1UHKA

Crystal structure of n-aequorin
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
191
structure length
191
Chain Sequence
ANSKLTSDFDNPRWIGRHKHMFNFLDVNHNGKISLDEMVYKASDIVINNLGATPEQAKRHKDAVEAFFGGAGMKYGVETDWPAYIEGWKKLATDELEKYAKNEPTLIRIWGDALFDIVDKDQNGAITLDEWKAYTKAAGIIQSSEDCEETFRVCDIDESGQLDVDEMTRQHLGFWYTMDPACEKLYGGAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Luminescent protein
molecule keywords Aequorin 2
publication title The crystal structures of semi-synthetic aequorins
pubmed doi rcsb
source organism Aequorea victoria
total genus 73
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1uhkA00
2K7BA 1PULA 1DTLA 1CDNA 3OX5A 1CTRA 1MQ1A 2KI4B 4QJ3B 5ER4X 1F8HA 2G2BA 4MZLA 5B8IB 2BBNA 5CSNA 3WHTB 4MN0A 1MXEA 3FS7A 1TOPA 2AUCA 2O5GA 3EVRA 3CS1A 2FOTA 5AEQA 4D1EA 4GGFC 1QATA 2MA2A 4Q04A 1QXPA 1QASA 1MWNA 1A2XA 2ZRSA 1UWOA 3KF9A 1JFKA 1YX7A 1GQMA 1KK8C 3AAJA 3BQ3A 3CR4X 1FI6A 3NXAA 4ORCB 1NX3A 1TNXA 2K0JA 1XFYO 2SCPA 2KGBC 3DVEA 4PHKA 4GGFA 5HLVA 1BLQA 1Y6WA 1ZUZA 1S5GY 3EKJA 4FTGA 3RM1A 1CNPA 1J7QA 3SG7A 1YRUB 4PCWA 4DCKA 4U8DA 1OE9B 2JPTA 3VRPA 5IBWA 2L51A 4WRIA 3LCPC 2LP2A 1X02A 3CR2A 1SL9A 1IG5A 3I5GC 2B1UA 3LL8B 2BKIB 1S5GZ 2MAZA 2JNXA 1KFXS 3PLFB 4FQOA 2KI6C 4I5LB 2L0PA 1KQVA 3EKHA 3LK1A 1YTZC 2Y4QA 4N5XA 4F0ZB 4PHMA 1SBJA 1U5IA 3HCMA 3IQQA 2K2AA 2KHNA 1K2HA 1F54A 3BXKA 3O78A 3WXAA 4JWQA 1F4QA 1TCFA 1U5IB 2Y1NA 1Y1AA 3LK0A 3PN7C 2ZN9A 4YGEB 3FWCA 2HF5A 2WCBA 4PE4A 1TNWA 3M0WA 3I5HC 4AOMA 2ISDA 3ICBA 3F45A 3AAKA 1XFWO 2BCBA 1MF8B 1NCZA 1NYAA 1PALA 2JWWA 1UURA 1DJZA 2WOSA 5CPVA 1MXLC 4QJ4B 1S26D 4I5NB 1L2OC 2GV5A 2BE4A 2I7AA 1QX2A 2JC2A 1AK8A 4GGNA 1PVAA 4PE0A 4WQ2A 4A4BA 1E8AA 2BCXA 1DF0A 1UUSA 3VRNA 4P5OE 1J1DA 1YVLA 2WC8A 1CM1A 1XK4A 2I18A 4GBAA 3DVKA 2LE9B 3O6BA 1V1GA 4C0LA 1DF0B 2Y5IA 4YI8A 4I5JA 3KEVA 4M2OA 5HKYA 1G33A 2E6WA 1IJ6A 2I2RE 2KAVA 1K90D 1AJ5A 3TS5B 1QVIY 2JT3A 1KWOB 1UHJA 1OQPA 1BT6A 1QLSA 2H61C 4ORAB 3FWBA 4E68A 3ZNIA 1V1FA 4UPGA 1N65A 2BL0C 2LVJA 2OTGC 5GQQC 1CM4A 1QVIZ 1XFXO 4PALA 1KK7Y 3GK2A 1AJ4A 2LC5A 1M63B 2LANA 2OS8C 1QS7A 2ZKMX 5PALA 2V53A 2F2OA 1QIVA 1Q80A 2AMIA 2PMYA 1JWDA 1SCMC 2MLEC 1DVIA 1KK7Z 2A4JA 3I5IB 1Y1XA 1CDPA 3BUXB 4MZJA 2BKHB 1K95A 1L7ZA 4CFRA 1KSMA 1NX1A 1JF2A 1OZSA 2KYCA 1F71A 2JZIA 3CTNA 1PK0D 2Q91A 4XJKB 1KSOA 1B7TY 1QJTA 3VROA 3CZTX 1XVJA 4DIRA 4DRWA 3NSOA 2HQ8A 1DJGA 3CGAA 3VGOA 2K7OA 3FIAA 4DUQA 1AHRA 3CLNA 5F6TA 5K89A 1QX7A 2LMUA 1ODBA 1BOCA 4MLWA 1B7TZ 2ZFDA 1KFXL 2D8NA 2KQYA 1QLKA 4PDZA 1IKUA 1B8LA 1XYDA 2M1UA 3GK1A 3IQOA 2ZRTA 5KU1A 1Y0VH 1CMFA 4HRGA 1UHHA 2ZNDA 4C0KA 5HLOA 1XFZO 1ZACA 2PASA 4ZCVA 1QX5B 1CB1A 2K7CA 1DJIA 1EL4A 1OMDA 1RK9A 3TDUA 4M2PA 2OPOA 1SR6B 2DOQA 1K9UA 2E30A 2JULA 2WCEA 1PVBA 5AERA 3SG6A 1DGUA 3JVTC 3O2PA 2P6BB 1KQMB 3BUOB 1DGVA 1EJ3A 1SPYA 3TDIA 4CFQA 5ER5A 5JOLA 1S1EA 3RLZA 3BYAA 1IRJA 1CKKA 2LVKA 1RROA 5BPJA 1OMVA 2KFHA 2M0RA 3BOWB 3PSRA 3TUYC 1QIWA 3I5FB 1XA5A 3KPXA 4MVFA 4YGCB 5I8NA 1DT7B 3D0YB 3KO0A 1TIZA 2LAPA 2MBXA 5J3XA 4JPZB 1A75B 5AFPA 2G9BA 1G8IA 2CBLA 2K61A 1RECA 2MJWB 4MSPA 4OVNF 1NP8A 2L98A 1JC2A 1A4PA 1RTP1 4PE7A 2LVVA 1N2DA 1KFUS 2LUCA 4AQIA 1HQVA 4XYNA 1FW4A 1OOJA 2JXLA 1XK4C 2NLNA 3BUNB 1NWDA 1S36A 1OMRA 1YUTA 2WNDA 3SIBA 1W7IB 3TS5C 4OKHA 2F3YA 4YBHB 4ORBB 2EC6B 1WLMA 1K94A 2MLFC 1ZFSA 1XFVO 5TNCA 4DS7A 1B4CA 4CPVA 2PRUA 1NSHA 1SK6D 3LLEA 2COLB 2KBMA 2CT9A 2NXQA 1VRKA 4CIDA 5D7FA 1ALWA 2M49B 3JTDC 2L4HA 1C07A 1BMOA 2HETA 3A8RA 5DKRA 2JXCA 1D1OA 1Y1UA 2BBMA 2F33A 1NPQA 4OV2A 1J7PA 2LMVA 2EHBA 3EK7A 2M29A 1LVCD 1B8CA 1DJXA 3EVUA 3I5IC 1SKTA 4JQ0D 4MRXA 2L50A 4AQJA 1GJYA 1A29A 2H2KA 2LHIA 1GGZA 2PALA 2KOTA 4BY5A 2GGZA 1LINA 1YVHA 1WDCC 1UHNA 1NX0A 2KBIA 1K9PA 5I2LA 1H8BA 2LVIA 3DD4A 1A03A 2KSPA 2NCOA 3PATA 1PSRA 3E3RA 2LV7A 2KQ6A 1SL7A 1J7OA 2M1KB 2LLUA 1BF5A 1F55A 1OZOA 1L2OB 1YRTB 3DVMA 3WHUB 4YI9A 4NDBA 4HREE 2LMTA 2CNPA 4XJKA 3VRQA 4ICBA 2KI4C 2F8PA 1G4YR 1SMGA 3CWGA 1IGVA 2BE6A 1SYMA 3PFVA 1AP4A 1RJVA 1WRLA 2KDHA 2M8UA 3OB2B 1C7VA 2KFFA 1BR4B 3EVVA 1YURA 2PSRA 2FJUB 2PVBA 1SR6C 3SJSA 1MR8A 1W7JB 3MSEB 1J7RA 2HPSA 3OX6A 3H4SE 1K8UA 1NUBA 2JNFA 2K2FA 1IJ5A 1M31A 3DVJA 4GNKB 3OP0A 1SY9A 5G08A 3A4UB 1SRAA 1CFDA 4ETOA 4NDDA 1KQMC 2KGRA 1UHKA 1CLLA 1J55A 2LP3A 1NCYA 2F2PA 2LLTA 2OS8B 3OB1B 3DF0A 1ZMZA 2KNEA 1QV1A 2WORA 1WLZA 1ALVA 1SCMB 2WCFA 2JQ6A 3DF0B 1KFUL 4TNCA 3NSLA 3OHMB 3I5FC 1TRFA 1RFJA 3BUWB 3KHEA 4YGDB 2L5XB 1UP5A 5D69A 4GUKA 4HSZA 2SASA 2LHLA 1KCYA 2MHHA 1AUIB 3PALA 3TZ1A 2K8MB 3BOWA 4GAOA 1IWQA 2JT8A 1DJYA 1CFCA 1BJFA 1LA0A 3WNXB 1JFJA 2JTTA 2MRDA 3D0YA 4BY4A 1A75A 1NCXA 2JT0A 1LA3A 3GOFA 5DKNA 5HKWA 2JRFA 2LNKA 2F3ZA 1LKJA 2KI6D 5CSFA 3GK4X 2LM5A 1M45A 1CDMA 1YUSA 2EC6C 5DKQA 1FPWA 2RGIA 4YGAA 4MZKA 1SCVA 3AKAA 3EK8A 4USLA 1JSAA 2CXJA 3PM8A 3SIAA 1CLBA 1YR5A 1MHOA 4OR9B 1KK8B 4NQGA 3VRRA 1CDLA 2QACA 2TN4A 5AANA 1LXFC 2NCPA 3JVTB 1BG1A 5HYDA 1SW8A 1S6JA 1IQ3A 4PHNA 1YX8A 2I94A 1F4OA 1BR1B 1EG4A 1S6CA 5I2QA 2JU0A 1B9AA 1KWOC 1BODA 3NSKA 1XO5A 1TTXA 3TDZA 1CFFA 1JBAA 1MUXA 2K7DA 1B47A 4P2YB 4WQ3A 4M2QA 2NZ0A 4GPLB 2BECA 3I5GB 5HKZA 3TUYB 1B1GA 3BUMB 1GGWA 1YUUA 5KSZA 2O60A 1AVSA 2M7NA 1OSAA 2AAOA 5CSJA 2JTZA 1EXRA 2FCDA 5FYXA 2HQWA 3QRXA 3SG3A 4YRUA 1FBVA 2CCMA 4N1GA 2M7LA 1K96A 2KFGA 2EGDA 2LCPA 2LLSA 2ZNEA 1WRKA 1DMOA 2QPTA 2BCAA 2CTNA 4I5KA 1BU3A 3PN7B 1H4BA 2M3WA 1QTXA 1HT9A 3I5HB 4NDCA 1CFPA 4ZCUA 4GFTA 2ZN8A 3CR5X 2M9GA 5AXIA 3D10A 4MRYA 3HX4A 2FCEA 1F70A 1TNQA 3ZWHA 3K21A 1M46A 4C0JA 1DJWA 1SNLA 3AKBA 2LUXA 1EH2A 1S6IA 1M39A 2JOJA 1B8RA 1PRWA 2KYFA 1JF0A 4HRHA 1CLMA 4L9MA 3O4YA 4IL1A 1S3PA 1R2UA 2L4IA 3JTDB 1UHIA 1QV0A 4PHJA 3SG2A 1RWYA 3SG5A 3EK4A 4OCIA 1IQ5A 1K93D 1FF1A 2H61A 4QJ5B 1K9KA 1R6PA 1FI5A 1TN4A 4PE1A 5I2OA 3IF7A 1N0YA 4YGBB 1PSBA 4CLNA 5KTYA 3NSIA 1J1EA 1WRZA 1WY9A 2Q4UA 1SL8A 2GGMA 4R1EA 1TNPA 1ZOTB 4MEWA 2Y1MA 5CSIA 5JJGA 1JUOA 2BL0B 1NIWA 2OTGB 1C7WA 1CMGA 2VRGA 3C1VA 2M97A 1WDCB 2L2EA 1NX2A 1XFUO 1TCOB 2IS9A 1DJHA 1EG3A 2KAXA 4N1FA 2KAYA 4A4CA 3SG4A 2R2IA 4MBEA 1IH0A
chains in the Genus database with same CATH superfamily
2K7BA 1PULA 1DTLA 5I94A 1CDNA 3OX5A 2WCJA 3OGNA 1CTRA 1MQ1A 2KI4B 4QJ3B 5ER4X 3DXLA 1F8HA 2G2BA 4MZLA 5B8IB 2BBNA 5CSNA 3WHTB 4MN0A 1MXEA 3FS7A 1TOPA 2AUCA 2O5GA 3EVRA 3CS1A 3NHIA 2FOTA 5AEQA 4D1EA 4GGFC 1QATA 3D74A 2MA2A 4Q04A 1QXPA 3B7AA 1QASA 1MWNA 1A2XA 1DEKA 2ZRSA 1UWOA 3KF9A 1JFKA 1YX7A 1GQMA 1KK8C 3AAJA 2L5YA 3BQ3A 3CR4X 1FI6A 3NXAA 2WCKA 4ORCB 1NX3A 1TNXA 2K0JA 1XFYO 2SCPA 2KGBC 3DVEA 3RZSA 2WCLA 4PHKA 4GGFA 5HLVA 1BLQA 2JPOA 1Y6WA 1ZUZA 1S5GY 3EKJA 4FTGA 3RM1A 1CNPA 1J7QA 3SG7A 1YRUB 4PCWA 4DCKA 3CZ0A 4U8DA 2BNXA 1OE9B 2JPTA 3VRPA 1TWOA 2H8VA 5IBWA 2L51A 4WRIA 3LCPC 2LP2A 1X02A 3CR2A 3R1PA 1SL9A 1IG5A 3I5GC 2B1UA 3LL8B 2BKIB 1S5GZ 2MAZA 2JNXA 1KFXS 3BFBA 3PLFB 4FQOA 2KI6C 4I5LB 2L0PA 1KQVA 3EKHA 3LK1A 1YTZC 3EG5B 2Y4QA 4N5XA 4F0ZB 4PHMA 1SBJA 1U5IA 3HCMA 3IQQA 2K2AA 2KHNA 1K2HA 2K60A 1F54A 3BXKA 3O78A 3WXAA 4JWQA 1F4QA 1TCFA 1U5IB 2Y1NA 1Y1AA 3LK0A 3PN7C 2ZN9A 4YGEB 3FWCA 2HF5A 2WCBA 3B86A 4PE4A 1TNWA 3L47A 3M0WA 3I5HC 4AOMA 2ISDA 3ICBA 3F45A 1TUJA 3AAKA 1XFWO 1PALA 1TUZA 1MF8B 1NCZA 1NYAA 2BCBA 2JWWA 5FI6A 1UURA 1DJZA 2WOSA 5CPVA 1MXLC 4QJ4B 1S26D 4I5NB 1L2OC 2GV5A 2BE4A 2I7AA 1QX2A 2JC2A 1T14A 4GGNA 1PVAA 4PE0A 4WQ2A 4A4BA 1E8AA 2BCXA 1DF0A 1UUSA 3VRNA 4P5OE 1J1DA 1YVLA 2WC8A 1CM1A 1XK4A 2I18A 4GBAA 3DVKA 2LE9B 3O6BA 1V1GA 4C0LA 1DF0B 2Y5IA 1XFRA 4YI8A 4I5JA 3KEVA 4M2OA 3B6XA 5HKYA 1G33A 2E6WA 1IJ6A 2I2RE 2KAVA 1K90D 1AJ5A 3TS5B 1QVIY 2JT3A 1KWOB 1UHJA 1OQPA 1BT6A 1QLSA 3K1EA 2H61C 3L4LA 4ORAB 2KPHA 3FWBA 4E68A 3ZNIA 1V1FA 4UPGA 1N65A 2BL0C 2LVJA 2OTGC 5GQQC 1CM4A 1QVIZ 1XFXO 4PALA 1KK7Y 3GK2A 1AJ4A 2LC5A 1M63B 2LANA 2OS8C 1QS7A 2ZKMX 5PALA 2V53A 2F2OA 1QIVA 2QEBA 1Q80A 2AMIA 2PMYA 3FE6A 1JWDA 1SCMC 1GM0A 2MLEC 1DVIA 1KK7Z 2A4JA 3I5IB 2WCMA 5FI2A 1Y1XA 1CDPA 3BUXB 4MZJA 2BKHB 1K95A 1L7ZA 4CFRA 1KSMA 1NX1A 1JF2A 1OZSA 2KYCA 1F71A 2JZIA 3CTNA 3Q8IA 1PK0D 3DY9A 4INXA 2Q91A 4XJKB 1KSOA 3S0GA 1B7TY 1QJTA 3UO9A 3VROA 3CZTX 1XVJA 4JD9A 4DIRA 3NSOA 4DRWA 3V2LA 2HQ8A 1DJGA 3CGAA 3VGOA 2K7OA 3FIAA 4DUQA 1AHRA 3CLNA 5F6TA 5K89A 1QX7A 2LMUA 1ODBA 1BOCA 2QEVA 4MLWA 1B7TZ 2ZFDA 1KFXL 2D8NA 2KQYA 1QLKA 3D76A 4PDZA 1IKUA 1B8LA 1XYDA 2M1UA 3GK1A 3IQOA 2ZRTA 5KU1A 1Y0VH 1CMFA 4HRGA 1UHHA 2ZNDA 3R72A 4C0KA 5HLOA 1XFZO 1ZACA 1C3ZA 2PASA 1QX5B 4ZCVA 3S0DA 2K7CA 1DJIA 1CB1A 1EL4A 1OMDA 1RK9A 3TDUA 4M2PA 3S0BA 2OPOA 1SR6B 2DOQA 1K9UA 2E30A 2JULA 2WCEA 1PVBA 1Z4HA 4KYNA 5AERA 3SG6A 1P28A 1DGUA 4JKTA 3JVTC 3O2PA 2P6BB 1ORGA 1KQMB 3BUOB 1DGVA 1EJ3A 1SPYA 5FI7A 3TDIA 2KLDA 4CFQA 5ER5A 3R1VA 5JOLA 4INWA 1S1EA 3RLZA 3BYAA 3D77A 1IRJA 1CKKA 2LVKA 1RROA 5BPJA 1OMVA 2KFHA 2M0RA 3BOWB 3PSRA 3TUYC 1QIWA 1OOIX 3I5FB 1XA5A 3KPXA 4MVFA 4YGCB 5I8NA 1DT7B 3D0YB 3KO0A 1TIZA 2LAPA 5DICA 2MBXA 2KLEA 5J3XA 4JPZB 1A75B 5AFPA 2G9BA 1G8IA 2CBLA 2K61A 1RECA 2MJWB 4MSPA 4OVNF 1NP8A 2L98A 1JC2A 1A4PA 1RTP1 4PE7A 2LVVA 1N2DA 1KFUS 2LUCA 3BJHA 4AQIA 1HQVA 4XYNA 1FW4A 1OOJA 2JXLA 1XK4C 2NLNA 3CZ2A 3SS4A 3NHTA 3FE8A 3BUNB 1NWDA 1S36A 1OMRA 1YUTA 2WNDA 3SIBA 1W7IB 3TS5C 4OKHA 4F7FA 2F3YA 4YBHB 4ORBB 2EC6B 1WLMA 1K94A 2MLFC 3SS3A 1ZFSA 1XFVO 3NGVA 5TNCA 4DS7A 1B4CA 4CPVA 2PRUA 1NSHA 1SK6D 3LLEA 2COLB 2KBMA 2CT9A 2NXQA 1VRKA 4CIDA 5D7FA 1ALWA 2M49B 3JTDC 2L4HA 1C07A 1BMOA 1LS8A 2HETA 3A8RA 5DKRA 2JXCA 1D1OA 1Y1UA 2BBMA 2F33A 1NPQA 3O4XA 4OV2A 1J7PA 2LMVA 2EHBA 3EK7A 2M29A 1LVCD 1B8CA 1DJXA 3EVUA 3I5IC 1SKTA 4JQ0D 4MRXA 2L50A 4AQJA 1GJYA 1AK8A 1A29A 2H2KA 2ERBA 1GGZA 2LHIA 2PALA 2KOTA 4BY5A 3BFAA 2GGZA 1LINA 1YVHA 1WDCC 1UHNA 1NX0A 2KBIA 1K9PA 5I2LA 1H8BA 2LVIA 3DD4A 1A03A 2KSPA 2NCOA 3PATA 1PSRA 3E3RA 2LV7A 2KQ6A 1SL7A 1J7OA 2M1KB 2LLUA 1BF5A 1F55A 1OZOA 1L2OB 1YRTB 3DVMA 3WHUB 4YI9A 4NDBA 4HREE 2LMTA 2CNPA 4XJKA 2PYQA 3VRQA 4ICBA 2KI4C 2F8PA 1G4YR 1OOGA 1SMGA 3CWGA 1IGVA 2BE6A 1SYMA 3PFVA 1AP4A 1RJVA 1WRLA 2KDHA 2M8UA 3OB2B 1C7VA 5EL2A 2KFFA 1BR4B 3EVVA 1IIOA 1YURA 2PSRA 2FJUB 1C3YA 2PVBA 3VB1A 1SR6C 3SJSA 3SS5A 1MR8A 1W7JB 3MSEB 1J7RA 2HPSA 3OX6A 3H4SE 1K8UA 1NUBA 2JNFA 2K2FA 1IJ5A 1M31A 3DVJA 4GNKB 3OP0A 1SY9A 5G08A 3A4UB 1QWVA 2PQLA 1SRAA 1CFDA 4ETOA 4NDDA 1KQMC 2KGRA 1UHKA 1CLLA 1J55A 1OW4A 2LP3A 1NCYA 2F2PA 2LLTA 2OS8B 3OB1B 3DF0A 1ZMZA 3CYZA 2KNEA 3BFHA 3QMEA 1QV1A 2WORA 1WLZA 1ALVA 1SCMB 2WCFA 2JQ6A 3DF0B 1KFUL 3UNWA 4TNCA 3NSLA 3OHMB 3I5FC 3DZTA 1TRFA 1RFJA 3BUWB 3KHEA 4YGDB 2L5XB 1UP5A 5D69A 4GUKA 4HSZA 2SASA 2LHLA 1KCYA 1DC1A 2MHHA 1AUIB 3PALA 3TZ1A 2WC6A 2K8MB 3BOWA 4GAOA 1IWQA 2JT8A 1DJYA 1CFCA 1Z2CB 1BJFA 2YGUA 1LA0A 4PT1A 3S0AA 3WNXB 1JFJA 2JTTA 2MRDA 3D0YA 3D75A 3N7HA 4BY4A 1A75A 1NCXA 2JT0A 1LA3A 3GOFA 2GTEA 5DKNA 5HKWA 2JRFA 2LNKA 2F3ZA 1LKJA 2WCHA 2KI6D 3B88A 5CSFA 3GK4X 3CDNA 4OZDA 2WC5A 2LM5A 1M45A 1CDMA 1YUSA 2EC6C 5DKQA 1FPWA 2RGIA 4YGAA 4MZKA 1SCVA 3AKAA 3EK8A 2L2CA 4USLA 1JSAA 2CXJA 3PM8A 3SIAA 1CLBA 1YR5A 1MHOA 3CABA 1KK8B 4NQGA 4OR9B 3VRRA 1CDLA 2QACA 2TN4A 5AANA 1LXFC 2NCPA 3JVTB 1BG1A 5HYDA 1SW8A 1S6JA 1IQ3A 4PHNA 1YX8A 2I94A 1F4OA 1BR1B 1EG4A 1SSEB 1S6CA 3S0EA 2JU0A 3R1OA 5I2QA 1DELA 1B9AA 1KWOC 1BODA 3NSKA 1XO5A 1OOFA 1TTXA 3TDZA 1CFFA 1JBAA 1MUXA 2K7DA 1B47A 4P2YB 4WQ3A 4M2QA 2NZ0A 4GPLB 2BECA 3I5GB 3PJIA 5HKZA 3TUYB 1B1GA 3BUMB 1GGWA 1YUUA 3D73A 2QEHA 5KSZA 2O60A 1AVSA 2M7NA 1OSAA 2AAOA 5CSJA 2JTZA 1EXRA 2FCDA 5FYXA 2HQWA 3PM2A 3QRXA 3SG3A 3D78A 4YRUA 1FBVA 2CCMA 4N1GA 2M7LA 1K96A 2KFGA 2EGDA 2LCPA 2LLSA 2ZNEA 1WRKA 1DMOA 2QPTA 2BCAA 2CTNA 4I5KA 1BU3A 3PN7B 1H4BA 2M3WA 1QTXA 1HT9A 3I5HB 4NDCA 1CFPA 4ZCUA 4GFTA 2ZN8A 3CR5X 2M9GA 5AXIA 3D10A 4MRYA 3HX4A 4IJ7A 3OBVA 2FCEA 2P71A 1F70A 1TNQA 3ZWHA 3FE9A 1M46A 2QDIA 3K21A 4C0JA 3S0FA 5HL1A 1OOHA 1DJWA 1SNLA 2FJYA 3AKBA 2LUXA 1EH2A 4FQTA 1S6IA 1M39A 3DYEA 2P70A 5D3OA 2JOJA 1B8RA 1PRWA 2KYFA 1JF0A 4HRHA 1CLMA 4L9MA 3O4YA 4IL1A 1S3PA 1R2UA 2L4IA 3JTDB 1UHIA 1QV0A 4PHJA 3SG2A 1RWYA 2QEOA 3SG5A 3EK4A 4OCIA 1DQEA 1IQ5A 1K93D 1FF1A 2H61A 4QJ5B 1K9KA 1R6PA 1FI5A 1TN4A 4PE1A 5I2OA 3IF7A 1N0YA 4YGBB 1PSBA 4CLNA 5KTYA 3NSIA 1J1EA 1WRZA 3IVTA 1WY9A 2Q4UA 1SL8A 2GGMA 3CZ1A 1TNPA 4R1EA 3B87A 1ZOTB 2BAPA 4MEWA 2Y1MA 5CSIA 5JJGA 1JUOA 2BL0B 1NIWA 2OTGB 1C7WA 1CMGA 2VRGA 3C1VA 2M97A 1WDCB 2L2EA 1NX2A 1XFUO 1TCOB 2IS9A 1DJHA 1W9ZA 1EG3A 2KAXA 4N1FA 2KAYA 4A4CA 3SG4A 2R2IA 4MBEA 3L4AA 1IH0A
chains in the Genus database with same CATH topology
2K7BA 1PULA 1DTLA 1CDNA 3OX5A 1CTRA 1MQ1A 2KI4B 4QJ3B 5ER4X 1F8HA 2G2BA 4MZLA 5B8IB 2BBNA 5CSNA 3WHTB 4MN0A 1MXEA 3FS7A 1TOPA 2AUCA 2O5GA 3EVRA 3CS1A 2FOTA 5AEQA 4D1EA 4GGFC 1QATA 2MA2A 4Q04A 1QXPA 1QASA 1MWNA 1A2XA 2ZRSA 1UWOA 3KF9A 1JFKA 1YX7A 1GQMA 1KK8C 3AAJA 3BQ3A 3CR4X 1FI6A 3NXAA 4ORCB 1NX3A 1TNXA 2K0JA 1XFYO 2SCPA 2KGBC 3DVEA 4PHKA 4GGFA 5HLVA 1BLQA 1Y6WA 1ZUZA 1S5GY 3EKJA 4FTGA 3RM1A 1CNPA 1J7QA 3SG7A 1YRUB 4PCWA 4DCKA 4U8DA 1OE9B 2JPTA 3VRPA 5IBWA 2L51A 4WRIA 3LCPC 2LP2A 1X02A 3CR2A 1SL9A 1IG5A 3I5GC 2B1UA 3LL8B 2BKIB 1S5GZ 2MAZA 2JNXA 1KFXS 3PLFB 4FQOA 2KI6C 4I5LB 2L0PA 1KQVA 3EKHA 3LK1A 1YTZC 2Y4QA 4N5XA 4F0ZB 4PHMA 1SBJA 1U5IA 3HCMA 3IQQA 2K2AA 2KHNA 1K2HA 1F54A 3BXKA 3O78A 3WXAA 4JWQA 1F4QA 1TCFA 1U5IB 2Y1NA 1Y1AA 3LK0A 3PN7C 2ZN9A 4YGEB 3FWCA 2HF5A 2WCBA 4PE4A 1TNWA 3M0WA 3I5HC 4AOMA 2ISDA 3ICBA 3F45A 3AAKA 1XFWO 2BCBA 1MF8B 1NCZA 1NYAA 1PALA 2JWWA 1UURA 1DJZA 2WOSA 5CPVA 1MXLC 4QJ4B 1S26D 4I5NB 1L2OC 2GV5A 2BE4A 2I7AA 1QX2A 2JC2A 1AK8A 4GGNA 1PVAA 4PE0A 4WQ2A 4A4BA 1E8AA 2BCXA 1DF0A 1UUSA 3VRNA 4P5OE 1J1DA 1YVLA 2WC8A 1CM1A 1XK4A 2I18A 4GBAA 3DVKA 2LE9B 3O6BA 1V1GA 4C0LA 1DF0B 2Y5IA 4YI8A 4I5JA 3KEVA 4M2OA 5HKYA 1G33A 2E6WA 1IJ6A 2I2RE 2KAVA 1K90D 1AJ5A 3TS5B 1QVIY 2JT3A 1KWOB 1UHJA 1OQPA 1BT6A 1QLSA 2H61C 4ORAB 3FWBA 4E68A 3ZNIA 1V1FA 4UPGA 1N65A 2BL0C 2LVJA 2OTGC 5GQQC 1CM4A 1QVIZ 1XFXO 4PALA 1KK7Y 3GK2A 1AJ4A 2LC5A 1M63B 2LANA 2OS8C 1QS7A 2ZKMX 5PALA 2V53A 2F2OA 1QIVA 1Q80A 2AMIA 2PMYA 1JWDA 1SCMC 2MLEC 1DVIA 1KK7Z 2A4JA 3I5IB 1Y1XA 1CDPA 3BUXB 4MZJA 2BKHB 1K95A 1L7ZA 4CFRA 1KSMA 1NX1A 1JF2A 1OZSA 2KYCA 1F71A 2JZIA 3CTNA 1PK0D 2Q91A 4XJKB 1KSOA 1B7TY 1QJTA 3VROA 3CZTX 1XVJA 4DIRA 4DRWA 3NSOA 2HQ8A 1DJGA 3CGAA 3VGOA 2K7OA 3FIAA 4DUQA 1AHRA 3CLNA 5F6TA 5K89A 1QX7A 2LMUA 1ODBA 1BOCA 4MLWA 1B7TZ 2ZFDA 1KFXL 2D8NA 2KQYA 1QLKA 4PDZA 1IKUA 1B8LA 1XYDA 2M1UA 3GK1A 3IQOA 2ZRTA 5KU1A 1Y0VH 1CMFA 4HRGA 1UHHA 2ZNDA 4C0KA 5HLOA 1XFZO 1ZACA 2PASA 4ZCVA 1QX5B 1CB1A 2K7CA 1DJIA 1EL4A 1OMDA 1RK9A 3TDUA 4M2PA 2OPOA 1SR6B 2DOQA 1K9UA 2E30A 2JULA 2WCEA 1PVBA 5AERA 3SG6A 1DGUA 3JVTC 3O2PA 2P6BB 1KQMB 3BUOB 1DGVA 1EJ3A 1SPYA 3TDIA 4CFQA 5ER5A 5JOLA 1S1EA 3RLZA 3BYAA 1IRJA 1CKKA 2LVKA 1RROA 5BPJA 1OMVA 2KFHA 2M0RA 3BOWB 3PSRA 3TUYC 1QIWA 3I5FB 1XA5A 3KPXA 4MVFA 4YGCB 5I8NA 1DT7B 3D0YB 3KO0A 1TIZA 2LAPA 2MBXA 5J3XA 4JPZB 1A75B 5AFPA 2G9BA 1G8IA 2CBLA 2K61A 1RECA 2MJWB 4MSPA 4OVNF 1NP8A 2L98A 1JC2A 1A4PA 1RTP1 4PE7A 2LVVA 1N2DA 1KFUS 2LUCA 4AQIA 1HQVA 4XYNA 1FW4A 1OOJA 2JXLA 1XK4C 2NLNA 3BUNB 1NWDA 1S36A 1OMRA 1YUTA 2WNDA 3SIBA 1W7IB 3TS5C 4OKHA 2F3YA 4YBHB 4ORBB 2EC6B 1WLMA 1K94A 2MLFC 1ZFSA 1XFVO 5TNCA 4DS7A 1B4CA 4CPVA 2PRUA 1NSHA 1SK6D 3LLEA 2COLB 2KBMA 2CT9A 2NXQA 1VRKA 4CIDA 5D7FA 1ALWA 2M49B 3JTDC 2L4HA 1C07A 1BMOA 2HETA 3A8RA 5DKRA 2JXCA 1D1OA 1Y1UA 2BBMA 2F33A 1NPQA 4OV2A 1J7PA 2LMVA 2EHBA 3EK7A 2M29A 1LVCD 1B8CA 1DJXA 3EVUA 3I5IC 1SKTA 4JQ0D 4MRXA 2L50A 4AQJA 1GJYA 1A29A 2H2KA 2LHIA 1GGZA 2PALA 2KOTA 4BY5A 2GGZA 1LINA 1YVHA 1WDCC 1UHNA 1NX0A 2KBIA 1K9PA 5I2LA 1H8BA 2LVIA 3DD4A 1A03A 2KSPA 2NCOA 3PATA 1PSRA 3E3RA 2LV7A 2KQ6A 1SL7A 1J7OA 2M1KB 2LLUA 1BF5A 1F55A 1OZOA 1L2OB 1YRTB 3DVMA 3WHUB 4YI9A 4NDBA 4HREE 2LMTA 2CNPA 4XJKA 3VRQA 4ICBA 2KI4C 2F8PA 1G4YR 1SMGA 3CWGA 1IGVA 2BE6A 1SYMA 3PFVA 1AP4A 1RJVA 1WRLA 2KDHA 2M8UA 3OB2B 1C7VA 2KFFA 1BR4B 3EVVA 1YURA 2PSRA 2FJUB 2PVBA 1SR6C 3SJSA 1MR8A 1W7JB 3MSEB 1J7RA 2HPSA 3OX6A 3H4SE 1K8UA 1NUBA 2JNFA 2K2FA 1IJ5A 1M31A 3DVJA 4GNKB 3OP0A 1SY9A 5G08A 3A4UB 1SRAA 1CFDA 4ETOA 4NDDA 1KQMC 2KGRA 1UHKA 1CLLA 1J55A 2LP3A 1NCYA 2F2PA 2LLTA 2OS8B 3OB1B 3DF0A 1ZMZA 2KNEA 1QV1A 2WORA 1WLZA 1ALVA 1SCMB 2WCFA 2JQ6A 3DF0B 1KFUL 4TNCA 3NSLA 3OHMB 3I5FC 1TRFA 1RFJA 3BUWB 3KHEA 4YGDB 2L5XB 1UP5A 5D69A 4GUKA 4HSZA 2SASA 2LHLA 1KCYA 2MHHA 1AUIB 3PALA 3TZ1A 2K8MB 3BOWA 4GAOA 1IWQA 2JT8A 1DJYA 1CFCA 1BJFA 1LA0A 3WNXB 1JFJA 2JTTA 2MRDA 3D0YA 4BY4A 1A75A 1NCXA 2JT0A 1LA3A 3GOFA 5DKNA 5HKWA 2JRFA 2LNKA 2F3ZA 1LKJA 2KI6D 5CSFA 3GK4X 2LM5A 1M45A 1CDMA 1YUSA 2EC6C 5DKQA 1FPWA 2RGIA 4YGAA 4MZKA 1SCVA 3AKAA 3EK8A 4USLA 1JSAA 2CXJA 3PM8A 3SIAA 1CLBA 1YR5A 1MHOA 4OR9B 1KK8B 4NQGA 3VRRA 1CDLA 2QACA 2TN4A 5AANA 1LXFC 2NCPA 3JVTB 1BG1A 5HYDA 1SW8A 1S6JA 1IQ3A 4PHNA 1YX8A 2I94A 1F4OA 1BR1B 1EG4A 1S6CA 5I2QA 2JU0A 1B9AA 1KWOC 1BODA 3NSKA 1XO5A 1TTXA 3TDZA 1CFFA 1JBAA 1MUXA 2K7DA 1B47A 4P2YB 4WQ3A 4M2QA 2NZ0A 4GPLB 2BECA 3I5GB 5HKZA 3TUYB 1B1GA 3BUMB 1GGWA 1YUUA 5KSZA 2O60A 1AVSA 2M7NA 1OSAA 2AAOA 5CSJA 2JTZA 1EXRA 2FCDA 5FYXA 2HQWA 3QRXA 3SG3A 4YRUA 1FBVA 2CCMA 4N1GA 2M7LA 1K96A 2KFGA 2EGDA 2LCPA 2LLSA 2ZNEA 1WRKA 1DMOA 2QPTA 2BCAA 2CTNA 4I5KA 1BU3A 3PN7B 1H4BA 2M3WA 1QTXA 1HT9A 3I5HB 4NDCA 1CFPA 4ZCUA 4GFTA 2ZN8A 3CR5X 2M9GA 5AXIA 3D10A 4MRYA 3HX4A 2FCEA 1F70A 1TNQA 3ZWHA 3K21A 1M46A 4C0JA 1DJWA 1SNLA 3AKBA 2LUXA 1EH2A 1S6IA 1M39A 2JOJA 1B8RA 1PRWA 2KYFA 1JF0A 4HRHA 1CLMA 4L9MA 3O4YA 4IL1A 1S3PA 1R2UA 2L4IA 3JTDB 1UHIA 1QV0A 4PHJA 3SG2A 1RWYA 3SG5A 3EK4A 4OCIA 1IQ5A 1K93D 1FF1A 2H61A 4QJ5B 1K9KA 1R6PA 1FI5A 1TN4A 4PE1A 5I2OA 3IF7A 1N0YA 4YGBB 1PSBA 4CLNA 5KTYA 3NSIA 1J1EA 1WRZA 1WY9A 2Q4UA 1SL8A 2GGMA 4R1EA 1TNPA 1ZOTB 4MEWA 2Y1MA 5CSIA 5JJGA 1JUOA 2BL0B 1NIWA 2OTGB 1C7WA 1CMGA 2VRGA 3C1VA 2M97A 1WDCB 2L2EA 1NX2A 1XFUO 1TCOB 2IS9A 1DJHA 1EG3A 2KAXA 4N1FA 2KAYA 4A4CA 3SG4A 2R2IA 4MBEA 1IH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K7B A;  1PUL A;  1DTL A;  1CDN A;  3OX5 A;  1CTR A;  1MQ1 A;  2KI4 B;  4QJ3 B;  5ER4 X;  1F8H A;  2G2B A;  4MZL A;  5B8I B;  2BBN A;  5CSN A;  3WHT B;  4MN0 A;  1MXE A;  3FS7 A;  1TOP A;  2AUC A;  2O5G A;  3EVR A;  3CS1 A;  2FOT A;  5AEQ A;  4D1E A;  4GGF C;  1QAT A;  2MA2 A;  4Q04 A;  1QXP A;  1QAS A;  1MWN A;  1A2X A;  2ZRS A;  1UWO A;  3KF9 A;  1JFK A;  1YX7 A;  1GQM A;  1KK8 C;  3AAJ A;  3BQ3 A;  3CR4 X;  1FI6 A;  3NXA A;  4ORC B;  1NX3 A;  1TNX A;  2K0J A;  1XFY O;  2SCP A;  2KGB C;  3DVE A;  4PHK A;  4GGF A;  5HLV A;  1BLQ A;  1Y6W A;  1ZUZ A;  1S5G Y;  3EKJ A;  4FTG A;  3RM1 A;  1CNP A;  1J7Q A;  3SG7 A;  1YRU B;  4PCW A;  4DCK A;  4U8D A;  1OE9 B;  2JPT A;  3VRP A;  5IBW A;  2L51 A;  4WRI A;  3LCP C;  2LP2 A;  1X02 A;  3CR2 A;  1SL9 A;  1IG5 A;  3I5G C;  2B1U A;  3LL8 B;  2BKI B;  1S5G Z;  2MAZ A;  2JNX A;  1KFX S;  3PLF B;  4FQO A;  2KI6 C;  4I5L B;  2L0P A;  1KQV A;  3EKH A;  3LK1 A;  1YTZ C;  2Y4Q A;  4N5X A;  4F0Z B;  4PHM A;  1SBJ A;  1U5I A;  3HCM A;  3IQQ A;  2K2A A;  2KHN A;  1K2H A;  1F54 A;  3BXK A;  3O78 A;  3WXA A;  4JWQ A;  1F4Q A;  1TCF A;  1U5I B;  2Y1N A;  1Y1A A;  3LK0 A;  3PN7 C;  2ZN9 A;  4YGE B;  3FWC A;  2HF5 A;  2WCB A;  4PE4 A;  1TNW A;  3M0W A;  3I5H C;  4AOM A;  2ISD A;  3ICB A;  3F45 A;  3AAK A;  1XFW O;  2BCB A;  1MF8 B;  1NCZ A;  1NYA A;  1PAL A;  2JWW A;  1UUR A;  1DJZ A;  2WOS A;  5CPV A;  1MXL C;  4QJ4 B;  1S26 D;  4I5N B;  1L2O C;  2GV5 A;  2BE4 A;  2I7A A;  1QX2 A;  2JC2 A;  1AK8 A;  4GGN A;  1PVA A;  4PE0 A;  4WQ2 A;  4A4B A;  1E8A A;  2BCX A;  1DF0 A;  1UUS A;  3VRN A;  4P5O E;  1J1D A;  1YVL A;  2WC8 A;  1CM1 A;  1XK4 A;  2I18 A;  4GBA A;  3DVK A;  2LE9 B;  3O6B A;  1V1G A;  4C0L A;  1DF0 B;  2Y5I A;  4YI8 A;  4I5J A;  3KEV A;  4M2O A;  5HKY A;  1G33 A;  2E6W A;  1IJ6 A;  2I2R E;  2KAV A;  1K90 D;  1AJ5 A;  3TS5 B;  1QVI Y;  2JT3 A;  1KWO B;  1UHJ A;  1OQP A;  1BT6 A;  1QLS A;  2H61 C;  4ORA B;  3FWB A;  4E68 A;  3ZNI A;  1V1F A;  4UPG A;  1N65 A;  2BL0 C;  2LVJ A;  2OTG C;  5GQQ C;  1CM4 A;  1QVI Z;  1XFX O;  4PAL A;  1KK7 Y;  3GK2 A;  1AJ4 A;  2LC5 A;  1M63 B;  2LAN A;  2OS8 C;  1QS7 A;  2ZKM X;  5PAL A;  2V53 A;  2F2O A;  1QIV A;  1Q80 A;  2AMI A;  2PMY A;  1JWD A;  1SCM C;  2MLE C;  1DVI A;  1KK7 Z;  2A4J A;  3I5I B;  1Y1X A;  1CDP A;  3BUX B;  4MZJ A;  2BKH B;  1K95 A;  1L7Z A;  4CFR A;  1KSM A;  1NX1 A;  1JF2 A;  1OZS A;  2KYC A;  1F71 A;  2JZI A;  3CTN A;  1PK0 D;  2Q91 A;  4XJK B;  1KSO A;  1B7T Y;  1QJT A;  3VRO A;  3CZT X;  1XVJ A;  4DIR A;  4DRW A;  3NSO A;  2HQ8 A;  1DJG A;  3CGA A;  3VGO A;  2K7O A;  3FIA A;  4DUQ A;  1AHR A;  3CLN A;  5F6T A;  5K89 A;  1QX7 A;  2LMU A;  1ODB A;  1BOC A;  4MLW A;  1B7T Z;  2ZFD A;  1KFX L;  2D8N A;  2KQY A;  1QLK A;  4PDZ A;  1IKU A;  1B8L A;  1XYD A;  2M1U A;  3GK1 A;  3IQO A;  2ZRT A;  5KU1 A;  1Y0V H;  1CMF A;  4HRG A;  1UHH A;  2ZND A;  4C0K A;  5HLO A;  1XFZ O;  1ZAC A;  2PAS A;  4ZCV A;  1QX5 B;  1CB1 A;  2K7C A;  1DJI A;  1EL4 A;  1OMD A;  1RK9 A;  3TDU A;  4M2P A;  2OPO A;  1SR6 B;  2DOQ A;  1K9U A;  2E30 A;  2JUL A;  2WCE A;  1PVB A;  5AER A;  3SG6 A;  1DGU A;  3JVT C;  3O2P A;  2P6B B;  1KQM B;  3BUO B;  1DGV A;  1EJ3 A;  1SPY A;  3TDI A;  4CFQ A;  5ER5 A;  5JOL A;  1S1E A;  3RLZ A;  3BYA A;  1IRJ A;  1CKK A;  2LVK A;  1RRO A;  5BPJ A;  1OMV A;  2KFH A;  2M0R A;  3BOW B;  3PSR A;  3TUY C;  1QIW A;  3I5F B;  1XA5 A;  3KPX A;  4MVF A;  4YGC B;  5I8N A;  1DT7 B;  3D0Y B;  3KO0 A;  1TIZ A;  2LAP A;  2MBX A;  5J3X A;  4JPZ B;  1A75 B;  5AFP A;  2G9B A;  1G8I A;  2CBL A;  2K61 A;  1REC A;  2MJW B;  4MSP A;  4OVN F;  1NP8 A;  2L98 A;  1JC2 A;  1A4P A;  1RTP 1;  4PE7 A;  2LVV A;  1N2D A;  1KFU S;  2LUC A;  4AQI A;  1HQV A;  4XYN A;  1FW4 A;  1OOJ A;  2JXL A;  1XK4 C;  2NLN A;  3BUN B;  1NWD A;  1S36 A;  1OMR A;  1YUT A;  2WND A;  3SIB A;  1W7I B;  3TS5 C;  4OKH A;  2F3Y A;  4YBH B;  4ORB B;  2EC6 B;  1WLM A;  1K94 A;  2MLF C;  1ZFS A;  1XFV O;  5TNC A;  4DS7 A;  1B4C A;  4CPV A;  2PRU A;  1NSH A;  1SK6 D;  3LLE A;  2COL B;  2KBM A;  2CT9 A;  2NXQ A;  1VRK A;  4CID A;  5D7F A;  1ALW A;  2M49 B;  3JTD C;  2L4H A;  1C07 A;  1BMO A;  2HET A;  3A8R A;  5DKR A;  2JXC A;  1D1O A;  1Y1U A;  2BBM A;  2F33 A;  1NPQ A;  4OV2 A;  1J7P A;  2LMV A;  2EHB A;  3EK7 A;  2M29 A;  1LVC D;  1B8C A;  1DJX A;  3EVU A;  3I5I C;  1SKT A;  4JQ0 D;  4MRX A;  2L50 A;  4AQJ A;  1GJY A;  1A29 A;  2H2K A;  2LHI A;  1GGZ A;  2PAL A;  2KOT A;  4BY5 A;  2GGZ A;  1LIN A;  1YVH A;  1WDC C;  1UHN A;  1NX0 A;  2KBI A;  1K9P A;  5I2L A;  1H8B A;  2LVI A;  3DD4 A;  1A03 A;  2KSP A;  2NCO A;  3PAT A;  1PSR A;  3E3R A;  2LV7 A;  2KQ6 A;  1SL7 A;  1J7O A;  2M1K B;  2LLU A;  1BF5 A;  1F55 A;  1OZO A;  1L2O B;  1YRT B;  3DVM A;  3WHU B;  4YI9 A;  4NDB A;  4HRE E;  2LMT A;  2CNP A;  4XJK A;  3VRQ A;  4ICB A;  2KI4 C;  2F8P A;  1G4Y R;  1SMG A;  3CWG A;  1IGV A;  2BE6 A;  1SYM A;  3PFV A;  1AP4 A;  1RJV A;  1WRL A;  2KDH A;  2M8U A;  3OB2 B;  1C7V A;  2KFF A;  1BR4 B;  3EVV A;  1YUR A;  2PSR A;  2FJU B;  2PVB A;  1SR6 C;  3SJS A;  1MR8 A;  1W7J B;  3MSE B;  1J7R A;  2HPS A;  3OX6 A;  3H4S E;  1K8U A;  1NUB A;  2JNF A;  2K2F A;  1IJ5 A;  1M31 A;  3DVJ A;  4GNK B;  3OP0 A;  1SY9 A;  5G08 A;  3A4U B;  1SRA A;  1CFD A;  4ETO A;  4NDD A;  1KQM C;  2KGR A;  1UHK A;  1CLL A;  1J55 A;  2LP3 A;  1NCY A;  2F2P A;  2LLT A;  2OS8 B;  3OB1 B;  3DF0 A;  1ZMZ A;  2KNE A;  1QV1 A;  2WOR A;  1WLZ A;  1ALV A;  1SCM B;  2WCF A;  2JQ6 A;  3DF0 B;  1KFU L;  4TNC A;  3NSL A;  3OHM B;  3I5F C;  1TRF A;  1RFJ A;  3BUW B;  3KHE A;  4YGD B;  2L5X B;  1UP5 A;  5D69 A;  4GUK A;  4HSZ A;  2SAS A;  2LHL A;  1KCY A;  2MHH A;  1AUI B;  3PAL A;  3TZ1 A;  2K8M B;  3BOW A;  4GAO A;  1IWQ A;  2JT8 A;  1DJY A;  1CFC A;  1BJF A;  1LA0 A;  3WNX B;  1JFJ A;  2JTT A;  2MRD A;  3D0Y A;  4BY4 A;  1A75 A;  1NCX A;  2JT0 A;  1LA3 A;  3GOF A;  5DKN A;  5HKW A;  2JRF A;  2LNK A;  2F3Z A;  1LKJ A;  2KI6 D;  5CSF A;  3GK4 X;  2LM5 A;  1M45 A;  1CDM A;  1YUS A;  2EC6 C;  5DKQ A;  1FPW A;  2RGI A;  4YGA A;  4MZK A;  1SCV A;  3AKA A;  3EK8 A;  4USL A;  1JSA A;  2CXJ A;  3PM8 A;  3SIA A;  1CLB A;  1YR5 A;  1MHO A;  4OR9 B;  1KK8 B;  4NQG A;  3VRR A;  1CDL A;  2QAC A;  2TN4 A;  5AAN A;  1LXF C;  2NCP A;  3JVT B;  1BG1 A;  5HYD A;  1SW8 A;  1S6J A;  1IQ3 A;  4PHN A;  1YX8 A;  2I94 A;  1F4O A;  1BR1 B;  1EG4 A;  1S6C A;  5I2Q A;  2JU0 A;  1B9A A;  1KWO C;  1BOD A;  3NSK A;  1XO5 A;  1TTX A;  3TDZ A;  1CFF A;  1JBA A;  1MUX A;  2K7D A;  1B47 A;  4P2Y B;  4WQ3 A;  4M2Q A;  2NZ0 A;  4GPL B;  2BEC A;  3I5G B;  5HKZ A;  3TUY B;  1B1G A;  3BUM B;  1GGW A;  1YUU A;  5KSZ A;  2O60 A;  1AVS A;  2M7N A;  1OSA A;  2AAO A;  5CSJ A;  2JTZ A;  1EXR A;  2FCD A;  5FYX A;  2HQW A;  3QRX A;  3SG3 A;  4YRU A;  1FBV A;  2CCM A;  4N1G A;  2M7L A;  1K96 A;  2KFG A;  2EGD A;  2LCP A;  2LLS A;  2ZNE A;  1WRK A;  1DMO A;  2QPT A;  2BCA A;  2CTN A;  4I5K A;  1BU3 A;  3PN7 B;  1H4B A;  2M3W A;  1QTX A;  1HT9 A;  3I5H B;  4NDC A;  1CFP A;  4ZCU A;  4GFT A;  2ZN8 A;  3CR5 X;  2M9G A;  5AXI A;  3D10 A;  4MRY A;  3HX4 A;  2FCE A;  1F70 A;  1TNQ A;  3ZWH A;  3K21 A;  1M46 A;  4C0J A;  1DJW A;  1SNL A;  3AKB A;  2LUX A;  1EH2 A;  1S6I A;  1M39 A;  2JOJ A;  1B8R A;  1PRW A;  2KYF A;  1JF0 A;  4HRH A;  1CLM A;  4L9M A;  3O4Y A;  4IL1 A;  1S3P A;  1R2U A;  2L4I A;  3JTD B;  1UHI A;  1QV0 A;  4PHJ A;  3SG2 A;  1RWY A;  3SG5 A;  3EK4 A;  4OCI A;  1IQ5 A;  1K93 D;  1FF1 A;  2H61 A;  4QJ5 B;  1K9K A;  1R6P A;  1FI5 A;  1TN4 A;  4PE1 A;  5I2O A;  3IF7 A;  1N0Y A;  4YGB B;  1PSB A;  4CLN A;  5KTY A;  3NSI A;  1J1E A;  1WRZ A;  1WY9 A;  2Q4U A;  1SL8 A;  2GGM A;  4R1E A;  1TNP A;  1ZOT B;  4MEW A;  2Y1M A;  5CSI A;  5JJG A;  1JUO A;  2BL0 B;  1NIW A;  2OTG B;  1C7W A;  1CMG A;  2VRG A;  3C1V A;  2M97 A;  1WDC B;  2L2E A;  1NX2 A;  1XFU O;  1TCO B;  2IS9 A;  1DJH A;  1EG3 A;  2KAX A;  4N1F A;  2KAY A;  4A4C A;  3SG4 A;  2R2I A;  4MBE A;  1IH0 A; 
#chains in the Genus database with same CATH topology
 2K7B A;  1PUL A;  1DTL A;  5I94 A;  1CDN A;  3OX5 A;  2WCJ A;  3OGN A;  1CTR A;  1MQ1 A;  2KI4 B;  4QJ3 B;  5ER4 X;  3DXL A;  1F8H A;  2G2B A;  4MZL A;  5B8I B;  2BBN A;  5CSN A;  3WHT B;  4MN0 A;  1MXE A;  3FS7 A;  1TOP A;  2AUC A;  2O5G A;  3EVR A;  3CS1 A;  3NHI A;  2FOT A;  5AEQ A;  4D1E A;  4GGF C;  1QAT A;  3D74 A;  2MA2 A;  4Q04 A;  1QXP A;  3B7A A;  1QAS A;  1MWN A;  1A2X A;  1DEK A;  2ZRS A;  1UWO A;  3KF9 A;  1JFK A;  1YX7 A;  1GQM A;  1KK8 C;  3AAJ A;  2L5Y A;  3BQ3 A;  3CR4 X;  1FI6 A;  3NXA A;  2WCK A;  4ORC B;  1NX3 A;  1TNX A;  2K0J A;  1XFY O;  2SCP A;  2KGB C;  3DVE A;  3RZS A;  2WCL A;  4PHK A;  4GGF A;  5HLV A;  1BLQ A;  2JPO A;  1Y6W A;  1ZUZ A;  1S5G Y;  3EKJ A;  4FTG A;  3RM1 A;  1CNP A;  1J7Q A;  3SG7 A;  1YRU B;  4PCW A;  4DCK A;  3CZ0 A;  4U8D A;  2BNX A;  1OE9 B;  2JPT A;  3VRP A;  1TWO A;  2H8V A;  5IBW A;  2L51 A;  4WRI A;  3LCP C;  2LP2 A;  1X02 A;  3CR2 A;  3R1P A;  1SL9 A;  1IG5 A;  3I5G C;  2B1U A;  3LL8 B;  2BKI B;  1S5G Z;  2MAZ A;  2JNX A;  1KFX S;  3BFB A;  3PLF B;  4FQO A;  2KI6 C;  4I5L B;  2L0P A;  1KQV A;  3EKH A;  3LK1 A;  1YTZ C;  3EG5 B;  2Y4Q A;  4N5X A;  4F0Z B;  4PHM A;  1SBJ A;  1U5I A;  3HCM A;  3IQQ A;  2K2A A;  2KHN A;  1K2H A;  2K60 A;  1F54 A;  3BXK A;  3O78 A;  3WXA A;  4JWQ A;  1F4Q A;  1TCF A;  1U5I B;  2Y1N A;  1Y1A A;  3LK0 A;  3PN7 C;  2ZN9 A;  4YGE B;  3FWC A;  2HF5 A;  2WCB A;  3B86 A;  4PE4 A;  1TNW A;  3L47 A;  3M0W A;  3I5H C;  4AOM A;  2ISD A;  3ICB A;  3F45 A;  1TUJ A;  3AAK A;  1XFW O;  1PAL A;  1TUZ A;  1MF8 B;  1NCZ A;  1NYA A;  2BCB A;  2JWW A;  5FI6 A;  1UUR A;  1DJZ A;  2WOS A;  5CPV A;  1MXL C;  4QJ4 B;  1S26 D;  4I5N B;  1L2O C;  2GV5 A;  2BE4 A;  2I7A A;  1QX2 A;  2JC2 A;  1T14 A;  4GGN A;  1PVA A;  4PE0 A;  4WQ2 A;  4A4B A;  1E8A A;  2BCX A;  1DF0 A;  1UUS A;  3VRN A;  4P5O E;  1J1D A;  1YVL A;  2WC8 A;  1CM1 A;  1XK4 A;  2I18 A;  4GBA A;  3DVK A;  2LE9 B;  3O6B A;  1V1G A;  4C0L A;  1DF0 B;  2Y5I A;  1XFR A;  4YI8 A;  4I5J A;  3KEV A;  4M2O A;  3B6X A;  5HKY A;  1G33 A;  2E6W A;  1IJ6 A;  2I2R E;  2KAV A;  1K90 D;  1AJ5 A;  3TS5 B;  1QVI Y;  2JT3 A;  1KWO B;  1UHJ A;  1OQP A;  1BT6 A;  1QLS A;  3K1E A;  2H61 C;  3L4L A;  4ORA B;  2KPH A;  3FWB A;  4E68 A;  3ZNI A;  1V1F A;  4UPG A;  1N65 A;  2BL0 C;  2LVJ A;  2OTG C;  5GQQ C;  1CM4 A;  1QVI Z;  1XFX O;  4PAL A;  1KK7 Y;  3GK2 A;  1AJ4 A;  2LC5 A;  1M63 B;  2LAN A;  2OS8 C;  1QS7 A;  2ZKM X;  5PAL A;  2V53 A;  2F2O A;  1QIV A;  2QEB A;  1Q80 A;  2AMI A;  2PMY A;  3FE6 A;  1JWD A;  1SCM C;  1GM0 A;  2MLE C;  1DVI A;  1KK7 Z;  2A4J A;  3I5I B;  2WCM A;  5FI2 A;  1Y1X A;  1CDP A;  3BUX B;  4MZJ A;  2BKH B;  1K95 A;  1L7Z A;  4CFR A;  1KSM A;  1NX1 A;  1JF2 A;  1OZS A;  2KYC A;  1F71 A;  2JZI A;  3CTN A;  3Q8I A;  1PK0 D;  3DY9 A;  4INX A;  2Q91 A;  4XJK B;  1KSO A;  3S0G A;  1B7T Y;  1QJT A;  3UO9 A;  3VRO A;  3CZT X;  1XVJ A;  4JD9 A;  4DIR A;  3NSO A;  4DRW A;  3V2L A;  2HQ8 A;  1DJG A;  3CGA A;  3VGO A;  2K7O A;  3FIA A;  4DUQ A;  1AHR A;  3CLN A;  5F6T A;  5K89 A;  1QX7 A;  2LMU A;  1ODB A;  1BOC A;  2QEV A;  4MLW A;  1B7T Z;  2ZFD A;  1KFX L;  2D8N A;  2KQY A;  1QLK A;  3D76 A;  4PDZ A;  1IKU A;  1B8L A;  1XYD A;  2M1U A;  3GK1 A;  3IQO A;  2ZRT A;  5KU1 A;  1Y0V H;  1CMF A;  4HRG A;  1UHH A;  2ZND A;  3R72 A;  4C0K A;  5HLO A;  1XFZ O;  1ZAC A;  1C3Z A;  2PAS A;  1QX5 B;  4ZCV A;  3S0D A;  2K7C A;  1DJI A;  1CB1 A;  1EL4 A;  1OMD A;  1RK9 A;  3TDU A;  4M2P A;  3S0B A;  2OPO A;  1SR6 B;  2DOQ A;  1K9U A;  2E30 A;  2JUL A;  2WCE A;  1PVB A;  1Z4H A;  4KYN A;  5AER A;  3SG6 A;  1P28 A;  1DGU A;  4JKT A;  3JVT C;  3O2P A;  2P6B B;  1ORG A;  1KQM B;  3BUO B;  1DGV A;  1EJ3 A;  1SPY A;  5FI7 A;  3TDI A;  2KLD A;  4CFQ A;  5ER5 A;  3R1V A;  5JOL A;  4INW A;  1S1E A;  3RLZ A;  3BYA A;  3D77 A;  1IRJ A;  1CKK A;  2LVK A;  1RRO A;  5BPJ A;  1OMV A;  2KFH A;  2M0R A;  3BOW B;  3PSR A;  3TUY C;  1QIW A;  1OOI X;  3I5F B;  1XA5 A;  3KPX A;  4MVF A;  4YGC B;  5I8N A;  1DT7 B;  3D0Y B;  3KO0 A;  1TIZ A;  2LAP A;  5DIC A;  2MBX A;  2KLE A;  5J3X A;  4JPZ B;  1A75 B;  5AFP A;  2G9B A;  1G8I A;  2CBL A;  2K61 A;  1REC A;  2MJW B;  4MSP A;  4OVN F;  1NP8 A;  2L98 A;  1JC2 A;  1A4P A;  1RTP 1;  4PE7 A;  2LVV A;  1N2D A;  1KFU S;  2LUC A;  3BJH A;  4AQI A;  1HQV A;  4XYN A;  1FW4 A;  1OOJ A;  2JXL A;  1XK4 C;  2NLN A;  3CZ2 A;  3SS4 A;  3NHT A;  3FE8 A;  3BUN B;  1NWD A;  1S36 A;  1OMR A;  1YUT A;  2WND A;  3SIB A;  1W7I B;  3TS5 C;  4OKH A;  4F7F A;  2F3Y A;  4YBH B;  4ORB B;  2EC6 B;  1WLM A;  1K94 A;  2MLF C;  3SS3 A;  1ZFS A;  1XFV O;  3NGV A;  5TNC A;  4DS7 A;  1B4C A;  4CPV A;  2PRU A;  1NSH A;  1SK6 D;  3LLE A;  2COL B;  2KBM A;  2CT9 A;  2NXQ A;  1VRK A;  4CID A;  5D7F A;  1ALW A;  2M49 B;  3JTD C;  2L4H A;  1C07 A;  1BMO A;  1LS8 A;  2HET A;  3A8R A;  5DKR A;  2JXC A;  1D1O A;  1Y1U A;  2BBM A;  2F33 A;  1NPQ A;  3O4X A;  4OV2 A;  1J7P A;  2LMV A;  2EHB A;  3EK7 A;  2M29 A;  1LVC D;  1B8C A;  1DJX A;  3EVU A;  3I5I C;  1SKT A;  4JQ0 D;  4MRX A;  2L50 A;  4AQJ A;  1GJY A;  1AK8 A;  1A29 A;  2H2K A;  2ERB A;  1GGZ A;  2LHI A;  2PAL A;  2KOT A;  4BY5 A;  3BFA A;  2GGZ A;  1LIN A;  1YVH A;  1WDC C;  1UHN A;  1NX0 A;  2KBI A;  1K9P A;  5I2L A;  1H8B A;  2LVI A;  3DD4 A;  1A03 A;  2KSP A;  2NCO A;  3PAT A;  1PSR A;  3E3R A;  2LV7 A;  2KQ6 A;  1SL7 A;  1J7O A;  2M1K B;  2LLU A;  1BF5 A;  1F55 A;  1OZO A;  1L2O B;  1YRT B;  3DVM A;  3WHU B;  4YI9 A;  4NDB A;  4HRE E;  2LMT A;  2CNP A;  4XJK A;  2PYQ A;  3VRQ A;  4ICB A;  2KI4 C;  2F8P A;  1G4Y R;  1OOG A;  1SMG A;  3CWG A;  1IGV A;  2BE6 A;  1SYM A;  3PFV A;  1AP4 A;  1RJV A;  1WRL A;  2KDH A;  2M8U A;  3OB2 B;  1C7V A;  5EL2 A;  2KFF A;  1BR4 B;  3EVV A;  1IIO A;  1YUR A;  2PSR A;  2FJU B;  1C3Y A;  2PVB A;  3VB1 A;  1SR6 C;  3SJS A;  3SS5 A;  1MR8 A;  1W7J B;  3MSE B;  1J7R A;  2HPS A;  3OX6 A;  3H4S E;  1K8U A;  1NUB A;  2JNF A;  2K2F A;  1IJ5 A;  1M31 A;  3DVJ A;  4GNK B;  3OP0 A;  1SY9 A;  5G08 A;  3A4U B;  1QWV A;  2PQL A;  1SRA A;  1CFD A;  4ETO A;  4NDD A;  1KQM C;  2KGR A;  1UHK A;  1CLL A;  1J55 A;  1OW4 A;  2LP3 A;  1NCY A;  2F2P A;  2LLT A;  2OS8 B;  3OB1 B;  3DF0 A;  1ZMZ A;  3CYZ A;  2KNE A;  3BFH A;  3QME A;  1QV1 A;  2WOR A;  1WLZ A;  1ALV A;  1SCM B;  2WCF A;  2JQ6 A;  3DF0 B;  1KFU L;  3UNW A;  4TNC A;  3NSL A;  3OHM B;  3I5F C;  3DZT A;  1TRF A;  1RFJ A;  3BUW B;  3KHE A;  4YGD B;  2L5X B;  1UP5 A;  5D69 A;  4GUK A;  4HSZ A;  2SAS A;  2LHL A;  1KCY A;  1DC1 A;  2MHH A;  1AUI B;  3PAL A;  3TZ1 A;  2WC6 A;  2K8M B;  3BOW A;  4GAO A;  1IWQ A;  2JT8 A;  1DJY A;  1CFC A;  1Z2C B;  1BJF A;  2YGU A;  1LA0 A;  4PT1 A;  3S0A A;  3WNX B;  1JFJ A;  2JTT A;  2MRD A;  3D0Y A;  3D75 A;  3N7H A;  4BY4 A;  1A75 A;  1NCX A;  2JT0 A;  1LA3 A;  3GOF A;  2GTE A;  5DKN A;  5HKW A;  2JRF A;  2LNK A;  2F3Z A;  1LKJ A;  2WCH A;  2KI6 D;  3B88 A;  5CSF A;  3GK4 X;  3CDN A;  4OZD A;  2WC5 A;  2LM5 A;  1M45 A;  1CDM A;  1YUS A;  2EC6 C;  5DKQ A;  1FPW A;  2RGI A;  4YGA A;  4MZK A;  1SCV A;  3AKA A;  3EK8 A;  2L2C A;  4USL A;  1JSA A;  2CXJ A;  3PM8 A;  3SIA A;  1CLB A;  1YR5 A;  1MHO A;  3CAB A;  1KK8 B;  4NQG A;  4OR9 B;  3VRR A;  1CDL A;  2QAC A;  2TN4 A;  5AAN A;  1LXF C;  2NCP A;  3JVT B;  1BG1 A;  5HYD A;  1SW8 A;  1S6J A;  1IQ3 A;  4PHN A;  1YX8 A;  2I94 A;  1F4O A;  1BR1 B;  1EG4 A;  1SSE B;  1S6C A;  3S0E A;  2JU0 A;  3R1O A;  5I2Q A;  1DEL A;  1B9A A;  1KWO C;  1BOD A;  3NSK A;  1XO5 A;  1OOF A;  1TTX A;  3TDZ A;  1CFF A;  1JBA A;  1MUX A;  2K7D A;  1B47 A;  4P2Y B;  4WQ3 A;  4M2Q A;  2NZ0 A;  4GPL B;  2BEC A;  3I5G B;  3PJI A;  5HKZ A;  3TUY B;  1B1G A;  3BUM B;  1GGW A;  1YUU A;  3D73 A;  2QEH A;  5KSZ A;  2O60 A;  1AVS A;  2M7N A;  1OSA A;  2AAO A;  5CSJ A;  2JTZ A;  1EXR A;  2FCD A;  5FYX A;  2HQW A;  3PM2 A;  3QRX A;  3SG3 A;  3D78 A;  4YRU A;  1FBV A;  2CCM A;  4N1G A;  2M7L A;  1K96 A;  2KFG A;  2EGD A;  2LCP A;  2LLS A;  2ZNE A;  1WRK A;  1DMO A;  2QPT A;  2BCA A;  2CTN A;  4I5K A;  1BU3 A;  3PN7 B;  1H4B A;  2M3W A;  1QTX A;  1HT9 A;  3I5H B;  4NDC A;  1CFP A;  4ZCU A;  4GFT A;  2ZN8 A;  3CR5 X;  2M9G A;  5AXI A;  3D10 A;  4MRY A;  3HX4 A;  4IJ7 A;  3OBV A;  2FCE A;  2P71 A;  1F70 A;  1TNQ A;  3ZWH A;  3FE9 A;  1M46 A;  2QDI A;  3K21 A;  4C0J A;  3S0F A;  5HL1 A;  1OOH A;  1DJW A;  1SNL A;  2FJY A;  3AKB A;  2LUX A;  1EH2 A;  4FQT A;  1S6I A;  1M39 A;  3DYE A;  2P70 A;  5D3O A;  2JOJ A;  1B8R A;  1PRW A;  2KYF A;  1JF0 A;  4HRH A;  1CLM A;  4L9M A;  3O4Y A;  4IL1 A;  1S3P A;  1R2U A;  2L4I A;  3JTD B;  1UHI A;  1QV0 A;  4PHJ A;  3SG2 A;  1RWY A;  2QEO A;  3SG5 A;  3EK4 A;  4OCI A;  1DQE A;  1IQ5 A;  1K93 D;  1FF1 A;  2H61 A;  4QJ5 B;  1K9K A;  1R6P A;  1FI5 A;  1TN4 A;  4PE1 A;  5I2O A;  3IF7 A;  1N0Y A;  4YGB B;  1PSB A;  4CLN A;  5KTY A;  3NSI A;  1J1E A;  1WRZ A;  3IVT A;  1WY9 A;  2Q4U A;  1SL8 A;  2GGM A;  3CZ1 A;  1TNP A;  4R1E A;  3B87 A;  1ZOT B;  2BAP A;  4MEW A;  2Y1M A;  5CSI A;  5JJG A;  1JUO A;  2BL0 B;  1NIW A;  2OTG B;  1C7W A;  1CMG A;  2VRG A;  3C1V A;  2M97 A;  1WDC B;  2L2E A;  1NX2 A;  1XFU O;  1TCO B;  2IS9 A;  1DJH A;  1W9Z A;  1EG3 A;  2KAX A;  4N1F A;  2KAY A;  4A4C A;  3SG4 A;  2R2I A;  4MBE A;  3L4A A;  1IH0 A; 
#chains in the Genus database with same CATH homology
 2K7B A;  1PUL A;  1DTL A;  1CDN A;  3OX5 A;  1CTR A;  1MQ1 A;  2KI4 B;  4QJ3 B;  5ER4 X;  1F8H A;  2G2B A;  4MZL A;  5B8I B;  2BBN A;  5CSN A;  3WHT B;  4MN0 A;  1MXE A;  3FS7 A;  1TOP A;  2AUC A;  2O5G A;  3EVR A;  3CS1 A;  2FOT A;  5AEQ A;  4D1E A;  4GGF C;  1QAT A;  2MA2 A;  4Q04 A;  1QXP A;  1QAS A;  1MWN A;  1A2X A;  2ZRS A;  1UWO A;  3KF9 A;  1JFK A;  1YX7 A;  1GQM A;  1KK8 C;  3AAJ A;  3BQ3 A;  3CR4 X;  1FI6 A;  3NXA A;  4ORC B;  1NX3 A;  1TNX A;  2K0J A;  1XFY O;  2SCP A;  2KGB C;  3DVE A;  4PHK A;  4GGF A;  5HLV A;  1BLQ A;  1Y6W A;  1ZUZ A;  1S5G Y;  3EKJ A;  4FTG A;  3RM1 A;  1CNP A;  1J7Q A;  3SG7 A;  1YRU B;  4PCW A;  4DCK A;  4U8D A;  1OE9 B;  2JPT A;  3VRP A;  5IBW A;  2L51 A;  4WRI A;  3LCP C;  2LP2 A;  1X02 A;  3CR2 A;  1SL9 A;  1IG5 A;  3I5G C;  2B1U A;  3LL8 B;  2BKI B;  1S5G Z;  2MAZ A;  2JNX A;  1KFX S;  3PLF B;  4FQO A;  2KI6 C;  4I5L B;  2L0P A;  1KQV A;  3EKH A;  3LK1 A;  1YTZ C;  2Y4Q A;  4N5X A;  4F0Z B;  4PHM A;  1SBJ A;  1U5I A;  3HCM A;  3IQQ A;  2K2A A;  2KHN A;  1K2H A;  1F54 A;  3BXK A;  3O78 A;  3WXA A;  4JWQ A;  1F4Q A;  1TCF A;  1U5I B;  2Y1N A;  1Y1A A;  3LK0 A;  3PN7 C;  2ZN9 A;  4YGE B;  3FWC A;  2HF5 A;  2WCB A;  4PE4 A;  1TNW A;  3M0W A;  3I5H C;  4AOM A;  2ISD A;  3ICB A;  3F45 A;  3AAK A;  1XFW O;  2BCB A;  1MF8 B;  1NCZ A;  1NYA A;  1PAL A;  2JWW A;  1UUR A;  1DJZ A;  2WOS A;  5CPV A;  1MXL C;  4QJ4 B;  1S26 D;  4I5N B;  1L2O C;  2GV5 A;  2BE4 A;  2I7A A;  1QX2 A;  2JC2 A;  1AK8 A;  4GGN A;  1PVA A;  4PE0 A;  4WQ2 A;  4A4B A;  1E8A A;  2BCX A;  1DF0 A;  1UUS A;  3VRN A;  4P5O E;  1J1D A;  1YVL A;  2WC8 A;  1CM1 A;  1XK4 A;  2I18 A;  4GBA A;  3DVK A;  2LE9 B;  3O6B A;  1V1G A;  4C0L A;  1DF0 B;  2Y5I A;  4YI8 A;  4I5J A;  3KEV A;  4M2O A;  5HKY A;  1G33 A;  2E6W A;  1IJ6 A;  2I2R E;  2KAV A;  1K90 D;  1AJ5 A;  3TS5 B;  1QVI Y;  2JT3 A;  1KWO B;  1UHJ A;  1OQP A;  1BT6 A;  1QLS A;  2H61 C;  4ORA B;  3FWB A;  4E68 A;  3ZNI A;  1V1F A;  4UPG A;  1N65 A;  2BL0 C;  2LVJ A;  2OTG C;  5GQQ C;  1CM4 A;  1QVI Z;  1XFX O;  4PAL A;  1KK7 Y;  3GK2 A;  1AJ4 A;  2LC5 A;  1M63 B;  2LAN A;  2OS8 C;  1QS7 A;  2ZKM X;  5PAL A;  2V53 A;  2F2O A;  1QIV A;  1Q80 A;  2AMI A;  2PMY A;  1JWD A;  1SCM C;  2MLE C;  1DVI A;  1KK7 Z;  2A4J A;  3I5I B;  1Y1X A;  1CDP A;  3BUX B;  4MZJ A;  2BKH B;  1K95 A;  1L7Z A;  4CFR A;  1KSM A;  1NX1 A;  1JF2 A;  1OZS A;  2KYC A;  1F71 A;  2JZI A;  3CTN A;  1PK0 D;  2Q91 A;  4XJK B;  1KSO A;  1B7T Y;  1QJT A;  3VRO A;  3CZT X;  1XVJ A;  4DIR A;  4DRW A;  3NSO A;  2HQ8 A;  1DJG A;  3CGA A;  3VGO A;  2K7O A;  3FIA A;  4DUQ A;  1AHR A;  3CLN A;  5F6T A;  5K89 A;  1QX7 A;  2LMU A;  1ODB A;  1BOC A;  4MLW A;  1B7T Z;  2ZFD A;  1KFX L;  2D8N A;  2KQY A;  1QLK A;  4PDZ A;  1IKU A;  1B8L A;  1XYD A;  2M1U A;  3GK1 A;  3IQO A;  2ZRT A;  5KU1 A;  1Y0V H;  1CMF A;  4HRG A;  1UHH A;  2ZND A;  4C0K A;  5HLO A;  1XFZ O;  1ZAC A;  2PAS A;  4ZCV A;  1QX5 B;  1CB1 A;  2K7C A;  1DJI A;  1EL4 A;  1OMD A;  1RK9 A;  3TDU A;  4M2P A;  2OPO A;  1SR6 B;  2DOQ A;  1K9U A;  2E30 A;  2JUL A;  2WCE A;  1PVB A;  5AER A;  3SG6 A;  1DGU A;  3JVT C;  3O2P A;  2P6B B;  1KQM B;  3BUO B;  1DGV A;  1EJ3 A;  1SPY A;  3TDI A;  4CFQ A;  5ER5 A;  5JOL A;  1S1E A;  3RLZ A;  3BYA A;  1IRJ A;  1CKK A;  2LVK A;  1RRO A;  5BPJ A;  1OMV A;  2KFH A;  2M0R A;  3BOW B;  3PSR A;  3TUY C;  1QIW A;  3I5F B;  1XA5 A;  3KPX A;  4MVF A;  4YGC B;  5I8N A;  1DT7 B;  3D0Y B;  3KO0 A;  1TIZ A;  2LAP A;  2MBX A;  5J3X A;  4JPZ B;  1A75 B;  5AFP A;  2G9B A;  1G8I A;  2CBL A;  2K61 A;  1REC A;  2MJW B;  4MSP A;  4OVN F;  1NP8 A;  2L98 A;  1JC2 A;  1A4P A;  1RTP 1;  4PE7 A;  2LVV A;  1N2D A;  1KFU S;  2LUC A;  4AQI A;  1HQV A;  4XYN A;  1FW4 A;  1OOJ A;  2JXL A;  1XK4 C;  2NLN A;  3BUN B;  1NWD A;  1S36 A;  1OMR A;  1YUT A;  2WND A;  3SIB A;  1W7I B;  3TS5 C;  4OKH A;  2F3Y A;  4YBH B;  4ORB B;  2EC6 B;  1WLM A;  1K94 A;  2MLF C;  1ZFS A;  1XFV O;  5TNC A;  4DS7 A;  1B4C A;  4CPV A;  2PRU A;  1NSH A;  1SK6 D;  3LLE A;  2COL B;  2KBM A;  2CT9 A;  2NXQ A;  1VRK A;  4CID A;  5D7F A;  1ALW A;  2M49 B;  3JTD C;  2L4H A;  1C07 A;  1BMO A;  2HET A;  3A8R A;  5DKR A;  2JXC A;  1D1O A;  1Y1U A;  2BBM A;  2F33 A;  1NPQ A;  4OV2 A;  1J7P A;  2LMV A;  2EHB A;  3EK7 A;  2M29 A;  1LVC D;  1B8C A;  1DJX A;  3EVU A;  3I5I C;  1SKT A;  4JQ0 D;  4MRX A;  2L50 A;  4AQJ A;  1GJY A;  1A29 A;  2H2K A;  2LHI A;  1GGZ A;  2PAL A;  2KOT A;  4BY5 A;  2GGZ A;  1LIN A;  1YVH A;  1WDC C;  1UHN A;  1NX0 A;  2KBI A;  1K9P A;  5I2L A;  1H8B A;  2LVI A;  3DD4 A;  1A03 A;  2KSP A;  2NCO A;  3PAT A;  1PSR A;  3E3R A;  2LV7 A;  2KQ6 A;  1SL7 A;  1J7O A;  2M1K B;  2LLU A;  1BF5 A;  1F55 A;  1OZO A;  1L2O B;  1YRT B;  3DVM A;  3WHU B;  4YI9 A;  4NDB A;  4HRE E;  2LMT A;  2CNP A;  4XJK A;  3VRQ A;  4ICB A;  2KI4 C;  2F8P A;  1G4Y R;  1SMG A;  3CWG A;  1IGV A;  2BE6 A;  1SYM A;  3PFV A;  1AP4 A;  1RJV A;  1WRL A;  2KDH A;  2M8U A;  3OB2 B;  1C7V A;  2KFF A;  1BR4 B;  3EVV A;  1YUR A;  2PSR A;  2FJU B;  2PVB A;  1SR6 C;  3SJS A;  1MR8 A;  1W7J B;  3MSE B;  1J7R A;  2HPS A;  3OX6 A;  3H4S E;  1K8U A;  1NUB A;  2JNF A;  2K2F A;  1IJ5 A;  1M31 A;  3DVJ A;  4GNK B;  3OP0 A;  1SY9 A;  5G08 A;  3A4U B;  1SRA A;  1CFD A;  4ETO A;  4NDD A;  1KQM C;  2KGR A;  1UHK A;  1CLL A;  1J55 A;  2LP3 A;  1NCY A;  2F2P A;  2LLT A;  2OS8 B;  3OB1 B;  3DF0 A;  1ZMZ A;  2KNE A;  1QV1 A;  2WOR A;  1WLZ A;  1ALV A;  1SCM B;  2WCF A;  2JQ6 A;  3DF0 B;  1KFU L;  4TNC A;  3NSL A;  3OHM B;  3I5F C;  1TRF A;  1RFJ A;  3BUW B;  3KHE A;  4YGD B;  2L5X B;  1UP5 A;  5D69 A;  4GUK A;  4HSZ A;  2SAS A;  2LHL A;  1KCY A;  2MHH A;  1AUI B;  3PAL A;  3TZ1 A;  2K8M B;  3BOW A;  4GAO A;  1IWQ A;  2JT8 A;  1DJY A;  1CFC A;  1BJF A;  1LA0 A;  3WNX B;  1JFJ A;  2JTT A;  2MRD A;  3D0Y A;  4BY4 A;  1A75 A;  1NCX A;  2JT0 A;  1LA3 A;  3GOF A;  5DKN A;  5HKW A;  2JRF A;  2LNK A;  2F3Z A;  1LKJ A;  2KI6 D;  5CSF A;  3GK4 X;  2LM5 A;  1M45 A;  1CDM A;  1YUS A;  2EC6 C;  5DKQ A;  1FPW A;  2RGI A;  4YGA A;  4MZK A;  1SCV A;  3AKA A;  3EK8 A;  4USL A;  1JSA A;  2CXJ A;  3PM8 A;  3SIA A;  1CLB A;  1YR5 A;  1MHO A;  4OR9 B;  1KK8 B;  4NQG A;  3VRR A;  1CDL A;  2QAC A;  2TN4 A;  5AAN A;  1LXF C;  2NCP A;  3JVT B;  1BG1 A;  5HYD A;  1SW8 A;  1S6J A;  1IQ3 A;  4PHN A;  1YX8 A;  2I94 A;  1F4O A;  1BR1 B;  1EG4 A;  1S6C A;  5I2Q A;  2JU0 A;  1B9A A;  1KWO C;  1BOD A;  3NSK A;  1XO5 A;  1TTX A;  3TDZ A;  1CFF A;  1JBA A;  1MUX A;  2K7D A;  1B47 A;  4P2Y B;  4WQ3 A;  4M2Q A;  2NZ0 A;  4GPL B;  2BEC A;  3I5G B;  5HKZ A;  3TUY B;  1B1G A;  3BUM B;  1GGW A;  1YUU A;  5KSZ A;  2O60 A;  1AVS A;  2M7N A;  1OSA A;  2AAO A;  5CSJ A;  2JTZ A;  1EXR A;  2FCD A;  5FYX A;  2HQW A;  3QRX A;  3SG3 A;  4YRU A;  1FBV A;  2CCM A;  4N1G A;  2M7L A;  1K96 A;  2KFG A;  2EGD A;  2LCP A;  2LLS A;  2ZNE A;  1WRK A;  1DMO A;  2QPT A;  2BCA A;  2CTN A;  4I5K A;  1BU3 A;  3PN7 B;  1H4B A;  2M3W A;  1QTX A;  1HT9 A;  3I5H B;  4NDC A;  1CFP A;  4ZCU A;  4GFT A;  2ZN8 A;  3CR5 X;  2M9G A;  5AXI A;  3D10 A;  4MRY A;  3HX4 A;  2FCE A;  1F70 A;  1TNQ A;  3ZWH A;  3K21 A;  1M46 A;  4C0J A;  1DJW A;  1SNL A;  3AKB A;  2LUX A;  1EH2 A;  1S6I A;  1M39 A;  2JOJ A;  1B8R A;  1PRW A;  2KYF A;  1JF0 A;  4HRH A;  1CLM A;  4L9M A;  3O4Y A;  4IL1 A;  1S3P A;  1R2U A;  2L4I A;  3JTD B;  1UHI A;  1QV0 A;  4PHJ A;  3SG2 A;  1RWY A;  3SG5 A;  3EK4 A;  4OCI A;  1IQ5 A;  1K93 D;  1FF1 A;  2H61 A;  4QJ5 B;  1K9K A;  1R6P A;  1FI5 A;  1TN4 A;  4PE1 A;  5I2O A;  3IF7 A;  1N0Y A;  4YGB B;  1PSB A;  4CLN A;  5KTY A;  3NSI A;  1J1E A;  1WRZ A;  1WY9 A;  2Q4U A;  1SL8 A;  2GGM A;  4R1E A;  1TNP A;  1ZOT B;  4MEW A;  2Y1M A;  5CSI A;  5JJG A;  1JUO A;  2BL0 B;  1NIW A;  2OTG B;  1C7W A;  1CMG A;  2VRG A;  3C1V A;  2M97 A;  1WDC B;  2L2E A;  1NX2 A;  1XFU O;  1TCO B;  2IS9 A;  1DJH A;  1EG3 A;  2KAX A;  4N1F A;  2KAY A;  4A4C A;  3SG4 A;  2R2I A;  4MBE A;  1IH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...