1UHKA

Crystal structure of n-aequorin
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
191
structure length
191
Chain Sequence
ANSKLTSDFDNPRWIGRHKHMFNFLDVNHNGKISLDEMVYKASDIVINNLGATPEQAKRHKDAVEAFFGGAGMKYGVETDWPAYIEGWKKLATDELEKYAKNEPTLIRIWGDALFDIVDKDQNGAITLDEWKAYTKAAGIIQSSEDCEETFRVCDIDESGQLDVDEMTRQHLGFWYTMDPACEKLYGGAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aequorin 2
publication title The crystal structures of semi-synthetic aequorins
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Luminescent protein
total genus 73
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1uhkA00
1KSOA 4I5KA 1F71A 1WDCB 4DIRA 4M2PA 1BLQA 2KAVA 1XO5A 1J1EA 3CR5X 2KFFA 1WLZA 2JXCA 4ZCVA 4QJ4B 1K94A 4QJ3B 1YR5A 3GK4X 3F45A 4HRHA 4ORAB 3O2PA 4MVFA 1CNPA 2BL0B 2LVVA 2AAOA 1JBAA 1YRUB 2AMIA 1OMVA 1QX2A 3BOWB 5IBWA 4XJKB 4JQ0D 4TNCA 1PALA 2R2IA 3A4UB 1SMGA 4WQ2A 5DKNA 2JOJA 2M3WA 4OVNF 1YURA 2MLEC 1SYMA 2AUCA 1UUSA 3SG4A 2EHBA 1K9KA 1SRAA 3CWGA 4YGBB 2PMYA 2LNKA 3SG3A 1S5GZ 4CFRA 1MXLC 2LHLA 4D1EA 1TTXA 1Y1UA 2GGMA 4P5OE 3EK7A 4HRGA 1V1FA 2JTZA 4MRXA 3KF9A 4YGDB 1CDNA 4OCIA 3BUXB 1SCMB 4C0LA 4YGAA 1KWOC 2NLNA 2I7AA 2K7DA 2LE9B 1JF2A 1GGWA 1CFFA 1RK9A 2EGDA 1SL7A 2M49B 2MJWB 4OKHA 2Y5IA 1CMFA 1K9UA 2LUXA 1A29A 2D8NA 1SCVA 1KQMB 4CFQA 1N2DA 1DF0B 2JULA 2KFHA 1YUSA 1AK8A 1CDMA 1KK8C 1JFKA 4JPZB 1UWOA 1B8CA 3KPXA 1PVBA 1S6IA 4PE4A 1DJWA 1CM4A 4PHNA 2ISDA 1NWDA 3BXKA 1KK8B 2GV5A 2PVBA 3BOWA 4XJKA 2KI4B 3TS5C 2JT8A 3NXAA 2VRGA 2KBIA 4CPVA 5AEQA 2KOTA 1YRTB 1LXFC 1NX1A 2CCMA 3BUWB 4AQJA 2KI6D 1QTXA 2OTGC 3K21A 2F2OA 5HKZA 2WNDA 1J7OA 1QX5B 1M31A 1FI5A 1CLLA 1CLBA 1SKTA 1B1GA 1PULA 1F54A 1TCOB 1L7ZA 1RWYA 3IQOA 3VROA 5B8IB 2NZ0A 3O78A 1YTZC 4N5XA 1BT6A 3EK4A 2OTGB 1CDLA 1LINA 3PALA 3AAKA 4NDCA 4WQ3A 2ZKMX 1DJYA 4HREE 2M7NA 3MSEB 1Y1AA 4MZJA 2ZRSA 4BY4A 2NXQA 2Y4QA 1KSMA 1IG5A 1QX7A 2LANA 1LVCD 3C1VA 1S6JA 1NCYA 1C7VA 3CGAA 2PASA 1Y0VH 5DKRA 1KK7Z 2JNXA 2K7OA 1B4CA 1IRJA 1K9PA 2Y1NA 3EKHA 1DMOA 1S36A 1JC2A 2MRDA 1UHJA 1UHKA 2PALA 3WXAA 1ZFSA 4MSPA 3I5HB 1DF0A 1XFUO 4GGNA 3O4YA 1Y1XA 2M29A 2LAPA 2LMTA 2ZFDA 3AAJA 1BODA 1CLMA 2BCBA 3GK1A 1GJYA 1DGVA 1PRWA 1TNXA 1CMGA 3VRNA 5JJGA 2LVKA 2H2KA 1RECA 2BL0C 3JVTC 4YGCB 5HKYA 3BUOB 2HF5A 3PLFB 1OMDA 1MQ1A 4PE1A 1F70A 2BKHB 5KSZA 3OX5A 1J7QA 1DJHA 4OV2A 3WNXB 2E6WA 3KO0A 1DT7B 2JC2A 1K95A 1LA0A 2PRUA 3JVTB 4I5LB 3RLZA 3O6BA 1QV1A 4NQGA 3EK8A 2TN4A 1MXEA 3EVVA 3PATA 4FQOA 1J1DA 1XFXO 2LLTA 1CDPA 2BBNA 1OZOA 1TRFA 2KQ6A 3DVJA 2JQ6A 3LCPC 4MEWA 1XFWO 1QJTA 2CT9A 2HETA 2M0RA 2WORA 4NDBA 5CSJA 2BECA 2G9BA 1NX0A 1A2XA 1JWDA 2L4HA 2L50A 2LM5A 1YUTA 1SCMC 2KYFA 4UPGA 3FWCA 1G33A 1B7TY 4GBAA 2MBXA 1WLMA 2OS8C 2LP2A 5KTYA 2F33A 3D0YA 2CBLA 1IQ5A 1N65A 1B8LA 1ZMZA 1W7IB 1F8HA 1FW4A 4XYNA 1N0YA 1QXPA 5CSIA 2BE6A 4I5JA 1NCXA 1M63B 4YGEB 3SIAA 2M7LA 5KU1A 2BBMA 1K96A 1XYDA 1TOPA 2GGZA 2OS8B 3DD4A 3DVEA 4U8DA 3VRRA 3OB1B 1BF5A 1EL4A 1KQMC 1X02A 2LMVA 3AKBA 5AANA 1IH0A 1JSAA 1SR6C 3OP0A 4HSZA 1XFVO 3I5FB 2WCFA 1XFZO 3WHTB 1QVIZ 2NCPA 2CNPA 2BE4A 4PALA 3CR4X 1NP8A 2K0JA 4GNKB 1SR6B 4MBEA 2KSPA 2JZIA 1ALWA 1CFDA 4R1EA 1SW8A 4A4CA 2LHIA 2WOSA 3PN7B 2ZN8A 1CKKA 2KI4C 4GAOA 3HX4A 1AUIB 2QPTA 3FIAA 4AQIA 2V53A 1QATA 2JU0A 1KFUS 4WRIA 2I2RE 1UHNA 2LCPA 1MUXA 1TNPA 3NSOA 2Y1MA 1CM1A 2F2PA 2KI6C 2FCDA 1KFUL 1AJ5A 1TNWA 2MAZA 2L4IA 2M9GA 2O60A 1B9AA 3NSLA 1FBVA 3TUYB 1IWQA 2FJUB 2LLUA 3DF0B 4PHMA 1Y6WA 2KAXA 3SG2A 5CSFA 3LK0A 3E3RA 4PE7A 1YVHA 1MR8A 3VRQA 3LK1A 4FTGA 3TDZA 1U5IA 3M0WA 1EG3A 3CZTX 3TDIA 2LLSA 2MHHA 4GGFA 3PM8A 1OE9B 1S6CA 1PK0D 4PHJA 1DVIA 2ZNDA 1QV0A 1MHOA 1ODBA 3ZWHA 1C07A 1QIWA 3D0YB 1XK4A 2WCEA 3IQQA 1AP4A 3BQ3A 3I5HC 3GK2A 2KFGA 1PSBA 1UHIA 1GGZA 1TIZA 2BKIB 4MZKA 1M45A 1DGUA 2E30A 1FPWA 3SJSA 1IJ5A 1SK6D 2JRFA 4MRYA 5DKQA 2JPTA 4PHKA 1K8UA 1WRKA 1R2UA 2Q4UA 1OMRA 3IF7A 2ZN9A 5D7FA 1J7PA 4L9MA 2I18A 1E8AA 2KNEA 1DTLA 1PVAA 1LKJA 2G2BA 2LV7A 2M97A 3ICBA 4OR9B 5JOLA 5BPJA 1BR4B 1K93D 1MWNA 3AKAA 1CFCA 1NX2A 1EG4A 1RTP1 4C0JA 1NIWA 1WRLA 2LMUA 1B8RA 1S26D 4GPLB 3EKJA 1W7JB 3BUMB 3LL8B 2M1KB 1BG1A 1J7RA 2F8PA 3OHMB 3VRPA 1S3PA 2LUCA 1QASA 2JXLA 2JNFA 1L2OC 4ZCUA 2ZRTA 3I5GB 2LVJA 4M2OA 4BY5A 3CS1A 2A4JA 3I5IB 2K8MB 2KHNA 2M1UA 5FYXA 5HYDA 5G08A 1UHHA 2BCXA 1XVJA 2P6BB 4N1GA 2F3YA 1CFPA 1YUUA 3DF0A 4PCWA 5ER5A 1L2OB 4DUQA 1HQVA 2L98A 1EXRA 2HQ8A 3CR2A 4PE0A 5CSNA 3PFVA 1DJXA 2SCPA 4YI8A 1NUBA 1IGVA 1QLSA 4GFTA 2O5GA 3D10A 3JTDC 4GGFC 2RGIA 1OZSA 4NDDA 4I5NB 3LLEA 2KGBC 5HLVA 2JTTA 4MLWA 2FOTA 1NX3A 3RM1A 1XK4C 1U5IB 4F0ZB 4YI9A 3JTDB 3I5FC 1SL9A 2CXJA 2L2EA 5AFPA 1B47A 2H61A 1TN4A 2DOQA 2K61A 1HT9A 3QRXA 1KFXS 1OOJA 2WCBA 4YRUA 1S1EA 4ORCB 3NSKA 1CTRA 4GUKA 3WHUB 2K7CA 5K89A 1AVSA 4Q04A 1PSRA 2LC5A 3PN7C 1JUOA 1C7WA 2HQWA 1F4OA 3ZNIA 2SASA 1J55A 3GOFA 1KFXL 2M8UA 5J3XA 2KGRA 4M2QA 1IKUA 1NYAA 2EC6C 1GQMA 2MA2A 1QS7A 2MLFC 1WY9A 4E68A 2KYCA 2BCAA 1AHRA 1JF0A 1M39A 3CTNA 1KCYA 1WRZA 3NSIA 1KK7Y 4IL1A 2JT0A 1TCFA 2JWWA 1H8BA 2JT3A 5AXIA 1A75A 1SNLA 2EC6B 1KWOB 1VRKA 3TUYC 2FCEA 4MN0A 3HCMA 5ER4X 2K2FA 1DJGA 2L0PA 1K90D 1EH2A 1FF1A 3TZ1A 2QACA 1OSAA 1YX7A 5D69A 4A4BA 1RFJA 2IS9A 4AOMA 3BUNB 1DJZA 1Q80A 1B7TZ 5F6TA 1MF8B 1ZACA 1UURA 1G8IA 2COLB 1SBJA 1JFJA 3CLNA 3FS7A 1OQPA 1ZOTB 3SG7A 4DS7A 4C0KA 5I8NA 1KQVA 5I2QA 1BOCA 1BMOA 1SL8A 1TNQA 2F3ZA 2H61C 3KHEA 5GQQC 2K2AA 1V1GA 1M46A 1H4BA 4ORBB 5TNCA 4USLA 5CPVA 1SPYA 1A4PA 3TS5B 4ICBA 1CB1A 4ETOA 1BJFA 4JWQA 1YX8A 2ZNEA 4QJ5B 1XA5A 2PSRA 3OB2B 2KAYA 1AJ4A 1F4QA 1SY9A 2KBMA 1S5GY 1A03A 1DJIA 1ALVA 1IJ6A 5I2OA 3DVMA 1LA3A 1RROA 1G4YR 1UP5A 2LVIA 3SIBA 2L5XB 1IQ3A 1EJ3A 2KQYA 2KDHA 3EVRA 1QLKA 5I2LA 3DVKA 3SG6A 3TDUA 4DRWA 1NPQA 1RJVA 2OPOA 3H4SE 3I5GC 4YBHB 3VGOA 1NCZA 2K7BA 1YVLA 2B1UA 1XFYO 3I5IC 1R6PA 1F55A 3OX6A 4CIDA 3FWBA 4P2YB 2NCOA 2WC8A 1K2HA 1NSHA 1BR1B 4N1FA 4PDZA 3SG5A 4CLNA 1QIVA 5HLOA 2I94A 2HPSA 1WDCC 1QVIY 2CTNA 4DCKA 1A75B 5PALA 3BYAA 2L51A 2Q91A 3EVUA 5AERA 1D1OA 2LP3A 1ZUZA 3KEVA 5HKWA 1BU3A 3PSRA 3A8RA 4MZLA 1FI6A
chains in the Genus database with same CATH superfamily
1KSOA 4I5KA 1F71A 1WDCB 4DIRA 4M2PA 1BLQA 2KAVA 1XO5A 1J1EA 3CR5X 2KFFA 1WLZA 2JXCA 4ZCVA 4QJ4B 1K94A 1ORGA 4QJ3B 1YR5A 3GK4X 3F45A 4HRHA 4ORAB 3O2PA 4MVFA 1CNPA 2BL0B 3D75A 5I94A 2LVVA 3D74A 3BFBA 3SS5A 2AAOA 1JBAA 1YRUB 2AMIA 1OMVA 1QX2A 3BOWB 5IBWA 4XJKB 3R1OA 4JQ0D 4TNCA 1PALA 1OOFA 2R2IA 3A4UB 1SMGA 4WQ2A 5DKNA 2JOJA 2M3WA 4OVNF 3SS4A 1YURA 2MLEC 1SYMA 2AUCA 1UUSA 3SG4A 2EHBA 1K9KA 1SRAA 3CWGA 4YGBB 2PMYA 2LNKA 3SG3A 1S5GZ 4CFRA 1MXLC 2LHLA 4D1EA 1TTXA 1Y1UA 2GGMA 3CYZA 4P5OE 3EK7A 4HRGA 1T14A 1V1FA 2JTZA 4MRXA 3KF9A 4YGDB 1CDNA 4OCIA 3BUXB 1SCMB 4C0LA 4YGAA 3B88A 1KWOC 2NLNA 2I7AA 2K7DA 2LE9B 3BJHA 2WCMA 1JF2A 1GGWA 1CFFA 2ERBA 1RK9A 2EGDA 1SL7A 2M49B 2MJWB 4OKHA 2Y5IA 1OOHA 1CMFA 1K9UA 2LUXA 1A29A 2D8NA 1SCVA 1KQMB 4CFQA 1N2DA 1DF0B 2JULA 2KFHA 1YUSA 1AK8A 1CDMA 1KK8C 1JFKA 4JPZB 1UWOA 1B8CA 3KPXA 1PVBA 1S6IA 4PE4A 1DJWA 1CM4A 4PHNA 2ISDA 3S0BA 1NWDA 3BXKA 2BAPA 1KK8B 2GV5A 2PVBA 3BOWA 4XJKA 2KI4B 3TS5C 2JT8A 3NXAA 2VRGA 2KBIA 4CPVA 5AEQA 2KOTA 1YRTB 4DRWA 1LXFC 1NX1A 2CCMA 3BUWB 4AQJA 1C3YA 2KI6D 1QTXA 2OTGC 3K21A 2F2OA 5HKZA 2WNDA 1J7OA 1QX5B 1M31A 1FI5A 1CLLA 1CLBA 1SKTA 3B86A 1PULA 5DICA 1B1GA 1F54A 1TCOB 1L7ZA 1RWYA 3IQOA 3VROA 5B8IB 2NZ0A 3O78A 1YTZC 4N5XA 1BT6A 3EK4A 5D3OA 2OTGB 1CDLA 1LINA 3PALA 3AAKA 4NDCA 4WQ3A 2ZKMX 1DJYA 4HREE 2M7NA 3MSEB 1Y1AA 2KPHA 4MZJA 2ZRSA 4BY4A 1TUJA 2NXQA 2Y4QA 2YGUA 1KSMA 1IG5A 1QX7A 2LANA 1LVCD 3C1VA 1S6JA 1NCYA 1C7VA 3CGAA 2PASA 1Y0VH 5DKRA 1KK7Z 2JNXA 2K7OA 1B4CA 1IRJA 1K9PA 2Y1NA 3EKHA 1DMOA 1S36A 1JC2A 2MRDA 1UHJA 1UHKA 2PALA 3WXAA 1ZFSA 4MSPA 3I5HB 1DF0A 1XFUO 4GGNA 3O4YA 1Y1XA 2M29A 2LAPA 2LMTA 2ZFDA 3AAJA 1BODA 1CLMA 2BCBA 1Z4HA 1GJYA 3GK1A 1DGVA 1PRWA 1TNXA 3CZ1A 3V2LA 1CMGA 1W9ZA 3VRNA 5JJGA 2LVKA 2H2KA 1RECA 2BL0C 3JVTC 4YGCB 3D73A 5HKYA 3BUOB 2HF5A 3PLFB 1OMDA 1MQ1A 1SSEB 4PE1A 1F70A 2BKHB 5KSZA 3OX5A 1J7QA 1DJHA 2QEVA 4OV2A 3WNXB 2E6WA 3KO0A 1DT7B 2JC2A 1K95A 1LA0A 2PRUA 3JVTB 4I5LB 3RLZA 3O6BA 3R1PA 1QV1A 4NQGA 3EK8A 2TN4A 1MXEA 3EVVA 3PATA 4FQOA 1J1DA 1XFXO 2LLTA 1CDPA 2BBNA 1OZOA 1TRFA 2KQ6A 3DVJA 2GTEA 2JQ6A 3LCPC 4MEWA 1XFWO 1QJTA 3UO9A 2CT9A 2HETA 2M0RA 2WORA 3B87A 4NDBA 2BECA 2G9BA 1NX0A 5CSJA 1A2XA 1JWDA 2L4HA 2L50A 2LM5A 1YUTA 1SCMC 2KYFA 4JKTA 4UPGA 3FWCA 1G33A 1B7TY 2WC6A 2P70A 4GBAA 2MBXA 1WLMA 2OS8C 2LP2A 5KTYA 2F33A 3D0YA 2CBLA 1IQ5A 1N65A 1B8LA 1ZMZA 1W7IB 1F8HA 1FW4A 4XYNA 1N0YA 1QXPA 5CSIA 2BE6A 4I5JA 1NCXA 1M63B 4YGEB 2L5YA 3SIAA 2M7LA 5KU1A 3S0AA 2BBMA 1K96A 1XYDA 1TOPA 2GGZA 2OS8B 3DD4A 3DVEA 4U8DA 3VRRA 3N7HA 3OB1B 1BF5A 1EL4A 1KQMC 1X02A 2LMVA 3AKBA 5AANA 1IH0A 1JSAA 1SR6C 3OP0A 4HSZA 1XFVO 3I5FB 2WCFA 1XFZO 3WHTB 1QVIZ 2NCPA 2CNPA 2BE4A 4PALA 3CR4X 1NP8A 2K0JA 2QEOA 4GNKB 1SR6B 4MBEA 2KSPA 2JZIA 1ALWA 5HL1A 1CFDA 4R1EA 1SW8A 4A4CA 2LHIA 2WOSA 3PN7B 2ZN8A 1CKKA 2KI4C 4GAOA 3HX4A 1AUIB 2QPTA 3FIAA 2BNXA 4AQIA 2V53A 1QATA 2WCJA 3CZ0A 3D78A 2JU0A 1KFUS 2K60A 4WRIA 2I2RE 1UHNA 2LCPA 1MUXA 1TNPA 3NSOA 2Y1MA 1CM1A 2PYQA 3BFHA 3FE6A 2F2PA 3NGVA 4F7FA 1TUZA 2KI6C 2FCDA 1KFUL 1AJ5A 1TNWA 2MAZA 2L4IA 2M9GA 2O60A 1B9AA 3NSLA 1FBVA 3TUYB 1IWQA 5EL2A 2FJUB 2LLUA 3DF0B 4PHMA 1Y6WA 2KAXA 3DXLA 3SG2A 5CSFA 3LK0A 3E3RA 4PE7A 1YVHA 1MR8A 3VRQA 3LK1A 4FTGA 3K1EA 3TDZA 1U5IA 3M0WA 1EG3A 3CZTX 3TDIA 2LLSA 2MHHA 4GGFA 1OOGA 3L47A 3PM8A 1OE9B 1S6CA 1PK0D 3S0GA 4PHJA 1DVIA 2ZNDA 1QV0A 1MHOA 1ODBA 3ZWHA 1C07A 1QIWA 3D0YB 1XK4A 2WCEA 3IQQA 1AP4A 3BQ3A 3I5HC 3GK2A 2KFGA 1PSBA 1UHIA 1GGZA 1TIZA 2BKIB 3L4LA 4JD9A 4MZKA 1M45A 1DGUA 2E30A 1FPWA 3SJSA 3UNWA 1IJ5A 1SK6D 3VB1A 2JRFA 4MRYA 5DKQA 2JPTA 4OZDA 4PT1A 4PHKA 1DEKA 1K8UA 1WRKA 1R2UA 2Q4UA 1OMRA 2WCKA 3IF7A 2ZN9A 5D7FA 1J7PA 4L9MA 2I18A 1E8AA 2KNEA 1DTLA 1PVAA 1LKJA 2G2BA 2LV7A 2M97A 3ICBA 2L2CA 4OR9B 5JOLA 5BPJA 1BR4B 1K93D 1MWNA 3AKAA 1CFCA 3CDNA 1NX2A 2KLEA 1EG4A 1RTP1 4C0JA 1NIWA 1WRLA 3IVTA 2LMUA 3B7AA 3FE8A 1B8RA 1S26D 2P71A 4GPLB 3EKJA 2KLDA 1W7JB 3BUMB 3LL8B 2M1KB 1BG1A 1J7RA 2F8PA 3OHMB 3VRPA 1S3PA 2LUCA 1QASA 2JXLA 1OOIX 2JNFA 1L2OC 4ZCUA 2ZRTA 3I5GB 2LVJA 4M2OA 4BY5A 3CS1A 2A4JA 3I5IB 2K8MB 2KHNA 2M1UA 2QEBA 5FYXA 5HYDA 4INWA 5G08A 1UHHA 2BCXA 1XVJA 2P6BB 2QEHA 4N1GA 3D77A 4KYNA 2F3YA 2H8VA 1CFPA 1YUUA 3DF0A 4PCWA 5ER5A 1L2OB 4DUQA 1HQVA 2L98A 1EXRA 2HQ8A 3CR2A 4PE0A 5CSNA 3PFVA 1DJXA 2SCPA 4YI8A 1NUBA 1IGVA 1QLSA 4GFTA 2O5GA 3D10A 3JTDC 4GGFC 2RGIA 3S0FA 1OZSA 4NDDA 2WCHA 4I5NB 3LLEA 2KGBC 5HLVA 2JTTA 4MLWA 2FOTA 1NX3A 3RM1A 1XK4C 1U5IB 3NHIA 3S0EA 4F0ZB 4YI9A 3JTDB 3I5FC 1SL9A 2CXJA 1DC1A 5FI7A 2L2EA 5AFPA 1B47A 2H61A 1TN4A 2DOQA 3D76A 2K61A 3NHTA 1HT9A 3QRXA 3PM2A 1KFXS 1OOJA 2WCBA 4YRUA 1S1EA 4ORCB 3NSKA 1CTRA 3S0DA 4GUKA 3WHUB 2K7CA 5K89A 3EG5B 1AVSA 4Q04A 2JPOA 1PSRA 2LC5A 3PN7C 1JUOA 1C7WA 3O4XA 2HQWA 1F4OA 3ZNIA 2SASA 1J55A 3GOFA 1KFXL 2M8UA 3OBVA 5J3XA 2KGRA 4M2QA 1IKUA 1NYAA 2EC6C 1GQMA 2MA2A 1QS7A 2MLFC 1WY9A 4E68A 2KYCA 2BCAA 1AHRA 1JF0A 1M39A 3CTNA 1KCYA 2FJYA 5FI2A 1DQEA 1WRZA 3NSIA 4INXA 1KK7Y 4IL1A 2JT0A 3SS3A 1TCFA 2JWWA 1H8BA 2JT3A 5AXIA 5FI6A 1A75A 1SNLA 2EC6B 1KWOB 1VRKA 3TUYC 2FCEA 4MN0A 3HCMA 5ER4X 1DELA 2K2FA 1DJGA 2WCLA 2L0PA 1K90D 3R1VA 1EH2A 1FF1A 4IJ7A 3TZ1A 1QWVA 2QACA 1OSAA 1YX7A 5D69A 4A4BA 1RFJA 2IS9A 3CZ2A 4AOMA 3BFAA 3BUNB 1DJZA 1Q80A 1LS8A 2WC5A 1B7TZ 5F6TA 1MF8B 1ZACA 1UURA 1G8IA 2COLB 1SBJA 1JFJA 3DY9A 3Q8IA 1Z2CB 3CLNA 1OQPA 1ZOTB 3FS7A 3OGNA 3SG7A 4DS7A 4C0KA 5I8NA 1KQVA 5I2QA 2PQLA 1BOCA 1BMOA 1SL8A 1TNQA 2F3ZA 1P28A 2H61C 3KHEA 5GQQC 2K2AA 1OW4A 1M46A 1V1GA 1H4BA 4ORBB 5TNCA 4USLA 5CPVA 1SPYA 1A4PA 3TS5B 1GM0A 3FE9A 4ICBA 4FQTA 1CB1A 4ETOA 1BJFA 4JWQA 1YX8A 3QMEA 2ZNEA 4QJ5B 1XA5A 2PSRA 3OB2B 2KAYA 1AJ4A 3PJIA 1F4QA 1SY9A 1IIOA 2KBMA 1S5GY 1A03A 1DJIA 3B6XA 1ALVA 1IJ6A 5I2OA 3DVMA 1LA3A 1RROA 3CABA 1G4YR 1TWOA 1UP5A 2LVIA 3SIBA 2L5XB 1IQ3A 1EJ3A 2KQYA 1XFRA 2KDHA 1QLKA 3DZTA 3DVKA 3EVRA 5I2LA 3SG6A 1NPQA 3TDUA 1RJVA 2OPOA 3H4SE 3I5GC 4YBHB 3VGOA 1NCZA 2K7BA 1YVLA 2B1UA 1XFYO 3DYEA 3I5IC 1R6PA 3L4AA 1F55A 3OX6A 4CIDA 3FWBA 4P2YB 2NCOA 2WC8A 1K2HA 1NSHA 1BR1B 4N1FA 4PDZA 3SG5A 4CLNA 1QIVA 5HLOA 2QDIA 2I94A 2HPSA 1WDCC 1C3ZA 1QVIY 2CTNA 4DCKA 1A75B 5PALA 3BYAA 2L51A 2Q91A 3EVUA 5AERA 1D1OA 2LP3A 1ZUZA 3KEVA 5HKWA 1BU3A 3PSRA 3A8RA 4MZLA 1FI6A 3R72A 3RZSA
chains in the Genus database with same CATH topology
1KSOA 4I5KA 1F71A 1WDCB 4DIRA 4M2PA 1BLQA 2KAVA 1XO5A 1J1EA 3CR5X 2KFFA 1WLZA 2JXCA 4ZCVA 4QJ4B 1K94A 4QJ3B 1YR5A 3GK4X 3F45A 4HRHA 4ORAB 3O2PA 4MVFA 1CNPA 2BL0B 2LVVA 2AAOA 1JBAA 1YRUB 2AMIA 1OMVA 1QX2A 3BOWB 5IBWA 4XJKB 4JQ0D 4TNCA 1PALA 2R2IA 3A4UB 1SMGA 4WQ2A 5DKNA 2JOJA 2M3WA 4OVNF 1YURA 2MLEC 1SYMA 2AUCA 1UUSA 3SG4A 2EHBA 1K9KA 1SRAA 3CWGA 4YGBB 2PMYA 2LNKA 3SG3A 1S5GZ 4CFRA 1MXLC 2LHLA 4D1EA 1TTXA 1Y1UA 2GGMA 4P5OE 3EK7A 4HRGA 1V1FA 2JTZA 4MRXA 3KF9A 4YGDB 1CDNA 4OCIA 3BUXB 1SCMB 4C0LA 4YGAA 1KWOC 2NLNA 2I7AA 2K7DA 2LE9B 1JF2A 1GGWA 1CFFA 1RK9A 2EGDA 1SL7A 2M49B 2MJWB 4OKHA 2Y5IA 1CMFA 1K9UA 2LUXA 1A29A 2D8NA 1SCVA 1KQMB 4CFQA 1N2DA 1DF0B 2JULA 2KFHA 1YUSA 1AK8A 1CDMA 1KK8C 1JFKA 4JPZB 1UWOA 1B8CA 3KPXA 1PVBA 1S6IA 4PE4A 1DJWA 1CM4A 4PHNA 2ISDA 1NWDA 3BXKA 1KK8B 2GV5A 2PVBA 3BOWA 4XJKA 2KI4B 3TS5C 2JT8A 3NXAA 2VRGA 2KBIA 4CPVA 5AEQA 2KOTA 1YRTB 1LXFC 1NX1A 2CCMA 3BUWB 4AQJA 2KI6D 1QTXA 2OTGC 3K21A 2F2OA 5HKZA 2WNDA 1J7OA 1QX5B 1M31A 1FI5A 1CLLA 1CLBA 1SKTA 1B1GA 1PULA 1F54A 1TCOB 1L7ZA 1RWYA 3IQOA 3VROA 5B8IB 2NZ0A 3O78A 1YTZC 4N5XA 1BT6A 3EK4A 2OTGB 1CDLA 1LINA 3PALA 3AAKA 4NDCA 4WQ3A 2ZKMX 1DJYA 4HREE 2M7NA 3MSEB 1Y1AA 4MZJA 2ZRSA 4BY4A 2NXQA 2Y4QA 1KSMA 1IG5A 1QX7A 2LANA 1LVCD 3C1VA 1S6JA 1NCYA 1C7VA 3CGAA 2PASA 1Y0VH 5DKRA 1KK7Z 2JNXA 2K7OA 1B4CA 1IRJA 1K9PA 2Y1NA 3EKHA 1DMOA 1S36A 1JC2A 2MRDA 1UHJA 1UHKA 2PALA 3WXAA 1ZFSA 4MSPA 3I5HB 1DF0A 1XFUO 4GGNA 3O4YA 1Y1XA 2M29A 2LAPA 2LMTA 2ZFDA 3AAJA 1BODA 1CLMA 2BCBA 3GK1A 1GJYA 1DGVA 1PRWA 1TNXA 1CMGA 3VRNA 5JJGA 2LVKA 2H2KA 1RECA 2BL0C 3JVTC 4YGCB 5HKYA 3BUOB 2HF5A 3PLFB 1OMDA 1MQ1A 4PE1A 1F70A 2BKHB 5KSZA 3OX5A 1J7QA 1DJHA 4OV2A 3WNXB 2E6WA 3KO0A 1DT7B 2JC2A 1K95A 1LA0A 2PRUA 3JVTB 4I5LB 3RLZA 3O6BA 1QV1A 4NQGA 3EK8A 2TN4A 1MXEA 3EVVA 3PATA 4FQOA 1J1DA 1XFXO 2LLTA 1CDPA 2BBNA 1OZOA 1TRFA 2KQ6A 3DVJA 2JQ6A 3LCPC 4MEWA 1XFWO 1QJTA 2CT9A 2HETA 2M0RA 2WORA 4NDBA 5CSJA 2BECA 2G9BA 1NX0A 1A2XA 1JWDA 2L4HA 2L50A 2LM5A 1YUTA 1SCMC 2KYFA 4UPGA 3FWCA 1G33A 1B7TY 4GBAA 2MBXA 1WLMA 2OS8C 2LP2A 5KTYA 2F33A 3D0YA 2CBLA 1IQ5A 1N65A 1B8LA 1ZMZA 1W7IB 1F8HA 1FW4A 4XYNA 1N0YA 1QXPA 5CSIA 2BE6A 4I5JA 1NCXA 1M63B 4YGEB 3SIAA 2M7LA 5KU1A 2BBMA 1K96A 1XYDA 1TOPA 2GGZA 2OS8B 3DD4A 3DVEA 4U8DA 3VRRA 3OB1B 1BF5A 1EL4A 1KQMC 1X02A 2LMVA 3AKBA 5AANA 1IH0A 1JSAA 1SR6C 3OP0A 4HSZA 1XFVO 3I5FB 2WCFA 1XFZO 3WHTB 1QVIZ 2NCPA 2CNPA 2BE4A 4PALA 3CR4X 1NP8A 2K0JA 4GNKB 1SR6B 4MBEA 2KSPA 2JZIA 1ALWA 1CFDA 4R1EA 1SW8A 4A4CA 2LHIA 2WOSA 3PN7B 2ZN8A 1CKKA 2KI4C 4GAOA 3HX4A 1AUIB 2QPTA 3FIAA 4AQIA 2V53A 1QATA 2JU0A 1KFUS 4WRIA 2I2RE 1UHNA 2LCPA 1MUXA 1TNPA 3NSOA 2Y1MA 1CM1A 2F2PA 2KI6C 2FCDA 1KFUL 1AJ5A 1TNWA 2MAZA 2L4IA 2M9GA 2O60A 1B9AA 3NSLA 1FBVA 3TUYB 1IWQA 2FJUB 2LLUA 3DF0B 4PHMA 1Y6WA 2KAXA 3SG2A 5CSFA 3LK0A 3E3RA 4PE7A 1YVHA 1MR8A 3VRQA 3LK1A 4FTGA 3TDZA 1U5IA 3M0WA 1EG3A 3CZTX 3TDIA 2LLSA 2MHHA 4GGFA 3PM8A 1OE9B 1S6CA 1PK0D 4PHJA 1DVIA 2ZNDA 1QV0A 1MHOA 1ODBA 3ZWHA 1C07A 1QIWA 3D0YB 1XK4A 2WCEA 3IQQA 1AP4A 3BQ3A 3I5HC 3GK2A 2KFGA 1PSBA 1UHIA 1GGZA 1TIZA 2BKIB 4MZKA 1M45A 1DGUA 2E30A 1FPWA 3SJSA 1IJ5A 1SK6D 2JRFA 4MRYA 5DKQA 2JPTA 4PHKA 1K8UA 1WRKA 1R2UA 2Q4UA 1OMRA 3IF7A 2ZN9A 5D7FA 1J7PA 4L9MA 2I18A 1E8AA 2KNEA 1DTLA 1PVAA 1LKJA 2G2BA 2LV7A 2M97A 3ICBA 4OR9B 5JOLA 5BPJA 1BR4B 1K93D 1MWNA 3AKAA 1CFCA 1NX2A 1EG4A 1RTP1 4C0JA 1NIWA 1WRLA 2LMUA 1B8RA 1S26D 4GPLB 3EKJA 1W7JB 3BUMB 3LL8B 2M1KB 1BG1A 1J7RA 2F8PA 3OHMB 3VRPA 1S3PA 2LUCA 1QASA 2JXLA 2JNFA 1L2OC 4ZCUA 2ZRTA 3I5GB 2LVJA 4M2OA 4BY5A 3CS1A 2A4JA 3I5IB 2K8MB 2KHNA 2M1UA 5FYXA 5HYDA 5G08A 1UHHA 2BCXA 1XVJA 2P6BB 4N1GA 2F3YA 1CFPA 1YUUA 3DF0A 4PCWA 5ER5A 1L2OB 4DUQA 1HQVA 2L98A 1EXRA 2HQ8A 3CR2A 4PE0A 5CSNA 3PFVA 1DJXA 2SCPA 4YI8A 1NUBA 1IGVA 1QLSA 4GFTA 2O5GA 3D10A 3JTDC 4GGFC 2RGIA 1OZSA 4NDDA 4I5NB 3LLEA 2KGBC 5HLVA 2JTTA 4MLWA 2FOTA 1NX3A 3RM1A 1XK4C 1U5IB 4F0ZB 4YI9A 3JTDB 3I5FC 1SL9A 2CXJA 2L2EA 5AFPA 1B47A 2H61A 1TN4A 2DOQA 2K61A 1HT9A 3QRXA 1KFXS 1OOJA 2WCBA 4YRUA 1S1EA 4ORCB 3NSKA 1CTRA 4GUKA 3WHUB 2K7CA 5K89A 1AVSA 4Q04A 1PSRA 2LC5A 3PN7C 1JUOA 1C7WA 2HQWA 1F4OA 3ZNIA 2SASA 1J55A 3GOFA 1KFXL 2M8UA 5J3XA 2KGRA 4M2QA 1IKUA 1NYAA 2EC6C 1GQMA 2MA2A 1QS7A 2MLFC 1WY9A 4E68A 2KYCA 2BCAA 1AHRA 1JF0A 1M39A 3CTNA 1KCYA 1WRZA 3NSIA 1KK7Y 4IL1A 2JT0A 1TCFA 2JWWA 1H8BA 2JT3A 5AXIA 1A75A 1SNLA 2EC6B 1KWOB 1VRKA 3TUYC 2FCEA 4MN0A 3HCMA 5ER4X 2K2FA 1DJGA 2L0PA 1K90D 1EH2A 1FF1A 3TZ1A 2QACA 1OSAA 1YX7A 5D69A 4A4BA 1RFJA 2IS9A 4AOMA 3BUNB 1DJZA 1Q80A 1B7TZ 5F6TA 1MF8B 1ZACA 1UURA 1G8IA 2COLB 1SBJA 1JFJA 3CLNA 3FS7A 1OQPA 1ZOTB 3SG7A 4DS7A 4C0KA 5I8NA 1KQVA 5I2QA 1BOCA 1BMOA 1SL8A 1TNQA 2F3ZA 2H61C 3KHEA 5GQQC 2K2AA 1V1GA 1M46A 1H4BA 4ORBB 5TNCA 4USLA 5CPVA 1SPYA 1A4PA 3TS5B 4ICBA 1CB1A 4ETOA 1BJFA 4JWQA 1YX8A 2ZNEA 4QJ5B 1XA5A 2PSRA 3OB2B 2KAYA 1AJ4A 1F4QA 1SY9A 2KBMA 1S5GY 1A03A 1DJIA 1ALVA 1IJ6A 5I2OA 3DVMA 1LA3A 1RROA 1G4YR 1UP5A 2LVIA 3SIBA 2L5XB 1IQ3A 1EJ3A 2KQYA 2KDHA 3EVRA 1QLKA 5I2LA 3DVKA 3SG6A 3TDUA 4DRWA 1NPQA 1RJVA 2OPOA 3H4SE 3I5GC 4YBHB 3VGOA 1NCZA 2K7BA 1YVLA 2B1UA 1XFYO 3I5IC 1R6PA 1F55A 3OX6A 4CIDA 3FWBA 4P2YB 2NCOA 2WC8A 1K2HA 1NSHA 1BR1B 4N1FA 4PDZA 3SG5A 4CLNA 1QIVA 5HLOA 2I94A 2HPSA 1WDCC 1QVIY 2CTNA 4DCKA 1A75B 5PALA 3BYAA 2L51A 2Q91A 3EVUA 5AERA 1D1OA 2LP3A 1ZUZA 3KEVA 5HKWA 1BU3A 3PSRA 3A8RA 4MZLA 1FI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KSO A;  4I5K A;  1F71 A;  1WDC B;  4DIR A;  4M2P A;  1BLQ A;  2KAV A;  1XO5 A;  1J1E A;  3CR5 X;  2KFF A;  1WLZ A;  2JXC A;  4ZCV A;  4QJ4 B;  1K94 A;  4QJ3 B;  1YR5 A;  3GK4 X;  3F45 A;  4HRH A;  4ORA B;  3O2P A;  4MVF A;  1CNP A;  2BL0 B;  2LVV A;  2AAO A;  1JBA A;  1YRU B;  2AMI A;  1OMV A;  1QX2 A;  3BOW B;  5IBW A;  4XJK B;  4JQ0 D;  4TNC A;  1PAL A;  2R2I A;  3A4U B;  1SMG A;  4WQ2 A;  5DKN A;  2JOJ A;  2M3W A;  4OVN F;  1YUR A;  2MLE C;  1SYM A;  2AUC A;  1UUS A;  3SG4 A;  2EHB A;  1K9K A;  1SRA A;  3CWG A;  4YGB B;  2PMY A;  2LNK A;  3SG3 A;  1S5G Z;  4CFR A;  1MXL C;  2LHL A;  4D1E A;  1TTX A;  1Y1U A;  2GGM A;  4P5O E;  3EK7 A;  4HRG A;  1V1F A;  2JTZ A;  4MRX A;  3KF9 A;  4YGD B;  1CDN A;  4OCI A;  3BUX B;  1SCM B;  4C0L A;  4YGA A;  1KWO C;  2NLN A;  2I7A A;  2K7D A;  2LE9 B;  1JF2 A;  1GGW A;  1CFF A;  1RK9 A;  2EGD A;  1SL7 A;  2M49 B;  2MJW B;  4OKH A;  2Y5I A;  1CMF A;  1K9U A;  2LUX A;  1A29 A;  2D8N A;  1SCV A;  1KQM B;  4CFQ A;  1N2D A;  1DF0 B;  2JUL A;  2KFH A;  1YUS A;  1AK8 A;  1CDM A;  1KK8 C;  1JFK A;  4JPZ B;  1UWO A;  1B8C A;  3KPX A;  1PVB A;  1S6I A;  4PE4 A;  1DJW A;  1CM4 A;  4PHN A;  2ISD A;  1NWD A;  3BXK A;  1KK8 B;  2GV5 A;  2PVB A;  3BOW A;  4XJK A;  2KI4 B;  3TS5 C;  2JT8 A;  3NXA A;  2VRG A;  2KBI A;  4CPV A;  5AEQ A;  2KOT A;  1YRT B;  1LXF C;  1NX1 A;  2CCM A;  3BUW B;  4AQJ A;  2KI6 D;  1QTX A;  2OTG C;  3K21 A;  2F2O A;  5HKZ A;  2WND A;  1J7O A;  1QX5 B;  1M31 A;  1FI5 A;  1CLL A;  1CLB A;  1SKT A;  1B1G A;  1PUL A;  1F54 A;  1TCO B;  1L7Z A;  1RWY A;  3IQO A;  3VRO A;  5B8I B;  2NZ0 A;  3O78 A;  1YTZ C;  4N5X A;  1BT6 A;  3EK4 A;  2OTG B;  1CDL A;  1LIN A;  3PAL A;  3AAK A;  4NDC A;  4WQ3 A;  2ZKM X;  1DJY A;  4HRE E;  2M7N A;  3MSE B;  1Y1A A;  4MZJ A;  2ZRS A;  4BY4 A;  2NXQ A;  2Y4Q A;  1KSM A;  1IG5 A;  1QX7 A;  2LAN A;  1LVC D;  3C1V A;  1S6J A;  1NCY A;  1C7V A;  3CGA A;  2PAS A;  1Y0V H;  5DKR A;  1KK7 Z;  2JNX A;  2K7O A;  1B4C A;  1IRJ A;  1K9P A;  2Y1N A;  3EKH A;  1DMO A;  1S36 A;  1JC2 A;  2MRD A;  1UHJ A;  1UHK A;  2PAL A;  3WXA A;  1ZFS A;  4MSP A;  3I5H B;  1DF0 A;  1XFU O;  4GGN A;  3O4Y A;  1Y1X A;  2M29 A;  2LAP A;  2LMT A;  2ZFD A;  3AAJ A;  1BOD A;  1CLM A;  2BCB A;  3GK1 A;  1GJY A;  1DGV A;  1PRW A;  1TNX A;  1CMG A;  3VRN A;  5JJG A;  2LVK A;  2H2K A;  1REC A;  2BL0 C;  3JVT C;  4YGC B;  5HKY A;  3BUO B;  2HF5 A;  3PLF B;  1OMD A;  1MQ1 A;  4PE1 A;  1F70 A;  2BKH B;  5KSZ A;  3OX5 A;  1J7Q A;  1DJH A;  4OV2 A;  3WNX B;  2E6W A;  3KO0 A;  1DT7 B;  2JC2 A;  1K95 A;  1LA0 A;  2PRU A;  3JVT B;  4I5L B;  3RLZ A;  3O6B A;  1QV1 A;  4NQG A;  3EK8 A;  2TN4 A;  1MXE A;  3EVV A;  3PAT A;  4FQO A;  1J1D A;  1XFX O;  2LLT A;  1CDP A;  2BBN A;  1OZO A;  1TRF A;  2KQ6 A;  3DVJ A;  2JQ6 A;  3LCP C;  4MEW A;  1XFW O;  1QJT A;  2CT9 A;  2HET A;  2M0R A;  2WOR A;  4NDB A;  5CSJ A;  2BEC A;  2G9B A;  1NX0 A;  1A2X A;  1JWD A;  2L4H A;  2L50 A;  2LM5 A;  1YUT A;  1SCM C;  2KYF A;  4UPG A;  3FWC A;  1G33 A;  1B7T Y;  4GBA A;  2MBX A;  1WLM A;  2OS8 C;  2LP2 A;  5KTY A;  2F33 A;  3D0Y A;  2CBL A;  1IQ5 A;  1N65 A;  1B8L A;  1ZMZ A;  1W7I B;  1F8H A;  1FW4 A;  4XYN A;  1N0Y A;  1QXP A;  5CSI A;  2BE6 A;  4I5J A;  1NCX A;  1M63 B;  4YGE B;  3SIA A;  2M7L A;  5KU1 A;  2BBM A;  1K96 A;  1XYD A;  1TOP A;  2GGZ A;  2OS8 B;  3DD4 A;  3DVE A;  4U8D A;  3VRR A;  3OB1 B;  1BF5 A;  1EL4 A;  1KQM C;  1X02 A;  2LMV A;  3AKB A;  5AAN A;  1IH0 A;  1JSA A;  1SR6 C;  3OP0 A;  4HSZ A;  1XFV O;  3I5F B;  2WCF A;  1XFZ O;  3WHT B;  1QVI Z;  2NCP A;  2CNP A;  2BE4 A;  4PAL A;  3CR4 X;  1NP8 A;  2K0J A;  4GNK B;  1SR6 B;  4MBE A;  2KSP A;  2JZI A;  1ALW A;  1CFD A;  4R1E A;  1SW8 A;  4A4C A;  2LHI A;  2WOS A;  3PN7 B;  2ZN8 A;  1CKK A;  2KI4 C;  4GAO A;  3HX4 A;  1AUI B;  2QPT A;  3FIA A;  4AQI A;  2V53 A;  1QAT A;  2JU0 A;  1KFU S;  4WRI A;  2I2R E;  1UHN A;  2LCP A;  1MUX A;  1TNP A;  3NSO A;  2Y1M A;  1CM1 A;  2F2P A;  2KI6 C;  2FCD A;  1KFU L;  1AJ5 A;  1TNW A;  2MAZ A;  2L4I A;  2M9G A;  2O60 A;  1B9A A;  3NSL A;  1FBV A;  3TUY B;  1IWQ A;  2FJU B;  2LLU A;  3DF0 B;  4PHM A;  1Y6W A;  2KAX A;  3SG2 A;  5CSF A;  3LK0 A;  3E3R A;  4PE7 A;  1YVH A;  1MR8 A;  3VRQ A;  3LK1 A;  4FTG A;  3TDZ A;  1U5I A;  3M0W A;  1EG3 A;  3CZT X;  3TDI A;  2LLS A;  2MHH A;  4GGF A;  3PM8 A;  1OE9 B;  1S6C A;  1PK0 D;  4PHJ A;  1DVI A;  2ZND A;  1QV0 A;  1MHO A;  1ODB A;  3ZWH A;  1C07 A;  1QIW A;  3D0Y B;  1XK4 A;  2WCE A;  3IQQ A;  1AP4 A;  3BQ3 A;  3I5H C;  3GK2 A;  2KFG A;  1PSB A;  1UHI A;  1GGZ A;  1TIZ A;  2BKI B;  4MZK A;  1M45 A;  1DGU A;  2E30 A;  1FPW A;  3SJS A;  1IJ5 A;  1SK6 D;  2JRF A;  4MRY A;  5DKQ A;  2JPT A;  4PHK A;  1K8U A;  1WRK A;  1R2U A;  2Q4U A;  1OMR A;  3IF7 A;  2ZN9 A;  5D7F A;  1J7P A;  4L9M A;  2I18 A;  1E8A A;  2KNE A;  1DTL A;  1PVA A;  1LKJ A;  2G2B A;  2LV7 A;  2M97 A;  3ICB A;  4OR9 B;  5JOL A;  5BPJ A;  1BR4 B;  1K93 D;  1MWN A;  3AKA A;  1CFC A;  1NX2 A;  1EG4 A;  1RTP 1;  4C0J A;  1NIW A;  1WRL A;  2LMU A;  1B8R A;  1S26 D;  4GPL B;  3EKJ A;  1W7J B;  3BUM B;  3LL8 B;  2M1K B;  1BG1 A;  1J7R A;  2F8P A;  3OHM B;  3VRP A;  1S3P A;  2LUC A;  1QAS A;  2JXL A;  2JNF A;  1L2O C;  4ZCU A;  2ZRT A;  3I5G B;  2LVJ A;  4M2O A;  4BY5 A;  3CS1 A;  2A4J A;  3I5I B;  2K8M B;  2KHN A;  2M1U A;  5FYX A;  5HYD A;  5G08 A;  1UHH A;  2BCX A;  1XVJ A;  2P6B B;  4N1G A;  2F3Y A;  1CFP A;  1YUU A;  3DF0 A;  4PCW A;  5ER5 A;  1L2O B;  4DUQ A;  1HQV A;  2L98 A;  1EXR A;  2HQ8 A;  3CR2 A;  4PE0 A;  5CSN A;  3PFV A;  1DJX A;  2SCP A;  4YI8 A;  1NUB A;  1IGV A;  1QLS A;  4GFT A;  2O5G A;  3D10 A;  3JTD C;  4GGF C;  2RGI A;  1OZS A;  4NDD A;  4I5N B;  3LLE A;  2KGB C;  5HLV A;  2JTT A;  4MLW A;  2FOT A;  1NX3 A;  3RM1 A;  1XK4 C;  1U5I B;  4F0Z B;  4YI9 A;  3JTD B;  3I5F C;  1SL9 A;  2CXJ A;  2L2E A;  5AFP A;  1B47 A;  2H61 A;  1TN4 A;  2DOQ A;  2K61 A;  1HT9 A;  3QRX A;  1KFX S;  1OOJ A;  2WCB A;  4YRU A;  1S1E A;  4ORC B;  3NSK A;  1CTR A;  4GUK A;  3WHU B;  2K7C A;  5K89 A;  1AVS A;  4Q04 A;  1PSR A;  2LC5 A;  3PN7 C;  1JUO A;  1C7W A;  2HQW A;  1F4O A;  3ZNI A;  2SAS A;  1J55 A;  3GOF A;  1KFX L;  2M8U A;  5J3X A;  2KGR A;  4M2Q A;  1IKU A;  1NYA A;  2EC6 C;  1GQM A;  2MA2 A;  1QS7 A;  2MLF C;  1WY9 A;  4E68 A;  2KYC A;  2BCA A;  1AHR A;  1JF0 A;  1M39 A;  3CTN A;  1KCY A;  1WRZ A;  3NSI A;  1KK7 Y;  4IL1 A;  2JT0 A;  1TCF A;  2JWW A;  1H8B A;  2JT3 A;  5AXI A;  1A75 A;  1SNL A;  2EC6 B;  1KWO B;  1VRK A;  3TUY C;  2FCE A;  4MN0 A;  3HCM A;  5ER4 X;  2K2F A;  1DJG A;  2L0P A;  1K90 D;  1EH2 A;  1FF1 A;  3TZ1 A;  2QAC A;  1OSA A;  1YX7 A;  5D69 A;  4A4B A;  1RFJ A;  2IS9 A;  4AOM A;  3BUN B;  1DJZ A;  1Q80 A;  1B7T Z;  5F6T A;  1MF8 B;  1ZAC A;  1UUR A;  1G8I A;  2COL B;  1SBJ A;  1JFJ A;  3CLN A;  3FS7 A;  1OQP A;  1ZOT B;  3SG7 A;  4DS7 A;  4C0K A;  5I8N A;  1KQV A;  5I2Q A;  1BOC A;  1BMO A;  1SL8 A;  1TNQ A;  2F3Z A;  2H61 C;  3KHE A;  5GQQ C;  2K2A A;  1V1G A;  1M46 A;  1H4B A;  4ORB B;  5TNC A;  4USL A;  5CPV A;  1SPY A;  1A4P A;  3TS5 B;  4ICB A;  1CB1 A;  4ETO A;  1BJF A;  4JWQ A;  1YX8 A;  2ZNE A;  4QJ5 B;  1XA5 A;  2PSR A;  3OB2 B;  2KAY A;  1AJ4 A;  1F4Q A;  1SY9 A;  2KBM A;  1S5G Y;  1A03 A;  1DJI A;  1ALV A;  1IJ6 A;  5I2O A;  3DVM A;  1LA3 A;  1RRO A;  1G4Y R;  1UP5 A;  2LVI A;  3SIB A;  2L5X B;  1IQ3 A;  1EJ3 A;  2KQY A;  2KDH A;  3EVR A;  1QLK A;  5I2L A;  3DVK A;  3SG6 A;  3TDU A;  4DRW A;  1NPQ A;  1RJV A;  2OPO A;  3H4S E;  3I5G C;  4YBH B;  3VGO A;  1NCZ A;  2K7B A;  1YVL A;  2B1U A;  1XFY O;  3I5I C;  1R6P A;  1F55 A;  3OX6 A;  4CID A;  3FWB A;  4P2Y B;  2NCO A;  2WC8 A;  1K2H A;  1NSH A;  1BR1 B;  4N1F A;  4PDZ A;  3SG5 A;  4CLN A;  1QIV A;  5HLO A;  2I94 A;  2HPS A;  1WDC C;  1QVI Y;  2CTN A;  4DCK A;  1A75 B;  5PAL A;  3BYA A;  2L51 A;  2Q91 A;  3EVU A;  5AER A;  1D1O A;  2LP3 A;  1ZUZ A;  3KEV A;  5HKW A;  1BU3 A;  3PSR A;  3A8R A;  4MZL A;  1FI6 A; 
#chains in the Genus database with same CATH topology
 1KSO A;  4I5K A;  1F71 A;  1WDC B;  4DIR A;  4M2P A;  1BLQ A;  2KAV A;  1XO5 A;  1J1E A;  3CR5 X;  2KFF A;  1WLZ A;  2JXC A;  4ZCV A;  4QJ4 B;  1K94 A;  1ORG A;  4QJ3 B;  1YR5 A;  3GK4 X;  3F45 A;  4HRH A;  4ORA B;  3O2P A;  4MVF A;  1CNP A;  2BL0 B;  3D75 A;  5I94 A;  2LVV A;  3D74 A;  3BFB A;  3SS5 A;  2AAO A;  1JBA A;  1YRU B;  2AMI A;  1OMV A;  1QX2 A;  3BOW B;  5IBW A;  4XJK B;  3R1O A;  4JQ0 D;  4TNC A;  1PAL A;  1OOF A;  2R2I A;  3A4U B;  1SMG A;  4WQ2 A;  5DKN A;  2JOJ A;  2M3W A;  4OVN F;  3SS4 A;  1YUR A;  2MLE C;  1SYM A;  2AUC A;  1UUS A;  3SG4 A;  2EHB A;  1K9K A;  1SRA A;  3CWG A;  4YGB B;  2PMY A;  2LNK A;  3SG3 A;  1S5G Z;  4CFR A;  1MXL C;  2LHL A;  4D1E A;  1TTX A;  1Y1U A;  2GGM A;  3CYZ A;  4P5O E;  3EK7 A;  4HRG A;  1T14 A;  1V1F A;  2JTZ A;  4MRX A;  3KF9 A;  4YGD B;  1CDN A;  4OCI A;  3BUX B;  1SCM B;  4C0L A;  4YGA A;  3B88 A;  1KWO C;  2NLN A;  2I7A A;  2K7D A;  2LE9 B;  3BJH A;  2WCM A;  1JF2 A;  1GGW A;  1CFF A;  2ERB A;  1RK9 A;  2EGD A;  1SL7 A;  2M49 B;  2MJW B;  4OKH A;  2Y5I A;  1OOH A;  1CMF A;  1K9U A;  2LUX A;  1A29 A;  2D8N A;  1SCV A;  1KQM B;  4CFQ A;  1N2D A;  1DF0 B;  2JUL A;  2KFH A;  1YUS A;  1AK8 A;  1CDM A;  1KK8 C;  1JFK A;  4JPZ B;  1UWO A;  1B8C A;  3KPX A;  1PVB A;  1S6I A;  4PE4 A;  1DJW A;  1CM4 A;  4PHN A;  2ISD A;  3S0B A;  1NWD A;  3BXK A;  2BAP A;  1KK8 B;  2GV5 A;  2PVB A;  3BOW A;  4XJK A;  2KI4 B;  3TS5 C;  2JT8 A;  3NXA A;  2VRG A;  2KBI A;  4CPV A;  5AEQ A;  2KOT A;  1YRT B;  4DRW A;  1LXF C;  1NX1 A;  2CCM A;  3BUW B;  4AQJ A;  1C3Y A;  2KI6 D;  1QTX A;  2OTG C;  3K21 A;  2F2O A;  5HKZ A;  2WND A;  1J7O A;  1QX5 B;  1M31 A;  1FI5 A;  1CLL A;  1CLB A;  1SKT A;  3B86 A;  1PUL A;  5DIC A;  1B1G A;  1F54 A;  1TCO B;  1L7Z A;  1RWY A;  3IQO A;  3VRO A;  5B8I B;  2NZ0 A;  3O78 A;  1YTZ C;  4N5X A;  1BT6 A;  3EK4 A;  5D3O A;  2OTG B;  1CDL A;  1LIN A;  3PAL A;  3AAK A;  4NDC A;  4WQ3 A;  2ZKM X;  1DJY A;  4HRE E;  2M7N A;  3MSE B;  1Y1A A;  2KPH A;  4MZJ A;  2ZRS A;  4BY4 A;  1TUJ A;  2NXQ A;  2Y4Q A;  2YGU A;  1KSM A;  1IG5 A;  1QX7 A;  2LAN A;  1LVC D;  3C1V A;  1S6J A;  1NCY A;  1C7V A;  3CGA A;  2PAS A;  1Y0V H;  5DKR A;  1KK7 Z;  2JNX A;  2K7O A;  1B4C A;  1IRJ A;  1K9P A;  2Y1N A;  3EKH A;  1DMO A;  1S36 A;  1JC2 A;  2MRD A;  1UHJ A;  1UHK A;  2PAL A;  3WXA A;  1ZFS A;  4MSP A;  3I5H B;  1DF0 A;  1XFU O;  4GGN A;  3O4Y A;  1Y1X A;  2M29 A;  2LAP A;  2LMT A;  2ZFD A;  3AAJ A;  1BOD A;  1CLM A;  2BCB A;  1Z4H A;  1GJY A;  3GK1 A;  1DGV A;  1PRW A;  1TNX A;  3CZ1 A;  3V2L A;  1CMG A;  1W9Z A;  3VRN A;  5JJG A;  2LVK A;  2H2K A;  1REC A;  2BL0 C;  3JVT C;  4YGC B;  3D73 A;  5HKY A;  3BUO B;  2HF5 A;  3PLF B;  1OMD A;  1MQ1 A;  1SSE B;  4PE1 A;  1F70 A;  2BKH B;  5KSZ A;  3OX5 A;  1J7Q A;  1DJH A;  2QEV A;  4OV2 A;  3WNX B;  2E6W A;  3KO0 A;  1DT7 B;  2JC2 A;  1K95 A;  1LA0 A;  2PRU A;  3JVT B;  4I5L B;  3RLZ A;  3O6B A;  3R1P A;  1QV1 A;  4NQG A;  3EK8 A;  2TN4 A;  1MXE A;  3EVV A;  3PAT A;  4FQO A;  1J1D A;  1XFX O;  2LLT A;  1CDP A;  2BBN A;  1OZO A;  1TRF A;  2KQ6 A;  3DVJ A;  2GTE A;  2JQ6 A;  3LCP C;  4MEW A;  1XFW O;  1QJT A;  3UO9 A;  2CT9 A;  2HET A;  2M0R A;  2WOR A;  3B87 A;  4NDB A;  2BEC A;  2G9B A;  1NX0 A;  5CSJ A;  1A2X A;  1JWD A;  2L4H A;  2L50 A;  2LM5 A;  1YUT A;  1SCM C;  2KYF A;  4JKT A;  4UPG A;  3FWC A;  1G33 A;  1B7T Y;  2WC6 A;  2P70 A;  4GBA A;  2MBX A;  1WLM A;  2OS8 C;  2LP2 A;  5KTY A;  2F33 A;  3D0Y A;  2CBL A;  1IQ5 A;  1N65 A;  1B8L A;  1ZMZ A;  1W7I B;  1F8H A;  1FW4 A;  4XYN A;  1N0Y A;  1QXP A;  5CSI A;  2BE6 A;  4I5J A;  1NCX A;  1M63 B;  4YGE B;  2L5Y A;  3SIA A;  2M7L A;  5KU1 A;  3S0A A;  2BBM A;  1K96 A;  1XYD A;  1TOP A;  2GGZ A;  2OS8 B;  3DD4 A;  3DVE A;  4U8D A;  3VRR A;  3N7H A;  3OB1 B;  1BF5 A;  1EL4 A;  1KQM C;  1X02 A;  2LMV A;  3AKB A;  5AAN A;  1IH0 A;  1JSA A;  1SR6 C;  3OP0 A;  4HSZ A;  1XFV O;  3I5F B;  2WCF A;  1XFZ O;  3WHT B;  1QVI Z;  2NCP A;  2CNP A;  2BE4 A;  4PAL A;  3CR4 X;  1NP8 A;  2K0J A;  2QEO A;  4GNK B;  1SR6 B;  4MBE A;  2KSP A;  2JZI A;  1ALW A;  5HL1 A;  1CFD A;  4R1E A;  1SW8 A;  4A4C A;  2LHI A;  2WOS A;  3PN7 B;  2ZN8 A;  1CKK A;  2KI4 C;  4GAO A;  3HX4 A;  1AUI B;  2QPT A;  3FIA A;  2BNX A;  4AQI A;  2V53 A;  1QAT A;  2WCJ A;  3CZ0 A;  3D78 A;  2JU0 A;  1KFU S;  2K60 A;  4WRI A;  2I2R E;  1UHN A;  2LCP A;  1MUX A;  1TNP A;  3NSO A;  2Y1M A;  1CM1 A;  2PYQ A;  3BFH A;  3FE6 A;  2F2P A;  3NGV A;  4F7F A;  1TUZ A;  2KI6 C;  2FCD A;  1KFU L;  1AJ5 A;  1TNW A;  2MAZ A;  2L4I A;  2M9G A;  2O60 A;  1B9A A;  3NSL A;  1FBV A;  3TUY B;  1IWQ A;  5EL2 A;  2FJU B;  2LLU A;  3DF0 B;  4PHM A;  1Y6W A;  2KAX A;  3DXL A;  3SG2 A;  5CSF A;  3LK0 A;  3E3R A;  4PE7 A;  1YVH A;  1MR8 A;  3VRQ A;  3LK1 A;  4FTG A;  3K1E A;  3TDZ A;  1U5I A;  3M0W A;  1EG3 A;  3CZT X;  3TDI A;  2LLS A;  2MHH A;  4GGF A;  1OOG A;  3L47 A;  3PM8 A;  1OE9 B;  1S6C A;  1PK0 D;  3S0G A;  4PHJ A;  1DVI A;  2ZND A;  1QV0 A;  1MHO A;  1ODB A;  3ZWH A;  1C07 A;  1QIW A;  3D0Y B;  1XK4 A;  2WCE A;  3IQQ A;  1AP4 A;  3BQ3 A;  3I5H C;  3GK2 A;  2KFG A;  1PSB A;  1UHI A;  1GGZ A;  1TIZ A;  2BKI B;  3L4L A;  4JD9 A;  4MZK A;  1M45 A;  1DGU A;  2E30 A;  1FPW A;  3SJS A;  3UNW A;  1IJ5 A;  1SK6 D;  3VB1 A;  2JRF A;  4MRY A;  5DKQ A;  2JPT A;  4OZD A;  4PT1 A;  4PHK A;  1DEK A;  1K8U A;  1WRK A;  1R2U A;  2Q4U A;  1OMR A;  2WCK A;  3IF7 A;  2ZN9 A;  5D7F A;  1J7P A;  4L9M A;  2I18 A;  1E8A A;  2KNE A;  1DTL A;  1PVA A;  1LKJ A;  2G2B A;  2LV7 A;  2M97 A;  3ICB A;  2L2C A;  4OR9 B;  5JOL A;  5BPJ A;  1BR4 B;  1K93 D;  1MWN A;  3AKA A;  1CFC A;  3CDN A;  1NX2 A;  2KLE A;  1EG4 A;  1RTP 1;  4C0J A;  1NIW A;  1WRL A;  3IVT A;  2LMU A;  3B7A A;  3FE8 A;  1B8R A;  1S26 D;  2P71 A;  4GPL B;  3EKJ A;  2KLD A;  1W7J B;  3BUM B;  3LL8 B;  2M1K B;  1BG1 A;  1J7R A;  2F8P A;  3OHM B;  3VRP A;  1S3P A;  2LUC A;  1QAS A;  2JXL A;  1OOI X;  2JNF A;  1L2O C;  4ZCU A;  2ZRT A;  3I5G B;  2LVJ A;  4M2O A;  4BY5 A;  3CS1 A;  2A4J A;  3I5I B;  2K8M B;  2KHN A;  2M1U A;  2QEB A;  5FYX A;  5HYD A;  4INW A;  5G08 A;  1UHH A;  2BCX A;  1XVJ A;  2P6B B;  2QEH A;  4N1G A;  3D77 A;  4KYN A;  2F3Y A;  2H8V A;  1CFP A;  1YUU A;  3DF0 A;  4PCW A;  5ER5 A;  1L2O B;  4DUQ A;  1HQV A;  2L98 A;  1EXR A;  2HQ8 A;  3CR2 A;  4PE0 A;  5CSN A;  3PFV A;  1DJX A;  2SCP A;  4YI8 A;  1NUB A;  1IGV A;  1QLS A;  4GFT A;  2O5G A;  3D10 A;  3JTD C;  4GGF C;  2RGI A;  3S0F A;  1OZS A;  4NDD A;  2WCH A;  4I5N B;  3LLE A;  2KGB C;  5HLV A;  2JTT A;  4MLW A;  2FOT A;  1NX3 A;  3RM1 A;  1XK4 C;  1U5I B;  3NHI A;  3S0E A;  4F0Z B;  4YI9 A;  3JTD B;  3I5F C;  1SL9 A;  2CXJ A;  1DC1 A;  5FI7 A;  2L2E A;  5AFP A;  1B47 A;  2H61 A;  1TN4 A;  2DOQ A;  3D76 A;  2K61 A;  3NHT A;  1HT9 A;  3QRX A;  3PM2 A;  1KFX S;  1OOJ A;  2WCB A;  4YRU A;  1S1E A;  4ORC B;  3NSK A;  1CTR A;  3S0D A;  4GUK A;  3WHU B;  2K7C A;  5K89 A;  3EG5 B;  1AVS A;  4Q04 A;  2JPO A;  1PSR A;  2LC5 A;  3PN7 C;  1JUO A;  1C7W A;  3O4X A;  2HQW A;  1F4O A;  3ZNI A;  2SAS A;  1J55 A;  3GOF A;  1KFX L;  2M8U A;  3OBV A;  5J3X A;  2KGR A;  4M2Q A;  1IKU A;  1NYA A;  2EC6 C;  1GQM A;  2MA2 A;  1QS7 A;  2MLF C;  1WY9 A;  4E68 A;  2KYC A;  2BCA A;  1AHR A;  1JF0 A;  1M39 A;  3CTN A;  1KCY A;  2FJY A;  5FI2 A;  1DQE A;  1WRZ A;  3NSI A;  4INX A;  1KK7 Y;  4IL1 A;  2JT0 A;  3SS3 A;  1TCF A;  2JWW A;  1H8B A;  2JT3 A;  5AXI A;  5FI6 A;  1A75 A;  1SNL A;  2EC6 B;  1KWO B;  1VRK A;  3TUY C;  2FCE A;  4MN0 A;  3HCM A;  5ER4 X;  1DEL A;  2K2F A;  1DJG A;  2WCL A;  2L0P A;  1K90 D;  3R1V A;  1EH2 A;  1FF1 A;  4IJ7 A;  3TZ1 A;  1QWV A;  2QAC A;  1OSA A;  1YX7 A;  5D69 A;  4A4B A;  1RFJ A;  2IS9 A;  3CZ2 A;  4AOM A;  3BFA A;  3BUN B;  1DJZ A;  1Q80 A;  1LS8 A;  2WC5 A;  1B7T Z;  5F6T A;  1MF8 B;  1ZAC A;  1UUR A;  1G8I A;  2COL B;  1SBJ A;  1JFJ A;  3DY9 A;  3Q8I A;  1Z2C B;  3CLN A;  1OQP A;  1ZOT B;  3FS7 A;  3OGN A;  3SG7 A;  4DS7 A;  4C0K A;  5I8N A;  1KQV A;  5I2Q A;  2PQL A;  1BOC A;  1BMO A;  1SL8 A;  1TNQ A;  2F3Z A;  1P28 A;  2H61 C;  3KHE A;  5GQQ C;  2K2A A;  1OW4 A;  1M46 A;  1V1G A;  1H4B A;  4ORB B;  5TNC A;  4USL A;  5CPV A;  1SPY A;  1A4P A;  3TS5 B;  1GM0 A;  3FE9 A;  4ICB A;  4FQT A;  1CB1 A;  4ETO A;  1BJF A;  4JWQ A;  1YX8 A;  3QME A;  2ZNE A;  4QJ5 B;  1XA5 A;  2PSR A;  3OB2 B;  2KAY A;  1AJ4 A;  3PJI A;  1F4Q A;  1SY9 A;  1IIO A;  2KBM A;  1S5G Y;  1A03 A;  1DJI A;  3B6X A;  1ALV A;  1IJ6 A;  5I2O A;  3DVM A;  1LA3 A;  1RRO A;  3CAB A;  1G4Y R;  1TWO A;  1UP5 A;  2LVI A;  3SIB A;  2L5X B;  1IQ3 A;  1EJ3 A;  2KQY A;  1XFR A;  2KDH A;  1QLK A;  3DZT A;  3DVK A;  3EVR A;  5I2L A;  3SG6 A;  1NPQ A;  3TDU A;  1RJV A;  2OPO A;  3H4S E;  3I5G C;  4YBH B;  3VGO A;  1NCZ A;  2K7B A;  1YVL A;  2B1U A;  1XFY O;  3DYE A;  3I5I C;  1R6P A;  3L4A A;  1F55 A;  3OX6 A;  4CID A;  3FWB A;  4P2Y B;  2NCO A;  2WC8 A;  1K2H A;  1NSH A;  1BR1 B;  4N1F A;  4PDZ A;  3SG5 A;  4CLN A;  1QIV A;  5HLO A;  2QDI A;  2I94 A;  2HPS A;  1WDC C;  1C3Z A;  1QVI Y;  2CTN A;  4DCK A;  1A75 B;  5PAL A;  3BYA A;  2L51 A;  2Q91 A;  3EVU A;  5AER A;  1D1O A;  2LP3 A;  1ZUZ A;  3KEV A;  5HKW A;  1BU3 A;  3PSR A;  3A8R A;  4MZL A;  1FI6 A;  3R72 A;  3RZS A; 
#chains in the Genus database with same CATH homology
 1KSO A;  4I5K A;  1F71 A;  1WDC B;  4DIR A;  4M2P A;  1BLQ A;  2KAV A;  1XO5 A;  1J1E A;  3CR5 X;  2KFF A;  1WLZ A;  2JXC A;  4ZCV A;  4QJ4 B;  1K94 A;  4QJ3 B;  1YR5 A;  3GK4 X;  3F45 A;  4HRH A;  4ORA B;  3O2P A;  4MVF A;  1CNP A;  2BL0 B;  2LVV A;  2AAO A;  1JBA A;  1YRU B;  2AMI A;  1OMV A;  1QX2 A;  3BOW B;  5IBW A;  4XJK B;  4JQ0 D;  4TNC A;  1PAL A;  2R2I A;  3A4U B;  1SMG A;  4WQ2 A;  5DKN A;  2JOJ A;  2M3W A;  4OVN F;  1YUR A;  2MLE C;  1SYM A;  2AUC A;  1UUS A;  3SG4 A;  2EHB A;  1K9K A;  1SRA A;  3CWG A;  4YGB B;  2PMY A;  2LNK A;  3SG3 A;  1S5G Z;  4CFR A;  1MXL C;  2LHL A;  4D1E A;  1TTX A;  1Y1U A;  2GGM A;  4P5O E;  3EK7 A;  4HRG A;  1V1F A;  2JTZ A;  4MRX A;  3KF9 A;  4YGD B;  1CDN A;  4OCI A;  3BUX B;  1SCM B;  4C0L A;  4YGA A;  1KWO C;  2NLN A;  2I7A A;  2K7D A;  2LE9 B;  1JF2 A;  1GGW A;  1CFF A;  1RK9 A;  2EGD A;  1SL7 A;  2M49 B;  2MJW B;  4OKH A;  2Y5I A;  1CMF A;  1K9U A;  2LUX A;  1A29 A;  2D8N A;  1SCV A;  1KQM B;  4CFQ A;  1N2D A;  1DF0 B;  2JUL A;  2KFH A;  1YUS A;  1AK8 A;  1CDM A;  1KK8 C;  1JFK A;  4JPZ B;  1UWO A;  1B8C A;  3KPX A;  1PVB A;  1S6I A;  4PE4 A;  1DJW A;  1CM4 A;  4PHN A;  2ISD A;  1NWD A;  3BXK A;  1KK8 B;  2GV5 A;  2PVB A;  3BOW A;  4XJK A;  2KI4 B;  3TS5 C;  2JT8 A;  3NXA A;  2VRG A;  2KBI A;  4CPV A;  5AEQ A;  2KOT A;  1YRT B;  1LXF C;  1NX1 A;  2CCM A;  3BUW B;  4AQJ A;  2KI6 D;  1QTX A;  2OTG C;  3K21 A;  2F2O A;  5HKZ A;  2WND A;  1J7O A;  1QX5 B;  1M31 A;  1FI5 A;  1CLL A;  1CLB A;  1SKT A;  1B1G A;  1PUL A;  1F54 A;  1TCO B;  1L7Z A;  1RWY A;  3IQO A;  3VRO A;  5B8I B;  2NZ0 A;  3O78 A;  1YTZ C;  4N5X A;  1BT6 A;  3EK4 A;  2OTG B;  1CDL A;  1LIN A;  3PAL A;  3AAK A;  4NDC A;  4WQ3 A;  2ZKM X;  1DJY A;  4HRE E;  2M7N A;  3MSE B;  1Y1A A;  4MZJ A;  2ZRS A;  4BY4 A;  2NXQ A;  2Y4Q A;  1KSM A;  1IG5 A;  1QX7 A;  2LAN A;  1LVC D;  3C1V A;  1S6J A;  1NCY A;  1C7V A;  3CGA A;  2PAS A;  1Y0V H;  5DKR A;  1KK7 Z;  2JNX A;  2K7O A;  1B4C A;  1IRJ A;  1K9P A;  2Y1N A;  3EKH A;  1DMO A;  1S36 A;  1JC2 A;  2MRD A;  1UHJ A;  1UHK A;  2PAL A;  3WXA A;  1ZFS A;  4MSP A;  3I5H B;  1DF0 A;  1XFU O;  4GGN A;  3O4Y A;  1Y1X A;  2M29 A;  2LAP A;  2LMT A;  2ZFD A;  3AAJ A;  1BOD A;  1CLM A;  2BCB A;  3GK1 A;  1GJY A;  1DGV A;  1PRW A;  1TNX A;  1CMG A;  3VRN A;  5JJG A;  2LVK A;  2H2K A;  1REC A;  2BL0 C;  3JVT C;  4YGC B;  5HKY A;  3BUO B;  2HF5 A;  3PLF B;  1OMD A;  1MQ1 A;  4PE1 A;  1F70 A;  2BKH B;  5KSZ A;  3OX5 A;  1J7Q A;  1DJH A;  4OV2 A;  3WNX B;  2E6W A;  3KO0 A;  1DT7 B;  2JC2 A;  1K95 A;  1LA0 A;  2PRU A;  3JVT B;  4I5L B;  3RLZ A;  3O6B A;  1QV1 A;  4NQG A;  3EK8 A;  2TN4 A;  1MXE A;  3EVV A;  3PAT A;  4FQO A;  1J1D A;  1XFX O;  2LLT A;  1CDP A;  2BBN A;  1OZO A;  1TRF A;  2KQ6 A;  3DVJ A;  2JQ6 A;  3LCP C;  4MEW A;  1XFW O;  1QJT A;  2CT9 A;  2HET A;  2M0R A;  2WOR A;  4NDB A;  5CSJ A;  2BEC A;  2G9B A;  1NX0 A;  1A2X A;  1JWD A;  2L4H A;  2L50 A;  2LM5 A;  1YUT A;  1SCM C;  2KYF A;  4UPG A;  3FWC A;  1G33 A;  1B7T Y;  4GBA A;  2MBX A;  1WLM A;  2OS8 C;  2LP2 A;  5KTY A;  2F33 A;  3D0Y A;  2CBL A;  1IQ5 A;  1N65 A;  1B8L A;  1ZMZ A;  1W7I B;  1F8H A;  1FW4 A;  4XYN A;  1N0Y A;  1QXP A;  5CSI A;  2BE6 A;  4I5J A;  1NCX A;  1M63 B;  4YGE B;  3SIA A;  2M7L A;  5KU1 A;  2BBM A;  1K96 A;  1XYD A;  1TOP A;  2GGZ A;  2OS8 B;  3DD4 A;  3DVE A;  4U8D A;  3VRR A;  3OB1 B;  1BF5 A;  1EL4 A;  1KQM C;  1X02 A;  2LMV A;  3AKB A;  5AAN A;  1IH0 A;  1JSA A;  1SR6 C;  3OP0 A;  4HSZ A;  1XFV O;  3I5F B;  2WCF A;  1XFZ O;  3WHT B;  1QVI Z;  2NCP A;  2CNP A;  2BE4 A;  4PAL A;  3CR4 X;  1NP8 A;  2K0J A;  4GNK B;  1SR6 B;  4MBE A;  2KSP A;  2JZI A;  1ALW A;  1CFD A;  4R1E A;  1SW8 A;  4A4C A;  2LHI A;  2WOS A;  3PN7 B;  2ZN8 A;  1CKK A;  2KI4 C;  4GAO A;  3HX4 A;  1AUI B;  2QPT A;  3FIA A;  4AQI A;  2V53 A;  1QAT A;  2JU0 A;  1KFU S;  4WRI A;  2I2R E;  1UHN A;  2LCP A;  1MUX A;  1TNP A;  3NSO A;  2Y1M A;  1CM1 A;  2F2P A;  2KI6 C;  2FCD A;  1KFU L;  1AJ5 A;  1TNW A;  2MAZ A;  2L4I A;  2M9G A;  2O60 A;  1B9A A;  3NSL A;  1FBV A;  3TUY B;  1IWQ A;  2FJU B;  2LLU A;  3DF0 B;  4PHM A;  1Y6W A;  2KAX A;  3SG2 A;  5CSF A;  3LK0 A;  3E3R A;  4PE7 A;  1YVH A;  1MR8 A;  3VRQ A;  3LK1 A;  4FTG A;  3TDZ A;  1U5I A;  3M0W A;  1EG3 A;  3CZT X;  3TDI A;  2LLS A;  2MHH A;  4GGF A;  3PM8 A;  1OE9 B;  1S6C A;  1PK0 D;  4PHJ A;  1DVI A;  2ZND A;  1QV0 A;  1MHO A;  1ODB A;  3ZWH A;  1C07 A;  1QIW A;  3D0Y B;  1XK4 A;  2WCE A;  3IQQ A;  1AP4 A;  3BQ3 A;  3I5H C;  3GK2 A;  2KFG A;  1PSB A;  1UHI A;  1GGZ A;  1TIZ A;  2BKI B;  4MZK A;  1M45 A;  1DGU A;  2E30 A;  1FPW A;  3SJS A;  1IJ5 A;  1SK6 D;  2JRF A;  4MRY A;  5DKQ A;  2JPT A;  4PHK A;  1K8U A;  1WRK A;  1R2U A;  2Q4U A;  1OMR A;  3IF7 A;  2ZN9 A;  5D7F A;  1J7P A;  4L9M A;  2I18 A;  1E8A A;  2KNE A;  1DTL A;  1PVA A;  1LKJ A;  2G2B A;  2LV7 A;  2M97 A;  3ICB A;  4OR9 B;  5JOL A;  5BPJ A;  1BR4 B;  1K93 D;  1MWN A;  3AKA A;  1CFC A;  1NX2 A;  1EG4 A;  1RTP 1;  4C0J A;  1NIW A;  1WRL A;  2LMU A;  1B8R A;  1S26 D;  4GPL B;  3EKJ A;  1W7J B;  3BUM B;  3LL8 B;  2M1K B;  1BG1 A;  1J7R A;  2F8P A;  3OHM B;  3VRP A;  1S3P A;  2LUC A;  1QAS A;  2JXL A;  2JNF A;  1L2O C;  4ZCU A;  2ZRT A;  3I5G B;  2LVJ A;  4M2O A;  4BY5 A;  3CS1 A;  2A4J A;  3I5I B;  2K8M B;  2KHN A;  2M1U A;  5FYX A;  5HYD A;  5G08 A;  1UHH A;  2BCX A;  1XVJ A;  2P6B B;  4N1G A;  2F3Y A;  1CFP A;  1YUU A;  3DF0 A;  4PCW A;  5ER5 A;  1L2O B;  4DUQ A;  1HQV A;  2L98 A;  1EXR A;  2HQ8 A;  3CR2 A;  4PE0 A;  5CSN A;  3PFV A;  1DJX A;  2SCP A;  4YI8 A;  1NUB A;  1IGV A;  1QLS A;  4GFT A;  2O5G A;  3D10 A;  3JTD C;  4GGF C;  2RGI A;  1OZS A;  4NDD A;  4I5N B;  3LLE A;  2KGB C;  5HLV A;  2JTT A;  4MLW A;  2FOT A;  1NX3 A;  3RM1 A;  1XK4 C;  1U5I B;  4F0Z B;  4YI9 A;  3JTD B;  3I5F C;  1SL9 A;  2CXJ A;  2L2E A;  5AFP A;  1B47 A;  2H61 A;  1TN4 A;  2DOQ A;  2K61 A;  1HT9 A;  3QRX A;  1KFX S;  1OOJ A;  2WCB A;  4YRU A;  1S1E A;  4ORC B;  3NSK A;  1CTR A;  4GUK A;  3WHU B;  2K7C A;  5K89 A;  1AVS A;  4Q04 A;  1PSR A;  2LC5 A;  3PN7 C;  1JUO A;  1C7W A;  2HQW A;  1F4O A;  3ZNI A;  2SAS A;  1J55 A;  3GOF A;  1KFX L;  2M8U A;  5J3X A;  2KGR A;  4M2Q A;  1IKU A;  1NYA A;  2EC6 C;  1GQM A;  2MA2 A;  1QS7 A;  2MLF C;  1WY9 A;  4E68 A;  2KYC A;  2BCA A;  1AHR A;  1JF0 A;  1M39 A;  3CTN A;  1KCY A;  1WRZ A;  3NSI A;  1KK7 Y;  4IL1 A;  2JT0 A;  1TCF A;  2JWW A;  1H8B A;  2JT3 A;  5AXI A;  1A75 A;  1SNL A;  2EC6 B;  1KWO B;  1VRK A;  3TUY C;  2FCE A;  4MN0 A;  3HCM A;  5ER4 X;  2K2F A;  1DJG A;  2L0P A;  1K90 D;  1EH2 A;  1FF1 A;  3TZ1 A;  2QAC A;  1OSA A;  1YX7 A;  5D69 A;  4A4B A;  1RFJ A;  2IS9 A;  4AOM A;  3BUN B;  1DJZ A;  1Q80 A;  1B7T Z;  5F6T A;  1MF8 B;  1ZAC A;  1UUR A;  1G8I A;  2COL B;  1SBJ A;  1JFJ A;  3CLN A;  3FS7 A;  1OQP A;  1ZOT B;  3SG7 A;  4DS7 A;  4C0K A;  5I8N A;  1KQV A;  5I2Q A;  1BOC A;  1BMO A;  1SL8 A;  1TNQ A;  2F3Z A;  2H61 C;  3KHE A;  5GQQ C;  2K2A A;  1V1G A;  1M46 A;  1H4B A;  4ORB B;  5TNC A;  4USL A;  5CPV A;  1SPY A;  1A4P A;  3TS5 B;  4ICB A;  1CB1 A;  4ETO A;  1BJF A;  4JWQ A;  1YX8 A;  2ZNE A;  4QJ5 B;  1XA5 A;  2PSR A;  3OB2 B;  2KAY A;  1AJ4 A;  1F4Q A;  1SY9 A;  2KBM A;  1S5G Y;  1A03 A;  1DJI A;  1ALV A;  1IJ6 A;  5I2O A;  3DVM A;  1LA3 A;  1RRO A;  1G4Y R;  1UP5 A;  2LVI A;  3SIB A;  2L5X B;  1IQ3 A;  1EJ3 A;  2KQY A;  2KDH A;  3EVR A;  1QLK A;  5I2L A;  3DVK A;  3SG6 A;  3TDU A;  4DRW A;  1NPQ A;  1RJV A;  2OPO A;  3H4S E;  3I5G C;  4YBH B;  3VGO A;  1NCZ A;  2K7B A;  1YVL A;  2B1U A;  1XFY O;  3I5I C;  1R6P A;  1F55 A;  3OX6 A;  4CID A;  3FWB A;  4P2Y B;  2NCO A;  2WC8 A;  1K2H A;  1NSH A;  1BR1 B;  4N1F A;  4PDZ A;  3SG5 A;  4CLN A;  1QIV A;  5HLO A;  2I94 A;  2HPS A;  1WDC C;  1QVI Y;  2CTN A;  4DCK A;  1A75 B;  5PAL A;  3BYA A;  2L51 A;  2Q91 A;  3EVU A;  5AER A;  1D1O A;  2LP3 A;  1ZUZ A;  3KEV A;  5HKW A;  1BU3 A;  3PSR A;  3A8R A;  4MZL A;  1FI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...