H4B A;  3SG6 A;  4UPG A;  1H8B A;  1FF1 A;  2F2P A;  1FI5 A;  1IQ5 A;  2GGM A;  2Y4Q A;  3OHM B;  1OMR A;  2LC5 A;  4DRW A;  1OE9 B;  2KQY A;  2WCE A;  5J3X A;  5I8N A;  3TUY C;  1SL7 A;  3BUX B;  1B8C A;  1PSB A;  3CZT X;  1ZAC A;  5CSF A;  1TIZ A;  1L2O C;  2KI4 C;  3CWG A;  2O5G A;  5GQQ C;  2NLN A;  2FOT A;  1LA3 A;  3VRQ A;  1GGW A;  2KI6 D;  1E8A A;  2Y5I A;  3VGO A;  2KI6 C;  1MUX A;  1CTR A;  3LCP C;  3GK4 X;  4PHN A;  3BUO B;  1JFK A;  2G2B A;  1QS7 A;  1YR5 A;  1KQM C;  2EC6 B;  2JXL A;  3OX5 A;  3VRR A;  3GOF A;  4CLN A;  3BQ3 A;  1K9K A;  1S6J A;  3DVJ A;  2LUC A;  4GFT A;  2JU0 A;  4NDB A;  3OP0 A;  3LK0 A;  1UHK A;  4QJ3 B;  1B4C A;  1DJH A;  4MN0 A;  4PHK A;  4CPV A;  1CDP A;  2L2E A;  2MJW B;  4MBE A;  3WXA A;  1QTX A;  3SIB A;  2NXQ A;  1YUS A;  5HKZ A;  1JWD A;  4GGF A;  2M49 B;  1U5I B;  3HCM A;  1AJ5 A;  2BL0 B;  1BJF A;  1BOD A;  2WOR A;  1NWD A;  4L9M A;  2KFF A;  2JXC A;  5TNC A;  3NSK A;  3I5I B;  1K90 D;  2JNF A;  2ZNE A;  5ER4 X;  2RGI A;  1TTX A;  2K7C A;  1BF5 A;  3NSO A;  3CTN A;  2ZN9 A;  4AQI A;  1IQ3 A;  2M1U A;  4PCW A;  2L98 A;  4YGA A;  3KEV A;  2ZFD A;  3BXK A;  1JF2 A;  1NX0 A;  2Y1M A;  2JC2 A;  2KQ6 A;  1F8H A;  1XFZ O;  1SRA A;  4MSP A;  1W7I B;  3PN7 B;  1J1D A;  4ORC B;  4CID A;  2MAZ A;  5BPJ A;  5AEQ A;  2H61 A;  1S3P A;  5DKR A;  1IGV A;  2BKI B;  2HPS A;  5JOL A;  2EGD A;  4MVF A;  1SCV A;  1LA0 A;  2L4I A;  2LNK A;  4ORA B;  1Y1U A;  1XFV O;  1VRK A;  3JTD C;  4R1E A;  2KGB C;  5HKY A;  1R6P A;  1GQM A;  4ETO A;  5HYD A;  2BCX A;  1PVB A;  2WC8 A;  3SG4 A;  4PHJ A;  3FWC A;  2QPT A;  2LVK A;  3CS1 A;  1A03 A;  1JC2 A;  1BG1 A;  1TCO B;  4MLW A;  1DJX A;  1LXF C;  2ZN8 A;  1PAL A;  1S5G Z;  1NP8 A;  1UHN A;  1YX8 A;  5AAN A;  4GAO A;  1RK9 A;  1M39 A;  1RJV A;  4M2P A;  1OQP A;  3SG5 A;  1QLK A;  2Q4U A;  1YTZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...