1SR6B

Structure of nucleotide-free scallop myosin s1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
144
structure length
144
Chain Sequence
PQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKGSGEEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain, striated muscle
publication title Myosin subfragment 1 structures reveal a partially bound nucleotide and a complex salt bridge that helps couple nucleotide and actin binding.
pubmed doi rcsb
molecule tags Contractile protein
total genus 18
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2004-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1sr6B01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1sr6B02
2MJWB 2KI6C 4HRHA 1WLMA 2LC5A 2L50A 2BCAA 2MA2A 1EH2A 1K9KA 1PSRA 2JXCA 2K2AA 1B7TY 1IH0A 2L5XB 5JOLA 1CDMA 3BYAA 5FYXA 3EK4A 3HX4A 1SYMA 2L2EA 5JJGA 2LCPA 2KAYA 3VRPA 1IQ3A 1DT7B 1PVAA 1NUBA 1KWOB 1X02A 3LLEA 1DJZA 4PE7A 2KYCA 1FBVA 1JC2A 1BU3A 1S5GZ 3NXAA 4YI8A 1QX2A 1OMRA 2BBNA 2D8NA 1KCYA 3LK1A 2F2OA 2KFGA 2JT0A 2V53A 2Y5IA 3A4UB 1FI5A 4ORCB 3OHMB 1BLQA 1NCXA 1SCMC 2LMTA 1BODA 1IG5A 2JT8A 2LV7A 1W7JB 1SR6C 2QPTA 1SW8A 4ZCVA 1B8LA 1CFFA 3SIBA 1D1OA 1KQMB 1IRJA 1QV0A 1OSAA 3PN7B 4GUKA 1CMGA 3BUNB 2LUCA 1IJ6A 1K2HA 1VRKA 2O5GA 3HCMA 1FPWA 3NSLA 2KI6D 2KAVA 4PDZA 2M97A 4QJ3B 1EG3A 1RK9A 3I5GC 2KGRA 4HSZA 1PSBA 2NCOA 2EHBA 2M0RA 1C7VA 1QIVA 3PLFB 1YRTB 2F2PA 3JVTB 1J7RA 3SG4A 2IS9A 1B4CA 3I5HC 2BE4A 2M3WA 3CR5X 4MN0A 2LLUA 2WCBA 2JZIA 1FI6A 1XFYO 2HQ8A 2LMVA 1DJHA 2FJUB 2LUXA 3BOWB 1UURA 2HETA 5HLVA 1QTXA 3IQOA 2OS8C 3EKJA 1LA0A 1DJWA 2K2FA 1WY9A 1NCZA 1WDCC 1WRKA 1DJXA 3KHEA 2SCPA 2RGIA 1GGWA 2COLB 1S5GY 2K7DA 2MLFC 5J3XA 4PHMA 1QVIY 1BF5A 2JOJA 1J7PA 4C0JA 2MLEC 3OP0A 1QLKA 1SY9A 1NWDA 4P2YB 2CBLA 4MZJA 1TNPA 2KQYA 1IWQA 2OTGC 3H4SE 4C0LA 1B7TZ 1TRFA 1XFUO 3DD4A 5B8IB 4PE4A 2JNFA 3NSOA 1KK8C 3DVMA 1YRUB 2WOSA 4GPLB 3OB1B 1KQMC 3GOFA 1NYAA 3AAKA 4L9MA 1SPYA 1XVJA 1QS7A 3VRQA 2LM5A 3CTNA 4E68A 2EGDA 1SRAA 2PSRA 1U5IB 2B1UA 2ZN9A 2KBMA 4I5JA 4D1EA 2TN4A 3I5FC 4NDCA 1A03A 2ISDA 4MBEA 2AAOA 1OQPA 1Q80A 2L4IA 2EC6B 4IL1A 2AUCA 1AJ5A 4GGNA 2BCBA 1KSOA 1MR8A 3EKHA 3GK2A 1NX0A 3EVRA 4XYNA 5KTYA 1Y0VH 1K94A 4MZLA 2AMIA 1CM1A 4XJKA 3RM1A 2JTTA 2OPOA 1LKJA 4GBAA 2LHLA 1S6JA 5DKRA 3CGAA 2K0JA 1QATA 1JF0A 1RWYA 2LLTA 3VROA 1FW4A 2I7AA 4DCKA 1XFZO 2ZRTA 4WRIA 1EL4A 2PVBA 1DJYA 5AERA 1OZSA 1XYDA 2BKHB 4HREE 2L0PA 1M46A 3SG7A 1B8RA 1BOCA 1UHIA 1NX2A 1BJFA 1MUXA 1F4OA 1QX5B 2PASA 1MQ1A 3WHTB 4MSPA 2NXQA 4CIDA 1CFCA 1SCVA 4I5LB 1TOPA 3TS5B 1SL8A 1CFPA 2KI4B 1CDLA 4DUQA 2HQWA 3BUOB 4ZCUA 1B47A 1NX3A 3TUYC 4USLA 4QJ4B 1KFUL 1SKTA 1DVIA 1ODBA 1GJYA 1QVIZ 1S6IA 1CFDA 1DF0B 3VRNA 4ICBA 1NSHA 1MXEA 4ORAB 2MRDA 1AVSA 4PCWA 4YGCB 5F6TA 3EVVA 1JWDA 1F55A 1K96A 2F3ZA 3AKAA 1NCYA 1G8IA 1K90D 1G4YR 1HT9A 4YGAA 4ETOA 1S6CA 1LXFC 4OR9B 1YVLA 5BPJA 4MZKA 1H8BA 1W7IB 5AEQA 1JUOA 3QRXA 1CTRA 2M7NA 2CXJA 3CR4X 3OB2B 1K9UA 2I2RE 3JTDB 2LAPA 2LVJA 1UUSA 1DF0A 1A29A 1A4PA 2Y1NA 2LP3A 1TN4A 2M1KB 3TDIA 2F8PA 4OV2A 2LMUA 3SIAA 2ZKMX 1LVCD 2KDHA 5K89A 2LNKA 1M63B 1R6PA 1DJIA 3EVUA 4A4CA 3DF0B 3I5IB 3LK0A 3WHUB 4BY4A 1KSMA 2G9BA 2K7OA 2M49B 4OCIA 3SG3A 1F54A 5D69A 5ER4X 2JXLA 2L4HA 1M39A 1M45A 1MXLC 1QV1A 2JU0A 3CWGA 3PFVA 3BXKA 3FWBA 1TCFA 1N65A 1BMOA 1BT6A 1EXRA 3F45A 2F3YA 4OKHA 2ZNEA 1KWOC 1RECA 2JRFA 2JNXA 4WQ3A 2JT3A 1YTZC 1N0YA 1SMGA 2WNDA 4CFQA 3TZ1A 1JF2A 2NZ0A 2CCMA 2KBIA 1CM4A 2BL0B 2ZNDA 1PALA 4NQGA 1L2OB 5IBWA 3GK4X 3BOWA 1JSAA 2GGMA 4M2OA 3PATA 1IQ5A 3O2PA 1SBJA 1CLMA 2BKIB 2WORA 1UHHA 1WRZA 4TNCA 1J7OA 2K7BA 2SASA 1NX1A 4U8DA 3O78A 3PN7C 1B1GA 3KEVA 3IQQA 2L98A 1YURA 2KOTA 3OX5A 1QIWA 5HKZA 3EK7A 5HKYA 5AXIA 4FTGA 3BQ3A 4MLWA 3CLNA 4YBHB 1UHJA 2MHHA 1J1DA 1Y1XA 3JVTC 3D0YB 1CB1A 1S3PA 3DVJA 4JWQA 1OE9B 3TDUA 1WLZA 4JQ0D 1MHOA 5G08A 2JTZA 5I2LA 1TCOB 2H2KA 1J55A 1KFUS 4GGFA 1CDNA 1K8UA 3CS1A 1BR4B 2WCEA 1U5IA 3D10A 4MRXA 2JQ6A 1YX8A 4PHJA 1JFKA 2KYFA 1J1EA 1ZOTB 3GK1A 3KPXA 1SCMB 2VRGA 3K21A 1SL9A 4MVFA 2M7LA 4NDDA 1KK7Z 5KU1A 1SR6B 1PRWA 5KSZA 1DTLA 4HRGA 5ER5A 2F33A 3BUWB 5I8NA 4I5NB 2KGBC 4A4BA 2PMYA 1DGUA 4M2QA 1F8HA 4PE1A 1OOJA 1NPQA 1IKUA 2H61A 5HKWA 2LHIA 4BY5A 3RLZA 1AHRA 3I5GB 1CLLA 2KAXA 4ORBB 3SG2A 3KF9A 3FS7A 1LINA 1Y1UA 4PHNA 1BR1B 3VRRA 1JFJA 2MAZA 1KFXL 3BUMB 2WC8A 2KSPA 2LANA 1OMDA 1QASA 1NP8A 4YGBB 1TNWA 1XFWO 1TIZA 3SG5A 1G33A 4AOMA 3A8RA 4GGFC 1CDPA 3NSKA 4CLNA 5AFPA 1QXPA 4CPVA 4PE0A 3IF7A 1FF1A 1C7WA 5DKQA 5CSIA 4AQIA 3AAJA 1CNPA 1YUTA 4WQ2A 1H4BA 2EC6C 2OS8B 4DIRA 1LA3A 4R1EA 1CKKA 1JBAA 3ZWHA 5GQQC 1N2DA 1WDCB 1K9PA 2BBMA 2A4JA 2Q4UA 2O60A 1DMOA 2KQ6A 3BUXB 1XK4A 3TDZA 2H61C 4F0ZB 1S36A 1S26D 1XFXO 4PALA 1M31A 3NSIA 2R2IA 2Q91A 1IGVA 2Y1MA 4YGDB 1RJVA 1ZMZA 2L51A 1KK7Y 2OTGB 4N1GA 4OVNF 2M8UA 2E6WA 1V1GA 1QLSA 2CT9A 2GGZA 1KK8B 2LLSA 1ZFSA 2Y4QA 3MSEB 3VGOA 4P5OE 2KHNA 1DJGA 1F71A 1A2XA 1ZUZA 2KNEA 2M29A 3PALA 2BCXA 1RROA 1ALWA 3I5FB 1YX7A 1EG4A 1Y6WA 2KFFA 2HPSA 1MWNA 1HQVA 1SL7A 4N5XA 2G2BA 1PVBA 3TS5C 4YGEB 1AUIB 2KI4C 2DOQA 1B8CA 1R2UA 4FQOA 3ICBA 1GGZA 1XK4C 1UP5A 1TNQA 1PULA 2LVIA 3OX6A 1UHKA 5I2QA 2P6BB 1GQMA 3DF0A 1F4QA 3EK8A 2KFHA 3CZTX 1K95A 2ZN8A 3O4YA 4AQJA 2M9GA 2NLNA 5DKNA 3M0WA 1RTP1 1E8AA 1C07A 2WCFA 4UPGA 5HYDA 1SK6D 4JPZB 5HLOA 1K93D 4DRWA 3CR2A 2FCDA 2E30A 5TNCA 4GNKB 1QX7A 2HF5A 1IJ5A 3SJSA 3LL8B 3LCPC 2M1UA 1YUUA 3JTDC 4PHKA 5CPVA 3FWCA 2K8MB 1UWOA 4C0KA 4N1FA 1YUSA 2FOTA 2PRUA 1NIWA 2FCEA 3WNXB 5I2OA 1WRLA 1J7QA 5CSNA 2CNPA 2JWWA 4GFTA 3E3RA 1TTXA 2CTNA 3C1VA 1DGVA 4GAOA 2NCPA 4CFRA 1ZACA 1YR5A 3O6BA 1TNXA 3TUYB 4DS7A 4XJKB 3I5IC 1KFXS 3SG6A 2LVVA 2PALA 1L7ZA 1A75B 1V1FA 1S1EA 2BECA 2I18A 2ZRSA 1OMVA 3WXAA 5CSFA 1AK8A 2JPTA 2QACA 2MBXA 4YI9A 4QJ5B 1B9AA 2BE6A 1CMFA 1SNLA 3PM8A 1RFJA 1PK0D 4M2PA 1XA5A 2LP2A 1QJTA 2K7CA 3D0YA 2GV5A 4MEWA 1KQVA 2LE9B 1F70A 1XFVO 1ALVA 2JC2A 5D7FA 4YRUA 4I5KA 1BG1A 2BL0C 5PALA 1XO5A 2JULA 3DVKA 1A75A 1L2OC 2K61A 4Q04A 3DVEA 1UHNA 3PSRA 5CSJA 2I94A 1CLBA 1MF8B 3KO0A 2LVKA 1Y1AA 1YVHA 4NDBA 5AANA 1AP4A 1AJ4A 1OZOA 3ZNIA 3I5HB 1EJ3A 4MRYA 2ZFDA 3AKBA 3FIAA
chains in the Genus database with same CATH superfamily
2MJWB 2KI6C 4HRHA 1WLMA 2LC5A 2L50A 2BCAA 2MA2A 1EH2A 1K9KA 1PSRA 2JXCA 2K2AA 1B7TY 1IH0A 2L5XB 2QEHA 3D77A 5JOLA 1CDMA 3BYAA 5FYXA 3EK4A 3HX4A 1SYMA 2L2EA 5JJGA 2LCPA 2KAYA 3VRPA 1IQ3A 1DT7B 1PVAA 1NUBA 1KWOB 1X02A 3LLEA 1DJZA 4PE7A 2KYCA 1TUZA 2WCLA 1FBVA 1C3ZA 1BU3A 1JC2A 1S5GZ 3NXAA 4YI8A 1QX2A 1OMRA 2BBNA 2D8NA 3IVTA 3LK1A 2F2OA 1KCYA 2KFGA 3BFAA 2JT0A 2V53A 2Y5IA 3A4UB 1FI5A 4ORCB 5EL2A 3OHMB 1BLQA 4PHJA 1NCXA 1SCMC 2LMTA 3R1OA 1BODA 1IG5A 2JT8A 2LV7A 1W7JB 1SR6C 2QPTA 1SW8A 1C3YA 4ZCVA 1B8LA 1CFFA 3UO9A 3SIBA 1D1OA 1KQMB 3Q8IA 1IRJA 3D75A 1QV0A 1OSAA 3PN7B 4GUKA 1CMGA 3BUNB 3CABA 2LUCA 1IJ6A 1K2HA 1VRKA 2O5GA 3HCMA 1FPWA 3NSLA 2KI6D 2KAVA 4PDZA 2M97A 4QJ3B 1EG3A 1RK9A 3I5GC 2KGRA 4HSZA 1PSBA 2NCOA 2EHBA 2M0RA 3DY9A 1C7VA 1QIVA 2WCJA 3PLFB 1YRTB 2F2PA 3JVTB 3D78A 1J7RA 3SG4A 2IS9A 1B4CA 3I5HC 2BE4A 2M3WA 3CR5X 4MN0A 2LLUA 2WCBA 2JZIA 1FI6A 1XFYO 2HQ8A 2LMVA 1DJHA 3NGVA 1W9ZA 2FJUB 2LUXA 3BOWB 1UURA 2HETA 5HLVA 1QTXA 4OZDA 3IQOA 2OS8C 3EKJA 1LA0A 1DJWA 2K2FA 1WY9A 1NCZA 1WDCC 3B7AA 1WRKA 1DJXA 3KHEA 2SCPA 2RGIA 1GGWA 2COLB 1S5GY 2K7DA 2MLFC 5J3XA 4PHMA 1QVIY 1BF5A 2JOJA 1J7PA 4C0JA 2MLEC 3OBVA 3OP0A 1QLKA 1OW4A 1SY9A 1NWDA 4P2YB 3CZ1A 2CBLA 4MZJA 1TNPA 2KQYA 1IWQA 2OTGC 3H4SE 4C0LA 1B7TZ 1TRFA 1XFUO 3DD4A 5B8IB 2K60A 2YGUA 2JNFA 3NSOA 1KK8C 4PE4A 3DVMA 1YRUB 2WOSA 4GPLB 3OB1B 1ORGA 3FE8A 1KQMC 3GOFA 1NYAA 3AAKA 4L9MA 1SPYA 1XVJA 1QS7A 3VRQA 2LM5A 3CTNA 4E68A 2P71A 2EGDA 3L4LA 1SRAA 2PSRA 1U5IB 2B1UA 2ZN9A 2KBMA 4I5JA 3FE6A 2TN4A 4D1EA 3I5FC 4NDCA 1A03A 3R1PA 4MBEA 2ISDA 2AAOA 2BNXA 3DZTA 1OQPA 1Q80A 2L4IA 2EC6B 4IL1A 2AUCA 1AJ5A 2KPHA 4GGNA 3S0DA 2BCBA 1KSOA 1MR8A 3EKHA 3GK2A 1NX0A 5I94A 3S0EA 3EVRA 4XYNA 5KTYA 1Y0VH 1K94A 2JPOA 4MZLA 2AMIA 1CM1A 4FQTA 4XJKA 3RM1A 2JTTA 2OPOA 1LKJA 4GBAA 2LHLA 1S6JA 3PJIA 5DKRA 4INWA 3CGAA 3DXLA 2K0JA 1QATA 1JF0A 1RWYA 2LLTA 3VROA 1FW4A 2I7AA 4DCKA 1XFZO 2ZRTA 4WRIA 1EL4A 2PVBA 1DJYA 5AERA 1OZSA 1XYDA 2BKHB 4HREE 2L0PA 2PYQA 1M46A 3SG7A 1B8RA 2FJYA 1BOCA 1UHIA 1NX2A 1BJFA 1MUXA 1F4OA 5FI2A 1QX5B 2PASA 3R72A 1MQ1A 3WHTB 4MSPA 2NXQA 1XFRA 4CIDA 1CFCA 1SSEB 1SCVA 2WCKA 4I5LB 1TOPA 3TS5B 5FI6A 1SL8A 3SS4A 1CFPA 2KI4B 1CDLA 4DUQA 2HQWA 3BUOB 4ZCUA 1B47A 1NX3A 3TUYC 4USLA 4QJ4B 1KFUL 1SKTA 1DVIA 1ODBA 3L4AA 1GJYA 1QVIZ 1S6IA 1CFDA 1DF0B 3VRNA 4ICBA 1NSHA 1MXEA 4ORAB 2MRDA 1AVSA 4PCWA 4YGCB 5F6TA 3EVVA 1JWDA 3BJHA 1F55A 1K96A 2F3ZA 3AKAA 1NCYA 1G8IA 4INXA 1K90D 1G4YR 1HT9A 4YGAA 4ETOA 1S6CA 1LXFC 4OR9B 1YVLA 1DEKA 5BPJA 4MZKA 1H8BA 3CYZA 1W7IB 5AEQA 1JUOA 3QRXA 1CTRA 2M7NA 2CXJA 3CR4X 3OB2B 1K9UA 2I2RE 3JTDB 2LAPA 2LVJA 1UUSA 1DF0A 1A29A 1A4PA 2Y1NA 2LP3A 1TN4A 2M1KB 2H8VA 2QDIA 3TDIA 2F8PA 4OV2A 2LMUA 3K1EA 5FI7A 3SIAA 2ZKMX 1LVCD 2KDHA 3DYEA 5K89A 4PT1A 2LNKA 1GM0A 3BFBA 1M63B 1R6PA 1DJIA 3EVUA 4A4CA 3S0AA 3DF0B 3I5IB 3LK0A 4KYNA 3PM2A 3WHUB 4BY4A 1KSMA 2G9BA 2K7OA 2M49B 4OCIA 3SG3A 1F54A 5D69A 5ER4X 2JXLA 2L4HA 1M39A 1M45A 1MXLC 1QV1A 2JU0A 3CWGA 3OGNA 3BXKA 3FWBA 1TCFA 1N65A 3PFVA 1BMOA 1BT6A 2WCHA 1EXRA 3F45A 2F3YA 4OKHA 2ZNEA 1KWOC 1RECA 2JRFA 3S0GA 2JNXA 4WQ3A 2JT3A 1YTZC 1N0YA 1SMGA 2QEBA 2WNDA 4JKTA 3SS3A 4CFQA 3TZ1A 1JF2A 2NZ0A 2CCMA 2KBIA 1CM4A 2BL0B 1DELA 2ZNDA 1PALA 4NQGA 1IIOA 1Z2CB 1L2OB 5IBWA 3GK4X 3BOWA 1JSAA 2GGMA 4M2OA 1TWOA 3PATA 1IQ5A 3O2PA 1SBJA 1CLMA 2BKIB 2WORA 1UHHA 1WRZA 3B88A 4TNCA 3V2LA 1J7OA 2K7BA 2SASA 1NX1A 4U8DA 3O78A 3PN7C 1B1GA 3KEVA 1LS8A 3IQQA 2L98A 1YURA 2KOTA 3OX5A 1QIWA 5HKZA 3EK7A 5HKYA 1TUJA 5AXIA 4FTGA 3BQ3A 4MLWA 3CLNA 1OOIX 4YBHB 1UHJA 2MHHA 1J1DA 1Y1XA 3CZ0A 3JVTC 3D0YB 1CB1A 1S3PA 3DVJA 4JWQA 1OE9B 3TDUA 2P70A 1WLZA 4JQ0D 1MHOA 5G08A 2JTZA 2KLEA 1TCOB 3L47A 5I2LA 2H2KA 1J55A 1KFUS 4GGFA 1CDNA 1K8UA 3CS1A 1BR4B 2WCEA 1U5IA 3D10A 4MRXA 2JQ6A 1YX8A 2L5YA 1JFKA 2KYFA 1J1EA 1ZOTB 3GK1A 3KPXA 1SCMB 2VRGA 3K21A 1SL9A 4MVFA 2M7LA 4NDDA 1KK7Z 1OOHA 1SR6B 5KU1A 1PRWA 5KSZA 1DTLA 4HRGA 3B86A 1DC1A 5HL1A 3UNWA 5ER5A 2F33A 3BUWB 5I8NA 2KLDA 4I5NB 2KGBC 3D73A 4A4BA 2PMYA 1DGUA 4M2QA 1F8HA 4PE1A 1OOJA 1NPQA 1IKUA 2H61A 5HKWA 2LHIA 4BY5A 3RLZA 1AHRA 3I5GB 1CLLA 2KAXA 4ORBB 3SG2A 3KF9A 3FS7A 1LINA 1Y1UA 4PHNA 1BR1B 3VRRA 1JFJA 3S0BA 2MAZA 1KFXL 3BUMB 2WC8A 2KSPA 2LANA 1OMDA 1QASA 1NP8A 4YGBB 1TNWA 1XFWO 1TIZA 3SG5A 1G33A 4AOMA 3A8RA 4GGFC 1CDPA 3NSKA 4CLNA 5AFPA 1QXPA 4CPVA 4PE0A 3IF7A 3R1VA 1FF1A 1C7WA 5DKQA 5CSIA 4AQIA 3AAJA 1CNPA 1YUTA 4WQ2A 1H4BA 2EC6C 2L2CA 2OS8B 4DIRA 1LA3A 4R1EA 1CKKA 1JBAA 3ZWHA 5GQQC 1N2DA 1WDCB 3NHIA 1K9PA 2BBMA 2A4JA 1OOGA 2Q4UA 2O60A 1DMOA 2KQ6A 3BUXB 1XK4A 3TDZA 2H61C 4F0ZB 1S36A 1S26D 1XFXO 4PALA 1M31A 3NSIA 2R2IA 2Q91A 1IGVA 2Y1MA 4YGDB 1OOFA 1RJVA 1ZMZA 2L51A 1KK7Y 2OTGB 4N1GA 4OVNF 2M8UA 2E6WA 1V1GA 1QLSA 2CT9A 2GGZA 3N7HA 1KK8B 2LLSA 3D74A 1ZFSA 2Y4QA 3BFHA 3MSEB 3VGOA 4P5OE 3S0FA 2KHNA 1DJGA 1F71A 3B87A 1A2XA 2WC5A 1ZUZA 2KNEA 2M29A 2WC6A 3PALA 2BCXA 1RROA 1ALWA 3I5FB 1YX7A 1EG4A 1Y6WA 2KFFA 3VB1A 2HPSA 1MWNA 1HQVA 1SL7A 4N5XA 2G2BA 1PVBA 3TS5C 4YGEB 1AUIB 2KI4C 2DOQA 1B8CA 3CDNA 1R2UA 4FQOA 3ICBA 2PQLA 1GGZA 3NHTA 3EG5B 1XK4C 1UP5A 1TNQA 1PULA 2LVIA 3OX6A 1UHKA 5I2QA 4JD9A 2P6BB 1GQMA 3DF0A 1F4QA 3EK8A 2KFHA 3CZTX 1K95A 2ZN8A 3O4YA 4AQJA 2M9GA 2NLNA 5DKNA 3M0WA 1RTP1 1E8AA 3RZSA 1C07A 2WCFA 4UPGA 5HYDA 1SK6D 4JPZB 5HLOA 1K93D 2QEVA 4DRWA 3CR2A 2FCDA 2E30A 2WCMA 3FE9A 4GNKB 5TNCA 1QX7A 2HF5A 3O4XA 4F7FA 1IJ5A 3SJSA 3LL8B 3LCPC 2M1UA 1YUUA 1P28A 3JTDC 4PHKA 5CPVA 3FWCA 2K8MB 1UWOA 5D3OA 4C0KA 4N1FA 1YUSA 2FOTA 2PRUA 1NIWA 2FCEA 3WNXB 5I2OA 1WRLA 1J7QA 5CSNA 2CNPA 2JWWA 4GFTA 3E3RA 1T14A 1TTXA 2CTNA 3C1VA 1DGVA 4GAOA 2NCPA 4CFRA 1QWVA 1YR5A 1ZACA 3O6BA 1TNXA 3B6XA 3TUYB 4DS7A 4XJKB 2GTEA 3I5IC 1KFXS 3SG6A 2LVVA 2PALA 1L7ZA 1A75B 3QMEA 1V1FA 1S1EA 2BECA 2I18A 2ZRSA 2ERBA 3D76A 1OMVA 3WXAA 5CSFA 1AK8A 2JPTA 2QACA 2MBXA 4YI9A 4QJ5B 1B9AA 2BE6A 1CMFA 1SNLA 3PM8A 1RFJA 1PK0D 4M2PA 1XA5A 2LP2A 1QJTA 2K7CA 3D0YA 2GV5A 4MEWA 1KQVA 2LE9B 1F70A 1XFVO 1ALVA 2JC2A 5D7FA 4YRUA 4I5KA 1BG1A 2BL0C 5PALA 3SS5A 1XO5A 2JULA 5DICA 3DVKA 1A75A 1L2OC 2K61A 4Q04A 3CZ2A 3DVEA 1UHNA 3PSRA 5CSJA 2I94A 1CLBA 1MF8B 3KO0A 2LVKA 1Y1AA 1YVHA 1Z4HA 4NDBA 2BAPA 5AANA 1AP4A 1AJ4A 1OZOA 3ZNIA 2QEOA 3I5HB 1EJ3A 4MRYA 4IJ7A 1DQEA 2ZFDA 3AKBA 3FIAA
chains in the Genus database with same CATH topology
2MJWB 2KI6C 4HRHA 1WLMA 2LC5A 2L50A 2BCAA 2MA2A 1EH2A 1K9KA 1PSRA 2JXCA 2K2AA 1B7TY 1IH0A 2L5XB 5JOLA 1CDMA 3BYAA 5FYXA 3EK4A 3HX4A 1SYMA 2L2EA 5JJGA 2LCPA 2KAYA 3VRPA 1IQ3A 1DT7B 1PVAA 1NUBA 1KWOB 1X02A 3LLEA 1DJZA 4PE7A 2KYCA 1FBVA 1JC2A 1BU3A 1S5GZ 3NXAA 4YI8A 1QX2A 1OMRA 2BBNA 2D8NA 1KCYA 3LK1A 2F2OA 2KFGA 2JT0A 2V53A 2Y5IA 3A4UB 1FI5A 4ORCB 3OHMB 1BLQA 1NCXA 1SCMC 2LMTA 1BODA 1IG5A 2JT8A 2LV7A 1W7JB 1SR6C 2QPTA 1SW8A 4ZCVA 1B8LA 1CFFA 3SIBA 1D1OA 1KQMB 1IRJA 1QV0A 1OSAA 3PN7B 4GUKA 1CMGA 3BUNB 2LUCA 1IJ6A 1K2HA 1VRKA 2O5GA 3HCMA 1FPWA 3NSLA 2KI6D 2KAVA 4PDZA 2M97A 4QJ3B 1EG3A 1RK9A 3I5GC 2KGRA 4HSZA 1PSBA 2NCOA 2EHBA 2M0RA 1C7VA 1QIVA 3PLFB 1YRTB 2F2PA 3JVTB 1J7RA 3SG4A 2IS9A 1B4CA 3I5HC 2BE4A 2M3WA 3CR5X 4MN0A 2LLUA 2WCBA 2JZIA 1FI6A 1XFYO 2HQ8A 2LMVA 1DJHA 2FJUB 2LUXA 3BOWB 1UURA 2HETA 5HLVA 1QTXA 3IQOA 2OS8C 3EKJA 1LA0A 1DJWA 2K2FA 1WY9A 1NCZA 1WDCC 1WRKA 1DJXA 3KHEA 2SCPA 2RGIA 1GGWA 2COLB 1S5GY 2K7DA 2MLFC 5J3XA 4PHMA 1QVIY 1BF5A 2JOJA 1J7PA 4C0JA 2MLEC 3OP0A 1QLKA 1SY9A 1NWDA 4P2YB 2CBLA 4MZJA 1TNPA 2KQYA 1IWQA 2OTGC 3H4SE 4C0LA 1B7TZ 1TRFA 1XFUO 3DD4A 5B8IB 4PE4A 2JNFA 3NSOA 1KK8C 3DVMA 1YRUB 2WOSA 4GPLB 3OB1B 1KQMC 3GOFA 1NYAA 3AAKA 4L9MA 1SPYA 1XVJA 1QS7A 3VRQA 2LM5A 3CTNA 4E68A 2EGDA 1SRAA 2PSRA 1U5IB 2B1UA 2ZN9A 2KBMA 4I5JA 4D1EA 2TN4A 3I5FC 4NDCA 1A03A 2ISDA 4MBEA 2AAOA 1OQPA 1Q80A 2L4IA 2EC6B 4IL1A 2AUCA 1AJ5A 4GGNA 2BCBA 1KSOA 1MR8A 3EKHA 3GK2A 1NX0A 3EVRA 4XYNA 5KTYA 1Y0VH 1K94A 4MZLA 2AMIA 1CM1A 4XJKA 3RM1A 2JTTA 2OPOA 1LKJA 4GBAA 2LHLA 1S6JA 5DKRA 3CGAA 2K0JA 1QATA 1JF0A 1RWYA 2LLTA 3VROA 1FW4A 2I7AA 4DCKA 1XFZO 2ZRTA 4WRIA 1EL4A 2PVBA 1DJYA 5AERA 1OZSA 1XYDA 2BKHB 4HREE 2L0PA 1M46A 3SG7A 1B8RA 1BOCA 1UHIA 1NX2A 1BJFA 1MUXA 1F4OA 1QX5B 2PASA 1MQ1A 3WHTB 4MSPA 2NXQA 4CIDA 1CFCA 1SCVA 4I5LB 1TOPA 3TS5B 1SL8A 1CFPA 2KI4B 1CDLA 4DUQA 2HQWA 3BUOB 4ZCUA 1B47A 1NX3A 3TUYC 4USLA 4QJ4B 1KFUL 1SKTA 1DVIA 1ODBA 1GJYA 1QVIZ 1S6IA 1CFDA 1DF0B 3VRNA 4ICBA 1NSHA 1MXEA 4ORAB 2MRDA 1AVSA 4PCWA 4YGCB 5F6TA 3EVVA 1JWDA 1F55A 1K96A 2F3ZA 3AKAA 1NCYA 1G8IA 1K90D 1G4YR 1HT9A 4YGAA 4ETOA 1S6CA 1LXFC 4OR9B 1YVLA 5BPJA 4MZKA 1H8BA 1W7IB 5AEQA 1JUOA 3QRXA 1CTRA 2M7NA 2CXJA 3CR4X 3OB2B 1K9UA 2I2RE 3JTDB 2LAPA 2LVJA 1UUSA 1DF0A 1A29A 1A4PA 2Y1NA 2LP3A 1TN4A 2M1KB 3TDIA 2F8PA 4OV2A 2LMUA 3SIAA 2ZKMX 1LVCD 2KDHA 5K89A 2LNKA 1M63B 1R6PA 1DJIA 3EVUA 4A4CA 3DF0B 3I5IB 3LK0A 3WHUB 4BY4A 1KSMA 2G9BA 2K7OA 2M49B 4OCIA 3SG3A 1F54A 5D69A 5ER4X 2JXLA 2L4HA 1M39A 1M45A 1MXLC 1QV1A 2JU0A 3CWGA 3PFVA 3BXKA 3FWBA 1TCFA 1N65A 1BMOA 1BT6A 1EXRA 3F45A 2F3YA 4OKHA 2ZNEA 1KWOC 1RECA 2JRFA 2JNXA 4WQ3A 2JT3A 1YTZC 1N0YA 1SMGA 2WNDA 4CFQA 3TZ1A 1JF2A 2NZ0A 2CCMA 2KBIA 1CM4A 2BL0B 2ZNDA 1PALA 4NQGA 1L2OB 5IBWA 3GK4X 3BOWA 1JSAA 2GGMA 4M2OA 3PATA 1IQ5A 3O2PA 1SBJA 1CLMA 2BKIB 2WORA 1UHHA 1WRZA 4TNCA 1J7OA 2K7BA 2SASA 1NX1A 4U8DA 3O78A 3PN7C 1B1GA 3KEVA 3IQQA 2L98A 1YURA 2KOTA 3OX5A 1QIWA 5HKZA 3EK7A 5HKYA 5AXIA 4FTGA 3BQ3A 4MLWA 3CLNA 4YBHB 1UHJA 2MHHA 1J1DA 1Y1XA 3JVTC 3D0YB 1CB1A 1S3PA 3DVJA 4JWQA 1OE9B 3TDUA 1WLZA 4JQ0D 1MHOA 5G08A 2JTZA 5I2LA 1TCOB 2H2KA 1J55A 1KFUS 4GGFA 1CDNA 1K8UA 3CS1A 1BR4B 2WCEA 1U5IA 3D10A 4MRXA 2JQ6A 1YX8A 4PHJA 1JFKA 2KYFA 1J1EA 1ZOTB 3GK1A 3KPXA 1SCMB 2VRGA 3K21A 1SL9A 4MVFA 2M7LA 4NDDA 1KK7Z 5KU1A 1SR6B 1PRWA 5KSZA 1DTLA 4HRGA 5ER5A 2F33A 3BUWB 5I8NA 4I5NB 2KGBC 4A4BA 2PMYA 1DGUA 4M2QA 1F8HA 4PE1A 1OOJA 1NPQA 1IKUA 2H61A 5HKWA 2LHIA 4BY5A 3RLZA 1AHRA 3I5GB 1CLLA 2KAXA 4ORBB 3SG2A 3KF9A 3FS7A 1LINA 1Y1UA 4PHNA 1BR1B 3VRRA 1JFJA 2MAZA 1KFXL 3BUMB 2WC8A 2KSPA 2LANA 1OMDA 1QASA 1NP8A 4YGBB 1TNWA 1XFWO 1TIZA 3SG5A 1G33A 4AOMA 3A8RA 4GGFC 1CDPA 3NSKA 4CLNA 5AFPA 1QXPA 4CPVA 4PE0A 3IF7A 1FF1A 1C7WA 5DKQA 5CSIA 4AQIA 3AAJA 1CNPA 1YUTA 4WQ2A 1H4BA 2EC6C 2OS8B 4DIRA 1LA3A 4R1EA 1CKKA 1JBAA 3ZWHA 5GQQC 1N2DA 1WDCB 1K9PA 2BBMA 2A4JA 2Q4UA 2O60A 1DMOA 2KQ6A 3BUXB 1XK4A 3TDZA 2H61C 4F0ZB 1S36A 1S26D 1XFXO 4PALA 1M31A 3NSIA 2R2IA 2Q91A 1IGVA 2Y1MA 4YGDB 1RJVA 1ZMZA 2L51A 1KK7Y 2OTGB 4N1GA 4OVNF 2M8UA 2E6WA 1V1GA 1QLSA 2CT9A 2GGZA 1KK8B 2LLSA 1ZFSA 2Y4QA 3MSEB 3VGOA 4P5OE 2KHNA 1DJGA 1F71A 1A2XA 1ZUZA 2KNEA 2M29A 3PALA 2BCXA 1RROA 1ALWA 3I5FB 1YX7A 1EG4A 1Y6WA 2KFFA 2HPSA 1MWNA 1HQVA 1SL7A 4N5XA 2G2BA 1PVBA 3TS5C 4YGEB 1AUIB 2KI4C 2DOQA 1B8CA 1R2UA 4FQOA 3ICBA 1GGZA 1XK4C 1UP5A 1TNQA 1PULA 2LVIA 3OX6A 1UHKA 5I2QA 2P6BB 1GQMA 3DF0A 1F4QA 3EK8A 2KFHA 3CZTX 1K95A 2ZN8A 3O4YA 4AQJA 2M9GA 2NLNA 5DKNA 3M0WA 1RTP1 1E8AA 1C07A 2WCFA 4UPGA 5HYDA 1SK6D 4JPZB 5HLOA 1K93D 4DRWA 3CR2A 2FCDA 2E30A 5TNCA 4GNKB 1QX7A 2HF5A 1IJ5A 3SJSA 3LL8B 3LCPC 2M1UA 1YUUA 3JTDC 4PHKA 5CPVA 3FWCA 2K8MB 1UWOA 4C0KA 4N1FA 1YUSA 2FOTA 2PRUA 1NIWA 2FCEA 3WNXB 5I2OA 1WRLA 1J7QA 5CSNA 2CNPA 2JWWA 4GFTA 3E3RA 1TTXA 2CTNA 3C1VA 1DGVA 4GAOA 2NCPA 4CFRA 1ZACA 1YR5A 3O6BA 1TNXA 3TUYB 4DS7A 4XJKB 3I5IC 1KFXS 3SG6A 2LVVA 2PALA 1L7ZA 1A75B 1V1FA 1S1EA 2BECA 2I18A 2ZRSA 1OMVA 3WXAA 5CSFA 1AK8A 2JPTA 2QACA 2MBXA 4YI9A 4QJ5B 1B9AA 2BE6A 1CMFA 1SNLA 3PM8A 1RFJA 1PK0D 4M2PA 1XA5A 2LP2A 1QJTA 2K7CA 3D0YA 2GV5A 4MEWA 1KQVA 2LE9B 1F70A 1XFVO 1ALVA 2JC2A 5D7FA 4YRUA 4I5KA 1BG1A 2BL0C 5PALA 1XO5A 2JULA 3DVKA 1A75A 1L2OC 2K61A 4Q04A 3DVEA 1UHNA 3PSRA 5CSJA 2I94A 1CLBA 1MF8B 3KO0A 2LVKA 1Y1AA 1YVHA 4NDBA 5AANA 1AP4A 1AJ4A 1OZOA 3ZNIA 3I5HB 1EJ3A 4MRYA 2ZFDA 3AKBA 3FIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MJW B;  2KI6 C;  4HRH A;  1WLM A;  2LC5 A;  2L50 A;  2BCA A;  2MA2 A;  1EH2 A;  1K9K A;  1PSR A;  2JXC A;  2K2A A;  1B7T Y;  1IH0 A;  2L5X B;  5JOL A;  1CDM A;  3BYA A;  5FYX A;  3EK4 A;  3HX4 A;  1SYM A;  2L2E A;  5JJG A;  2LCP A;  2KAY A;  3VRP A;  1IQ3 A;  1DT7 B;  1PVA A;  1NUB A;  1KWO B;  1X02 A;  3LLE A;  1DJZ A;  4PE7 A;  2KYC A;  1FBV A;  1JC2 A;  1BU3 A;  1S5G Z;  3NXA A;  4YI8 A;  1QX2 A;  1OMR A;  2BBN A;  2D8N A;  1KCY A;  3LK1 A;  2F2O A;  2KFG A;  2JT0 A;  2V53 A;  2Y5I A;  3A4U B;  1FI5 A;  4ORC B;  3OHM B;  1BLQ A;  1NCX A;  1SCM C;  2LMT A;  1BOD A;  1IG5 A;  2JT8 A;  2LV7 A;  1W7J B;  1SR6 C;  2QPT A;  1SW8 A;  4ZCV A;  1B8L A;  1CFF A;  3SIB A;  1D1O A;  1KQM B;  1IRJ A;  1QV0 A;  1OSA A;  3PN7 B;  4GUK A;  1CMG A;  3BUN B;  2LUC A;  1IJ6 A;  1K2H A;  1VRK A;  2O5G A;  3HCM A;  1FPW A;  3NSL A;  2KI6 D;  2KAV A;  4PDZ A;  2M97 A;  4QJ3 B;  1EG3 A;  1RK9 A;  3I5G C;  2KGR A;  4HSZ A;  1PSB A;  2NCO A;  2EHB A;  2M0R A;  1C7V A;  1QIV A;  3PLF B;  1YRT B;  2F2P A;  3JVT B;  1J7R A;  3SG4 A;  2IS9 A;  1B4C A;  3I5H C;  2BE4 A;  2M3W A;  3CR5 X;  4MN0 A;  2LLU A;  2WCB A;  2JZI A;  1FI6 A;  1XFY O;  2HQ8 A;  2LMV A;  1DJH A;  2FJU B;  2LUX A;  3BOW B;  1UUR A;  2HET A;  5HLV A;  1QTX A;  3IQO A;  2OS8 C;  3EKJ A;  1LA0 A;  1DJW A;  2K2F A;  1WY9 A;  1NCZ A;  1WDC C;  1WRK A;  1DJX A;  3KHE A;  2SCP A;  2RGI A;  1GGW A;  2COL B;  1S5G Y;  2K7D A;  2MLF C;  5J3X A;  4PHM A;  1QVI Y;  1BF5 A;  2JOJ A;  1J7P A;  4C0J A;  2MLE C;  3OP0 A;  1QLK A;  1SY9 A;  1NWD A;  4P2Y B;  2CBL A;  4MZJ A;  1TNP A;  2KQY A;  1IWQ A;  2OTG C;  3H4S E;  4C0L A;  1B7T Z;  1TRF A;  1XFU O;  3DD4 A;  5B8I B;  4PE4 A;  2JNF A;  3NSO A;  1KK8 C;  3DVM A;  1YRU B;  2WOS A;  4GPL B;  3OB1 B;  1KQM C;  3GOF A;  1NYA A;  3AAK A;  4L9M A;  1SPY A;  1XVJ A;  1QS7 A;  3VRQ A;  2LM5 A;  3CTN A;  4E68 A;  2EGD A;  1SRA A;  2PSR A;  1U5I B;  2B1U A;  2ZN9 A;  2KBM A;  4I5J A;  4D1E A;  2TN4 A;  3I5F C;  4NDC A;  1A03 A;  2ISD A;  4MBE A;  2AAO A;  1OQP A;  1Q80 A;  2L4I A;  2EC6 B;  4IL1 A;  2AUC A;  1AJ5 A;  4GGN A;  2BCB A;  1KSO A;  1MR8 A;  3EKH A;  3GK2 A;  1NX0 A;  3EVR A;  4XYN A;  5KTY A;  1Y0V H;  1K94 A;  4MZL A;  2AMI A;  1CM1 A;  4XJK A;  3RM1 A;  2JTT A;  2OPO A;  1LKJ A;  4GBA A;  2LHL A;  1S6J A;  5DKR A;  3CGA A;  2K0J A;  1QAT A;  1JF0 A;  1RWY A;  2LLT A;  3VRO A;  1FW4 A;  2I7A A;  4DCK A;  1XFZ O;  2ZRT A;  4WRI A;  1EL4 A;  2PVB A;  1DJY A;  5AER A;  1OZS A;  1XYD A;  2BKH B;  4HRE E;  2L0P A;  1M46 A;  3SG7 A;  1B8R A;  1BOC A;  1UHI A;  1NX2 A;  1BJF A;  1MUX A;  1F4O A;  1QX5 B;  2PAS A;  1MQ1 A;  3WHT B;  4MSP A;  2NXQ A;  4CID A;  1CFC A;  1SCV A;  4I5L B;  1TOP A;  3TS5 B;  1SL8 A;  1CFP A;  2KI4 B;  1CDL A;  4DUQ A;  2HQW A;  3BUO B;  4ZCU A;  1B47 A;  1NX3 A;  3TUY C;  4USL A;  4QJ4 B;  1KFU L;  1SKT A;  1DVI A;  1ODB A;  1GJY A;  1QVI Z;  1S6I A;  1CFD A;  1DF0 B;  3VRN A;  4ICB A;  1NSH A;  1MXE A;  4ORA B;  2MRD A;  1AVS A;  4PCW A;  4YGC B;  5F6T A;  3EVV A;  1JWD A;  1F55 A;  1K96 A;  2F3Z A;  3AKA A;  1NCY A;  1G8I A;  1K90 D;  1G4Y R;  1HT9 A;  4YGA A;  4ETO A;  1S6C A;  1LXF C;  4OR9 B;  1YVL A;  5BPJ A;  4MZK A;  1H8B A;  1W7I B;  5AEQ A;  1JUO A;  3QRX A;  1CTR A;  2M7N A;  2CXJ A;  3CR4 X;  3OB2 B;  1K9U A;  2I2R E;  3JTD B;  2LAP A;  2LVJ A;  1UUS A;  1DF0 A;  1A29 A;  1A4P A;  2Y1N A;  2LP3 A;  1TN4 A;  2M1K B;  3TDI A;  2F8P A;  4OV2 A;  2LMU A;  3SIA A;  2ZKM X;  1LVC D;  2KDH A;  5K89 A;  2LNK A;  1M63 B;  1R6P A;  1DJI A;  3EVU A;  4A4C A;  3DF0 B;  3I5I B;  3LK0 A;  3WHU B;  4BY4 A;  1KSM A;  2G9B A;  2K7O A;  2M49 B;  4OCI A;  3SG3 A;  1F54 A;  5D69 A;  5ER4 X;  2JXL A;  2L4H A;  1M39 A;  1M45 A;  1MXL C;  1QV1 A;  2JU0 A;  3CWG A;  3PFV A;  3BXK A;  3FWB A;  1TCF A;  1N65 A;  1BMO A;  1BT6 A;  1EXR A;  3F45 A;  2F3Y A;  4OKH A;  2ZNE A;  1KWO C;  1REC A;  2JRF A;  2JNX A;  4WQ3 A;  2JT3 A;  1YTZ C;  1N0Y A;  1SMG A;  2WND A;  4CFQ A;  3TZ1 A;  1JF2 A;  2NZ0 A;  2CCM A;  2KBI A;  1CM4 A;  2BL0 B;  2ZND A;  1PAL A;  4NQG A;  1L2O B;  5IBW A;  3GK4 X;  3BOW A;  1JSA A;  2GGM A;  4M2O A;  3PAT A;  1IQ5 A;  3O2P A;  1SBJ A;  1CLM A;  2BKI B;  2WOR A;  1UHH A;  1WRZ A;  4TNC A;  1J7O A;  2K7B A;  2SAS A;  1NX1 A;  4U8D A;  3O78 A;  3PN7 C;  1B1G A;  3KEV A;  3IQQ A;  2L98 A;  1YUR A;  2KOT A;  3OX5 A;  1QIW A;  5HKZ A;  3EK7 A;  5HKY A;  5AXI A;  4FTG A;  3BQ3 A;  4MLW A;  3CLN A;  4YBH B;  1UHJ A;  2MHH A;  1J1D A;  1Y1X A;  3JVT C;  3D0Y B;  1CB1 A;  1S3P A;  3DVJ A;  4JWQ A;  1OE9 B;  3TDU A;  1WLZ A;  4JQ0 D;  1MHO A;  5G08 A;  2JTZ A;  5I2L A;  1TCO B;  2H2K A;  1J55 A;  1KFU S;  4GGF A;  1CDN A;  1K8U A;  3CS1 A;  1BR4 B;  2WCE A;  1U5I A;  3D10 A;  4MRX A;  2JQ6 A;  1YX8 A;  4PHJ A;  1JFK A;  2KYF A;  1J1E A;  1ZOT B;  3GK1 A;  3KPX A;  1SCM B;  2VRG A;  3K21 A;  1SL9 A;  4MVF A;  2M7L A;  4NDD A;  1KK7 Z;  5KU1 A;  1SR6 B;  1PRW A;  5KSZ A;  1DTL A;  4HRG A;  5ER5 A;  2F33 A;  3BUW B;  5I8N A;  4I5N B;  2KGB C;  4A4B A;  2PMY A;  1DGU A;  4M2Q A;  1F8H A;  4PE1 A;  1OOJ A;  1NPQ A;  1IKU A;  2H61 A;  5HKW A;  2LHI A;  4BY5 A;  3RLZ A;  1AHR A;  3I5G B;  1CLL A;  2KAX A;  4ORB B;  3SG2 A;  3KF9 A;  3FS7 A;  1LIN A;  1Y1U A;  4PHN A;  1BR1 B;  3VRR A;  1JFJ A;  2MAZ A;  1KFX L;  3BUM B;  2WC8 A;  2KSP A;  2LAN A;  1OMD A;  1QAS A;  1NP8 A;  4YGB B;  1TNW A;  1XFW O;  1TIZ A;  3SG5 A;  1G33 A;  4AOM A;  3A8R A;  4GGF C;  1CDP A;  3NSK A;  4CLN A;  5AFP A;  1QXP A;  4CPV A;  4PE0 A;  3IF7 A;  1FF1 A;  1C7W A;  5DKQ A;  5CSI A;  4AQI A;  3AAJ A;  1CNP A;  1YUT A;  4WQ2 A;  1H4B A;  2EC6 C;  2OS8 B;  4DIR A;  1LA3 A;  4R1E A;  1CKK A;  1JBA A;  3ZWH A;  5GQQ C;  1N2D A;  1WDC B;  1K9P A;  2BBM A;  2A4J A;  2Q4U A;  2O60 A;  1DMO A;  2KQ6 A;  3BUX B;  1XK4 A;  3TDZ A;  2H61 C;  4F0Z B;  1S36 A;  1S26 D;  1XFX O;  4PAL A;  1M31 A;  3NSI A;  2R2I A;  2Q91 A;  1IGV A;  2Y1M A;  4YGD B;  1RJV A;  1ZMZ A;  2L51 A;  1KK7 Y;  2OTG B;  4N1G A;  4OVN F;  2M8U A;  2E6W A;  1V1G A;  1QLS A;  2CT9 A;  2GGZ A;  1KK8 B;  2LLS A;  1ZFS A;  2Y4Q A;  3MSE B;  3VGO A;  4P5O E;  2KHN A;  1DJG A;  1F71 A;  1A2X A;  1ZUZ A;  2KNE A;  2M29 A;  3PAL A;  2BCX A;  1RRO A;  1ALW A;  3I5F B;  1YX7 A;  1EG4 A;  1Y6W A;  2KFF A;  2HPS A;  1MWN A;  1HQV A;  1SL7 A;  4N5X A;  2G2B A;  1PVB A;  3TS5 C;  4YGE B;  1AUI B;  2KI4 C;  2DOQ A;  1B8C A;  1R2U A;  4FQO A;  3ICB A;  1GGZ A;  1XK4 C;  1UP5 A;  1TNQ A;  1PUL A;  2LVI A;  3OX6 A;  1UHK A;  5I2Q A;  2P6B B;  1GQM A;  3DF0 A;  1F4Q A;  3EK8 A;  2KFH A;  3CZT X;  1K95 A;  2ZN8 A;  3O4Y A;  4AQJ A;  2M9G A;  2NLN A;  5DKN A;  3M0W A;  1RTP 1;  1E8A A;  1C07 A;  2WCF A;  4UPG A;  5HYD A;  1SK6 D;  4JPZ B;  5HLO A;  1K93 D;  4DRW A;  3CR2 A;  2FCD A;  2E30 A;  5TNC A;  4GNK B;  1QX7 A;  2HF5 A;  1IJ5 A;  3SJS A;  3LL8 B;  3LCP C;  2M1U A;  1YUU A;  3JTD C;  4PHK A;  5CPV A;  3FWC A;  2K8M B;  1UWO A;  4C0K A;  4N1F A;  1YUS A;  2FOT A;  2PRU A;  1NIW A;  2FCE A;  3WNX B;  5I2O A;  1WRL A;  1J7Q A;  5CSN A;  2CNP A;  2JWW A;  4GFT A;  3E3R A;  1TTX A;  2CTN A;  3C1V A;  1DGV A;  4GAO A;  2NCP A;  4CFR A;  1ZAC A;  1YR5 A;  3O6B A;  1TNX A;  3TUY B;  4DS7 A;  4XJK B;  3I5I C;  1KFX S;  3SG6 A;  2LVV A;  2PAL A;  1L7Z A;  1A75 B;  1V1F A;  1S1E A;  2BEC A;  2I18 A;  2ZRS A;  1OMV A;  3WXA A;  5CSF A;  1AK8 A;  2JPT A;  2QAC A;  2MBX A;  4YI9 A;  4QJ5 B;  1B9A A;  2BE6 A;  1CMF A;  1SNL A;  3PM8 A;  1RFJ A;  1PK0 D;  4M2P A;  1XA5 A;  2LP2 A;  1QJT A;  2K7C A;  3D0Y A;  2GV5 A;  4MEW A;  1KQV A;  2LE9 B;  1F70 A;  1XFV O;  1ALV A;  2JC2 A;  5D7F A;  4YRU A;  4I5K A;  1BG1 A;  2BL0 C;  5PAL A;  1XO5 A;  2JUL A;  3DVK A;  1A75 A;  1L2O C;  2K61 A;  4Q04 A;  3DVE A;  1UHN A;  3PSR A;  5CSJ A;  2I94 A;  1CLB A;  1MF8 B;  3KO0 A;  2LVK A;  1Y1A A;  1YVH A;  4NDB A;  5AAN A;  1AP4 A;  1AJ4 A;  1OZO A;  3ZNI A;  3I5H B;  1EJ3 A;  4MRY A;  2ZFD A;  3AKB A;  3FIA A; 
#chains in the Genus database with same CATH topology
 2MJW B;  2KI6 C;  4HRH A;  1WLM A;  2LC5 A;  2L50 A;  2BCA A;  2MA2 A;  1EH2 A;  1K9K A;  1PSR A;  2JXC A;  2K2A A;  1B7T Y;  1IH0 A;  2L5X B;  2QEH A;  3D77 A;  5JOL A;  1CDM A;  3BYA A;  5FYX A;  3EK4 A;  3HX4 A;  1SYM A;  2L2E A;  5JJG A;  2LCP A;  2KAY A;  3VRP A;  1IQ3 A;  1DT7 B;  1PVA A;  1NUB A;  1KWO B;  1X02 A;  3LLE A;  1DJZ A;  4PE7 A;  2KYC A;  1TUZ A;  2WCL A;  1FBV A;  1C3Z A;  1BU3 A;  1JC2 A;  1S5G Z;  3NXA A;  4YI8 A;  1QX2 A;  1OMR A;  2BBN A;  2D8N A;  3IVT A;  3LK1 A;  2F2O A;  1KCY A;  2KFG A;  3BFA A;  2JT0 A;  2V53 A;  2Y5I A;  3A4U B;  1FI5 A;  4ORC B;  5EL2 A;  3OHM B;  1BLQ A;  4PHJ A;  1NCX A;  1SCM C;  2LMT A;  3R1O A;  1BOD A;  1IG5 A;  2JT8 A;  2LV7 A;  1W7J B;  1SR6 C;  2QPT A;  1SW8 A;  1C3Y A;  4ZCV A;  1B8L A;  1CFF A;  3UO9 A;  3SIB A;  1D1O A;  1KQM B;  3Q8I A;  1IRJ A;  3D75 A;  1QV0 A;  1OSA A;  3PN7 B;  4GUK A;  1CMG A;  3BUN B;  3CAB A;  2LUC A;  1IJ6 A;  1K2H A;  1VRK A;  2O5G A;  3HCM A;  1FPW A;  3NSL A;  2KI6 D;  2KAV A;  4PDZ A;  2M97 A;  4QJ3 B;  1EG3 A;  1RK9 A;  3I5G C;  2KGR A;  4HSZ A;  1PSB A;  2NCO A;  2EHB A;  2M0R A;  3DY9 A;  1C7V A;  1QIV A;  2WCJ A;  3PLF B;  1YRT B;  2F2P A;  3JVT B;  3D78 A;  1J7R A;  3SG4 A;  2IS9 A;  1B4C A;  3I5H C;  2BE4 A;  2M3W A;  3CR5 X;  4MN0 A;  2LLU A;  2WCB A;  2JZI A;  1FI6 A;  1XFY O;  2HQ8 A;  2LMV A;  1DJH A;  3NGV A;  1W9Z A;  2FJU B;  2LUX A;  3BOW B;  1UUR A;  2HET A;  5HLV A;  1QTX A;  4OZD A;  3IQO A;  2OS8 C;  3EKJ A;  1LA0 A;  1DJW A;  2K2F A;  1WY9 A;  1NCZ A;  1WDC C;  3B7A A;  1WRK A;  1DJX A;  3KHE A;  2SCP A;  2RGI A;  1GGW A;  2COL B;  1S5G Y;  2K7D A;  2MLF C;  5J3X A;  4PHM A;  1QVI Y;  1BF5 A;  2JOJ A;  1J7P A;  4C0J A;  2MLE C;  3OBV A;  3OP0 A;  1QLK A;  1OW4 A;  1SY9 A;  1NWD A;  4P2Y B;  3CZ1 A;  2CBL A;  4MZJ A;  1TNP A;  2KQY A;  1IWQ A;  2OTG C;  3H4S E;  4C0L A;  1B7T Z;  1TRF A;  1XFU O;  3DD4 A;  5B8I B;  2K60 A;  2YGU A;  2JNF A;  3NSO A;  1KK8 C;  4PE4 A;  3DVM A;  1YRU B;  2WOS A;  4GPL B;  3OB1 B;  1ORG A;  3FE8 A;  1KQM C;  3GOF A;  1NYA A;  3AAK A;  4L9M A;  1SPY A;  1XVJ A;  1QS7 A;  3VRQ A;  2LM5 A;  3CTN A;  4E68 A;  2P71 A;  2EGD A;  3L4L A;  1SRA A;  2PSR A;  1U5I B;  2B1U A;  2ZN9 A;  2KBM A;  4I5J A;  3FE6 A;  2TN4 A;  4D1E A;  3I5F C;  4NDC A;  1A03 A;  3R1P A;  4MBE A;  2ISD A;  2AAO A;  2BNX A;  3DZT A;  1OQP A;  1Q80 A;  2L4I A;  2EC6 B;  4IL1 A;  2AUC A;  1AJ5 A;  2KPH A;  4GGN A;  3S0D A;  2BCB A;  1KSO A;  1MR8 A;  3EKH A;  3GK2 A;  1NX0 A;  5I94 A;  3S0E A;  3EVR A;  4XYN A;  5KTY A;  1Y0V H;  1K94 A;  2JPO A;  4MZL A;  2AMI A;  1CM1 A;  4FQT A;  4XJK A;  3RM1 A;  2JTT A;  2OPO A;  1LKJ A;  4GBA A;  2LHL A;  1S6J A;  3PJI A;  5DKR A;  4INW A;  3CGA A;  3DXL A;  2K0J A;  1QAT A;  1JF0 A;  1RWY A;  2LLT A;  3VRO A;  1FW4 A;  2I7A A;  4DCK A;  1XFZ O;  2ZRT A;  4WRI A;  1EL4 A;  2PVB A;  1DJY A;  5AER A;  1OZS A;  1XYD A;  2BKH B;  4HRE E;  2L0P A;  2PYQ A;  1M46 A;  3SG7 A;  1B8R A;  2FJY A;  1BOC A;  1UHI A;  1NX2 A;  1BJF A;  1MUX A;  1F4O A;  5FI2 A;  1QX5 B;  2PAS A;  3R72 A;  1MQ1 A;  3WHT B;  4MSP A;  2NXQ A;  1XFR A;  4CID A;  1CFC A;  1SSE B;  1SCV A;  2WCK A;  4I5L B;  1TOP A;  3TS5 B;  5FI6 A;  1SL8 A;  3SS4 A;  1CFP A;  2KI4 B;  1CDL A;  4DUQ A;  2HQW A;  3BUO B;  4ZCU A;  1B47 A;  1NX3 A;  3TUY C;  4USL A;  4QJ4 B;  1KFU L;  1SKT A;  1DVI A;  1ODB A;  3L4A A;  1GJY A;  1QVI Z;  1S6I A;  1CFD A;  1DF0 B;  3VRN A;  4ICB A;  1NSH A;  1MXE A;  4ORA B;  2MRD A;  1AVS A;  4PCW A;  4YGC B;  5F6T A;  3EVV A;  1JWD A;  3BJH A;  1F55 A;  1K96 A;  2F3Z A;  3AKA A;  1NCY A;  1G8I A;  4INX A;  1K90 D;  1G4Y R;  1HT9 A;  4YGA A;  4ETO A;  1S6C A;  1LXF C;  4OR9 B;  1YVL A;  1DEK A;  5BPJ A;  4MZK A;  1H8B A;  3CYZ A;  1W7I B;  5AEQ A;  1JUO A;  3QRX A;  1CTR A;  2M7N A;  2CXJ A;  3CR4 X;  3OB2 B;  1K9U A;  2I2R E;  3JTD B;  2LAP A;  2LVJ A;  1UUS A;  1DF0 A;  1A29 A;  1A4P A;  2Y1N A;  2LP3 A;  1TN4 A;  2M1K B;  2H8V A;  2QDI A;  3TDI A;  2F8P A;  4OV2 A;  2LMU A;  3K1E A;  5FI7 A;  3SIA A;  2ZKM X;  1LVC D;  2KDH A;  3DYE A;  5K89 A;  4PT1 A;  2LNK A;  1GM0 A;  3BFB A;  1M63 B;  1R6P A;  1DJI A;  3EVU A;  4A4C A;  3S0A A;  3DF0 B;  3I5I B;  3LK0 A;  4KYN A;  3PM2 A;  3WHU B;  4BY4 A;  1KSM A;  2G9B A;  2K7O A;  2M49 B;  4OCI A;  3SG3 A;  1F54 A;  5D69 A;  5ER4 X;  2JXL A;  2L4H A;  1M39 A;  1M45 A;  1MXL C;  1QV1 A;  2JU0 A;  3CWG A;  3OGN A;  3BXK A;  3FWB A;  1TCF A;  1N65 A;  3PFV A;  1BMO A;  1BT6 A;  2WCH A;  1EXR A;  3F45 A;  2F3Y A;  4OKH A;  2ZNE A;  1KWO C;  1REC A;  2JRF A;  3S0G A;  2JNX A;  4WQ3 A;  2JT3 A;  1YTZ C;  1N0Y A;  1SMG A;  2QEB A;  2WND A;  4JKT A;  3SS3 A;  4CFQ A;  3TZ1 A;  1JF2 A;  2NZ0 A;  2CCM A;  2KBI A;  1CM4 A;  2BL0 B;  1DEL A;  2ZND A;  1PAL A;  4NQG A;  1IIO A;  1Z2C B;  1L2O B;  5IBW A;  3GK4 X;  3BOW A;  1JSA A;  2GGM A;  4M2O A;  1TWO A;  3PAT A;  1IQ5 A;  3O2P A;  1SBJ A;  1CLM A;  2BKI B;  2WOR A;  1UHH A;  1WRZ A;  3B88 A;  4TNC A;  3V2L A;  1J7O A;  2K7B A;  2SAS A;  1NX1 A;  4U8D A;  3O78 A;  3PN7 C;  1B1G A;  3KEV A;  1LS8 A;  3IQQ A;  2L98 A;  1YUR A;  2KOT A;  3OX5 A;  1QIW A;  5HKZ A;  3EK7 A;  5HKY A;  1TUJ A;  5AXI A;  4FTG A;  3BQ3 A;  4MLW A;  3CLN A;  1OOI X;  4YBH B;  1UHJ A;  2MHH A;  1J1D A;  1Y1X A;  3CZ0 A;  3JVT C;  3D0Y B;  1CB1 A;  1S3P A;  3DVJ A;  4JWQ A;  1OE9 B;  3TDU A;  2P70 A;  1WLZ A;  4JQ0 D;  1MHO A;  5G08 A;  2JTZ A;  2KLE A;  1TCO B;  3L47 A;  5I2L A;  2H2K A;  1J55 A;  1KFU S;  4GGF A;  1CDN A;  1K8U A;  3CS1 A;  1BR4 B;  2WCE A;  1U5I A;  3D10 A;  4MRX A;  2JQ6 A;  1YX8 A;  2L5Y A;  1JFK A;  2KYF A;  1J1E A;  1ZOT B;  3GK1 A;  3KPX A;  1SCM B;  2VRG A;  3K21 A;  1SL9 A;  4MVF A;  2M7L A;  4NDD A;  1KK7 Z;  1OOH A;  1SR6 B;  5KU1 A;  1PRW A;  5KSZ A;  1DTL A;  4HRG A;  3B86 A;  1DC1 A;  5HL1 A;  3UNW A;  5ER5 A;  2F33 A;  3BUW B;  5I8N A;  2KLD A;  4I5N B;  2KGB C;  3D73 A;  4A4B A;  2PMY A;  1DGU A;  4M2Q A;  1F8H A;  4PE1 A;  1OOJ A;  1NPQ A;  1IKU A;  2H61 A;  5HKW A;  2LHI A;  4BY5 A;  3RLZ A;  1AHR A;  3I5G B;  1CLL A;  2KAX A;  4ORB B;  3SG2 A;  3KF9 A;  3FS7 A;  1LIN A;  1Y1U A;  4PHN A;  1BR1 B;  3VRR A;  1JFJ A;  3S0B A;  2MAZ A;  1KFX L;  3BUM B;  2WC8 A;  2KSP A;  2LAN A;  1OMD A;  1QAS A;  1NP8 A;  4YGB B;  1TNW A;  1XFW O;  1TIZ A;  3SG5 A;  1G33 A;  4AOM A;  3A8R A;  4GGF C;  1CDP A;  3NSK A;  4CLN A;  5AFP A;  1QXP A;  4CPV A;  4PE0 A;  3IF7 A;  3R1V A;  1FF1 A;  1C7W A;  5DKQ A;  5CSI A;  4AQI A;  3AAJ A;  1CNP A;  1YUT A;  4WQ2 A;  1H4B A;  2EC6 C;  2L2C A;  2OS8 B;  4DIR A;  1LA3 A;  4R1E A;  1CKK A;  1JBA A;  3ZWH A;  5GQQ C;  1N2D A;  1WDC B;  3NHI A;  1K9P A;  2BBM A;  2A4J A;  1OOG A;  2Q4U A;  2O60 A;  1DMO A;  2KQ6 A;  3BUX B;  1XK4 A;  3TDZ A;  2H61 C;  4F0Z B;  1S36 A;  1S26 D;  1XFX O;  4PAL A;  1M31 A;  3NSI A;  2R2I A;  2Q91 A;  1IGV A;  2Y1M A;  4YGD B;  1OOF A;  1RJV A;  1ZMZ A;  2L51 A;  1KK7 Y;  2OTG B;  4N1G A;  4OVN F;  2M8U A;  2E6W A;  1V1G A;  1QLS A;  2CT9 A;  2GGZ A;  3N7H A;  1KK8 B;  2LLS A;  3D74 A;  1ZFS A;  2Y4Q A;  3BFH A;  3MSE B;  3VGO A;  4P5O E;  3S0F A;  2KHN A;  1DJG A;  1F71 A;  3B87 A;  1A2X A;  2WC5 A;  1ZUZ A;  2KNE A;  2M29 A;  2WC6 A;  3PAL A;  2BCX A;  1RRO A;  1ALW A;  3I5F B;  1YX7 A;  1EG4 A;  1Y6W A;  2KFF A;  3VB1 A;  2HPS A;  1MWN A;  1HQV A;  1SL7 A;  4N5X A;  2G2B A;  1PVB A;  3TS5 C;  4YGE B;  1AUI B;  2KI4 C;  2DOQ A;  1B8C A;  3CDN A;  1R2U A;  4FQO A;  3ICB A;  2PQL A;  1GGZ A;  3NHT A;  3EG5 B;  1XK4 C;  1UP5 A;  1TNQ A;  1PUL A;  2LVI A;  3OX6 A;  1UHK A;  5I2Q A;  4JD9 A;  2P6B B;  1GQM A;  3DF0 A;  1F4Q A;  3EK8 A;  2KFH A;  3CZT X;  1K95 A;  2ZN8 A;  3O4Y A;  4AQJ A;  2M9G A;  2NLN A;  5DKN A;  3M0W A;  1RTP 1;  1E8A A;  3RZS A;  1C07 A;  2WCF A;  4UPG A;  5HYD A;  1SK6 D;  4JPZ B;  5HLO A;  1K93 D;  2QEV A;  4DRW A;  3CR2 A;  2FCD A;  2E30 A;  2WCM A;  3FE9 A;  4GNK B;  5TNC A;  1QX7 A;  2HF5 A;  3O4X A;  4F7F A;  1IJ5 A;  3SJS A;  3LL8 B;  3LCP C;  2M1U A;  1YUU A;  1P28 A;  3JTD C;  4PHK A;  5CPV A;  3FWC A;  2K8M B;  1UWO A;  5D3O A;  4C0K A;  4N1F A;  1YUS A;  2FOT A;  2PRU A;  1NIW A;  2FCE A;  3WNX B;  5I2O A;  1WRL A;  1J7Q A;  5CSN A;  2CNP A;  2JWW A;  4GFT A;  3E3R A;  1T14 A;  1TTX A;  2CTN A;  3C1V A;  1DGV A;  4GAO A;  2NCP A;  4CFR A;  1QWV A;  1YR5 A;  1ZAC A;  3O6B A;  1TNX A;  3B6X A;  3TUY B;  4DS7 A;  4XJK B;  2GTE A;  3I5I C;  1KFX S;  3SG6 A;  2LVV A;  2PAL A;  1L7Z A;  1A75 B;  3QME A;  1V1F A;  1S1E A;  2BEC A;  2I18 A;  2ZRS A;  2ERB A;  3D76 A;  1OMV A;  3WXA A;  5CSF A;  1AK8 A;  2JPT A;  2QAC A;  2MBX A;  4YI9 A;  4QJ5 B;  1B9A A;  2BE6 A;  1CMF A;  1SNL A;  3PM8 A;  1RFJ A;  1PK0 D;  4M2P A;  1XA5 A;  2LP2 A;  1QJT A;  2K7C A;  3D0Y A;  2GV5 A;  4MEW A;  1KQV A;  2LE9 B;  1F70 A;  1XFV O;  1ALV A;  2JC2 A;  5D7F A;  4YRU A;  4I5K A;  1BG1 A;  2BL0 C;  5PAL A;  3SS5 A;  1XO5 A;  2JUL A;  5DIC A;  3DVK A;  1A75 A;  1L2O C;  2K61 A;  4Q04 A;  3CZ2 A;  3DVE A;  1UHN A;  3PSR A;  5CSJ A;  2I94 A;  1CLB A;  1MF8 B;  3KO0 A;  2LVK A;  1Y1A A;  1YVH A;  1Z4H A;  4NDB A;  2BAP A;  5AAN A;  1AP4 A;  1AJ4 A;  1OZO A;  3ZNI A;  2QEO A;  3I5H B;  1EJ3 A;  4MRY A;  4IJ7 A;  1DQE A;  2ZFD A;  3AKB A;  3FIA A; 
#chains in the Genus database with same CATH homology
 2MJW B;  2KI6 C;  4HRH A;  1WLM A;  2LC5 A;  2L50 A;  2BCA A;  2MA2 A;  1EH2 A;  1K9K A;  1PSR A;  2JXC A;  2K2A A;  1B7T Y;  1IH0 A;  2L5X B;  5JOL A;  1CDM A;  3BYA A;  5FYX A;  3EK4 A;  3HX4 A;  1SYM A;  2L2E A;  5JJG A;  2LCP A;  2KAY A;  3VRP A;  1IQ3 A;  1DT7 B;  1PVA A;  1NUB A;  1KWO B;  1X02 A;  3LLE A;  1DJZ A;  4PE7 A;  2KYC A;  1FBV A;  1JC2 A;  1BU3 A;  1S5G Z;  3NXA A;  4YI8 A;  1QX2 A;  1OMR A;  2BBN A;  2D8N A;  1KCY A;  3LK1 A;  2F2O A;  2KFG A;  2JT0 A;  2V53 A;  2Y5I A;  3A4U B;  1FI5 A;  4ORC B;  3OHM B;  1BLQ A;  1NCX A;  1SCM C;  2LMT A;  1BOD A;  1IG5 A;  2JT8 A;  2LV7 A;  1W7J B;  1SR6 C;  2QPT A;  1SW8 A;  4ZCV A;  1B8L A;  1CFF A;  3SIB A;  1D1O A;  1KQM B;  1IRJ A;  1QV0 A;  1OSA A;  3PN7 B;  4GUK A;  1CMG A;  3BUN B;  2LUC A;  1IJ6 A;  1K2H A;  1VRK A;  2O5G A;  3HCM A;  1FPW A;  3NSL A;  2KI6 D;  2KAV A;  4PDZ A;  2M97 A;  4QJ3 B;  1EG3 A;  1RK9 A;  3I5G C;  2KGR A;  4HSZ A;  1PSB A;  2NCO A;  2EHB A;  2M0R A;  1C7V A;  1QIV A;  3PLF B;  1YRT B;  2F2P A;  3JVT B;  1J7R A;  3SG4 A;  2IS9 A;  1B4C A;  3I5H C;  2BE4 A;  2M3W A;  3CR5 X;  4MN0 A;  2LLU A;  2WCB A;  2JZI A;  1FI6 A;  1XFY O;  2HQ8 A;  2LMV A;  1DJH A;  2FJU B;  2LUX A;  3BOW B;  1UUR A;  2HET A;  5HLV A;  1QTX A;  3IQO A;  2OS8 C;  3EKJ A;  1LA0 A;  1DJW A;  2K2F A;  1WY9 A;  1NCZ A;  1WDC C;  1WRK A;  1DJX A;  3KHE A;  2SCP A;  2RGI A;  1GGW A;  2COL B;  1S5G Y;  2K7D A;  2MLF C;  5J3X A;  4PHM A;  1QVI Y;  1BF5 A;  2JOJ A;  1J7P A;  4C0J A;  2MLE C;  3OP0 A;  1QLK A;  1SY9 A;  1NWD A;  4P2Y B;  2CBL A;  4MZJ A;  1TNP A;  2KQY A;  1IWQ A;  2OTG C;  3H4S E;  4C0L A;  1B7T Z;  1TRF A;  1XFU O;  3DD4 A;  5B8I B;  4PE4 A;  2JNF A;  3NSO A;  1KK8 C;  3DVM A;  1YRU B;  2WOS A;  4GPL B;  3OB1 B;  1KQM C;  3GOF A;  1NYA A;  3AAK A;  4L9M A;  1SPY A;  1XVJ A;  1QS7 A;  3VRQ A;  2LM5 A;  3CTN A;  4E68 A;  2EGD A;  1SRA A;  2PSR A;  1U5I B;  2B1U A;  2ZN9 A;  2KBM A;  4I5J A;  4D1E A;  2TN4 A;  3I5F C;  4NDC A;  1A03 A;  2ISD A;  4MBE A;  2AAO A;  1OQP A;  1Q80 A;  2L4I A;  2EC6 B;  4IL1 A;  2AUC A;  1AJ5 A;  4GGN A;  2BCB A;  1KSO A;  1MR8 A;  3EKH A;  3GK2 A;  1NX0 A;  3EVR A;  4XYN A;  5KTY A;  1Y0V H;  1K94 A;  4MZL A;  2AMI A;  1CM1 A;  4XJK A;  3RM1 A;  2JTT A;  2OPO A;  1LKJ A;  4GBA A;  2LHL A;  1S6J A;  5DKR A;  3CGA A;  2K0J A;  1QAT A;  1JF0 A;  1RWY A;  2LLT A;  3VRO A;  1FW4 A;  2I7A A;  4DCK A;  1XFZ O;  2ZRT A;  4WRI A;  1EL4 A;  2PVB A;  1DJY A;  5AER A;  1OZS A;  1XYD A;  2BKH B;  4HRE E;  2L0P A;  1M46 A;  3SG7 A;  1B8R A;  1BOC A;  1UHI A;  1NX2 A;  1BJF A;  1MUX A;  1F4O A;  1QX5 B;  2PAS A;  1MQ1 A;  3WHT B;  4MSP A;  2NXQ A;  4CID A;  1CFC A;  1SCV A;  4I5L B;  1TOP A;  3TS5 B;  1SL8 A;  1CFP A;  2KI4 B;  1CDL A;  4DUQ A;  2HQW A;  3BUO B;  4ZCU A;  1B47 A;  1NX3 A;  3TUY C;  4USL A;  4QJ4 B;  1KFU L;  1SKT A;  1DVI A;  1ODB A;  1GJY A;  1QVI Z;  1S6I A;  1CFD A;  1DF0 B;  3VRN A;  4ICB A;  1NSH A;  1MXE A;  4ORA B;  2MRD A;  1AVS A;  4PCW A;  4YGC B;  5F6T A;  3EVV A;  1JWD A;  1F55 A;  1K96 A;  2F3Z A;  3AKA A;  1NCY A;  1G8I A;  1K90 D;  1G4Y R;  1HT9 A;  4YGA A;  4ETO A;  1S6C A;  1LXF C;  4OR9 B;  1YVL A;  5BPJ A;  4MZK A;  1H8B A;  1W7I B;  5AEQ A;  1JUO A;  3QRX A;  1CTR A;  2M7N A;  2CXJ A;  3CR4 X;  3OB2 B;  1K9U A;  2I2R E;  3JTD B;  2LAP A;  2LVJ A;  1UUS A;  1DF0 A;  1A29 A;  1A4P A;  2Y1N A;  2LP3 A;  1TN4 A;  2M1K B;  3TDI A;  2F8P A;  4OV2 A;  2LMU A;  3SIA A;  2ZKM X;  1LVC D;  2KDH A;  5K89 A;  2LNK A;  1M63 B;  1R6P A;  1DJI A;  3EVU A;  4A4C A;  3DF0 B;  3I5I B;  3LK0 A;  3WHU B;  4BY4 A;  1KSM A;  2G9B A;  2K7O A;  2M49 B;  4OCI A;  3SG3 A;  1F54 A;  5D69 A;  5ER4 X;  2JXL A;  2L4H A;  1M39 A;  1M45 A;  1MXL C;  1QV1 A;  2JU0 A;  3CWG A;  3PFV A;  3BXK A;  3FWB A;  1TCF A;  1N65 A;  1BMO A;  1BT6 A;  1EXR A;  3F45 A;  2F3Y A;  4OKH A;  2ZNE A;  1KWO C;  1REC A;  2JRF A;  2JNX A;  4WQ3 A;  2JT3 A;  1YTZ C;  1N0Y A;  1SMG A;  2WND A;  4CFQ A;  3TZ1 A;  1JF2 A;  2NZ0 A;  2CCM A;  2KBI A;  1CM4 A;  2BL0 B;  2ZND A;  1PAL A;  4NQG A;  1L2O B;  5IBW A;  3GK4 X;  3BOW A;  1JSA A;  2GGM A;  4M2O A;  3PAT A;  1IQ5 A;  3O2P A;  1SBJ A;  1CLM A;  2BKI B;  2WOR A;  1UHH A;  1WRZ A;  4TNC A;  1J7O A;  2K7B A;  2SAS A;  1NX1 A;  4U8D A;  3O78 A;  3PN7 C;  1B1G A;  3KEV A;  3IQQ A;  2L98 A;  1YUR A;  2KOT A;  3OX5 A;  1QIW A;  5HKZ A;  3EK7 A;  5HKY A;  5AXI A;  4FTG A;  3BQ3 A;  4MLW A;  3CLN A;  4YBH B;  1UHJ A;  2MHH A;  1J1D A;  1Y1X A;  3JVT C;  3D0Y B;  1CB1 A;  1S3P A;  3DVJ A;  4JWQ A;  1OE9 B;  3TDU A;  1WLZ A;  4JQ0 D;  1MHO A;  5G08 A;  2JTZ A;  5I2L A;  1TCO B;  2H2K A;  1J55 A;  1KFU S;  4GGF A;  1CDN A;  1K8U A;  3CS1 A;  1BR4 B;  2WCE A;  1U5I A;  3D10 A;  4MRX A;  2JQ6 A;  1YX8 A;  4PHJ A;  1JFK A;  2KYF A;  1J1E A;  1ZOT B;  3GK1 A;  3KPX A;  1SCM B;  2VRG A;  3K21 A;  1SL9 A;  4MVF A;  2M7L A;  4NDD A;  1KK7 Z;  5KU1 A;  1SR6 B;  1PRW A;  5KSZ A;  1DTL A;  4HRG A;  5ER5 A;  2F33 A;  3BUW B;  5I8N A;  4I5N B;  2KGB C;  4A4B A;  2PMY A;  1DGU A;  4M2Q A;  1F8H A;  4PE1 A;  1OOJ A;  1NPQ A;  1IKU A;  2H61 A;  5HKW A;  2LHI A;  4BY5 A;  3RLZ A;  1AHR A;  3I5G B;  1CLL A;  2KAX A;  4ORB B;  3SG2 A;  3KF9 A;  3FS7 A;  1LIN A;  1Y1U A;  4PHN A;  1BR1 B;  3VRR A;  1JFJ A;  2MAZ A;  1KFX L;  3BUM B;  2WC8 A;  2KSP A;  2LAN A;  1OMD A;  1QAS A;  1NP8 A;  4YGB B;  1TNW A;  1XFW O;  1TIZ A;  3SG5 A;  1G33 A;  4AOM A;  3A8R A;  4GGF C;  1CDP A;  3NSK A;  4CLN A;  5AFP A;  1QXP A;  4CPV A;  4PE0 A;  3IF7 A;  1FF1 A;  1C7W A;  5DKQ A;  5CSI A;  4AQI A;  3AAJ A;  1CNP A;  1YUT A;  4WQ2 A;  1H4B A;  2EC6 C;  2OS8 B;  4DIR A;  1LA3 A;  4R1E A;  1CKK A;  1JBA A;  3ZWH A;  5GQQ C;  1N2D A;  1WDC B;  1K9P A;  2BBM A;  2A4J A;  2Q4U A;  2O60 A;  1DMO A;  2KQ6 A;  3BUX B;  1XK4 A;  3TDZ A;  2H61 C;  4F0Z B;  1S36 A;  1S26 D;  1XFX O;  4PAL A;  1M31 A;  3NSI A;  2R2I A;  2Q91 A;  1IGV A;  2Y1M A;  4YGD B;  1RJV A;  1ZMZ A;  2L51 A;  1KK7 Y;  2OTG B;  4N1G A;  4OVN F;  2M8U A;  2E6W A;  1V1G A;  1QLS A;  2CT9 A;  2GGZ A;  1KK8 B;  2LLS A;  1ZFS A;  2Y4Q A;  3MSE B;  3VGO A;  4P5O E;  2KHN A;  1DJG A;  1F71 A;  1A2X A;  1ZUZ A;  2KNE A;  2M29 A;  3PAL A;  2BCX A;  1RRO A;  1ALW A;  3I5F B;  1YX7 A;  1EG4 A;  1Y6W A;  2KFF A;  2HPS A;  1MWN A;  1HQV A;  1SL7 A;  4N5X A;  2G2B A;  1PVB A;  3TS5 C;  4YGE B;  1AUI B;  2KI4 C;  2DOQ A;  1B8C A;  1R2U A;  4FQO A;  3ICB A;  1GGZ A;  1XK4 C;  1UP5 A;  1TNQ A;  1PUL A;  2LVI A;  3OX6 A;  1UHK A;  5I2Q A;  2P6B B;  1GQM A;  3DF0 A;  1F4Q A;  3EK8 A;  2KFH A;  3CZT X;  1K95 A;  2ZN8 A;  3O4Y A;  4AQJ A;  2M9G A;  2NLN A;  5DKN A;  3M0W A;  1RTP 1;  1E8A A;  1C07 A;  2WCF A;  4UPG A;  5HYD A;  1SK6 D;  4JPZ B;  5HLO A;  1K93 D;  4DRW A;  3CR2 A;  2FCD A;  2E30 A;  5TNC A;  4GNK B;  1QX7 A;  2HF5 A;  1IJ5 A;  3SJS A;  3LL8 B;  3LCP C;  2M1U A;  1YUU A;  3JTD C;  4PHK A;  5CPV A;  3FWC A;  2K8M B;  1UWO A;  4C0K A;  4N1F A;  1YUS A;  2FOT A;  2PRU A;  1NIW A;  2FCE A;  3WNX B;  5I2O A;  1WRL A;  1J7Q A;  5CSN A;  2CNP A;  2JWW A;  4GFT A;  3E3R A;  1TTX A;  2CTN A;  3C1V A;  1DGV A;  4GAO A;  2NCP A;  4CFR A;  1ZAC A;  1YR5 A;  3O6B A;  1TNX A;  3TUY B;  4DS7 A;  4XJK B;  3I5I C;  1KFX S;  3SG6 A;  2LVV A;  2PAL A;  1L7Z A;  1A75 B;  1V1F A;  1S1E A;  2BEC A;  2I18 A;  2ZRS A;  1OMV A;  3WXA A;  5CSF A;  1AK8 A;  2JPT A;  2QAC A;  2MBX A;  4YI9 A;  4QJ5 B;  1B9A A;  2BE6 A;  1CMF A;  1SNL A;  3PM8 A;  1RFJ A;  1PK0 D;  4M2P A;  1XA5 A;  2LP2 A;  1QJT A;  2K7C A;  3D0Y A;  2GV5 A;  4MEW A;  1KQV A;  2LE9 B;  1F70 A;  1XFV O;  1ALV A;  2JC2 A;  5D7F A;  4YRU A;  4I5K A;  1BG1 A;  2BL0 C;  5PAL A;  1XO5 A;  2JUL A;  3DVK A;  1A75 A;  1L2O C;  2K61 A;  4Q04 A;  3DVE A;  1UHN A;  3PSR A;  5CSJ A;  2I94 A;  1CLB A;  1MF8 B;  3KO0 A;  2LVK A;  1Y1A A;  1YVH A;  4NDB A;  5AAN A;  1AP4 A;  1AJ4 A;  1OZO A;  3ZNI A;  3I5H B;  1EJ3 A;  4MRY A;  2ZFD A;  3AKB A;  3FIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...