1ZMZA

Solution structure of the n-terminal domain (m1-s98) of human centrin 2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Centrin-2
publication title The N-terminal domain of human centrin 2 has a closed structure, binds calcium with a very low affinity, and plays a role in the protein self-assembly
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 25
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1zmzA01
5HLVA 2SASA 4C0LA 2K0JA 1S6IA 2NXQA 2Q91A 4CIDA 3PLFB 1IRJA 2KNEA 4C0KA 5CPVA 3SIBA 2LVVA 3DVMA 2OTGB 2ZFDA 2QACA 2ZKMX 1S6CA 1MUXA 2M8UA 2WNDA 1UWOA 1K8UA 3DF0B 1QIWA 1J7PA 1SR6C 1K93D 4OV2A 1M46A 1TN4A 2NCPA 5JJGA 1AHRA 3SG4A 3TDUA 2FOTA 1DJWA 3VRPA 4JQ0D 1NIWA 5BPJA 1QV0A 3CLNA 1CDMA 3BXKA 1TIZA 3PATA 1UHKA 2BE6A 3O78A 1FPWA 3TDIA 1SR6B 1OE9B 2KDHA 2G9BA 1JUOA 3SG2A 2K7BA 2L51A 3O2PA 2Y1MA 2KFFA 2ZRTA 3CR5X 4TNCA 3KPXA 2P6BB 1QVIZ 2JT8A 4I5JA 5I8NA 4PE1A 4R1EA 2MJWB 1J1DA 2B1UA 2OS8C 3DD4A 1J55A 1AJ5A 1B9AA 2PASA 1RFJA 1BR1B 2KOTA 3CR4X 2OS8B 5I2OA 1ZMZA 1JF2A 1NPQA 2L50A 3SG3A 1KK7Y 1ZUZA 1CM1A 1XFZO 3SJSA 3D0YA 1CDLA 4JPZB 2LMVA 3EVRA 3I5FC 4GGFC 1SW8A 1RJVA 1PVBA 2K7OA 5HKWA 2BBMA 2K8MB 2KI6C 2LLTA 2H2KA 2ZRSA 3GK1A 1IKUA 1QS7A 1B7TY 1SK6D 3OHMB 1XFXO 3I5FB 2L4HA 2K61A 2WCFA 2JTZA 2M97A 4ORCB 1M45A 3WNXB 3SG5A 1XK4A 2V53A 1WRKA 1YUUA 3FIAA 4MLWA 1UHIA 2AAOA 5AEQA 4NQGA 4M2OA 1CM4A 1QIVA 1QXPA 1QLKA 1NP8A 4YGAA 1EH2A 2G2BA 2LVKA 3IF7A 4MZJA 2KQ6A 4PALA 1X02A 4CFQA 3SIAA 1A2XA 2KBMA 3FWBA 2KFGA 1XFYO 2WORA 3H4SE 2LLUA 1G8IA 1KWOC 1WDCC 3I5HC 1SBJA 1F71A 1DJYA 4JWQA 1KK7Z 4I5NB 2TN4A 3BUMB 2MLEC 3KEVA 1G4YR 2FCDA 2BCBA 1S1EA 1BODA 1K90D 3I5IC 3HCMA 1NX3A 2NCOA 2LCPA 1KWOB 1WDCB 3I5HB 4MVFA 1GQMA 2Q4UA 1U5IA 3DVJA 1V1FA 1DJXA 1QJTA 1B7TZ 1HT9A 4QJ5B 1FW4A 1UUSA 2JU0A 1R6PA 1JSAA 3JTDC 2MAZA 1FI6A 5CSIA 1DMOA 2ZNDA 1SL7A 1TNWA 1TCFA 3I5IB 5I2LA 4FTGA 3BUNB 4Q04A 2JZIA 1CNPA 3CR2A 1WLMA 1DVIA 4MBEA 2CTNA 2HF5A 2MLFC 1BU3A 4DRWA 1K2HA 2KQYA 2SCPA 3JTDB 2KBIA 1Y1UA 2GGMA 4C0JA 4GGNA 4MEWA 2K7CA 1TNPA 4YGEB 1F4QA 4HREE 4OVNF 2LMTA 2LE9B 1DTLA 3PFVA 1YRTB 3D10A 4MZLA 1C7WA 1L7ZA 1NYAA 2L0PA 1PK0D 2MA2A 3NSOA 3LLEA 2I94A 2HPSA 3AKAA 3PM8A 3BOWA 3DVKA 2LMUA 1YX8A 1CB1A 1UHJA 1M63B 2AUCA 1OMDA 5I2QA 4YRUA 1K9KA 1AVSA 1UP5A 1YRUB 2PALA 1A75A 2JT3A 2ZN8A 4PE7A 5CSFA 1CKKA 1KFXL 1K96A 1TOPA 4XJKA 2WC8A 2LHIA 1NX2A 1KFUL 2E6WA 4FQOA 1YUSA 2COLB 3EK7A 2GGZA 2HQWA 2M29A 1UHHA 3MSEB 5K89A 1J1EA 2KGBC 1OZSA 4OKHA 2F3YA 2M1UA 1SKTA 1KFXS 1AK8A 2PRUA 2RGIA 2BE4A 1IH0A 5G08A 1W7IB 4D1EA 2KAVA 1EG3A 5IBWA 1S5GY 1JBAA 3VRRA 3WHUB 2HQ8A 4MN0A 1K95A 2HETA 3RLZA 3OX5A 4DUQA 1Y0VH 2JXCA 2LUCA 3CS1A 1K94A 1QLSA 1YURA 3GOFA 1ODBA 1NWDA 1SYMA 4F0ZB 1H4BA 1HQVA 2M1KB 1BF5A 1DF0B 2H61C 1FI5A 1PALA 3OP0A 2LM5A 3PALA 3BQ3A 4GUKA 1J7QA 2BECA 4AOMA 1A29A 1RK9A 5KSZA 1MHOA 1NCXA 4OCIA 4ZCVA 2PSRA 2Y1NA 5J3XA 1XO5A 3EK4A 3GK4X 1BR4B 1ZACA 2JPTA 3LCPC 1C07A 1CFPA 4HRHA 1KQMC 2JRFA 2CXJA 3CWGA 4ORBB 2MBXA 1OSAA 3F45A 3PN7C 1BLQA 1K9UA 5ER5A 2KYCA 2LANA 1E8AA 2F2PA 1KQVA 2CT9A 1KQMB 1XFWO 2I2RE 3JVTC 1CFDA 1PRWA 3KO0A 3PN7B 1YX7A 4U8DA 4ORAB 3BUOB 4CPVA 1S5GZ 1TNXA 1CMGA 3TZ1A 3O6BA 2L5XB 2OPOA 4WQ3A 1YUTA 1JF0A 4QJ3B 5AXIA 3WXAA 1CFCA 3JVTB 1IJ6A 4YGDB 1RWYA 1GJYA 1JC2A 1BMOA 4HSZA 1ALWA 3LK1A 4ICBA 1QX5B 4YBHB 2L98A 3SG6A 3VRQA 1CDPA 3FWCA 1MWNA 2I7AA 4YI9A 4WRIA 1MXLC 4I5LB 1SL9A 3VGOA 2WCBA 1S6JA 1QATA 1WY9A 1TCOB 2F3ZA 2NZ0A 3NXAA 1QASA 4A4CA 2FJUB 5DKNA 4ZCUA 1OMVA 2MRDA 1A03A 1R2UA 1TTXA 1YVHA 3LK0A 1MXEA 4GBAA 1OQPA 3EKJA 1KSOA 3OB1B 2LNKA 1BJFA 1CLLA 2JTTA 1DJZA 2PVBA 4PE4A 5CSJA 1Y1XA 1NSHA 4PCWA 4MRYA 1CMFA 3M0WA 1WRLA 4YGBB 5DKQA 3TUYC 4HRGA 5KU1A 4M2QA 4DCKA 3ZNIA 3BUWB 3K21A 1WRZA 1KK8C 4IL1A 1YTZC 4WQ2A 3NSLA 5TNCA 1LINA 4ETOA 2M7LA 3LL8B 1DJHA 4YI8A 1VRKA 1Y1AA 4I5KA 1D1OA 4GNKB 1SPYA 2QPTA 2JXLA 2ISDA 5PALA 4PHMA 1S26D 1SMGA 2K7DA 3D0YB 4P2YB 3TUYB 4GFTA 3KHEA 2M9GA 1IG5A 1KK8B 1S36A 2LP3A 2LHLA 1F54A 1PSRA 4GGFA 5KTYA 3ICBA 1TRFA 3PSRA 1GGZA 1CLMA 2IS9A 4N1GA 5DKRA 1XK4C 5HLOA 3BUXB 1XVJA 1V1GA 3O4YA 2F2OA 1Q80A 4NDBA 3EVUA 2LAPA 2KSPA 1XA5A 2M49B 5HYDA 4UPGA 1N65A 1K9PA 3FS7A 1KSMA 3GK2A 1MQ1A 5D7FA 1RECA 2CNPA 2KAYA 2EHBA 1EJ3A 4PHKA 1SNLA 1LXFC 1QV1A 2LVIA 2CCMA 4NDCA 4M2PA 2JULA 1DT7B 1B1GA 1Y6WA 1CLBA 1AJ4A 2K2FA 3CTNA 3VROA 3EK8A 4DS7A 4BY4A 1MF8B 2FCEA 1NX1A 3AAKA 2R2IA 1KFUS 4NDDA 1B8RA 1DJIA 2KI4C 2JNXA 2JOJA 4AQJA 2M0RA 1W7JB 4A4BA 1PSBA 3OB2B 4MSPA 1M31A 1QX2A 1NUBA 3AAJA 1ALVA 1M39A 2BKHB 3RM1A 1N2DA 1BOCA 4YGCB 4QJ4B 2I18A 2O5GA 4PE0A 3OX6A 2E30A 4GPLB 2KI4B 3TDZA 4MZKA 2L2EA 1U5IB 4USLA 2LP2A 1NX0A 1PVAA 1J7RA 1GGWA 1SRAA 3A4UB 1DGUA 1LA0A 4CLNA 1CTRA 2BKIB 2KFHA 3NSKA 2ZN9A 3QRXA 2KHNA 2K2AA 2LVJA 3EKHA 2KGRA 1JWDA 2EGDA 5D69A 5AANA 3DVEA 2L4IA 4CFRA 2VRGA 1L2OC 4PHJA 2Y4QA 4N5XA 5B8IB 5CSNA 2KAXA 5GQQC 1B8LA 1UURA 3DF0A 3C1VA 2M7NA 1B8CA 3EVVA 5JOLA 5HKZA 1QX7A 3CZTX 3I5GC 2CBLA 4AQIA 1BG1A 1YVLA 1PULA 1LKJA 1F8HA 3IQOA 3CGAA 4E68A 2F33A 2NLNA 1IJ5A 1L2OB 2A4JA 4MRXA 2JQ6A 5FYXA 3WHTB 1FBVA 2F8PA 1RROA 4N1FA 5AERA 5AFPA 1EL4A 2JWWA 4PDZA 3BOWB 1XFUO 1AP4A 1EXRA 3I5GB 2MHHA 1TNQA 1SL8A 3HX4A 1F70A 1ZOTB 2M3WA 1C7VA 1DGVA 3IQQA 1BT6A 1XYDA 1A75B 1N0YA 2BCAA 2Y5IA 2AMIA 1IGVA 4DIRA 2WOSA 4XJKB 2LUXA 1FF1A 1IQ5A 3E3RA 1A4PA 4L9MA 1OOJA 1IWQA 3TS5C 1UHNA 1SCMC 3ZWHA 1F4OA 4P5OE 1KCYA 4PHNA 1NCZA 1MR8A 1S3PA 3KF9A 3NSIA 3VRNA 1RTP1 3SG7A 1IQ3A 1ZFSA 1EG4A 1OZOA 1WLZA 1CFFA 2PMYA 1OMRA 2JNFA 1QTXA 5ER4X 1JFKA 3BYAA 3TS5B 1LVCD 1SCVA 2EC6C 1SCMB 2JT0A 1NCYA 2LC5A 2LLSA 2DOQA 1DF0A 1DJGA 1G33A 1LA3A 2BCXA 1B4CA 4XYNA 2KYFA 2D8NA 2GV5A 4OR9B 1YR5A 4GAOA 3A8RA 2BL0C 2O60A 2EC6B 1AUIB 2WCEA 1JFJA 1QVIY 1B47A 2H61A 4BY5A 1H8BA 1J7OA 2BBNA 1F55A 2ZNEA 2OTGC 3AKBA 2LV7A 5F6TA 1SY9A 5HKYA 2KI6D 1CDNA 2JC2A 2BL0B 1XFVO
chains in the Genus database with same CATH superfamily
4JD9A 5HLVA 2SASA 4C0LA 2K0JA 1S6IA 2NXQA 2Q91A 4CIDA 3PLFB 1IRJA 2KNEA 4C0KA 5CPVA 3SIBA 2LVVA 3DVMA 2OTGB 2ZFDA 2GTEA 2QACA 1S6CA 1MUXA 2ZKMX 2M8UA 2WNDA 1UWOA 1K8UA 3DF0B 1QIWA 1J7PA 3D75A 5FI7A 1SR6C 1K93D 4OV2A 1M46A 1TN4A 2NCPA 5JJGA 1AHRA 3SG4A 4INWA 3PM2A 3TDUA 3V2LA 2FOTA 1DJWA 3VRPA 4JQ0D 1NIWA 5BPJA 1QV0A 3CLNA 1CDMA 3BXKA 1TIZA 3PATA 1UHKA 2BE6A 3O78A 1FPWA 3TDIA 1SR6B 3L4LA 1OE9B 2KDHA 2G9BA 1JUOA 3S0BA 3SG2A 2K7BA 2L51A 3O2PA 2Y1MA 1ORGA 2KFFA 1GM0A 2ZRTA 3CR5X 4TNCA 3KPXA 2P6BB 1QVIZ 2JT8A 4I5JA 5I8NA 4PE1A 3NHTA 3R1PA 4R1EA 2MJWB 1J1DA 2B1UA 2OS8C 3DD4A 1J55A 1AJ5A 1B9AA 2PASA 1RFJA 3B87A 1BR1B 2KOTA 3CR4X 2OS8B 5I2OA 1ZMZA 1JF2A 1NPQA 2L50A 3SG3A 1KK7Y 2WC6A 1ZUZA 2QEHA 1CM1A 1XFZO 3SJSA 3D0YA 1CDLA 4JPZB 2LMVA 3EVRA 3I5FC 4GGFC 1SW8A 1RJVA 1XFRA 2WCJA 1PVBA 2K7OA 5HKWA 2BBMA 2K8MB 2KI6C 2LLTA 2H2KA 2ZRSA 3GK1A 1IKUA 3IVTA 1QS7A 1B7TY 1SK6D 3BJHA 3OHMB 1XFXO 3I5FB 4FQTA 2L4HA 2K61A 2WCFA 2JTZA 3SS4A 2M97A 4ORCB 1M45A 3WNXB 4KYNA 3SG5A 1XK4A 2V53A 1WRKA 1YUUA 3FIAA 3L4AA 4MLWA 1UHIA 3S0DA 2AAOA 5AEQA 4NQGA 4M2OA 1CM4A 1QIVA 1QXPA 1QLKA 1NP8A 2YGUA 4YGAA 1EH2A 2G2BA 2LVKA 3IF7A 4MZJA 2KQ6A 4PALA 1X02A 4CFQA 3SIAA 1A2XA 1W9ZA 2KBMA 3FWBA 2KFGA 2QDIA 1XFYO 2WORA 3H4SE 3D73A 2BAPA 2LLUA 1G8IA 1KWOC 1WDCC 3I5HC 1DQEA 1SBJA 1F71A 1DJYA 4JWQA 1KK7Z 4I5NB 2TN4A 3BUMB 2MLEC 3KEVA 1G4YR 2FCDA 2BCBA 1S1EA 1BODA 1K90D 3I5IC 3HCMA 1NX3A 2NCOA 2LCPA 1KWOB 1WDCB 3I5HB 4MVFA 1GQMA 1OOHA 1U5IA 2Q4UA 3DVJA 1V1FA 3FE9A 1DJXA 1QJTA 1B7TZ 1HT9A 4QJ5B 1FW4A 1UUSA 2JU0A 1R6PA 1JSAA 3JTDC 2MAZA 1FI6A 5CSIA 1DMOA 2ZNDA 1SL7A 1TNWA 1TCFA 3I5IB 5I2LA 4FTGA 3BUNB 4Q04A 2JZIA 1CNPA 3CR2A 1WLMA 1DVIA 4IJ7A 2CTNA 2HF5A 2MLFC 4MBEA 1BU3A 4DRWA 1K2HA 2KQYA 2SCPA 3NHIA 3JTDB 2KBIA 1Y1UA 3OBVA 4PT1A 2PQLA 2QEVA 3R72A 2GGMA 4C0JA 4GGNA 4MEWA 2K7CA 1TNPA 4YGEB 1F4QA 4HREE 4OVNF 2LMTA 2LE9B 1DTLA 1OOGA 2BNXA 3PFVA 1YRTB 3D10A 4MZLA 1C7WA 1L7ZA 1NYAA 2L0PA 1PK0D 2MA2A 3NSOA 3LLEA 2I94A 2HPSA 3AKAA 3PM8A 1TWOA 3S0FA 2P70A 3S0AA 3PJIA 3BOWA 3DVKA 2LMUA 1YX8A 1CB1A 1UHJA 1M63B 2AUCA 1OMDA 5I2QA 4YRUA 1K9KA 1AVSA 1UP5A 1YRUB 2PALA 1A75A 2JT3A 2ZN8A 4PE7A 5CSFA 1CKKA 1KFXL 1K96A 1TOPA 4XJKA 2WC8A 2LHIA 1NX2A 1KFUL 2E6WA 4FQOA 1YUSA 2COLB 5FI6A 5EL2A 3EK7A 2GGZA 2HQWA 2M29A 1UHHA 3MSEB 5K89A 1J1EA 2KGBC 1OZSA 4OKHA 2F3YA 2M1UA 1SKTA 3B6XA 1KFXS 1AK8A 3CDNA 2PRUA 2RGIA 2BE4A 1IH0A 5G08A 1W7IB 4D1EA 2KAVA 1EG3A 5IBWA 1S5GY 3L47A 5DICA 1JBAA 1Z4HA 3VRRA 3WHUB 2HQ8A 4MN0A 1K95A 2HETA 3RLZA 3OX5A 4DUQA 1Y0VH 2JXCA 2LUCA 3CS1A 1K94A 1QLSA 1YURA 3GOFA 1ODBA 1NWDA 1SYMA 3EG5B 4F0ZB 1H4BA 1HQVA 2M1KB 1BF5A 1DF0B 2H61C 1FI5A 1PALA 3OP0A 2LM5A 3PALA 3BQ3A 4GUKA 1J7QA 2BECA 4AOMA 1A29A 1RK9A 5KSZA 1MHOA 1NCXA 4OCIA 4ZCVA 2PSRA 2Y1NA 5J3XA 1XO5A 3EK4A 3GK4X 1BR4B 1ZACA 2JPTA 3LCPC 1C07A 1CFPA 4HRHA 1KQMC 2JRFA 2CXJA 3CWGA 4ORBB 2MBXA 1OSAA 3F45A 3PN7C 1BLQA 1K9UA 2WC5A 2WCLA 5ER5A 2KYCA 2LANA 3K1EA 1E8AA 3FE8A 5HL1A 2F2PA 3S0EA 1KQVA 2CT9A 1KQMB 1XFWO 2I2RE 3JVTC 1CFDA 1PRWA 3KO0A 3PN7B 1YX7A 4U8DA 2PYQA 3SS3A 4ORAB 3BUOB 4CPVA 1S5GZ 1TNXA 3D78A 1CMGA 3TZ1A 3O6BA 2L5XB 2OPOA 4WQ3A 1YUTA 1JF0A 4QJ3B 5AXIA 3WXAA 3CZ1A 1CFCA 3JVTB 1IJ6A 4YGDB 1RWYA 1GJYA 3BFBA 1JC2A 1BMOA 4HSZA 1ALWA 3LK1A 4ICBA 1QX5B 4YBHB 2L98A 3SG6A 3VRQA 1CDPA 3FWCA 1MWNA 2I7AA 3R1VA 4YI9A 4WRIA 1MXLC 3DZTA 4I5LB 1SL9A 3VGOA 2WCBA 1LS8A 1S6JA 1QATA 1WY9A 1TCOB 2F3ZA 2NZ0A 3NXAA 1QASA 4A4CA 2FJUB 5DKNA 1IIOA 3CABA 4ZCUA 1OMVA 2MRDA 1A03A 1R2UA 1TTXA 1YVHA 3LK0A 1MXEA 4GBAA 1OQPA 2WCKA 3EKJA 1KSOA 3OB1B 2LNKA 1BJFA 1QWVA 1CLLA 2JTTA 1DJZA 2PVBA 2P71A 3BFHA 4PE4A 1Y1XA 1NSHA 4PCWA 2QEOA 5CSJA 4MRYA 1CMFA 3M0WA 1WRLA 2K60A 4YGBB 5DKQA 3TUYC 4HRGA 5KU1A 4M2QA 4DCKA 3ZNIA 1C3YA 3BUWB 3K21A 1WRZA 1KK8C 4IL1A 1YTZC 4WQ2A 3NSLA 5TNCA 1LINA 3O4XA 4ETOA 2M7LA 3LL8B 1DJHA 4YI8A 1VRKA 1Y1AA 4I5KA 1D1OA 4GNKB 1SPYA 2QPTA 1Z2CB 2JXLA 2ISDA 5PALA 4PHMA 1S26D 3VB1A 1SMGA 2K7DA 3D0YB 4P2YB 3TUYB 3OGNA 4GFTA 3CZ0A 3DY9A 3KHEA 2M9GA 1IG5A 1KK8B 1S36A 2LP3A 4INXA 2LHLA 1F54A 1PSRA 4GGFA 5KTYA 3ICBA 1TRFA 3PSRA 1GGZA 1CLMA 2IS9A 4N1GA 5DKRA 1XK4C 5HLOA 3BUXB 1XVJA 1V1GA 3O4YA 3B86A 2F2OA 1Q80A 4NDBA 3EVUA 2JPOA 2LAPA 3QMEA 2KSPA 1XA5A 2M49B 5HYDA 4UPGA 1N65A 1K9PA 3FS7A 3D76A 1KSMA 3GK2A 1MQ1A 5D7FA 1RECA 2CNPA 2KAYA 2EHBA 1EJ3A 4PHKA 1SNLA 1LXFC 1OOIX 1QV1A 2LVIA 2CCMA 4NDCA 4M2PA 2JULA 3DYEA 1DT7B 1B1GA 1Y6WA 1CLBA 1AJ4A 2K2FA 3CTNA 3VROA 3EK8A 4DS7A 4BY4A 3DXLA 1MF8B 2FCEA 1NX1A 5FI2A 3AAKA 2R2IA 1KFUS 4NDDA 1B8RA 1DJIA 2KI4C 3SS5A 2JNXA 2JOJA 4AQJA 2M0RA 1W7JB 4A4BA 1PSBA 3OB2B 4MSPA 1M31A 1QX2A 1NUBA 2H8VA 3AAJA 3N7HA 1ALVA 1M39A 1DEKA 2BKHB 3RM1A 1N2DA 1BOCA 4YGCB 4QJ4B 2I18A 2O5GA 4PE0A 3OX6A 2E30A 4GPLB 2KI4B 3TDZA 4MZKA 2L2EA 1U5IB 4USLA 2LP2A 1NX0A 1PVAA 1J7RA 1GGWA 1SRAA 3CZ2A 3A4UB 1DGUA 1LA0A 4CLNA 1CTRA 2BKIB 1DELA 4OZDA 2KFHA 3NSKA 2ZN9A 3QRXA 2KHNA 2K2AA 2LVJA 3EKHA 2KGRA 2KLDA 1JWDA 2EGDA 5D69A 5AANA 3DVEA 2L4IA 4CFRA 2VRGA 1L2OC 4PHJA 2Y4QA 4N5XA 5B8IB 5CSNA 1TUJA 2KAXA 5GQQC 1B8LA 1UURA 3DF0A 3C1VA 3S0GA 2M7NA 1B8CA 3EVVA 5JOLA 5HKZA 1QX7A 3CZTX 3I5GC 2CBLA 4AQIA 1BG1A 1YVLA 1PULA 1LKJA 1F8HA 3IQOA 3CGAA 3UO9A 4E68A 2F33A 2NLNA 1IJ5A 1L2OB 2A4JA 4MRXA 2JQ6A 3Q8IA 5FYXA 3UNWA 3WHTB 1FBVA 2F8PA 1RROA 4N1FA 5AERA 5AFPA 1EL4A 2JWWA 3FE6A 4PDZA 3BOWB 1XFUO 2L5YA 1AP4A 1EXRA 3CYZA 3I5GB 2MHHA 1TNQA 1SL8A 3HX4A 1F70A 1ZOTB 2M3WA 1C7VA 2L2CA 1DGVA 3IQQA 1BT6A 1XYDA 1A75B 1N0YA 2BCAA 2Y5IA 2AMIA 2ERBA 1IGVA 4DIRA 2WOSA 4XJKB 2LUXA 1FF1A 2FJYA 3D77A 1IQ5A 2WCMA 3E3RA 4F7FA 1A4PA 4L9MA 2QEBA 1SSEB 1OOJA 1IWQA 3TS5C 3B7AA 1C3ZA 1UHNA 1DC1A 1SCMC 3ZWHA 1F4OA 4P5OE 1KCYA 4PHNA 1NCZA 1MR8A 1OOFA 1S3PA 3KF9A 3NSIA 5D3OA 3VRNA 1RTP1 3SG7A 1IQ3A 1ZFSA 1EG4A 1OZOA 1WLZA 1CFFA 3D74A 2PMYA 1OMRA 2JNFA 1QTXA 5ER4X 3B88A 1JFKA 3BYAA 3TS5B 1LVCD 1SCVA 1OW4A 2EC6C 1SCMB 2JT0A 1NCYA 5I94A 2LC5A 2LLSA 2DOQA 1DF0A 1T14A 1DJGA 1G33A 1LA3A 2BCXA 1B4CA 2WCHA 4XYNA 2KPHA 3R1OA 2KLEA 2KYFA 2D8NA 2GV5A 4OR9B 1YR5A 4GAOA 3A8RA 2BL0C 3NGVA 2O60A 2EC6B 1AUIB 2WCEA 1JFJA 1QVIY 1B47A 2H61A 4BY5A 1H8BA 3RZSA 1J7OA 2BBNA 1F55A 4JKTA 2ZNEA 2OTGC 3AKBA 1TUZA 2LV7A 5F6TA 1SY9A 3BFAA 5HKYA 1P28A 2KI6D 1CDNA 2JC2A 2BL0B 1XFVO
chains in the Genus database with same CATH topology
5HLVA 2SASA 4C0LA 2K0JA 1S6IA 2NXQA 2Q91A 4CIDA 3PLFB 1IRJA 2KNEA 4C0KA 5CPVA 3SIBA 2LVVA 3DVMA 2OTGB 2ZFDA 2QACA 2ZKMX 1S6CA 1MUXA 2M8UA 2WNDA 1UWOA 1K8UA 3DF0B 1QIWA 1J7PA 1SR6C 1K93D 4OV2A 1M46A 1TN4A 2NCPA 5JJGA 1AHRA 3SG4A 3TDUA 2FOTA 1DJWA 3VRPA 4JQ0D 1NIWA 5BPJA 1QV0A 3CLNA 1CDMA 3BXKA 1TIZA 3PATA 1UHKA 2BE6A 3O78A 1FPWA 3TDIA 1SR6B 1OE9B 2KDHA 2G9BA 1JUOA 3SG2A 2K7BA 2L51A 3O2PA 2Y1MA 2KFFA 2ZRTA 3CR5X 4TNCA 3KPXA 2P6BB 1QVIZ 2JT8A 4I5JA 5I8NA 4PE1A 4R1EA 2MJWB 1J1DA 2B1UA 2OS8C 3DD4A 1J55A 1AJ5A 1B9AA 2PASA 1RFJA 1BR1B 2KOTA 3CR4X 2OS8B 5I2OA 1ZMZA 1JF2A 1NPQA 2L50A 3SG3A 1KK7Y 1ZUZA 1CM1A 1XFZO 3SJSA 3D0YA 1CDLA 4JPZB 2LMVA 3EVRA 3I5FC 4GGFC 1SW8A 1RJVA 1PVBA 2K7OA 5HKWA 2BBMA 2K8MB 2KI6C 2LLTA 2H2KA 2ZRSA 3GK1A 1IKUA 1QS7A 1B7TY 1SK6D 3OHMB 1XFXO 3I5FB 2L4HA 2K61A 2WCFA 2JTZA 2M97A 4ORCB 1M45A 3WNXB 3SG5A 1XK4A 2V53A 1WRKA 1YUUA 3FIAA 4MLWA 1UHIA 2AAOA 5AEQA 4NQGA 4M2OA 1CM4A 1QIVA 1QXPA 1QLKA 1NP8A 4YGAA 1EH2A 2G2BA 2LVKA 3IF7A 4MZJA 2KQ6A 4PALA 1X02A 4CFQA 3SIAA 1A2XA 2KBMA 3FWBA 2KFGA 1XFYO 2WORA 3H4SE 2LLUA 1G8IA 1KWOC 1WDCC 3I5HC 1SBJA 1F71A 1DJYA 4JWQA 1KK7Z 4I5NB 2TN4A 3BUMB 2MLEC 3KEVA 1G4YR 2FCDA 2BCBA 1S1EA 1BODA 1K90D 3I5IC 3HCMA 1NX3A 2NCOA 2LCPA 1KWOB 1WDCB 3I5HB 4MVFA 1GQMA 2Q4UA 1U5IA 3DVJA 1V1FA 1DJXA 1QJTA 1B7TZ 1HT9A 4QJ5B 1FW4A 1UUSA 2JU0A 1R6PA 1JSAA 3JTDC 2MAZA 1FI6A 5CSIA 1DMOA 2ZNDA 1SL7A 1TNWA 1TCFA 3I5IB 5I2LA 4FTGA 3BUNB 4Q04A 2JZIA 1CNPA 3CR2A 1WLMA 1DVIA 4MBEA 2CTNA 2HF5A 2MLFC 1BU3A 4DRWA 1K2HA 2KQYA 2SCPA 3JTDB 2KBIA 1Y1UA 2GGMA 4C0JA 4GGNA 4MEWA 2K7CA 1TNPA 4YGEB 1F4QA 4HREE 4OVNF 2LMTA 2LE9B 1DTLA 3PFVA 1YRTB 3D10A 4MZLA 1C7WA 1L7ZA 1NYAA 2L0PA 1PK0D 2MA2A 3NSOA 3LLEA 2I94A 2HPSA 3AKAA 3PM8A 3BOWA 3DVKA 2LMUA 1YX8A 1CB1A 1UHJA 1M63B 2AUCA 1OMDA 5I2QA 4YRUA 1K9KA 1AVSA 1UP5A 1YRUB 2PALA 1A75A 2JT3A 2ZN8A 4PE7A 5CSFA 1CKKA 1KFXL 1K96A 1TOPA 4XJKA 2WC8A 2LHIA 1NX2A 1KFUL 2E6WA 4FQOA 1YUSA 2COLB 3EK7A 2GGZA 2HQWA 2M29A 1UHHA 3MSEB 5K89A 1J1EA 2KGBC 1OZSA 4OKHA 2F3YA 2M1UA 1SKTA 1KFXS 1AK8A 2PRUA 2RGIA 2BE4A 1IH0A 5G08A 1W7IB 4D1EA 2KAVA 1EG3A 5IBWA 1S5GY 1JBAA 3VRRA 3WHUB 2HQ8A 4MN0A 1K95A 2HETA 3RLZA 3OX5A 4DUQA 1Y0VH 2JXCA 2LUCA 3CS1A 1K94A 1QLSA 1YURA 3GOFA 1ODBA 1NWDA 1SYMA 4F0ZB 1H4BA 1HQVA 2M1KB 1BF5A 1DF0B 2H61C 1FI5A 1PALA 3OP0A 2LM5A 3PALA 3BQ3A 4GUKA 1J7QA 2BECA 4AOMA 1A29A 1RK9A 5KSZA 1MHOA 1NCXA 4OCIA 4ZCVA 2PSRA 2Y1NA 5J3XA 1XO5A 3EK4A 3GK4X 1BR4B 1ZACA 2JPTA 3LCPC 1C07A 1CFPA 4HRHA 1KQMC 2JRFA 2CXJA 3CWGA 4ORBB 2MBXA 1OSAA 3F45A 3PN7C 1BLQA 1K9UA 5ER5A 2KYCA 2LANA 1E8AA 2F2PA 1KQVA 2CT9A 1KQMB 1XFWO 2I2RE 3JVTC 1CFDA 1PRWA 3KO0A 3PN7B 1YX7A 4U8DA 4ORAB 3BUOB 4CPVA 1S5GZ 1TNXA 1CMGA 3TZ1A 3O6BA 2L5XB 2OPOA 4WQ3A 1YUTA 1JF0A 4QJ3B 5AXIA 3WXAA 1CFCA 3JVTB 1IJ6A 4YGDB 1RWYA 1GJYA 1JC2A 1BMOA 4HSZA 1ALWA 3LK1A 4ICBA 1QX5B 4YBHB 2L98A 3SG6A 3VRQA 1CDPA 3FWCA 1MWNA 2I7AA 4YI9A 4WRIA 1MXLC 4I5LB 1SL9A 3VGOA 2WCBA 1S6JA 1QATA 1WY9A 1TCOB 2F3ZA 2NZ0A 3NXAA 1QASA 4A4CA 2FJUB 5DKNA 4ZCUA 1OMVA 2MRDA 1A03A 1R2UA 1TTXA 1YVHA 3LK0A 1MXEA 4GBAA 1OQPA 3EKJA 1KSOA 3OB1B 2LNKA 1BJFA 1CLLA 2JTTA 1DJZA 2PVBA 4PE4A 5CSJA 1Y1XA 1NSHA 4PCWA 4MRYA 1CMFA 3M0WA 1WRLA 4YGBB 5DKQA 3TUYC 4HRGA 5KU1A 4M2QA 4DCKA 3ZNIA 3BUWB 3K21A 1WRZA 1KK8C 4IL1A 1YTZC 4WQ2A 3NSLA 5TNCA 1LINA 4ETOA 2M7LA 3LL8B 1DJHA 4YI8A 1VRKA 1Y1AA 4I5KA 1D1OA 4GNKB 1SPYA 2QPTA 2JXLA 2ISDA 5PALA 4PHMA 1S26D 1SMGA 2K7DA 3D0YB 4P2YB 3TUYB 4GFTA 3KHEA 2M9GA 1IG5A 1KK8B 1S36A 2LP3A 2LHLA 1F54A 1PSRA 4GGFA 5KTYA 3ICBA 1TRFA 3PSRA 1GGZA 1CLMA 2IS9A 4N1GA 5DKRA 1XK4C 5HLOA 3BUXB 1XVJA 1V1GA 3O4YA 2F2OA 1Q80A 4NDBA 3EVUA 2LAPA 2KSPA 1XA5A 2M49B 5HYDA 4UPGA 1N65A 1K9PA 3FS7A 1KSMA 3GK2A 1MQ1A 5D7FA 1RECA 2CNPA 2KAYA 2EHBA 1EJ3A 4PHKA 1SNLA 1LXFC 1QV1A 2LVIA 2CCMA 4NDCA 4M2PA 2JULA 1DT7B 1B1GA 1Y6WA 1CLBA 1AJ4A 2K2FA 3CTNA 3VROA 3EK8A 4DS7A 4BY4A 1MF8B 2FCEA 1NX1A 3AAKA 2R2IA 1KFUS 4NDDA 1B8RA 1DJIA 2KI4C 2JNXA 2JOJA 4AQJA 2M0RA 1W7JB 4A4BA 1PSBA 3OB2B 4MSPA 1M31A 1QX2A 1NUBA 3AAJA 1ALVA 1M39A 2BKHB 3RM1A 1N2DA 1BOCA 4YGCB 4QJ4B 2I18A 2O5GA 4PE0A 3OX6A 2E30A 4GPLB 2KI4B 3TDZA 4MZKA 2L2EA 1U5IB 4USLA 2LP2A 1NX0A 1PVAA 1J7RA 1GGWA 1SRAA 3A4UB 1DGUA 1LA0A 4CLNA 1CTRA 2BKIB 2KFHA 3NSKA 2ZN9A 3QRXA 2KHNA 2K2AA 2LVJA 3EKHA 2KGRA 1JWDA 2EGDA 5D69A 5AANA 3DVEA 2L4IA 4CFRA 2VRGA 1L2OC 4PHJA 2Y4QA 4N5XA 5B8IB 5CSNA 2KAXA 5GQQC 1B8LA 1UURA 3DF0A 3C1VA 2M7NA 1B8CA 3EVVA 5JOLA 5HKZA 1QX7A 3CZTX 3I5GC 2CBLA 4AQIA 1BG1A 1YVLA 1PULA 1LKJA 1F8HA 3IQOA 3CGAA 4E68A 2F33A 2NLNA 1IJ5A 1L2OB 2A4JA 4MRXA 2JQ6A 5FYXA 3WHTB 1FBVA 2F8PA 1RROA 4N1FA 5AERA 5AFPA 1EL4A 2JWWA 4PDZA 3BOWB 1XFUO 1AP4A 1EXRA 3I5GB 2MHHA 1TNQA 1SL8A 3HX4A 1F70A 1ZOTB 2M3WA 1C7VA 1DGVA 3IQQA 1BT6A 1XYDA 1A75B 1N0YA 2BCAA 2Y5IA 2AMIA 1IGVA 4DIRA 2WOSA 4XJKB 2LUXA 1FF1A 1IQ5A 3E3RA 1A4PA 4L9MA 1OOJA 1IWQA 3TS5C 1UHNA 1SCMC 3ZWHA 1F4OA 4P5OE 1KCYA 4PHNA 1NCZA 1MR8A 1S3PA 3KF9A 3NSIA 3VRNA 1RTP1 3SG7A 1IQ3A 1ZFSA 1EG4A 1OZOA 1WLZA 1CFFA 2PMYA 1OMRA 2JNFA 1QTXA 5ER4X 1JFKA 3BYAA 3TS5B 1LVCD 1SCVA 2EC6C 1SCMB 2JT0A 1NCYA 2LC5A 2LLSA 2DOQA 1DF0A 1DJGA 1G33A 1LA3A 2BCXA 1B4CA 4XYNA 2KYFA 2D8NA 2GV5A 4OR9B 1YR5A 4GAOA 3A8RA 2BL0C 2O60A 2EC6B 1AUIB 2WCEA 1JFJA 1QVIY 1B47A 2H61A 4BY5A 1H8BA 1J7OA 2BBNA 1F55A 2ZNEA 2OTGC 3AKBA 2LV7A 5F6TA 1SY9A 5HKYA 2KI6D 1CDNA 2JC2A 2BL0B 1XFVO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HLV A;  2SAS A;  4C0L A;  2K0J A;  1S6I A;  2NXQ A;  2Q91 A;  4CID A;  3PLF B;  1IRJ A;  2KNE A;  4C0K A;  5CPV A;  3SIB A;  2LVV A;  3DVM A;  2OTG B;  2ZFD A;  2QAC A;  2ZKM X;  1S6C A;  1MUX A;  2M8U A;  2WND A;  1UWO A;  1K8U A;  3DF0 B;  1QIW A;  1J7P A;  1SR6 C;  1K93 D;  4OV2 A;  1M46 A;  1TN4 A;  2NCP A;  5JJG A;  1AHR A;  3SG4 A;  3TDU A;  2FOT A;  1DJW A;  3VRP A;  4JQ0 D;  1NIW A;  5BPJ A;  1QV0 A;  3CLN A;  1CDM A;  3BXK A;  1TIZ A;  3PAT A;  1UHK A;  2BE6 A;  3O78 A;  1FPW A;  3TDI A;  1SR6 B;  1OE9 B;  2KDH A;  2G9B A;  1JUO A;  3SG2 A;  2K7B A;  2L51 A;  3O2P A;  2Y1M A;  2KFF A;  2ZRT A;  3CR5 X;  4TNC A;  3KPX A;  2P6B B;  1QVI Z;  2JT8 A;  4I5J A;  5I8N A;  4PE1 A;  4R1E A;  2MJW B;  1J1D A;  2B1U A;  2OS8 C;  3DD4 A;  1J55 A;  1AJ5 A;  1B9A A;  2PAS A;  1RFJ A;  1BR1 B;  2KOT A;  3CR4 X;  2OS8 B;  5I2O A;  1ZMZ A;  1JF2 A;  1NPQ A;  2L50 A;  3SG3 A;  1KK7 Y;  1ZUZ A;  1CM1 A;  1XFZ O;  3SJS A;  3D0Y A;  1CDL A;  4JPZ B;  2LMV A;  3EVR A;  3I5F C;  4GGF C;  1SW8 A;  1RJV A;  1PVB A;  2K7O A;  5HKW A;  2BBM A;  2K8M B;  2KI6 C;  2LLT A;  2H2K A;  2ZRS A;  3GK1 A;  1IKU A;  1QS7 A;  1B7T Y;  1SK6 D;  3OHM B;  1XFX O;  3I5F B;  2L4H A;  2K61 A;  2WCF A;  2JTZ A;  2M97 A;  4ORC B;  1M45 A;  3WNX B;  3SG5 A;  1XK4 A;  2V53 A;  1WRK A;  1YUU A;  3FIA A;  4MLW A;  1UHI A;  2AAO A;  5AEQ A;  4NQG A;  4M2O A;  1CM4 A;  1QIV A;  1QXP A;  1QLK A;  1NP8 A;  4YGA A;  1EH2 A;  2G2B A;  2LVK A;  3IF7 A;  4MZJ A;  2KQ6 A;  4PAL A;  1X02 A;  4CFQ A;  3SIA A;  1A2X A;  2KBM A;  3FWB A;  2KFG A;  1XFY O;  2WOR A;  3H4S E;  2LLU A;  1G8I A;  1KWO C;  1WDC C;  3I5H C;  1SBJ A;  1F71 A;  1DJY A;  4JWQ A;  1KK7 Z;  4I5N B;  2TN4 A;  3BUM B;  2MLE C;  3KEV A;  1G4Y R;  2FCD A;  2BCB A;  1S1E A;  1BOD A;  1K90 D;  3I5I C;  3HCM A;  1NX3 A;  2NCO A;  2LCP A;  1KWO B;  1WDC B;  3I5H B;  4MVF A;  1GQM A;  2Q4U A;  1U5I A;  3DVJ A;  1V1F A;  1DJX A;  1QJT A;  1B7T Z;  1HT9 A;  4QJ5 B;  1FW4 A;  1UUS A;  2JU0 A;  1R6P A;  1JSA A;  3JTD C;  2MAZ A;  1FI6 A;  5CSI A;  1DMO A;  2ZND A;  1SL7 A;  1TNW A;  1TCF A;  3I5I B;  5I2L A;  4FTG A;  3BUN B;  4Q04 A;  2JZI A;  1CNP A;  3CR2 A;  1WLM A;  1DVI A;  4MBE A;  2CTN A;  2HF5 A;  2MLF C;  1BU3 A;  4DRW A;  1K2H A;  2KQY A;  2SCP A;  3JTD B;  2KBI A;  1Y1U A;  2GGM A;  4C0J A;  4GGN A;  4MEW A;  2K7C A;  1TNP A;  4YGE B;  1F4Q A;  4HRE E;  4OVN F;  2LMT A;  2LE9 B;  1DTL A;  3PFV A;  1YRT B;  3D10 A;  4MZL A;  1C7W A;  1L7Z A;  1NYA A;  2L0P A;  1PK0 D;  2MA2 A;  3NSO A;  3LLE A;  2I94 A;  2HPS A;  3AKA A;  3PM8 A;  3BOW A;  3DVK A;  2LMU A;  1YX8 A;  1CB1 A;  1UHJ A;  1M63 B;  2AUC A;  1OMD A;  5I2Q A;  4YRU A;  1K9K A;  1AVS A;  1UP5 A;  1YRU B;  2PAL A;  1A75 A;  2JT3 A;  2ZN8 A;  4PE7 A;  5CSF A;  1CKK A;  1KFX L;  1K96 A;  1TOP A;  4XJK A;  2WC8 A;  2LHI A;  1NX2 A;  1KFU L;  2E6W A;  4FQO A;  1YUS A;  2COL B;  3EK7 A;  2GGZ A;  2HQW A;  2M29 A;  1UHH A;  3MSE B;  5K89 A;  1J1E A;  2KGB C;  1OZS A;  4OKH A;  2F3Y A;  2M1U A;  1SKT A;  1KFX S;  1AK8 A;  2PRU A;  2RGI A;  2BE4 A;  1IH0 A;  5G08 A;  1W7I B;  4D1E A;  2KAV A;  1EG3 A;  5IBW A;  1S5G Y;  1JBA A;  3VRR A;  3WHU B;  2HQ8 A;  4MN0 A;  1K95 A;  2HET A;  3RLZ A;  3OX5 A;  4DUQ A;  1Y0V H;  2JXC A;  2LUC A;  3CS1 A;  1K94 A;  1QLS A;  1YUR A;  3GOF A;  1ODB A;  1NWD A;  1SYM A;  4F0Z B;  1H4B A;  1HQV A;  2M1K B;  1BF5 A;  1DF0 B;  2H61 C;  1FI5 A;  1PAL A;  3OP0 A;  2LM5 A;  3PAL A;  3BQ3 A;  4GUK A;  1J7Q A;  2BEC A;  4AOM A;  1A29 A;  1RK9 A;  5KSZ A;  1MHO A;  1NCX A;  4OCI A;  4ZCV A;  2PSR A;  2Y1N A;  5J3X A;  1XO5 A;  3EK4 A;  3GK4 X;  1BR4 B;  1ZAC A;  2JPT A;  3LCP C;  1C07 A;  1CFP A;  4HRH A;  1KQM C;  2JRF A;  2CXJ A;  3CWG A;  4ORB B;  2MBX A;  1OSA A;  3F45 A;  3PN7 C;  1BLQ A;  1K9U A;  5ER5 A;  2KYC A;  2LAN A;  1E8A A;  2F2P A;  1KQV A;  2CT9 A;  1KQM B;  1XFW O;  2I2R E;  3JVT C;  1CFD A;  1PRW A;  3KO0 A;  3PN7 B;  1YX7 A;  4U8D A;  4ORA B;  3BUO B;  4CPV A;  1S5G Z;  1TNX A;  1CMG A;  3TZ1 A;  3O6B A;  2L5X B;  2OPO A;  4WQ3 A;  1YUT A;  1JF0 A;  4QJ3 B;  5AXI A;  3WXA A;  1CFC A;  3JVT B;  1IJ6 A;  4YGD B;  1RWY A;  1GJY A;  1JC2 A;  1BMO A;  4HSZ A;  1ALW A;  3LK1 A;  4ICB A;  1QX5 B;  4YBH B;  2L98 A;  3SG6 A;  3VRQ A;  1CDP A;  3FWC A;  1MWN A;  2I7A A;  4YI9 A;  4WRI A;  1MXL C;  4I5L B;  1SL9 A;  3VGO A;  2WCB A;  1S6J A;  1QAT A;  1WY9 A;  1TCO B;  2F3Z A;  2NZ0 A;  3NXA A;  1QAS A;  4A4C A;  2FJU B;  5DKN A;  4ZCU A;  1OMV A;  2MRD A;  1A03 A;  1R2U A;  1TTX A;  1YVH A;  3LK0 A;  1MXE A;  4GBA A;  1OQP A;  3EKJ A;  1KSO A;  3OB1 B;  2LNK A;  1BJF A;  1CLL A;  2JTT A;  1DJZ A;  2PVB A;  4PE4 A;  5CSJ A;  1Y1X A;  1NSH A;  4PCW A;  4MRY A;  1CMF A;  3M0W A;  1WRL A;  4YGB B;  5DKQ A;  3TUY C;  4HRG A;  5KU1 A;  4M2Q A;  4DCK A;  3ZNI A;  3BUW B;  3K21 A;  1WRZ A;  1KK8 C;  4IL1 A;  1YTZ C;  4WQ2 A;  3NSL A;  5TNC A;  1LIN A;  4ETO A;  2M7L A;  3LL8 B;  1DJH A;  4YI8 A;  1VRK A;  1Y1A A;  4I5K A;  1D1O A;  4GNK B;  1SPY A;  2QPT A;  2JXL A;  2ISD A;  5PAL A;  4PHM A;  1S26 D;  1SMG A;  2K7D A;  3D0Y B;  4P2Y B;  3TUY B;  4GFT A;  3KHE A;  2M9G A;  1IG5 A;  1KK8 B;  1S36 A;  2LP3 A;  2LHL A;  1F54 A;  1PSR A;  4GGF A;  5KTY A;  3ICB A;  1TRF A;  3PSR A;  1GGZ A;  1CLM A;  2IS9 A;  4N1G A;  5DKR A;  1XK4 C;  5HLO A;  3BUX B;  1XVJ A;  1V1G A;  3O4Y A;  2F2O A;  1Q80 A;  4NDB A;  3EVU A;  2LAP A;  2KSP A;  1XA5 A;  2M49 B;  5HYD A;  4UPG A;  1N65 A;  1K9P A;  3FS7 A;  1KSM A;  3GK2 A;  1MQ1 A;  5D7F A;  1REC A;  2CNP A;  2KAY A;  2EHB A;  1EJ3 A;  4PHK A;  1SNL A;  1LXF C;  1QV1 A;  2LVI A;  2CCM A;  4NDC A;  4M2P A;  2JUL A;  1DT7 B;  1B1G A;  1Y6W A;  1CLB A;  1AJ4 A;  2K2F A;  3CTN A;  3VRO A;  3EK8 A;  4DS7 A;  4BY4 A;  1MF8 B;  2FCE A;  1NX1 A;  3AAK A;  2R2I A;  1KFU S;  4NDD A;  1B8R A;  1DJI A;  2KI4 C;  2JNX A;  2JOJ A;  4AQJ A;  2M0R A;  1W7J B;  4A4B A;  1PSB A;  3OB2 B;  4MSP A;  1M31 A;  1QX2 A;  1NUB A;  3AAJ A;  1ALV A;  1M39 A;  2BKH B;  3RM1 A;  1N2D A;  1BOC A;  4YGC B;  4QJ4 B;  2I18 A;  2O5G A;  4PE0 A;  3OX6 A;  2E30 A;  4GPL B;  2KI4 B;  3TDZ A;  4MZK A;  2L2E A;  1U5I B;  4USL A;  2LP2 A;  1NX0 A;  1PVA A;  1J7R A;  1GGW A;  1SRA A;  3A4U B;  1DGU A;  1LA0 A;  4CLN A;  1CTR A;  2BKI B;  2KFH A;  3NSK A;  2ZN9 A;  3QRX A;  2KHN A;  2K2A A;  2LVJ A;  3EKH A;  2KGR A;  1JWD A;  2EGD A;  5D69 A;  5AAN A;  3DVE A;  2L4I A;  4CFR A;  2VRG A;  1L2O C;  4PHJ A;  2Y4Q A;  4N5X A;  5B8I B;  5CSN A;  2KAX A;  5GQQ C;  1B8L A;  1UUR A;  3DF0 A;  3C1V A;  2M7N A;  1B8C A;  3EVV A;  5JOL A;  5HKZ A;  1QX7 A;  3CZT X;  3I5G C;  2CBL A;  4AQI A;  1BG1 A;  1YVL A;  1PUL A;  1LKJ A;  1F8H A;  3IQO A;  3CGA A;  4E68 A;  2F33 A;  2NLN A;  1IJ5 A;  1L2O B;  2A4J A;  4MRX A;  2JQ6 A;  5FYX A;  3WHT B;  1FBV A;  2F8P A;  1RRO A;  4N1F A;  5AER A;  5AFP A;  1EL4 A;  2JWW A;  4PDZ A;  3BOW B;  1XFU O;  1AP4 A;  1EXR A;  3I5G B;  2MHH A;  1TNQ A;  1SL8 A;  3HX4 A;  1F70 A;  1ZOT B;  2M3W A;  1C7V A;  1DGV A;  3IQQ A;  1BT6 A;  1XYD A;  1A75 B;  1N0Y A;  2BCA A;  2Y5I A;  2AMI A;  1IGV A;  4DIR A;  2WOS A;  4XJK B;  2LUX A;  1FF1 A;  1IQ5 A;  3E3R A;  1A4P A;  4L9M A;  1OOJ A;  1IWQ A;  3TS5 C;  1UHN A;  1SCM C;  3ZWH A;  1F4O A;  4P5O E;  1KCY A;  4PHN A;  1NCZ A;  1MR8 A;  1S3P A;  3KF9 A;  3NSI A;  3VRN A;  1RTP 1;  3SG7 A;  1IQ3 A;  1ZFS A;  1EG4 A;  1OZO A;  1WLZ A;  1CFF A;  2PMY A;  1OMR A;  2JNF A;  1QTX A;  5ER4 X;  1JFK A;  3BYA A;  3TS5 B;  1LVC D;  1SCV A;  2EC6 C;  1SCM B;  2JT0 A;  1NCY A;  2LC5 A;  2LLS A;  2DOQ A;  1DF0 A;  1DJG A;  1G33 A;  1LA3 A;  2BCX A;  1B4C A;  4XYN A;  2KYF A;  2D8N A;  2GV5 A;  4OR9 B;  1YR5 A;  4GAO A;  3A8R A;  2BL0 C;  2O60 A;  2EC6 B;  1AUI B;  2WCE A;  1JFJ A;  1QVI Y;  1B47 A;  2H61 A;  4BY5 A;  1H8B A;  1J7O A;  2BBN A;  1F55 A;  2ZNE A;  2OTG C;  3AKB A;  2LV7 A;  5F6T A;  1SY9 A;  5HKY A;  2KI6 D;  1CDN A;  2JC2 A;  2BL0 B;  1XFV O; 
#chains in the Genus database with same CATH topology
 4JD9 A;  5HLV A;  2SAS A;  4C0L A;  2K0J A;  1S6I A;  2NXQ A;  2Q91 A;  4CID A;  3PLF B;  1IRJ A;  2KNE A;  4C0K A;  5CPV A;  3SIB A;  2LVV A;  3DVM A;  2OTG B;  2ZFD A;  2GTE A;  2QAC A;  1S6C A;  1MUX A;  2ZKM X;  2M8U A;  2WND A;  1UWO A;  1K8U A;  3DF0 B;  1QIW A;  1J7P A;  3D75 A;  5FI7 A;  1SR6 C;  1K93 D;  4OV2 A;  1M46 A;  1TN4 A;  2NCP A;  5JJG A;  1AHR A;  3SG4 A;  4INW A;  3PM2 A;  3TDU A;  3V2L A;  2FOT A;  1DJW A;  3VRP A;  4JQ0 D;  1NIW A;  5BPJ A;  1QV0 A;  3CLN A;  1CDM A;  3BXK A;  1TIZ A;  3PAT A;  1UHK A;  2BE6 A;  3O78 A;  1FPW A;  3TDI A;  1SR6 B;  3L4L A;  1OE9 B;  2KDH A;  2G9B A;  1JUO A;  3S0B A;  3SG2 A;  2K7B A;  2L51 A;  3O2P A;  2Y1M A;  1ORG A;  2KFF A;  1GM0 A;  2ZRT A;  3CR5 X;  4TNC A;  3KPX A;  2P6B B;  1QVI Z;  2JT8 A;  4I5J A;  5I8N A;  4PE1 A;  3NHT A;  3R1P A;  4R1E A;  2MJW B;  1J1D A;  2B1U A;  2OS8 C;  3DD4 A;  1J55 A;  1AJ5 A;  1B9A A;  2PAS A;  1RFJ A;  3B87 A;  1BR1 B;  2KOT A;  3CR4 X;  2OS8 B;  5I2O A;  1ZMZ A;  1JF2 A;  1NPQ A;  2L50 A;  3SG3 A;  1KK7 Y;  2WC6 A;  1ZUZ A;  2QEH A;  1CM1 A;  1XFZ O;  3SJS A;  3D0Y A;  1CDL A;  4JPZ B;  2LMV A;  3EVR A;  3I5F C;  4GGF C;  1SW8 A;  1RJV A;  1XFR A;  2WCJ A;  1PVB A;  2K7O A;  5HKW A;  2BBM A;  2K8M B;  2KI6 C;  2LLT A;  2H2K A;  2ZRS A;  3GK1 A;  1IKU A;  3IVT A;  1QS7 A;  1B7T Y;  1SK6 D;  3BJH A;  3OHM B;  1XFX O;  3I5F B;  4FQT A;  2L4H A;  2K61 A;  2WCF A;  2JTZ A;  3SS4 A;  2M97 A;  4ORC B;  1M45 A;  3WNX B;  4KYN A;  3SG5 A;  1XK4 A;  2V53 A;  1WRK A;  1YUU A;  3FIA A;  3L4A A;  4MLW A;  1UHI A;  3S0D A;  2AAO A;  5AEQ A;  4NQG A;  4M2O A;  1CM4 A;  1QIV A;  1QXP A;  1QLK A;  1NP8 A;  2YGU A;  4YGA A;  1EH2 A;  2G2B A;  2LVK A;  3IF7 A;  4MZJ A;  2KQ6 A;  4PAL A;  1X02 A;  4CFQ A;  3SIA A;  1A2X A;  1W9Z A;  2KBM A;  3FWB A;  2KFG A;  2QDI A;  1XFY O;  2WOR A;  3H4S E;  3D73 A;  2BAP A;  2LLU A;  1G8I A;  1KWO C;  1WDC C;  3I5H C;  1DQE A;  1SBJ A;  1F71 A;  1DJY A;  4JWQ A;  1KK7 Z;  4I5N B;  2TN4 A;  3BUM B;  2MLE C;  3KEV A;  1G4Y R;  2FCD A;  2BCB A;  1S1E A;  1BOD A;  1K90 D;  3I5I C;  3HCM A;  1NX3 A;  2NCO A;  2LCP A;  1KWO B;  1WDC B;  3I5H B;  4MVF A;  1GQM A;  1OOH A;  1U5I A;  2Q4U A;  3DVJ A;  1V1F A;  3FE9 A;  1DJX A;  1QJT A;  1B7T Z;  1HT9 A;  4QJ5 B;  1FW4 A;  1UUS A;  2JU0 A;  1R6P A;  1JSA A;  3JTD C;  2MAZ A;  1FI6 A;  5CSI A;  1DMO A;  2ZND A;  1SL7 A;  1TNW A;  1TCF A;  3I5I B;  5I2L A;  4FTG A;  3BUN B;  4Q04 A;  2JZI A;  1CNP A;  3CR2 A;  1WLM A;  1DVI A;  4IJ7 A;  2CTN A;  2HF5 A;  2MLF C;  4MBE A;  1BU3 A;  4DRW A;  1K2H A;  2KQY A;  2SCP A;  3NHI A;  3JTD B;  2KBI A;  1Y1U A;  3OBV A;  4PT1 A;  2PQL A;  2QEV A;  3R72 A;  2GGM A;  4C0J A;  4GGN A;  4MEW A;  2K7C A;  1TNP A;  4YGE B;  1F4Q A;  4HRE E;  4OVN F;  2LMT A;  2LE9 B;  1DTL A;  1OOG A;  2BNX A;  3PFV A;  1YRT B;  3D10 A;  4MZL A;  1C7W A;  1L7Z A;  1NYA A;  2L0P A;  1PK0 D;  2MA2 A;  3NSO A;  3LLE A;  2I94 A;  2HPS A;  3AKA A;  3PM8 A;  1TWO A;  3S0F A;  2P70 A;  3S0A A;  3PJI A;  3BOW A;  3DVK A;  2LMU A;  1YX8 A;  1CB1 A;  1UHJ A;  1M63 B;  2AUC A;  1OMD A;  5I2Q A;  4YRU A;  1K9K A;  1AVS A;  1UP5 A;  1YRU B;  2PAL A;  1A75 A;  2JT3 A;  2ZN8 A;  4PE7 A;  5CSF A;  1CKK A;  1KFX L;  1K96 A;  1TOP A;  4XJK A;  2WC8 A;  2LHI A;  1NX2 A;  1KFU L;  2E6W A;  4FQO A;  1YUS A;  2COL B;  5FI6 A;  5EL2 A;  3EK7 A;  2GGZ A;  2HQW A;  2M29 A;  1UHH A;  3MSE B;  5K89 A;  1J1E A;  2KGB C;  1OZS A;  4OKH A;  2F3Y A;  2M1U A;  1SKT A;  3B6X A;  1KFX S;  1AK8 A;  3CDN A;  2PRU A;  2RGI A;  2BE4 A;  1IH0 A;  5G08 A;  1W7I B;  4D1E A;  2KAV A;  1EG3 A;  5IBW A;  1S5G Y;  3L47 A;  5DIC A;  1JBA A;  1Z4H A;  3VRR A;  3WHU B;  2HQ8 A;  4MN0 A;  1K95 A;  2HET A;  3RLZ A;  3OX5 A;  4DUQ A;  1Y0V H;  2JXC A;  2LUC A;  3CS1 A;  1K94 A;  1QLS A;  1YUR A;  3GOF A;  1ODB A;  1NWD A;  1SYM A;  3EG5 B;  4F0Z B;  1H4B A;  1HQV A;  2M1K B;  1BF5 A;  1DF0 B;  2H61 C;  1FI5 A;  1PAL A;  3OP0 A;  2LM5 A;  3PAL A;  3BQ3 A;  4GUK A;  1J7Q A;  2BEC A;  4AOM A;  1A29 A;  1RK9 A;  5KSZ A;  1MHO A;  1NCX A;  4OCI A;  4ZCV A;  2PSR A;  2Y1N A;  5J3X A;  1XO5 A;  3EK4 A;  3GK4 X;  1BR4 B;  1ZAC A;  2JPT A;  3LCP C;  1C07 A;  1CFP A;  4HRH A;  1KQM C;  2JRF A;  2CXJ A;  3CWG A;  4ORB B;  2MBX A;  1OSA A;  3F45 A;  3PN7 C;  1BLQ A;  1K9U A;  2WC5 A;  2WCL A;  5ER5 A;  2KYC A;  2LAN A;  3K1E A;  1E8A A;  3FE8 A;  5HL1 A;  2F2P A;  3S0E A;  1KQV A;  2CT9 A;  1KQM B;  1XFW O;  2I2R E;  3JVT C;  1CFD A;  1PRW A;  3KO0 A;  3PN7 B;  1YX7 A;  4U8D A;  2PYQ A;  3SS3 A;  4ORA B;  3BUO B;  4CPV A;  1S5G Z;  1TNX A;  3D78 A;  1CMG A;  3TZ1 A;  3O6B A;  2L5X B;  2OPO A;  4WQ3 A;  1YUT A;  1JF0 A;  4QJ3 B;  5AXI A;  3WXA A;  3CZ1 A;  1CFC A;  3JVT B;  1IJ6 A;  4YGD B;  1RWY A;  1GJY A;  3BFB A;  1JC2 A;  1BMO A;  4HSZ A;  1ALW A;  3LK1 A;  4ICB A;  1QX5 B;  4YBH B;  2L98 A;  3SG6 A;  3VRQ A;  1CDP A;  3FWC A;  1MWN A;  2I7A A;  3R1V A;  4YI9 A;  4WRI A;  1MXL C;  3DZT A;  4I5L B;  1SL9 A;  3VGO A;  2WCB A;  1LS8 A;  1S6J A;  1QAT A;  1WY9 A;  1TCO B;  2F3Z A;  2NZ0 A;  3NXA A;  1QAS A;  4A4C A;  2FJU B;  5DKN A;  1IIO A;  3CAB A;  4ZCU A;  1OMV A;  2MRD A;  1A03 A;  1R2U A;  1TTX A;  1YVH A;  3LK0 A;  1MXE A;  4GBA A;  1OQP A;  2WCK A;  3EKJ A;  1KSO A;  3OB1 B;  2LNK A;  1BJF A;  1QWV A;  1CLL A;  2JTT A;  1DJZ A;  2PVB A;  2P71 A;  3BFH A;  4PE4 A;  1Y1X A;  1NSH A;  4PCW A;  2QEO A;  5CSJ A;  4MRY A;  1CMF A;  3M0W A;  1WRL A;  2K60 A;  4YGB B;  5DKQ A;  3TUY C;  4HRG A;  5KU1 A;  4M2Q A;  4DCK A;  3ZNI A;  1C3Y A;  3BUW B;  3K21 A;  1WRZ A;  1KK8 C;  4IL1 A;  1YTZ C;  4WQ2 A;  3NSL A;  5TNC A;  1LIN A;  3O4X A;  4ETO A;  2M7L A;  3LL8 B;  1DJH A;  4YI8 A;  1VRK A;  1Y1A A;  4I5K A;  1D1O A;  4GNK B;  1SPY A;  2QPT A;  1Z2C B;  2JXL A;  2ISD A;  5PAL A;  4PHM A;  1S26 D;  3VB1 A;  1SMG A;  2K7D A;  3D0Y B;  4P2Y B;  3TUY B;  3OGN A;  4GFT A;  3CZ0 A;  3DY9 A;  3KHE A;  2M9G A;  1IG5 A;  1KK8 B;  1S36 A;  2LP3 A;  4INX A;  2LHL A;  1F54 A;  1PSR A;  4GGF A;  5KTY A;  3ICB A;  1TRF A;  3PSR A;  1GGZ A;  1CLM A;  2IS9 A;  4N1G A;  5DKR A;  1XK4 C;  5HLO A;  3BUX B;  1XVJ A;  1V1G A;  3O4Y A;  3B86 A;  2F2O A;  1Q80 A;  4NDB A;  3EVU A;  2JPO A;  2LAP A;  3QME A;  2KSP A;  1XA5 A;  2M49 B;  5HYD A;  4UPG A;  1N65 A;  1K9P A;  3FS7 A;  3D76 A;  1KSM A;  3GK2 A;  1MQ1 A;  5D7F A;  1REC A;  2CNP A;  2KAY A;  2EHB A;  1EJ3 A;  4PHK A;  1SNL A;  1LXF C;  1OOI X;  1QV1 A;  2LVI A;  2CCM A;  4NDC A;  4M2P A;  2JUL A;  3DYE A;  1DT7 B;  1B1G A;  1Y6W A;  1CLB A;  1AJ4 A;  2K2F A;  3CTN A;  3VRO A;  3EK8 A;  4DS7 A;  4BY4 A;  3DXL A;  1MF8 B;  2FCE A;  1NX1 A;  5FI2 A;  3AAK A;  2R2I A;  1KFU S;  4NDD A;  1B8R A;  1DJI A;  2KI4 C;  3SS5 A;  2JNX A;  2JOJ A;  4AQJ A;  2M0R A;  1W7J B;  4A4B A;  1PSB A;  3OB2 B;  4MSP A;  1M31 A;  1QX2 A;  1NUB A;  2H8V A;  3AAJ A;  3N7H A;  1ALV A;  1M39 A;  1DEK A;  2BKH B;  3RM1 A;  1N2D A;  1BOC A;  4YGC B;  4QJ4 B;  2I18 A;  2O5G A;  4PE0 A;  3OX6 A;  2E30 A;  4GPL B;  2KI4 B;  3TDZ A;  4MZK A;  2L2E A;  1U5I B;  4USL A;  2LP2 A;  1NX0 A;  1PVA A;  1J7R A;  1GGW A;  1SRA A;  3CZ2 A;  3A4U B;  1DGU A;  1LA0 A;  4CLN A;  1CTR A;  2BKI B;  1DEL A;  4OZD A;  2KFH A;  3NSK A;  2ZN9 A;  3QRX A;  2KHN A;  2K2A A;  2LVJ A;  3EKH A;  2KGR A;  2KLD A;  1JWD A;  2EGD A;  5D69 A;  5AAN A;  3DVE A;  2L4I A;  4CFR A;  2VRG A;  1L2O C;  4PHJ A;  2Y4Q A;  4N5X A;  5B8I B;  5CSN A;  1TUJ A;  2KAX A;  5GQQ C;  1B8L A;  1UUR A;  3DF0 A;  3C1V A;  3S0G A;  2M7N A;  1B8C A;  3EVV A;  5JOL A;  5HKZ A;  1QX7 A;  3CZT X;  3I5G C;  2CBL A;  4AQI A;  1BG1 A;  1YVL A;  1PUL A;  1LKJ A;  1F8H A;  3IQO A;  3CGA A;  3UO9 A;  4E68 A;  2F33 A;  2NLN A;  1IJ5 A;  1L2O B;  2A4J A;  4MRX A;  2JQ6 A;  3Q8I A;  5FYX A;  3UNW A;  3WHT B;  1FBV A;  2F8P A;  1RRO A;  4N1F A;  5AER A;  5AFP A;  1EL4 A;  2JWW A;  3FE6 A;  4PDZ A;  3BOW B;  1XFU O;  2L5Y A;  1AP4 A;  1EXR A;  3CYZ A;  3I5G B;  2MHH A;  1TNQ A;  1SL8 A;  3HX4 A;  1F70 A;  1ZOT B;  2M3W A;  1C7V A;  2L2C A;  1DGV A;  3IQQ A;  1BT6 A;  1XYD A;  1A75 B;  1N0Y A;  2BCA A;  2Y5I A;  2AMI A;  2ERB A;  1IGV A;  4DIR A;  2WOS A;  4XJK B;  2LUX A;  1FF1 A;  2FJY A;  3D77 A;  1IQ5 A;  2WCM A;  3E3R A;  4F7F A;  1A4P A;  4L9M A;  2QEB A;  1SSE B;  1OOJ A;  1IWQ A;  3TS5 C;  3B7A A;  1C3Z A;  1UHN A;  1DC1 A;  1SCM C;  3ZWH A;  1F4O A;  4P5O E;  1KCY A;  4PHN A;  1NCZ A;  1MR8 A;  1OOF A;  1S3P A;  3KF9 A;  3NSI A;  5D3O A;  3VRN A;  1RTP 1;  3SG7 A;  1IQ3 A;  1ZFS A;  1EG4 A;  1OZO A;  1WLZ A;  1CFF A;  3D74 A;  2PMY A;  1OMR A;  2JNF A;  1QTX A;  5ER4 X;  3B88 A;  1JFK A;  3BYA A;  3TS5 B;  1LVC D;  1SCV A;  1OW4 A;  2EC6 C;  1SCM B;  2JT0 A;  1NCY A;  5I94 A;  2LC5 A;  2LLS A;  2DOQ A;  1DF0 A;  1T14 A;  1DJG A;  1G33 A;  1LA3 A;  2BCX A;  1B4C A;  2WCH A;  4XYN A;  2KPH A;  3R1O A;  2KLE A;  2KYF A;  2D8N A;  2GV5 A;  4OR9 B;  1YR5 A;  4GAO A;  3A8R A;  2BL0 C;  3NGV A;  2O60 A;  2EC6 B;  1AUI B;  2WCE A;  1JFJ A;  1QVI Y;  1B47 A;  2H61 A;  4BY5 A;  1H8B A;  3RZS A;  1J7O A;  2BBN A;  1F55 A;  4JKT A;  2ZNE A;  2OTG C;  3AKB A;  1TUZ A;  2LV7 A;  5F6T A;  1SY9 A;  3BFA A;  5HKY A;  1P28 A;  2KI6 D;  1CDN A;  2JC2 A;  2BL0 B;  1XFV O; 
#chains in the Genus database with same CATH homology
 5HLV A;  2SAS A;  4C0L A;  2K0J A;  1S6I A;  2NXQ A;  2Q91 A;  4CID A;  3PLF B;  1IRJ A;  2KNE A;  4C0K A;  5CPV A;  3SIB A;  2LVV A;  3DVM A;  2OTG B;  2ZFD A;  2QAC A;  2ZKM X;  1S6C A;  1MUX A;  2M8U A;  2WND A;  1UWO A;  1K8U A;  3DF0 B;  1QIW A;  1J7P A;  1SR6 C;  1K93 D;  4OV2 A;  1M46 A;  1TN4 A;  2NCP A;  5JJG A;  1AHR A;  3SG4 A;  3TDU A;  2FOT A;  1DJW A;  3VRP A;  4JQ0 D;  1NIW A;  5BPJ A;  1QV0 A;  3CLN A;  1CDM A;  3BXK A;  1TIZ A;  3PAT A;  1UHK A;  2BE6 A;  3O78 A;  1FPW A;  3TDI A;  1SR6 B;  1OE9 B;  2KDH A;  2G9B A;  1JUO A;  3SG2 A;  2K7B A;  2L51 A;  3O2P A;  2Y1M A;  2KFF A;  2ZRT A;  3CR5 X;  4TNC A;  3KPX A;  2P6B B;  1QVI Z;  2JT8 A;  4I5J A;  5I8N A;  4PE1 A;  4R1E A;  2MJW B;  1J1D A;  2B1U A;  2OS8 C;  3DD4 A;  1J55 A;  1AJ5 A;  1B9A A;  2PAS A;  1RFJ A;  1BR1 B;  2KOT A;  3CR4 X;  2OS8 B;  5I2O A;  1ZMZ A;  1JF2 A;  1NPQ A;  2L50 A;  3SG3 A;  1KK7 Y;  1ZUZ A;  1CM1 A;  1XFZ O;  3SJS A;  3D0Y A;  1CDL A;  4JPZ B;  2LMV A;  3EVR A;  3I5F C;  4GGF C;  1SW8 A;  1RJV A;  1PVB A;  2K7O A;  5HKW A;  2BBM A;  2K8M B;  2KI6 C;  2LLT A;  2H2K A;  2ZRS A;  3GK1 A;  1IKU A;  1QS7 A;  1B7T Y;  1SK6 D;  3OHM B;  1XFX O;  3I5F B;  2L4H A;  2K61 A;  2WCF A;  2JTZ A;  2M97 A;  4ORC B;  1M45 A;  3WNX B;  3SG5 A;  1XK4 A;  2V53 A;  1WRK A;  1YUU A;  3FIA A;  4MLW A;  1UHI A;  2AAO A;  5AEQ A;  4NQG A;  4M2O A;  1CM4 A;  1QIV A;  1QXP A;  1QLK A;  1NP8 A;  4YGA A;  1EH2 A;  2G2B A;  2LVK A;  3IF7 A;  4MZJ A;  2KQ6 A;  4PAL A;  1X02 A;  4CFQ A;  3SIA A;  1A2X A;  2KBM A;  3FWB A;  2KFG A;  1XFY O;  2WOR A;  3H4S E;  2LLU A;  1G8I A;  1KWO C;  1WDC C;  3I5H C;  1SBJ A;  1F71 A;  1DJY A;  4JWQ A;  1KK7 Z;  4I5N B;  2TN4 A;  3BUM B;  2MLE C;  3KEV A;  1G4Y R;  2FCD A;  2BCB A;  1S1E A;  1BOD A;  1K90 D;  3I5I C;  3HCM A;  1NX3 A;  2NCO A;  2LCP A;  1KWO B;  1WDC B;  3I5H B;  4MVF A;  1GQM A;  2Q4U A;  1U5I A;  3DVJ A;  1V1F A;  1DJX A;  1QJT A;  1B7T Z;  1HT9 A;  4QJ5 B;  1FW4 A;  1UUS A;  2JU0 A;  1R6P A;  1JSA A;  3JTD C;  2MAZ A;  1FI6 A;  5CSI A;  1DMO A;  2ZND A;  1SL7 A;  1TNW A;  1TCF A;  3I5I B;  5I2L A;  4FTG A;  3BUN B;  4Q04 A;  2JZI A;  1CNP A;  3CR2 A;  1WLM A;  1DVI A;  4MBE A;  2CTN A;  2HF5 A;  2MLF C;  1BU3 A;  4DRW A;  1K2H A;  2KQY A;  2SCP A;  3JTD B;  2KBI A;  1Y1U A;  2GGM A;  4C0J A;  4GGN A;  4MEW A;  2K7C A;  1TNP A;  4YGE B;  1F4Q A;  4HRE E;  4OVN F;  2LMT A;  2LE9 B;  1DTL A;  3PFV A;  1YRT B;  3D10 A;  4MZL A;  1C7W A;  1L7Z A;  1NYA A;  2L0P A;  1PK0 D;  2MA2 A;  3NSO A;  3LLE A;  2I94 A;  2HPS A;  3AKA A;  3PM8 A;  3BOW A;  3DVK A;  2LMU A;  1YX8 A;  1CB1 A;  1UHJ A;  1M63 B;  2AUC A;  1OMD A;  5I2Q A;  4YRU A;  1K9K A;  1AVS A;  1UP5 A;  1YRU B;  2PAL A;  1A75 A;  2JT3 A;  2ZN8 A;  4PE7 A;  5CSF A;  1CKK A;  1KFX L;  1K96 A;  1TOP A;  4XJK A;  2WC8 A;  2LHI A;  1NX2 A;  1KFU L;  2E6W A;  4FQO A;  1YUS A;  2COL B;  3EK7 A;  2GGZ A;  2HQW A;  2M29 A;  1UHH A;  3MSE B;  5K89 A;  1J1E A;  2KGB C;  1OZS A;  4OKH A;  2F3Y A;  2M1U A;  1SKT A;  1KFX S;  1AK8 A;  2PRU A;  2RGI A;  2BE4 A;  1IH0 A;  5G08 A;  1W7I B;  4D1E A;  2KAV A;  1EG3 A;  5IBW A;  1S5G Y;  1JBA A;  3VRR A;  3WHU B;  2HQ8 A;  4MN0 A;  1K95 A;  2HET A;  3RLZ A;  3OX5 A;  4DUQ A;  1Y0V H;  2JXC A;  2LUC A;  3CS1 A;  1K94 A;  1QLS A;  1YUR A;  3GOF A;  1ODB A;  1NWD A;  1SYM A;  4F0Z B;  1H4B A;  1HQV A;  2M1K B;  1BF5 A;  1DF0 B;  2H61 C;  1FI5 A;  1PAL A;  3OP0 A;  2LM5 A;  3PAL A;  3BQ3 A;  4GUK A;  1J7Q A;  2BEC A;  4AOM A;  1A29 A;  1RK9 A;  5KSZ A;  1MHO A;  1NCX A;  4OCI A;  4ZCV A;  2PSR A;  2Y1N A;  5J3X A;  1XO5 A;  3EK4 A;  3GK4 X;  1BR4 B;  1ZAC A;  2JPT A;  3LCP C;  1C07 A;  1CFP A;  4HRH A;  1KQM C;  2JRF A;  2CXJ A;  3CWG A;  4ORB B;  2MBX A;  1OSA A;  3F45 A;  3PN7 C;  1BLQ A;  1K9U A;  5ER5 A;  2KYC A;  2LAN A;  1E8A A;  2F2P A;  1KQV A;  2CT9 A;  1KQM B;  1XFW O;  2I2R E;  3JVT C;  1CFD A;  1PRW A;  3KO0 A;  3PN7 B;  1YX7 A;  4U8D A;  4ORA B;  3BUO B;  4CPV A;  1S5G Z;  1TNX A;  1CMG A;  3TZ1 A;  3O6B A;  2L5X B;  2OPO A;  4WQ3 A;  1YUT A;  1JF0 A;  4QJ3 B;  5AXI A;  3WXA A;  1CFC A;  3JVT B;  1IJ6 A;  4YGD B;  1RWY A;  1GJY A;  1JC2 A;  1BMO A;  4HSZ A;  1ALW A;  3LK1 A;  4ICB A;  1QX5 B;  4YBH B;  2L98 A;  3SG6 A;  3VRQ A;  1CDP A;  3FWC A;  1MWN A;  2I7A A;  4YI9 A;  4WRI A;  1MXL C;  4I5L B;  1SL9 A;  3VGO A;  2WCB A;  1S6J A;  1QAT A;  1WY9 A;  1TCO B;  2F3Z A;  2NZ0 A;  3NXA A;  1QAS A;  4A4C A;  2FJU B;  5DKN A;  4ZCU A;  1OMV A;  2MRD A;  1A03 A;  1R2U A;  1TTX A;  1YVH A;  3LK0 A;  1MXE A;  4GBA A;  1OQP A;  3EKJ A;  1KSO A;  3OB1 B;  2LNK A;  1BJF A;  1CLL A;  2JTT A;  1DJZ A;  2PVB A;  4PE4 A;  5CSJ A;  1Y1X A;  1NSH A;  4PCW A;  4MRY A;  1CMF A;  3M0W A;  1WRL A;  4YGB B;  5DKQ A;  3TUY C;  4HRG A;  5KU1 A;  4M2Q A;  4DCK A;  3ZNI A;  3BUW B;  3K21 A;  1WRZ A;  1KK8 C;  4IL1 A;  1YTZ C;  4WQ2 A;  3NSL A;  5TNC A;  1LIN A;  4ETO A;  2M7L A;  3LL8 B;  1DJH A;  4YI8 A;  1VRK A;  1Y1A A;  4I5K A;  1D1O A;  4GNK B;  1SPY A;  2QPT A;  2JXL A;  2ISD A;  5PAL A;  4PHM A;  1S26 D;  1SMG A;  2K7D A;  3D0Y B;  4P2Y B;  3TUY B;  4GFT A;  3KHE A;  2M9G A;  1IG5 A;  1KK8 B;  1S36 A;  2LP3 A;  2LHL A;  1F54 A;  1PSR A;  4GGF A;  5KTY A;  3ICB A;  1TRF A;  3PSR A;  1GGZ A;  1CLM A;  2IS9 A;  4N1G A;  5DKR A;  1XK4 C;  5HLO A;  3BUX B;  1XVJ A;  1V1G A;  3O4Y A;  2F2O A;  1Q80 A;  4NDB A;  3EVU A;  2LAP A;  2KSP A;  1XA5 A;  2M49 B;  5HYD A;  4UPG A;  1N65 A;  1K9P A;  3FS7 A;  1KSM A;  3GK2 A;  1MQ1 A;  5D7F A;  1REC A;  2CNP A;  2KAY A;  2EHB A;  1EJ3 A;  4PHK A;  1SNL A;  1LXF C;  1QV1 A;  2LVI A;  2CCM A;  4NDC A;  4M2P A;  2JUL A;  1DT7 B;  1B1G A;  1Y6W A;  1CLB A;  1AJ4 A;  2K2F A;  3CTN A;  3VRO A;  3EK8 A;  4DS7 A;  4BY4 A;  1MF8 B;  2FCE A;  1NX1 A;  3AAK A;  2R2I A;  1KFU S;  4NDD A;  1B8R A;  1DJI A;  2KI4 C;  2JNX A;  2JOJ A;  4AQJ A;  2M0R A;  1W7J B;  4A4B A;  1PSB A;  3OB2 B;  4MSP A;  1M31 A;  1QX2 A;  1NUB A;  3AAJ A;  1ALV A;  1M39 A;  2BKH B;  3RM1 A;  1N2D A;  1BOC A;  4YGC B;  4QJ4 B;  2I18 A;  2O5G A;  4PE0 A;  3OX6 A;  2E30 A;  4GPL B;  2KI4 B;  3TDZ A;  4MZK A;  2L2E A;  1U5I B;  4USL A;  2LP2 A;  1NX0 A;  1PVA A;  1J7R A;  1GGW A;  1SRA A;  3A4U B;  1DGU A;  1LA0 A;  4CLN A;  1CTR A;  2BKI B;  2KFH A;  3NSK A;  2ZN9 A;  3QRX A;  2KHN A;  2K2A A;  2LVJ A;  3EKH A;  2KGR A;  1JWD A;  2EGD A;  5D69 A;  5AAN A;  3DVE A;  2L4I A;  4CFR A;  2VRG A;  1L2O C;  4PHJ A;  2Y4Q A;  4N5X A;  5B8I B;  5CSN A;  2KAX A;  5GQQ C;  1B8L A;  1UUR A;  3DF0 A;  3C1V A;  2M7N A;  1B8C A;  3EVV A;  5JOL A;  5HKZ A;  1QX7 A;  3CZT X;  3I5G C;  2CBL A;  4AQI A;  1BG1 A;  1YVL A;  1PUL A;  1LKJ A;  1F8H A;  3IQO A;  3CGA A;  4E68 A;  2F33 A;  2NLN A;  1IJ5 A;  1L2O B;  2A4J A;  4MRX A;  2JQ6 A;  5FYX A;  3WHT B;  1FBV A;  2F8P A;  1RRO A;  4N1F A;  5AER A;  5AFP A;  1EL4 A;  2JWW A;  4PDZ A;  3BOW B;  1XFU O;  1AP4 A;  1EXR A;  3I5G B;  2MHH A;  1TNQ A;  1SL8 A;  3HX4 A;  1F70 A;  1ZOT B;  2M3W A;  1C7V A;  1DGV A;  3IQQ A;  1BT6 A;  1XYD A;  1A75 B;  1N0Y A;  2BCA A;  2Y5I A;  2AMI A;  1IGV A;  4DIR A;  2WOS A;  4XJK B;  2LUX A;  1FF1 A;  1IQ5 A;  3E3R A;  1A4P A;  4L9M A;  1OOJ A;  1IWQ A;  3TS5 C;  1UHN A;  1SCM C;  3ZWH A;  1F4O A;  4P5O E;  1KCY A;  4PHN A;  1NCZ A;  1MR8 A;  1S3P A;  3KF9 A;  3NSI A;  3VRN A;  1RTP 1;  3SG7 A;  1IQ3 A;  1ZFS A;  1EG4 A;  1OZO A;  1WLZ A;  1CFF A;  2PMY A;  1OMR A;  2JNF A;  1QTX A;  5ER4 X;  1JFK A;  3BYA A;  3TS5 B;  1LVC D;  1SCV A;  2EC6 C;  1SCM B;  2JT0 A;  1NCY A;  2LC5 A;  2LLS A;  2DOQ A;  1DF0 A;  1DJG A;  1G33 A;  1LA3 A;  2BCX A;  1B4C A;  4XYN A;  2KYF A;  2D8N A;  2GV5 A;  4OR9 B;  1YR5 A;  4GAO A;  3A8R A;  2BL0 C;  2O60 A;  2EC6 B;  1AUI B;  2WCE A;  1JFJ A;  1QVI Y;  1B47 A;  2H61 A;  4BY5 A;  1H8B A;  1J7O A;  2BBN A;  1F55 A;  2ZNE A;  2OTG C;  3AKB A;  2LV7 A;  5F6T A;  1SY9 A;  5HKY A;  2KI6 D;  1CDN A;  2JC2 A;  2BL0 B;  1XFV O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...