1SR6B

Structure of nucleotide-free scallop myosin s1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
144
structure length
144
Chain Sequence
PQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKGSGEEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords Myosin heavy chain, striated muscle
publication title Myosin subfragment 1 structures reveal a partially bound nucleotide and a complex salt bridge that helps couple nucleotide and actin binding.
pubmed doi rcsb
total genus 18
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2004-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1sr6B01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1sr6B02
2JPTA 1DF0B 4MZKA 1CMGA 1C7WA 2OS8C 2QACA 4OVNF 1GQMA 3IQQA 1BR1B 2LLUA 3DF0B 1RFJA 3CGAA 1S6IA 2AMIA 4YGCB 1KWOC 2BBNA 2LHIA 2QPTA 1IWQA 1BODA 3PFVA 2BCXA 3D0YB 2ZN8A 4OR9B 1W7JB 5CSFA 4XJKA 1J1DA 2EC6B 4AQIA 2K61A 2M7NA 2AUCA 3PN7B 1BG1A 1J7QA 4A4CA 1BMOA 1JSAA 3I5GB 4HRGA 4HREE 1ZACA 1TNPA 4NDDA 3OX6A 3WHUB 1IRJA 3CZTX 1FF1A 2KQ6A 1K94A 3BQ3A 1KFXS 3BUOB 4M2OA 1SL8A 2HF5A 1XFYO 4MN0A 1A29A 1K90D 4C0KA 3CWGA 3TDZA 1CDNA 2JT3A 2KI4B 2E30A 1DJZA 2KOTA 1SMGA 4ZCUA 4OKHA 1RJVA 1DTLA 1YR5A 1FPWA 2FCDA 1DJWA 2M7LA 1B7TY 3AKAA 1QLKA 3DVEA 1EH2A 2CXJA 1F4OA 1XK4A 4YGAA 1YUTA 2WCFA 5BPJA 4PCWA 2A4JA 2H2KA 2Q91A 2WOSA 3I5FB 2AAOA 3O2PA 4ORAB 4PHKA 3BUMB 1QX2A 2BCAA 3GK1A 1B9AA 3OHMB 3EVUA 2D8NA 1K93D 1ODBA 2K2FA 1JWDA 2LMUA 2I94A 2Y1MA 2BBMA 2ZNEA 2BCBA 1QVIY 4HRHA 1NP8A 1CM4A 1AJ5A 4MZLA 4I5KA 2COLB 4CPVA 2M3WA 2LNKA 5KTYA 1AP4A 4ETOA 3CR2A 2JTTA 2KGRA 2LVKA 3CS1A 3FS7A 3CR5X 5G08A 3VGOA 4XJKB 2KSPA 1S6JA 1M31A 2V53A 1DMOA 1WLZA 1RTP1 1PK0D 1S36A 5D7FA 3SG5A 1WDCB 1SRAA 2I18A 2JNXA 1G33A 2PRUA 1KCYA 4MLWA 1YRTB 1NSHA 2ZRTA 1NUBA 4UPGA 1CB1A 2WCEA 3I5IC 2M9GA 3SIBA 1XVJA 3CTNA 2JQ6A 4DS7A 3I5HC 1BLQA 3PALA 1EXRA 1OE9B 1ZFSA 3H4SE 4ICBA 1SCVA 5FYXA 5AEQA 1FI5A 3BUWB 1DJYA 2P6BB 1BOCA 1J7RA 1MQ1A 2NCPA 3O6BA 1XYDA 1ZMZA 3JVTC 1V1FA 4AQJA 3DVKA 1SKTA 1Q80A 1A2XA 5PALA 2PSRA 2BKHB 2BE4A 1KQMB 2F2OA 4PHJA 2OPOA 1TRFA 1S5GZ 4N1FA 1S26D 3DVMA 5B8IB 5HLOA 1OMDA 3ZNIA 1A75A 1K2HA 1BF5A 2VRGA 3FWBA 1NCZA 3OB1B 3TS5B 2OTGC 4DUQA 1E8AA 4MSPA 1L2OB 1SY9A 5DKNA 3D10A 1Y1AA 1SPYA 1WRLA 2KNEA 1MUXA 3HX4A 4GPLB 1KK7Z 3C1VA 4PE0A 4I5JA 1PULA 4PE7A 1WRKA 2O60A 1UUSA 1G8IA 3KO0A 4ZCVA 1VRKA 4QJ5B 1PSRA 1QS7A 2H61C 3WNXB 2MHHA 4JQ0D 1D1OA 3NSOA 1HQVA 5HKWA 1CM1A 5CSIA 2LP2A 2JRFA 1KK7Y 1XFZO 1IJ5A 2JWWA 2NXQA 5K89A 3SIAA 1AK8A 2BL0C 4JPZB 1KWOB 2JOJA 3PATA 1Y1UA 1M45A 3FWCA 4GFTA 3RM1A 1FW4A 1H8BA 1EL4A 3DD4A 1SCMB 3JTDB 2SASA 2G9BA 3E3RA 1IKUA 4C0LA 5I8NA 4DIRA 2KDHA 1OMRA 2ISDA 3A8RA 1W7IB 1CLLA 2MA2A 1LA0A 1UP5A 5AFPA 1NX2A 1TCFA 2PMYA 3F45A 1IJ6A 2F3YA 1XFXO 5TNCA 3BYAA 1LVCD 1F8HA 3CR4X 4IL1A 1SYMA 1UHNA 2KHNA 4YBHB 2HQ8A 2CCMA 2JT8A 1NX3A 3HCMA 1K96A 1MXEA 1BT6A 4GBAA 4Q04A 1DVIA 1A75B 1RK9A 1DJGA 1PVBA 2WORA 2ZRSA 2WCBA 3LK0A 1NX0A 3O4YA 1EG3A 4XYNA 1B47A 1SNLA 4YI8A 1F70A 3PN7C 4GGFC 4DRWA 4PHMA 3BUXB 1UHJA 2LAPA 1TTXA 1SW8A 4GGNA 5JOLA 3RLZA 5IBWA 2SCPA 4P2YB 3I5GC 3QRXA 1YUUA 1PSBA 2KAVA 3KF9A 3OB2B 1AVSA 1J1EA 2LLTA 3PSRA 3PM8A 1YVHA 4E68A 1GGZA 1AJ4A 3NSLA 5AANA 1KSMA 1TN4A 4YRUA 1XFVO 2CBLA 4I5LB 2KI4C 1K8UA 4GAOA 4ORBB 5HYDA 1UHKA 4HSZA 2K2AA 1XO5A 2KYCA 1SR6B 1XA5A 1IGVA 2B1UA 1C7VA 1JFJA 2JNFA 3NSKA 2KBIA 3O78A 1MWNA 1CDPA 1MR8A 2ZN9A 2KQYA 2KFGA 4U8DA 2LE9B 1IQ3A 4YGDB 1U5IA 1YX7A 1TCOB 3WXAA 1WRZA 1R2UA 1NIWA 3VROA 2F8PA 2WNDA 2LMVA 1F55A 1B8RA 1KFUS 2MBXA 1UWOA 2K7BA 3I5IB 1UHIA 1NYAA 1OOJA 2I7AA 1QASA 1K95A 2KAXA 3TUYC 5KU1A 5KSZA 4A4BA 1X02A 1L7ZA 2Q4UA 4P5OE 1IH0A 3AKBA 4YGBB 2LCPA 2M0RA 4ORCB 1RECA 2M8UA 3VRQA 1B4CA 5DKRA 2Y5IA 4CIDA 2L98A 3JVTB 3TZ1A 2E6WA 1DF0A 2KFFA 1N0YA 1KFXL 1YURA 2M29A 3GK2A 1QIVA 2PVBA 4D1EA 4PALA 1QX5B 3IF7A 4TNCA 1DGUA 1TNXA 1BJFA 1QX7A 2L4HA 1RROA 1YTZC 3ZWHA 1DJIA 2KAYA 4F0ZB 1QTXA 1Y1XA 1OZSA 3LL8B 4PHNA 1CMFA 3CLNA 1ZUZA 4QJ4B 1JBAA 4PE1A 1EJ3A 4GGFA 1KQVA 3LLEA 1M46A 2I2RE 5F6TA 1TOPA 3EVRA 1S5GY 3BUNB 1N65A 1CFCA 2GGZA 4NDCA 1OMVA 1GGWA 1UHHA 3EK7A 3SG2A 3FIAA 1OSAA 2R2IA 1GJYA 3OX5A 1KSOA 1U5IB 3GOFA 5I2QA 2OS8B 3EK4A 3MSEB 4YGEB 2KGBC 2TN4A 1CLBA 4FTGA 2JT0A 2EHBA 3VRPA 2L4IA 2BL0B 1F4QA 3TS5C 2K7CA 1J55A 3TDUA 2BECA 2L50A 1L2OC 1Y0VH 2NLNA 3SG7A 3A4UB 2ZFDA 4CLNA 4PDZA 1DJXA 1NWDA 4MEWA 5I2OA 5I2LA 2Y4QA 2PALA 5CSJA 2MLEC 3GK4X 1KK8C 1S6CA 2NCOA 1F71A 2K7OA 1MF8B 4MRYA 2LVIA 1A03A 4AOMA 1NPQA 1RWYA 1JF0A 2JTZA 2K8MB 1FI6A 2FCEA 4I5NB 5HLVA 2LM5A 2O5GA 1SK6D 5HKYA 1S1EA 1V1GA 1WY9A 2HQWA 1J7PA 3JTDC 1NX1A 1SCMC 2JC2A 2F33A 5JJGA 1LA3A 5DKQA 3KPXA 1WLMA 1UURA 2ZKMX 2EC6C 2L5XB 3ICBA 4BY4A 1CNPA 5GQQC 1BU3A 1M63B 2KYFA 3VRNA 2CT9A 1DGVA 2M1UA 4MBEA 2F2PA 1CKKA 2CTNA 2LHLA 4MVFA 1B7TZ 2JZIA 2MAZA 1CFPA 1F54A 1AHRA 2LVVA 3WHTB 2PASA 4GNKB 2KFHA 1QLSA 5AXIA 1QATA 3BXKA 3SG4A 1K9PA 1K9UA 1ALVA 3SG3A 1B1GA 2JULA 4WQ3A 1CDMA 1JUOA 2LVJA 1PRWA 2LLSA 1QVIZ 2KI6C 1BR4B 1LINA 3LCPC 4M2QA 4YI9A 5D69A 1K9KA 2F3ZA 3PLFB 2LC5A 2H61A 1N2DA 1MHOA 1DJHA 3I5FC 1PALA 3BOWA 4JWQA 3TDIA 2HPSA 2L2EA 2LUCA 2MRDA 2BE6A 1IG5A 1NCXA 4DCKA 1OZOA 3K21A 3TUYB 1IQ5A 1SR6C 3I5HB 1XFWO 4GUKA 4R1EA 5HKZA 1YVLA 2FOTA 3IQOA 2IS9A 4C0JA 3EK8A 2M97A 2KBMA 2ZNDA 1LXFC 2Y1NA 3EKHA 1C07A 1TNWA 2M49B 2MJWB 2JXLA 4NDBA 1M39A 2CNPA 4NQGA 5CPVA 1FBVA 2LV7A 1AUIB 1B8CA 2KI6D 2L0PA 2LP3A 1SL9A 1WDCC 1YUSA 3EKJA 1CFFA 4MRXA 1QV1A 2G2BA 1QV0A 2BKIB 1ALWA 3AAKA 1TIZA 4USLA 2RGIA 3DF0A 2LMTA 1SL7A 1JF2A 3NSIA 1J7OA 1QIWA 3D0YA 2OTGB 5ER5A 1JFKA 1CDLA 1CFDA 1YRUB 4OV2A 1A4PA 1QJTA 2GV5A 2HETA 1XFUO 1CLMA 2FJUB 2K7DA 3SG6A 2JU0A 1OQPA 4CFQA 1QXPA 3LK1A 4OCIA 1H4BA 2DOQA 1EG4A 2JXCA 3DVJA 1XK4C 3VRRA 4CFRA 5J3XA 1R6PA 5ER4X 2K0JA 3KHEA 3BOWB 4M2PA 3KEVA 1NCYA 1KQMC 2LANA 1LKJA 4FQOA 3AAJA 4N1GA 4PE4A 1TNQA 4N5XA 1YX8A 1Y6WA 2L51A 2M1KB 4WQ2A 1S3PA 2MLFC 5AERA 2WC8A 1ZOTB 4MZJA 1CTRA 2NZ0A 3OP0A 1HT9A 1MXLC 3NXAA 3M0WA 2EGDA 1PVAA 2GGMA 4QJ3B 4BY5A 1DT7B 5CSNA 3EVVA 1JC2A 1G4YR 1SBJA 4WRIA 1B8LA 1KK8B 3SJSA 4L9MA 2LUXA 1KFUL
chains in the Genus database with same CATH superfamily
2JPTA 5I94A 3OGNA 1DF0B 4MZKA 1CMGA 1C7WA 2OS8C 2QACA 3S0FA 4OVNF 1GQMA 3IQQA 1BR1B 2LLUA 3DF0B 1RFJA 3CGAA 1S6IA 1W9ZA 2AMIA 4YGCB 1KWOC 2BBNA 2LHIA 2QPTA 1IWQA 1BODA 3PFVA 2BCXA 3D0YB 2KLDA 2ZN8A 4OR9B 1W7JB 5CSFA 2P71A 1J1DA 4XJKA 2EC6B 4AQIA 2K61A 2M7NA 2AUCA 3PN7B 3S0BA 1BG1A 1J7QA 2KLEA 4A4CA 1BMOA 1OOIX 1JSAA 3I5GB 4HRGA 4HREE 1ZACA 1TNPA 4NDDA 3OX6A 3WHUB 1IRJA 3CZTX 1TWOA 1FF1A 2KQ6A 1K94A 3BQ3A 1KFXS 3BUOB 4M2OA 1SL8A 2HF5A 1XFYO 4MN0A 3DZTA 1A29A 1K90D 4C0KA 3CWGA 3TDZA 1CDNA 3BFAA 2JT3A 2KI4B 2E30A 1DJZA 2KOTA 1SMGA 4ZCUA 4OKHA 1RJVA 1DTLA 1YR5A 1FPWA 2FCDA 1DJWA 2M7LA 1B7TY 1DEKA 2BNXA 3AKAA 1QLKA 1T14A 3DVEA 1EH2A 2CXJA 1F4OA 1XK4A 4YGAA 1YUTA 2WCFA 5BPJA 4PCWA 2A4JA 2H2KA 2Q91A 2WOSA 3I5FB 4INXA 2AAOA 4KYNA 3EG5B 3O2PA 4ORAB 4PHKA 3BUMB 4F7FA 1QX2A 2BCAA 3GK1A 2L5YA 1B9AA 3OHMB 3EVUA 2D8NA 1K93D 1ODBA 2K2FA 1JWDA 2LMUA 2I94A 2Y1MA 2BBMA 2ZNEA 2BCBA 1QVIY 4HRHA 1NP8A 1CM4A 1AJ5A 4MZLA 4I5KA 3D78A 2COLB 4CPVA 2M3WA 2LNKA 5KTYA 1AP4A 4ETOA 1LS8A 2JTTA 2KGRA 2LVKA 3CR2A 3CS1A 3FS7A 3CR5X 5G08A 2H8VA 4XJKB 3VGOA 2KSPA 1S6JA 1M31A 2V53A 1DMOA 1WLZA 1RTP1 1PK0D 1S36A 3D73A 5D7FA 1DC1A 3SG5A 1WDCB 1P28A 1SRAA 3L4LA 5FI2A 2I18A 2JNXA 1G33A 2PRUA 1KCYA 5D3OA 4MLWA 1YRTB 1NSHA 2WCMA 1NUBA 2ZRTA 4UPGA 1CB1A 2WCEA 3I5IC 2M9GA 3SIBA 1XVJA 3CTNA 2JQ6A 3CZ0A 4DS7A 3I5HC 1BLQA 3PALA 1EXRA 1OE9B 1ZFSA 3H4SE 4ICBA 1SCVA 5FYXA 5AEQA 1FI5A 3D75A 2QEOA 3BUWB 1DJYA 2P6BB 1BOCA 1J7RA 1MQ1A 2NCPA 3O6BA 1XYDA 3IVTA 1OOHA 1ZMZA 3JVTC 1V1FA 4AQJA 3DVKA 1SKTA 5HL1A 1Q80A 5EL2A 1A2XA 5PALA 2PSRA 2BKHB 3R1VA 2BE4A 1KQMB 2F2OA 4PHJA 2OPOA 1TRFA 1S5GZ 4N1FA 1S26D 3DVMA 5B8IB 1Z4HA 3N7HA 5HLOA 1OMDA 3ZNIA 3DYEA 2K60A 1A75A 1K2HA 1BF5A 2VRGA 3FWBA 1NCZA 2WCLA 3OB1B 3TS5B 2OTGC 4DUQA 1E8AA 4MSPA 1L2OB 1SY9A 5DKNA 3D10A 3S0EA 1Y1AA 1SPYA 1WRLA 2KNEA 1MUXA 2WCHA 3HX4A 4GPLB 1KK7Z 3C1VA 4PE0A 4I5JA 1PULA 1Z2CB 4PE7A 1WRKA 2O60A 1UUSA 1G8IA 3KO0A 4ZCVA 1VRKA 4QJ5B 1PSRA 1QS7A 2H61C 2P70A 2MHHA 4JQ0D 3WNXB 3S0AA 1D1OA 3NSOA 1HQVA 4OZDA 5HKWA 1CM1A 5CSIA 2LP2A 2JRFA 3B87A 3RZSA 1KK7Y 1XFZO 1IJ5A 2JPOA 2JWWA 2NXQA 5K89A 3SIAA 1AK8A 2BL0C 4JPZB 1KWOB 2JOJA 3CZ2A 3PATA 1Y1UA 1M45A 3FWCA 4GFTA 3RM1A 1FW4A 1H8BA 1EL4A 3DD4A 1SCMB 3JTDB 2SASA 2G9BA 3E3RA 2YGUA 1IKUA 3S0DA 4C0LA 5I8NA 3DXLA 4DIRA 2KDHA 3V2LA 1OMRA 2ISDA 3A8RA 1W7IB 1CLLA 2MA2A 1LA0A 1UP5A 5AFPA 1NX2A 1TCFA 2PMYA 2QEVA 3F45A 1IJ6A 2F3YA 1XFXO 5TNCA 3BYAA 1LVCD 1F8HA 3CR4X 4IL1A 1SYMA 1UHNA 2KHNA 4YBHB 2HQ8A 2CCMA 2JT8A 1NX3A 3HCMA 1K96A 1MXEA 1BT6A 4GBAA 4Q04A 1DVIA 1A75B 1RK9A 1DJGA 3CYZA 1PVBA 2WORA 2ZRSA 2WCBA 3LK0A 3DY9A 2FJYA 1NX0A 3O4YA 1EG3A 4XYNA 1B47A 1OOFA 1SNLA 3NHTA 4YI8A 3FE8A 1F70A 3PN7C 4GGFC 4DRWA 4PHMA 3BUXB 1UHJA 2LAPA 1TTXA 1SW8A 4GGNA 5JOLA 3RLZA 5IBWA 2SCPA 4P2YB 2ERBA 3I5GC 3QRXA 1YUUA 1PSBA 2KAVA 3KF9A 3OB2B 1AVSA 1J1EA 2LLTA 3PSRA 3PM8A 1YVHA 4E68A 1GGZA 1AJ4A 1TUZA 3NSLA 1KSMA 1TN4A 3D74A 1XFVO 2CBLA 5AANA 4I5LB 2KI4C 1K8UA 4GAOA 4ORBB 5HYDA 1UHKA 4HSZA 2K2AA 1XO5A 2PYQA 2KYCA 1SR6B 1XA5A 1IGVA 2B1UA 3OBVA 1C7VA 1JFJA 2JNFA 3NSKA 2KBIA 3O78A 1MWNA 1CDPA 1MR8A 2ZN9A 2KQYA 2KFGA 4U8DA 2LE9B 1IQ3A 4YGDB 1U5IA 1YX7A 1TCOB 3WXAA 1WRZA 1R2UA 1NIWA 3VROA 2F8PA 2QDIA 2WNDA 1C3YA 2LMVA 1F55A 1B8RA 1KFUS 2MBXA 1QWVA 3S0GA 1UWOA 2K7BA 3I5IB 1UHIA 1NYAA 3UO9A 1OOJA 2I7AA 1QASA 1K95A 2KAXA 3TUYC 5KU1A 5KSZA 4A4BA 1X02A 1L7ZA 2Q4UA 4P5OE 1IH0A 3AKBA 4YGBB 2LCPA 2M0RA 3SS5A 4ORCB 1RECA 1XFRA 2M8UA 3VRQA 3D77A 1B4CA 5DKRA 5DICA 2Y5IA 4CIDA 2L98A 3JVTB 3TZ1A 2E6WA 1DF0A 2KFFA 1GM0A 1N0YA 1KFXL 1YURA 2M29A 3GK2A 1QIVA 2PVBA 4D1EA 4PALA 3B88A 1QX5B 3IF7A 4TNCA 1DGUA 1TNXA 1BJFA 1QX7A 2L4HA 1RROA 1YTZC 3ZWHA 1DJIA 2KAYA 4F0ZB 1QTXA 1Y1XA 1OZSA 3LL8B 4PHNA 1CMFA 3CLNA 1DQEA 1ZUZA 4QJ4B 1JBAA 4PE1A 1EJ3A 4GGFA 1KQVA 3LLEA 3Q8IA 1M46A 2I2RE 5F6TA 1TOPA 3EVRA 1S5GY 3BUNB 1N65A 1CFCA 2GGZA 4NDCA 1OMVA 1GGWA 1UHHA 3EK7A 3SG2A 3FIAA 1OSAA 2R2IA 1GJYA 3OX5A 3FE9A 1KSOA 1U5IB 1ORGA 3GOFA 5I2QA 3QMEA 2OS8B 3EK4A 3MSEB 2WCJA 4YGEB 2KGBC 2TN4A 1CLBA 1OW4A 4FTGA 2JT0A 2EHBA 3PJIA 3VRPA 2L4IA 1DELA 3SS3A 2BL0B 2KPHA 1F4QA 3BFHA 2K7CA 1C3ZA 1J55A 3NGVA 3TS5C 3TDUA 2BECA 2L50A 1L2OC 1Y0VH 2NLNA 3SG7A 3A4UB 2ZFDA 4CLNA 4PDZA 1DJXA 1NWDA 4MEWA 5I2OA 5I2LA 2Y4QA 2PALA 5CSJA 2MLEC 3GK4X 1KK8C 1S6CA 2NCOA 1F71A 3VB1A 2K7OA 1MF8B 4MRYA 2L2CA 2LVIA 2QEHA 4INWA 4AOMA 1A03A 1NPQA 1RWYA 1JF0A 4YRUA 2JTZA 2K8MB 1FI6A 2FCEA 4I5NB 5HLVA 2LM5A 2O5GA 3O4XA 1SK6D 5HKYA 1S1EA 1V1GA 1WY9A 2HQWA 1J7PA 3JTDC 1NX1A 1SCMC 2JC2A 2F33A 5JJGA 1LA3A 5DKQA 3KPXA 1WLMA 1UURA 2ZKMX 2BAPA 2EC6C 2L5XB 3ICBA 4BY4A 1CNPA 5GQQC 1BU3A 1M63B 2KYFA 3VRNA 1DGVA 2CT9A 2M1UA 3CABA 4MBEA 3B86A 2F2PA 1CKKA 2CTNA 2LHLA 3L4AA 4MVFA 1B7TZ 2JZIA 2MAZA 1CFPA 1F54A 1AHRA 2LVVA 3WHTB 2PASA 4GNKB 2KFHA 1QLSA 5AXIA 4PT1A 1QATA 1IIOA 2GTEA 3BXKA 3CZ1A 4JD9A 3SG4A 1K9PA 1K9UA 3L47A 1ALVA 3B6XA 3SG3A 1OOGA 1B1GA 2JULA 4WQ3A 1CDMA 1JUOA 4JKTA 2LVJA 3NHIA 1PRWA 2LLSA 1QVIZ 2KI6C 1BR4B 1LINA 3LCPC 4M2QA 4YI9A 5D69A 1K9KA 2F3ZA 3PLFB 2LC5A 2H61A 1N2DA 1MHOA 1DJHA 3I5FC 1PALA 3BOWA 4JWQA 3TDIA 2HPSA 2L2EA 2LUCA 2MRDA 4IJ7A 2BE6A 1IG5A 1NCXA 4DCKA 1OZOA 3K21A 1SSEB 3TUYB 3FE6A 1IQ5A 3K1EA 1SR6C 3I5HB 1XFWO 4GUKA 4R1EA 5HKZA 1YVLA 2FOTA 3B7AA 3BJHA 3IQOA 3SS4A 2IS9A 4C0JA 3EK8A 3CDNA 2M97A 2KBMA 2ZNDA 1LXFC 2Y1NA 3EKHA 3R1OA 5FI7A 1C07A 1TNWA 2M49B 2MJWB 2JXLA 4NDBA 1M39A 2CNPA 3R1PA 2WCKA 4NQGA 5CPVA 1FBVA 3D76A 2LV7A 1AUIB 1B8CA 2KI6D 2L0PA 3PM2A 2LP3A 1SL9A 1WDCC 1YUSA 3EKJA 1CFFA 4MRXA 1QV1A 2G2BA 1QV0A 2BKIB 1ALWA 3AAKA 1TIZA 4USLA 2RGIA 3DF0A 2LMTA 1SL7A 1JF2A 3NSIA 1J7OA 1QIWA 3D0YA 3BFBA 2OTGB 5ER5A 1JFKA 1CDLA 1CFDA 1YRUB 4OV2A 1A4PA 1QJTA 2GV5A 2HETA 1XFUO 1CLMA 1TUJA 2FJUB 2K7DA 3SG6A 2JU0A 1OQPA 4CFQA 1QXPA 3LK1A 4OCIA 1H4BA 2QEBA 2DOQA 1EG4A 2JXCA 3DVJA 1XK4C 3VRRA 4CFRA 5J3XA 1R6PA 5ER4X 2K0JA 3KHEA 4FQTA 3BOWB 4M2PA 3KEVA 1NCYA 2WC6A 1KQMC 2LANA 1LKJA 4FQOA 5FI6A 3UNWA 3AAJA 4N1GA 4PE4A 1TNQA 4N5XA 1YX8A 1Y6WA 2L51A 2WC5A 2M1KB 4WQ2A 1S3PA 2MLFC 5AERA 2WC8A 1ZOTB 3R72A 4MZJA 1CTRA 2NZ0A 3OP0A 1HT9A 1MXLC 2PQLA 3M0WA 2EGDA 1PVAA 2GGMA 3NXAA 4QJ3B 4BY5A 5CSNA 1DT7B 3EVVA 1JC2A 1G4YR 1SBJA 4WRIA 1B8LA 1KK8B 3SJSA 4L9MA 2LUXA 1KFUL
chains in the Genus database with same CATH topology
2JPTA 1DF0B 4MZKA 1CMGA 1C7WA 2OS8C 2QACA 4OVNF 1GQMA 3IQQA 1BR1B 2LLUA 3DF0B 1RFJA 3CGAA 1S6IA 2AMIA 4YGCB 1KWOC 2BBNA 2LHIA 2QPTA 1IWQA 1BODA 3PFVA 2BCXA 3D0YB 2ZN8A 4OR9B 1W7JB 5CSFA 4XJKA 1J1DA 2EC6B 4AQIA 2K61A 2M7NA 2AUCA 3PN7B 1BG1A 1J7QA 4A4CA 1BMOA 1JSAA 3I5GB 4HRGA 4HREE 1ZACA 1TNPA 4NDDA 3OX6A 3WHUB 1IRJA 3CZTX 1FF1A 2KQ6A 1K94A 3BQ3A 1KFXS 3BUOB 4M2OA 1SL8A 2HF5A 1XFYO 4MN0A 1A29A 1K90D 4C0KA 3CWGA 3TDZA 1CDNA 2JT3A 2KI4B 2E30A 1DJZA 2KOTA 1SMGA 4ZCUA 4OKHA 1RJVA 1DTLA 1YR5A 1FPWA 2FCDA 1DJWA 2M7LA 1B7TY 3AKAA 1QLKA 3DVEA 1EH2A 2CXJA 1F4OA 1XK4A 4YGAA 1YUTA 2WCFA 5BPJA 4PCWA 2A4JA 2H2KA 2Q91A 2WOSA 3I5FB 2AAOA 3O2PA 4ORAB 4PHKA 3BUMB 1QX2A 2BCAA 3GK1A 1B9AA 3OHMB 3EVUA 2D8NA 1K93D 1ODBA 2K2FA 1JWDA 2LMUA 2I94A 2Y1MA 2BBMA 2ZNEA 2BCBA 1QVIY 4HRHA 1NP8A 1CM4A 1AJ5A 4MZLA 4I5KA 2COLB 4CPVA 2M3WA 2LNKA 5KTYA 1AP4A 4ETOA 3CR2A 2JTTA 2KGRA 2LVKA 3CS1A 3FS7A 3CR5X 5G08A 3VGOA 4XJKB 2KSPA 1S6JA 1M31A 2V53A 1DMOA 1WLZA 1RTP1 1PK0D 1S36A 5D7FA 3SG5A 1WDCB 1SRAA 2I18A 2JNXA 1G33A 2PRUA 1KCYA 4MLWA 1YRTB 1NSHA 2ZRTA 1NUBA 4UPGA 1CB1A 2WCEA 3I5IC 2M9GA 3SIBA 1XVJA 3CTNA 2JQ6A 4DS7A 3I5HC 1BLQA 3PALA 1EXRA 1OE9B 1ZFSA 3H4SE 4ICBA 1SCVA 5FYXA 5AEQA 1FI5A 3BUWB 1DJYA 2P6BB 1BOCA 1J7RA 1MQ1A 2NCPA 3O6BA 1XYDA 1ZMZA 3JVTC 1V1FA 4AQJA 3DVKA 1SKTA 1Q80A 1A2XA 5PALA 2PSRA 2BKHB 2BE4A 1KQMB 2F2OA 4PHJA 2OPOA 1TRFA 1S5GZ 4N1FA 1S26D 3DVMA 5B8IB 5HLOA 1OMDA 3ZNIA 1A75A 1K2HA 1BF5A 2VRGA 3FWBA 1NCZA 3OB1B 3TS5B 2OTGC 4DUQA 1E8AA 4MSPA 1L2OB 1SY9A 5DKNA 3D10A 1Y1AA 1SPYA 1WRLA 2KNEA 1MUXA 3HX4A 4GPLB 1KK7Z 3C1VA 4PE0A 4I5JA 1PULA 4PE7A 1WRKA 2O60A 1UUSA 1G8IA 3KO0A 4ZCVA 1VRKA 4QJ5B 1PSRA 1QS7A 2H61C 3WNXB 2MHHA 4JQ0D 1D1OA 3NSOA 1HQVA 5HKWA 1CM1A 5CSIA 2LP2A 2JRFA 1KK7Y 1XFZO 1IJ5A 2JWWA 2NXQA 5K89A 3SIAA 1AK8A 2BL0C 4JPZB 1KWOB 2JOJA 3PATA 1Y1UA 1M45A 3FWCA 4GFTA 3RM1A 1FW4A 1H8BA 1EL4A 3DD4A 1SCMB 3JTDB 2SASA 2G9BA 3E3RA 1IKUA 4C0LA 5I8NA 4DIRA 2KDHA 1OMRA 2ISDA 3A8RA 1W7IB 1CLLA 2MA2A 1LA0A 1UP5A 5AFPA 1NX2A 1TCFA 2PMYA 3F45A 1IJ6A 2F3YA 1XFXO 5TNCA 3BYAA 1LVCD 1F8HA 3CR4X 4IL1A 1SYMA 1UHNA 2KHNA 4YBHB 2HQ8A 2CCMA 2JT8A 1NX3A 3HCMA 1K96A 1MXEA 1BT6A 4GBAA 4Q04A 1DVIA 1A75B 1RK9A 1DJGA 1PVBA 2WORA 2ZRSA 2WCBA 3LK0A 1NX0A 3O4YA 1EG3A 4XYNA 1B47A 1SNLA 4YI8A 1F70A 3PN7C 4GGFC 4DRWA 4PHMA 3BUXB 1UHJA 2LAPA 1TTXA 1SW8A 4GGNA 5JOLA 3RLZA 5IBWA 2SCPA 4P2YB 3I5GC 3QRXA 1YUUA 1PSBA 2KAVA 3KF9A 3OB2B 1AVSA 1J1EA 2LLTA 3PSRA 3PM8A 1YVHA 4E68A 1GGZA 1AJ4A 3NSLA 5AANA 1KSMA 1TN4A 4YRUA 1XFVO 2CBLA 4I5LB 2KI4C 1K8UA 4GAOA 4ORBB 5HYDA 1UHKA 4HSZA 2K2AA 1XO5A 2KYCA 1SR6B 1XA5A 1IGVA 2B1UA 1C7VA 1JFJA 2JNFA 3NSKA 2KBIA 3O78A 1MWNA 1CDPA 1MR8A 2ZN9A 2KQYA 2KFGA 4U8DA 2LE9B 1IQ3A 4YGDB 1U5IA 1YX7A 1TCOB 3WXAA 1WRZA 1R2UA 1NIWA 3VROA 2F8PA 2WNDA 2LMVA 1F55A 1B8RA 1KFUS 2MBXA 1UWOA 2K7BA 3I5IB 1UHIA 1NYAA 1OOJA 2I7AA 1QASA 1K95A 2KAXA 3TUYC 5KU1A 5KSZA 4A4BA 1X02A 1L7ZA 2Q4UA 4P5OE 1IH0A 3AKBA 4YGBB 2LCPA 2M0RA 4ORCB 1RECA 2M8UA 3VRQA 1B4CA 5DKRA 2Y5IA 4CIDA 2L98A 3JVTB 3TZ1A 2E6WA 1DF0A 2KFFA 1N0YA 1KFXL 1YURA 2M29A 3GK2A 1QIVA 2PVBA 4D1EA 4PALA 1QX5B 3IF7A 4TNCA 1DGUA 1TNXA 1BJFA 1QX7A 2L4HA 1RROA 1YTZC 3ZWHA 1DJIA 2KAYA 4F0ZB 1QTXA 1Y1XA 1OZSA 3LL8B 4PHNA 1CMFA 3CLNA 1ZUZA 4QJ4B 1JBAA 4PE1A 1EJ3A 4GGFA 1KQVA 3LLEA 1M46A 2I2RE 5F6TA 1TOPA 3EVRA 1S5GY 3BUNB 1N65A 1CFCA 2GGZA 4NDCA 1OMVA 1GGWA 1UHHA 3EK7A 3SG2A 3FIAA 1OSAA 2R2IA 1GJYA 3OX5A 1KSOA 1U5IB 3GOFA 5I2QA 2OS8B 3EK4A 3MSEB 4YGEB 2KGBC 2TN4A 1CLBA 4FTGA 2JT0A 2EHBA 3VRPA 2L4IA 2BL0B 1F4QA 3TS5C 2K7CA 1J55A 3TDUA 2BECA 2L50A 1L2OC 1Y0VH 2NLNA 3SG7A 3A4UB 2ZFDA 4CLNA 4PDZA 1DJXA 1NWDA 4MEWA 5I2OA 5I2LA 2Y4QA 2PALA 5CSJA 2MLEC 3GK4X 1KK8C 1S6CA 2NCOA 1F71A 2K7OA 1MF8B 4MRYA 2LVIA 1A03A 4AOMA 1NPQA 1RWYA 1JF0A 2JTZA 2K8MB 1FI6A 2FCEA 4I5NB 5HLVA 2LM5A 2O5GA 1SK6D 5HKYA 1S1EA 1V1GA 1WY9A 2HQWA 1J7PA 3JTDC 1NX1A 1SCMC 2JC2A 2F33A 5JJGA 1LA3A 5DKQA 3KPXA 1WLMA 1UURA 2ZKMX 2EC6C 2L5XB 3ICBA 4BY4A 1CNPA 5GQQC 1BU3A 1M63B 2KYFA 3VRNA 2CT9A 1DGVA 2M1UA 4MBEA 2F2PA 1CKKA 2CTNA 2LHLA 4MVFA 1B7TZ 2JZIA 2MAZA 1CFPA 1F54A 1AHRA 2LVVA 3WHTB 2PASA 4GNKB 2KFHA 1QLSA 5AXIA 1QATA 3BXKA 3SG4A 1K9PA 1K9UA 1ALVA 3SG3A 1B1GA 2JULA 4WQ3A 1CDMA 1JUOA 2LVJA 1PRWA 2LLSA 1QVIZ 2KI6C 1BR4B 1LINA 3LCPC 4M2QA 4YI9A 5D69A 1K9KA 2F3ZA 3PLFB 2LC5A 2H61A 1N2DA 1MHOA 1DJHA 3I5FC 1PALA 3BOWA 4JWQA 3TDIA 2HPSA 2L2EA 2LUCA 2MRDA 2BE6A 1IG5A 1NCXA 4DCKA 1OZOA 3K21A 3TUYB 1IQ5A 1SR6C 3I5HB 1XFWO 4GUKA 4R1EA 5HKZA 1YVLA 2FOTA 3IQOA 2IS9A 4C0JA 3EK8A 2M97A 2KBMA 2ZNDA 1LXFC 2Y1NA 3EKHA 1C07A 1TNWA 2M49B 2MJWB 2JXLA 4NDBA 1M39A 2CNPA 4NQGA 5CPVA 1FBVA 2LV7A 1AUIB 1B8CA 2KI6D 2L0PA 2LP3A 1SL9A 1WDCC 1YUSA 3EKJA 1CFFA 4MRXA 1QV1A 2G2BA 1QV0A 2BKIB 1ALWA 3AAKA 1TIZA 4USLA 2RGIA 3DF0A 2LMTA 1SL7A 1JF2A 3NSIA 1J7OA 1QIWA 3D0YA 2OTGB 5ER5A 1JFKA 1CDLA 1CFDA 1YRUB 4OV2A 1A4PA 1QJTA 2GV5A 2HETA 1XFUO 1CLMA 2FJUB 2K7DA 3SG6A 2JU0A 1OQPA 4CFQA 1QXPA 3LK1A 4OCIA 1H4BA 2DOQA 1EG4A 2JXCA 3DVJA 1XK4C 3VRRA 4CFRA 5J3XA 1R6PA 5ER4X 2K0JA 3KHEA 3BOWB 4M2PA 3KEVA 1NCYA 1KQMC 2LANA 1LKJA 4FQOA 3AAJA 4N1GA 4PE4A 1TNQA 4N5XA 1YX8A 1Y6WA 2L51A 2M1KB 4WQ2A 1S3PA 2MLFC 5AERA 2WC8A 1ZOTB 4MZJA 1CTRA 2NZ0A 3OP0A 1HT9A 1MXLC 3NXAA 3M0WA 2EGDA 1PVAA 2GGMA 4QJ3B 4BY5A 1DT7B 5CSNA 3EVVA 1JC2A 1G4YR 1SBJA 4WRIA 1B8LA 1KK8B 3SJSA 4L9MA 2LUXA 1KFUL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JPT A;  1DF0 B;  4MZK A;  1CMG A;  1C7W A;  2OS8 C;  2QAC A;  4OVN F;  1GQM A;  3IQQ A;  1BR1 B;  2LLU A;  3DF0 B;  1RFJ A;  3CGA A;  1S6I A;  2AMI A;  4YGC B;  1KWO C;  2BBN A;  2LHI A;  2QPT A;  1IWQ A;  1BOD A;  3PFV A;  2BCX A;  3D0Y B;  2ZN8 A;  4OR9 B;  1W7J B;  5CSF A;  4XJK A;  1J1D A;  2EC6 B;  4AQI A;  2K61 A;  2M7N A;  2AUC A;  3PN7 B;  1BG1 A;  1J7Q A;  4A4C A;  1BMO A;  1JSA A;  3I5G B;  4HRG A;  4HRE E;  1ZAC A;  1TNP A;  4NDD A;  3OX6 A;  3WHU B;  1IRJ A;  3CZT X;  1FF1 A;  2KQ6 A;  1K94 A;  3BQ3 A;  1KFX S;  3BUO B;  4M2O A;  1SL8 A;  2HF5 A;  1XFY O;  4MN0 A;  1A29 A;  1K90 D;  4C0K A;  3CWG A;  3TDZ A;  1CDN A;  2JT3 A;  2KI4 B;  2E30 A;  1DJZ A;  2KOT A;  1SMG A;  4ZCU A;  4OKH A;  1RJV A;  1DTL A;  1YR5 A;  1FPW A;  2FCD A;  1DJW A;  2M7L A;  1B7T Y;  3AKA A;  1QLK A;  3DVE A;  1EH2 A;  2CXJ A;  1F4O A;  1XK4 A;  4YGA A;  1YUT A;  2WCF A;  5BPJ A;  4PCW A;  2A4J A;  2H2K A;  2Q91 A;  2WOS A;  3I5F B;  2AAO A;  3O2P A;  4ORA B;  4PHK A;  3BUM B;  1QX2 A;  2BCA A;  3GK1 A;  1B9A A;  3OHM B;  3EVU A;  2D8N A;  1K93 D;  1ODB A;  2K2F A;  1JWD A;  2LMU A;  2I94 A;  2Y1M A;  2BBM A;  2ZNE A;  2BCB A;  1QVI Y;  4HRH A;  1NP8 A;  1CM4 A;  1AJ5 A;  4MZL A;  4I5K A;  2COL B;  4CPV A;  2M3W A;  2LNK A;  5KTY A;  1AP4 A;  4ETO A;  3CR2 A;  2JTT A;  2KGR A;  2LVK A;  3CS1 A;  3FS7 A;  3CR5 X;  5G08 A;  3VGO A;  4XJK B;  2KSP A;  1S6J A;  1M31 A;  2V53 A;  1DMO A;  1WLZ A;  1RTP 1;  1PK0 D;  1S36 A;  5D7F A;  3SG5 A;  1WDC B;  1SRA A;  2I18 A;  2JNX A;  1G33 A;  2PRU A;  1KCY A;  4MLW A;  1YRT B;  1NSH A;  2ZRT A;  1NUB A;  4UPG A;  1CB1 A;  2WCE A;  3I5I C;  2M9G A;  3SIB A;  1XVJ A;  3CTN A;  2JQ6 A;  4DS7 A;  3I5H C;  1BLQ A;  3PAL A;  1EXR A;  1OE9 B;  1ZFS A;  3H4S E;  4ICB A;  1SCV A;  5FYX A;  5AEQ A;  1FI5 A;  3BUW B;  1DJY A;  2P6B B;  1BOC A;  1J7R A;  1MQ1 A;  2NCP A;  3O6B A;  1XYD A;  1ZMZ A;  3JVT C;  1V1F A;  4AQJ A;  3DVK A;  1SKT A;  1Q80 A;  1A2X A;  5PAL A;  2PSR A;  2BKH B;  2BE4 A;  1KQM B;  2F2O A;  4PHJ A;  2OPO A;  1TRF A;  1S5G Z;  4N1F A;  1S26 D;  3DVM A;  5B8I B;  5HLO A;  1OMD A;  3ZNI A;  1A75 A;  1K2H A;  1BF5 A;  2VRG A;  3FWB A;  1NCZ A;  3OB1 B;  3TS5 B;  2OTG C;  4DUQ A;  1E8A A;  4MSP A;  1L2O B;  1SY9 A;  5DKN A;  3D10 A;  1Y1A A;  1SPY A;  1WRL A;  2KNE A;  1MUX A;  3HX4 A;  4GPL B;  1KK7 Z;  3C1V A;  4PE0 A;  4I5J A;  1PUL A;  4PE7 A;  1WRK A;  2O60 A;  1UUS A;  1G8I A;  3KO0 A;  4ZCV A;  1VRK A;  4QJ5 B;  1PSR A;  1QS7 A;  2H61 C;  3WNX B;  2MHH A;  4JQ0 D;  1D1O A;  3NSO A;  1HQV A;  5HKW A;  1CM1 A;  5CSI A;  2LP2 A;  2JRF A;  1KK7 Y;  1XFZ O;  1IJ5 A;  2JWW A;  2NXQ A;  5K89 A;  3SIA A;  1AK8 A;  2BL0 C;  4JPZ B;  1KWO B;  2JOJ A;  3PAT A;  1Y1U A;  1M45 A;  3FWC A;  4GFT A;  3RM1 A;  1FW4 A;  1H8B A;  1EL4 A;  3DD4 A;  1SCM B;  3JTD B;  2SAS A;  2G9B A;  3E3R A;  1IKU A;  4C0L A;  5I8N A;  4DIR A;  2KDH A;  1OMR A;  2ISD A;  3A8R A;  1W7I B;  1CLL A;  2MA2 A;  1LA0 A;  1UP5 A;  5AFP A;  1NX2 A;  1TCF A;  2PMY A;  3F45 A;  1IJ6 A;  2F3Y A;  1XFX O;  5TNC A;  3BYA A;  1LVC D;  1F8H A;  3CR4 X;  4IL1 A;  1SYM A;  1UHN A;  2KHN A;  4YBH B;  2HQ8 A;  2CCM A;  2JT8 A;  1NX3 A;  3HCM A;  1K96 A;  1MXE A;  1BT6 A;  4GBA A;  4Q04 A;  1DVI A;  1A75 B;  1RK9 A;  1DJG A;  1PVB A;  2WOR A;  2ZRS A;  2WCB A;  3LK0 A;  1NX0 A;  3O4Y A;  1EG3 A;  4XYN A;  1B47 A;  1SNL A;  4YI8 A;  1F70 A;  3PN7 C;  4GGF C;  4DRW A;  4PHM A;  3BUX B;  1UHJ A;  2LAP A;  1TTX A;  1SW8 A;  4GGN A;  5JOL A;  3RLZ A;  5IBW A;  2SCP A;  4P2Y B;  3I5G C;  3QRX A;  1YUU A;  1PSB A;  2KAV A;  3KF9 A;  3OB2 B;  1AVS A;  1J1E A;  2LLT A;  3PSR A;  3PM8 A;  1YVH A;  4E68 A;  1GGZ A;  1AJ4 A;  3NSL A;  5AAN A;  1KSM A;  1TN4 A;  4YRU A;  1XFV O;  2CBL A;  4I5L B;  2KI4 C;  1K8U A;  4GAO A;  4ORB B;  5HYD A;  1UHK A;  4HSZ A;  2K2A A;  1XO5 A;  2KYC A;  1SR6 B;  1XA5 A;  1IGV A;  2B1U A;  1C7V A;  1JFJ A;  2JNF A;  3NSK A;  2KBI A;  3O78 A;  1MWN A;  1CDP A;  1MR8 A;  2ZN9 A;  2KQY A;  2KFG A;  4U8D A;  2LE9 B;  1IQ3 A;  4YGD B;  1U5I A;  1YX7 A;  1TCO B;  3WXA A;  1WRZ A;  1R2U A;  1NIW A;  3VRO A;  2F8P A;  2WND A;  2LMV A;  1F55 A;  1B8R A;  1KFU S;  2MBX A;  1UWO A;  2K7B A;  3I5I B;  1UHI A;  1NYA A;  1OOJ A;  2I7A A;  1QAS A;  1K95 A;  2KAX A;  3TUY C;  5KU1 A;  5KSZ A;  4A4B A;  1X02 A;  1L7Z A;  2Q4U A;  4P5O E;  1IH0 A;  3AKB A;  4YGB B;  2LCP A;  2M0R A;  4ORC B;  1REC A;  2M8U A;  3VRQ A;  1B4C A;  5DKR A;  2Y5I A;  4CID A;  2L98 A;  3JVT B;  3TZ1 A;  2E6W A;  1DF0 A;  2KFF A;  1N0Y A;  1KFX L;  1YUR A;  2M29 A;  3GK2 A;  1QIV A;  2PVB A;  4D1E A;  4PAL A;  1QX5 B;  3IF7 A;  4TNC A;  1DGU A;  1TNX A;  1BJF A;  1QX7 A;  2L4H A;  1RRO A;  1YTZ C;  3ZWH A;  1DJI A;  2KAY A;  4F0Z B;  1QTX A;  1Y1X A;  1OZS A;  3LL8 B;  4PHN A;  1CMF A;  3CLN A;  1ZUZ A;  4QJ4 B;  1JBA A;  4PE1 A;  1EJ3 A;  4GGF A;  1KQV A;  3LLE A;  1M46 A;  2I2R E;  5F6T A;  1TOP A;  3EVR A;  1S5G Y;  3BUN B;  1N65 A;  1CFC A;  2GGZ A;  4NDC A;  1OMV A;  1GGW A;  1UHH A;  3EK7 A;  3SG2 A;  3FIA A;  1OSA A;  2R2I A;  1GJY A;  3OX5 A;  1KSO A;  1U5I B;  3GOF A;  5I2Q A;  2OS8 B;  3EK4 A;  3MSE B;  4YGE B;  2KGB C;  2TN4 A;  1CLB A;  4FTG A;  2JT0 A;  2EHB A;  3VRP A;  2L4I A;  2BL0 B;  1F4Q A;  3TS5 C;  2K7C A;  1J55 A;  3TDU A;  2BEC A;  2L50 A;  1L2O C;  1Y0V H;  2NLN A;  3SG7 A;  3A4U B;  2ZFD A;  4CLN A;  4PDZ A;  1DJX A;  1NWD A;  4MEW A;  5I2O A;  5I2L A;  2Y4Q A;  2PAL A;  5CSJ A;  2MLE C;  3GK4 X;  1KK8 C;  1S6C A;  2NCO A;  1F71 A;  2K7O A;  1MF8 B;  4MRY A;  2LVI A;  1A03 A;  4AOM A;  1NPQ A;  1RWY A;  1JF0 A;  2JTZ A;  2K8M B;  1FI6 A;  2FCE A;  4I5N B;  5HLV A;  2LM5 A;  2O5G A;  1SK6 D;  5HKY A;  1S1E A;  1V1G A;  1WY9 A;  2HQW A;  1J7P A;  3JTD C;  1NX1 A;  1SCM C;  2JC2 A;  2F33 A;  5JJG A;  1LA3 A;  5DKQ A;  3KPX A;  1WLM A;  1UUR A;  2ZKM X;  2EC6 C;  2L5X B;  3ICB A;  4BY4 A;  1CNP A;  5GQQ C;  1BU3 A;  1M63 B;  2KYF A;  3VRN A;  2CT9 A;  1DGV A;  2M1U A;  4MBE A;  2F2P A;  1CKK A;  2CTN A;  2LHL A;  4MVF A;  1B7T Z;  2JZI A;  2MAZ A;  1CFP A;  1F54 A;  1AHR A;  2LVV A;  3WHT B;  2PAS A;  4GNK B;  2KFH A;  1QLS A;  5AXI A;  1QAT A;  3BXK A;  3SG4 A;  1K9P A;  1K9U A;  1ALV A;  3SG3 A;  1B1G A;  2JUL A;  4WQ3 A;  1CDM A;  1JUO A;  2LVJ A;  1PRW A;  2LLS A;  1QVI Z;  2KI6 C;  1BR4 B;  1LIN A;  3LCP C;  4M2Q A;  4YI9 A;  5D69 A;  1K9K A;  2F3Z A;  3PLF B;  2LC5 A;  2H61 A;  1N2D A;  1MHO A;  1DJH A;  3I5F C;  1PAL A;  3BOW A;  4JWQ A;  3TDI A;  2HPS A;  2L2E A;  2LUC A;  2MRD A;  2BE6 A;  1IG5 A;  1NCX A;  4DCK A;  1OZO A;  3K21 A;  3TUY B;  1IQ5 A;  1SR6 C;  3I5H B;  1XFW O;  4GUK A;  4R1E A;  5HKZ A;  1YVL A;  2FOT A;  3IQO A;  2IS9 A;  4C0J A;  3EK8 A;  2M97 A;  2KBM A;  2ZND A;  1LXF C;  2Y1N A;  3EKH A;  1C07 A;  1TNW A;  2M49 B;  2MJW B;  2JXL A;  4NDB A;  1M39 A;  2CNP A;  4NQG A;  5CPV A;  1FBV A;  2LV7 A;  1AUI B;  1B8C A;  2KI6 D;  2L0P A;  2LP3 A;  1SL9 A;  1WDC C;  1YUS A;  3EKJ A;  1CFF A;  4MRX A;  1QV1 A;  2G2B A;  1QV0 A;  2BKI B;  1ALW A;  3AAK A;  1TIZ A;  4USL A;  2RGI A;  3DF0 A;  2LMT A;  1SL7 A;  1JF2 A;  3NSI A;  1J7O A;  1QIW A;  3D0Y A;  2OTG B;  5ER5 A;  1JFK A;  1CDL A;  1CFD A;  1YRU B;  4OV2 A;  1A4P A;  1QJT A;  2GV5 A;  2HET A;  1XFU O;  1CLM A;  2FJU B;  2K7D A;  3SG6 A;  2JU0 A;  1OQP A;  4CFQ A;  1QXP A;  3LK1 A;  4OCI A;  1H4B A;  2DOQ A;  1EG4 A;  2JXC A;  3DVJ A;  1XK4 C;  3VRR A;  4CFR A;  5J3X A;  1R6P A;  5ER4 X;  2K0J A;  3KHE A;  3BOW B;  4M2P A;  3KEV A;  1NCY A;  1KQM C;  2LAN A;  1LKJ A;  4FQO A;  3AAJ A;  4N1G A;  4PE4 A;  1TNQ A;  4N5X A;  1YX8 A;  1Y6W A;  2L51 A;  2M1K B;  4WQ2 A;  1S3P A;  2MLF C;  5AER A;  2WC8 A;  1ZOT B;  4MZJ A;  1CTR A;  2NZ0 A;  3OP0 A;  1HT9 A;  1MXL C;  3NXA A;  3M0W A;  2EGD A;  1PVA A;  2GGM A;  4QJ3 B;  4BY5 A;  1DT7 B;  5CSN A;  3EVV A;  1JC2 A;  1G4Y R;  1SBJ A;  4WRI A;  1B8L A;  1KK8 B;  3SJS A;  4L9M A;  2LUX A;  1KFU L; 
#chains in the Genus database with same CATH topology
 2JPT A;  5I94 A;  3OGN A;  1DF0 B;  4MZK A;  1CMG A;  1C7W A;  2OS8 C;  2QAC A;  3S0F A;  4OVN F;  1GQM A;  3IQQ A;  1BR1 B;  2LLU A;  3DF0 B;  1RFJ A;  3CGA A;  1S6I A;  1W9Z A;  2AMI A;  4YGC B;  1KWO C;  2BBN A;  2LHI A;  2QPT A;  1IWQ A;  1BOD A;  3PFV A;  2BCX A;  3D0Y B;  2KLD A;  2ZN8 A;  4OR9 B;  1W7J B;  5CSF A;  2P71 A;  1J1D A;  4XJK A;  2EC6 B;  4AQI A;  2K61 A;  2M7N A;  2AUC A;  3PN7 B;  3S0B A;  1BG1 A;  1J7Q A;  2KLE A;  4A4C A;  1BMO A;  1OOI X;  1JSA A;  3I5G B;  4HRG A;  4HRE E;  1ZAC A;  1TNP A;  4NDD A;  3OX6 A;  3WHU B;  1IRJ A;  3CZT X;  1TWO A;  1FF1 A;  2KQ6 A;  1K94 A;  3BQ3 A;  1KFX S;  3BUO B;  4M2O A;  1SL8 A;  2HF5 A;  1XFY O;  4MN0 A;  3DZT A;  1A29 A;  1K90 D;  4C0K A;  3CWG A;  3TDZ A;  1CDN A;  3BFA A;  2JT3 A;  2KI4 B;  2E30 A;  1DJZ A;  2KOT A;  1SMG A;  4ZCU A;  4OKH A;  1RJV A;  1DTL A;  1YR5 A;  1FPW A;  2FCD A;  1DJW A;  2M7L A;  1B7T Y;  1DEK A;  2BNX A;  3AKA A;  1QLK A;  1T14 A;  3DVE A;  1EH2 A;  2CXJ A;  1F4O A;  1XK4 A;  4YGA A;  1YUT A;  2WCF A;  5BPJ A;  4PCW A;  2A4J A;  2H2K A;  2Q91 A;  2WOS A;  3I5F B;  4INX A;  2AAO A;  4KYN A;  3EG5 B;  3O2P A;  4ORA B;  4PHK A;  3BUM B;  4F7F A;  1QX2 A;  2BCA A;  3GK1 A;  2L5Y A;  1B9A A;  3OHM B;  3EVU A;  2D8N A;  1K93 D;  1ODB A;  2K2F A;  1JWD A;  2LMU A;  2I94 A;  2Y1M A;  2BBM A;  2ZNE A;  2BCB A;  1QVI Y;  4HRH A;  1NP8 A;  1CM4 A;  1AJ5 A;  4MZL A;  4I5K A;  3D78 A;  2COL B;  4CPV A;  2M3W A;  2LNK A;  5KTY A;  1AP4 A;  4ETO A;  1LS8 A;  2JTT A;  2KGR A;  2LVK A;  3CR2 A;  3CS1 A;  3FS7 A;  3CR5 X;  5G08 A;  2H8V A;  4XJK B;  3VGO A;  2KSP A;  1S6J A;  1M31 A;  2V53 A;  1DMO A;  1WLZ A;  1RTP 1;  1PK0 D;  1S36 A;  3D73 A;  5D7F A;  1DC1 A;  3SG5 A;  1WDC B;  1P28 A;  1SRA A;  3L4L A;  5FI2 A;  2I18 A;  2JNX A;  1G33 A;  2PRU A;  1KCY A;  5D3O A;  4MLW A;  1YRT B;  1NSH A;  2WCM A;  1NUB A;  2ZRT A;  4UPG A;  1CB1 A;  2WCE A;  3I5I C;  2M9G A;  3SIB A;  1XVJ A;  3CTN A;  2JQ6 A;  3CZ0 A;  4DS7 A;  3I5H C;  1BLQ A;  3PAL A;  1EXR A;  1OE9 B;  1ZFS A;  3H4S E;  4ICB A;  1SCV A;  5FYX A;  5AEQ A;  1FI5 A;  3D75 A;  2QEO A;  3BUW B;  1DJY A;  2P6B B;  1BOC A;  1J7R A;  1MQ1 A;  2NCP A;  3O6B A;  1XYD A;  3IVT A;  1OOH A;  1ZMZ A;  3JVT C;  1V1F A;  4AQJ A;  3DVK A;  1SKT A;  5HL1 A;  1Q80 A;  5EL2 A;  1A2X A;  5PAL A;  2PSR A;  2BKH B;  3R1V A;  2BE4 A;  1KQM B;  2F2O A;  4PHJ A;  2OPO A;  1TRF A;  1S5G Z;  4N1F A;  1S26 D;  3DVM A;  5B8I B;  1Z4H A;  3N7H A;  5HLO A;  1OMD A;  3ZNI A;  3DYE A;  2K60 A;  1A75 A;  1K2H A;  1BF5 A;  2VRG A;  3FWB A;  1NCZ A;  2WCL A;  3OB1 B;  3TS5 B;  2OTG C;  4DUQ A;  1E8A A;  4MSP A;  1L2O B;  1SY9 A;  5DKN A;  3D10 A;  3S0E A;  1Y1A A;  1SPY A;  1WRL A;  2KNE A;  1MUX A;  2WCH A;  3HX4 A;  4GPL B;  1KK7 Z;  3C1V A;  4PE0 A;  4I5J A;  1PUL A;  1Z2C B;  4PE7 A;  1WRK A;  2O60 A;  1UUS A;  1G8I A;  3KO0 A;  4ZCV A;  1VRK A;  4QJ5 B;  1PSR A;  1QS7 A;  2H61 C;  2P70 A;  2MHH A;  4JQ0 D;  3WNX B;  3S0A A;  1D1O A;  3NSO A;  1HQV A;  4OZD A;  5HKW A;  1CM1 A;  5CSI A;  2LP2 A;  2JRF A;  3B87 A;  3RZS A;  1KK7 Y;  1XFZ O;  1IJ5 A;  2JPO A;  2JWW A;  2NXQ A;  5K89 A;  3SIA A;  1AK8 A;  2BL0 C;  4JPZ B;  1KWO B;  2JOJ A;  3CZ2 A;  3PAT A;  1Y1U A;  1M45 A;  3FWC A;  4GFT A;  3RM1 A;  1FW4 A;  1H8B A;  1EL4 A;  3DD4 A;  1SCM B;  3JTD B;  2SAS A;  2G9B A;  3E3R A;  2YGU A;  1IKU A;  3S0D A;  4C0L A;  5I8N A;  3DXL A;  4DIR A;  2KDH A;  3V2L A;  1OMR A;  2ISD A;  3A8R A;  1W7I B;  1CLL A;  2MA2 A;  1LA0 A;  1UP5 A;  5AFP A;  1NX2 A;  1TCF A;  2PMY A;  2QEV A;  3F45 A;  1IJ6 A;  2F3Y A;  1XFX O;  5TNC A;  3BYA A;  1LVC D;  1F8H A;  3CR4 X;  4IL1 A;  1SYM A;  1UHN A;  2KHN A;  4YBH B;  2HQ8 A;  2CCM A;  2JT8 A;  1NX3 A;  3HCM A;  1K96 A;  1MXE A;  1BT6 A;  4GBA A;  4Q04 A;  1DVI A;  1A75 B;  1RK9 A;  1DJG A;  3CYZ A;  1PVB A;  2WOR A;  2ZRS A;  2WCB A;  3LK0 A;  3DY9 A;  2FJY A;  1NX0 A;  3O4Y A;  1EG3 A;  4XYN A;  1B47 A;  1OOF A;  1SNL A;  3NHT A;  4YI8 A;  3FE8 A;  1F70 A;  3PN7 C;  4GGF C;  4DRW A;  4PHM A;  3BUX B;  1UHJ A;  2LAP A;  1TTX A;  1SW8 A;  4GGN A;  5JOL A;  3RLZ A;  5IBW A;  2SCP A;  4P2Y B;  2ERB A;  3I5G C;  3QRX A;  1YUU A;  1PSB A;  2KAV A;  3KF9 A;  3OB2 B;  1AVS A;  1J1E A;  2LLT A;  3PSR A;  3PM8 A;  1YVH A;  4E68 A;  1GGZ A;  1AJ4 A;  1TUZ A;  3NSL A;  1KSM A;  1TN4 A;  3D74 A;  1XFV O;  2CBL A;  5AAN A;  4I5L B;  2KI4 C;  1K8U A;  4GAO A;  4ORB B;  5HYD A;  1UHK A;  4HSZ A;  2K2A A;  1XO5 A;  2PYQ A;  2KYC A;  1SR6 B;  1XA5 A;  1IGV A;  2B1U A;  3OBV A;  1C7V A;  1JFJ A;  2JNF A;  3NSK A;  2KBI A;  3O78 A;  1MWN A;  1CDP A;  1MR8 A;  2ZN9 A;  2KQY A;  2KFG A;  4U8D A;  2LE9 B;  1IQ3 A;  4YGD B;  1U5I A;  1YX7 A;  1TCO B;  3WXA A;  1WRZ A;  1R2U A;  1NIW A;  3VRO A;  2F8P A;  2QDI A;  2WND A;  1C3Y A;  2LMV A;  1F55 A;  1B8R A;  1KFU S;  2MBX A;  1QWV A;  3S0G A;  1UWO A;  2K7B A;  3I5I B;  1UHI A;  1NYA A;  3UO9 A;  1OOJ A;  2I7A A;  1QAS A;  1K95 A;  2KAX A;  3TUY C;  5KU1 A;  5KSZ A;  4A4B A;  1X02 A;  1L7Z A;  2Q4U A;  4P5O E;  1IH0 A;  3AKB A;  4YGB B;  2LCP A;  2M0R A;  3SS5 A;  4ORC B;  1REC A;  1XFR A;  2M8U A;  3VRQ A;  3D77 A;  1B4C A;  5DKR A;  5DIC A;  2Y5I A;  4CID A;  2L98 A;  3JVT B;  3TZ1 A;  2E6W A;  1DF0 A;  2KFF A;  1GM0 A;  1N0Y A;  1KFX L;  1YUR A;  2M29 A;  3GK2 A;  1QIV A;  2PVB A;  4D1E A;  4PAL A;  3B88 A;  1QX5 B;  3IF7 A;  4TNC A;  1DGU A;  1TNX A;  1BJF A;  1QX7 A;  2L4H A;  1RRO A;  1YTZ C;  3ZWH A;  1DJI A;  2KAY A;  4F0Z B;  1QTX A;  1Y1X A;  1OZS A;  3LL8 B;  4PHN A;  1CMF A;  3CLN A;  1DQE A;  1ZUZ A;  4QJ4 B;  1JBA A;  4PE1 A;  1EJ3 A;  4GGF A;  1KQV A;  3LLE A;  3Q8I A;  1M46 A;  2I2R E;  5F6T A;  1TOP A;  3EVR A;  1S5G Y;  3BUN B;  1N65 A;  1CFC A;  2GGZ A;  4NDC A;  1OMV A;  1GGW A;  1UHH A;  3EK7 A;  3SG2 A;  3FIA A;  1OSA A;  2R2I A;  1GJY A;  3OX5 A;  3FE9 A;  1KSO A;  1U5I B;  1ORG A;  3GOF A;  5I2Q A;  3QME A;  2OS8 B;  3EK4 A;  3MSE B;  2WCJ A;  4YGE B;  2KGB C;  2TN4 A;  1CLB A;  1OW4 A;  4FTG A;  2JT0 A;  2EHB A;  3PJI A;  3VRP A;  2L4I A;  1DEL A;  3SS3 A;  2BL0 B;  2KPH A;  1F4Q A;  3BFH A;  2K7C A;  1C3Z A;  1J55 A;  3NGV A;  3TS5 C;  3TDU A;  2BEC A;  2L50 A;  1L2O C;  1Y0V H;  2NLN A;  3SG7 A;  3A4U B;  2ZFD A;  4CLN A;  4PDZ A;  1DJX A;  1NWD A;  4MEW A;  5I2O A;  5I2L A;  2Y4Q A;  2PAL A;  5CSJ A;  2MLE C;  3GK4 X;  1KK8 C;  1S6C A;  2NCO A;  1F71 A;  3VB1 A;  2K7O A;  1MF8 B;  4MRY A;  2L2C A;  2LVI A;  2QEH A;  4INW A;  4AOM A;  1A03 A;  1NPQ A;  1RWY A;  1JF0 A;  4YRU A;  2JTZ A;  2K8M B;  1FI6 A;  2FCE A;  4I5N B;  5HLV A;  2LM5 A;  2O5G A;  3O4X A;  1SK6 D;  5HKY A;  1S1E A;  1V1G A;  1WY9 A;  2HQW A;  1J7P A;  3JTD C;  1NX1 A;  1SCM C;  2JC2 A;  2F33 A;  5JJG A;  1LA3 A;  5DKQ A;  3KPX A;  1WLM A;  1UUR A;  2ZKM X;  2BAP A;  2EC6 C;  2L5X B;  3ICB A;  4BY4 A;  1CNP A;  5GQQ C;  1BU3 A;  1M63 B;  2KYF A;  3VRN A;  1DGV A;  2CT9 A;  2M1U A;  3CAB A;  4MBE A;  3B86 A;  2F2P A;  1CKK A;  2CTN A;  2LHL A;  3L4A A;  4MVF A;  1B7T Z;  2JZI A;  2MAZ A;  1CFP A;  1F54 A;  1AHR A;  2LVV A;  3WHT B;  2PAS A;  4GNK B;  2KFH A;  1QLS A;  5AXI A;  4PT1 A;  1QAT A;  1IIO A;  2GTE A;  3BXK A;  3CZ1 A;  4JD9 A;  3SG4 A;  1K9P A;  1K9U A;  3L47 A;  1ALV A;  3B6X A;  3SG3 A;  1OOG A;  1B1G A;  2JUL A;  4WQ3 A;  1CDM A;  1JUO A;  4JKT A;  2LVJ A;  3NHI A;  1PRW A;  2LLS A;  1QVI Z;  2KI6 C;  1BR4 B;  1LIN A;  3LCP C;  4M2Q A;  4YI9 A;  5D69 A;  1K9K A;  2F3Z A;  3PLF B;  2LC5 A;  2H61 A;  1N2D A;  1MHO A;  1DJH A;  3I5F C;  1PAL A;  3BOW A;  4JWQ A;  3TDI A;  2HPS A;  2L2E A;  2LUC A;  2MRD A;  4IJ7 A;  2BE6 A;  1IG5 A;  1NCX A;  4DCK A;  1OZO A;  3K21 A;  1SSE B;  3TUY B;  3FE6 A;  1IQ5 A;  3K1E A;  1SR6 C;  3I5H B;  1XFW O;  4GUK A;  4R1E A;  5HKZ A;  1YVL A;  2FOT A;  3B7A A;  3BJH A;  3IQO A;  3SS4 A;  2IS9 A;  4C0J A;  3EK8 A;  3CDN A;  2M97 A;  2KBM A;  2ZND A;  1LXF C;  2Y1N A;  3EKH A;  3R1O A;  5FI7 A;  1C07 A;  1TNW A;  2M49 B;  2MJW B;  2JXL A;  4NDB A;  1M39 A;  2CNP A;  3R1P A;  2WCK A;  4NQG A;  5CPV A;  1FBV A;  3D76 A;  2LV7 A;  1AUI B;  1B8C A;  2KI6 D;  2L0P A;  3PM2 A;  2LP3 A;  1SL9 A;  1WDC C;  1YUS A;  3EKJ A;  1CFF A;  4MRX A;  1QV1 A;  2G2B A;  1QV0 A;  2BKI B;  1ALW A;  3AAK A;  1TIZ A;  4USL A;  2RGI A;  3DF0 A;  2LMT A;  1SL7 A;  1JF2 A;  3NSI A;  1J7O A;  1QIW A;  3D0Y A;  3BFB A;  2OTG B;  5ER5 A;  1JFK A;  1CDL A;  1CFD A;  1YRU B;  4OV2 A;  1A4P A;  1QJT A;  2GV5 A;  2HET A;  1XFU O;  1CLM A;  1TUJ A;  2FJU B;  2K7D A;  3SG6 A;  2JU0 A;  1OQP A;  4CFQ A;  1QXP A;  3LK1 A;  4OCI A;  1H4B A;  2QEB A;  2DOQ A;  1EG4 A;  2JXC A;  3DVJ A;  1XK4 C;  3VRR A;  4CFR A;  5J3X A;  1R6P A;  5ER4 X;  2K0J A;  3KHE A;  4FQT A;  3BOW B;  4M2P A;  3KEV A;  1NCY A;  2WC6 A;  1KQM C;  2LAN A;  1LKJ A;  4FQO A;  5FI6 A;  3UNW A;  3AAJ A;  4N1G A;  4PE4 A;  1TNQ A;  4N5X A;  1YX8 A;  1Y6W A;  2L51 A;  2WC5 A;  2M1K B;  4WQ2 A;  1S3P A;  2MLF C;  5AER A;  2WC8 A;  1ZOT B;  3R72 A;  4MZJ A;  1CTR A;  2NZ0 A;  3OP0 A;  1HT9 A;  1MXL C;  2PQL A;  3M0W A;  2EGD A;  1PVA A;  2GGM A;  3NXA A;  4QJ3 B;  4BY5 A;  5CSN A;  1DT7 B;  3EVV A;  1JC2 A;  1G4Y R;  1SBJ A;  4WRI A;  1B8L A;  1KK8 B;  3SJS A;  4L9M A;  2LUX A;  1KFU L; 
#chains in the Genus database with same CATH homology
 2JPT A;  1DF0 B;  4MZK A;  1CMG A;  1C7W A;  2OS8 C;  2QAC A;  4OVN F;  1GQM A;  3IQQ A;  1BR1 B;  2LLU A;  3DF0 B;  1RFJ A;  3CGA A;  1S6I A;  2AMI A;  4YGC B;  1KWO C;  2BBN A;  2LHI A;  2QPT A;  1IWQ A;  1BOD A;  3PFV A;  2BCX A;  3D0Y B;  2ZN8 A;  4OR9 B;  1W7J B;  5CSF A;  4XJK A;  1J1D A;  2EC6 B;  4AQI A;  2K61 A;  2M7N A;  2AUC A;  3PN7 B;  1BG1 A;  1J7Q A;  4A4C A;  1BMO A;  1JSA A;  3I5G B;  4HRG A;  4HRE E;  1ZAC A;  1TNP A;  4NDD A;  3OX6 A;  3WHU B;  1IRJ A;  3CZT X;  1FF1 A;  2KQ6 A;  1K94 A;  3BQ3 A;  1KFX S;  3BUO B;  4M2O A;  1SL8 A;  2HF5 A;  1XFY O;  4MN0 A;  1A29 A;  1K90 D;  4C0K A;  3CWG A;  3TDZ A;  1CDN A;  2JT3 A;  2KI4 B;  2E30 A;  1DJZ A;  2KOT A;  1SMG A;  4ZCU A;  4OKH A;  1RJV A;  1DTL A;  1YR5 A;  1FPW A;  2FCD A;  1DJW A;  2M7L A;  1B7T Y;  3AKA A;  1QLK A;  3DVE A;  1EH2 A;  2CXJ A;  1F4O A;  1XK4 A;  4YGA A;  1YUT A;  2WCF A;  5BPJ A;  4PCW A;  2A4J A;  2H2K A;  2Q91 A;  2WOS A;  3I5F B;  2AAO A;  3O2P A;  4ORA B;  4PHK A;  3BUM B;  1QX2 A;  2BCA A;  3GK1 A;  1B9A A;  3OHM B;  3EVU A;  2D8N A;  1K93 D;  1ODB A;  2K2F A;  1JWD A;  2LMU A;  2I94 A;  2Y1M A;  2BBM A;  2ZNE A;  2BCB A;  1QVI Y;  4HRH A;  1NP8 A;  1CM4 A;  1AJ5 A;  4MZL A;  4I5K A;  2COL B;  4CPV A;  2M3W A;  2LNK A;  5KTY A;  1AP4 A;  4ETO A;  3CR2 A;  2JTT A;  2KGR A;  2LVK A;  3CS1 A;  3FS7 A;  3CR5 X;  5G08 A;  3VGO A;  4XJK B;  2KSP A;  1S6J A;  1M31 A;  2V53 A;  1DMO A;  1WLZ A;  1RTP 1;  1PK0 D;  1S36 A;  5D7F A;  3SG5 A;  1WDC B;  1SRA A;  2I18 A;  2JNX A;  1G33 A;  2PRU A;  1KCY A;  4MLW A;  1YRT B;  1NSH A;  2ZRT A;  1NUB A;  4UPG A;  1CB1 A;  2WCE A;  3I5I C;  2M9G A;  3SIB A;  1XVJ A;  3CTN A;  2JQ6 A;  4DS7 A;  3I5H C;  1BLQ A;  3PAL A;  1EXR A;  1OE9 B;  1ZFS A;  3H4S E;  4ICB A;  1SCV A;  5FYX A;  5AEQ A;  1FI5 A;  3BUW B;  1DJY A;  2P6B B;  1BOC A;  1J7R A;  1MQ1 A;  2NCP A;  3O6B A;  1XYD A;  1ZMZ A;  3JVT C;  1V1F A;  4AQJ A;  3DVK A;  1SKT A;  1Q80 A;  1A2X A;  5PAL A;  2PSR A;  2BKH B;  2BE4 A;  1KQM B;  2F2O A;  4PHJ A;  2OPO A;  1TRF A;  1S5G Z;  4N1F A;  1S26 D;  3DVM A;  5B8I B;  5HLO A;  1OMD A;  3ZNI A;  1A75 A;  1K2H A;  1BF5 A;  2VRG A;  3FWB A;  1NCZ A;  3OB1 B;  3TS5 B;  2OTG C;  4DUQ A;  1E8A A;  4MSP A;  1L2O B;  1SY9 A;  5DKN A;  3D10 A;  1Y1A A;  1SPY A;  1WRL A;  2KNE A;  1MUX A;  3HX4 A;  4GPL B;  1KK7 Z;  3C1V A;  4PE0 A;  4I5J A;  1PUL A;  4PE7 A;  1WRK A;  2O60 A;  1UUS A;  1G8I A;  3KO0 A;  4ZCV A;  1VRK A;  4QJ5 B;  1PSR A;  1QS7 A;  2H61 C;  3WNX B;  2MHH A;  4JQ0 D;  1D1O A;  3NSO A;  1HQV A;  5HKW A;  1CM1 A;  5CSI A;  2LP2 A;  2JRF A;  1KK7 Y;  1XFZ O;  1IJ5 A;  2JWW A;  2NXQ A;  5K89 A;  3SIA A;  1AK8 A;  2BL0 C;  4JPZ B;  1KWO B;  2JOJ A;  3PAT A;  1Y1U A;  1M45 A;  3FWC A;  4GFT A;  3RM1 A;  1FW4 A;  1H8B A;  1EL4 A;  3DD4 A;  1SCM B;  3JTD B;  2SAS A;  2G9B A;  3E3R A;  1IKU A;  4C0L A;  5I8N A;  4DIR A;  2KDH A;  1OMR A;  2ISD A;  3A8R A;  1W7I B;  1CLL A;  2MA2 A;  1LA0 A;  1UP5 A;  5AFP A;  1NX2 A;  1TCF A;  2PMY A;  3F45 A;  1IJ6 A;  2F3Y A;  1XFX O;  5TNC A;  3BYA A;  1LVC D;  1F8H A;  3CR4 X;  4IL1 A;  1SYM A;  1UHN A;  2KHN A;  4YBH B;  2HQ8 A;  2CCM A;  2JT8 A;  1NX3 A;  3HCM A;  1K96 A;  1MXE A;  1BT6 A;  4GBA A;  4Q04 A;  1DVI A;  1A75 B;  1RK9 A;  1DJG A;  1PVB A;  2WOR A;  2ZRS A;  2WCB A;  3LK0 A;  1NX0 A;  3O4Y A;  1EG3 A;  4XYN A;  1B47 A;  1SNL A;  4YI8 A;  1F70 A;  3PN7 C;  4GGF C;  4DRW A;  4PHM A;  3BUX B;  1UHJ A;  2LAP A;  1TTX A;  1SW8 A;  4GGN A;  5JOL A;  3RLZ A;  5IBW A;  2SCP A;  4P2Y B;  3I5G C;  3QRX A;  1YUU A;  1PSB A;  2KAV A;  3KF9 A;  3OB2 B;  1AVS A;  1J1E A;  2LLT A;  3PSR A;  3PM8 A;  1YVH A;  4E68 A;  1GGZ A;  1AJ4 A;  3NSL A;  5AAN A;  1KSM A;  1TN4 A;  4YRU A;  1XFV O;  2CBL A;  4I5L B;  2KI4 C;  1K8U A;  4GAO A;  4ORB B;  5HYD A;  1UHK A;  4HSZ A;  2K2A A;  1XO5 A;  2KYC A;  1SR6 B;  1XA5 A;  1IGV A;  2B1U A;  1C7V A;  1JFJ A;  2JNF A;  3NSK A;  2KBI A;  3O78 A;  1MWN A;  1CDP A;  1MR8 A;  2ZN9 A;  2KQY A;  2KFG A;  4U8D A;  2LE9 B;  1IQ3 A;  4YGD B;  1U5I A;  1YX7 A;  1TCO B;  3WXA A;  1WRZ A;  1R2U A;  1NIW A;  3VRO A;  2F8P A;  2WND A;  2LMV A;  1F55 A;  1B8R A;  1KFU S;  2MBX A;  1UWO A;  2K7B A;  3I5I B;  1UHI A;  1NYA A;  1OOJ A;  2I7A A;  1QAS A;  1K95 A;  2KAX A;  3TUY C;  5KU1 A;  5KSZ A;  4A4B A;  1X02 A;  1L7Z A;  2Q4U A;  4P5O E;  1IH0 A;  3AKB A;  4YGB B;  2LCP A;  2M0R A;  4ORC B;  1REC A;  2M8U A;  3VRQ A;  1B4C A;  5DKR A;  2Y5I A;  4CID A;  2L98 A;  3JVT B;  3TZ1 A;  2E6W A;  1DF0 A;  2KFF A;  1N0Y A;  1KFX L;  1YUR A;  2M29 A;  3GK2 A;  1QIV A;  2PVB A;  4D1E A;  4PAL A;  1QX5 B;  3IF7 A;  4TNC A;  1DGU A;  1TNX A;  1BJF A;  1QX7 A;  2L4H A;  1RRO A;  1YTZ C;  3ZWH A;  1DJI A;  2KAY A;  4F0Z B;  1QTX A;  1Y1X A;  1OZS A;  3LL8 B;  4PHN A;  1CMF A;  3CLN A;  1ZUZ A;  4QJ4 B;  1JBA A;  4PE1 A;  1EJ3 A;  4GGF A;  1KQV A;  3LLE A;  1M46 A;  2I2R E;  5F6T A;  1TOP A;  3EVR A;  1S5G Y;  3BUN B;  1N65 A;  1CFC A;  2GGZ A;  4NDC A;  1OMV A;  1GGW A;  1UHH A;  3EK7 A;  3SG2 A;  3FIA A;  1OSA A;  2R2I A;  1GJY A;  3OX5 A;  1KSO A;  1U5I B;  3GOF A;  5I2Q A;  2OS8 B;  3EK4 A;  3MSE B;  4YGE B;  2KGB C;  2TN4 A;  1CLB A;  4FTG A;  2JT0 A;  2EHB A;  3VRP A;  2L4I A;  2BL0 B;  1F4Q A;  3TS5 C;  2K7C A;  1J55 A;  3TDU A;  2BEC A;  2L50 A;  1L2O C;  1Y0V H;  2NLN A;  3SG7 A;  3A4U B;  2ZFD A;  4CLN A;  4PDZ A;  1DJX A;  1NWD A;  4MEW A;  5I2O A;  5I2L A;  2Y4Q A;  2PAL A;  5CSJ A;  2MLE C;  3GK4 X;  1KK8 C;  1S6C A;  2NCO A;  1F71 A;  2K7O A;  1MF8 B;  4MRY A;  2LVI A;  1A03 A;  4AOM A;  1NPQ A;  1RWY A;  1JF0 A;  2JTZ A;  2K8M B;  1FI6 A;  2FCE A;  4I5N B;  5HLV A;  2LM5 A;  2O5G A;  1SK6 D;  5HKY A;  1S1E A;  1V1G A;  1WY9 A;  2HQW A;  1J7P A;  3JTD C;  1NX1 A;  1SCM C;  2JC2 A;  2F33 A;  5JJG A;  1LA3 A;  5DKQ A;  3KPX A;  1WLM A;  1UUR A;  2ZKM X;  2EC6 C;  2L5X B;  3ICB A;  4BY4 A;  1CNP A;  5GQQ C;  1BU3 A;  1M63 B;  2KYF A;  3VRN A;  2CT9 A;  1DGV A;  2M1U A;  4MBE A;  2F2P A;  1CKK A;  2CTN A;  2LHL A;  4MVF A;  1B7T Z;  2JZI A;  2MAZ A;  1CFP A;  1F54 A;  1AHR A;  2LVV A;  3WHT B;  2PAS A;  4GNK B;  2KFH A;  1QLS A;  5AXI A;  1QAT A;  3BXK A;  3SG4 A;  1K9P A;  1K9U A;  1ALV A;  3SG3 A;  1B1G A;  2JUL A;  4WQ3 A;  1CDM A;  1JUO A;  2LVJ A;  1PRW A;  2LLS A;  1QVI Z;  2KI6 C;  1BR4 B;  1LIN A;  3LCP C;  4M2Q A;  4YI9 A;  5D69 A;  1K9K A;  2F3Z A;  3PLF B;  2LC5 A;  2H61 A;  1N2D A;  1MHO A;  1DJH A;  3I5F C;  1PAL A;  3BOW A;  4JWQ A;  3TDI A;  2HPS A;  2L2E A;  2LUC A;  2MRD A;  2BE6 A;  1IG5 A;  1NCX A;  4DCK A;  1OZO A;  3K21 A;  3TUY B;  1IQ5 A;  1SR6 C;  3I5H B;  1XFW O;  4GUK A;  4R1E A;  5HKZ A;  1YVL A;  2FOT A;  3IQO A;  2IS9 A;  4C0J A;  3EK8 A;  2M97 A;  2KBM A;  2ZND A;  1LXF C;  2Y1N A;  3EKH A;  1C07 A;  1TNW A;  2M49 B;  2MJW B;  2JXL A;  4NDB A;  1M39 A;  2CNP A;  4NQG A;  5CPV A;  1FBV A;  2LV7 A;  1AUI B;  1B8C A;  2KI6 D;  2L0P A;  2LP3 A;  1SL9 A;  1WDC C;  1YUS A;  3EKJ A;  1CFF A;  4MRX A;  1QV1 A;  2G2B A;  1QV0 A;  2BKI B;  1ALW A;  3AAK A;  1TIZ A;  4USL A;  2RGI A;  3DF0 A;  2LMT A;  1SL7 A;  1JF2 A;  3NSI A;  1J7O A;  1QIW A;  3D0Y A;  2OTG B;  5ER5 A;  1JFK A;  1CDL A;  1CFD A;  1YRU B;  4OV2 A;  1A4P A;  1QJT A;  2GV5 A;  2HET A;  1XFU O;  1CLM A;  2FJU B;  2K7D A;  3SG6 A;  2JU0 A;  1OQP A;  4CFQ A;  1QXP A;  3LK1 A;  4OCI A;  1H4B A;  2DOQ A;  1EG4 A;  2JXC A;  3DVJ A;  1XK4 C;  3VRR A;  4CFR A;  5J3X A;  1R6P A;  5ER4 X;  2K0J A;  3KHE A;  3BOW B;  4M2P A;  3KEV A;  1NCY A;  1KQM C;  2LAN A;  1LKJ A;  4FQO A;  3AAJ A;  4N1G A;  4PE4 A;  1TNQ A;  4N5X A;  1YX8 A;  1Y6W A;  2L51 A;  2M1K B;  4WQ2 A;  1S3P A;  2MLF C;  5AER A;  2WC8 A;  1ZOT B;  4MZJ A;  1CTR A;  2NZ0 A;  3OP0 A;  1HT9 A;  1MXL C;  3NXA A;  3M0W A;  2EGD A;  1PVA A;  2GGM A;  4QJ3 B;  4BY5 A;  1DT7 B;  5CSN A;  3EVV A;  1JC2 A;  1G4Y R;  1SBJ A;  4WRI A;  1B8L A;  1KK8 B;  3SJS A;  4L9M A;  2LUX A;  1KFU L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...