1UHKA

Crystal structure of n-aequorin
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
191
structure length
191
Chain Sequence
ANSKLTSDFDNPRWIGRHKHMFNFLDVNHNGKISLDEMVYKASDIVINNLGATPEQAKRHKDAVEAFFGGAGMKYGVETDWPAYIEGWKKLATDELEKYAKNEPTLIRIWGDALFDIVDKDQNGAITLDEWKAYTKAAGIIQSSEDCEETFRVCDIDESGQLDVDEMTRQHLGFWYTMDPACEKLYGGAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aequorin 2
publication title The crystal structures of semi-synthetic aequorins
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Luminescent protein
total genus 73
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1uhkA00
1PSBA 2G9BA 1EL4A 1NCZA 1TIZA 3ICBA 4MEWA 2PMYA 3O2PA 1DT7B 1EJ3A 2LUXA 1PALA 1GJYA 2JT3A 1IG5A 4BY5A 2F2OA 3HX4A 4GGNA 1SNLA 5F6TA 4YBHB 3OX5A 2LNKA 2Y1NA 3EKHA 1DJXA 1OQPA 1UWOA 1BU3A 4CFQA 3KPXA 1H8BA 3RM1A 1X02A 1V1FA 1MUXA 4MVFA 1C7VA 1NPQA 4JWQA 1PULA 2M0RA 1G8IA 4BY4A 3LCPC 1CDNA 2ZN9A 3TDIA 3SG4A 1SL9A 2LLSA 1TRFA 1SMGA 2G2BA 4AQIA 3PLFB 1TOPA 4HREE 5CSJA 4ETOA 1Y1UA 1AHRA 2KSPA 3LK0A 3QRXA 2HF5A 2R2IA 3FS7A 4C0LA 1OZSA 3I5GC 2O5GA 1RWYA 3AKAA 1NX0A 5HLOA 1SR6B 1UHIA 1CMFA 1R2UA 2JXCA 1IJ6A 2MRDA 1ZFSA 4TNCA 2WOSA 1IJ5A 2EHBA 3CGAA 1RTP1 1KQMC 1KK8B 1KFXL 2M8UA 1S5GY 4UPGA 1Y6WA 3NSIA 1S6CA 1JBAA 5DKNA 1F8HA 4C0KA 1DTLA 1CFDA 1N65A 2KYCA 1IQ3A 1CMGA 4PHJA 1J1DA 1ALWA 3EK7A 5PALA 2ZNDA 1QV0A 4Q04A 1NCYA 4OVNF 1LA3A 2LANA 1MR8A 2E6WA 3EK4A 5I8NA 2AAOA 4PALA 3A8RA 2F33A 3PFVA 1KSMA 1S6JA 2JXLA 5ER4X 4AOMA 1WLMA 4PE7A 2LMVA 4XJKB 4R1EA 4PCWA 1G33A 1SRAA 3NSLA 3EVVA 5JOLA 4NQGA 1A4PA 1YRTB 1KWOB 1NWDA 1Y0VH 2KHNA 3TUYC 1S6IA 1SCMC 1CDLA 3BUNB 2JPTA 3KEVA 1NP8A 4YI9A 1CLLA 2FCEA 5HKYA 2KFFA 2M29A 3DVMA 3JVTB 1QIVA 1CM1A 2KI4C 1EXRA 3CR5X 4OKHA 1NCXA 2KNEA 1SK6D 1CDPA 1DJHA 2D8NA 2CTNA 5HKZA 1CLBA 2TN4A 1OMDA 2GGZA 2O60A 1MHOA 4PHNA 1HQVA 1UHKA 1F55A 1R6PA 1YRUB 2OTGC 3FWBA 1K93D 1LKJA 4OV2A 1ZMZA 1RFJA 4GNKB 1ODBA 1YVLA 5AFPA 2M97A 1XO5A 3HCMA 4QJ3B 5CSIA 1SL8A 2E30A 3D0YA 4PE0A 1LVCD 1M63B 2M3WA 5K89A 3TDZA 1IKUA 2MJWB 3FIAA 3OB1B 4E68A 4ZCUA 2HETA 5FYXA 2KDHA 4PHMA 3BUXB 1QXPA 2WCFA 2KGRA 1B8LA 1M31A 4MLWA 3SG2A 1J7QA 2LVKA 2NXQA 2KGBC 2JT0A 1B7TZ 4ZCVA 4ORAB 2JZIA 2K61A 2LHIA 1DGVA 1KK8C 1TNXA 2CCMA 2MBXA 1Y1XA 1NUBA 3DVKA 2Y4QA 2K0JA 1WLZA 2BCBA 1TCFA 1XVJA 4CFRA 1XK4C 3GK1A 4I5LB 2WCBA 2LM5A 3O4YA 1CKKA 1FI5A 1CDMA 1QVIZ 1ZACA 4M2PA 2WC8A 1DJWA 5D69A 2JTZA 4N1GA 1DGUA 1TNPA 1QX7A 1YX8A 4U8DA 2M9GA 1TNWA 2Y5IA 1E8AA 4WRIA 4HSZA 2FJUB 2H2KA 1J7OA 1W7IB 4DS7A 4QJ5B 1KK7Y 1S3PA 2OTGB 1AP4A 1M45A 1QIWA 1KFUL 1QASA 5CSNA 1FI6A 1OSAA 1SBJA 1QJTA 4QJ4B 1KWOC 3M0WA 3F45A 2M1KB 1S1EA 2LHLA 1FF1A 1UP5A 3E3RA 2DOQA 1MWNA 3JVTC 1WY9A 2H61C 2OPOA 2QPTA 2ZNEA 4P5OE 1DMOA 2F3ZA 2LVIA 3DVEA 1A75B 2LMTA 2SCPA 4YI8A 1KCYA 2Q91A 1D1OA 1GGWA 4M2OA 1K95A 1S26D 1UHHA 1BLQA 3TZ1A 2K7DA 1OMVA 1YR5A 1G4YR 1JF2A 1K9PA 2HPSA 4JQ0D 2JT8A 3EVUA 4DCKA 2ZN8A 4I5NB 2KAXA 3VRNA 3I5HB 2B1UA 4GAOA 1F4QA 3NSOA 3DF0B 3LL8B 5HLVA 4YGEB 5B8IB 2A4JA 3AKBA 3CWGA 4PE1A 3A4UB 2GGMA 2NZ0A 4CLNA 2MA2A 2MLFC 3FWCA 1TCOB 1KQVA 1GGZA 3SIBA 1GQMA 2MLEC 3TDUA 2PRUA 3EKJA 5KU1A 1J1EA 3VRPA 2M7LA 4YGAA 5JJGA 1A03A 1B4CA 4MSPA 2KOTA 3D10A 4USLA 1SPYA 1N0YA 2BE4A 2M7NA 3ZNIA 1FPWA 1JFKA 2CXJA 4DIRA 1A2XA 1BODA 1JSAA 4GUKA 3VROA 1C7WA 2RGIA 5HKWA 1QTXA 1BR1B 4ORCB 3BUMB 2F8PA 1RROA 2KQYA 3AAKA 1DF0B 3WXAA 5TNCA 1MXLC 1TN4A 1JWDA 2L4IA 2NCOA 1B47A 2KYFA 2OS8B 2EGDA 1XFUO 4XJKA 2Q4UA 3VGOA 1U5IB 1LXFC 2V53A 4A4CA 2LLTA 2JNFA 2ZRSA 2I18A 4MBEA 4IL1A 1PVAA 2PALA 1K2HA 4F0ZB 1IWQA 1NIWA 4ICBA 2KI6C 1XFWO 4MZLA 1VRKA 1YUUA 1PVBA 1RECA 2K7CA 2BBMA 2SASA 1MF8B 2WNDA 3PSRA 4YGCB 1YURA 3VRQA 2PASA 5IBWA 3I5FB 1QS7A 4FQOA 4OCIA 1CM4A 3MSEB 2I94A 2JULA 2BCAA 1DJZA 2KBMA 1SKTA 1AJ4A 2AMIA 1EG4A 1NYAA 3K21A 4NDDA 1XA5A 2LV7A 1H4BA 3BOWB 1BOCA 3SG5A 5DKRA 1NX3A 4GBAA 3I5IB 2HQWA 3I5HC 1BMOA 1QX5B 4N1FA 1XYDA 3DVJA 1SW8A 1K94A 3OHMB 2BE6A 3PM8A 5AERA 2AUCA 2I7AA 3KO0A 4I5KA 1QV1A 2BL0B 2CBLA 2PSRA 1SCVA 2L98A 3JTDB 4P2YB 1BJFA 1YTZC 1CFCA 1F71A 1L2OB 1AK8A 4GGFC 4JPZB 3PN7B 2GV5A 2ZFDA 4ORBB 5BPJA 2K8MB 3O6BA 1KFUS 3TS5B 1IRJA 1B7TY 1FW4A 1N2DA 1WRKA 3CR2A 4OR9B 3PATA 4MRXA 1K90D 1MXEA 3BUOB 3EVRA 2L4HA 4I5JA 2BCXA 1UUSA 2I2RE 2WCEA 1WDCB 1YVHA 1CFFA 2LVVA 2F2PA 1TNQA 2JWWA 1IH0A 1WRZA 3GK4X 1AJ5A 5DKQA 3RLZA 2OS8C 1B1GA 4DRWA 1NX1A 1S5GZ 1QVIY 1UURA 2KQ6A 3ZWHA 2L2EA 4GFTA 2LP2A 4PHKA 4C0JA 2M1UA 3BXKA 4YRUA 2ISDA 3O78A 2LVJA 4FTGA 4NDBA 2K2AA 4M2QA 3SG7A 3NSKA 1K9UA 2JU0A 1DJYA 1ZUZA 4MN0A 3KHEA 1KFXS 5AANA 4A4BA 2IS9A 1JUOA 3OX6A 1NX2A 3KF9A 1PSRA 5CPVA 1J7RA 2NLNA 1KSOA 1J55A 4XYNA 2KBIA 1F70A 1A75A 1SYMA 2Y1MA 2LMUA 3SJSA 2HQ8A 2KFHA 3I5FC 1L7ZA 4D1EA 1F54A 1V1GA 2L50A 5KSZA 1M46A 5G08A 1AVSA 1W7JB 4NDCA 1J7PA 2L0PA 2LP3A 1CNPA 2WORA 1JFJA 1OZOA 1OOJA 2L5XB 1PK0D 2LCPA 4L9MA 5AEQA 1HT9A 4WQ2A 5I2QA 3GK2A 1TTXA 3SG3A 1XK4A 1OMRA 4MZKA 3BUWB 1C07A 1UHNA 3EK8A 2L51A 5I2OA 1LA0A 3DF0A 1YUSA 2EC6B 4N5XA 3I5IC 5HYDA 1B8RA 1DJIA 1XFXO 3SG6A 3PALA 2KFGA 1XFYO 5GQQC 3LK1A 5CSFA 1DJGA 2CNPA 2LAPA 5I2LA 2K7BA 4CPVA 1CFPA 2LE9B 4GGFA 4YGBB 2BL0C 3JTDC 3VRRA 1L2OC 1BR4B 2VRGA 2M49B 3OB2B 1YUTA 1S36A 1AUIB 3PN7C 1Y1AA 1QLKA 4GPLB 4CIDA 3TS5C 2KAVA 4MZJA 3WHUB 2FCDA 2KI6D 2PVBA 1SL7A 2BKIB 2JRFA 3CZTX 5AXIA 2QACA 2H61A 1CB1A 2LC5A 3CS1A 2K2FA 2MHHA 4MRYA 2COLB 3D0YB 2NCPA 4AQJA 4DUQA 1EG3A 2ZKMX 2JTTA 1DF0A 2ZRTA 3CTNA 1QATA 1BF5A 1WDCC 2BECA 3I5GB 3C1VA 1U5IA 3WHTB 2P6BB 5KTYA 1LINA 1SY9A 1K9KA 3LLEA 1YX7A 1JF0A 3CLNA 1QX2A 5J3XA 2CT9A 5ER5A 1BG1A 1KQMB 3CR4X 3SIAA 1NSHA 3NXAA 1ZOTB 2MAZA 2KAYA 2K7OA 2F3YA 1RJVA 3IF7A 3WNXB 1K96A 1F4OA 4PE4A 1WRLA 1IQ5A 1IGVA 2JOJA 1Q80A 4PDZA 1B9AA 1RK9A 3GOFA 4YGDB 2JC2A 1DVIA 1QLSA 1B8CA 2JNXA 2LLUA 2BBNA 1KK7Z 3BYAA 1CLMA 4WQ3A 1XFVO 1FBVA 1UHJA 3IQOA 1SR6C 3OP0A 1BT6A 1JC2A 1K8UA 1EH2A 3IQQA 2BKHB 3BQ3A 2JQ6A 1XFZO 2LUCA 1PRWA 3BOWA 2FOTA 3AAJA 5D7FA 3TUYB 3H4SE 1SCMB 4HRGA 1A29A 1OE9B 1MQ1A 1M39A 3DD4A 4HRHA 2KI4B 2EC6C 1ALVA 1CTRA
chains in the Genus database with same CATH superfamily
1PSBA 2G9BA 1EL4A 1NCZA 1TIZA 3ICBA 4MEWA 2PMYA 2WCLA 3O2PA 1DT7B 1EJ3A 2LUXA 1PALA 1GJYA 2JT3A 1IG5A 3BFBA 2F2OA 4BY5A 1QWVA 3HX4A 4GGNA 1SNLA 5F6TA 4YBHB 3OX5A 2LNKA 2Y1NA 3EKHA 1DJXA 1OQPA 1UWOA 1BU3A 2KPHA 3KPXA 4CFQA 1H8BA 3RM1A 1X02A 1V1FA 1MUXA 4MVFA 1C7VA 1NPQA 4JWQA 1PULA 2M0RA 1G8IA 4BY4A 3LCPC 1CDNA 2ZN9A 3TDIA 3SG4A 1SL9A 2LLSA 1TRFA 1SMGA 2G2BA 4AQIA 3PLFB 1TOPA 4HREE 5CSJA 4ETOA 1Y1UA 1AHRA 2KSPA 3LK0A 1IIOA 3QRXA 2HF5A 2R2IA 3FS7A 4C0LA 5I94A 1OZSA 3I5GC 2O5GA 1RWYA 3AKAA 3B6XA 1NX0A 5HLOA 1SR6B 1UHIA 1CMFA 1R2UA 2JXCA 2WCJA 1IJ6A 2MRDA 1ZFSA 4TNCA 2WOSA 1IJ5A 2EHBA 3CGAA 1RTP1 1KQMC 1KK8B 3B88A 1KFXL 3S0GA 2M8UA 1S5GY 4UPGA 1Y6WA 3NSIA 1S6CA 1JBAA 5DKNA 1F8HA 4C0KA 1DTLA 1CFDA 1N65A 2KYCA 1IQ3A 1C3YA 1CMGA 4PHJA 1J1DA 1ALWA 3EK7A 5PALA 2ZNDA 1OOHA 1QV0A 4Q04A 1NCYA 4OVNF 1LA3A 2LANA 1OOIX 1MR8A 2E6WA 3EK4A 4OZDA 2AAOA 5I8NA 4PALA 3A8RA 2F33A 3PFVA 1KSMA 1S6JA 2JXLA 5ER4X 4AOMA 1WLMA 4PE7A 2LMVA 4XJKB 4R1EA 4PCWA 1G33A 1SRAA 3NSLA 3EVVA 5JOLA 4NQGA 1A4PA 1YRTB 1KWOB 1NWDA 1Y0VH 2KHNA 3TUYC 2PYQA 1S6IA 1SCMC 1CDLA 3BUNB 2JPTA 3KEVA 1NP8A 4YI9A 1CLLA 2FCEA 5HKYA 2KFFA 2M29A 1T14A 2QEBA 3DVMA 3JVTB 4INXA 1QIVA 1CM1A 2KI4C 1EXRA 3CR5X 4OKHA 1NCXA 2KNEA 1SK6D 3NHIA 1CDPA 1DJHA 2D8NA 2CTNA 3FE6A 5HKZA 2TN4A 1CLBA 1OMDA 2GGZA 1C3ZA 2O60A 4F7FA 1MHOA 4PHNA 1HQVA 1UHKA 1P28A 1F55A 1R6PA 1YRUB 2OTGC 3FWBA 1Z2CB 1K93D 1LKJA 4OV2A 1OOFA 1ZMZA 1RFJA 4GNKB 1ODBA 1YVLA 5AFPA 2M97A 1XO5A 3V2LA 3HCMA 4QJ3B 5CSIA 3CABA 1SL8A 2E30A 3D0YA 4INWA 4PE0A 1LVCD 1M63B 2L2CA 2M3WA 5K89A 3TDZA 2YGUA 2MJWB 3FIAA 3OB1B 3CZ1A 3CZ0A 4E68A 1IKUA 4ZCUA 2HETA 5FYXA 2KDHA 1DQEA 4PHMA 1GM0A 3BUXB 1QXPA 2WCFA 2KGRA 3PJIA 1B8LA 5DICA 1M31A 4MLWA 3SG2A 1J7QA 2LVKA 2NXQA 2KGBC 2JT0A 1B7TZ 4ZCVA 2P71A 3S0AA 4ORAB 2JZIA 2K61A 2LHIA 1DGVA 1KK8C 1SSEB 1TNXA 2CCMA 2MBXA 1Y1XA 1NUBA 3DVKA 2Y4QA 2K0JA 1WLZA 2BCBA 1TCFA 1XVJA 4CFRA 1XK4C 3GK1A 4I5LB 2WCBA 3SS5A 2LM5A 3O4YA 1CKKA 1FI5A 3D76A 1CDMA 1QVIZ 1ZACA 4M2PA 2WC8A 1DJWA 5D69A 2JTZA 4N1GA 1DGUA 1TNPA 5EL2A 1QX7A 1YX8A 4U8DA 2M9GA 1TNWA 2Y5IA 1E8AA 1OW4A 4WRIA 4HSZA 2FJUB 2H2KA 1J7OA 1W7IB 1Z4HA 4DS7A 4QJ5B 1KK7Y 1S3PA 2OTGB 1AP4A 1M45A 3OGNA 1QIWA 1KFUL 1QASA 3N7HA 5CSNA 1FI6A 1OSAA 1SBJA 1QJTA 4QJ4B 1KWOC 3M0WA 3F45A 2M1KB 1S1EA 2LHLA 1FF1A 1UP5A 3E3RA 2DOQA 1MWNA 4JD9A 3JVTC 3UNWA 3R1OA 1WY9A 2H61C 3D77A 2OPOA 2QPTA 2ZNEA 4P5OE 1DMOA 2QEOA 3BJHA 2F3ZA 2LVIA 4JKTA 3DVEA 3DXLA 3B86A 1A75B 2LMTA 2SCPA 4YI8A 1KCYA 2Q91A 1D1OA 1GGWA 4M2OA 1K95A 1S26D 1UHHA 1BLQA 3TZ1A 2K7DA 1OMVA 1YR5A 1G4YR 3PM2A 1JF2A 1K9PA 2HPSA 4JQ0D 3L4AA 2JT8A 2WCMA 1DEKA 3D75A 3EVUA 4DCKA 2ZN8A 3CDNA 4I5NB 2KAXA 3VRNA 3I5HB 2B1UA 4GAOA 1F4QA 1TUZA 3NSOA 3DF0B 3LL8B 5HLVA 4YGEB 2ERBA 2A4JA 5B8IB 3AKBA 3CWGA 4PE1A 3A4UB 3IVTA 2GGMA 2JPOA 2NZ0A 4CLNA 2MA2A 2MLFC 3FWCA 1TCOB 1KQVA 1GGZA 3SIBA 1GQMA 2MLEC 3TDUA 2PRUA 3EKJA 5KU1A 1J1EA 3VRPA 2M7LA 4YGAA 5JJGA 1A03A 1B4CA 4MSPA 2KOTA 3D10A 4USLA 1SPYA 1N0YA 2BE4A 2M7NA 3ZNIA 1FPWA 1JFKA 2CXJA 4DIRA 1A2XA 1BODA 3VB1A 1JSAA 4GUKA 3D78A 1C7WA 2RGIA 5HKWA 3VROA 1QTXA 1BR1B 4ORCB 3BUMB 2F8PA 1RROA 2KQYA 3AAKA 1DF0B 2H8VA 5TNCA 1MXLC 1TN4A 3WXAA 1JWDA 2L4IA 2NCOA 1B47A 2KYFA 2OS8B 2EGDA 1XFUO 3BFHA 4XJKA 2Q4UA 3VGOA 1U5IB 1LXFC 2V53A 4A4CA 2LLTA 2JNFA 2ZRSA 3D74A 2I18A 4MBEA 5HL1A 4IL1A 1PVAA 2PALA 2K60A 1K2HA 4F0ZB 1IWQA 1NIWA 4ICBA 3FE9A 2KI6C 1XFWO 4MZLA 1VRKA 1YUUA 1PVBA 1RECA 2K7CA 2BBMA 2SASA 1MF8B 2WNDA 3PSRA 3CZ2A 4IJ7A 1YURA 4YGCB 3VRQA 2PASA 5IBWA 3I5FB 1QS7A 4FQOA 4OCIA 1CM4A 3MSEB 2I94A 2JULA 2BCAA 1DJZA 2WCHA 2KBMA 1SKTA 1AJ4A 2AMIA 1EG4A 1NYAA 3K21A 4NDDA 1XA5A 2LV7A 1H4BA 2QDIA 3BOWB 1BOCA 3SG5A 1XFRA 5DKRA 1NX3A 4GBAA 3I5IB 2HQWA 3I5HC 2L5YA 3S0FA 1BMOA 1QX5B 2QEVA 1XYDA 4N1FA 3DVJA 3SS3A 1SW8A 1K94A 3OHMB 2BE6A 3PM8A 5AERA 2AUCA 2I7AA 3B87A 3KO0A 4I5KA 1QV1A 2BL0B 2CBLA 2PSRA 1SCVA 2L98A 3JTDB 4P2YB 1BJFA 1YTZC 1CFCA 3D73A 1L2OB 1F71A 1AK8A 4GGFC 4JPZB 2WC6A 3PN7B 2GV5A 2PQLA 2ZFDA 3Q8IA 4ORBB 5BPJA 2K8MB 3O6BA 1KFUS 3TS5B 1IRJA 1B7TY 1FW4A 1N2DA 1WRKA 3CR2A 4OR9B 3RZSA 3PATA 4MRXA 1K90D 3UO9A 1MXEA 3R1PA 3BUOB 1TWOA 2KLEA 3EVRA 2L4HA 4I5JA 2BCXA 1UUSA 2I2RE 2WCEA 1WDCB 1YVHA 3FE8A 2P70A 1CFFA 2LVVA 2F2PA 1TNQA 2JWWA 1IH0A 1WRZA 3GK4X 1AJ5A 1OOGA 3QMEA 5DKQA 2OS8C 3RLZA 4DRWA 1B1GA 1NX1A 1S5GZ 1QVIY 1UURA 2KQ6A 2BAPA 3ZWHA 2L2EA 4GFTA 2LP2A 4PHKA 4C0JA 2M1UA 3BXKA 4YRUA 2ISDA 3O78A 2LVJA 4FTGA 4NDBA 2K2AA 4M2QA 3SG7A 3NSKA 1K9UA 3L47A 2JU0A 1DJYA 1ZUZA 4MN0A 3KHEA 1KFXS 1LS8A 5AANA 4A4BA 2IS9A 1JUOA 3OX6A 3O4XA 1NX2A 3KF9A 1PSRA 1ORGA 5CPVA 1J7RA 2NLNA 1KSOA 1J55A 3EG5B 4XYNA 2KBIA 1F70A 1A75A 1SYMA 2Y1MA 2LMUA 3SJSA 2HQ8A 2KFHA 3I5FC 1L7ZA 4D1EA 1F54A 1V1GA 2L50A 5KSZA 1M46A 3B7AA 5G08A 1AVSA 1W7JB 4NDCA 1J7PA 2L0PA 2LP3A 1CNPA 2WORA 1JFJA 1OZOA 2FJYA 1OOJA 2L5XB 4KYNA 1PK0D 2LCPA 4L9MA 5AEQA 1HT9A 4WQ2A 5FI7A 5I2QA 3GK2A 1TTXA 3SG3A 1XK4A 1OMRA 4MZKA 3BUWB 1C07A 1UHNA 3EK8A 2L51A 5I2OA 1LA0A 3DF0A 1YUSA 2EC6B 4N5XA 3I5IC 5HYDA 1B8RA 1DJIA 1XFXO 3SG6A 3PALA 2KFGA 1XFYO 5GQQC 3LK1A 5CSFA 3DY9A 3CYZA 1DJGA 2CNPA 2LAPA 5FI6A 2K7BA 5I2LA 4CPVA 1CFPA 2LE9B 4GGFA 4YGBB 2BL0C 3JTDC 2WCKA 3VRRA 1L2OC 1BR4B 2VRGA 2M49B 3OB2B 1YUTA 1S36A 1AUIB 3PN7C 1Y1AA 1QLKA 4GPLB 4CIDA 3TS5C 2KAVA 4MZJA 3WHUB 2FCDA 2KI6D 2PVBA 1DELA 2KLDA 1SL7A 2BKIB 2JRFA 3CZTX 5AXIA 2QACA 2H61A 1CB1A 2LC5A 3CS1A 2K2FA 2MHHA 4MRYA 2COLB 3BFAA 3D0YB 2NCPA 5FI2A 4AQJA 4DUQA 1EG3A 2ZKMX 2JTTA 1DF0A 2ZRTA 3CTNA 1QATA 3NGVA 1WDCC 3OBVA 4FQTA 1BF5A 3S0EA 2BECA 3I5GB 3C1VA 1U5IA 3WHTB 2P6BB 2WC5A 3SS4A 5KTYA 1LINA 1SY9A 1K9KA 3LLEA 1YX7A 1JF0A 3CLNA 1QX2A 4PT1A 5J3XA 2CT9A 5ER5A 1BG1A 1KQMB 3CR4X 3SIAA 1NSHA 3NXAA 1ZOTB 3S0BA 2MAZA 2KAYA 2K7OA 2F3YA 1RJVA 3IF7A 3WNXB 1K96A 1F4OA 4PE4A 1WRLA 1IQ5A 1IGVA 2JOJA 1Q80A 3DZTA 1B9AA 2QEHA 4PDZA 1RK9A 2BNXA 3GOFA 3R72A 1W9ZA 2JC2A 1DVIA 4YGDB 1QLSA 1B8CA 2JNXA 5D3OA 2LLUA 2BBNA 3NHTA 3R1VA 1KK7Z 3BYAA 1CLMA 4WQ3A 1XFVO 3DYEA 1FBVA 1UHJA 3IQOA 1DC1A 1SR6C 3OP0A 1BT6A 1JC2A 1K8UA 1EH2A 3IQQA 2BKHB 3BQ3A 2JQ6A 1XFZO 2LUCA 1PRWA 3BOWA 2FOTA 2GTEA 3AAJA 5D7FA 3S0DA 3H4SE 3L4LA 3TUYB 1SCMB 4HRGA 1A29A 1OE9B 1MQ1A 1TUJA 1M39A 3DD4A 4HRHA 3K1EA 2KI4B 2EC6C 1ALVA 1CTRA
chains in the Genus database with same CATH topology
1PSBA 2G9BA 1EL4A 1NCZA 1TIZA 3ICBA 4MEWA 2PMYA 3O2PA 1DT7B 1EJ3A 2LUXA 1PALA 1GJYA 2JT3A 1IG5A 4BY5A 2F2OA 3HX4A 4GGNA 1SNLA 5F6TA 4YBHB 3OX5A 2LNKA 2Y1NA 3EKHA 1DJXA 1OQPA 1UWOA 1BU3A 4CFQA 3KPXA 1H8BA 3RM1A 1X02A 1V1FA 1MUXA 4MVFA 1C7VA 1NPQA 4JWQA 1PULA 2M0RA 1G8IA 4BY4A 3LCPC 1CDNA 2ZN9A 3TDIA 3SG4A 1SL9A 2LLSA 1TRFA 1SMGA 2G2BA 4AQIA 3PLFB 1TOPA 4HREE 5CSJA 4ETOA 1Y1UA 1AHRA 2KSPA 3LK0A 3QRXA 2HF5A 2R2IA 3FS7A 4C0LA 1OZSA 3I5GC 2O5GA 1RWYA 3AKAA 1NX0A 5HLOA 1SR6B 1UHIA 1CMFA 1R2UA 2JXCA 1IJ6A 2MRDA 1ZFSA 4TNCA 2WOSA 1IJ5A 2EHBA 3CGAA 1RTP1 1KQMC 1KK8B 1KFXL 2M8UA 1S5GY 4UPGA 1Y6WA 3NSIA 1S6CA 1JBAA 5DKNA 1F8HA 4C0KA 1DTLA 1CFDA 1N65A 2KYCA 1IQ3A 1CMGA 4PHJA 1J1DA 1ALWA 3EK7A 5PALA 2ZNDA 1QV0A 4Q04A 1NCYA 4OVNF 1LA3A 2LANA 1MR8A 2E6WA 3EK4A 5I8NA 2AAOA 4PALA 3A8RA 2F33A 3PFVA 1KSMA 1S6JA 2JXLA 5ER4X 4AOMA 1WLMA 4PE7A 2LMVA 4XJKB 4R1EA 4PCWA 1G33A 1SRAA 3NSLA 3EVVA 5JOLA 4NQGA 1A4PA 1YRTB 1KWOB 1NWDA 1Y0VH 2KHNA 3TUYC 1S6IA 1SCMC 1CDLA 3BUNB 2JPTA 3KEVA 1NP8A 4YI9A 1CLLA 2FCEA 5HKYA 2KFFA 2M29A 3DVMA 3JVTB 1QIVA 1CM1A 2KI4C 1EXRA 3CR5X 4OKHA 1NCXA 2KNEA 1SK6D 1CDPA 1DJHA 2D8NA 2CTNA 5HKZA 1CLBA 2TN4A 1OMDA 2GGZA 2O60A 1MHOA 4PHNA 1HQVA 1UHKA 1F55A 1R6PA 1YRUB 2OTGC 3FWBA 1K93D 1LKJA 4OV2A 1ZMZA 1RFJA 4GNKB 1ODBA 1YVLA 5AFPA 2M97A 1XO5A 3HCMA 4QJ3B 5CSIA 1SL8A 2E30A 3D0YA 4PE0A 1LVCD 1M63B 2M3WA 5K89A 3TDZA 1IKUA 2MJWB 3FIAA 3OB1B 4E68A 4ZCUA 2HETA 5FYXA 2KDHA 4PHMA 3BUXB 1QXPA 2WCFA 2KGRA 1B8LA 1M31A 4MLWA 3SG2A 1J7QA 2LVKA 2NXQA 2KGBC 2JT0A 1B7TZ 4ZCVA 4ORAB 2JZIA 2K61A 2LHIA 1DGVA 1KK8C 1TNXA 2CCMA 2MBXA 1Y1XA 1NUBA 3DVKA 2Y4QA 2K0JA 1WLZA 2BCBA 1TCFA 1XVJA 4CFRA 1XK4C 3GK1A 4I5LB 2WCBA 2LM5A 3O4YA 1CKKA 1FI5A 1CDMA 1QVIZ 1ZACA 4M2PA 2WC8A 1DJWA 5D69A 2JTZA 4N1GA 1DGUA 1TNPA 1QX7A 1YX8A 4U8DA 2M9GA 1TNWA 2Y5IA 1E8AA 4WRIA 4HSZA 2FJUB 2H2KA 1J7OA 1W7IB 4DS7A 4QJ5B 1KK7Y 1S3PA 2OTGB 1AP4A 1M45A 1QIWA 1KFUL 1QASA 5CSNA 1FI6A 1OSAA 1SBJA 1QJTA 4QJ4B 1KWOC 3M0WA 3F45A 2M1KB 1S1EA 2LHLA 1FF1A 1UP5A 3E3RA 2DOQA 1MWNA 3JVTC 1WY9A 2H61C 2OPOA 2QPTA 2ZNEA 4P5OE 1DMOA 2F3ZA 2LVIA 3DVEA 1A75B 2LMTA 2SCPA 4YI8A 1KCYA 2Q91A 1D1OA 1GGWA 4M2OA 1K95A 1S26D 1UHHA 1BLQA 3TZ1A 2K7DA 1OMVA 1YR5A 1G4YR 1JF2A 1K9PA 2HPSA 4JQ0D 2JT8A 3EVUA 4DCKA 2ZN8A 4I5NB 2KAXA 3VRNA 3I5HB 2B1UA 4GAOA 1F4QA 3NSOA 3DF0B 3LL8B 5HLVA 4YGEB 5B8IB 2A4JA 3AKBA 3CWGA 4PE1A 3A4UB 2GGMA 2NZ0A 4CLNA 2MA2A 2MLFC 3FWCA 1TCOB 1KQVA 1GGZA 3SIBA 1GQMA 2MLEC 3TDUA 2PRUA 3EKJA 5KU1A 1J1EA 3VRPA 2M7LA 4YGAA 5JJGA 1A03A 1B4CA 4MSPA 2KOTA 3D10A 4USLA 1SPYA 1N0YA 2BE4A 2M7NA 3ZNIA 1FPWA 1JFKA 2CXJA 4DIRA 1A2XA 1BODA 1JSAA 4GUKA 3VROA 1C7WA 2RGIA 5HKWA 1QTXA 1BR1B 4ORCB 3BUMB 2F8PA 1RROA 2KQYA 3AAKA 1DF0B 3WXAA 5TNCA 1MXLC 1TN4A 1JWDA 2L4IA 2NCOA 1B47A 2KYFA 2OS8B 2EGDA 1XFUO 4XJKA 2Q4UA 3VGOA 1U5IB 1LXFC 2V53A 4A4CA 2LLTA 2JNFA 2ZRSA 2I18A 4MBEA 4IL1A 1PVAA 2PALA 1K2HA 4F0ZB 1IWQA 1NIWA 4ICBA 2KI6C 1XFWO 4MZLA 1VRKA 1YUUA 1PVBA 1RECA 2K7CA 2BBMA 2SASA 1MF8B 2WNDA 3PSRA 4YGCB 1YURA 3VRQA 2PASA 5IBWA 3I5FB 1QS7A 4FQOA 4OCIA 1CM4A 3MSEB 2I94A 2JULA 2BCAA 1DJZA 2KBMA 1SKTA 1AJ4A 2AMIA 1EG4A 1NYAA 3K21A 4NDDA 1XA5A 2LV7A 1H4BA 3BOWB 1BOCA 3SG5A 5DKRA 1NX3A 4GBAA 3I5IB 2HQWA 3I5HC 1BMOA 1QX5B 4N1FA 1XYDA 3DVJA 1SW8A 1K94A 3OHMB 2BE6A 3PM8A 5AERA 2AUCA 2I7AA 3KO0A 4I5KA 1QV1A 2BL0B 2CBLA 2PSRA 1SCVA 2L98A 3JTDB 4P2YB 1BJFA 1YTZC 1CFCA 1F71A 1L2OB 1AK8A 4GGFC 4JPZB 3PN7B 2GV5A 2ZFDA 4ORBB 5BPJA 2K8MB 3O6BA 1KFUS 3TS5B 1IRJA 1B7TY 1FW4A 1N2DA 1WRKA 3CR2A 4OR9B 3PATA 4MRXA 1K90D 1MXEA 3BUOB 3EVRA 2L4HA 4I5JA 2BCXA 1UUSA 2I2RE 2WCEA 1WDCB 1YVHA 1CFFA 2LVVA 2F2PA 1TNQA 2JWWA 1IH0A 1WRZA 3GK4X 1AJ5A 5DKQA 3RLZA 2OS8C 1B1GA 4DRWA 1NX1A 1S5GZ 1QVIY 1UURA 2KQ6A 3ZWHA 2L2EA 4GFTA 2LP2A 4PHKA 4C0JA 2M1UA 3BXKA 4YRUA 2ISDA 3O78A 2LVJA 4FTGA 4NDBA 2K2AA 4M2QA 3SG7A 3NSKA 1K9UA 2JU0A 1DJYA 1ZUZA 4MN0A 3KHEA 1KFXS 5AANA 4A4BA 2IS9A 1JUOA 3OX6A 1NX2A 3KF9A 1PSRA 5CPVA 1J7RA 2NLNA 1KSOA 1J55A 4XYNA 2KBIA 1F70A 1A75A 1SYMA 2Y1MA 2LMUA 3SJSA 2HQ8A 2KFHA 3I5FC 1L7ZA 4D1EA 1F54A 1V1GA 2L50A 5KSZA 1M46A 5G08A 1AVSA 1W7JB 4NDCA 1J7PA 2L0PA 2LP3A 1CNPA 2WORA 1JFJA 1OZOA 1OOJA 2L5XB 1PK0D 2LCPA 4L9MA 5AEQA 1HT9A 4WQ2A 5I2QA 3GK2A 1TTXA 3SG3A 1XK4A 1OMRA 4MZKA 3BUWB 1C07A 1UHNA 3EK8A 2L51A 5I2OA 1LA0A 3DF0A 1YUSA 2EC6B 4N5XA 3I5IC 5HYDA 1B8RA 1DJIA 1XFXO 3SG6A 3PALA 2KFGA 1XFYO 5GQQC 3LK1A 5CSFA 1DJGA 2CNPA 2LAPA 5I2LA 2K7BA 4CPVA 1CFPA 2LE9B 4GGFA 4YGBB 2BL0C 3JTDC 3VRRA 1L2OC 1BR4B 2VRGA 2M49B 3OB2B 1YUTA 1S36A 1AUIB 3PN7C 1Y1AA 1QLKA 4GPLB 4CIDA 3TS5C 2KAVA 4MZJA 3WHUB 2FCDA 2KI6D 2PVBA 1SL7A 2BKIB 2JRFA 3CZTX 5AXIA 2QACA 2H61A 1CB1A 2LC5A 3CS1A 2K2FA 2MHHA 4MRYA 2COLB 3D0YB 2NCPA 4AQJA 4DUQA 1EG3A 2ZKMX 2JTTA 1DF0A 2ZRTA 3CTNA 1QATA 1BF5A 1WDCC 2BECA 3I5GB 3C1VA 1U5IA 3WHTB 2P6BB 5KTYA 1LINA 1SY9A 1K9KA 3LLEA 1YX7A 1JF0A 3CLNA 1QX2A 5J3XA 2CT9A 5ER5A 1BG1A 1KQMB 3CR4X 3SIAA 1NSHA 3NXAA 1ZOTB 2MAZA 2KAYA 2K7OA 2F3YA 1RJVA 3IF7A 3WNXB 1K96A 1F4OA 4PE4A 1WRLA 1IQ5A 1IGVA 2JOJA 1Q80A 4PDZA 1B9AA 1RK9A 3GOFA 4YGDB 2JC2A 1DVIA 1QLSA 1B8CA 2JNXA 2LLUA 2BBNA 1KK7Z 3BYAA 1CLMA 4WQ3A 1XFVO 1FBVA 1UHJA 3IQOA 1SR6C 3OP0A 1BT6A 1JC2A 1K8UA 1EH2A 3IQQA 2BKHB 3BQ3A 2JQ6A 1XFZO 2LUCA 1PRWA 3BOWA 2FOTA 3AAJA 5D7FA 3TUYB 3H4SE 1SCMB 4HRGA 1A29A 1OE9B 1MQ1A 1M39A 3DD4A 4HRHA 2KI4B 2EC6C 1ALVA 1CTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PSB A;  2G9B A;  1EL4 A;  1NCZ A;  1TIZ A;  3ICB A;  4MEW A;  2PMY A;  3O2P A;  1DT7 B;  1EJ3 A;  2LUX A;  1PAL A;  1GJY A;  2JT3 A;  1IG5 A;  4BY5 A;  2F2O A;  3HX4 A;  4GGN A;  1SNL A;  5F6T A;  4YBH B;  3OX5 A;  2LNK A;  2Y1N A;  3EKH A;  1DJX A;  1OQP A;  1UWO A;  1BU3 A;  4CFQ A;  3KPX A;  1H8B A;  3RM1 A;  1X02 A;  1V1F A;  1MUX A;  4MVF A;  1C7V A;  1NPQ A;  4JWQ A;  1PUL A;  2M0R A;  1G8I A;  4BY4 A;  3LCP C;  1CDN A;  2ZN9 A;  3TDI A;  3SG4 A;  1SL9 A;  2LLS A;  1TRF A;  1SMG A;  2G2B A;  4AQI A;  3PLF B;  1TOP A;  4HRE E;  5CSJ A;  4ETO A;  1Y1U A;  1AHR A;  2KSP A;  3LK0 A;  3QRX A;  2HF5 A;  2R2I A;  3FS7 A;  4C0L A;  1OZS A;  3I5G C;  2O5G A;  1RWY A;  3AKA A;  1NX0 A;  5HLO A;  1SR6 B;  1UHI A;  1CMF A;  1R2U A;  2JXC A;  1IJ6 A;  2MRD A;  1ZFS A;  4TNC A;  2WOS A;  1IJ5 A;  2EHB A;  3CGA A;  1RTP 1;  1KQM C;  1KK8 B;  1KFX L;  2M8U A;  1S5G Y;  4UPG A;  1Y6W A;  3NSI A;  1S6C A;  1JBA A;  5DKN A;  1F8H A;  4C0K A;  1DTL A;  1CFD A;  1N65 A;  2KYC A;  1IQ3 A;  1CMG A;  4PHJ A;  1J1D A;  1ALW A;  3EK7 A;  5PAL A;  2ZND A;  1QV0 A;  4Q04 A;  1NCY A;  4OVN F;  1LA3 A;  2LAN A;  1MR8 A;  2E6W A;  3EK4 A;  5I8N A;  2AAO A;  4PAL A;  3A8R A;  2F33 A;  3PFV A;  1KSM A;  1S6J A;  2JXL A;  5ER4 X;  4AOM A;  1WLM A;  4PE7 A;  2LMV A;  4XJK B;  4R1E A;  4PCW A;  1G33 A;  1SRA A;  3NSL A;  3EVV A;  5JOL A;  4NQG A;  1A4P A;  1YRT B;  1KWO B;  1NWD A;  1Y0V H;  2KHN A;  3TUY C;  1S6I A;  1SCM C;  1CDL A;  3BUN B;  2JPT A;  3KEV A;  1NP8 A;  4YI9 A;  1CLL A;  2FCE A;  5HKY A;  2KFF A;  2M29 A;  3DVM A;  3JVT B;  1QIV A;  1CM1 A;  2KI4 C;  1EXR A;  3CR5 X;  4OKH A;  1NCX A;  2KNE A;  1SK6 D;  1CDP A;  1DJH A;  2D8N A;  2CTN A;  5HKZ A;  1CLB A;  2TN4 A;  1OMD A;  2GGZ A;  2O60 A;  1MHO A;  4PHN A;  1HQV A;  1UHK A;  1F55 A;  1R6P A;  1YRU B;  2OTG C;  3FWB A;  1K93 D;  1LKJ A;  4OV2 A;  1ZMZ A;  1RFJ A;  4GNK B;  1ODB A;  1YVL A;  5AFP A;  2M97 A;  1XO5 A;  3HCM A;  4QJ3 B;  5CSI A;  1SL8 A;  2E30 A;  3D0Y A;  4PE0 A;  1LVC D;  1M63 B;  2M3W A;  5K89 A;  3TDZ A;  1IKU A;  2MJW B;  3FIA A;  3OB1 B;  4E68 A;  4ZCU A;  2HET A;  5FYX A;  2KDH A;  4PHM A;  3BUX B;  1QXP A;  2WCF A;  2KGR A;  1B8L A;  1M31 A;  4MLW A;  3SG2 A;  1J7Q A;  2LVK A;  2NXQ A;  2KGB C;  2JT0 A;  1B7T Z;  4ZCV A;  4ORA B;  2JZI A;  2K61 A;  2LHI A;  1DGV A;  1KK8 C;  1TNX A;  2CCM A;  2MBX A;  1Y1X A;  1NUB A;  3DVK A;  2Y4Q A;  2K0J A;  1WLZ A;  2BCB A;  1TCF A;  1XVJ A;  4CFR A;  1XK4 C;  3GK1 A;  4I5L B;  2WCB A;  2LM5 A;  3O4Y A;  1CKK A;  1FI5 A;  1CDM A;  1QVI Z;  1ZAC A;  4M2P A;  2WC8 A;  1DJW A;  5D69 A;  2JTZ A;  4N1G A;  1DGU A;  1TNP A;  1QX7 A;  1YX8 A;  4U8D A;  2M9G A;  1TNW A;  2Y5I A;  1E8A A;  4WRI A;  4HSZ A;  2FJU B;  2H2K A;  1J7O A;  1W7I B;  4DS7 A;  4QJ5 B;  1KK7 Y;  1S3P A;  2OTG B;  1AP4 A;  1M45 A;  1QIW A;  1KFU L;  1QAS A;  5CSN A;  1FI6 A;  1OSA A;  1SBJ A;  1QJT A;  4QJ4 B;  1KWO C;  3M0W A;  3F45 A;  2M1K B;  1S1E A;  2LHL A;  1FF1 A;  1UP5 A;  3E3R A;  2DOQ A;  1MWN A;  3JVT C;  1WY9 A;  2H61 C;  2OPO A;  2QPT A;  2ZNE A;  4P5O E;  1DMO A;  2F3Z A;  2LVI A;  3DVE A;  1A75 B;  2LMT A;  2SCP A;  4YI8 A;  1KCY A;  2Q91 A;  1D1O A;  1GGW A;  4M2O A;  1K95 A;  1S26 D;  1UHH A;  1BLQ A;  3TZ1 A;  2K7D A;  1OMV A;  1YR5 A;  1G4Y R;  1JF2 A;  1K9P A;  2HPS A;  4JQ0 D;  2JT8 A;  3EVU A;  4DCK A;  2ZN8 A;  4I5N B;  2KAX A;  3VRN A;  3I5H B;  2B1U A;  4GAO A;  1F4Q A;  3NSO A;  3DF0 B;  3LL8 B;  5HLV A;  4YGE B;  5B8I B;  2A4J A;  3AKB A;  3CWG A;  4PE1 A;  3A4U B;  2GGM A;  2NZ0 A;  4CLN A;  2MA2 A;  2MLF C;  3FWC A;  1TCO B;  1KQV A;  1GGZ A;  3SIB A;  1GQM A;  2MLE C;  3TDU A;  2PRU A;  3EKJ A;  5KU1 A;  1J1E A;  3VRP A;  2M7L A;  4YGA A;  5JJG A;  1A03 A;  1B4C A;  4MSP A;  2KOT A;  3D10 A;  4USL A;  1SPY A;  1N0Y A;  2BE4 A;  2M7N A;  3ZNI A;  1FPW A;  1JFK A;  2CXJ A;  4DIR A;  1A2X A;  1BOD A;  1JSA A;  4GUK A;  3VRO A;  1C7W A;  2RGI A;  5HKW A;  1QTX A;  1BR1 B;  4ORC B;  3BUM B;  2F8P A;  1RRO A;  2KQY A;  3AAK A;  1DF0 B;  3WXA A;  5TNC A;  1MXL C;  1TN4 A;  1JWD A;  2L4I A;  2NCO A;  1B47 A;  2KYF A;  2OS8 B;  2EGD A;  1XFU O;  4XJK A;  2Q4U A;  3VGO A;  1U5I B;  1LXF C;  2V53 A;  4A4C A;  2LLT A;  2JNF A;  2ZRS A;  2I18 A;  4MBE A;  4IL1 A;  1PVA A;  2PAL A;  1K2H A;  4F0Z B;  1IWQ A;  1NIW A;  4ICB A;  2KI6 C;  1XFW O;  4MZL A;  1VRK A;  1YUU A;  1PVB A;  1REC A;  2K7C A;  2BBM A;  2SAS A;  1MF8 B;  2WND A;  3PSR A;  4YGC B;  1YUR A;  3VRQ A;  2PAS A;  5IBW A;  3I5F B;  1QS7 A;  4FQO A;  4OCI A;  1CM4 A;  3MSE B;  2I94 A;  2JUL A;  2BCA A;  1DJZ A;  2KBM A;  1SKT A;  1AJ4 A;  2AMI A;  1EG4 A;  1NYA A;  3K21 A;  4NDD A;  1XA5 A;  2LV7 A;  1H4B A;  3BOW B;  1BOC A;  3SG5 A;  5DKR A;  1NX3 A;  4GBA A;  3I5I B;  2HQW A;  3I5H C;  1BMO A;  1QX5 B;  4N1F A;  1XYD A;  3DVJ A;  1SW8 A;  1K94 A;  3OHM B;  2BE6 A;  3PM8 A;  5AER A;  2AUC A;  2I7A A;  3KO0 A;  4I5K A;  1QV1 A;  2BL0 B;  2CBL A;  2PSR A;  1SCV A;  2L98 A;  3JTD B;  4P2Y B;  1BJF A;  1YTZ C;  1CFC A;  1F71 A;  1L2O B;  1AK8 A;  4GGF C;  4JPZ B;  3PN7 B;  2GV5 A;  2ZFD A;  4ORB B;  5BPJ A;  2K8M B;  3O6B A;  1KFU S;  3TS5 B;  1IRJ A;  1B7T Y;  1FW4 A;  1N2D A;  1WRK A;  3CR2 A;  4OR9 B;  3PAT A;  4MRX A;  1K90 D;  1MXE A;  3BUO B;  3EVR A;  2L4H A;  4I5J A;  2BCX A;  1UUS A;  2I2R E;  2WCE A;  1WDC B;  1YVH A;  1CFF A;  2LVV A;  2F2P A;  1TNQ A;  2JWW A;  1IH0 A;  1WRZ A;  3GK4 X;  1AJ5 A;  5DKQ A;  3RLZ A;  2OS8 C;  1B1G A;  4DRW A;  1NX1 A;  1S5G Z;  1QVI Y;  1UUR A;  2KQ6 A;  3ZWH A;  2L2E A;  4GFT A;  2LP2 A;  4PHK A;  4C0J A;  2M1U A;  3BXK A;  4YRU A;  2ISD A;  3O78 A;  2LVJ A;  4FTG A;  4NDB A;  2K2A A;  4M2Q A;  3SG7 A;  3NSK A;  1K9U A;  2JU0 A;  1DJY A;  1ZUZ A;  4MN0 A;  3KHE A;  1KFX S;  5AAN A;  4A4B A;  2IS9 A;  1JUO A;  3OX6 A;  1NX2 A;  3KF9 A;  1PSR A;  5CPV A;  1J7R A;  2NLN A;  1KSO A;  1J55 A;  4XYN A;  2KBI A;  1F70 A;  1A75 A;  1SYM A;  2Y1M A;  2LMU A;  3SJS A;  2HQ8 A;  2KFH A;  3I5F C;  1L7Z A;  4D1E A;  1F54 A;  1V1G A;  2L50 A;  5KSZ A;  1M46 A;  5G08 A;  1AVS A;  1W7J B;  4NDC A;  1J7P A;  2L0P A;  2LP3 A;  1CNP A;  2WOR A;  1JFJ A;  1OZO A;  1OOJ A;  2L5X B;  1PK0 D;  2LCP A;  4L9M A;  5AEQ A;  1HT9 A;  4WQ2 A;  5I2Q A;  3GK2 A;  1TTX A;  3SG3 A;  1XK4 A;  1OMR A;  4MZK A;  3BUW B;  1C07 A;  1UHN A;  3EK8 A;  2L51 A;  5I2O A;  1LA0 A;  3DF0 A;  1YUS A;  2EC6 B;  4N5X A;  3I5I C;  5HYD A;  1B8R A;  1DJI A;  1XFX O;  3SG6 A;  3PAL A;  2KFG A;  1XFY O;  5GQQ C;  3LK1 A;  5CSF A;  1DJG A;  2CNP A;  2LAP A;  5I2L A;  2K7B A;  4CPV A;  1CFP A;  2LE9 B;  4GGF A;  4YGB B;  2BL0 C;  3JTD C;  3VRR A;  1L2O C;  1BR4 B;  2VRG A;  2M49 B;  3OB2 B;  1YUT A;  1S36 A;  1AUI B;  3PN7 C;  1Y1A A;  1QLK A;  4GPL B;  4CID A;  3TS5 C;  2KAV A;  4MZJ A;  3WHU B;  2FCD A;  2KI6 D;  2PVB A;  1SL7 A;  2BKI B;  2JRF A;  3CZT X;  5AXI A;  2QAC A;  2H61 A;  1CB1 A;  2LC5 A;  3CS1 A;  2K2F A;  2MHH A;  4MRY A;  2COL B;  3D0Y B;  2NCP A;  4AQJ A;  4DUQ A;  1EG3 A;  2ZKM X;  2JTT A;  1DF0 A;  2ZRT A;  3CTN A;  1QAT A;  1BF5 A;  1WDC C;  2BEC A;  3I5G B;  3C1V A;  1U5I A;  3WHT B;  2P6B B;  5KTY A;  1LIN A;  1SY9 A;  1K9K A;  3LLE A;  1YX7 A;  1JF0 A;  3CLN A;  1QX2 A;  5J3X A;  2CT9 A;  5ER5 A;  1BG1 A;  1KQM B;  3CR4 X;  3SIA A;  1NSH A;  3NXA A;  1ZOT B;  2MAZ A;  2KAY A;  2K7O A;  2F3Y A;  1RJV A;  3IF7 A;  3WNX B;  1K96 A;  1F4O A;  4PE4 A;  1WRL A;  1IQ5 A;  1IGV A;  2JOJ A;  1Q80 A;  4PDZ A;  1B9A A;  1RK9 A;  3GOF A;  4YGD B;  2JC2 A;  1DVI A;  1QLS A;  1B8C A;  2JNX A;  2LLU A;  2BBN A;  1KK7 Z;  3BYA A;  1CLM A;  4WQ3 A;  1XFV O;  1FBV A;  1UHJ A;  3IQO A;  1SR6 C;  3OP0 A;  1BT6 A;  1JC2 A;  1K8U A;  1EH2 A;  3IQQ A;  2BKH B;  3BQ3 A;  2JQ6 A;  1XFZ O;  2LUC A;  1PRW A;  3BOW A;  2FOT A;  3AAJ A;  5D7F A;  3TUY B;  3H4S E;  1SCM B;  4HRG A;  1A29 A;  1OE9 B;  1MQ1 A;  1M39 A;  3DD4 A;  4HRH A;  2KI4 B;  2EC6 C;  1ALV A;  1CTR A; 
#chains in the Genus database with same CATH topology
 1PSB A;  2G9B A;  1EL4 A;  1NCZ A;  1TIZ A;  3ICB A;  4MEW A;  2PMY A;  2WCL A;  3O2P A;  1DT7 B;  1EJ3 A;  2LUX A;  1PAL A;  1GJY A;  2JT3 A;  1IG5 A;  3BFB A;  2F2O A;  4BY5 A;  1QWV A;  3HX4 A;  4GGN A;  1SNL A;  5F6T A;  4YBH B;  3OX5 A;  2LNK A;  2Y1N A;  3EKH A;  1DJX A;  1OQP A;  1UWO A;  1BU3 A;  2KPH A;  3KPX A;  4CFQ A;  1H8B A;  3RM1 A;  1X02 A;  1V1F A;  1MUX A;  4MVF A;  1C7V A;  1NPQ A;  4JWQ A;  1PUL A;  2M0R A;  1G8I A;  4BY4 A;  3LCP C;  1CDN A;  2ZN9 A;  3TDI A;  3SG4 A;  1SL9 A;  2LLS A;  1TRF A;  1SMG A;  2G2B A;  4AQI A;  3PLF B;  1TOP A;  4HRE E;  5CSJ A;  4ETO A;  1Y1U A;  1AHR A;  2KSP A;  3LK0 A;  1IIO A;  3QRX A;  2HF5 A;  2R2I A;  3FS7 A;  4C0L A;  5I94 A;  1OZS A;  3I5G C;  2O5G A;  1RWY A;  3AKA A;  3B6X A;  1NX0 A;  5HLO A;  1SR6 B;  1UHI A;  1CMF A;  1R2U A;  2JXC A;  2WCJ A;  1IJ6 A;  2MRD A;  1ZFS A;  4TNC A;  2WOS A;  1IJ5 A;  2EHB A;  3CGA A;  1RTP 1;  1KQM C;  1KK8 B;  3B88 A;  1KFX L;  3S0G A;  2M8U A;  1S5G Y;  4UPG A;  1Y6W A;  3NSI A;  1S6C A;  1JBA A;  5DKN A;  1F8H A;  4C0K A;  1DTL A;  1CFD A;  1N65 A;  2KYC A;  1IQ3 A;  1C3Y A;  1CMG A;  4PHJ A;  1J1D A;  1ALW A;  3EK7 A;  5PAL A;  2ZND A;  1OOH A;  1QV0 A;  4Q04 A;  1NCY A;  4OVN F;  1LA3 A;  2LAN A;  1OOI X;  1MR8 A;  2E6W A;  3EK4 A;  4OZD A;  2AAO A;  5I8N A;  4PAL A;  3A8R A;  2F33 A;  3PFV A;  1KSM A;  1S6J A;  2JXL A;  5ER4 X;  4AOM A;  1WLM A;  4PE7 A;  2LMV A;  4XJK B;  4R1E A;  4PCW A;  1G33 A;  1SRA A;  3NSL A;  3EVV A;  5JOL A;  4NQG A;  1A4P A;  1YRT B;  1KWO B;  1NWD A;  1Y0V H;  2KHN A;  3TUY C;  2PYQ A;  1S6I A;  1SCM C;  1CDL A;  3BUN B;  2JPT A;  3KEV A;  1NP8 A;  4YI9 A;  1CLL A;  2FCE A;  5HKY A;  2KFF A;  2M29 A;  1T14 A;  2QEB A;  3DVM A;  3JVT B;  4INX A;  1QIV A;  1CM1 A;  2KI4 C;  1EXR A;  3CR5 X;  4OKH A;  1NCX A;  2KNE A;  1SK6 D;  3NHI A;  1CDP A;  1DJH A;  2D8N A;  2CTN A;  3FE6 A;  5HKZ A;  2TN4 A;  1CLB A;  1OMD A;  2GGZ A;  1C3Z A;  2O60 A;  4F7F A;  1MHO A;  4PHN A;  1HQV A;  1UHK A;  1P28 A;  1F55 A;  1R6P A;  1YRU B;  2OTG C;  3FWB A;  1Z2C B;  1K93 D;  1LKJ A;  4OV2 A;  1OOF A;  1ZMZ A;  1RFJ A;  4GNK B;  1ODB A;  1YVL A;  5AFP A;  2M97 A;  1XO5 A;  3V2L A;  3HCM A;  4QJ3 B;  5CSI A;  3CAB A;  1SL8 A;  2E30 A;  3D0Y A;  4INW A;  4PE0 A;  1LVC D;  1M63 B;  2L2C A;  2M3W A;  5K89 A;  3TDZ A;  2YGU A;  2MJW B;  3FIA A;  3OB1 B;  3CZ1 A;  3CZ0 A;  4E68 A;  1IKU A;  4ZCU A;  2HET A;  5FYX A;  2KDH A;  1DQE A;  4PHM A;  1GM0 A;  3BUX B;  1QXP A;  2WCF A;  2KGR A;  3PJI A;  1B8L A;  5DIC A;  1M31 A;  4MLW A;  3SG2 A;  1J7Q A;  2LVK A;  2NXQ A;  2KGB C;  2JT0 A;  1B7T Z;  4ZCV A;  2P71 A;  3S0A A;  4ORA B;  2JZI A;  2K61 A;  2LHI A;  1DGV A;  1KK8 C;  1SSE B;  1TNX A;  2CCM A;  2MBX A;  1Y1X A;  1NUB A;  3DVK A;  2Y4Q A;  2K0J A;  1WLZ A;  2BCB A;  1TCF A;  1XVJ A;  4CFR A;  1XK4 C;  3GK1 A;  4I5L B;  2WCB A;  3SS5 A;  2LM5 A;  3O4Y A;  1CKK A;  1FI5 A;  3D76 A;  1CDM A;  1QVI Z;  1ZAC A;  4M2P A;  2WC8 A;  1DJW A;  5D69 A;  2JTZ A;  4N1G A;  1DGU A;  1TNP A;  5EL2 A;  1QX7 A;  1YX8 A;  4U8D A;  2M9G A;  1TNW A;  2Y5I A;  1E8A A;  1OW4 A;  4WRI A;  4HSZ A;  2FJU B;  2H2K A;  1J7O A;  1W7I B;  1Z4H A;  4DS7 A;  4QJ5 B;  1KK7 Y;  1S3P A;  2OTG B;  1AP4 A;  1M45 A;  3OGN A;  1QIW A;  1KFU L;  1QAS A;  3N7H A;  5CSN A;  1FI6 A;  1OSA A;  1SBJ A;  1QJT A;  4QJ4 B;  1KWO C;  3M0W A;  3F45 A;  2M1K B;  1S1E A;  2LHL A;  1FF1 A;  1UP5 A;  3E3R A;  2DOQ A;  1MWN A;  4JD9 A;  3JVT C;  3UNW A;  3R1O A;  1WY9 A;  2H61 C;  3D77 A;  2OPO A;  2QPT A;  2ZNE A;  4P5O E;  1DMO A;  2QEO A;  3BJH A;  2F3Z A;  2LVI A;  4JKT A;  3DVE A;  3DXL A;  3B86 A;  1A75 B;  2LMT A;  2SCP A;  4YI8 A;  1KCY A;  2Q91 A;  1D1O A;  1GGW A;  4M2O A;  1K95 A;  1S26 D;  1UHH A;  1BLQ A;  3TZ1 A;  2K7D A;  1OMV A;  1YR5 A;  1G4Y R;  3PM2 A;  1JF2 A;  1K9P A;  2HPS A;  4JQ0 D;  3L4A A;  2JT8 A;  2WCM A;  1DEK A;  3D75 A;  3EVU A;  4DCK A;  2ZN8 A;  3CDN A;  4I5N B;  2KAX A;  3VRN A;  3I5H B;  2B1U A;  4GAO A;  1F4Q A;  1TUZ A;  3NSO A;  3DF0 B;  3LL8 B;  5HLV A;  4YGE B;  2ERB A;  2A4J A;  5B8I B;  3AKB A;  3CWG A;  4PE1 A;  3A4U B;  3IVT A;  2GGM A;  2JPO A;  2NZ0 A;  4CLN A;  2MA2 A;  2MLF C;  3FWC A;  1TCO B;  1KQV A;  1GGZ A;  3SIB A;  1GQM A;  2MLE C;  3TDU A;  2PRU A;  3EKJ A;  5KU1 A;  1J1E A;  3VRP A;  2M7L A;  4YGA A;  5JJG A;  1A03 A;  1B4C A;  4MSP A;  2KOT A;  3D10 A;  4USL A;  1SPY A;  1N0Y A;  2BE4 A;  2M7N A;  3ZNI A;  1FPW A;  1JFK A;  2CXJ A;  4DIR A;  1A2X A;  1BOD A;  3VB1 A;  1JSA A;  4GUK A;  3D78 A;  1C7W A;  2RGI A;  5HKW A;  3VRO A;  1QTX A;  1BR1 B;  4ORC B;  3BUM B;  2F8P A;  1RRO A;  2KQY A;  3AAK A;  1DF0 B;  2H8V A;  5TNC A;  1MXL C;  1TN4 A;  3WXA A;  1JWD A;  2L4I A;  2NCO A;  1B47 A;  2KYF A;  2OS8 B;  2EGD A;  1XFU O;  3BFH A;  4XJK A;  2Q4U A;  3VGO A;  1U5I B;  1LXF C;  2V53 A;  4A4C A;  2LLT A;  2JNF A;  2ZRS A;  3D74 A;  2I18 A;  4MBE A;  5HL1 A;  4IL1 A;  1PVA A;  2PAL A;  2K60 A;  1K2H A;  4F0Z B;  1IWQ A;  1NIW A;  4ICB A;  3FE9 A;  2KI6 C;  1XFW O;  4MZL A;  1VRK A;  1YUU A;  1PVB A;  1REC A;  2K7C A;  2BBM A;  2SAS A;  1MF8 B;  2WND A;  3PSR A;  3CZ2 A;  4IJ7 A;  1YUR A;  4YGC B;  3VRQ A;  2PAS A;  5IBW A;  3I5F B;  1QS7 A;  4FQO A;  4OCI A;  1CM4 A;  3MSE B;  2I94 A;  2JUL A;  2BCA A;  1DJZ A;  2WCH A;  2KBM A;  1SKT A;  1AJ4 A;  2AMI A;  1EG4 A;  1NYA A;  3K21 A;  4NDD A;  1XA5 A;  2LV7 A;  1H4B A;  2QDI A;  3BOW B;  1BOC A;  3SG5 A;  1XFR A;  5DKR A;  1NX3 A;  4GBA A;  3I5I B;  2HQW A;  3I5H C;  2L5Y A;  3S0F A;  1BMO A;  1QX5 B;  2QEV A;  1XYD A;  4N1F A;  3DVJ A;  3SS3 A;  1SW8 A;  1K94 A;  3OHM B;  2BE6 A;  3PM8 A;  5AER A;  2AUC A;  2I7A A;  3B87 A;  3KO0 A;  4I5K A;  1QV1 A;  2BL0 B;  2CBL A;  2PSR A;  1SCV A;  2L98 A;  3JTD B;  4P2Y B;  1BJF A;  1YTZ C;  1CFC A;  3D73 A;  1L2O B;  1F71 A;  1AK8 A;  4GGF C;  4JPZ B;  2WC6 A;  3PN7 B;  2GV5 A;  2PQL A;  2ZFD A;  3Q8I A;  4ORB B;  5BPJ A;  2K8M B;  3O6B A;  1KFU S;  3TS5 B;  1IRJ A;  1B7T Y;  1FW4 A;  1N2D A;  1WRK A;  3CR2 A;  4OR9 B;  3RZS A;  3PAT A;  4MRX A;  1K90 D;  3UO9 A;  1MXE A;  3R1P A;  3BUO B;  1TWO A;  2KLE A;  3EVR A;  2L4H A;  4I5J A;  2BCX A;  1UUS A;  2I2R E;  2WCE A;  1WDC B;  1YVH A;  3FE8 A;  2P70 A;  1CFF A;  2LVV A;  2F2P A;  1TNQ A;  2JWW A;  1IH0 A;  1WRZ A;  3GK4 X;  1AJ5 A;  1OOG A;  3QME A;  5DKQ A;  2OS8 C;  3RLZ A;  4DRW A;  1B1G A;  1NX1 A;  1S5G Z;  1QVI Y;  1UUR A;  2KQ6 A;  2BAP A;  3ZWH A;  2L2E A;  4GFT A;  2LP2 A;  4PHK A;  4C0J A;  2M1U A;  3BXK A;  4YRU A;  2ISD A;  3O78 A;  2LVJ A;  4FTG A;  4NDB A;  2K2A A;  4M2Q A;  3SG7 A;  3NSK A;  1K9U A;  3L47 A;  2JU0 A;  1DJY A;  1ZUZ A;  4MN0 A;  3KHE A;  1KFX S;  1LS8 A;  5AAN A;  4A4B A;  2IS9 A;  1JUO A;  3OX6 A;  3O4X A;  1NX2 A;  3KF9 A;  1PSR A;  1ORG A;  5CPV A;  1J7R A;  2NLN A;  1KSO A;  1J55 A;  3EG5 B;  4XYN A;  2KBI A;  1F70 A;  1A75 A;  1SYM A;  2Y1M A;  2LMU A;  3SJS A;  2HQ8 A;  2KFH A;  3I5F C;  1L7Z A;  4D1E A;  1F54 A;  1V1G A;  2L50 A;  5KSZ A;  1M46 A;  3B7A A;  5G08 A;  1AVS A;  1W7J B;  4NDC A;  1J7P A;  2L0P A;  2LP3 A;  1CNP A;  2WOR A;  1JFJ A;  1OZO A;  2FJY A;  1OOJ A;  2L5X B;  4KYN A;  1PK0 D;  2LCP A;  4L9M A;  5AEQ A;  1HT9 A;  4WQ2 A;  5FI7 A;  5I2Q A;  3GK2 A;  1TTX A;  3SG3 A;  1XK4 A;  1OMR A;  4MZK A;  3BUW B;  1C07 A;  1UHN A;  3EK8 A;  2L51 A;  5I2O A;  1LA0 A;  3DF0 A;  1YUS A;  2EC6 B;  4N5X A;  3I5I C;  5HYD A;  1B8R A;  1DJI A;  1XFX O;  3SG6 A;  3PAL A;  2KFG A;  1XFY O;  5GQQ C;  3LK1 A;  5CSF A;  3DY9 A;  3CYZ A;  1DJG A;  2CNP A;  2LAP A;  5FI6 A;  2K7B A;  5I2L A;  4CPV A;  1CFP A;  2LE9 B;  4GGF A;  4YGB B;  2BL0 C;  3JTD C;  2WCK A;  3VRR A;  1L2O C;  1BR4 B;  2VRG A;  2M49 B;  3OB2 B;  1YUT A;  1S36 A;  1AUI B;  3PN7 C;  1Y1A A;  1QLK A;  4GPL B;  4CID A;  3TS5 C;  2KAV A;  4MZJ A;  3WHU B;  2FCD A;  2KI6 D;  2PVB A;  1DEL A;  2KLD A;  1SL7 A;  2BKI B;  2JRF A;  3CZT X;  5AXI A;  2QAC A;  2H61 A;  1CB1 A;  2LC5 A;  3CS1 A;  2K2F A;  2MHH A;  4MRY A;  2COL B;  3BFA A;  3D0Y B;  2NCP A;  5FI2 A;  4AQJ A;  4DUQ A;  1EG3 A;  2ZKM X;  2JTT A;  1DF0 A;  2ZRT A;  3CTN A;  1QAT A;  3NGV A;  1WDC C;  3OBV A;  4FQT A;  1BF5 A;  3S0E A;  2BEC A;  3I5G B;  3C1V A;  1U5I A;  3WHT B;  2P6B B;  2WC5 A;  3SS4 A;  5KTY A;  1LIN A;  1SY9 A;  1K9K A;  3LLE A;  1YX7 A;  1JF0 A;  3CLN A;  1QX2 A;  4PT1 A;  5J3X A;  2CT9 A;  5ER5 A;  1BG1 A;  1KQM B;  3CR4 X;  3SIA A;  1NSH A;  3NXA A;  1ZOT B;  3S0B A;  2MAZ A;  2KAY A;  2K7O A;  2F3Y A;  1RJV A;  3IF7 A;  3WNX B;  1K96 A;  1F4O A;  4PE4 A;  1WRL A;  1IQ5 A;  1IGV A;  2JOJ A;  1Q80 A;  3DZT A;  1B9A A;  2QEH A;  4PDZ A;  1RK9 A;  2BNX A;  3GOF A;  3R72 A;  1W9Z A;  2JC2 A;  1DVI A;  4YGD B;  1QLS A;  1B8C A;  2JNX A;  5D3O A;  2LLU A;  2BBN A;  3NHT A;  3R1V A;  1KK7 Z;  3BYA A;  1CLM A;  4WQ3 A;  1XFV O;  3DYE A;  1FBV A;  1UHJ A;  3IQO A;  1DC1 A;  1SR6 C;  3OP0 A;  1BT6 A;  1JC2 A;  1K8U A;  1EH2 A;  3IQQ A;  2BKH B;  3BQ3 A;  2JQ6 A;  1XFZ O;  2LUC A;  1PRW A;  3BOW A;  2FOT A;  2GTE A;  3AAJ A;  5D7F A;  3S0D A;  3H4S E;  3L4L A;  3TUY B;  1SCM B;  4HRG A;  1A29 A;  1OE9 B;  1MQ1 A;  1TUJ A;  1M39 A;  3DD4 A;  4HRH A;  3K1E A;  2KI4 B;  2EC6 C;  1ALV A;  1CTR A; 
#chains in the Genus database with same CATH homology
 1PSB A;  2G9B A;  1EL4 A;  1NCZ A;  1TIZ A;  3ICB A;  4MEW A;  2PMY A;  3O2P A;  1DT7 B;  1EJ3 A;  2LUX A;  1PAL A;  1GJY A;  2JT3 A;  1IG5 A;  4BY5 A;  2F2O A;  3HX4 A;  4GGN A;  1SNL A;  5F6T A;  4YBH B;  3OX5 A;  2LNK A;  2Y1N A;  3EKH A;  1DJX A;  1OQP A;  1UWO A;  1BU3 A;  4CFQ A;  3KPX A;  1H8B A;  3RM1 A;  1X02 A;  1V1F A;  1MUX A;  4MVF A;  1C7V A;  1NPQ A;  4JWQ A;  1PUL A;  2M0R A;  1G8I A;  4BY4 A;  3LCP C;  1CDN A;  2ZN9 A;  3TDI A;  3SG4 A;  1SL9 A;  2LLS A;  1TRF A;  1SMG A;  2G2B A;  4AQI A;  3PLF B;  1TOP A;  4HRE E;  5CSJ A;  4ETO A;  1Y1U A;  1AHR A;  2KSP A;  3LK0 A;  3QRX A;  2HF5 A;  2R2I A;  3FS7 A;  4C0L A;  1OZS A;  3I5G C;  2O5G A;  1RWY A;  3AKA A;  1NX0 A;  5HLO A;  1SR6 B;  1UHI A;  1CMF A;  1R2U A;  2JXC A;  1IJ6 A;  2MRD A;  1ZFS A;  4TNC A;  2WOS A;  1IJ5 A;  2EHB A;  3CGA A;  1RTP 1;  1KQM C;  1KK8 B;  1KFX L;  2M8U A;  1S5G Y;  4UPG A;  1Y6W A;  3NSI A;  1S6C A;  1JBA A;  5DKN A;  1F8H A;  4C0K A;  1DTL A;  1CFD A;  1N65 A;  2KYC A;  1IQ3 A;  1CMG A;  4PHJ A;  1J1D A;  1ALW A;  3EK7 A;  5PAL A;  2ZND A;  1QV0 A;  4Q04 A;  1NCY A;  4OVN F;  1LA3 A;  2LAN A;  1MR8 A;  2E6W A;  3EK4 A;  5I8N A;  2AAO A;  4PAL A;  3A8R A;  2F33 A;  3PFV A;  1KSM A;  1S6J A;  2JXL A;  5ER4 X;  4AOM A;  1WLM A;  4PE7 A;  2LMV A;  4XJK B;  4R1E A;  4PCW A;  1G33 A;  1SRA A;  3NSL A;  3EVV A;  5JOL A;  4NQG A;  1A4P A;  1YRT B;  1KWO B;  1NWD A;  1Y0V H;  2KHN A;  3TUY C;  1S6I A;  1SCM C;  1CDL A;  3BUN B;  2JPT A;  3KEV A;  1NP8 A;  4YI9 A;  1CLL A;  2FCE A;  5HKY A;  2KFF A;  2M29 A;  3DVM A;  3JVT B;  1QIV A;  1CM1 A;  2KI4 C;  1EXR A;  3CR5 X;  4OKH A;  1NCX A;  2KNE A;  1SK6 D;  1CDP A;  1DJH A;  2D8N A;  2CTN A;  5HKZ A;  1CLB A;  2TN4 A;  1OMD A;  2GGZ A;  2O60 A;  1MHO A;  4PHN A;  1HQV A;  1UHK A;  1F55 A;  1R6P A;  1YRU B;  2OTG C;  3FWB A;  1K93 D;  1LKJ A;  4OV2 A;  1ZMZ A;  1RFJ A;  4GNK B;  1ODB A;  1YVL A;  5AFP A;  2M97 A;  1XO5 A;  3HCM A;  4QJ3 B;  5CSI A;  1SL8 A;  2E30 A;  3D0Y A;  4PE0 A;  1LVC D;  1M63 B;  2M3W A;  5K89 A;  3TDZ A;  1IKU A;  2MJW B;  3FIA A;  3OB1 B;  4E68 A;  4ZCU A;  2HET A;  5FYX A;  2KDH A;  4PHM A;  3BUX B;  1QXP A;  2WCF A;  2KGR A;  1B8L A;  1M31 A;  4MLW A;  3SG2 A;  1J7Q A;  2LVK A;  2NXQ A;  2KGB C;  2JT0 A;  1B7T Z;  4ZCV A;  4ORA B;  2JZI A;  2K61 A;  2LHI A;  1DGV A;  1KK8 C;  1TNX A;  2CCM A;  2MBX A;  1Y1X A;  1NUB A;  3DVK A;  2Y4Q A;  2K0J A;  1WLZ A;  2BCB A;  1TCF A;  1XVJ A;  4CFR A;  1XK4 C;  3GK1 A;  4I5L B;  2WCB A;  2LM5 A;  3O4Y A;  1CKK A;  1FI5 A;  1CDM A;  1QVI Z;  1ZAC A;  4M2P A;  2WC8 A;  1DJW A;  5D69 A;  2JTZ A;  4N1G A;  1DGU A;  1TNP A;  1QX7 A;  1YX8 A;  4U8D A;  2M9G A;  1TNW A;  2Y5I A;  1E8A A;  4WRI A;  4HSZ A;  2FJU B;  2H2K A;  1J7O A;  1W7I B;  4DS7 A;  4QJ5 B;  1KK7 Y;  1S3P A;  2OTG B;  1AP4 A;  1M45 A;  1QIW A;  1KFU L;  1QAS A;  5CSN A;  1FI6 A;  1OSA A;  1SBJ A;  1QJT A;  4QJ4 B;  1KWO C;  3M0W A;  3F45 A;  2M1K B;  1S1E A;  2LHL A;  1FF1 A;  1UP5 A;  3E3R A;  2DOQ A;  1MWN A;  3JVT C;  1WY9 A;  2H61 C;  2OPO A;  2QPT A;  2ZNE A;  4P5O E;  1DMO A;  2F3Z A;  2LVI A;  3DVE A;  1A75 B;  2LMT A;  2SCP A;  4YI8 A;  1KCY A;  2Q91 A;  1D1O A;  1GGW A;  4M2O A;  1K95 A;  1S26 D;  1UHH A;  1BLQ A;  3TZ1 A;  2K7D A;  1OMV A;  1YR5 A;  1G4Y R;  1JF2 A;  1K9P A;  2HPS A;  4JQ0 D;  2JT8 A;  3EVU A;  4DCK A;  2ZN8 A;  4I5N B;  2KAX A;  3VRN A;  3I5H B;  2B1U A;  4GAO A;  1F4Q A;  3NSO A;  3DF0 B;  3LL8 B;  5HLV A;  4YGE B;  5B8I B;  2A4J A;  3AKB A;  3CWG A;  4PE1 A;  3A4U B;  2GGM A;  2NZ0 A;  4CLN A;  2MA2 A;  2MLF C;  3FWC A;  1TCO B;  1KQV A;  1GGZ A;  3SIB A;  1GQM A;  2MLE C;  3TDU A;  2PRU A;  3EKJ A;  5KU1 A;  1J1E A;  3VRP A;  2M7L A;  4YGA A;  5JJG A;  1A03 A;  1B4C A;  4MSP A;  2KOT A;  3D10 A;  4USL A;  1SPY A;  1N0Y A;  2BE4 A;  2M7N A;  3ZNI A;  1FPW A;  1JFK A;  2CXJ A;  4DIR A;  1A2X A;  1BOD A;  1JSA A;  4GUK A;  3VRO A;  1C7W A;  2RGI A;  5HKW A;  1QTX A;  1BR1 B;  4ORC B;  3BUM B;  2F8P A;  1RRO A;  2KQY A;  3AAK A;  1DF0 B;  3WXA A;  5TNC A;  1MXL C;  1TN4 A;  1JWD A;  2L4I A;  2NCO A;  1B47 A;  2KYF A;  2OS8 B;  2EGD A;  1XFU O;  4XJK A;  2Q4U A;  3VGO A;  1U5I B;  1LXF C;  2V53 A;  4A4C A;  2LLT A;  2JNF A;  2ZRS A;  2I18 A;  4MBE A;  4IL1 A;  1PVA A;  2PAL A;  1K2H A;  4F0Z B;  1IWQ A;  1NIW A;  4ICB A;  2KI6 C;  1XFW O;  4MZL A;  1VRK A;  1YUU A;  1PVB A;  1REC A;  2K7C A;  2BBM A;  2SAS A;  1MF8 B;  2WND A;  3PSR A;  4YGC B;  1YUR A;  3VRQ A;  2PAS A;  5IBW A;  3I5F B;  1QS7 A;  4FQO A;  4OCI A;  1CM4 A;  3MSE B;  2I94 A;  2JUL A;  2BCA A;  1DJZ A;  2KBM A;  1SKT A;  1AJ4 A;  2AMI A;  1EG4 A;  1NYA A;  3K21 A;  4NDD A;  1XA5 A;  2LV7 A;  1H4B A;  3BOW B;  1BOC A;  3SG5 A;  5DKR A;  1NX3 A;  4GBA A;  3I5I B;  2HQW A;  3I5H C;  1BMO A;  1QX5 B;  4N1F A;  1XYD A;  3DVJ A;  1SW8 A;  1K94 A;  3OHM B;  2BE6 A;  3PM8 A;  5AER A;  2AUC A;  2I7A A;  3KO0 A;  4I5K A;  1QV1 A;  2BL0 B;  2CBL A;  2PSR A;  1SCV A;  2L98 A;  3JTD B;  4P2Y B;  1BJF A;  1YTZ C;  1CFC A;  1F71 A;  1L2O B;  1AK8 A;  4GGF C;  4JPZ B;  3PN7 B;  2GV5 A;  2ZFD A;  4ORB B;  5BPJ A;  2K8M B;  3O6B A;  1KFU S;  3TS5 B;  1IRJ A;  1B7T Y;  1FW4 A;  1N2D A;  1WRK A;  3CR2 A;  4OR9 B;  3PAT A;  4MRX A;  1K90 D;  1MXE A;  3BUO B;  3EVR A;  2L4H A;  4I5J A;  2BCX A;  1UUS A;  2I2R E;  2WCE A;  1WDC B;  1YVH A;  1CFF A;  2LVV A;  2F2P A;  1TNQ A;  2JWW A;  1IH0 A;  1WRZ A;  3GK4 X;  1AJ5 A;  5DKQ A;  3RLZ A;  2OS8 C;  1B1G A;  4DRW A;  1NX1 A;  1S5G Z;  1QVI Y;  1UUR A;  2KQ6 A;  3ZWH A;  2L2E A;  4GFT A;  2LP2 A;  4PHK A;  4C0J A;  2M1U A;  3BXK A;  4YRU A;  2ISD A;  3O78 A;  2LVJ A;  4FTG A;  4NDB A;  2K2A A;  4M2Q A;  3SG7 A;  3NSK A;  1K9U A;  2JU0 A;  1DJY A;  1ZUZ A;  4MN0 A;  3KHE A;  1KFX S;  5AAN A;  4A4B A;  2IS9 A;  1JUO A;  3OX6 A;  1NX2 A;  3KF9 A;  1PSR A;  5CPV A;  1J7R A;  2NLN A;  1KSO A;  1J55 A;  4XYN A;  2KBI A;  1F70 A;  1A75 A;  1SYM A;  2Y1M A;  2LMU A;  3SJS A;  2HQ8 A;  2KFH A;  3I5F C;  1L7Z A;  4D1E A;  1F54 A;  1V1G A;  2L50 A;  5KSZ A;  1M46 A;  5G08 A;  1AVS A;  1W7J B;  4NDC A;  1J7P A;  2L0P A;  2LP3 A;  1CNP A;  2WOR A;  1JFJ A;  1OZO A;  1OOJ A;  2L5X B;  1PK0 D;  2LCP A;  4L9M A;  5AEQ A;  1HT9 A;  4WQ2 A;  5I2Q A;  3GK2 A;  1TTX A;  3SG3 A;  1XK4 A;  1OMR A;  4MZK A;  3BUW B;  1C07 A;  1UHN A;  3EK8 A;  2L51 A;  5I2O A;  1LA0 A;  3DF0 A;  1YUS A;  2EC6 B;  4N5X A;  3I5I C;  5HYD A;  1B8R A;  1DJI A;  1XFX O;  3SG6 A;  3PAL A;  2KFG A;  1XFY O;  5GQQ C;  3LK1 A;  5CSF A;  1DJG A;  2CNP A;  2LAP A;  5I2L A;  2K7B A;  4CPV A;  1CFP A;  2LE9 B;  4GGF A;  4YGB B;  2BL0 C;  3JTD C;  3VRR A;  1L2O C;  1BR4 B;  2VRG A;  2M49 B;  3OB2 B;  1YUT A;  1S36 A;  1AUI B;  3PN7 C;  1Y1A A;  1QLK A;  4GPL B;  4CID A;  3TS5 C;  2KAV A;  4MZJ A;  3WHU B;  2FCD A;  2KI6 D;  2PVB A;  1SL7 A;  2BKI B;  2JRF A;  3CZT X;  5AXI A;  2QAC A;  2H61 A;  1CB1 A;  2LC5 A;  3CS1 A;  2K2F A;  2MHH A;  4MRY A;  2COL B;  3D0Y B;  2NCP A;  4AQJ A;  4DUQ A;  1EG3 A;  2ZKM X;  2JTT A;  1DF0 A;  2ZRT A;  3CTN A;  1QAT A;  1BF5 A;  1WDC C;  2BEC A;  3I5G B;  3C1V A;  1U5I A;  3WHT B;  2P6B B;  5KTY A;  1LIN A;  1SY9 A;  1K9K A;  3LLE A;  1YX7 A;  1JF0 A;  3CLN A;  1QX2 A;  5J3X A;  2CT9 A;  5ER5 A;  1BG1 A;  1KQM B;  3CR4 X;  3SIA A;  1NSH A;  3NXA A;  1ZOT B;  2MAZ A;  2KAY A;  2K7O A;  2F3Y A;  1RJV A;  3IF7 A;  3WNX B;  1K96 A;  1F4O A;  4PE4 A;  1WRL A;  1IQ5 A;  1IGV A;  2JOJ A;  1Q80 A;  4PDZ A;  1B9A A;  1RK9 A;  3GOF A;  4YGD B;  2JC2 A;  1DVI A;  1QLS A;  1B8C A;  2JNX A;  2LLU A;  2BBN A;  1KK7 Z;  3BYA A;  1CLM A;  4WQ3 A;  1XFV O;  1FBV A;  1UHJ A;  3IQO A;  1SR6 C;  3OP0 A;  1BT6 A;  1JC2 A;  1K8U A;  1EH2 A;  3IQQ A;  2BKH B;  3BQ3 A;  2JQ6 A;  1XFZ O;  2LUC A;  1PRW A;  3BOW A;  2FOT A;  3AAJ A;  5D7F A;  3TUY B;  3H4S E;  1SCM B;  4HRG A;  1A29 A;  1OE9 B;  1MQ1 A;  1M39 A;  3DD4 A;  4HRH A;  2KI4 B;  2EC6 C;  1ALV A;  1CTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...