1ZMZA

Solution structure of the n-terminal domain (m1-s98) of human centrin 2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Centrin-2
publication title The N-terminal domain of human centrin 2 has a closed structure, binds calcium with a very low affinity, and plays a role in the protein self-assembly
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1zmzA01
1C07A 1QLKA 1SMGA 2MLFC 4GGNA 4HSZA 1YR5A 2KNEA 2B1UA 1A75A 4FQOA 3CGAA 4QJ3B 3WHUB 4WQ2A 2D8NA 1KK7Z 1GQMA 1AJ4A 2PMYA 3OX6A 4N5XA 1QJTA 1K9UA 1ZUZA 2M9GA 4N1FA 1KFXS 1ZFSA 1RTP1 1DJIA 3I5GB 1S3PA 2ZN8A 2QPTA 1IG5A 3TDIA 3WXAA 1IKUA 1PSRA 2OS8C 2LP3A 2KYFA 2JTZA 1XVJA 2WC8A 1J7OA 1NSHA 2VRGA 1KK8B 2I7AA 3SG6A 1FBVA 2LVIA 2CBLA 2K7DA 5FYXA 5I2LA 1B47A 1PALA 1XFWO 1H8BA 4PHJA 1RK9A 3TDUA 3OB2B 1OZOA 1F8HA 5HLVA 2H61A 5ER4X 3LL8B 1K95A 2L0PA 3PM8A 1YUUA 5D7FA 2WNDA 2GGMA 3NSLA 4HREE 1DTLA 1SW8A 2KAXA 1CB1A 3BUXB 2LHLA 5AFPA 3JVTB 2JRFA 2MRDA 3I5FB 3SG3A 1L7ZA 1Y1UA 1XFZO 5DKRA 1SKTA 1V1GA 2ZN9A 1QV1A 4M2OA 1OMDA 3VRNA 2LANA 3VRPA 1QVIY 1SR6B 1G4YR 1TNQA 2K7BA 5KU1A 2WORA 3NXAA 4GGFA 1AP4A 2I18A 4U8DA 3VROA 3C1VA 1FF1A 2LV7A 1KK8C 2JOJA 1FPWA 3WNXB 2BBMA 1MR8A 1S5GZ 3FIAA 1ALVA 1TCOB 3VGOA 1TCFA 2KGRA 2KGBC 1K93D 1QX5B 1M31A 2KDHA 2M8UA 1ODBA 1EH2A 4XJKB 2KAYA 3NSKA 1Q80A 4CLNA 1NPQA 1M63B 3CLNA 4ZCVA 4C0KA 2M3WA 1U5IB 3BOWA 4MN0A 2JNXA 2KOTA 4XJKA 1S6CA 2Y5IA 5I2OA 1BMOA 2KQ6A 4DUQA 1SR6C 5AANA 1N65A 1QIWA 3EK4A 4OKHA 4M2PA 4OVNF 1U5IA 4YGBB 3GK2A 2K7OA 1JF0A 2F8PA 2LMTA 1KFUS 5CSJA 1IH0A 1JC2A 2ZKMX 2KI4B 2LAPA 3HCMA 1SYMA 1WDCC 5TNCA 4IL1A 1CDPA 4GAOA 2MJWB 1WLMA 4F0ZB 2CCMA 5CSFA 5AEQA 1BG1A 3EVVA 1EL4A 1YTZC 2EC6B 3NSOA 1H4BA 5D69A 1EG3A 2KI6C 1S36A 1B1GA 2O5GA 1F71A 3PFVA 5JJGA 1BR1B 2BKIB 1TNPA 1BODA 2RGIA 4NQGA 1ZMZA 2JT0A 2BE6A 3GK1A 2OTGC 5AXIA 2E6WA 2FCDA 4PE1A 3WHTB 1XA5A 1N0YA 1YUTA 4GNKB 3SG2A 4AOMA 1LKJA 3DVJA 1JFJA 1AJ5A 4DS7A 2TN4A 5KTYA 2OS8B 1M39A 2NZ0A 4PHNA 2MAZA 1K90D 1K8UA 2MBXA 1UUSA 2LHIA 3DVMA 3FS7A 2KI4C 4CPVA 1BJFA 2BECA 5HYDA 1HQVA 1NCZA 4OCIA 3SG4A 3SIBA 2F2OA 2I2RE 1DGUA 1UHKA 3BQ3A 3D0YA 1J55A 1AVSA 1S26D 1K96A 5HKYA 2CT9A 1UURA 2M7LA 4PE4A 2AAOA 2F2PA 3SJSA 1MHOA 1DF0A 1PVBA 1YVHA 2PSRA 1Y0VH 4MLWA 1BR4B 2LLUA 3DF0A 1FI5A 1XFVO 2L50A 1PRWA 2M97A 1RFJA 4YGAA 1XFXO 1GGZA 1G8IA 3DD4A 1KQVA 1R2UA 1UWOA 3RLZA 5DKNA 1CDNA 1FI6A 1RECA 2CNPA 1A2XA 3VRQA 2KYCA 3BUMB 1K94A 4GFTA 1UHIA 3A4UB 3CR2A 1IQ3A 2JU0A 2M1UA 1A4PA 1J1EA 3EK8A 4ORBB 1GJYA 2ZNEA 1AK8A 1KWOC 1CM4A 1NX0A 2CXJA 4ETOA 1TNXA 1BF5A 1G33A 5JOLA 4I5JA 2I94A 2PALA 1CM1A 1S6JA 5CSIA 2BE4A 1RWYA 1D1OA 1UHNA 3O2PA 5K89A 2LE9B 5KSZA 2BBNA 2FCEA 2JC2A 3OX5A 1IWQA 1MUXA 1SY9A 3GOFA 4DRWA 2G2BA 2WCEA 3TS5C 4YI8A 4JQ0D 4QJ5B 1CFPA 1M45A 3MSEB 1AUIB 2NLNA 1SCMC 2MLEC 3PALA 2KBMA 5HKZA 3CS1A 2BKHB 5B8IB 1YURA 1IJ6A 2M0RA 1HT9A 1DJWA 1KQMC 2F3YA 1JFKA 3CR4X 3FWBA 5ER5A 3TUYB 3F45A 5CPVA 1WDCB 1WRKA 3NSIA 2K61A 2EHBA 3CWGA 4JWQA 4BY5A 1L2OC 1SCVA 1MQ1A 4AQIA 1B7TY 1WRLA 1DJYA 1MF8B 1WY9A 1MWNA 1CFCA 1ZOTB 2FJUB 1Y6WA 4GUKA 1K9KA 2R2IA 2KSPA 4OR9B 3K21A 3EKJA 1LINA 4MSPA 1XO5A 2LLTA 4HRHA 1KK7Y 1LA0A 2E30A 3LK0A 4NDBA 3O6BA 2H61C 3ICBA 2IS9A 2OTGB 1FW4A 2JT8A 4MVFA 4ORAB 1QV0A 2DOQA 2G9BA 4MRXA 3I5HC 4CFQA 2KHNA 4MBEA 1TOPA 3D10A 3CTNA 1KCYA 2O60A 4PHKA 1NCYA 1IJ5A 1IRJA 4GPLB 2KQYA 2L98A 2LUCA 1J7QA 3TZ1A 3A8RA 3TUYC 2LC5A 2MA2A 4DIRA 1DT7B 3ZNIA 3LK1A 4GGFC 1R6PA 1J7PA 1YRUB 5BPJA 1Y1XA 1V1FA 4PE7A 5CSNA 1JBAA 4MRYA 1DGVA 1NIWA 2OPOA 4R1EA 3O78A 1SL7A 1C7VA 2L2EA 2L51A 1CMGA 5I2QA 2JTTA 2P6BB 1QASA 4MZKA 1JF2A 1GGWA 2Q91A 1CFFA 3JTDC 4USLA 4YGDB 1SBJA 2Q4UA 4UPGA 2LMVA 2JQ6A 1DJGA 1B8LA 1SL8A 1RJVA 2GGZA 3AAKA 4XYNA 1ZACA 1TIZA 1B8CA 1SRAA 1S5GY 1PK0D 3QRXA 2BL0C 1CDLA 4AQJA 1CDMA 1KWOB 1KSOA 2HQ8A 3PN7B 3I5IC 4ORCB 1TRFA 5GQQC 1OE9B 2HETA 1LA3A 3VRRA 1MXEA 1J1DA 2SCPA 4JPZB 1CTRA 4FTGA 1B4CA 1KSMA 1QVIZ 1W7IB 2MHHA 3PLFB 2WCBA 3TS5B 1JWDA 1DJXA 1QIVA 1Y1AA 1NYAA 1S6IA 1XK4C 1JUOA 1SCMB 1J7RA 2GV5A 1F54A 2FOTA 4PHMA 3AKBA 2ZFDA 3O4YA 2BCAA 3BUWB 1F4QA 3KHEA 1TN4A 1KQMB 1OOJA 4YBHB 1NX2A 1A75B 3ZWHA 3KEVA 3GK4X 1BLQA 1OQPA 3OB1B 3AKAA 5HKWA 4PALA 1MXLC 4PDZA 1KFUL 3BXKA 3PN7C 1A03A 1L2OB 1YX8A 4ICBA 4Q04A 3CZTX 5AERA 3HX4A 1NUBA 4N1GA 3KO0A 1F55A 2JZIA 1OMRA 3EK7A 1UHHA 1CLLA 1BU3A 4YI9A 3BUOB 4NDDA 1BOCA 2KFFA 3OP0A 4A4CA 4CIDA 2AMIA 2KAVA 1CLBA 2WOSA 4I5NB 1WLZA 4C0LA 4L9MA 1N2DA 2HQWA 3I5HB 4PCWA 1PULA 2NCOA 1DJZA 4NDCA 1QTXA 1EG4A 1QXPA 1WRZA 5PALA 1QS7A 5IBWA 1NP8A 1TNWA 1M46A 1UP5A 4PE0A 1YRTB 1YVLA 5F6TA 2JT3A 3EVUA 2JPTA 2EGDA 2AUCA 1LXFC 2LP2A 2PRUA 1OMVA 3EVRA 2M29A 3FWCA 1X02A 1IGVA 2PVBA 4C0JA 2BCBA 2BCXA 2CTNA 2JXLA 3I5GC 1K9PA 1RROA 2Y1NA 2F33A 4ZCUA 1SK6D 2KI6D 2QACA 1IQ5A 4YGCB 1CKKA 4WRIA 4MZJA 3JTDB 3OHMB 2HPSA 2F3ZA 4P2YB 1KFXL 2LLSA 3BYAA 4OV2A 2M7NA 3BOWB 1YUSA 3IF7A 1CNPA 2BL0B 2K7CA 2M1KB 1B8RA 1CLMA 2ZNDA 3I5IB 2ZRTA 3JVTC 1QATA 2Y1MA 4YGEB 3KPXA 4A4BA 5J3XA 3I5FC 1K2HA 1QX7A 4MEWA 2K2AA 4YRUA 4HRGA 2LM5A 1CMFA 3CR5X 1TTXA 2H2KA 2JWWA 1BT6A 2LMUA 1SNLA 4DCKA 1SPYA 2HF5A 1SL9A 4P5OE 3TDZA 2PASA 2JNFA 1S1EA 1AHRA 2K2FA 1QLSA 3BUNB 3LCPC 5DKQA 1UHJA 1A29A 2WCFA 4I5LB 3SG5A 1DJHA 1VRKA 3IQQA 1XFYO 2A4JA 2LVVA 4WQ3A 1DMOA 1XFUO 5I8NA 4I5KA 4BY4A 2KFHA 3M0WA 4TNCA 5G08A 1LVCD 1PVAA 2COLB 4D1EA 1XK4A 3DVEA 2KBIA 1NWDA 4GBAA 1CFDA 3LLEA 4CFRA 3AAJA 1DVIA 3PSRA 1E8AA 2L4HA 2L4IA 2K8MB 1W7JB 3DVKA 1XYDA 1YX7A 1C7WA 2M49B 1NCXA 2L5XB 2LVJA 3PATA 2Y4QA 3RM1A 2ZRSA 2LUXA 2SASA 2JXCA 2NXQA 3H4SE 3D0YB 1PSBA 1F4OA 2JULA 2LCPA 2LNKA 3EKHA 1ALWA 3SG7A 1EXRA 2LVKA 4QJ4B 3E3RA 1DF0B 2KFGA 3SIAA 3DF0B 4M2QA 4MZLA 1NX3A 1OSAA 2K0JA 1B9AA 2V53A 4E68A 1QX2A 1B7TZ 2EC6C 2NCPA 5HLOA 1NX1A 2ISDA 1JSAA 3IQOA 1OZSA 1F70A 3KF9A 1EJ3A
chains in the Genus database with same CATH superfamily
1C07A 1QLKA 1ORGA 1SMGA 2MLFC 3PM2A 4GGNA 4HSZA 1YR5A 2KNEA 4INXA 2B1UA 1A75A 4FQOA 3CGAA 3PALA 4QJ3B 3WHUB 4WQ2A 2D8NA 1KK7Z 1GQMA 1AJ4A 2PMYA 3OX6A 4N5XA 1QJTA 1K9UA 1ZUZA 2M9GA 3BFAA 4N1FA 1KFXS 1ZFSA 1RTP1 1DJIA 3I5GB 1S3PA 2ZN8A 2QPTA 1IG5A 3TDIA 3WXAA 1IKUA 1PSRA 2OS8C 2LP3A 2KYFA 2JTZA 1XVJA 1TUZA 2WC8A 1NSHA 1J7OA 2VRGA 1KK8B 1TUJA 2I7AA 3PJIA 3SG6A 1FBVA 2LVIA 2CBLA 2K7DA 5FYXA 5I2LA 1B47A 1PALA 1XFWO 1H8BA 4PHJA 1RK9A 3TDUA 3OB2B 1OZOA 1F8HA 5HLVA 2H61A 5ER4X 3LL8B 3NHIA 1K95A 2L0PA 3PM8A 1YUUA 5D7FA 2WNDA 2GGMA 3NSLA 4HREE 4PT1A 1DTLA 1SW8A 2KAXA 2L2CA 4IJ7A 1CB1A 3BUXB 2LHLA 5AFPA 3JVTB 2JRFA 2MRDA 3I5FB 3SG3A 1L7ZA 1Y1UA 1XFZO 5DKRA 3UNWA 3R72A 1SKTA 1V1GA 2BNXA 2ZN9A 1QV1A 4M2OA 1OMDA 4KYNA 3V2LA 3VRNA 2LANA 3VRPA 1QVIY 1SR6B 4OZDA 1G4YR 1TNQA 2K7BA 5KU1A 2WORA 3NXAA 2QEBA 3QMEA 2I18A 4GGFA 4U8DA 1AP4A 3VROA 3C1VA 1FF1A 2LV7A 1KK8C 1CNPA 2JOJA 1FPWA 3WNXB 2BBMA 1MR8A 2WCMA 1S5GZ 3FIAA 1ALVA 1TCOB 1P28A 1OOIX 3VGOA 3D77A 1TCFA 2KGRA 3L4LA 2KGBC 1K93D 1QX5B 1M31A 2KLEA 2KDHA 2M8UA 1ODBA 1EH2A 4XJKB 2KAYA 3NSKA 1Q80A 2YGUA 3NHTA 4CLNA 1Z4HA 1NPQA 1M63B 3CLNA 4ZCVA 4C0KA 2M3WA 3R1PA 4INWA 1U5IB 3BOWA 3OGNA 3S0GA 4MN0A 2JNXA 2KOTA 4XJKA 1S6CA 2Y5IA 5I2OA 1BMOA 2KQ6A 4DUQA 1SR6C 5AANA 1IIOA 1N65A 1QIWA 3EK4A 4OKHA 2PQLA 3RZSA 4M2PA 4OVNF 1U5IA 4YGBB 3GK2A 2K7OA 1JF0A 2F8PA 2LMTA 1KFUS 3DXLA 3CDNA 5CSJA 1JC2A 1IH0A 2ZKMX 2KI4B 2LAPA 3HCMA 1SYMA 1WDCC 1XFRA 4IL1A 5FI6A 1CDPA 5TNCA 2WCHA 4GAOA 2MJWB 1WLMA 4F0ZB 2CCMA 5CSFA 3O4XA 1W9ZA 5AEQA 1BG1A 3EVVA 1EL4A 1YTZC 2EC6B 2P71A 3FE6A 3NSOA 5D69A 1EG3A 2KI6C 1H4BA 1S36A 1B1GA 2O5GA 1F71A 3PFVA 5JJGA 1BR1B 2BKIB 1TNPA 1BODA 1OW4A 2RGIA 4NQGA 1ZMZA 2JT0A 2BE6A 3GK1A 2OTGC 5AXIA 2E6WA 2FCDA 4PE1A 3WHTB 2QDIA 1XA5A 3FE8A 1N0YA 3L4AA 1YUTA 4GNKB 3SG2A 1DEKA 4AOMA 1LKJA 3DVJA 1JFJA 1AJ5A 4DS7A 2TN4A 5KTYA 2GTEA 2OS8B 1M39A 2NZ0A 4PHNA 2MAZA 1K90D 1K8UA 2MBXA 1UUSA 2LHIA 3DVMA 3FS7A 2KI4C 4CPVA 1BJFA 2BECA 5HYDA 1HQVA 1NCZA 4OCIA 3SG4A 3SIBA 2F2OA 2I2RE 1DGUA 1UHKA 3BQ3A 3D0YA 1J55A 1AVSA 1S26D 1K96A 5HKYA 2CT9A 1UURA 2M7LA 4PE4A 2AAOA 2F2PA 3B7AA 3SJSA 1MHOA 1DF0A 1PVBA 1YVHA 2PSRA 1Y0VH 4MLWA 1BR4B 2LLUA 3DF0A 1FI5A 1XFVO 2L50A 1PRWA 2M97A 1RFJA 4YGAA 3S0AA 1XFXO 1GGZA 5EL2A 1G8IA 3DD4A 1KQVA 1R2UA 1UWOA 3RLZA 5DKNA 1CDNA 1FI6A 1RECA 2CNPA 1A2XA 3VRQA 2K60A 2KYCA 3BUMB 1K94A 4GFTA 3S0EA 1UHIA 3A4UB 3CR2A 1IQ3A 2JU0A 2M1UA 1A4PA 1J1EA 3EK8A 4ORBB 1GJYA 2ZNEA 1AK8A 1KWOC 1CM4A 1NX0A 2CXJA 4ETOA 1TNXA 1BF5A 1G33A 5JOLA 4I5JA 1SSEB 2I94A 2PALA 1CM1A 1S6JA 5CSIA 2BE4A 1RWYA 1D1OA 1UHNA 3O2PA 5K89A 2LE9B 5KSZA 2BBNA 2FCEA 2JC2A 3OX5A 1IWQA 1MUXA 1SY9A 3GOFA 4DRWA 2G2BA 2WCEA 3TS5C 4YI8A 2QEHA 2WC5A 4JQ0D 4QJ5B 1CFPA 1M45A 3D75A 3MSEB 1AUIB 2NLNA 1SCMC 2MLEC 3IVTA 2KBMA 3N7HA 3CS1A 2BKHB 3D78A 5HKZA 5B8IB 1C3YA 1YURA 1IJ6A 1Z2CB 1HT9A 1DJWA 2M0RA 3CZ2A 1KQMC 2F3YA 3BJHA 1JFKA 3CR4X 3FWBA 5ER5A 3D73A 3TUYB 3F45A 5CPVA 1WDCB 1OOFA 1WRKA 3NSIA 2K61A 2EHBA 3CWGA 3DYEA 4JWQA 3VB1A 4BY5A 1L2OC 1SCVA 1MQ1A 4AQIA 1B7TY 1WRLA 1DJYA 1MF8B 1WY9A 1MWNA 1CFCA 1GM0A 1ZOTB 2FJUB 1Y6WA 4GUKA 1K9KA 2R2IA 2KSPA 4OR9B 3K21A 3EKJA 1LINA 4MSPA 2WCKA 1XO5A 2LLTA 4HRHA 1KK7Y 1LA0A 2E30A 3LK0A 4NDBA 3O6BA 2H61C 3ICBA 2IS9A 2OTGB 1FW4A 2JT8A 3Q8IA 4MVFA 4ORAB 1QV0A 2DOQA 2G9BA 4MRXA 3I5HC 4CFQA 2KHNA 4MBEA 4JD9A 3B88A 1LS8A 3OBVA 1TOPA 3D10A 3CTNA 1KCYA 2O60A 4PHKA 1NCYA 1IJ5A 1IRJA 4GPLB 2KQYA 2L98A 2LUCA 1J7QA 2P70A 3A8RA 3TZ1A 3TUYC 2LC5A 2MA2A 4DIRA 1DT7B 3ZNIA 3LK1A 4GGFC 1R6PA 1J7PA 1YRUB 5BPJA 1Y1XA 1V1FA 4PE7A 3BFHA 5CSNA 1JBAA 4MRYA 1DGVA 1NIWA 2OPOA 4R1EA 3O78A 1SL7A 3R1VA 1C7VA 2L2EA 1DQEA 2L51A 1CMGA 5I2QA 2JTTA 2P6BB 1QASA 4MZKA 1JF2A 5FI2A 1GGWA 2Q91A 1CFFA 3FE9A 3JTDC 4USLA 4YGDB 1SBJA 2Q4UA 4UPGA 2LMVA 2JQ6A 1DJGA 1B8LA 1SL8A 1RJVA 2GGZA 3AAKA 4XYNA 1ZACA 1OOHA 1TIZA 3SS5A 1B8CA 1SRAA 1S5GY 1PK0D 3QRXA 2BL0C 1CDLA 4AQJA 1CDMA 1KWOB 1KSOA 1DELA 2HQ8A 3PN7B 3I5IC 4ORCB 1TRFA 5GQQC 1OE9B 2HETA 1LA3A 3DY9A 3VRRA 1MXEA 1J1DA 2SCPA 4JPZB 1CTRA 3B6XA 4FTGA 1B4CA 1KSMA 1QVIZ 1DC1A 1W7IB 2MHHA 1QWVA 2WCBA 3PLFB 3TS5B 4F7FA 1DJXA 1QIVA 1JWDA 1Y1AA 1NYAA 1S6IA 1XK4C 3SS3A 1JUOA 1SCMB 1J7RA 2GV5A 1F54A 2FOTA 4PHMA 3AKBA 2ZFDA 3O4YA 2BCAA 3BUWB 1F4QA 3KHEA 1TN4A 1KQMB 1OOJA 4YBHB 1NX2A 1A75B 2KLDA 3KEVA 3ZWHA 3GK4X 1BLQA 1OQPA 3OB1B 3AKAA 5HKWA 4PALA 1MXLC 4PDZA 1KFUL 3BXKA 3PN7C 2BAPA 1A03A 1L2OB 1YX8A 4ICBA 4Q04A 3CZTX 5AERA 3HX4A 1NUBA 4N1GA 3KO0A 1F55A 2JZIA 1OMRA 3EK7A 2WCLA 3K1EA 1UHHA 1CLLA 1BU3A 4YI9A 3BUOB 4NDDA 1BOCA 2KFFA 3OP0A 4A4CA 3BFBA 4CIDA 2AMIA 2KAVA 1CLBA 2WOSA 4I5NB 4JKTA 1WLZA 4C0LA 4L9MA 1N2DA 2HQWA 3CZ1A 2PYQA 3I5HB 4PCWA 1PULA 2NCOA 1DJZA 4NDCA 1QTXA 1EG4A 1QXPA 1WRZA 5PALA 3CZ0A 1QS7A 5IBWA 1NP8A 1TNWA 1M46A 1UP5A 4PE0A 1YRTB 1YVLA 5F6TA 2JT3A 3EVUA 2L5YA 2JPTA 2EGDA 2AUCA 1LXFC 2LP2A 4FQTA 3D74A 2PRUA 1OMVA 3EVRA 2M29A 3FWCA 1X02A 3S0FA 5D3OA 1IGVA 2PVBA 4C0JA 2BCBA 2BCXA 2CTNA 2JXLA 3I5GC 1K9PA 1RROA 2Y1NA 2KPHA 2F33A 4ZCUA 1SK6D 2KI6D 2QACA 1IQ5A 4YGCB 1CKKA 4WRIA 4MZJA 3JTDB 2JPOA 3S0BA 3OHMB 2HPSA 2F3ZA 4P2YB 3B87A 5FI7A 3D76A 1KFXL 2LLSA 3BYAA 3NGVA 3R1OA 2M7NA 3BOWB 1YUSA 3IF7A 4OV2A 3UO9A 2BL0B 2K7CA 2M1KB 1B8RA 3SS4A 3S0DA 1CLMA 2H8VA 2ZNDA 3I5IB 2ZRTA 2QEVA 3JVTC 1QATA 2Y1MA 4YGEB 3KPXA 4A4BA 5J3XA 3I5FC 1K2HA 1QX7A 4MEWA 2K2AA 4YRUA 4HRGA 2FJYA 2LM5A 1CMFA 3CR5X 1TTXA 3B86A 2H2KA 2JWWA 1BT6A 2LMUA 3CABA 1SNLA 4DCKA 1SPYA 2HF5A 1SL9A 4P5OE 3TDZA 2PASA 1OOGA 2JNFA 1S1EA 1AHRA 2K2FA 1QLSA 3BUNB 3LCPC 5DKQA 1UHJA 1A29A 2WCFA 4I5LB 3SG5A 1DJHA 1VRKA 3IQQA 1XFYO 5I94A 2A4JA 2LVVA 4WQ3A 1DMOA 1XFUO 5I8NA 3EG5B 3L47A 4I5KA 4BY4A 2KFHA 3M0WA 2ERBA 4TNCA 5G08A 1LVCD 1PVAA 2COLB 4D1EA 1XK4A 3DVEA 2KBIA 1NWDA 4GBAA 1CFDA 3LLEA 4CFRA 3AAJA 1DVIA 3PSRA 1E8AA 2L4HA 2L4IA 2K8MB 1W7JB 3DVKA 1XYDA 1YX7A 1C7WA 2M49B 2WCJA 2WC6A 1NCXA 2L5XB 2LVJA 3PATA 2Y4QA 3RM1A 2ZRSA 2LUXA 2SASA 5DICA 2JXCA 2NXQA 3H4SE 3D0YB 1PSBA 1F4OA 1T14A 2JULA 2LCPA 2LNKA 3EKHA 1ALWA 5HL1A 3CYZA 3SG7A 1EXRA 2QEOA 1C3ZA 2LVKA 4QJ4B 3E3RA 1DF0B 2KFGA 3SIAA 1TWOA 3DF0B 4M2QA 4MZLA 1NX3A 1OSAA 2K0JA 1B9AA 2V53A 4E68A 1QX2A 1B7TZ 2EC6C 2NCPA 3DZTA 1NX1A 5HLOA 2ISDA 1JSAA 3IQOA 1OZSA 1F70A 3KF9A 1EJ3A
chains in the Genus database with same CATH topology
1C07A 1QLKA 1SMGA 2MLFC 4GGNA 4HSZA 1YR5A 2KNEA 2B1UA 1A75A 4FQOA 3CGAA 4QJ3B 3WHUB 4WQ2A 2D8NA 1KK7Z 1GQMA 1AJ4A 2PMYA 3OX6A 4N5XA 1QJTA 1K9UA 1ZUZA 2M9GA 4N1FA 1KFXS 1ZFSA 1RTP1 1DJIA 3I5GB 1S3PA 2ZN8A 2QPTA 1IG5A 3TDIA 3WXAA 1IKUA 1PSRA 2OS8C 2LP3A 2KYFA 2JTZA 1XVJA 2WC8A 1J7OA 1NSHA 2VRGA 1KK8B 2I7AA 3SG6A 1FBVA 2LVIA 2CBLA 2K7DA 5FYXA 5I2LA 1B47A 1PALA 1XFWO 1H8BA 4PHJA 1RK9A 3TDUA 3OB2B 1OZOA 1F8HA 5HLVA 2H61A 5ER4X 3LL8B 1K95A 2L0PA 3PM8A 1YUUA 5D7FA 2WNDA 2GGMA 3NSLA 4HREE 1DTLA 1SW8A 2KAXA 1CB1A 3BUXB 2LHLA 5AFPA 3JVTB 2JRFA 2MRDA 3I5FB 3SG3A 1L7ZA 1Y1UA 1XFZO 5DKRA 1SKTA 1V1GA 2ZN9A 1QV1A 4M2OA 1OMDA 3VRNA 2LANA 3VRPA 1QVIY 1SR6B 1G4YR 1TNQA 2K7BA 5KU1A 2WORA 3NXAA 4GGFA 1AP4A 2I18A 4U8DA 3VROA 3C1VA 1FF1A 2LV7A 1KK8C 2JOJA 1FPWA 3WNXB 2BBMA 1MR8A 1S5GZ 3FIAA 1ALVA 1TCOB 3VGOA 1TCFA 2KGRA 2KGBC 1K93D 1QX5B 1M31A 2KDHA 2M8UA 1ODBA 1EH2A 4XJKB 2KAYA 3NSKA 1Q80A 4CLNA 1NPQA 1M63B 3CLNA 4ZCVA 4C0KA 2M3WA 1U5IB 3BOWA 4MN0A 2JNXA 2KOTA 4XJKA 1S6CA 2Y5IA 5I2OA 1BMOA 2KQ6A 4DUQA 1SR6C 5AANA 1N65A 1QIWA 3EK4A 4OKHA 4M2PA 4OVNF 1U5IA 4YGBB 3GK2A 2K7OA 1JF0A 2F8PA 2LMTA 1KFUS 5CSJA 1IH0A 1JC2A 2ZKMX 2KI4B 2LAPA 3HCMA 1SYMA 1WDCC 5TNCA 4IL1A 1CDPA 4GAOA 2MJWB 1WLMA 4F0ZB 2CCMA 5CSFA 5AEQA 1BG1A 3EVVA 1EL4A 1YTZC 2EC6B 3NSOA 1H4BA 5D69A 1EG3A 2KI6C 1S36A 1B1GA 2O5GA 1F71A 3PFVA 5JJGA 1BR1B 2BKIB 1TNPA 1BODA 2RGIA 4NQGA 1ZMZA 2JT0A 2BE6A 3GK1A 2OTGC 5AXIA 2E6WA 2FCDA 4PE1A 3WHTB 1XA5A 1N0YA 1YUTA 4GNKB 3SG2A 4AOMA 1LKJA 3DVJA 1JFJA 1AJ5A 4DS7A 2TN4A 5KTYA 2OS8B 1M39A 2NZ0A 4PHNA 2MAZA 1K90D 1K8UA 2MBXA 1UUSA 2LHIA 3DVMA 3FS7A 2KI4C 4CPVA 1BJFA 2BECA 5HYDA 1HQVA 1NCZA 4OCIA 3SG4A 3SIBA 2F2OA 2I2RE 1DGUA 1UHKA 3BQ3A 3D0YA 1J55A 1AVSA 1S26D 1K96A 5HKYA 2CT9A 1UURA 2M7LA 4PE4A 2AAOA 2F2PA 3SJSA 1MHOA 1DF0A 1PVBA 1YVHA 2PSRA 1Y0VH 4MLWA 1BR4B 2LLUA 3DF0A 1FI5A 1XFVO 2L50A 1PRWA 2M97A 1RFJA 4YGAA 1XFXO 1GGZA 1G8IA 3DD4A 1KQVA 1R2UA 1UWOA 3RLZA 5DKNA 1CDNA 1FI6A 1RECA 2CNPA 1A2XA 3VRQA 2KYCA 3BUMB 1K94A 4GFTA 1UHIA 3A4UB 3CR2A 1IQ3A 2JU0A 2M1UA 1A4PA 1J1EA 3EK8A 4ORBB 1GJYA 2ZNEA 1AK8A 1KWOC 1CM4A 1NX0A 2CXJA 4ETOA 1TNXA 1BF5A 1G33A 5JOLA 4I5JA 2I94A 2PALA 1CM1A 1S6JA 5CSIA 2BE4A 1RWYA 1D1OA 1UHNA 3O2PA 5K89A 2LE9B 5KSZA 2BBNA 2FCEA 2JC2A 3OX5A 1IWQA 1MUXA 1SY9A 3GOFA 4DRWA 2G2BA 2WCEA 3TS5C 4YI8A 4JQ0D 4QJ5B 1CFPA 1M45A 3MSEB 1AUIB 2NLNA 1SCMC 2MLEC 3PALA 2KBMA 5HKZA 3CS1A 2BKHB 5B8IB 1YURA 1IJ6A 2M0RA 1HT9A 1DJWA 1KQMC 2F3YA 1JFKA 3CR4X 3FWBA 5ER5A 3TUYB 3F45A 5CPVA 1WDCB 1WRKA 3NSIA 2K61A 2EHBA 3CWGA 4JWQA 4BY5A 1L2OC 1SCVA 1MQ1A 4AQIA 1B7TY 1WRLA 1DJYA 1MF8B 1WY9A 1MWNA 1CFCA 1ZOTB 2FJUB 1Y6WA 4GUKA 1K9KA 2R2IA 2KSPA 4OR9B 3K21A 3EKJA 1LINA 4MSPA 1XO5A 2LLTA 4HRHA 1KK7Y 1LA0A 2E30A 3LK0A 4NDBA 3O6BA 2H61C 3ICBA 2IS9A 2OTGB 1FW4A 2JT8A 4MVFA 4ORAB 1QV0A 2DOQA 2G9BA 4MRXA 3I5HC 4CFQA 2KHNA 4MBEA 1TOPA 3D10A 3CTNA 1KCYA 2O60A 4PHKA 1NCYA 1IJ5A 1IRJA 4GPLB 2KQYA 2L98A 2LUCA 1J7QA 3TZ1A 3A8RA 3TUYC 2LC5A 2MA2A 4DIRA 1DT7B 3ZNIA 3LK1A 4GGFC 1R6PA 1J7PA 1YRUB 5BPJA 1Y1XA 1V1FA 4PE7A 5CSNA 1JBAA 4MRYA 1DGVA 1NIWA 2OPOA 4R1EA 3O78A 1SL7A 1C7VA 2L2EA 2L51A 1CMGA 5I2QA 2JTTA 2P6BB 1QASA 4MZKA 1JF2A 1GGWA 2Q91A 1CFFA 3JTDC 4USLA 4YGDB 1SBJA 2Q4UA 4UPGA 2LMVA 2JQ6A 1DJGA 1B8LA 1SL8A 1RJVA 2GGZA 3AAKA 4XYNA 1ZACA 1TIZA 1B8CA 1SRAA 1S5GY 1PK0D 3QRXA 2BL0C 1CDLA 4AQJA 1CDMA 1KWOB 1KSOA 2HQ8A 3PN7B 3I5IC 4ORCB 1TRFA 5GQQC 1OE9B 2HETA 1LA3A 3VRRA 1MXEA 1J1DA 2SCPA 4JPZB 1CTRA 4FTGA 1B4CA 1KSMA 1QVIZ 1W7IB 2MHHA 3PLFB 2WCBA 3TS5B 1JWDA 1DJXA 1QIVA 1Y1AA 1NYAA 1S6IA 1XK4C 1JUOA 1SCMB 1J7RA 2GV5A 1F54A 2FOTA 4PHMA 3AKBA 2ZFDA 3O4YA 2BCAA 3BUWB 1F4QA 3KHEA 1TN4A 1KQMB 1OOJA 4YBHB 1NX2A 1A75B 3ZWHA 3KEVA 3GK4X 1BLQA 1OQPA 3OB1B 3AKAA 5HKWA 4PALA 1MXLC 4PDZA 1KFUL 3BXKA 3PN7C 1A03A 1L2OB 1YX8A 4ICBA 4Q04A 3CZTX 5AERA 3HX4A 1NUBA 4N1GA 3KO0A 1F55A 2JZIA 1OMRA 3EK7A 1UHHA 1CLLA 1BU3A 4YI9A 3BUOB 4NDDA 1BOCA 2KFFA 3OP0A 4A4CA 4CIDA 2AMIA 2KAVA 1CLBA 2WOSA 4I5NB 1WLZA 4C0LA 4L9MA 1N2DA 2HQWA 3I5HB 4PCWA 1PULA 2NCOA 1DJZA 4NDCA 1QTXA 1EG4A 1QXPA 1WRZA 5PALA 1QS7A 5IBWA 1NP8A 1TNWA 1M46A 1UP5A 4PE0A 1YRTB 1YVLA 5F6TA 2JT3A 3EVUA 2JPTA 2EGDA 2AUCA 1LXFC 2LP2A 2PRUA 1OMVA 3EVRA 2M29A 3FWCA 1X02A 1IGVA 2PVBA 4C0JA 2BCBA 2BCXA 2CTNA 2JXLA 3I5GC 1K9PA 1RROA 2Y1NA 2F33A 4ZCUA 1SK6D 2KI6D 2QACA 1IQ5A 4YGCB 1CKKA 4WRIA 4MZJA 3JTDB 3OHMB 2HPSA 2F3ZA 4P2YB 1KFXL 2LLSA 3BYAA 4OV2A 2M7NA 3BOWB 1YUSA 3IF7A 1CNPA 2BL0B 2K7CA 2M1KB 1B8RA 1CLMA 2ZNDA 3I5IB 2ZRTA 3JVTC 1QATA 2Y1MA 4YGEB 3KPXA 4A4BA 5J3XA 3I5FC 1K2HA 1QX7A 4MEWA 2K2AA 4YRUA 4HRGA 2LM5A 1CMFA 3CR5X 1TTXA 2H2KA 2JWWA 1BT6A 2LMUA 1SNLA 4DCKA 1SPYA 2HF5A 1SL9A 4P5OE 3TDZA 2PASA 2JNFA 1S1EA 1AHRA 2K2FA 1QLSA 3BUNB 3LCPC 5DKQA 1UHJA 1A29A 2WCFA 4I5LB 3SG5A 1DJHA 1VRKA 3IQQA 1XFYO 2A4JA 2LVVA 4WQ3A 1DMOA 1XFUO 5I8NA 4I5KA 4BY4A 2KFHA 3M0WA 4TNCA 5G08A 1LVCD 1PVAA 2COLB 4D1EA 1XK4A 3DVEA 2KBIA 1NWDA 4GBAA 1CFDA 3LLEA 4CFRA 3AAJA 1DVIA 3PSRA 1E8AA 2L4HA 2L4IA 2K8MB 1W7JB 3DVKA 1XYDA 1YX7A 1C7WA 2M49B 1NCXA 2L5XB 2LVJA 3PATA 2Y4QA 3RM1A 2ZRSA 2LUXA 2SASA 2JXCA 2NXQA 3H4SE 3D0YB 1PSBA 1F4OA 2JULA 2LCPA 2LNKA 3EKHA 1ALWA 3SG7A 1EXRA 2LVKA 4QJ4B 3E3RA 1DF0B 2KFGA 3SIAA 3DF0B 4M2QA 4MZLA 1NX3A 1OSAA 2K0JA 1B9AA 2V53A 4E68A 1QX2A 1B7TZ 2EC6C 2NCPA 5HLOA 1NX1A 2ISDA 1JSAA 3IQOA 1OZSA 1F70A 3KF9A 1EJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C07 A;  1QLK A;  1SMG A;  2MLF C;  4GGN A;  4HSZ A;  1YR5 A;  2KNE A;  2B1U A;  1A75 A;  4FQO A;  3CGA A;  4QJ3 B;  3WHU B;  4WQ2 A;  2D8N A;  1KK7 Z;  1GQM A;  1AJ4 A;  2PMY A;  3OX6 A;  4N5X A;  1QJT A;  1K9U A;  1ZUZ A;  2M9G A;  4N1F A;  1KFX S;  1ZFS A;  1RTP 1;  1DJI A;  3I5G B;  1S3P A;  2ZN8 A;  2QPT A;  1IG5 A;  3TDI A;  3WXA A;  1IKU A;  1PSR A;  2OS8 C;  2LP3 A;  2KYF A;  2JTZ A;  1XVJ A;  2WC8 A;  1J7O A;  1NSH A;  2VRG A;  1KK8 B;  2I7A A;  3SG6 A;  1FBV A;  2LVI A;  2CBL A;  2K7D A;  5FYX A;  5I2L A;  1B47 A;  1PAL A;  1XFW O;  1H8B A;  4PHJ A;  1RK9 A;  3TDU A;  3OB2 B;  1OZO A;  1F8H A;  5HLV A;  2H61 A;  5ER4 X;  3LL8 B;  1K95 A;  2L0P A;  3PM8 A;  1YUU A;  5D7F A;  2WND A;  2GGM A;  3NSL A;  4HRE E;  1DTL A;  1SW8 A;  2KAX A;  1CB1 A;  3BUX B;  2LHL A;  5AFP A;  3JVT B;  2JRF A;  2MRD A;  3I5F B;  3SG3 A;  1L7Z A;  1Y1U A;  1XFZ O;  5DKR A;  1SKT A;  1V1G A;  2ZN9 A;  1QV1 A;  4M2O A;  1OMD A;  3VRN A;  2LAN A;  3VRP A;  1QVI Y;  1SR6 B;  1G4Y R;  1TNQ A;  2K7B A;  5KU1 A;  2WOR A;  3NXA A;  4GGF A;  1AP4 A;  2I18 A;  4U8D A;  3VRO A;  3C1V A;  1FF1 A;  2LV7 A;  1KK8 C;  2JOJ A;  1FPW A;  3WNX B;  2BBM A;  1MR8 A;  1S5G Z;  3FIA A;  1ALV A;  1TCO B;  3VGO A;  1TCF A;  2KGR A;  2KGB C;  1K93 D;  1QX5 B;  1M31 A;  2KDH A;  2M8U A;  1ODB A;  1EH2 A;  4XJK B;  2KAY A;  3NSK A;  1Q80 A;  4CLN A;  1NPQ A;  1M63 B;  3CLN A;  4ZCV A;  4C0K A;  2M3W A;  1U5I B;  3BOW A;  4MN0 A;  2JNX A;  2KOT A;  4XJK A;  1S6C A;  2Y5I A;  5I2O A;  1BMO A;  2KQ6 A;  4DUQ A;  1SR6 C;  5AAN A;  1N65 A;  1QIW A;  3EK4 A;  4OKH A;  4M2P A;  4OVN F;  1U5I A;  4YGB B;  3GK2 A;  2K7O A;  1JF0 A;  2F8P A;  2LMT A;  1KFU S;  5CSJ A;  1IH0 A;  1JC2 A;  2ZKM X;  2KI4 B;  2LAP A;  3HCM A;  1SYM A;  1WDC C;  5TNC A;  4IL1 A;  1CDP A;  4GAO A;  2MJW B;  1WLM A;  4F0Z B;  2CCM A;  5CSF A;  5AEQ A;  1BG1 A;  3EVV A;  1EL4 A;  1YTZ C;  2EC6 B;  3NSO A;  1H4B A;  5D69 A;  1EG3 A;  2KI6 C;  1S36 A;  1B1G A;  2O5G A;  1F71 A;  3PFV A;  5JJG A;  1BR1 B;  2BKI B;  1TNP A;  1BOD A;  2RGI A;  4NQG A;  1ZMZ A;  2JT0 A;  2BE6 A;  3GK1 A;  2OTG C;  5AXI A;  2E6W A;  2FCD A;  4PE1 A;  3WHT B;  1XA5 A;  1N0Y A;  1YUT A;  4GNK B;  3SG2 A;  4AOM A;  1LKJ A;  3DVJ A;  1JFJ A;  1AJ5 A;  4DS7 A;  2TN4 A;  5KTY A;  2OS8 B;  1M39 A;  2NZ0 A;  4PHN A;  2MAZ A;  1K90 D;  1K8U A;  2MBX A;  1UUS A;  2LHI A;  3DVM A;  3FS7 A;  2KI4 C;  4CPV A;  1BJF A;  2BEC A;  5HYD A;  1HQV A;  1NCZ A;  4OCI A;  3SG4 A;  3SIB A;  2F2O A;  2I2R E;  1DGU A;  1UHK A;  3BQ3 A;  3D0Y A;  1J55 A;  1AVS A;  1S26 D;  1K96 A;  5HKY A;  2CT9 A;  1UUR A;  2M7L A;  4PE4 A;  2AAO A;  2F2P A;  3SJS A;  1MHO A;  1DF0 A;  1PVB A;  1YVH A;  2PSR A;  1Y0V H;  4MLW A;  1BR4 B;  2LLU A;  3DF0 A;  1FI5 A;  1XFV O;  2L50 A;  1PRW A;  2M97 A;  1RFJ A;  4YGA A;  1XFX O;  1GGZ A;  1G8I A;  3DD4 A;  1KQV A;  1R2U A;  1UWO A;  3RLZ A;  5DKN A;  1CDN A;  1FI6 A;  1REC A;  2CNP A;  1A2X A;  3VRQ A;  2KYC A;  3BUM B;  1K94 A;  4GFT A;  1UHI A;  3A4U B;  3CR2 A;  1IQ3 A;  2JU0 A;  2M1U A;  1A4P A;  1J1E A;  3EK8 A;  4ORB B;  1GJY A;  2ZNE A;  1AK8 A;  1KWO C;  1CM4 A;  1NX0 A;  2CXJ A;  4ETO A;  1TNX A;  1BF5 A;  1G33 A;  5JOL A;  4I5J A;  2I94 A;  2PAL A;  1CM1 A;  1S6J A;  5CSI A;  2BE4 A;  1RWY A;  1D1O A;  1UHN A;  3O2P A;  5K89 A;  2LE9 B;  5KSZ A;  2BBN A;  2FCE A;  2JC2 A;  3OX5 A;  1IWQ A;  1MUX A;  1SY9 A;  3GOF A;  4DRW A;  2G2B A;  2WCE A;  3TS5 C;  4YI8 A;  4JQ0 D;  4QJ5 B;  1CFP A;  1M45 A;  3MSE B;  1AUI B;  2NLN A;  1SCM C;  2MLE C;  3PAL A;  2KBM A;  5HKZ A;  3CS1 A;  2BKH B;  5B8I B;  1YUR A;  1IJ6 A;  2M0R A;  1HT9 A;  1DJW A;  1KQM C;  2F3Y A;  1JFK A;  3CR4 X;  3FWB A;  5ER5 A;  3TUY B;  3F45 A;  5CPV A;  1WDC B;  1WRK A;  3NSI A;  2K61 A;  2EHB A;  3CWG A;  4JWQ A;  4BY5 A;  1L2O C;  1SCV A;  1MQ1 A;  4AQI A;  1B7T Y;  1WRL A;  1DJY A;  1MF8 B;  1WY9 A;  1MWN A;  1CFC A;  1ZOT B;  2FJU B;  1Y6W A;  4GUK A;  1K9K A;  2R2I A;  2KSP A;  4OR9 B;  3K21 A;  3EKJ A;  1LIN A;  4MSP A;  1XO5 A;  2LLT A;  4HRH A;  1KK7 Y;  1LA0 A;  2E30 A;  3LK0 A;  4NDB A;  3O6B A;  2H61 C;  3ICB A;  2IS9 A;  2OTG B;  1FW4 A;  2JT8 A;  4MVF A;  4ORA B;  1QV0 A;  2DOQ A;  2G9B A;  4MRX A;  3I5H C;  4CFQ A;  2KHN A;  4MBE A;  1TOP A;  3D10 A;  3CTN A;  1KCY A;  2O60 A;  4PHK A;  1NCY A;  1IJ5 A;  1IRJ A;  4GPL B;  2KQY A;  2L98 A;  2LUC A;  1J7Q A;  3TZ1 A;  3A8R A;  3TUY C;  2LC5 A;  2MA2 A;  4DIR A;  1DT7 B;  3ZNI A;  3LK1 A;  4GGF C;  1R6P A;  1J7P A;  1YRU B;  5BPJ A;  1Y1X A;  1V1F A;  4PE7 A;  5CSN A;  1JBA A;  4MRY A;  1DGV A;  1NIW A;  2OPO A;  4R1E A;  3O78 A;  1SL7 A;  1C7V A;  2L2E A;  2L51 A;  1CMG A;  5I2Q A;  2JTT A;  2P6B B;  1QAS A;  4MZK A;  1JF2 A;  1GGW A;  2Q91 A;  1CFF A;  3JTD C;  4USL A;  4YGD B;  1SBJ A;  2Q4U A;  4UPG A;  2LMV A;  2JQ6 A;  1DJG A;  1B8L A;  1SL8 A;  1RJV A;  2GGZ A;  3AAK A;  4XYN A;  1ZAC A;  1TIZ A;  1B8C A;  1SRA A;  1S5G Y;  1PK0 D;  3QRX A;  2BL0 C;  1CDL A;  4AQJ A;  1CDM A;  1KWO B;  1KSO A;  2HQ8 A;  3PN7 B;  3I5I C;  4ORC B;  1TRF A;  5GQQ C;  1OE9 B;  2HET A;  1LA3 A;  3VRR A;  1MXE A;  1J1D A;  2SCP A;  4JPZ B;  1CTR A;  4FTG A;  1B4C A;  1KSM A;  1QVI Z;  1W7I B;  2MHH A;  3PLF B;  2WCB A;  3TS5 B;  1JWD A;  1DJX A;  1QIV A;  1Y1A A;  1NYA A;  1S6I A;  1XK4 C;  1JUO A;  1SCM B;  1J7R A;  2GV5 A;  1F54 A;  2FOT A;  4PHM A;  3AKB A;  2ZFD A;  3O4Y A;  2BCA A;  3BUW B;  1F4Q A;  3KHE A;  1TN4 A;  1KQM B;  1OOJ A;  4YBH B;  1NX2 A;  1A75 B;  3ZWH A;  3KEV A;  3GK4 X;  1BLQ A;  1OQP A;  3OB1 B;  3AKA A;  5HKW A;  4PAL A;  1MXL C;  4PDZ A;  1KFU L;  3BXK A;  3PN7 C;  1A03 A;  1L2O B;  1YX8 A;  4ICB A;  4Q04 A;  3CZT X;  5AER A;  3HX4 A;  1NUB A;  4N1G A;  3KO0 A;  1F55 A;  2JZI A;  1OMR A;  3EK7 A;  1UHH A;  1CLL A;  1BU3 A;  4YI9 A;  3BUO B;  4NDD A;  1BOC A;  2KFF A;  3OP0 A;  4A4C A;  4CID A;  2AMI A;  2KAV A;  1CLB A;  2WOS A;  4I5N B;  1WLZ A;  4C0L A;  4L9M A;  1N2D A;  2HQW A;  3I5H B;  4PCW A;  1PUL A;  2NCO A;  1DJZ A;  4NDC A;  1QTX A;  1EG4 A;  1QXP A;  1WRZ A;  5PAL A;  1QS7 A;  5IBW A;  1NP8 A;  1TNW A;  1M46 A;  1UP5 A;  4PE0 A;  1YRT B;  1YVL A;  5F6T A;  2JT3 A;  3EVU A;  2JPT A;  2EGD A;  2AUC A;  1LXF C;  2LP2 A;  2PRU A;  1OMV A;  3EVR A;  2M29 A;  3FWC A;  1X02 A;  1IGV A;  2PVB A;  4C0J A;  2BCB A;  2BCX A;  2CTN A;  2JXL A;  3I5G C;  1K9P A;  1RRO A;  2Y1N A;  2F33 A;  4ZCU A;  1SK6 D;  2KI6 D;  2QAC A;  1IQ5 A;  4YGC B;  1CKK A;  4WRI A;  4MZJ A;  3JTD B;  3OHM B;  2HPS A;  2F3Z A;  4P2Y B;  1KFX L;  2LLS A;  3BYA A;  4OV2 A;  2M7N A;  3BOW B;  1YUS A;  3IF7 A;  1CNP A;  2BL0 B;  2K7C A;  2M1K B;  1B8R A;  1CLM A;  2ZND A;  3I5I B;  2ZRT A;  3JVT C;  1QAT A;  2Y1M A;  4YGE B;  3KPX A;  4A4B A;  5J3X A;  3I5F C;  1K2H A;  1QX7 A;  4MEW A;  2K2A A;  4YRU A;  4HRG A;  2LM5 A;  1CMF A;  3CR5 X;  1TTX A;  2H2K A;  2JWW A;  1BT6 A;  2LMU A;  1SNL A;  4DCK A;  1SPY A;  2HF5 A;  1SL9 A;  4P5O E;  3TDZ A;  2PAS A;  2JNF A;  1S1E A;  1AHR A;  2K2F A;  1QLS A;  3BUN B;  3LCP C;  5DKQ A;  1UHJ A;  1A29 A;  2WCF A;  4I5L B;  3SG5 A;  1DJH A;  1VRK A;  3IQQ A;  1XFY O;  2A4J A;  2LVV A;  4WQ3 A;  1DMO A;  1XFU O;  5I8N A;  4I5K A;  4BY4 A;  2KFH A;  3M0W A;  4TNC A;  5G08 A;  1LVC D;  1PVA A;  2COL B;  4D1E A;  1XK4 A;  3DVE A;  2KBI A;  1NWD A;  4GBA A;  1CFD A;  3LLE A;  4CFR A;  3AAJ A;  1DVI A;  3PSR A;  1E8A A;  2L4H A;  2L4I A;  2K8M B;  1W7J B;  3DVK A;  1XYD A;  1YX7 A;  1C7W A;  2M49 B;  1NCX A;  2L5X B;  2LVJ A;  3PAT A;  2Y4Q A;  3RM1 A;  2ZRS A;  2LUX A;  2SAS A;  2JXC A;  2NXQ A;  3H4S E;  3D0Y B;  1PSB A;  1F4O A;  2JUL A;  2LCP A;  2LNK A;  3EKH A;  1ALW A;  3SG7 A;  1EXR A;  2LVK A;  4QJ4 B;  3E3R A;  1DF0 B;  2KFG A;  3SIA A;  3DF0 B;  4M2Q A;  4MZL A;  1NX3 A;  1OSA A;  2K0J A;  1B9A A;  2V53 A;  4E68 A;  1QX2 A;  1B7T Z;  2EC6 C;  2NCP A;  5HLO A;  1NX1 A;  2ISD A;  1JSA A;  3IQO A;  1OZS A;  1F70 A;  3KF9 A;  1EJ3 A; 
#chains in the Genus database with same CATH topology
 1C07 A;  1QLK A;  1ORG A;  1SMG A;  2MLF C;  3PM2 A;  4GGN A;  4HSZ A;  1YR5 A;  2KNE A;  4INX A;  2B1U A;  1A75 A;  4FQO A;  3CGA A;  3PAL A;  4QJ3 B;  3WHU B;  4WQ2 A;  2D8N A;  1KK7 Z;  1GQM A;  1AJ4 A;  2PMY A;  3OX6 A;  4N5X A;  1QJT A;  1K9U A;  1ZUZ A;  2M9G A;  3BFA A;  4N1F A;  1KFX S;  1ZFS A;  1RTP 1;  1DJI A;  3I5G B;  1S3P A;  2ZN8 A;  2QPT A;  1IG5 A;  3TDI A;  3WXA A;  1IKU A;  1PSR A;  2OS8 C;  2LP3 A;  2KYF A;  2JTZ A;  1XVJ A;  1TUZ A;  2WC8 A;  1NSH A;  1J7O A;  2VRG A;  1KK8 B;  1TUJ A;  2I7A A;  3PJI A;  3SG6 A;  1FBV A;  2LVI A;  2CBL A;  2K7D A;  5FYX A;  5I2L A;  1B47 A;  1PAL A;  1XFW O;  1H8B A;  4PHJ A;  1RK9 A;  3TDU A;  3OB2 B;  1OZO A;  1F8H A;  5HLV A;  2H61 A;  5ER4 X;  3LL8 B;  3NHI A;  1K95 A;  2L0P A;  3PM8 A;  1YUU A;  5D7F A;  2WND A;  2GGM A;  3NSL A;  4HRE E;  4PT1 A;  1DTL A;  1SW8 A;  2KAX A;  2L2C A;  4IJ7 A;  1CB1 A;  3BUX B;  2LHL A;  5AFP A;  3JVT B;  2JRF A;  2MRD A;  3I5F B;  3SG3 A;  1L7Z A;  1Y1U A;  1XFZ O;  5DKR A;  3UNW A;  3R72 A;  1SKT A;  1V1G A;  2BNX A;  2ZN9 A;  1QV1 A;  4M2O A;  1OMD A;  4KYN A;  3V2L A;  3VRN A;  2LAN A;  3VRP A;  1QVI Y;  1SR6 B;  4OZD A;  1G4Y R;  1TNQ A;  2K7B A;  5KU1 A;  2WOR A;  3NXA A;  2QEB A;  3QME A;  2I18 A;  4GGF A;  4U8D A;  1AP4 A;  3VRO A;  3C1V A;  1FF1 A;  2LV7 A;  1KK8 C;  1CNP A;  2JOJ A;  1FPW A;  3WNX B;  2BBM A;  1MR8 A;  2WCM A;  1S5G Z;  3FIA A;  1ALV A;  1TCO B;  1P28 A;  1OOI X;  3VGO A;  3D77 A;  1TCF A;  2KGR A;  3L4L A;  2KGB C;  1K93 D;  1QX5 B;  1M31 A;  2KLE A;  2KDH A;  2M8U A;  1ODB A;  1EH2 A;  4XJK B;  2KAY A;  3NSK A;  1Q80 A;  2YGU A;  3NHT A;  4CLN A;  1Z4H A;  1NPQ A;  1M63 B;  3CLN A;  4ZCV A;  4C0K A;  2M3W A;  3R1P A;  4INW A;  1U5I B;  3BOW A;  3OGN A;  3S0G A;  4MN0 A;  2JNX A;  2KOT A;  4XJK A;  1S6C A;  2Y5I A;  5I2O A;  1BMO A;  2KQ6 A;  4DUQ A;  1SR6 C;  5AAN A;  1IIO A;  1N65 A;  1QIW A;  3EK4 A;  4OKH A;  2PQL A;  3RZS A;  4M2P A;  4OVN F;  1U5I A;  4YGB B;  3GK2 A;  2K7O A;  1JF0 A;  2F8P A;  2LMT A;  1KFU S;  3DXL A;  3CDN A;  5CSJ A;  1JC2 A;  1IH0 A;  2ZKM X;  2KI4 B;  2LAP A;  3HCM A;  1SYM A;  1WDC C;  1XFR A;  4IL1 A;  5FI6 A;  1CDP A;  5TNC A;  2WCH A;  4GAO A;  2MJW B;  1WLM A;  4F0Z B;  2CCM A;  5CSF A;  3O4X A;  1W9Z A;  5AEQ A;  1BG1 A;  3EVV A;  1EL4 A;  1YTZ C;  2EC6 B;  2P71 A;  3FE6 A;  3NSO A;  5D69 A;  1EG3 A;  2KI6 C;  1H4B A;  1S36 A;  1B1G A;  2O5G A;  1F71 A;  3PFV A;  5JJG A;  1BR1 B;  2BKI B;  1TNP A;  1BOD A;  1OW4 A;  2RGI A;  4NQG A;  1ZMZ A;  2JT0 A;  2BE6 A;  3GK1 A;  2OTG C;  5AXI A;  2E6W A;  2FCD A;  4PE1 A;  3WHT B;  2QDI A;  1XA5 A;  3FE8 A;  1N0Y A;  3L4A A;  1YUT A;  4GNK B;  3SG2 A;  1DEK A;  4AOM A;  1LKJ A;  3DVJ A;  1JFJ A;  1AJ5 A;  4DS7 A;  2TN4 A;  5KTY A;  2GTE A;  2OS8 B;  1M39 A;  2NZ0 A;  4PHN A;  2MAZ A;  1K90 D;  1K8U A;  2MBX A;  1UUS A;  2LHI A;  3DVM A;  3FS7 A;  2KI4 C;  4CPV A;  1BJF A;  2BEC A;  5HYD A;  1HQV A;  1NCZ A;  4OCI A;  3SG4 A;  3SIB A;  2F2O A;  2I2R E;  1DGU A;  1UHK A;  3BQ3 A;  3D0Y A;  1J55 A;  1AVS A;  1S26 D;  1K96 A;  5HKY A;  2CT9 A;  1UUR A;  2M7L A;  4PE4 A;  2AAO A;  2F2P A;  3B7A A;  3SJS A;  1MHO A;  1DF0 A;  1PVB A;  1YVH A;  2PSR A;  1Y0V H;  4MLW A;  1BR4 B;  2LLU A;  3DF0 A;  1FI5 A;  1XFV O;  2L50 A;  1PRW A;  2M97 A;  1RFJ A;  4YGA A;  3S0A A;  1XFX O;  1GGZ A;  5EL2 A;  1G8I A;  3DD4 A;  1KQV A;  1R2U A;  1UWO A;  3RLZ A;  5DKN A;  1CDN A;  1FI6 A;  1REC A;  2CNP A;  1A2X A;  3VRQ A;  2K60 A;  2KYC A;  3BUM B;  1K94 A;  4GFT A;  3S0E A;  1UHI A;  3A4U B;  3CR2 A;  1IQ3 A;  2JU0 A;  2M1U A;  1A4P A;  1J1E A;  3EK8 A;  4ORB B;  1GJY A;  2ZNE A;  1AK8 A;  1KWO C;  1CM4 A;  1NX0 A;  2CXJ A;  4ETO A;  1TNX A;  1BF5 A;  1G33 A;  5JOL A;  4I5J A;  1SSE B;  2I94 A;  2PAL A;  1CM1 A;  1S6J A;  5CSI A;  2BE4 A;  1RWY A;  1D1O A;  1UHN A;  3O2P A;  5K89 A;  2LE9 B;  5KSZ A;  2BBN A;  2FCE A;  2JC2 A;  3OX5 A;  1IWQ A;  1MUX A;  1SY9 A;  3GOF A;  4DRW A;  2G2B A;  2WCE A;  3TS5 C;  4YI8 A;  2QEH A;  2WC5 A;  4JQ0 D;  4QJ5 B;  1CFP A;  1M45 A;  3D75 A;  3MSE B;  1AUI B;  2NLN A;  1SCM C;  2MLE C;  3IVT A;  2KBM A;  3N7H A;  3CS1 A;  2BKH B;  3D78 A;  5HKZ A;  5B8I B;  1C3Y A;  1YUR A;  1IJ6 A;  1Z2C B;  1HT9 A;  1DJW A;  2M0R A;  3CZ2 A;  1KQM C;  2F3Y A;  3BJH A;  1JFK A;  3CR4 X;  3FWB A;  5ER5 A;  3D73 A;  3TUY B;  3F45 A;  5CPV A;  1WDC B;  1OOF A;  1WRK A;  3NSI A;  2K61 A;  2EHB A;  3CWG A;  3DYE A;  4JWQ A;  3VB1 A;  4BY5 A;  1L2O C;  1SCV A;  1MQ1 A;  4AQI A;  1B7T Y;  1WRL A;  1DJY A;  1MF8 B;  1WY9 A;  1MWN A;  1CFC A;  1GM0 A;  1ZOT B;  2FJU B;  1Y6W A;  4GUK A;  1K9K A;  2R2I A;  2KSP A;  4OR9 B;  3K21 A;  3EKJ A;  1LIN A;  4MSP A;  2WCK A;  1XO5 A;  2LLT A;  4HRH A;  1KK7 Y;  1LA0 A;  2E30 A;  3LK0 A;  4NDB A;  3O6B A;  2H61 C;  3ICB A;  2IS9 A;  2OTG B;  1FW4 A;  2JT8 A;  3Q8I A;  4MVF A;  4ORA B;  1QV0 A;  2DOQ A;  2G9B A;  4MRX A;  3I5H C;  4CFQ A;  2KHN A;  4MBE A;  4JD9 A;  3B88 A;  1LS8 A;  3OBV A;  1TOP A;  3D10 A;  3CTN A;  1KCY A;  2O60 A;  4PHK A;  1NCY A;  1IJ5 A;  1IRJ A;  4GPL B;  2KQY A;  2L98 A;  2LUC A;  1J7Q A;  2P70 A;  3A8R A;  3TZ1 A;  3TUY C;  2LC5 A;  2MA2 A;  4DIR A;  1DT7 B;  3ZNI A;  3LK1 A;  4GGF C;  1R6P A;  1J7P A;  1YRU B;  5BPJ A;  1Y1X A;  1V1F A;  4PE7 A;  3BFH A;  5CSN A;  1JBA A;  4MRY A;  1DGV A;  1NIW A;  2OPO A;  4R1E A;  3O78 A;  1SL7 A;  3R1V A;  1C7V A;  2L2E A;  1DQE A;  2L51 A;  1CMG A;  5I2Q A;  2JTT A;  2P6B B;  1QAS A;  4MZK A;  1JF2 A;  5FI2 A;  1GGW A;  2Q91 A;  1CFF A;  3FE9 A;  3JTD C;  4USL A;  4YGD B;  1SBJ A;  2Q4U A;  4UPG A;  2LMV A;  2JQ6 A;  1DJG A;  1B8L A;  1SL8 A;  1RJV A;  2GGZ A;  3AAK A;  4XYN A;  1ZAC A;  1OOH A;  1TIZ A;  3SS5 A;  1B8C A;  1SRA A;  1S5G Y;  1PK0 D;  3QRX A;  2BL0 C;  1CDL A;  4AQJ A;  1CDM A;  1KWO B;  1KSO A;  1DEL A;  2HQ8 A;  3PN7 B;  3I5I C;  4ORC B;  1TRF A;  5GQQ C;  1OE9 B;  2HET A;  1LA3 A;  3DY9 A;  3VRR A;  1MXE A;  1J1D A;  2SCP A;  4JPZ B;  1CTR A;  3B6X A;  4FTG A;  1B4C A;  1KSM A;  1QVI Z;  1DC1 A;  1W7I B;  2MHH A;  1QWV A;  2WCB A;  3PLF B;  3TS5 B;  4F7F A;  1DJX A;  1QIV A;  1JWD A;  1Y1A A;  1NYA A;  1S6I A;  1XK4 C;  3SS3 A;  1JUO A;  1SCM B;  1J7R A;  2GV5 A;  1F54 A;  2FOT A;  4PHM A;  3AKB A;  2ZFD A;  3O4Y A;  2BCA A;  3BUW B;  1F4Q A;  3KHE A;  1TN4 A;  1KQM B;  1OOJ A;  4YBH B;  1NX2 A;  1A75 B;  2KLD A;  3KEV A;  3ZWH A;  3GK4 X;  1BLQ A;  1OQP A;  3OB1 B;  3AKA A;  5HKW A;  4PAL A;  1MXL C;  4PDZ A;  1KFU L;  3BXK A;  3PN7 C;  2BAP A;  1A03 A;  1L2O B;  1YX8 A;  4ICB A;  4Q04 A;  3CZT X;  5AER A;  3HX4 A;  1NUB A;  4N1G A;  3KO0 A;  1F55 A;  2JZI A;  1OMR A;  3EK7 A;  2WCL A;  3K1E A;  1UHH A;  1CLL A;  1BU3 A;  4YI9 A;  3BUO B;  4NDD A;  1BOC A;  2KFF A;  3OP0 A;  4A4C A;  3BFB A;  4CID A;  2AMI A;  2KAV A;  1CLB A;  2WOS A;  4I5N B;  4JKT A;  1WLZ A;  4C0L A;  4L9M A;  1N2D A;  2HQW A;  3CZ1 A;  2PYQ A;  3I5H B;  4PCW A;  1PUL A;  2NCO A;  1DJZ A;  4NDC A;  1QTX A;  1EG4 A;  1QXP A;  1WRZ A;  5PAL A;  3CZ0 A;  1QS7 A;  5IBW A;  1NP8 A;  1TNW A;  1M46 A;  1UP5 A;  4PE0 A;  1YRT B;  1YVL A;  5F6T A;  2JT3 A;  3EVU A;  2L5Y A;  2JPT A;  2EGD A;  2AUC A;  1LXF C;  2LP2 A;  4FQT A;  3D74 A;  2PRU A;  1OMV A;  3EVR A;  2M29 A;  3FWC A;  1X02 A;  3S0F A;  5D3O A;  1IGV A;  2PVB A;  4C0J A;  2BCB A;  2BCX A;  2CTN A;  2JXL A;  3I5G C;  1K9P A;  1RRO A;  2Y1N A;  2KPH A;  2F33 A;  4ZCU A;  1SK6 D;  2KI6 D;  2QAC A;  1IQ5 A;  4YGC B;  1CKK A;  4WRI A;  4MZJ A;  3JTD B;  2JPO A;  3S0B A;  3OHM B;  2HPS A;  2F3Z A;  4P2Y B;  3B87 A;  5FI7 A;  3D76 A;  1KFX L;  2LLS A;  3BYA A;  3NGV A;  3R1O A;  2M7N A;  3BOW B;  1YUS A;  3IF7 A;  4OV2 A;  3UO9 A;  2BL0 B;  2K7C A;  2M1K B;  1B8R A;  3SS4 A;  3S0D A;  1CLM A;  2H8V A;  2ZND A;  3I5I B;  2ZRT A;  2QEV A;  3JVT C;  1QAT A;  2Y1M A;  4YGE B;  3KPX A;  4A4B A;  5J3X A;  3I5F C;  1K2H A;  1QX7 A;  4MEW A;  2K2A A;  4YRU A;  4HRG A;  2FJY A;  2LM5 A;  1CMF A;  3CR5 X;  1TTX A;  3B86 A;  2H2K A;  2JWW A;  1BT6 A;  2LMU A;  3CAB A;  1SNL A;  4DCK A;  1SPY A;  2HF5 A;  1SL9 A;  4P5O E;  3TDZ A;  2PAS A;  1OOG A;  2JNF A;  1S1E A;  1AHR A;  2K2F A;  1QLS A;  3BUN B;  3LCP C;  5DKQ A;  1UHJ A;  1A29 A;  2WCF A;  4I5L B;  3SG5 A;  1DJH A;  1VRK A;  3IQQ A;  1XFY O;  5I94 A;  2A4J A;  2LVV A;  4WQ3 A;  1DMO A;  1XFU O;  5I8N A;  3EG5 B;  3L47 A;  4I5K A;  4BY4 A;  2KFH A;  3M0W A;  2ERB A;  4TNC A;  5G08 A;  1LVC D;  1PVA A;  2COL B;  4D1E A;  1XK4 A;  3DVE A;  2KBI A;  1NWD A;  4GBA A;  1CFD A;  3LLE A;  4CFR A;  3AAJ A;  1DVI A;  3PSR A;  1E8A A;  2L4H A;  2L4I A;  2K8M B;  1W7J B;  3DVK A;  1XYD A;  1YX7 A;  1C7W A;  2M49 B;  2WCJ A;  2WC6 A;  1NCX A;  2L5X B;  2LVJ A;  3PAT A;  2Y4Q A;  3RM1 A;  2ZRS A;  2LUX A;  2SAS A;  5DIC A;  2JXC A;  2NXQ A;  3H4S E;  3D0Y B;  1PSB A;  1F4O A;  1T14 A;  2JUL A;  2LCP A;  2LNK A;  3EKH A;  1ALW A;  5HL1 A;  3CYZ A;  3SG7 A;  1EXR A;  2QEO A;  1C3Z A;  2LVK A;  4QJ4 B;  3E3R A;  1DF0 B;  2KFG A;  3SIA A;  1TWO A;  3DF0 B;  4M2Q A;  4MZL A;  1NX3 A;  1OSA A;  2K0J A;  1B9A A;  2V53 A;  4E68 A;  1QX2 A;  1B7T Z;  2EC6 C;  2NCP A;  3DZT A;  1NX1 A;  5HLO A;  2ISD A;  1JSA A;  3IQO A;  1OZS A;  1F70 A;  3KF9 A;  1EJ3 A; 
#chains in the Genus database with same CATH homology
 1C07 A;  1QLK A;  1SMG A;  2MLF C;  4GGN A;  4HSZ A;  1YR5 A;  2KNE A;  2B1U A;  1A75 A;  4FQO A;  3CGA A;  4QJ3 B;  3WHU B;  4WQ2 A;  2D8N A;  1KK7 Z;  1GQM A;  1AJ4 A;  2PMY A;  3OX6 A;  4N5X A;  1QJT A;  1K9U A;  1ZUZ A;  2M9G A;  4N1F A;  1KFX S;  1ZFS A;  1RTP 1;  1DJI A;  3I5G B;  1S3P A;  2ZN8 A;  2QPT A;  1IG5 A;  3TDI A;  3WXA A;  1IKU A;  1PSR A;  2OS8 C;  2LP3 A;  2KYF A;  2JTZ A;  1XVJ A;  2WC8 A;  1J7O A;  1NSH A;  2VRG A;  1KK8 B;  2I7A A;  3SG6 A;  1FBV A;  2LVI A;  2CBL A;  2K7D A;  5FYX A;  5I2L A;  1B47 A;  1PAL A;  1XFW O;  1H8B A;  4PHJ A;  1RK9 A;  3TDU A;  3OB2 B;  1OZO A;  1F8H A;  5HLV A;  2H61 A;  5ER4 X;  3LL8 B;  1K95 A;  2L0P A;  3PM8 A;  1YUU A;  5D7F A;  2WND A;  2GGM A;  3NSL A;  4HRE E;  1DTL A;  1SW8 A;  2KAX A;  1CB1 A;  3BUX B;  2LHL A;  5AFP A;  3JVT B;  2JRF A;  2MRD A;  3I5F B;  3SG3 A;  1L7Z A;  1Y1U A;  1XFZ O;  5DKR A;  1SKT A;  1V1G A;  2ZN9 A;  1QV1 A;  4M2O A;  1OMD A;  3VRN A;  2LAN A;  3VRP A;  1QVI Y;  1SR6 B;  1G4Y R;  1TNQ A;  2K7B A;  5KU1 A;  2WOR A;  3NXA A;  4GGF A;  1AP4 A;  2I18 A;  4U8D A;  3VRO A;  3C1V A;  1FF1 A;  2LV7 A;  1KK8 C;  2JOJ A;  1FPW A;  3WNX B;  2BBM A;  1MR8 A;  1S5G Z;  3FIA A;  1ALV A;  1TCO B;  3VGO A;  1TCF A;  2KGR A;  2KGB C;  1K93 D;  1QX5 B;  1M31 A;  2KDH A;  2M8U A;  1ODB A;  1EH2 A;  4XJK B;  2KAY A;  3NSK A;  1Q80 A;  4CLN A;  1NPQ A;  1M63 B;  3CLN A;  4ZCV A;  4C0K A;  2M3W A;  1U5I B;  3BOW A;  4MN0 A;  2JNX A;  2KOT A;  4XJK A;  1S6C A;  2Y5I A;  5I2O A;  1BMO A;  2KQ6 A;  4DUQ A;  1SR6 C;  5AAN A;  1N65 A;  1QIW A;  3EK4 A;  4OKH A;  4M2P A;  4OVN F;  1U5I A;  4YGB B;  3GK2 A;  2K7O A;  1JF0 A;  2F8P A;  2LMT A;  1KFU S;  5CSJ A;  1IH0 A;  1JC2 A;  2ZKM X;  2KI4 B;  2LAP A;  3HCM A;  1SYM A;  1WDC C;  5TNC A;  4IL1 A;  1CDP A;  4GAO A;  2MJW B;  1WLM A;  4F0Z B;  2CCM A;  5CSF A;  5AEQ A;  1BG1 A;  3EVV A;  1EL4 A;  1YTZ C;  2EC6 B;  3NSO A;  1H4B A;  5D69 A;  1EG3 A;  2KI6 C;  1S36 A;  1B1G A;  2O5G A;  1F71 A;  3PFV A;  5JJG A;  1BR1 B;  2BKI B;  1TNP A;  1BOD A;  2RGI A;  4NQG A;  1ZMZ A;  2JT0 A;  2BE6 A;  3GK1 A;  2OTG C;  5AXI A;  2E6W A;  2FCD A;  4PE1 A;  3WHT B;  1XA5 A;  1N0Y A;  1YUT A;  4GNK B;  3SG2 A;  4AOM A;  1LKJ A;  3DVJ A;  1JFJ A;  1AJ5 A;  4DS7 A;  2TN4 A;  5KTY A;  2OS8 B;  1M39 A;  2NZ0 A;  4PHN A;  2MAZ A;  1K90 D;  1K8U A;  2MBX A;  1UUS A;  2LHI A;  3DVM A;  3FS7 A;  2KI4 C;  4CPV A;  1BJF A;  2BEC A;  5HYD A;  1HQV A;  1NCZ A;  4OCI A;  3SG4 A;  3SIB A;  2F2O A;  2I2R E;  1DGU A;  1UHK A;  3BQ3 A;  3D0Y A;  1J55 A;  1AVS A;  1S26 D;  1K96 A;  5HKY A;  2CT9 A;  1UUR A;  2M7L A;  4PE4 A;  2AAO A;  2F2P A;  3SJS A;  1MHO A;  1DF0 A;  1PVB A;  1YVH A;  2PSR A;  1Y0V H;  4MLW A;  1BR4 B;  2LLU A;  3DF0 A;  1FI5 A;  1XFV O;  2L50 A;  1PRW A;  2M97 A;  1RFJ A;  4YGA A;  1XFX O;  1GGZ A;  1G8I A;  3DD4 A;  1KQV A;  1R2U A;  1UWO A;  3RLZ A;  5DKN A;  1CDN A;  1FI6 A;  1REC A;  2CNP A;  1A2X A;  3VRQ A;  2KYC A;  3BUM B;  1K94 A;  4GFT A;  1UHI A;  3A4U B;  3CR2 A;  1IQ3 A;  2JU0 A;  2M1U A;  1A4P A;  1J1E A;  3EK8 A;  4ORB B;  1GJY A;  2ZNE A;  1AK8 A;  1KWO C;  1CM4 A;  1NX0 A;  2CXJ A;  4ETO A;  1TNX A;  1BF5 A;  1G33 A;  5JOL A;  4I5J A;  2I94 A;  2PAL A;  1CM1 A;  1S6J A;  5CSI A;  2BE4 A;  1RWY A;  1D1O A;  1UHN A;  3O2P A;  5K89 A;  2LE9 B;  5KSZ A;  2BBN A;  2FCE A;  2JC2 A;  3OX5 A;  1IWQ A;  1MUX A;  1SY9 A;  3GOF A;  4DRW A;  2G2B A;  2WCE A;  3TS5 C;  4YI8 A;  4JQ0 D;  4QJ5 B;  1CFP A;  1M45 A;  3MSE B;  1AUI B;  2NLN A;  1SCM C;  2MLE C;  3PAL A;  2KBM A;  5HKZ A;  3CS1 A;  2BKH B;  5B8I B;  1YUR A;  1IJ6 A;  2M0R A;  1HT9 A;  1DJW A;  1KQM C;  2F3Y A;  1JFK A;  3CR4 X;  3FWB A;  5ER5 A;  3TUY B;  3F45 A;  5CPV A;  1WDC B;  1WRK A;  3NSI A;  2K61 A;  2EHB A;  3CWG A;  4JWQ A;  4BY5 A;  1L2O C;  1SCV A;  1MQ1 A;  4AQI A;  1B7T Y;  1WRL A;  1DJY A;  1MF8 B;  1WY9 A;  1MWN A;  1CFC A;  1ZOT B;  2FJU B;  1Y6W A;  4GUK A;  1K9K A;  2R2I A;  2KSP A;  4OR9 B;  3K21 A;  3EKJ A;  1LIN A;  4MSP A;  1XO5 A;  2LLT A;  4HRH A;  1KK7 Y;  1LA0 A;  2E30 A;  3LK0 A;  4NDB A;  3O6B A;  2H61 C;  3ICB A;  2IS9 A;  2OTG B;  1FW4 A;  2JT8 A;  4MVF A;  4ORA B;  1QV0 A;  2DOQ A;  2G9B A;  4MRX A;  3I5H C;  4CFQ A;  2KHN A;  4MBE A;  1TOP A;  3D10 A;  3CTN A;  1KCY A;  2O60 A;  4PHK A;  1NCY A;  1IJ5 A;  1IRJ A;  4GPL B;  2KQY A;  2L98 A;  2LUC A;  1J7Q A;  3TZ1 A;  3A8R A;  3TUY C;  2LC5 A;  2MA2 A;  4DIR A;  1DT7 B;  3ZNI A;  3LK1 A;  4GGF C;  1R6P A;  1J7P A;  1YRU B;  5BPJ A;  1Y1X A;  1V1F A;  4PE7 A;  5CSN A;  1JBA A;  4MRY A;  1DGV A;  1NIW A;  2OPO A;  4R1E A;  3O78 A;  1SL7 A;  1C7V A;  2L2E A;  2L51 A;  1CMG A;  5I2Q A;  2JTT A;  2P6B B;  1QAS A;  4MZK A;  1JF2 A;  1GGW A;  2Q91 A;  1CFF A;  3JTD C;  4USL A;  4YGD B;  1SBJ A;  2Q4U A;  4UPG A;  2LMV A;  2JQ6 A;  1DJG A;  1B8L A;  1SL8 A;  1RJV A;  2GGZ A;  3AAK A;  4XYN A;  1ZAC A;  1TIZ A;  1B8C A;  1SRA A;  1S5G Y;  1PK0 D;  3QRX A;  2BL0 C;  1CDL A;  4AQJ A;  1CDM A;  1KWO B;  1KSO A;  2HQ8 A;  3PN7 B;  3I5I C;  4ORC B;  1TRF A;  5GQQ C;  1OE9 B;  2HET A;  1LA3 A;  3VRR A;  1MXE A;  1J1D A;  2SCP A;  4JPZ B;  1CTR A;  4FTG A;  1B4C A;  1KSM A;  1QVI Z;  1W7I B;  2MHH A;  3PLF B;  2WCB A;  3TS5 B;  1JWD A;  1DJX A;  1QIV A;  1Y1A A;  1NYA A;  1S6I A;  1XK4 C;  1JUO A;  1SCM B;  1J7R A;  2GV5 A;  1F54 A;  2FOT A;  4PHM A;  3AKB A;  2ZFD A;  3O4Y A;  2BCA A;  3BUW B;  1F4Q A;  3KHE A;  1TN4 A;  1KQM B;  1OOJ A;  4YBH B;  1NX2 A;  1A75 B;  3ZWH A;  3KEV A;  3GK4 X;  1BLQ A;  1OQP A;  3OB1 B;  3AKA A;  5HKW A;  4PAL A;  1MXL C;  4PDZ A;  1KFU L;  3BXK A;  3PN7 C;  1A03 A;  1L2O B;  1YX8 A;  4ICB A;  4Q04 A;  3CZT X;  5AER A;  3HX4 A;  1NUB A;  4N1G A;  3KO0 A;  1F55 A;  2JZI A;  1OMR A;  3EK7 A;  1UHH A;  1CLL A;  1BU3 A;  4YI9 A;  3BUO B;  4NDD A;  1BOC A;  2KFF A;  3OP0 A;  4A4C A;  4CID A;  2AMI A;  2KAV A;  1CLB A;  2WOS A;  4I5N B;  1WLZ A;  4C0L A;  4L9M A;  1N2D A;  2HQW A;  3I5H B;  4PCW A;  1PUL A;  2NCO A;  1DJZ A;  4NDC A;  1QTX A;  1EG4 A;  1QXP A;  1WRZ A;  5PAL A;  1QS7 A;  5IBW A;  1NP8 A;  1TNW A;  1M46 A;  1UP5 A;  4PE0 A;  1YRT B;  1YVL A;  5F6T A;  2JT3 A;  3EVU A;  2JPT A;  2EGD A;  2AUC A;  1LXF C;  2LP2 A;  2PRU A;  1OMV A;  3EVR A;  2M29 A;  3FWC A;  1X02 A;  1IGV A;  2PVB A;  4C0J A;  2BCB A;  2BCX A;  2CTN A;  2JXL A;  3I5G C;  1K9P A;  1RRO A;  2Y1N A;  2F33 A;  4ZCU A;  1SK6 D;  2KI6 D;  2QAC A;  1IQ5 A;  4YGC B;  1CKK A;  4WRI A;  4MZJ A;  3JTD B;  3OHM B;  2HPS A;  2F3Z A;  4P2Y B;  1KFX L;  2LLS A;  3BYA A;  4OV2 A;  2M7N A;  3BOW B;  1YUS A;  3IF7 A;  1CNP A;  2BL0 B;  2K7C A;  2M1K B;  1B8R A;  1CLM A;  2ZND A;  3I5I B;  2ZRT A;  3JVT C;  1QAT A;  2Y1M A;  4YGE B;  3KPX A;  4A4B A;  5J3X A;  3I5F C;  1K2H A;  1QX7 A;  4MEW A;  2K2A A;  4YRU A;  4HRG A;  2LM5 A;  1CMF A;  3CR5 X;  1TTX A;  2H2K A;  2JWW A;  1BT6 A;  2LMU A;  1SNL A;  4DCK A;  1SPY A;  2HF5 A;  1SL9 A;  4P5O E;  3TDZ A;  2PAS A;  2JNF A;  1S1E A;  1AHR A;  2K2F A;  1QLS A;  3BUN B;  3LCP C;  5DKQ A;  1UHJ A;  1A29 A;  2WCF A;  4I5L B;  3SG5 A;  1DJH A;  1VRK A;  3IQQ A;  1XFY O;  2A4J A;  2LVV A;  4WQ3 A;  1DMO A;  1XFU O;  5I8N A;  4I5K A;  4BY4 A;  2KFH A;  3M0W A;  4TNC A;  5G08 A;  1LVC D;  1PVA A;  2COL B;  4D1E A;  1XK4 A;  3DVE A;  2KBI A;  1NWD A;  4GBA A;  1CFD A;  3LLE A;  4CFR A;  3AAJ A;  1DVI A;  3PSR A;  1E8A A;  2L4H A;  2L4I A;  2K8M B;  1W7J B;  3DVK A;  1XYD A;  1YX7 A;  1C7W A;  2M49 B;  1NCX A;  2L5X B;  2LVJ A;  3PAT A;  2Y4Q A;  3RM1 A;  2ZRS A;  2LUX A;  2SAS A;  2JXC A;  2NXQ A;  3H4S E;  3D0Y B;  1PSB A;  1F4O A;  2JUL A;  2LCP A;  2LNK A;  3EKH A;  1ALW A;  3SG7 A;  1EXR A;  2LVK A;  4QJ4 B;  3E3R A;  1DF0 B;  2KFG A;  3SIA A;  3DF0 B;  4M2Q A;  4MZL A;  1NX3 A;  1OSA A;  2K0J A;  1B9A A;  2V53 A;  4E68 A;  1QX2 A;  1B7T Z;  2EC6 C;  2NCP A;  5HLO A;  1NX1 A;  2ISD A;  1JSA A;  3IQO A;  1OZS A;  1F70 A;  3KF9 A;  1EJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...