1ZMZA

Solution structure of the n-terminal domain (m1-s98) of human centrin 2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
b'MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Centrin-2
publication title The N-terminal domain of human centrin 2 has a closed structure, binds calcium with a very low affinity, and plays a role in the protein self-assembly
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 25
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1zmzA01
2K7DA 2CBLA 2LMVA 5J3XA 4BY4A 2KFGA 1DJIA 4HRHA 3KEVA 1K96A 4PDZA 1DF0A 1SR6B 1G4YR 5KTYA 2JTZA 1MWNA 1J7RA 4C0JA 1FW4A 4YI9A 4OV2A 1BG1A 4CLNA 4NDCA 5CSJA 2KI6C 2BKHB 3WXAA 2JULA 1B7TZ 1TNQA 4AQJA 2ZNDA 2HF5A 4YGDB 2E30A 3FIAA 3MSEB 2AMIA 1B8LA 2L0PA 2KOTA 4PE4A 1LINA 1XO5A 1CLLA 2KDHA 5BPJA 3RM1A 1B47A 4YI8A 1F71A 2WCEA 2K0JA 2NLNA 1WLZA 3A4UB 4PHMA 1K94A 2M9GA 2H61C 2KFFA 1OOJA 3DVEA 3SG7A 3TDUA 1DMOA 1QJTA 3C1VA 1XFWO 2BCXA 2JZIA 2EC6C 2KAYA 2JOJA 1FI6A 1MF8B 1BU3A 1CM4A 1KK8C 2ZKMX 4QJ3B 1Y6WA 1OZOA 3PLFB 2MLFC 1XYDA 1SPYA 3HX4A 5HKWA 1NX0A 1QATA 1JSAA 1MR8A 5D7FA 5ER4X 5TNCA 1DJHA 4USLA 3WHUB 1XFZO 1TRFA 1LVCD 1ZOTB 1F8HA 5DKNA 2JWWA 1J7QA 2VRGA 2WCFA 1Y1XA 4F0ZB 1YX8A 1CTRA 2MLEC 3BYAA 3PFVA 1L7ZA 4E68A 1QTXA 3M0WA 2MBXA 4D1EA 2L98A 4CPVA 2LMTA 1M31A 4TNCA 5IBWA 1RJVA 1J7PA 1SRAA 1CFCA 3VRQA 1WY9A 1F54A 1KFUS 1ZMZA 5CPVA 3IF7A 1MHOA 2MHHA 1U5IB 1MXLC 1EG4A 2KYCA 1J55A 2LLTA 1UHKA 1CM1A 1QV1A 4HSZA 1U5IA 4XYNA 5GQQC 1L2OC 3TDZA 4UPGA 1TIZA 1UURA 3JVTB 2GGMA 3KHEA 1NP8A 2IS9A 1S26D 4HREE 1OQPA 2Y1MA 4NDDA 1WRZA 2ZFDA 2HETA 1S36A 2JNXA 2RGIA 1K90D 1B8CA 3BXKA 1CLMA 2O5GA 5DKQA 1WRLA 1G8IA 2F2PA 3CLNA 4JWQA 2KBMA 1UUSA 2D8NA 2F3ZA 4ORCB 2LANA 1XVJA 1SBJA 1WRKA 1AJ5A 3DVJA 1SCMC 4MN0A 1A29A 2LP2A 1SL7A 1SCVA 1LA3A 1KWOC 1SK6D 1R6PA 2LHLA 1BF5A 2NXQA 4YGAA 1EH2A 3D0YB 3DVKA 1TCOB 4OVNF 1YUUA 3EK7A 1ZUZA 1OE9B 4A4BA 2PVBA 4NDBA 1QIVA 1LKJA 2I7AA 1DJWA 2Y1NA 1BLQA 4GNKB 1IJ6A 1NX2A 2G9BA 3SG2A 3O2PA 2F2OA 1XK4A 1TN4A 5PALA 4ORAB 2JNFA 2KAXA 1B9AA 3CR2A 1M39A 4PE0A 1PK0D 5KU1A 1IGVA 1RK9A 1G33A 3LLEA 2JPTA 2EC6B 3LCPC 1QASA 4WQ2A 1HQVA 2LCPA 2LC5A 1KK8B 1NYAA 1BMOA 3NSIA 3I5IC 3VRNA 3BUOB 1A03A 1NPQA 1DT7B 1XFVO 2G2BA 2MRDA 5I2LA 3OB1B 4HRGA 2CTNA 4MLWA 1Y0VH 4PHKA 4NQGA 5DKRA 2KI6D 4OR9B 5B8IB 4P2YB 2M3WA 3HCMA 4N5XA 3A8RA 1MUXA 5ER5A 1B1GA 3TDIA 1JFKA 1OMVA 4P5OE 2CXJA 2LUXA 1KFXL 2BKIB 1NSHA 1VRKA 3CS1A 3EVRA 1KQMC 2M0RA 4MRXA 3SG5A 2LVJA 4I5NB 1BODA 2Y4QA 2Q91A 4R1EA 1XK4C 3ZWHA 5F6TA 1YUSA 2F8PA 1S6IA 2PASA 4PCWA 1R2UA 1QX7A 2LV7A 1L2OB 3GK2A 1PVBA 3TUYC 2WC8A 1DGUA 2QACA 1NUBA 5JOLA 2BBNA 4OCIA 4ZCUA 2M29A 2M8UA 4ORBB 1GJYA 5AFPA 1J1DA 1W7JB 2LNKA 2SASA 1M63B 1SY9A 1CDMA 4OKHA 4QJ5B 2JT8A 4M2OA 1QXPA 2DOQA 3OX6A 3NXAA 1CFPA 1YVHA 4QJ4B 1B8RA 2JT3A 1WDCB 3SG6A 3SJSA 2ZRTA 1AK8A 2H2KA 1PSBA 2O60A 4FTGA 1A4PA 2K8MB 2BE4A 1SCMB 1OZSA 2FCEA 4C0LA 1FF1A 3I5FC 4CIDA 2Y5IA 2KI4C 1CDNA 1HT9A 1BR4B 3AAKA 3AKAA 3H4SE 2JRFA 3IQQA 1DJXA 1F4OA 3VRRA 4PHNA 1YUTA 1N2DA 1K9PA 2WNDA 1KQVA 3NSKA 1KCYA 2L4IA 3TZ1A 2HPSA 4M2QA 4YGBB 1EXRA 2M1KB 1SR6C 2FCDA 4DS7A 2K61A 1M45A 1KK7Z 1IH0A 1BOCA 4YRUA 1MQ1A 3SIBA 1YURA 3SG3A 3BUXB 3DF0A 1F4QA 2BCBA 2LUCA 3I5IB 4GGFC 1IQ5A 2KQ6A 1SMGA 4AQIA 1JBAA 2I2RE 2K7OA 3EKHA 1KK7Y 1GGWA 2ZNEA 4N1FA 2M1UA 2L5XB 1DJZA 3BOWA 1KFUL 1CKKA 1QS7A 2JC2A 3NSOA 1QIWA 1NCYA 1H8BA 2MAZA 1GQMA 4MZJA 3FWBA 2CNPA 1S3PA 3CGAA 1FBVA 1TCFA 1MXEA 2NCOA 1V1FA 1F55A 3I5GC 1YRUB 1ZFSA 3I5HC 3OB2B 4MVFA 1KQMB 4MZLA 1SKTA 2LP3A 1C7WA 2WOSA 2MJWB 5I8NA 1FPWA 2HQ8A 4GUKA 5CSIA 2ZN9A 1TNWA 3O4YA 4JPZB 1OMDA 1BR1B 5K89A 1AP4A 2PMYA 3OX5A 2NZ0A 2ZRSA 3PN7C 3TUYB 2QPTA 1JC2A 2JQ6A 1RWYA 3CR5X 4MZKA 1UHHA 1XFXO 1UHNA 3BQ3A 1K8UA 3EKJA 3F45A 3E3RA 1KSMA 4PE7A 2BCAA 1J7OA 4C0KA 4WQ3A 1GGZA 4WRIA 3TS5C 1DVIA 2L4HA 1K2HA 5FYXA 3CWGA 2V53A 1ALVA 1A75B 1LA0A 2OS8C 1XFYO 3DVMA 2LVVA 1IQ3A 4M2PA 3JTDC 3VRPA 2BBMA 2PALA 2KSPA 3FS7A 4DIRA 1A75A 1NCXA 3I5FB 1DTLA 3OP0A 2LM5A 1PVAA 2COLB 2OPOA 2KNEA 3CR4X 5HLVA 2KGBC 2KI4B 2MA2A 2BE6A 4DCKA 2AUCA 4ICBA 2SCPA 3EVVA 4I5LB 1AHRA 3JVTC 4PE1A 2KGRA 1CFDA 2M7LA 3ZNIA 4IL1A 5HYDA 2KFHA 3EK8A 1CFFA 2A4JA 2KYFA 1YVLA 3IQOA 3ICBA 4GGNA 5KSZA 3SG4A 5I2QA 3FWCA 1TTXA 1YX7A 2GV5A 1TNPA 4I5KA 4PALA 1UP5A 3AKBA 5JJGA 1A2XA 1BJFA 1CNPA 1D1OA 1IWQA 1XFUO 2AAOA 5CSFA 5AXIA 3WHTB 2I18A 2I94A 2CT9A 1TOPA 2KAVA 5HLOA 3BUNB 2LAPA 3SIAA 1QLSA 2F3YA 2LHIA 3KO0A 1J1EA 1M46A 1QVIZ 2JU0A 3KPXA 2LVIA 4GGFA 1YR5A 4MBEA 5I2OA 1NCZA 1IKUA 1QX2A 1YRTB 2L50A 2OTGC 1ODBA 3RLZA 1C07A 5CSNA 3K21A 1LXFC 1B7TY 2JTTA 4GBAA 3LK0A 3O6BA 1KWOB 1QVIY 1PULA 1FI5A 1EG3A 3NSLA 1JF2A 1BT6A 1SL9A 1UWOA 1K93D 3BUWB 1OSAA 3I5GB 3WNXB 2ZN8A 3I5HB 2BECA 5D69A 4A4CA 1JWDA 2L51A 4MSPA 1QX5B 3EK4A 4N1GA 3GK4X 3GK1A 1C7VA 3DD4A 2BL0C 2L2EA 1F70A 1S5GZ 4MRYA 1NX1A 3PN7B 1NIWA 2LVKA 1K9KA 1K95A 4AOMA 2JXCA 2K2AA 3DF0B 1JF0A 1SNLA 1YTZC 1CDLA 5HKZA 2KBIA 4YGCB 1S6JA 4U8DA 1IG5A 3AAJA 1S5GY 3GOFA 3PATA 1NX3A 2KHNA 1WLMA 1E8AA 3TS5B 1IRJA 1TNXA 5AERA 1JFJA 4YBHB 3LK1A 3O78A 4DUQA 3BOWB 1Q80A 1RFJA 2OS8B 2P6BB 2KQYA 2PRUA 2GGZA 2FJUB 3VROA 2EGDA 1SW8A 3JTDB 2JT0A 4L9MA 1KSOA 4I5JA 1CDPA 2M7NA 1N65A 2K2FA 5AANA 1PSRA 2M97A 1IJ5A 3KF9A 3PALA 1S6CA 2E6WA 1EL4A 1RROA 1RTP1 1ZACA 4CFRA 1V1GA 2LLUA 4GAOA 2CCMA 3OHMB 3BUMB 1QV0A 1PALA 4ETOA 1WDCC 2HQWA 1AJ4A 3LL8B 2LMUA 4XJKB 4YGEB 5G08A 4ZCVA 1QLKA 1N0YA 1DJGA 2R2IA 4XJKA 1CMFA 2NCPA 1CMGA 4CFQA 4MEWA 1EJ3A 1NWDA 3CZTX 2JXLA 3PM8A 2K7CA 2M49B 4GFTA 4BY5A 3VGOA 3D0YA 2OTGB 4JQ0D 1OMRA 2TN4A 2F33A 1W7IB 1SL8A 3PSRA 1ALWA 2FOTA 1H4BA 2EHBA 1Y1AA 1K9UA 3D10A 3QRXA 2K7BA 2ISDA 1SYMA 1PRWA 1DGVA 1KFXS 1S1EA 1X02A 1XA5A 1JUOA 1AVSA 1RECA 1AUIB 2LLSA 4Q04A 1CLBA 1Y1UA 2WCBA 1CB1A 2B1UA 2LE9B 1UHJA 2H61A 2Q4UA 4GPLB 3CTNA 5HKYA 4DRWA 2WORA 2PSRA 1DJYA 1B4CA 1DF0B 5AEQA 2BL0B 3EVUA 1UHIA 4PHJA 4FQOA
chains in the Genus database with same CATH superfamily
2K7DA 2CBLA 2LMVA 5J3XA 4BY4A 3NHIA 2KFGA 1DJIA 4HRHA 3KEVA 1K96A 4PDZA 1IIOA 1DF0A 1SR6B 1G4YR 3CZ0A 2JTZA 1MWNA 5KTYA 1J7RA 4C0JA 1FW4A 2P71A 4YI9A 4OV2A 1BG1A 4CLNA 4NDCA 3OBVA 5CSJA 2KI6C 3B6XA 3D77A 2BKHB 3WXAA 2JULA 1B7TZ 1TNQA 4AQJA 2ZNDA 2HF5A 1OOGA 4YGDB 2E30A 3FIAA 3FE9A 3MSEB 2PYQA 2AMIA 1B8LA 3DY9A 2L0PA 2KOTA 2QEVA 4PE4A 1LINA 1XO5A 1CLLA 2KDHA 5BPJA 3RM1A 1B47A 4YI8A 1F71A 2WCEA 2K0JA 2NLNA 1WLZA 3A4UB 2KPHA 4PHMA 1K94A 2M9GA 3R1VA 2H61C 2KFFA 1OOJA 3DVEA 3SG7A 3TDUA 1DMOA 1QJTA 3C1VA 1XFWO 2BCXA 2JZIA 2EC6C 2KAYA 2JOJA 2KLDA 2WCJA 3FE6A 1FI6A 3L4LA 3NHTA 1MF8B 1BU3A 1CM4A 1KK8C 2BNXA 2ZKMX 1Y6WA 1OZOA 3PLFB 4QJ3B 2MLFC 1XYDA 1SPYA 3HX4A 5HKWA 1NX0A 1QATA 1JSAA 1MR8A 5D7FA 5ER4X 5TNCA 1DJHA 4USLA 3WHUB 1XFZO 1TRFA 1LVCD 4JKTA 1ZOTB 1F8HA 5DKNA 2JWWA 1J7QA 2VRGA 2WCFA 1Y1XA 4F0ZB 1YX8A 1CTRA 2MLEC 3BYAA 3PFVA 1L7ZA 4E68A 1QTXA 3M0WA 2MBXA 4D1EA 2L98A 4CPVA 2LMTA 1M31A 4TNCA 5IBWA 1RJVA 1J7PA 1SRAA 1CFCA 3VRQA 1WY9A 3IVTA 1F54A 1KFUS 1ZMZA 3D73A 5CPVA 3IF7A 1MHOA 2MHHA 1U5IB 1MXLC 1EG4A 2KYCA 4FQTA 1J55A 2LLTA 5FI2A 1UHKA 1CM1A 1QV1A 3NGVA 2PQLA 4HSZA 1U5IA 3N7HA 4XYNA 5GQQC 1L2OC 1TUZA 3TDZA 1P28A 4UPGA 1TIZA 1UURA 3JVTB 2GGMA 3KHEA 1NP8A 2IS9A 1S26D 4HREE 1OQPA 3OGNA 2Y1MA 4NDDA 1WRZA 2ZFDA 2HETA 1S36A 2JNXA 2RGIA 1K90D 1B8CA 3BXKA 1CLMA 2O5GA 1GM0A 5DKQA 1WRLA 1G8IA 2F2PA 3CLNA 4JWQA 2KBMA 1LS8A 1UUSA 2D8NA 2F3ZA 4ORCB 2LANA 1XVJA 1SBJA 1WRKA 1AJ5A 3DVJA 1SCMC 4MN0A 1A29A 2LP2A 1SL7A 1SCVA 1LA3A 1DEKA 1KWOC 1SK6D 1R6PA 2LHLA 2FJYA 2NXQA 1BF5A 4YGAA 1EH2A 3D0YB 3DVKA 4OZDA 1TCOB 4OVNF 1YUUA 3EK7A 1ZUZA 1OE9B 4A4BA 2PVBA 4NDBA 1QIVA 1LKJA 2I7AA 1DJWA 2Y1NA 1BLQA 4GNKB 1IJ6A 1NX2A 2G9BA 3SG2A 3O2PA 2F2OA 1XK4A 1TN4A 5PALA 4ORAB 2JNFA 2KAXA 1B9AA 3CR2A 1M39A 4PE0A 1PK0D 3UNWA 3S0GA 1IGVA 5KU1A 1RK9A 1G33A 3CYZA 3LLEA 2JPTA 2EC6B 3CABA 4KYNA 3LCPC 1QASA 4WQ2A 1HQVA 2LCPA 2LC5A 1KK8B 1NYAA 1BMOA 3NSIA 3I5IC 3VRNA 3BUOB 3O4XA 1A03A 1NPQA 1DT7B 1XFVO 2G2BA 2WC6A 2MRDA 5I2LA 3OB1B 4HRGA 2CTNA 4MLWA 1Y0VH 4PHKA 4NQGA 5DKRA 2KI6D 4OR9B 5B8IB 4P2YB 2M3WA 3HCMA 4N5XA 3A8RA 2WC5A 1MUXA 5ER5A 1B1GA 3TDIA 1JFKA 1OMVA 4P5OE 2CXJA 2LUXA 1KFXL 2BKIB 1NSHA 1VRKA 3B87A 1DQEA 3CS1A 3D78A 1KQMC 2M0RA 3EVRA 4MRXA 3SG5A 2LVJA 4I5NB 1BODA 2Y4QA 2Q91A 4R1EA 1XK4C 3V2LA 3ZWHA 5F6TA 1YUSA 2F8PA 1S6IA 2PASA 4PCWA 1R2UA 1QX7A 2LV7A 1L2OB 3GK2A 1PVBA 3TUYC 2WC8A 1DGUA 2QACA 1NUBA 5JOLA 2BBNA 3Q8IA 4OCIA 4ZCUA 2M29A 2M8UA 4ORBB 1GJYA 1QWVA 1J1DA 5AFPA 1W7JB 3S0EA 2LNKA 2SASA 1M63B 1SY9A 1CDMA 4OKHA 4QJ5B 2JT8A 4M2OA 1QXPA 2DOQA 3OX6A 3NXAA 4PT1A 1YVHA 4QJ4B 1CFPA 1B8RA 2JT3A 1WDCB 3SG6A 3SJSA 2ZRTA 1AK8A 2H2KA 1PSBA 1Z4HA 2O60A 4FTGA 3D75A 1A4PA 2K8MB 2BE4A 1SCMB 1OZSA 2FCEA 5D3OA 4C0LA 1FF1A 3I5FC 4CIDA 2Y5IA 2KI4C 3CZ1A 1CDNA 1HT9A 3FE8A 1BR4B 3AAKA 3AKAA 3H4SE 2JRFA 3IQQA 3DZTA 1DJXA 1F4OA 3VRRA 4PHNA 1YUTA 1N2DA 1K9PA 2WNDA 1KQVA 3NSKA 1KCYA 3EG5B 2L4IA 1OW4A 1TWOA 3QMEA 3TZ1A 2HPSA 4M2QA 4YGBB 1EXRA 2M1KB 1SR6C 2FCDA 3SS3A 4DS7A 2K61A 1M45A 1KK7Z 1IH0A 1BOCA 4YRUA 1MQ1A 3SIBA 1YURA 3SG3A 3PJIA 3BUXB 3DF0A 2L2CA 1F4QA 2BCBA 2LUCA 3I5IB 4GGFC 1IQ5A 2KQ6A 1SMGA 3BFBA 4AQIA 1JBAA 2I2RE 3D76A 1DELA 2K7OA 3EKHA 1KK7Y 1GGWA 2QEBA 2ZNEA 4N1FA 2M1UA 2L5XB 1DJZA 3BOWA 1KFUL 1CKKA 2WCKA 1QS7A 2JC2A 3NSOA 1QIWA 1NCYA 1H8BA 2MAZA 1GQMA 4MZJA 3FWBA 2CNPA 1S3PA 3CGAA 1FBVA 1TCFA 1MXEA 2NCOA 1V1FA 1F55A 3I5GC 1YRUB 1ZFSA 3I5HC 3OB2B 4MVFA 1KQMB 4MZLA 1SKTA 2LP3A 4JD9A 1ORGA 1C7WA 2WOSA 2MJWB 3R1PA 5I8NA 1FPWA 2HQ8A 3BFHA 4GUKA 5CSIA 2ZN9A 3R72A 5FI7A 1TNWA 3O4YA 4JPZB 1OMDA 1BR1B 3PM2A 5K89A 1AP4A 2PMYA 3OX5A 5HL1A 2ERBA 2NZ0A 2ZRSA 3PN7C 3TUYB 2QPTA 1JC2A 2JQ6A 1RWYA 3CR5X 4MZKA 1UHHA 1XFXO 2QEHA 1UHNA 3BQ3A 1K8UA 3EKJA 3F45A 3SS5A 3E3RA 1KSMA 4PE7A 2GTEA 2BCAA 1J7OA 4C0KA 4WQ3A 1GGZA 4WRIA 3TS5C 1DVIA 2L4HA 1K2HA 5FYXA 3CWGA 2V53A 1ALVA 1A75B 1LA0A 2OS8C 1XFYO 3DVMA 2LVVA 1IQ3A 1OOHA 4M2PA 3JTDC 3VRPA 2BBMA 2PALA 2KSPA 3FS7A 1Z2CB 2L5YA 4DIRA 1A75A 1NCXA 3I5FB 1DTLA 3OP0A 2LM5A 1PVAA 2COLB 2OPOA 2KNEA 3CR4X 5HLVA 2KGBC 2KI4B 2MA2A 2BE6A 4DCKA 2AUCA 4ICBA 3S0DA 2SCPA 3EVVA 4I5LB 1AHRA 3JVTC 1TUJA 4PE1A 2KGRA 3L4AA 1CFDA 2M7LA 3ZNIA 4IL1A 5HYDA 2KFHA 3EK8A 1CFFA 2A4JA 2KYFA 1YVLA 3IQOA 3ICBA 4GGNA 5KSZA 3SG4A 5I2QA 5FI6A 3FWCA 1TTXA 1YX7A 2GV5A 1TNPA 4I5KA 4PALA 1UP5A 3AKBA 5JJGA 1A2XA 1DC1A 3DXLA 1BJFA 2WCHA 1CNPA 1D1OA 1IWQA 1XFUO 2AAOA 5CSFA 5AXIA 3WHTB 2I18A 3S0FA 2I94A 3DYEA 3K1EA 2CT9A 4F7FA 1TOPA 2KAVA 3L47A 5HLOA 3BUNB 2LAPA 3SIAA 1QLSA 2F3YA 2LHIA 2WCLA 1J1EA 1M46A 1QVIZ 2JU0A 3KO0A 3KPXA 2LVIA 4GGFA 1YR5A 4MBEA 5I2OA 1NCZA 1IKUA 2BAPA 1QX2A 1YRTB 2L50A 2OTGC 1ODBA 3BJHA 3RLZA 1C07A 5CSNA 4INWA 3K21A 3B7AA 1LXFC 1B7TY 2JTTA 2H8VA 4GBAA 3LK0A 3O6BA 1KWOB 1OOFA 1QVIY 1PULA 1FI5A 1EG3A 3NSLA 1JF2A 1BT6A 1SL9A 1T14A 1UWOA 1W9ZA 1K93D 3BUWB 1OSAA 3D74A 3I5GB 3WNXB 2ZN8A 3I5HB 2BECA 5D69A 4A4CA 1JWDA 2L51A 4MSPA 1QX5B 3EK4A 4N1GA 3GK4X 4INXA 3GK1A 1C7VA 2K60A 3DD4A 2BL0C 2L2EA 1F70A 1S5GZ 4MRYA 1NX1A 3PN7B 1NIWA 2LVKA 3B86A 1K9KA 1K95A 4AOMA 2JXCA 1C3YA 2K2AA 3R1OA 3DF0B 1JF0A 1SNLA 1YTZC 1CDLA 5HKZA 2KBIA 4YGCB 1S6JA 4U8DA 1IG5A 3AAJA 1S5GY 3GOFA 3PATA 3S0AA 1NX3A 2KHNA 1WLMA 1E8AA 3TS5B 1IRJA 1TNXA 5DICA 5AERA 1JFJA 4YBHB 3LK1A 3O78A 3RZSA 3BFAA 4IJ7A 4DUQA 3BOWB 1Q80A 1RFJA 2OS8B 2P6BB 2KQYA 2PRUA 2GGZA 2FJUB 3VROA 2EGDA 1SW8A 3JTDB 2JT0A 4L9MA 1KSOA 4I5JA 1CDPA 2M7NA 1N65A 2K2FA 5AANA 1PSRA 2M97A 1IJ5A 3KF9A 3PALA 1S6CA 2E6WA 1EL4A 1RROA 1OOIX 1RTP1 1ZACA 4CFRA 1V1GA 2LLUA 3UO9A 4GAOA 1SSEB 2CCMA 2YGUA 3OHMB 1C3ZA 3BUMB 1QV0A 1PALA 4ETOA 1WDCC 2P70A 2HQWA 1AJ4A 3LL8B 2LMUA 4XJKB 4YGEB 3SS4A 5G08A 4ZCVA 3B88A 1QLKA 1N0YA 1DJGA 2R2IA 4XJKA 1CMFA 2NCPA 1CMGA 4CFQA 4MEWA 1EJ3A 1NWDA 3CZTX 2JXLA 3PM8A 2K7CA 2M49B 4GFTA 4BY5A 2KLEA 5EL2A 3VGOA 3D0YA 3CZ2A 2OTGB 2JPOA 4JQ0D 1OMRA 2TN4A 2F33A 1W7IB 1SL8A 3PSRA 1ALWA 2FOTA 1H4BA 2EHBA 1Y1AA 1K9UA 3D10A 3QRXA 2K7BA 2ISDA 1SYMA 1PRWA 1DGVA 2WCMA 1KFXS 3VB1A 1S1EA 3CDNA 1X02A 1XA5A 1JUOA 1AVSA 1RECA 1AUIB 2LLSA 4Q04A 2QDIA 1CLBA 1Y1UA 2WCBA 1CB1A 2B1UA 2LE9B 1UHJA 2H61A 2Q4UA 4GPLB 3CTNA 5HKYA 5I94A 4DRWA 2WORA 2PSRA 2QEOA 1DJYA 1B4CA 1DF0B 5AEQA 3S0BA 2BL0B 3EVUA 1UHIA 1XFRA 4PHJA 4FQOA
chains in the Genus database with same CATH topology
2K7DA 2CBLA 2LMVA 5J3XA 4BY4A 2KFGA 1DJIA 4HRHA 3KEVA 1K96A 4PDZA 1DF0A 1SR6B 1G4YR 5KTYA 2JTZA 1MWNA 1J7RA 4C0JA 1FW4A 4YI9A 4OV2A 1BG1A 4CLNA 4NDCA 5CSJA 2KI6C 2BKHB 3WXAA 2JULA 1B7TZ 1TNQA 4AQJA 2ZNDA 2HF5A 4YGDB 2E30A 3FIAA 3MSEB 2AMIA 1B8LA 2L0PA 2KOTA 4PE4A 1LINA 1XO5A 1CLLA 2KDHA 5BPJA 3RM1A 1B47A 4YI8A 1F71A 2WCEA 2K0JA 2NLNA 1WLZA 3A4UB 4PHMA 1K94A 2M9GA 2H61C 2KFFA 1OOJA 3DVEA 3SG7A 3TDUA 1DMOA 1QJTA 3C1VA 1XFWO 2BCXA 2JZIA 2EC6C 2KAYA 2JOJA 1FI6A 1MF8B 1BU3A 1CM4A 1KK8C 2ZKMX 4QJ3B 1Y6WA 1OZOA 3PLFB 2MLFC 1XYDA 1SPYA 3HX4A 5HKWA 1NX0A 1QATA 1JSAA 1MR8A 5D7FA 5ER4X 5TNCA 1DJHA 4USLA 3WHUB 1XFZO 1TRFA 1LVCD 1ZOTB 1F8HA 5DKNA 2JWWA 1J7QA 2VRGA 2WCFA 1Y1XA 4F0ZB 1YX8A 1CTRA 2MLEC 3BYAA 3PFVA 1L7ZA 4E68A 1QTXA 3M0WA 2MBXA 4D1EA 2L98A 4CPVA 2LMTA 1M31A 4TNCA 5IBWA 1RJVA 1J7PA 1SRAA 1CFCA 3VRQA 1WY9A 1F54A 1KFUS 1ZMZA 5CPVA 3IF7A 1MHOA 2MHHA 1U5IB 1MXLC 1EG4A 2KYCA 1J55A 2LLTA 1UHKA 1CM1A 1QV1A 4HSZA 1U5IA 4XYNA 5GQQC 1L2OC 3TDZA 4UPGA 1TIZA 1UURA 3JVTB 2GGMA 3KHEA 1NP8A 2IS9A 1S26D 4HREE 1OQPA 2Y1MA 4NDDA 1WRZA 2ZFDA 2HETA 1S36A 2JNXA 2RGIA 1K90D 1B8CA 3BXKA 1CLMA 2O5GA 5DKQA 1WRLA 1G8IA 2F2PA 3CLNA 4JWQA 2KBMA 1UUSA 2D8NA 2F3ZA 4ORCB 2LANA 1XVJA 1SBJA 1WRKA 1AJ5A 3DVJA 1SCMC 4MN0A 1A29A 2LP2A 1SL7A 1SCVA 1LA3A 1KWOC 1SK6D 1R6PA 2LHLA 1BF5A 2NXQA 4YGAA 1EH2A 3D0YB 3DVKA 1TCOB 4OVNF 1YUUA 3EK7A 1ZUZA 1OE9B 4A4BA 2PVBA 4NDBA 1QIVA 1LKJA 2I7AA 1DJWA 2Y1NA 1BLQA 4GNKB 1IJ6A 1NX2A 2G9BA 3SG2A 3O2PA 2F2OA 1XK4A 1TN4A 5PALA 4ORAB 2JNFA 2KAXA 1B9AA 3CR2A 1M39A 4PE0A 1PK0D 5KU1A 1IGVA 1RK9A 1G33A 3LLEA 2JPTA 2EC6B 3LCPC 1QASA 4WQ2A 1HQVA 2LCPA 2LC5A 1KK8B 1NYAA 1BMOA 3NSIA 3I5IC 3VRNA 3BUOB 1A03A 1NPQA 1DT7B 1XFVO 2G2BA 2MRDA 5I2LA 3OB1B 4HRGA 2CTNA 4MLWA 1Y0VH 4PHKA 4NQGA 5DKRA 2KI6D 4OR9B 5B8IB 4P2YB 2M3WA 3HCMA 4N5XA 3A8RA 1MUXA 5ER5A 1B1GA 3TDIA 1JFKA 1OMVA 4P5OE 2CXJA 2LUXA 1KFXL 2BKIB 1NSHA 1VRKA 3CS1A 3EVRA 1KQMC 2M0RA 4MRXA 3SG5A 2LVJA 4I5NB 1BODA 2Y4QA 2Q91A 4R1EA 1XK4C 3ZWHA 5F6TA 1YUSA 2F8PA 1S6IA 2PASA 4PCWA 1R2UA 1QX7A 2LV7A 1L2OB 3GK2A 1PVBA 3TUYC 2WC8A 1DGUA 2QACA 1NUBA 5JOLA 2BBNA 4OCIA 4ZCUA 2M29A 2M8UA 4ORBB 1GJYA 5AFPA 1J1DA 1W7JB 2LNKA 2SASA 1M63B 1SY9A 1CDMA 4OKHA 4QJ5B 2JT8A 4M2OA 1QXPA 2DOQA 3OX6A 3NXAA 1CFPA 1YVHA 4QJ4B 1B8RA 2JT3A 1WDCB 3SG6A 3SJSA 2ZRTA 1AK8A 2H2KA 1PSBA 2O60A 4FTGA 1A4PA 2K8MB 2BE4A 1SCMB 1OZSA 2FCEA 4C0LA 1FF1A 3I5FC 4CIDA 2Y5IA 2KI4C 1CDNA 1HT9A 1BR4B 3AAKA 3AKAA 3H4SE 2JRFA 3IQQA 1DJXA 1F4OA 3VRRA 4PHNA 1YUTA 1N2DA 1K9PA 2WNDA 1KQVA 3NSKA 1KCYA 2L4IA 3TZ1A 2HPSA 4M2QA 4YGBB 1EXRA 2M1KB 1SR6C 2FCDA 4DS7A 2K61A 1M45A 1KK7Z 1IH0A 1BOCA 4YRUA 1MQ1A 3SIBA 1YURA 3SG3A 3BUXB 3DF0A 1F4QA 2BCBA 2LUCA 3I5IB 4GGFC 1IQ5A 2KQ6A 1SMGA 4AQIA 1JBAA 2I2RE 2K7OA 3EKHA 1KK7Y 1GGWA 2ZNEA 4N1FA 2M1UA 2L5XB 1DJZA 3BOWA 1KFUL 1CKKA 1QS7A 2JC2A 3NSOA 1QIWA 1NCYA 1H8BA 2MAZA 1GQMA 4MZJA 3FWBA 2CNPA 1S3PA 3CGAA 1FBVA 1TCFA 1MXEA 2NCOA 1V1FA 1F55A 3I5GC 1YRUB 1ZFSA 3I5HC 3OB2B 4MVFA 1KQMB 4MZLA 1SKTA 2LP3A 1C7WA 2WOSA 2MJWB 5I8NA 1FPWA 2HQ8A 4GUKA 5CSIA 2ZN9A 1TNWA 3O4YA 4JPZB 1OMDA 1BR1B 5K89A 1AP4A 2PMYA 3OX5A 2NZ0A 2ZRSA 3PN7C 3TUYB 2QPTA 1JC2A 2JQ6A 1RWYA 3CR5X 4MZKA 1UHHA 1XFXO 1UHNA 3BQ3A 1K8UA 3EKJA 3F45A 3E3RA 1KSMA 4PE7A 2BCAA 1J7OA 4C0KA 4WQ3A 1GGZA 4WRIA 3TS5C 1DVIA 2L4HA 1K2HA 5FYXA 3CWGA 2V53A 1ALVA 1A75B 1LA0A 2OS8C 1XFYO 3DVMA 2LVVA 1IQ3A 4M2PA 3JTDC 3VRPA 2BBMA 2PALA 2KSPA 3FS7A 4DIRA 1A75A 1NCXA 3I5FB 1DTLA 3OP0A 2LM5A 1PVAA 2COLB 2OPOA 2KNEA 3CR4X 5HLVA 2KGBC 2KI4B 2MA2A 2BE6A 4DCKA 2AUCA 4ICBA 2SCPA 3EVVA 4I5LB 1AHRA 3JVTC 4PE1A 2KGRA 1CFDA 2M7LA 3ZNIA 4IL1A 5HYDA 2KFHA 3EK8A 1CFFA 2A4JA 2KYFA 1YVLA 3IQOA 3ICBA 4GGNA 5KSZA 3SG4A 5I2QA 3FWCA 1TTXA 1YX7A 2GV5A 1TNPA 4I5KA 4PALA 1UP5A 3AKBA 5JJGA 1A2XA 1BJFA 1CNPA 1D1OA 1IWQA 1XFUO 2AAOA 5CSFA 5AXIA 3WHTB 2I18A 2I94A 2CT9A 1TOPA 2KAVA 5HLOA 3BUNB 2LAPA 3SIAA 1QLSA 2F3YA 2LHIA 3KO0A 1J1EA 1M46A 1QVIZ 2JU0A 3KPXA 2LVIA 4GGFA 1YR5A 4MBEA 5I2OA 1NCZA 1IKUA 1QX2A 1YRTB 2L50A 2OTGC 1ODBA 3RLZA 1C07A 5CSNA 3K21A 1LXFC 1B7TY 2JTTA 4GBAA 3LK0A 3O6BA 1KWOB 1QVIY 1PULA 1FI5A 1EG3A 3NSLA 1JF2A 1BT6A 1SL9A 1UWOA 1K93D 3BUWB 1OSAA 3I5GB 3WNXB 2ZN8A 3I5HB 2BECA 5D69A 4A4CA 1JWDA 2L51A 4MSPA 1QX5B 3EK4A 4N1GA 3GK4X 3GK1A 1C7VA 3DD4A 2BL0C 2L2EA 1F70A 1S5GZ 4MRYA 1NX1A 3PN7B 1NIWA 2LVKA 1K9KA 1K95A 4AOMA 2JXCA 2K2AA 3DF0B 1JF0A 1SNLA 1YTZC 1CDLA 5HKZA 2KBIA 4YGCB 1S6JA 4U8DA 1IG5A 3AAJA 1S5GY 3GOFA 3PATA 1NX3A 2KHNA 1WLMA 1E8AA 3TS5B 1IRJA 1TNXA 5AERA 1JFJA 4YBHB 3LK1A 3O78A 4DUQA 3BOWB 1Q80A 1RFJA 2OS8B 2P6BB 2KQYA 2PRUA 2GGZA 2FJUB 3VROA 2EGDA 1SW8A 3JTDB 2JT0A 4L9MA 1KSOA 4I5JA 1CDPA 2M7NA 1N65A 2K2FA 5AANA 1PSRA 2M97A 1IJ5A 3KF9A 3PALA 1S6CA 2E6WA 1EL4A 1RROA 1RTP1 1ZACA 4CFRA 1V1GA 2LLUA 4GAOA 2CCMA 3OHMB 3BUMB 1QV0A 1PALA 4ETOA 1WDCC 2HQWA 1AJ4A 3LL8B 2LMUA 4XJKB 4YGEB 5G08A 4ZCVA 1QLKA 1N0YA 1DJGA 2R2IA 4XJKA 1CMFA 2NCPA 1CMGA 4CFQA 4MEWA 1EJ3A 1NWDA 3CZTX 2JXLA 3PM8A 2K7CA 2M49B 4GFTA 4BY5A 3VGOA 3D0YA 2OTGB 4JQ0D 1OMRA 2TN4A 2F33A 1W7IB 1SL8A 3PSRA 1ALWA 2FOTA 1H4BA 2EHBA 1Y1AA 1K9UA 3D10A 3QRXA 2K7BA 2ISDA 1SYMA 1PRWA 1DGVA 1KFXS 1S1EA 1X02A 1XA5A 1JUOA 1AVSA 1RECA 1AUIB 2LLSA 4Q04A 1CLBA 1Y1UA 2WCBA 1CB1A 2B1UA 2LE9B 1UHJA 2H61A 2Q4UA 4GPLB 3CTNA 5HKYA 4DRWA 2WORA 2PSRA 1DJYA 1B4CA 1DF0B 5AEQA 2BL0B 3EVUA 1UHIA 4PHJA 4FQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K7D A;  2CBL A;  2LMV A;  5J3X A;  4BY4 A;  2KFG A;  1DJI A;  4HRH A;  3KEV A;  1K96 A;  4PDZ A;  1DF0 A;  1SR6 B;  1G4Y R;  5KTY A;  2JTZ A;  1MWN A;  1J7R A;  4C0J A;  1FW4 A;  4YI9 A;  4OV2 A;  1BG1 A;  4CLN A;  4NDC A;  5CSJ A;  2KI6 C;  2BKH B;  3WXA A;  2JUL A;  1B7T Z;  1TNQ A;  4AQJ A;  2ZND A;  2HF5 A;  4YGD B;  2E30 A;  3FIA A;  3MSE B;  2AMI A;  1B8L A;  2L0P A;  2KOT A;  4PE4 A;  1LIN A;  1XO5 A;  1CLL A;  2KDH A;  5BPJ A;  3RM1 A;  1B47 A;  4YI8 A;  1F71 A;  2WCE A;  2K0J A;  2NLN A;  1WLZ A;  3A4U B;  4PHM A;  1K94 A;  2M9G A;  2H61 C;  2KFF A;  1OOJ A;  3DVE A;  3SG7 A;  3TDU A;  1DMO A;  1QJT A;  3C1V A;  1XFW O;  2BCX A;  2JZI A;  2EC6 C;  2KAY A;  2JOJ A;  1FI6 A;  1MF8 B;  1BU3 A;  1CM4 A;  1KK8 C;  2ZKM X;  4QJ3 B;  1Y6W A;  1OZO A;  3PLF B;  2MLF C;  1XYD A;  1SPY A;  3HX4 A;  5HKW A;  1NX0 A;  1QAT A;  1JSA A;  1MR8 A;  5D7F A;  5ER4 X;  5TNC A;  1DJH A;  4USL A;  3WHU B;  1XFZ O;  1TRF A;  1LVC D;  1ZOT B;  1F8H A;  5DKN A;  2JWW A;  1J7Q A;  2VRG A;  2WCF A;  1Y1X A;  4F0Z B;  1YX8 A;  1CTR A;  2MLE C;  3BYA A;  3PFV A;  1L7Z A;  4E68 A;  1QTX A;  3M0W A;  2MBX A;  4D1E A;  2L98 A;  4CPV A;  2LMT A;  1M31 A;  4TNC A;  5IBW A;  1RJV A;  1J7P A;  1SRA A;  1CFC A;  3VRQ A;  1WY9 A;  1F54 A;  1KFU S;  1ZMZ A;  5CPV A;  3IF7 A;  1MHO A;  2MHH A;  1U5I B;  1MXL C;  1EG4 A;  2KYC A;  1J55 A;  2LLT A;  1UHK A;  1CM1 A;  1QV1 A;  4HSZ A;  1U5I A;  4XYN A;  5GQQ C;  1L2O C;  3TDZ A;  4UPG A;  1TIZ A;  1UUR A;  3JVT B;  2GGM A;  3KHE A;  1NP8 A;  2IS9 A;  1S26 D;  4HRE E;  1OQP A;  2Y1M A;  4NDD A;  1WRZ A;  2ZFD A;  2HET A;  1S36 A;  2JNX A;  2RGI A;  1K90 D;  1B8C A;  3BXK A;  1CLM A;  2O5G A;  5DKQ A;  1WRL A;  1G8I A;  2F2P A;  3CLN A;  4JWQ A;  2KBM A;  1UUS A;  2D8N A;  2F3Z A;  4ORC B;  2LAN A;  1XVJ A;  1SBJ A;  1WRK A;  1AJ5 A;  3DVJ A;  1SCM C;  4MN0 A;  1A29 A;  2LP2 A;  1SL7 A;  1SCV A;  1LA3 A;  1KWO C;  1SK6 D;  1R6P A;  2LHL A;  1BF5 A;  2NXQ A;  4YGA A;  1EH2 A;  3D0Y B;  3DVK A;  1TCO B;  4OVN F;  1YUU A;  3EK7 A;  1ZUZ A;  1OE9 B;  4A4B A;  2PVB A;  4NDB A;  1QIV A;  1LKJ A;  2I7A A;  1DJW A;  2Y1N A;  1BLQ A;  4GNK B;  1IJ6 A;  1NX2 A;  2G9B A;  3SG2 A;  3O2P A;  2F2O A;  1XK4 A;  1TN4 A;  5PAL A;  4ORA B;  2JNF A;  2KAX A;  1B9A A;  3CR2 A;  1M39 A;  4PE0 A;  1PK0 D;  5KU1 A;  1IGV A;  1RK9 A;  1G33 A;  3LLE A;  2JPT A;  2EC6 B;  3LCP C;  1QAS A;  4WQ2 A;  1HQV A;  2LCP A;  2LC5 A;  1KK8 B;  1NYA A;  1BMO A;  3NSI A;  3I5I C;  3VRN A;  3BUO B;  1A03 A;  1NPQ A;  1DT7 B;  1XFV O;  2G2B A;  2MRD A;  5I2L A;  3OB1 B;  4HRG A;  2CTN A;  4MLW A;  1Y0V H;  4PHK A;  4NQG A;  5DKR A;  2KI6 D;  4OR9 B;  5B8I B;  4P2Y B;  2M3W A;  3HCM A;  4N5X A;  3A8R A;  1MUX A;  5ER5 A;  1B1G A;  3TDI A;  1JFK A;  1OMV A;  4P5O E;  2CXJ A;  2LUX A;  1KFX L;  2BKI B;  1NSH A;  1VRK A;  3CS1 A;  3EVR A;  1KQM C;  2M0R A;  4MRX A;  3SG5 A;  2LVJ A;  4I5N B;  1BOD A;  2Y4Q A;  2Q91 A;  4R1E A;  1XK4 C;  3ZWH A;  5F6T A;  1YUS A;  2F8P A;  1S6I A;  2PAS A;  4PCW A;  1R2U A;  1QX7 A;  2LV7 A;  1L2O B;  3GK2 A;  1PVB A;  3TUY C;  2WC8 A;  1DGU A;  2QAC A;  1NUB A;  5JOL A;  2BBN A;  4OCI A;  4ZCU A;  2M29 A;  2M8U A;  4ORB B;  1GJY A;  5AFP A;  1J1D A;  1W7J B;  2LNK A;  2SAS A;  1M63 B;  1SY9 A;  1CDM A;  4OKH A;  4QJ5 B;  2JT8 A;  4M2O A;  1QXP A;  2DOQ A;  3OX6 A;  3NXA A;  1CFP A;  1YVH A;  4QJ4 B;  1B8R A;  2JT3 A;  1WDC B;  3SG6 A;  3SJS A;  2ZRT A;  1AK8 A;  2H2K A;  1PSB A;  2O60 A;  4FTG A;  1A4P A;  2K8M B;  2BE4 A;  1SCM B;  1OZS A;  2FCE A;  4C0L A;  1FF1 A;  3I5F C;  4CID A;  2Y5I A;  2KI4 C;  1CDN A;  1HT9 A;  1BR4 B;  3AAK A;  3AKA A;  3H4S E;  2JRF A;  3IQQ A;  1DJX A;  1F4O A;  3VRR A;  4PHN A;  1YUT A;  1N2D A;  1K9P A;  2WND A;  1KQV A;  3NSK A;  1KCY A;  2L4I A;  3TZ1 A;  2HPS A;  4M2Q A;  4YGB B;  1EXR A;  2M1K B;  1SR6 C;  2FCD A;  4DS7 A;  2K61 A;  1M45 A;  1KK7 Z;  1IH0 A;  1BOC A;  4YRU A;  1MQ1 A;  3SIB A;  1YUR A;  3SG3 A;  3BUX B;  3DF0 A;  1F4Q A;  2BCB A;  2LUC A;  3I5I B;  4GGF C;  1IQ5 A;  2KQ6 A;  1SMG A;  4AQI A;  1JBA A;  2I2R E;  2K7O A;  3EKH A;  1KK7 Y;  1GGW A;  2ZNE A;  4N1F A;  2M1U A;  2L5X B;  1DJZ A;  3BOW A;  1KFU L;  1CKK A;  1QS7 A;  2JC2 A;  3NSO A;  1QIW A;  1NCY A;  1H8B A;  2MAZ A;  1GQM A;  4MZJ A;  3FWB A;  2CNP A;  1S3P A;  3CGA A;  1FBV A;  1TCF A;  1MXE A;  2NCO A;  1V1F A;  1F55 A;  3I5G C;  1YRU B;  1ZFS A;  3I5H C;  3OB2 B;  4MVF A;  1KQM B;  4MZL A;  1SKT A;  2LP3 A;  1C7W A;  2WOS A;  2MJW B;  5I8N A;  1FPW A;  2HQ8 A;  4GUK A;  5CSI A;  2ZN9 A;  1TNW A;  3O4Y A;  4JPZ B;  1OMD A;  1BR1 B;  5K89 A;  1AP4 A;  2PMY A;  3OX5 A;  2NZ0 A;  2ZRS A;  3PN7 C;  3TUY B;  2QPT A;  1JC2 A;  2JQ6 A;  1RWY A;  3CR5 X;  4MZK A;  1UHH A;  1XFX O;  1UHN A;  3BQ3 A;  1K8U A;  3EKJ A;  3F45 A;  3E3R A;  1KSM A;  4PE7 A;  2BCA A;  1J7O A;  4C0K A;  4WQ3 A;  1GGZ A;  4WRI A;  3TS5 C;  1DVI A;  2L4H A;  1K2H A;  5FYX A;  3CWG A;  2V53 A;  1ALV A;  1A75 B;  1LA0 A;  2OS8 C;  1XFY O;  3DVM A;  2LVV A;  1IQ3 A;  4M2P A;  3JTD C;  3VRP A;  2BBM A;  2PAL A;  2KSP A;  3FS7 A;  4DIR A;  1A75 A;  1NCX A;  3I5F B;  1DTL A;  3OP0 A;  2LM5 A;  1PVA A;  2COL B;  2OPO A;  2KNE A;  3CR4 X;  5HLV A;  2KGB C;  2KI4 B;  2MA2 A;  2BE6 A;  4DCK A;  2AUC A;  4ICB A;  2SCP A;  3EVV A;  4I5L B;  1AHR A;  3JVT C;  4PE1 A;  2KGR A;  1CFD A;  2M7L A;  3ZNI A;  4IL1 A;  5HYD A;  2KFH A;  3EK8 A;  1CFF A;  2A4J A;  2KYF A;  1YVL A;  3IQO A;  3ICB A;  4GGN A;  5KSZ A;  3SG4 A;  5I2Q A;  3FWC A;  1TTX A;  1YX7 A;  2GV5 A;  1TNP A;  4I5K A;  4PAL A;  1UP5 A;  3AKB A;  5JJG A;  1A2X A;  1BJF A;  1CNP A;  1D1O A;  1IWQ A;  1XFU O;  2AAO A;  5CSF A;  5AXI A;  3WHT B;  2I18 A;  2I94 A;  2CT9 A;  1TOP A;  2KAV A;  5HLO A;  3BUN B;  2LAP A;  3SIA A;  1QLS A;  2F3Y A;  2LHI A;  3KO0 A;  1J1E A;  1M46 A;  1QVI Z;  2JU0 A;  3KPX A;  2LVI A;  4GGF A;  1YR5 A;  4MBE A;  5I2O A;  1NCZ A;  1IKU A;  1QX2 A;  1YRT B;  2L50 A;  2OTG C;  1ODB A;  3RLZ A;  1C07 A;  5CSN A;  3K21 A;  1LXF C;  1B7T Y;  2JTT A;  4GBA A;  3LK0 A;  3O6B A;  1KWO B;  1QVI Y;  1PUL A;  1FI5 A;  1EG3 A;  3NSL A;  1JF2 A;  1BT6 A;  1SL9 A;  1UWO A;  1K93 D;  3BUW B;  1OSA A;  3I5G B;  3WNX B;  2ZN8 A;  3I5H B;  2BEC A;  5D69 A;  4A4C A;  1JWD A;  2L51 A;  4MSP A;  1QX5 B;  3EK4 A;  4N1G A;  3GK4 X;  3GK1 A;  1C7V A;  3DD4 A;  2BL0 C;  2L2E A;  1F70 A;  1S5G Z;  4MRY A;  1NX1 A;  3PN7 B;  1NIW A;  2LVK A;  1K9K A;  1K95 A;  4AOM A;  2JXC A;  2K2A A;  3DF0 B;  1JF0 A;  1SNL A;  1YTZ C;  1CDL A;  5HKZ A;  2KBI A;  4YGC B;  1S6J A;  4U8D A;  1IG5 A;  3AAJ A;  1S5G Y;  3GOF A;  3PAT A;  1NX3 A;  2KHN A;  1WLM A;  1E8A A;  3TS5 B;  1IRJ A;  1TNX A;  5AER A;  1JFJ A;  4YBH B;  3LK1 A;  3O78 A;  4DUQ A;  3BOW B;  1Q80 A;  1RFJ A;  2OS8 B;  2P6B B;  2KQY A;  2PRU A;  2GGZ A;  2FJU B;  3VRO A;  2EGD A;  1SW8 A;  3JTD B;  2JT0 A;  4L9M A;  1KSO A;  4I5J A;  1CDP A;  2M7N A;  1N65 A;  2K2F A;  5AAN A;  1PSR A;  2M97 A;  1IJ5 A;  3KF9 A;  3PAL A;  1S6C A;  2E6W A;  1EL4 A;  1RRO A;  1RTP 1;  1ZAC A;  4CFR A;  1V1G A;  2LLU A;  4GAO A;  2CCM A;  3OHM B;  3BUM B;  1QV0 A;  1PAL A;  4ETO A;  1WDC C;  2HQW A;  1AJ4 A;  3LL8 B;  2LMU A;  4XJK B;  4YGE B;  5G08 A;  4ZCV A;  1QLK A;  1N0Y A;  1DJG A;  2R2I A;  4XJK A;  1CMF A;  2NCP A;  1CMG A;  4CFQ A;  4MEW A;  1EJ3 A;  1NWD A;  3CZT X;  2JXL A;  3PM8 A;  2K7C A;  2M49 B;  4GFT A;  4BY5 A;  3VGO A;  3D0Y A;  2OTG B;  4JQ0 D;  1OMR A;  2TN4 A;  2F33 A;  1W7I B;  1SL8 A;  3PSR A;  1ALW A;  2FOT A;  1H4B A;  2EHB A;  1Y1A A;  1K9U A;  3D10 A;  3QRX A;  2K7B A;  2ISD A;  1SYM A;  1PRW A;  1DGV A;  1KFX S;  1S1E A;  1X02 A;  1XA5 A;  1JUO A;  1AVS A;  1REC A;  1AUI B;  2LLS A;  4Q04 A;  1CLB A;  1Y1U A;  2WCB A;  1CB1 A;  2B1U A;  2LE9 B;  1UHJ A;  2H61 A;  2Q4U A;  4GPL B;  3CTN A;  5HKY A;  4DRW A;  2WOR A;  2PSR A;  1DJY A;  1B4C A;  1DF0 B;  5AEQ A;  2BL0 B;  3EVU A;  1UHI A;  4PHJ A;  4FQO A; 
#chains in the Genus database with same CATH topology
 2K7D A;  2CBL A;  2LMV A;  5J3X A;  4BY4 A;  3NHI A;  2KFG A;  1DJI A;  4HRH A;  3KEV A;  1K96 A;  4PDZ A;  1IIO A;  1DF0 A;  1SR6 B;  1G4Y R;  3CZ0 A;  2JTZ A;  1MWN A;  5KTY A;  1J7R A;  4C0J A;  1FW4 A;  2P71 A;  4YI9 A;  4OV2 A;  1BG1 A;  4CLN A;  4NDC A;  3OBV A;  5CSJ A;  2KI6 C;  3B6X A;  3D77 A;  2BKH B;  3WXA A;  2JUL A;  1B7T Z;  1TNQ A;  4AQJ A;  2ZND A;  2HF5 A;  1OOG A;  4YGD B;  2E30 A;  3FIA A;  3FE9 A;  3MSE B;  2PYQ A;  2AMI A;  1B8L A;  3DY9 A;  2L0P A;  2KOT A;  2QEV A;  4PE4 A;  1LIN A;  1XO5 A;  1CLL A;  2KDH A;  5BPJ A;  3RM1 A;  1B47 A;  4YI8 A;  1F71 A;  2WCE A;  2K0J A;  2NLN A;  1WLZ A;  3A4U B;  2KPH A;  4PHM A;  1K94 A;  2M9G A;  3R1V A;  2H61 C;  2KFF A;  1OOJ A;  3DVE A;  3SG7 A;  3TDU A;  1DMO A;  1QJT A;  3C1V A;  1XFW O;  2BCX A;  2JZI A;  2EC6 C;  2KAY A;  2JOJ A;  2KLD A;  2WCJ A;  3FE6 A;  1FI6 A;  3L4L A;  3NHT A;  1MF8 B;  1BU3 A;  1CM4 A;  1KK8 C;  2BNX A;  2ZKM X;  1Y6W A;  1OZO A;  3PLF B;  4QJ3 B;  2MLF C;  1XYD A;  1SPY A;  3HX4 A;  5HKW A;  1NX0 A;  1QAT A;  1JSA A;  1MR8 A;  5D7F A;  5ER4 X;  5TNC A;  1DJH A;  4USL A;  3WHU B;  1XFZ O;  1TRF A;  1LVC D;  4JKT A;  1ZOT B;  1F8H A;  5DKN A;  2JWW A;  1J7Q A;  2VRG A;  2WCF A;  1Y1X A;  4F0Z B;  1YX8 A;  1CTR A;  2MLE C;  3BYA A;  3PFV A;  1L7Z A;  4E68 A;  1QTX A;  3M0W A;  2MBX A;  4D1E A;  2L98 A;  4CPV A;  2LMT A;  1M31 A;  4TNC A;  5IBW A;  1RJV A;  1J7P A;  1SRA A;  1CFC A;  3VRQ A;  1WY9 A;  3IVT A;  1F54 A;  1KFU S;  1ZMZ A;  3D73 A;  5CPV A;  3IF7 A;  1MHO A;  2MHH A;  1U5I B;  1MXL C;  1EG4 A;  2KYC A;  4FQT A;  1J55 A;  2LLT A;  5FI2 A;  1UHK A;  1CM1 A;  1QV1 A;  3NGV A;  2PQL A;  4HSZ A;  1U5I A;  3N7H A;  4XYN A;  5GQQ C;  1L2O C;  1TUZ A;  3TDZ A;  1P28 A;  4UPG A;  1TIZ A;  1UUR A;  3JVT B;  2GGM A;  3KHE A;  1NP8 A;  2IS9 A;  1S26 D;  4HRE E;  1OQP A;  3OGN A;  2Y1M A;  4NDD A;  1WRZ A;  2ZFD A;  2HET A;  1S36 A;  2JNX A;  2RGI A;  1K90 D;  1B8C A;  3BXK A;  1CLM A;  2O5G A;  1GM0 A;  5DKQ A;  1WRL A;  1G8I A;  2F2P A;  3CLN A;  4JWQ A;  2KBM A;  1LS8 A;  1UUS A;  2D8N A;  2F3Z A;  4ORC B;  2LAN A;  1XVJ A;  1SBJ A;  1WRK A;  1AJ5 A;  3DVJ A;  1SCM C;  4MN0 A;  1A29 A;  2LP2 A;  1SL7 A;  1SCV A;  1LA3 A;  1DEK A;  1KWO C;  1SK6 D;  1R6P A;  2LHL A;  2FJY A;  2NXQ A;  1BF5 A;  4YGA A;  1EH2 A;  3D0Y B;  3DVK A;  4OZD A;  1TCO B;  4OVN F;  1YUU A;  3EK7 A;  1ZUZ A;  1OE9 B;  4A4B A;  2PVB A;  4NDB A;  1QIV A;  1LKJ A;  2I7A A;  1DJW A;  2Y1N A;  1BLQ A;  4GNK B;  1IJ6 A;  1NX2 A;  2G9B A;  3SG2 A;  3O2P A;  2F2O A;  1XK4 A;  1TN4 A;  5PAL A;  4ORA B;  2JNF A;  2KAX A;  1B9A A;  3CR2 A;  1M39 A;  4PE0 A;  1PK0 D;  3UNW A;  3S0G A;  1IGV A;  5KU1 A;  1RK9 A;  1G33 A;  3CYZ A;  3LLE A;  2JPT A;  2EC6 B;  3CAB A;  4KYN A;  3LCP C;  1QAS A;  4WQ2 A;  1HQV A;  2LCP A;  2LC5 A;  1KK8 B;  1NYA A;  1BMO A;  3NSI A;  3I5I C;  3VRN A;  3BUO B;  3O4X A;  1A03 A;  1NPQ A;  1DT7 B;  1XFV O;  2G2B A;  2WC6 A;  2MRD A;  5I2L A;  3OB1 B;  4HRG A;  2CTN A;  4MLW A;  1Y0V H;  4PHK A;  4NQG A;  5DKR A;  2KI6 D;  4OR9 B;  5B8I B;  4P2Y B;  2M3W A;  3HCM A;  4N5X A;  3A8R A;  2WC5 A;  1MUX A;  5ER5 A;  1B1G A;  3TDI A;  1JFK A;  1OMV A;  4P5O E;  2CXJ A;  2LUX A;  1KFX L;  2BKI B;  1NSH A;  1VRK A;  3B87 A;  1DQE A;  3CS1 A;  3D78 A;  1KQM C;  2M0R A;  3EVR A;  4MRX A;  3SG5 A;  2LVJ A;  4I5N B;  1BOD A;  2Y4Q A;  2Q91 A;  4R1E A;  1XK4 C;  3V2L A;  3ZWH A;  5F6T A;  1YUS A;  2F8P A;  1S6I A;  2PAS A;  4PCW A;  1R2U A;  1QX7 A;  2LV7 A;  1L2O B;  3GK2 A;  1PVB A;  3TUY C;  2WC8 A;  1DGU A;  2QAC A;  1NUB A;  5JOL A;  2BBN A;  3Q8I A;  4OCI A;  4ZCU A;  2M29 A;  2M8U A;  4ORB B;  1GJY A;  1QWV A;  1J1D A;  5AFP A;  1W7J B;  3S0E A;  2LNK A;  2SAS A;  1M63 B;  1SY9 A;  1CDM A;  4OKH A;  4QJ5 B;  2JT8 A;  4M2O A;  1QXP A;  2DOQ A;  3OX6 A;  3NXA A;  4PT1 A;  1YVH A;  4QJ4 B;  1CFP A;  1B8R A;  2JT3 A;  1WDC B;  3SG6 A;  3SJS A;  2ZRT A;  1AK8 A;  2H2K A;  1PSB A;  1Z4H A;  2O60 A;  4FTG A;  3D75 A;  1A4P A;  2K8M B;  2BE4 A;  1SCM B;  1OZS A;  2FCE A;  5D3O A;  4C0L A;  1FF1 A;  3I5F C;  4CID A;  2Y5I A;  2KI4 C;  3CZ1 A;  1CDN A;  1HT9 A;  3FE8 A;  1BR4 B;  3AAK A;  3AKA A;  3H4S E;  2JRF A;  3IQQ A;  3DZT A;  1DJX A;  1F4O A;  3VRR A;  4PHN A;  1YUT A;  1N2D A;  1K9P A;  2WND A;  1KQV A;  3NSK A;  1KCY A;  3EG5 B;  2L4I A;  1OW4 A;  1TWO A;  3QME A;  3TZ1 A;  2HPS A;  4M2Q A;  4YGB B;  1EXR A;  2M1K B;  1SR6 C;  2FCD A;  3SS3 A;  4DS7 A;  2K61 A;  1M45 A;  1KK7 Z;  1IH0 A;  1BOC A;  4YRU A;  1MQ1 A;  3SIB A;  1YUR A;  3SG3 A;  3PJI A;  3BUX B;  3DF0 A;  2L2C A;  1F4Q A;  2BCB A;  2LUC A;  3I5I B;  4GGF C;  1IQ5 A;  2KQ6 A;  1SMG A;  3BFB A;  4AQI A;  1JBA A;  2I2R E;  3D76 A;  1DEL A;  2K7O A;  3EKH A;  1KK7 Y;  1GGW A;  2QEB A;  2ZNE A;  4N1F A;  2M1U A;  2L5X B;  1DJZ A;  3BOW A;  1KFU L;  1CKK A;  2WCK A;  1QS7 A;  2JC2 A;  3NSO A;  1QIW A;  1NCY A;  1H8B A;  2MAZ A;  1GQM A;  4MZJ A;  3FWB A;  2CNP A;  1S3P A;  3CGA A;  1FBV A;  1TCF A;  1MXE A;  2NCO A;  1V1F A;  1F55 A;  3I5G C;  1YRU B;  1ZFS A;  3I5H C;  3OB2 B;  4MVF A;  1KQM B;  4MZL A;  1SKT A;  2LP3 A;  4JD9 A;  1ORG A;  1C7W A;  2WOS A;  2MJW B;  3R1P A;  5I8N A;  1FPW A;  2HQ8 A;  3BFH A;  4GUK A;  5CSI A;  2ZN9 A;  3R72 A;  5FI7 A;  1TNW A;  3O4Y A;  4JPZ B;  1OMD A;  1BR1 B;  3PM2 A;  5K89 A;  1AP4 A;  2PMY A;  3OX5 A;  5HL1 A;  2ERB A;  2NZ0 A;  2ZRS A;  3PN7 C;  3TUY B;  2QPT A;  1JC2 A;  2JQ6 A;  1RWY A;  3CR5 X;  4MZK A;  1UHH A;  1XFX O;  2QEH A;  1UHN A;  3BQ3 A;  1K8U A;  3EKJ A;  3F45 A;  3SS5 A;  3E3R A;  1KSM A;  4PE7 A;  2GTE A;  2BCA A;  1J7O A;  4C0K A;  4WQ3 A;  1GGZ A;  4WRI A;  3TS5 C;  1DVI A;  2L4H A;  1K2H A;  5FYX A;  3CWG A;  2V53 A;  1ALV A;  1A75 B;  1LA0 A;  2OS8 C;  1XFY O;  3DVM A;  2LVV A;  1IQ3 A;  1OOH A;  4M2P A;  3JTD C;  3VRP A;  2BBM A;  2PAL A;  2KSP A;  3FS7 A;  1Z2C B;  2L5Y A;  4DIR A;  1A75 A;  1NCX A;  3I5F B;  1DTL A;  3OP0 A;  2LM5 A;  1PVA A;  2COL B;  2OPO A;  2KNE A;  3CR4 X;  5HLV A;  2KGB C;  2KI4 B;  2MA2 A;  2BE6 A;  4DCK A;  2AUC A;  4ICB A;  3S0D A;  2SCP A;  3EVV A;  4I5L B;  1AHR A;  3JVT C;  1TUJ A;  4PE1 A;  2KGR A;  3L4A A;  1CFD A;  2M7L A;  3ZNI A;  4IL1 A;  5HYD A;  2KFH A;  3EK8 A;  1CFF A;  2A4J A;  2KYF A;  1YVL A;  3IQO A;  3ICB A;  4GGN A;  5KSZ A;  3SG4 A;  5I2Q A;  5FI6 A;  3FWC A;  1TTX A;  1YX7 A;  2GV5 A;  1TNP A;  4I5K A;  4PAL A;  1UP5 A;  3AKB A;  5JJG A;  1A2X A;  1DC1 A;  3DXL A;  1BJF A;  2WCH A;  1CNP A;  1D1O A;  1IWQ A;  1XFU O;  2AAO A;  5CSF A;  5AXI A;  3WHT B;  2I18 A;  3S0F A;  2I94 A;  3DYE A;  3K1E A;  2CT9 A;  4F7F A;  1TOP A;  2KAV A;  3L47 A;  5HLO A;  3BUN B;  2LAP A;  3SIA A;  1QLS A;  2F3Y A;  2LHI A;  2WCL A;  1J1E A;  1M46 A;  1QVI Z;  2JU0 A;  3KO0 A;  3KPX A;  2LVI A;  4GGF A;  1YR5 A;  4MBE A;  5I2O A;  1NCZ A;  1IKU A;  2BAP A;  1QX2 A;  1YRT B;  2L50 A;  2OTG C;  1ODB A;  3BJH A;  3RLZ A;  1C07 A;  5CSN A;  4INW A;  3K21 A;  3B7A A;  1LXF C;  1B7T Y;  2JTT A;  2H8V A;  4GBA A;  3LK0 A;  3O6B A;  1KWO B;  1OOF A;  1QVI Y;  1PUL A;  1FI5 A;  1EG3 A;  3NSL A;  1JF2 A;  1BT6 A;  1SL9 A;  1T14 A;  1UWO A;  1W9Z A;  1K93 D;  3BUW B;  1OSA A;  3D74 A;  3I5G B;  3WNX B;  2ZN8 A;  3I5H B;  2BEC A;  5D69 A;  4A4C A;  1JWD A;  2L51 A;  4MSP A;  1QX5 B;  3EK4 A;  4N1G A;  3GK4 X;  4INX A;  3GK1 A;  1C7V A;  2K60 A;  3DD4 A;  2BL0 C;  2L2E A;  1F70 A;  1S5G Z;  4MRY A;  1NX1 A;  3PN7 B;  1NIW A;  2LVK A;  3B86 A;  1K9K A;  1K95 A;  4AOM A;  2JXC A;  1C3Y A;  2K2A A;  3R1O A;  3DF0 B;  1JF0 A;  1SNL A;  1YTZ C;  1CDL A;  5HKZ A;  2KBI A;  4YGC B;  1S6J A;  4U8D A;  1IG5 A;  3AAJ A;  1S5G Y;  3GOF A;  3PAT A;  3S0A A;  1NX3 A;  2KHN A;  1WLM A;  1E8A A;  3TS5 B;  1IRJ A;  1TNX A;  5DIC A;  5AER A;  1JFJ A;  4YBH B;  3LK1 A;  3O78 A;  3RZS A;  3BFA A;  4IJ7 A;  4DUQ A;  3BOW B;  1Q80 A;  1RFJ A;  2OS8 B;  2P6B B;  2KQY A;  2PRU A;  2GGZ A;  2FJU B;  3VRO A;  2EGD A;  1SW8 A;  3JTD B;  2JT0 A;  4L9M A;  1KSO A;  4I5J A;  1CDP A;  2M7N A;  1N65 A;  2K2F A;  5AAN A;  1PSR A;  2M97 A;  1IJ5 A;  3KF9 A;  3PAL A;  1S6C A;  2E6W A;  1EL4 A;  1RRO A;  1OOI X;  1RTP 1;  1ZAC A;  4CFR A;  1V1G A;  2LLU A;  3UO9 A;  4GAO A;  1SSE B;  2CCM A;  2YGU A;  3OHM B;  1C3Z A;  3BUM B;  1QV0 A;  1PAL A;  4ETO A;  1WDC C;  2P70 A;  2HQW A;  1AJ4 A;  3LL8 B;  2LMU A;  4XJK B;  4YGE B;  3SS4 A;  5G08 A;  4ZCV A;  3B88 A;  1QLK A;  1N0Y A;  1DJG A;  2R2I A;  4XJK A;  1CMF A;  2NCP A;  1CMG A;  4CFQ A;  4MEW A;  1EJ3 A;  1NWD A;  3CZT X;  2JXL A;  3PM8 A;  2K7C A;  2M49 B;  4GFT A;  4BY5 A;  2KLE A;  5EL2 A;  3VGO A;  3D0Y A;  3CZ2 A;  2OTG B;  2JPO A;  4JQ0 D;  1OMR A;  2TN4 A;  2F33 A;  1W7I B;  1SL8 A;  3PSR A;  1ALW A;  2FOT A;  1H4B A;  2EHB A;  1Y1A A;  1K9U A;  3D10 A;  3QRX A;  2K7B A;  2ISD A;  1SYM A;  1PRW A;  1DGV A;  2WCM A;  1KFX S;  3VB1 A;  1S1E A;  3CDN A;  1X02 A;  1XA5 A;  1JUO A;  1AVS A;  1REC A;  1AUI B;  2LLS A;  4Q04 A;  2QDI A;  1CLB A;  1Y1U A;  2WCB A;  1CB1 A;  2B1U A;  2LE9 B;  1UHJ A;  2H61 A;  2Q4U A;  4GPL B;  3CTN A;  5HKY A;  5I94 A;  4DRW A;  2WOR A;  2PSR A;  2QEO A;  1DJY A;  1B4C A;  1DF0 B;  5AEQ A;  3S0B A;  2BL0 B;  3EVU A;  1UHI A;  1XFR A;  4PHJ A;  4FQO A; 
#chains in the Genus database with same CATH homology
 2K7D A;  2CBL A;  2LMV A;  5J3X A;  4BY4 A;  2KFG A;  1DJI A;  4HRH A;  3KEV A;  1K96 A;  4PDZ A;  1DF0 A;  1SR6 B;  1G4Y R;  5KTY A;  2JTZ A;  1MWN A;  1J7R A;  4C0J A;  1FW4 A;  4YI9 A;  4OV2 A;  1BG1 A;  4CLN A;  4NDC A;  5CSJ A;  2KI6 C;  2BKH B;  3WXA A;  2JUL A;  1B7T Z;  1TNQ A;  4AQJ A;  2ZND A;  2HF5 A;  4YGD B;  2E30 A;  3FIA A;  3MSE B;  2AMI A;  1B8L A;  2L0P A;  2KOT A;  4PE4 A;  1LIN A;  1XO5 A;  1CLL A;  2KDH A;  5BPJ A;  3RM1 A;  1B47 A;  4YI8 A;  1F71 A;  2WCE A;  2K0J A;  2NLN A;  1WLZ A;  3A4U B;  4PHM A;  1K94 A;  2M9G A;  2H61 C;  2KFF A;  1OOJ A;  3DVE A;  3SG7 A;  3TDU A;  1DMO A;  1QJT A;  3C1V A;  1XFW O;  2BCX A;  2JZI A;  2EC6 C;  2KAY A;  2JOJ A;  1FI6 A;  1MF8 B;  1BU3 A;  1CM4 A;  1KK8 C;  2ZKM X;  4QJ3 B;  1Y6W A;  1OZO A;  3PLF B;  2MLF C;  1XYD A;  1SPY A;  3HX4 A;  5HKW A;  1NX0 A;  1QAT A;  1JSA A;  1MR8 A;  5D7F A;  5ER4 X;  5TNC A;  1DJH A;  4USL A;  3WHU B;  1XFZ O;  1TRF A;  1LVC D;  1ZOT B;  1F8H A;  5DKN A;  2JWW A;  1J7Q A;  2VRG A;  2WCF A;  1Y1X A;  4F0Z B;  1YX8 A;  1CTR A;  2MLE C;  3BYA A;  3PFV A;  1L7Z A;  4E68 A;  1QTX A;  3M0W A;  2MBX A;  4D1E A;  2L98 A;  4CPV A;  2LMT A;  1M31 A;  4TNC A;  5IBW A;  1RJV A;  1J7P A;  1SRA A;  1CFC A;  3VRQ A;  1WY9 A;  1F54 A;  1KFU S;  1ZMZ A;  5CPV A;  3IF7 A;  1MHO A;  2MHH A;  1U5I B;  1MXL C;  1EG4 A;  2KYC A;  1J55 A;  2LLT A;  1UHK A;  1CM1 A;  1QV1 A;  4HSZ A;  1U5I A;  4XYN A;  5GQQ C;  1L2O C;  3TDZ A;  4UPG A;  1TIZ A;  1UUR A;  3JVT B;  2GGM A;  3KHE A;  1NP8 A;  2IS9 A;  1S26 D;  4HRE E;  1OQP A;  2Y1M A;  4NDD A;  1WRZ A;  2ZFD A;  2HET A;  1S36 A;  2JNX A;  2RGI A;  1K90 D;  1B8C A;  3BXK A;  1CLM A;  2O5G A;  5DKQ A;  1WRL A;  1G8I A;  2F2P A;  3CLN A;  4JWQ A;  2KBM A;  1UUS A;  2D8N A;  2F3Z A;  4ORC B;  2LAN A;  1XVJ A;  1SBJ A;  1WRK A;  1AJ5 A;  3DVJ A;  1SCM C;  4MN0 A;  1A29 A;  2LP2 A;  1SL7 A;  1SCV A;  1LA3 A;  1KWO C;  1SK6 D;  1R6P A;  2LHL A;  1BF5 A;  2NXQ A;  4YGA A;  1EH2 A;  3D0Y B;  3DVK A;  1TCO B;  4OVN F;  1YUU A;  3EK7 A;  1ZUZ A;  1OE9 B;  4A4B A;  2PVB A;  4NDB A;  1QIV A;  1LKJ A;  2I7A A;  1DJW A;  2Y1N A;  1BLQ A;  4GNK B;  1IJ6 A;  1NX2 A;  2G9B A;  3SG2 A;  3O2P A;  2F2O A;  1XK4 A;  1TN4 A;  5PAL A;  4ORA B;  2JNF A;  2KAX A;  1B9A A;  3CR2 A;  1M39 A;  4PE0 A;  1PK0 D;  5KU1 A;  1IGV A;  1RK9 A;  1G33 A;  3LLE A;  2JPT A;  2EC6 B;  3LCP C;  1QAS A;  4WQ2 A;  1HQV A;  2LCP A;  2LC5 A;  1KK8 B;  1NYA A;  1BMO A;  3NSI A;  3I5I C;  3VRN A;  3BUO B;  1A03 A;  1NPQ A;  1DT7 B;  1XFV O;  2G2B A;  2MRD A;  5I2L A;  3OB1 B;  4HRG A;  2CTN A;  4MLW A;  1Y0V H;  4PHK A;  4NQG A;  5DKR A;  2KI6 D;  4OR9 B;  5B8I B;  4P2Y B;  2M3W A;  3HCM A;  4N5X A;  3A8R A;  1MUX A;  5ER5 A;  1B1G A;  3TDI A;  1JFK A;  1OMV A;  4P5O E;  2CXJ A;  2LUX A;  1KFX L;  2BKI B;  1NSH A;  1VRK A;  3CS1 A;  3EVR A;  1KQM C;  2M0R A;  4MRX A;  3SG5 A;  2LVJ A;  4I5N B;  1BOD A;  2Y4Q A;  2Q91 A;  4R1E A;  1XK4 C;  3ZWH A;  5F6T A;  1YUS A;  2F8P A;  1S6I A;  2PAS A;  4PCW A;  1R2U A;  1QX7 A;  2LV7 A;  1L2O B;  3GK2 A;  1PVB A;  3TUY C;  2WC8 A;  1DGU A;  2QAC A;  1NUB A;  5JOL A;  2BBN A;  4OCI A;  4ZCU A;  2M29 A;  2M8U A;  4ORB B;  1GJY A;  5AFP A;  1J1D A;  1W7J B;  2LNK A;  2SAS A;  1M63 B;  1SY9 A;  1CDM A;  4OKH A;  4QJ5 B;  2JT8 A;  4M2O A;  1QXP A;  2DOQ A;  3OX6 A;  3NXA A;  1CFP A;  1YVH A;  4QJ4 B;  1B8R A;  2JT3 A;  1WDC B;  3SG6 A;  3SJS A;  2ZRT A;  1AK8 A;  2H2K A;  1PSB A;  2O60 A;  4FTG A;  1A4P A;  2K8M B;  2BE4 A;  1SCM B;  1OZS A;  2FCE A;  4C0L A;  1FF1 A;  3I5F C;  4CID A;  2Y5I A;  2KI4 C;  1CDN A;  1HT9 A;  1BR4 B;  3AAK A;  3AKA A;  3H4S E;  2JRF A;  3IQQ A;  1DJX A;  1F4O A;  3VRR A;  4PHN A;  1YUT A;  1N2D A;  1K9P A;  2WND A;  1KQV A;  3NSK A;  1KCY A;  2L4I A;  3TZ1 A;  2HPS A;  4M2Q A;  4YGB B;  1EXR A;  2M1K B;  1SR6 C;  2FCD A;  4DS7 A;  2K61 A;  1M45 A;  1KK7 Z;  1IH0 A;  1BOC A;  4YRU A;  1MQ1 A;  3SIB A;  1YUR A;  3SG3 A;  3BUX B;  3DF0 A;  1F4Q A;  2BCB A;  2LUC A;  3I5I B;  4GGF C;  1IQ5 A;  2KQ6 A;  1SMG A;  4AQI A;  1JBA A;  2I2R E;  2K7O A;  3EKH A;  1KK7 Y;  1GGW A;  2ZNE A;  4N1F A;  2M1U A;  2L5X B;  1DJZ A;  3BOW A;  1KFU L;  1CKK A;  1QS7 A;  2JC2 A;  3NSO A;  1QIW A;  1NCY A;  1H8B A;  2MAZ A;  1GQM A;  4MZJ A;  3FWB A;  2CNP A;  1S3P A;  3CGA A;  1FBV A;  1TCF A;  1MXE A;  2NCO A;  1V1F A;  1F55 A;  3I5G C;  1YRU B;  1ZFS A;  3I5H C;  3OB2 B;  4MVF A;  1KQM B;  4MZL A;  1SKT A;  2LP3 A;  1C7W A;  2WOS A;  2MJW B;  5I8N A;  1FPW A;  2HQ8 A;  4GUK A;  5CSI A;  2ZN9 A;  1TNW A;  3O4Y A;  4JPZ B;  1OMD A;  1BR1 B;  5K89 A;  1AP4 A;  2PMY A;  3OX5 A;  2NZ0 A;  2ZRS A;  3PN7 C;  3TUY B;  2QPT A;  1JC2 A;  2JQ6 A;  1RWY A;  3CR5 X;  4MZK A;  1UHH A;  1XFX O;  1UHN A;  3BQ3 A;  1K8U A;  3EKJ A;  3F45 A;  3E3R A;  1KSM A;  4PE7 A;  2BCA A;  1J7O A;  4C0K A;  4WQ3 A;  1GGZ A;  4WRI A;  3TS5 C;  1DVI A;  2L4H A;  1K2H A;  5FYX A;  3CWG A;  2V53 A;  1ALV A;  1A75 B;  1LA0 A;  2OS8 C;  1XFY O;  3DVM A;  2LVV A;  1IQ3 A;  4M2P A;  3JTD C;  3VRP A;  2BBM A;  2PAL A;  2KSP A;  3FS7 A;  4DIR A;  1A75 A;  1NCX A;  3I5F B;  1DTL A;  3OP0 A;  2LM5 A;  1PVA A;  2COL B;  2OPO A;  2KNE A;  3CR4 X;  5HLV A;  2KGB C;  2KI4 B;  2MA2 A;  2BE6 A;  4DCK A;  2AUC A;  4ICB A;  2SCP A;  3EVV A;  4I5L B;  1AHR A;  3JVT C;  4PE1 A;  2KGR A;  1CFD A;  2M7L A;  3ZNI A;  4IL1 A;  5HYD A;  2KFH A;  3EK8 A;  1CFF A;  2A4J A;  2KYF A;  1YVL A;  3IQO A;  3ICB A;  4GGN A;  5KSZ A;  3SG4 A;  5I2Q A;  3FWC A;  1TTX A;  1YX7 A;  2GV5 A;  1TNP A;  4I5K A;  4PAL A;  1UP5 A;  3AKB A;  5JJG A;  1A2X A;  1BJF A;  1CNP A;  1D1O A;  1IWQ A;  1XFU O;  2AAO A;  5CSF A;  5AXI A;  3WHT B;  2I18 A;  2I94 A;  2CT9 A;  1TOP A;  2KAV A;  5HLO A;  3BUN B;  2LAP A;  3SIA A;  1QLS A;  2F3Y A;  2LHI A;  3KO0 A;  1J1E A;  1M46 A;  1QVI Z;  2JU0 A;  3KPX A;  2LVI A;  4GGF A;  1YR5 A;  4MBE A;  5I2O A;  1NCZ A;  1IKU A;  1QX2 A;  1YRT B;  2L50 A;  2OTG C;  1ODB A;  3RLZ A;  1C07 A;  5CSN A;  3K21 A;  1LXF C;  1B7T Y;  2JTT A;  4GBA A;  3LK0 A;  3O6B A;  1KWO B;  1QVI Y;  1PUL A;  1FI5 A;  1EG3 A;  3NSL A;  1JF2 A;  1BT6 A;  1SL9 A;  1UWO A;  1K93 D;  3BUW B;  1OSA A;  3I5G B;  3WNX B;  2ZN8 A;  3I5H B;  2BEC A;  5D69 A;  4A4C A;  1JWD A;  2L51 A;  4MSP A;  1QX5 B;  3EK4 A;  4N1G A;  3GK4 X;  3GK1 A;  1C7V A;  3DD4 A;  2BL0 C;  2L2E A;  1F70 A;  1S5G Z;  4MRY A;  1NX1 A;  3PN7 B;  1NIW A;  2LVK A;  1K9K A;  1K95 A;  4AOM A;  2JXC A;  2K2A A;  3DF0 B;  1JF0 A;  1SNL A;  1YTZ C;  1CDL A;  5HKZ A;  2KBI A;  4YGC B;  1S6J A;  4U8D A;  1IG5 A;  3AAJ A;  1S5G Y;  3GOF A;  3PAT A;  1NX3 A;  2KHN A;  1WLM A;  1E8A A;  3TS5 B;  1IRJ A;  1TNX A;  5AER A;  1JFJ A;  4YBH B;  3LK1 A;  3O78 A;  4DUQ A;  3BOW B;  1Q80 A;  1RFJ A;  2OS8 B;  2P6B B;  2KQY A;  2PRU A;  2GGZ A;  2FJU B;  3VRO A;  2EGD A;  1SW8 A;  3JTD B;  2JT0 A;  4L9M A;  1KSO A;  4I5J A;  1CDP A;  2M7N A;  1N65 A;  2K2F A;  5AAN A;  1PSR A;  2M97 A;  1IJ5 A;  3KF9 A;  3PAL A;  1S6C A;  2E6W A;  1EL4 A;  1RRO A;  1RTP 1;  1ZAC A;  4CFR A;  1V1G A;  2LLU A;  4GAO A;  2CCM A;  3OHM B;  3BUM B;  1QV0 A;  1PAL A;  4ETO A;  1WDC C;  2HQW A;  1AJ4 A;  3LL8 B;  2LMU A;  4XJK B;  4YGE B;  5G08 A;  4ZCV A;  1QLK A;  1N0Y A;  1DJG A;  2R2I A;  4XJK A;  1CMF A;  2NCP A;  1CMG A;  4CFQ A;  4MEW A;  1EJ3 A;  1NWD A;  3CZT X;  2JXL A;  3PM8 A;  2K7C A;  2M49 B;  4GFT A;  4BY5 A;  3VGO A;  3D0Y A;  2OTG B;  4JQ0 D;  1OMR A;  2TN4 A;  2F33 A;  1W7I B;  1SL8 A;  3PSR A;  1ALW A;  2FOT A;  1H4B A;  2EHB A;  1Y1A A;  1K9U A;  3D10 A;  3QRX A;  2K7B A;  2ISD A;  1SYM A;  1PRW A;  1DGV A;  1KFX S;  1S1E A;  1X02 A;  1XA5 A;  1JUO A;  1AVS A;  1REC A;  1AUI B;  2LLS A;  4Q04 A;  1CLB A;  1Y1U A;  2WCB A;  1CB1 A;  2B1U A;  2LE9 B;  1UHJ A;  2H61 A;  2Q4U A;  4GPL B;  3CTN A;  5HKY A;  4DRW A;  2WOR A;  2PSR A;  1DJY A;  1B4C A;  1DF0 B;  5AEQ A;  2BL0 B;  3EVU A;  1UHI A;  4PHJ A;  4FQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...