1IRJA

Crystal structure of the mrp14 complexed with chaps
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
85
structure length
85
Chain Sequence
b'TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Migration Inhibitory Factor-Related Protein 14
publication title The crystal structure of human MRP14 (S100A9), a Ca(2+)-dependent regulator protein in inflammatory process.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 33
structure length 85
sequence length 85
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2001-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1irjA00
3VRQA 1RFJA 1YTZC 3PATA 2I18A 1HT9A 2CT9A 2ZN9A 5DKQA 2KOTA 2Q4UA 1ZUZA 1QIVA 4R1EA 1XFWO 1K96A 2HETA 2M1KB 1MWNA 1EJ3A 3FIAA 1QX7A 4MZKA 4GFTA 2JC2A 1CTRA 1JF0A 1SKTA 1YX8A 2E6WA 2WCBA 3TUYC 1QS7A 4PE1A 4N1FA 1L7ZA 1U5IA 1CDLA 1XA5A 2GGZA 3SJSA 3SG4A 2BE6A 2OS8B 4OKHA 1MHOA 2EC6C 1WRKA 3BYAA 3DD4A 3JTDB 5BPJA 1LINA 1EXRA 2JNFA 5I2LA 2WORA 3VRPA 3E3RA 2KNEA 1F4OA 1CLBA 1SW8A 1K9UA 1GJYA 2Y1NA 4A4CA 2K0JA 1RK9A 4PHJA 4YGAA 3I5IC 1BR1B 1BR4B 4PHMA 1SRAA 1B4CA 4NDBA 2L4IA 2FCEA 2PASA 1MUXA 3KO0A 3EK4A 1QX5B 5HKWA 2FJUB 2B1UA 5GQQC 2NXQA 2R2IA 1SR6C 1KQMC 5I2QA 1M63B 1G8IA 1JFKA 1B8LA 1KSMA 1QV1A 2CXJA 2AMIA 4TNCA 2KFHA 2LE9B 1S5GY 3O4YA 1A2XA 3O2PA 3LL8B 1TNPA 1SL8A 3KHEA 1JFJA 3C1VA 1HQVA 1VRKA 3EVRA 1FW4A 2LANA 2O5GA 4AOMA 1QJTA 1ODBA 4P2YB 3NSKA 2F8PA 4MBEA 2BL0B 2LLTA 2EHBA 4HREE 1TNWA 1PALA 4YGDB 4YGEB 1AHRA 2LVVA 1IJ6A 2F2PA 2TN4A 1QASA 2F33A 1YX7A 2LCPA 5G08A 1XFVO 2Y5IA 1PVBA 3GOFA 3BOWA 2OS8C 1EG3A 1J7PA 2KI4B 1ALVA 1DJIA 1LXFC 3JTDC 4PHNA 4QJ3B 1JBAA 1AJ5A 1IWQA 3ZNIA 2M8UA 3FWCA 4JWQA 1JWDA 4ICBA 4XJKA 3A4UB 1SBJA 1NCXA 1IQ5A 1OQPA 2L98A 1ALWA 1KFXS 1K90D 1OMDA 4M2QA 2I7AA 2M49B 1NX1A 4PE4A 2Y4QA 4NQGA 3SG7A 2MLEC 4MVFA 2E30A 1IH0A 2KI6C 1J7RA 1YUUA 1CFDA 1CNPA 1C07A 1TCOB 1A4PA 2BE4A 4M2OA 4PE0A 2QACA 1S6JA 5ER4X 1D1OA 2KDHA 2OTGB 3BUOB 2LUCA 2MLFC 2I2RE 3RM1A 2M3WA 4GGFC 1OOJA 1BLQA 4C0KA 2LMUA 2L2EA 1MF8B 1H4BA 2KYFA 5J3XA 1C7WA 1EL4A 1XYDA 1B8CA 2CTNA 2WC8A 2KHNA 1KWOB 3TS5B 4MRYA 1J7OA 1XFXO 2JWWA 1DJYA 2JXCA 1K9PA 2M97A 2BL0C 1UHNA 1WLMA 3NSIA 2HQ8A 1A75B 1NWDA 2PMYA 2LVIA 4AQIA 3OB1B 4MSPA 2ISDA 1WRZA 1DJZA 1LKJA 4DUQA 1UURA 3EKJA 3CTNA 3IF7A 4CPVA 5B8IB 2KFGA 1UHKA 2K7CA 3LK0A 3RLZA 1PSBA 2RGIA 4PE7A 1FF1A 1F70A 4Q04A 3AKAA 2BCAA 2KI4C 1B8RA 2LC5A 1F4QA 2K61A 5I8NA 1L2OB 1QV0A 2JU0A 1OMRA 3I5FB 2MAZA 1NCYA 1KQVA 4GUKA 2JPTA 1NSHA 2M0RA 1J7QA 3CGAA 3NSOA 4I5NB 1XVJA 3PLFB 4CFQA 3ZWHA 4N5XA 2LV7A 3SG3A 2KQ6A 3NSLA 1NX3A 2LMTA 2NCPA 1QATA 1BU3A 5K89A 1KCYA 1W7IB 3BOWB 3JVTB 4FQOA 1H8BA 2OTGC 2ZFDA 2NLNA 1XFYO 2I94A 2KAXA 1DT7B 5F6TA 3OB2B 3DF0B 2M7NA 4ORAB 4HSZA 3IQOA 4DS7A 1RROA 4XJKB 4ETOA 1A75A 1QIWA 1WY9A 4D1EA 1MXEA 3BQ3A 3AAJA 3OP0A 1FI6A 3FS7A 1ZFSA 1AP4A 1KWOC 2P6BB 3TS5C 4CIDA 2ZKMX 1DGVA 1TNXA 1J55A 1MXLC 1F55A 4BY5A 4WQ2A 1G33A 1PRWA 1RWYA 1RJVA 3MSEB 3VGOA 1IGVA 4GBAA 1M46A 5I2OA 2LP2A 1KSOA 3BUWB 4GNKB 1NP8A 1K9KA 4BY4A 3TDUA 1S26D 2L50A 4PHKA 1NX0A 3BUMB 5AXIA 4GAOA 2QPTA 3WXAA 2L5XB 3VRRA 1FPWA 1B9AA 1TN4A 2K7DA 1L2OC 3PALA 3I5FC 5KTYA 4JPZB 2A4JA 1Y1AA 5TNCA 1DJXA 1KK7Y 2LMVA 3GK2A 1GQMA 2LLSA 1EG4A 1QVIY 2K7BA 4DCKA 2K2FA 2JULA 1X02A 1G4YR 2V53A 1S5GZ 1TRFA 5CSJA 1BJFA 2VRGA 5HYDA 5DKRA 4MEWA 1UP5A 1F8HA 1N0YA 3D10A 3SG5A 1JSAA 3PN7B 1S3PA 2KSPA 2JOJA 1F71A 5D69A 4I5JA 3FWBA 5CSNA 1K2HA 2GGMA 1OE9B 1V1FA 3DF0A 2BBMA 1YR5A 1KK8B 1V1GA 2K2AA 1XFUO 1CDMA 3JVTC 1BG1A 3I5HB 1RTP1 2KFFA 1DMOA 2K7OA 3OHMB 2CBLA 1DJGA 1PULA 2MRDA 1E8AA 1TTXA 3CR4X 2LUXA 2JRFA 2GV5A 1K94A 2F2OA 4A4BA 2Q91A 1KFXL 1TCFA 4OV2A 4ORCB 2PALA 3D0YB 1M45A 5IBWA 1WRLA 2WCEA 2M1UA 5CSFA 1Y1XA 2O60A 1LVCD 2NZ0A 1QLKA 3OX5A 1CMGA 1QTXA 2BKIB 3KF9A 1CLLA 1CKKA 2HQWA 1B7TY 2ZNDA 2ZRTA 1AJ4A 1OZOA 1B47A 2PRUA 1MQ1A 2BKHB 2JNXA 4MZJA 3LK1A 1YUSA 1S6CA 2MHHA 1CMFA 5CPVA 3DVKA 1J1DA 1AUIB 2L4HA 2D8NA 1GGWA 1KFUS 3K21A 1SYMA 5PALA 4QJ5B 5JJGA 1Y6WA 1OSAA 1F54A 4WRIA 4YGCB 1SPYA 1CB1A 4NDDA 4PALA 1BMOA 2KBIA 2ZRSA 5AERA 2LHIA 3PN7C 1B1GA 1N2DA 1AK8A 2K8MB 2G2BA 4L9MA 1EH2A 1FBVA 3I5GB 2JXLA 4USLA 2BCBA 1GGZA 1KK8C 4P5OE 3CR5X 1ZOTB 3CS1A 3I5HC 5AFPA 1UHHA 3SIAA 2KYCA 3WHTB 1DF0B 3HX4A 5AANA 3D0YA 5HKYA 4CFRA 4WQ3A 2LLUA 1JUOA 3CWGA 1AVSA 2CNPA 4OR9B 5D7FA 1K8UA 3AKBA 4NDCA 5HLVA 1WLZA 1IKUA 1XFZO 5FYXA 3M0WA 1M31A 2M29A 2LAPA 4GPLB 4HRHA 2PVBA 2MJWB 1R2UA 2F3YA 1XK4A 4YGBB 1J1EA 2WNDA 1BOCA 1JF2A 4GGNA 3CZTX 4MRXA 2M9GA 2Y1MA 1ZACA 4YI8A 3NXAA 1SK6D 1IG5A 3H4SE 4YBHB 1LA3A 2KBMA 4N1GA 1XK4C 4DIRA 3PSRA 1NCZA 1Q80A 1SCMB 4OCIA 1YURA 4PCWA 1JC2A 3AAKA 3IQQA 2EGDA 4HRGA 3O6BA 1NUBA 1NYAA 1QXPA 2HF5A 2H2KA 2JT3A 1IQ3A 3QRXA 5DKNA 4IL1A 3KPXA 2L0PA 3SG2A 1YRUB 1YVHA 4M2PA 3DVJA 1N65A 1R6PA 2BCXA 1BF5A 3TZ1A 1FI5A 3WHUB 1NX2A 3LLEA 2DOQA 3SIBA 2KAYA 4ZCUA 1Y0VH 2AUCA 3LCPC 4MLWA 3KEVA 1QLSA 4I5LB 1DF0A 2KI6D 2BBNA 1DJHA 1C7VA 3I5GC 4OVNF 1UWOA 2G9BA 2JTZA 3F45A 2M7LA 2KAVA 3PM8A 4DRWA 3DVMA 1CFPA 1XO5A 1CFFA 5HKZA 1SNLA 1DVIA 2JT0A 1MR8A 3SG6A 2KGBC 3GK1A 4MN0A 2KGRA 2WOSA 1WDCB 4ZCVA 2FCDA 2AAOA 1TIZA 1UHIA 2ZN8A 2ZNEA 1RECA 3EK7A 2SCPA 3VRNA 3A8RA 2MA2A 5KU1A 1Y1UA 1S1EA 3BXKA 1KK7Z 1LA0A 1TNQA 2SASA 2WCFA 2LVJA 1QVIZ 4ORBB 1BODA 1CM1A 4QJ4B 1IRJA 2H61A 1SCMC 4U8DA 3CR2A 3EK8A 4C0LA 1UUSA 1IJ5A 1W7JB 1A29A 3GK4X 4UPGA 1SL9A 3ICBA 3OX6A 4AQJA 2PSRA 4F0ZB 2LNKA 1SCVA 3TDIA 4YI9A 3VROA 1PVAA 2JTTA 2LVKA 3BUXB 3TUYB 4C0JA 4E68A 3BUNB 1DJWA 2H61C 2L51A 1CM4A 1K95A 4CLNA 1DTLA 1M39A 2IS9A 1UHJA 3HCMA 1YRTB 1BT6A 1SY9A 4FTGA 2F3ZA 2EC6B 1SMGA 5AEQA 1SL7A 3O78A 2JT8A 2HPSA 3EVUA 4GGFA 2BECA 1YUTA 5HLOA 4I5KA 5KSZA 1U5IB 1QX2A 2CCMA 2JZIA 2LM5A 2KQYA 1A03A 1DGUA 1OMVA 1NIWA 1PSRA 1S6IA 1ZMZA 3EVVA 5JOLA 1YVLA 3CLNA 4MZLA 1S36A 3I5IB 2LHLA 2COLB 1TOPA 5ER5A 2FOTA 1K93D 4JQ0D 2NCOA 4XYNA 3DVEA 1KFUL 1SR6B 3TDZA 1B7TZ 5CSIA 3WNXB 1WDCC 1KQMB 3EKHA 1PK0D 1CLMA 2JQ6A 1CDPA 4YRUA 1NPQA 2LP3A 1OZSA 4PDZA 2MBXA 3PFVA 1CFCA 2OPOA 1CDNA
chains in the Genus database with same CATH superfamily
3VRQA 1RFJA 4INWA 1YTZC 3PATA 2I18A 1HT9A 2CT9A 2ZN9A 5DKQA 3B7AA 2KOTA 2Q4UA 1ZUZA 1QIVA 3CABA 4R1EA 1XFWO 1K96A 2HETA 3S0BA 2M1KB 1MWNA 1OOHA 1EJ3A 3D75A 3FIAA 1QX7A 4MZKA 4GFTA 2JC2A 1CTRA 1JF0A 1SKTA 1YX8A 2E6WA 2WCBA 3TUYC 1QS7A 4PE1A 2WCKA 4N1FA 1L7ZA 1U5IA 1CDLA 1XA5A 2GGZA 2GTEA 1SSEB 3SJSA 3K1EA 3SG4A 2BE6A 2OS8B 4OKHA 1MHOA 2EC6C 1WRKA 3BYAA 3DD4A 3JTDB 5BPJA 1LINA 1EXRA 2JNFA 2KLEA 5I2LA 2WORA 3VRPA 3E3RA 2KNEA 1F4OA 1CLBA 1SW8A 1K9UA 1GJYA 2Y1NA 3R72A 4A4CA 3PJIA 2K0JA 3PM2A 1RK9A 4PHJA 3IVTA 4YGAA 3I5IC 1BR1B 1BR4B 4PHMA 1SRAA 1B4CA 4NDBA 2L4IA 2FCEA 2PASA 1MUXA 3KO0A 1C3YA 3EK4A 1QX5B 5HKWA 2FJUB 2B1UA 5GQQC 2NXQA 3D74A 2R2IA 1SR6C 1KQMC 3S0GA 1M63B 1G8IA 3O4XA 5I2QA 1JFKA 1B8LA 1KSMA 1QV1A 2CXJA 2AMIA 4TNCA 2KFHA 2LE9B 1S5GY 3S0DA 3O4YA 1A2XA 3DXLA 3O2PA 3LL8B 1TNPA 1SL8A 3KHEA 1JFJA 3C1VA 1HQVA 1DC1A 1VRKA 3EVRA 1FW4A 1XFRA 2LANA 2O5GA 4AOMA 1QJTA 1ODBA 2WC5A 4P2YB 3NSKA 2F8PA 4MBEA 5FI2A 2BL0B 2LLTA 2EHBA 4HREE 1TNWA 1PALA 4YGDB 4YGEB 1AHRA 2LVVA 1IJ6A 2F2PA 2TN4A 4FQTA 1QASA 2F33A 1YX7A 2LCPA 5G08A 1XFVO 2Y5IA 1PVBA 3GOFA 3BOWA 3N7HA 2OS8C 1EG3A 1J7PA 2KI4B 3VB1A 1ALVA 1DJIA 1LXFC 3JTDC 4PHNA 4QJ3B 1JBAA 1AJ5A 1IWQA 3SS5A 3ZNIA 2M8UA 3FWCA 4OZDA 4JWQA 1JWDA 4ICBA 4XJKA 3A4UB 1SBJA 1NCXA 1IQ5A 1OQPA 2L98A 1ALWA 1KFXS 1K90D 1OMDA 4KYNA 4M2QA 2I7AA 1W9ZA 2M49B 2P70A 1NX1A 4PE4A 2Y4QA 4NQGA 3SS3A 3NHIA 3SG7A 2MLEC 4MVFA 2E30A 3S0AA 1IH0A 2KI6C 2WC6A 1J7RA 1YUUA 1CFDA 1CNPA 3BFBA 1C07A 1TCOB 1A4PA 2BE4A 4M2OA 4PE0A 2QACA 1S6JA 5ER4X 1D1OA 2KDHA 2OTGB 3BUOB 2LUCA 2MLFC 3R1OA 2I2RE 3RM1A 2M3WA 4GGFC 1OOJA 1BLQA 4C0KA 2LMUA 2L2EA 1MF8B 1H4BA 2KYFA 5J3XA 1C7WA 1EL4A 1XYDA 1B8CA 2CTNA 2WC8A 2KHNA 1KWOB 3TS5B 4MRYA 1J7OA 1XFXO 2JWWA 1DJYA 2JXCA 1K9PA 2M97A 2BL0C 1UHNA 1WLMA 3NSIA 5I94A 2HQ8A 1A75B 1NWDA 2PMYA 2LVIA 3CZ0A 3OB1B 4MSPA 4AQIA 2ISDA 1WRZA 1DJZA 1LKJA 4DUQA 1UURA 3EKJA 3CTNA 3IF7A 4CPVA 5B8IB 2KFGA 1UHKA 3BJHA 2K7CA 4JD9A 3LK0A 3NGVA 3RLZA 1PSBA 2RGIA 4PE7A 1FF1A 1F70A 4Q04A 3AKAA 2BCAA 2KI4C 1B8RA 2LC5A 1F4QA 2K61A 5I8NA 1L2OB 1QV0A 2JU0A 1OMRA 1DQEA 2MAZA 1NCYA 3I5FB 3UNWA 1KQVA 4GUKA 2JPTA 1NSHA 2M0RA 3Q8IA 1J7QA 3CGAA 3NSOA 4I5NB 1XVJA 3PLFB 4CFQA 3ZWHA 4N5XA 2LV7A 2QEVA 3SG3A 2KQ6A 3NSLA 1NX3A 3FE8A 2LMTA 2NCPA 1OW4A 1IIOA 1QATA 3CZ1A 1BU3A 5K89A 1KCYA 1W7IB 3BOWB 3JVTB 2WCJA 4FQOA 1H8BA 2OTGC 2ZFDA 3S0FA 2NLNA 1LS8A 1XFYO 2I94A 2KAXA 1DT7B 5F6TA 2ERBA 3OB2B 3DF0B 2M7NA 4ORAB 2WCLA 3IQOA 3R1PA 1RROA 4HSZA 4XJKB 4DS7A 4ETOA 1A75A 1QIWA 1WY9A 4D1EA 1MXEA 3BQ3A 3AAJA 3OP0A 1FI6A 3FS7A 1ZFSA 1AP4A 1KWOC 2P6BB 3TS5C 4CIDA 2PQLA 2ZKMX 1DGVA 1TNXA 1J55A 1MXLC 1F55A 4BY5A 4WQ2A 1OOGA 1G33A 1PRWA 1RWYA 1RJVA 3MSEB 3VGOA 1IGVA 1T14A 2QDIA 4GBAA 1M46A 3FE9A 5I2OA 2LP2A 1KSOA 3BUWB 4GNKB 1NP8A 1K9KA 4BY4A 3TDUA 1S26D 2L50A 4PHKA 1NX0A 3BUMB 5AXIA 4GAOA 1Z2CB 2QPTA 3WXAA 2L5XB 3VRRA 1FPWA 1B9AA 1TN4A 2K7DA 1L2OC 3PALA 3I5FC 5KTYA 4JPZB 2A4JA 1Y1AA 5TNCA 1DJXA 1KK7Y 2LMVA 3GK2A 1GQMA 2LLSA 1EG4A 1QVIY 2K7BA 2PYQA 2K2FA 4DCKA 2JULA 1X02A 1G4YR 2V53A 1S5GZ 1TRFA 5CSJA 1BJFA 2VRGA 3S0EA 5HYDA 5DKRA 4MEWA 1UP5A 1F8HA 1N0YA 3D10A 3SG5A 1JSAA 3PN7B 1S3PA 2KSPA 2JOJA 1F71A 5D69A 4I5JA 3FWBA 5CSNA 1K2HA 2GGMA 1OE9B 1V1FA 3DF0A 2BBMA 1YR5A 1KK8B 1V1GA 2K2AA 1XFUO 1CDMA 3JVTC 1BG1A 3I5HB 1RTP1 2KFFA 1DMOA 2K7OA 3OHMB 2CBLA 1DJGA 1PULA 1DEKA 2MRDA 1E8AA 1TTXA 3CR4X 2LUXA 2JRFA 2GV5A 1K94A 2F2OA 4A4BA 2Q91A 1KFXL 1TCFA 4OV2A 4ORCB 2PALA 3D0YB 1M45A 5IBWA 1WRLA 2WCEA 2M1UA 1ORGA 3R1VA 5CSFA 1Y1XA 2O60A 1LVCD 3UO9A 2K60A 2NZ0A 1QLKA 1P28A 2JPOA 3DZTA 3OX5A 1CMGA 1QTXA 2BKIB 3KF9A 1CLLA 1CKKA 2HQWA 1B7TY 2ZNDA 2ZRTA 2H8VA 1AJ4A 1OZOA 1B47A 2PRUA 1MQ1A 2BAPA 2BKHB 2JNXA 4MZJA 1GM0A 3LK1A 2BNXA 1YUSA 1S6CA 2MHHA 1CMFA 5CPVA 3DVKA 1J1DA 1AUIB 5D3OA 2L4HA 2D8NA 2L5YA 1GGWA 1KFUS 3K21A 1SYMA 3BFAA 5PALA 4QJ5B 1OOIX 1Y6WA 5JJGA 5DICA 1OSAA 1F54A 4WRIA 4YGCB 1SPYA 3RZSA 1CB1A 4NDDA 4PALA 1BMOA 1TUJA 1TWOA 3CZ2A 2QEBA 2KBIA 2ZRSA 5AERA 2LHIA 3PN7C 1B1GA 1N2DA 1AK8A 2K8MB 2G2BA 3EG5B 4L9MA 1EH2A 1FBVA 3I5GB 2JXLA 3QMEA 4USLA 2BCBA 3D77A 1GGZA 1KK8C 4P5OE 3CR5X 1ZOTB 3CS1A 3I5HC 5AFPA 1UHHA 3SIAA 2KYCA 3DY9A 3WHTB 4IJ7A 1DF0B 3HX4A 1OOFA 3D0YA 5AANA 5HKYA 4CFRA 4WQ3A 2LLUA 1JUOA 3CWGA 1AVSA 2CNPA 4OR9B 2P71A 5D7FA 1K8UA 3AKBA 4NDCA 5HLVA 1WLZA 1IKUA 1XFZO 5FYXA 3M0WA 1M31A 2M29A 2LAPA 4GPLB 4HRHA 2PVBA 2MJWB 1R2UA 2F3YA 3V2LA 3FE6A 1XK4A 4YGBB 1J1EA 2WNDA 2YGUA 1BOCA 1JF2A 4GGNA 3CZTX 4MRXA 1QWVA 2M9GA 2Y1MA 1ZACA 4YI8A 3NXAA 1SK6D 1IG5A 3H4SE 4YBHB 1LA3A 2KBMA 4N1GA 1XK4C 4DIRA 3PSRA 1NCZA 1Q80A 1SCMB 4OCIA 1YURA 4PCWA 1JC2A 3AAKA 3IQQA 2EGDA 4HRGA 3DYEA 3O6BA 1NUBA 1NYAA 1QXPA 2HF5A 2H2KA 2JT3A 1IQ3A 3QRXA 2QEOA 5DKNA 4IL1A 3KPXA 2L0PA 3SG2A 1YRUB 1YVHA 4M2PA 3DVJA 1N65A 1R6PA 2BCXA 1BF5A 3TZ1A 1FI5A 3WHUB 2FJYA 2WCMA 1NX2A 3LLEA 2DOQA 3SIBA 2KAYA 4ZCUA 1Y0VH 2AUCA 3LCPC 1Z4HA 4MLWA 3L4AA 3KEVA 1QLSA 4I5LB 1C3ZA 3SS4A 1DF0A 2KI6D 2BBNA 1DJHA 1C7VA 3I5GC 4OVNF 1DELA 1UWOA 2G9BA 2JTZA 3F45A 2M7LA 2KAVA 3PM8A 4DRWA 3DVMA 5FI6A 1CFPA 2QEHA 1XO5A 3NHTA 5HKZA 1SNLA 3B86A 1CFFA 1DVIA 2JT0A 1MR8A 3D78A 3SG6A 3B6XA 2KGBC 3GK1A 3OGNA 2KGRA 4MN0A 2WOSA 1WDCB 4ZCVA 2FCDA 2AAOA 1TIZA 1UHIA 2ZN8A 2ZNEA 1RECA 3EK7A 2SCPA 3VRNA 3A8RA 1TUZA 2MA2A 5KU1A 1Y1UA 1S1EA 2KLDA 3BXKA 1KK7Z 1LA0A 1TNQA 2SASA 2WCFA 2LVJA 1QVIZ 4ORBB 3D73A 1BODA 1CM1A 4QJ4B 1IRJA 2H61A 1SCMC 4U8DA 3CR2A 3EK8A 4C0LA 1UUSA 1IJ5A 1W7JB 1A29A 3GK4X 4UPGA 1SL9A 3ICBA 3OX6A 4AQJA 2PSRA 4F0ZB 4PT1A 2LNKA 1SCVA 3TDIA 4YI9A 3VROA 1PVAA 4F7FA 2JTTA 2LVKA 3BUXB 3TUYB 4C0JA 4E68A 3BUNB 1DJWA 2H61C 2L51A 2L2CA 1CM4A 1K95A 4CLNA 1DTLA 1M39A 2IS9A 1UHJA 3HCMA 1YRTB 1BT6A 1SY9A 5FI7A 4FTGA 2F3ZA 2EC6B 1SMGA 3B88A 5AEQA 1SL7A 3O78A 2JT8A 2HPSA 2KPHA 3EVUA 4GGFA 3D76A 2BECA 1YUTA 3CDNA 4I5KA 4JKTA 1U5IB 5HLOA 5KSZA 1QX2A 2CCMA 2JZIA 2LM5A 2KQYA 5EL2A 1A03A 1DGUA 1OMVA 1NIWA 1PSRA 1S6IA 1ZMZA 3EVVA 5JOLA 1YVLA 3CLNA 4MZLA 1S36A 3I5IB 2LHLA 3B87A 2COLB 1TOPA 5ER5A 2FOTA 1K93D 4JQ0D 2NCOA 4XYNA 3DVEA 1KFUL 1SR6B 2WCHA 3TDZA 1B7TZ 3BFHA 5CSIA 3WNXB 1WDCC 1KQMB 3EKHA 1PK0D 1CLMA 2JQ6A 1CDPA 3L47A 4INXA 4YRUA 1NPQA 2LP3A 1OZSA 3L4LA 4PDZA 2MBXA 3PFVA 1CFCA 3OBVA 5HL1A 3CYZA 2OPOA 1CDNA
chains in the Genus database with same CATH topology
3VRQA 1RFJA 1YTZC 3PATA 2I18A 1HT9A 2CT9A 2ZN9A 5DKQA 2KOTA 2Q4UA 1ZUZA 1QIVA 4R1EA 1XFWO 1K96A 2HETA 2M1KB 1MWNA 1EJ3A 3FIAA 1QX7A 4MZKA 4GFTA 2JC2A 1CTRA 1JF0A 1SKTA 1YX8A 2E6WA 2WCBA 3TUYC 1QS7A 4PE1A 4N1FA 1L7ZA 1U5IA 1CDLA 1XA5A 2GGZA 3SJSA 3SG4A 2BE6A 2OS8B 4OKHA 1MHOA 2EC6C 1WRKA 3BYAA 3DD4A 3JTDB 5BPJA 1LINA 1EXRA 2JNFA 5I2LA 2WORA 3VRPA 3E3RA 2KNEA 1F4OA 1CLBA 1SW8A 1K9UA 1GJYA 2Y1NA 4A4CA 2K0JA 1RK9A 4PHJA 4YGAA 3I5IC 1BR1B 1BR4B 4PHMA 1SRAA 1B4CA 4NDBA 2L4IA 2FCEA 2PASA 1MUXA 3KO0A 3EK4A 1QX5B 5HKWA 2FJUB 2B1UA 5GQQC 2NXQA 2R2IA 1SR6C 1KQMC 5I2QA 1M63B 1G8IA 1JFKA 1B8LA 1KSMA 1QV1A 2CXJA 2AMIA 4TNCA 2KFHA 2LE9B 1S5GY 3O4YA 1A2XA 3O2PA 3LL8B 1TNPA 1SL8A 3KHEA 1JFJA 3C1VA 1HQVA 1VRKA 3EVRA 1FW4A 2LANA 2O5GA 4AOMA 1QJTA 1ODBA 4P2YB 3NSKA 2F8PA 4MBEA 2BL0B 2LLTA 2EHBA 4HREE 1TNWA 1PALA 4YGDB 4YGEB 1AHRA 2LVVA 1IJ6A 2F2PA 2TN4A 1QASA 2F33A 1YX7A 2LCPA 5G08A 1XFVO 2Y5IA 1PVBA 3GOFA 3BOWA 2OS8C 1EG3A 1J7PA 2KI4B 1ALVA 1DJIA 1LXFC 3JTDC 4PHNA 4QJ3B 1JBAA 1AJ5A 1IWQA 3ZNIA 2M8UA 3FWCA 4JWQA 1JWDA 4ICBA 4XJKA 3A4UB 1SBJA 1NCXA 1IQ5A 1OQPA 2L98A 1ALWA 1KFXS 1K90D 1OMDA 4M2QA 2I7AA 2M49B 1NX1A 4PE4A 2Y4QA 4NQGA 3SG7A 2MLEC 4MVFA 2E30A 1IH0A 2KI6C 1J7RA 1YUUA 1CFDA 1CNPA 1C07A 1TCOB 1A4PA 2BE4A 4M2OA 4PE0A 2QACA 1S6JA 5ER4X 1D1OA 2KDHA 2OTGB 3BUOB 2LUCA 2MLFC 2I2RE 3RM1A 2M3WA 4GGFC 1OOJA 1BLQA 4C0KA 2LMUA 2L2EA 1MF8B 1H4BA 2KYFA 5J3XA 1C7WA 1EL4A 1XYDA 1B8CA 2CTNA 2WC8A 2KHNA 1KWOB 3TS5B 4MRYA 1J7OA 1XFXO 2JWWA 1DJYA 2JXCA 1K9PA 2M97A 2BL0C 1UHNA 1WLMA 3NSIA 2HQ8A 1A75B 1NWDA 2PMYA 2LVIA 4AQIA 3OB1B 4MSPA 2ISDA 1WRZA 1DJZA 1LKJA 4DUQA 1UURA 3EKJA 3CTNA 3IF7A 4CPVA 5B8IB 2KFGA 1UHKA 2K7CA 3LK0A 3RLZA 1PSBA 2RGIA 4PE7A 1FF1A 1F70A 4Q04A 3AKAA 2BCAA 2KI4C 1B8RA 2LC5A 1F4QA 2K61A 5I8NA 1L2OB 1QV0A 2JU0A 1OMRA 3I5FB 2MAZA 1NCYA 1KQVA 4GUKA 2JPTA 1NSHA 2M0RA 1J7QA 3CGAA 3NSOA 4I5NB 1XVJA 3PLFB 4CFQA 3ZWHA 4N5XA 2LV7A 3SG3A 2KQ6A 3NSLA 1NX3A 2LMTA 2NCPA 1QATA 1BU3A 5K89A 1KCYA 1W7IB 3BOWB 3JVTB 4FQOA 1H8BA 2OTGC 2ZFDA 2NLNA 1XFYO 2I94A 2KAXA 1DT7B 5F6TA 3OB2B 3DF0B 2M7NA 4ORAB 4HSZA 3IQOA 4DS7A 1RROA 4XJKB 4ETOA 1A75A 1QIWA 1WY9A 4D1EA 1MXEA 3BQ3A 3AAJA 3OP0A 1FI6A 3FS7A 1ZFSA 1AP4A 1KWOC 2P6BB 3TS5C 4CIDA 2ZKMX 1DGVA 1TNXA 1J55A 1MXLC 1F55A 4BY5A 4WQ2A 1G33A 1PRWA 1RWYA 1RJVA 3MSEB 3VGOA 1IGVA 4GBAA 1M46A 5I2OA 2LP2A 1KSOA 3BUWB 4GNKB 1NP8A 1K9KA 4BY4A 3TDUA 1S26D 2L50A 4PHKA 1NX0A 3BUMB 5AXIA 4GAOA 2QPTA 3WXAA 2L5XB 3VRRA 1FPWA 1B9AA 1TN4A 2K7DA 1L2OC 3PALA 3I5FC 5KTYA 4JPZB 2A4JA 1Y1AA 5TNCA 1DJXA 1KK7Y 2LMVA 3GK2A 1GQMA 2LLSA 1EG4A 1QVIY 2K7BA 4DCKA 2K2FA 2JULA 1X02A 1G4YR 2V53A 1S5GZ 1TRFA 5CSJA 1BJFA 2VRGA 5HYDA 5DKRA 4MEWA 1UP5A 1F8HA 1N0YA 3D10A 3SG5A 1JSAA 3PN7B 1S3PA 2KSPA 2JOJA 1F71A 5D69A 4I5JA 3FWBA 5CSNA 1K2HA 2GGMA 1OE9B 1V1FA 3DF0A 2BBMA 1YR5A 1KK8B 1V1GA 2K2AA 1XFUO 1CDMA 3JVTC 1BG1A 3I5HB 1RTP1 2KFFA 1DMOA 2K7OA 3OHMB 2CBLA 1DJGA 1PULA 2MRDA 1E8AA 1TTXA 3CR4X 2LUXA 2JRFA 2GV5A 1K94A 2F2OA 4A4BA 2Q91A 1KFXL 1TCFA 4OV2A 4ORCB 2PALA 3D0YB 1M45A 5IBWA 1WRLA 2WCEA 2M1UA 5CSFA 1Y1XA 2O60A 1LVCD 2NZ0A 1QLKA 3OX5A 1CMGA 1QTXA 2BKIB 3KF9A 1CLLA 1CKKA 2HQWA 1B7TY 2ZNDA 2ZRTA 1AJ4A 1OZOA 1B47A 2PRUA 1MQ1A 2BKHB 2JNXA 4MZJA 3LK1A 1YUSA 1S6CA 2MHHA 1CMFA 5CPVA 3DVKA 1J1DA 1AUIB 2L4HA 2D8NA 1GGWA 1KFUS 3K21A 1SYMA 5PALA 4QJ5B 5JJGA 1Y6WA 1OSAA 1F54A 4WRIA 4YGCB 1SPYA 1CB1A 4NDDA 4PALA 1BMOA 2KBIA 2ZRSA 5AERA 2LHIA 3PN7C 1B1GA 1N2DA 1AK8A 2K8MB 2G2BA 4L9MA 1EH2A 1FBVA 3I5GB 2JXLA 4USLA 2BCBA 1GGZA 1KK8C 4P5OE 3CR5X 1ZOTB 3CS1A 3I5HC 5AFPA 1UHHA 3SIAA 2KYCA 3WHTB 1DF0B 3HX4A 5AANA 3D0YA 5HKYA 4CFRA 4WQ3A 2LLUA 1JUOA 3CWGA 1AVSA 2CNPA 4OR9B 5D7FA 1K8UA 3AKBA 4NDCA 5HLVA 1WLZA 1IKUA 1XFZO 5FYXA 3M0WA 1M31A 2M29A 2LAPA 4GPLB 4HRHA 2PVBA 2MJWB 1R2UA 2F3YA 1XK4A 4YGBB 1J1EA 2WNDA 1BOCA 1JF2A 4GGNA 3CZTX 4MRXA 2M9GA 2Y1MA 1ZACA 4YI8A 3NXAA 1SK6D 1IG5A 3H4SE 4YBHB 1LA3A 2KBMA 4N1GA 1XK4C 4DIRA 3PSRA 1NCZA 1Q80A 1SCMB 4OCIA 1YURA 4PCWA 1JC2A 3AAKA 3IQQA 2EGDA 4HRGA 3O6BA 1NUBA 1NYAA 1QXPA 2HF5A 2H2KA 2JT3A 1IQ3A 3QRXA 5DKNA 4IL1A 3KPXA 2L0PA 3SG2A 1YRUB 1YVHA 4M2PA 3DVJA 1N65A 1R6PA 2BCXA 1BF5A 3TZ1A 1FI5A 3WHUB 1NX2A 3LLEA 2DOQA 3SIBA 2KAYA 4ZCUA 1Y0VH 2AUCA 3LCPC 4MLWA 3KEVA 1QLSA 4I5LB 1DF0A 2KI6D 2BBNA 1DJHA 1C7VA 3I5GC 4OVNF 1UWOA 2G9BA 2JTZA 3F45A 2M7LA 2KAVA 3PM8A 4DRWA 3DVMA 1CFPA 1XO5A 1CFFA 5HKZA 1SNLA 1DVIA 2JT0A 1MR8A 3SG6A 2KGBC 3GK1A 4MN0A 2KGRA 2WOSA 1WDCB 4ZCVA 2FCDA 2AAOA 1TIZA 1UHIA 2ZN8A 2ZNEA 1RECA 3EK7A 2SCPA 3VRNA 3A8RA 2MA2A 5KU1A 1Y1UA 1S1EA 3BXKA 1KK7Z 1LA0A 1TNQA 2SASA 2WCFA 2LVJA 1QVIZ 4ORBB 1BODA 1CM1A 4QJ4B 1IRJA 2H61A 1SCMC 4U8DA 3CR2A 3EK8A 4C0LA 1UUSA 1IJ5A 1W7JB 1A29A 3GK4X 4UPGA 1SL9A 3ICBA 3OX6A 4AQJA 2PSRA 4F0ZB 2LNKA 1SCVA 3TDIA 4YI9A 3VROA 1PVAA 2JTTA 2LVKA 3BUXB 3TUYB 4C0JA 4E68A 3BUNB 1DJWA 2H61C 2L51A 1CM4A 1K95A 4CLNA 1DTLA 1M39A 2IS9A 1UHJA 3HCMA 1YRTB 1BT6A 1SY9A 4FTGA 2F3ZA 2EC6B 1SMGA 5AEQA 1SL7A 3O78A 2JT8A 2HPSA 3EVUA 4GGFA 2BECA 1YUTA 5HLOA 4I5KA 5KSZA 1U5IB 1QX2A 2CCMA 2JZIA 2LM5A 2KQYA 1A03A 1DGUA 1OMVA 1NIWA 1PSRA 1S6IA 1ZMZA 3EVVA 5JOLA 1YVLA 3CLNA 4MZLA 1S36A 3I5IB 2LHLA 2COLB 1TOPA 5ER5A 2FOTA 1K93D 4JQ0D 2NCOA 4XYNA 3DVEA 1KFUL 1SR6B 3TDZA 1B7TZ 5CSIA 3WNXB 1WDCC 1KQMB 3EKHA 1PK0D 1CLMA 2JQ6A 1CDPA 4YRUA 1NPQA 2LP3A 1OZSA 4PDZA 2MBXA 3PFVA 1CFCA 2OPOA 1CDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VRQ A;  1RFJ A;  1YTZ C;  3PAT A;  2I18 A;  1HT9 A;  2CT9 A;  2ZN9 A;  5DKQ A;  2KOT A;  2Q4U A;  1ZUZ A;  1QIV A;  4R1E A;  1XFW O;  1K96 A;  2HET A;  2M1K B;  1MWN A;  1EJ3 A;  3FIA A;  1QX7 A;  4MZK A;  4GFT A;  2JC2 A;  1CTR A;  1JF0 A;  1SKT A;  1YX8 A;  2E6W A;  2WCB A;  3TUY C;  1QS7 A;  4PE1 A;  4N1F A;  1L7Z A;  1U5I A;  1CDL A;  1XA5 A;  2GGZ A;  3SJS A;  3SG4 A;  2BE6 A;  2OS8 B;  4OKH A;  1MHO A;  2EC6 C;  1WRK A;  3BYA A;  3DD4 A;  3JTD B;  5BPJ A;  1LIN A;  1EXR A;  2JNF A;  5I2L A;  2WOR A;  3VRP A;  3E3R A;  2KNE A;  1F4O A;  1CLB A;  1SW8 A;  1K9U A;  1GJY A;  2Y1N A;  4A4C A;  2K0J A;  1RK9 A;  4PHJ A;  4YGA A;  3I5I C;  1BR1 B;  1BR4 B;  4PHM A;  1SRA A;  1B4C A;  4NDB A;  2L4I A;  2FCE A;  2PAS A;  1MUX A;  3KO0 A;  3EK4 A;  1QX5 B;  5HKW A;  2FJU B;  2B1U A;  5GQQ C;  2NXQ A;  2R2I A;  1SR6 C;  1KQM C;  5I2Q A;  1M63 B;  1G8I A;  1JFK A;  1B8L A;  1KSM A;  1QV1 A;  2CXJ A;  2AMI A;  4TNC A;  2KFH A;  2LE9 B;  1S5G Y;  3O4Y A;  1A2X A;  3O2P A;  3LL8 B;  1TNP A;  1SL8 A;  3KHE A;  1JFJ A;  3C1V A;  1HQV A;  1VRK A;  3EVR A;  1FW4 A;  2LAN A;  2O5G A;  4AOM A;  1QJT A;  1ODB A;  4P2Y B;  3NSK A;  2F8P A;  4MBE A;  2BL0 B;  2LLT A;  2EHB A;  4HRE E;  1TNW A;  1PAL A;  4YGD B;  4YGE B;  1AHR A;  2LVV A;  1IJ6 A;  2F2P A;  2TN4 A;  1QAS A;  2F33 A;  1YX7 A;  2LCP A;  5G08 A;  1XFV O;  2Y5I A;  1PVB A;  3GOF A;  3BOW A;  2OS8 C;  1EG3 A;  1J7P A;  2KI4 B;  1ALV A;  1DJI A;  1LXF C;  3JTD C;  4PHN A;  4QJ3 B;  1JBA A;  1AJ5 A;  1IWQ A;  3ZNI A;  2M8U A;  3FWC A;  4JWQ A;  1JWD A;  4ICB A;  4XJK A;  3A4U B;  1SBJ A;  1NCX A;  1IQ5 A;  1OQP A;  2L98 A;  1ALW A;  1KFX S;  1K90 D;  1OMD A;  4M2Q A;  2I7A A;  2M49 B;  1NX1 A;  4PE4 A;  2Y4Q A;  4NQG A;  3SG7 A;  2MLE C;  4MVF A;  2E30 A;  1IH0 A;  2KI6 C;  1J7R A;  1YUU A;  1CFD A;  1CNP A;  1C07 A;  1TCO B;  1A4P A;  2BE4 A;  4M2O A;  4PE0 A;  2QAC A;  1S6J A;  5ER4 X;  1D1O A;  2KDH A;  2OTG B;  3BUO B;  2LUC A;  2MLF C;  2I2R E;  3RM1 A;  2M3W A;  4GGF C;  1OOJ A;  1BLQ A;  4C0K A;  2LMU A;  2L2E A;  1MF8 B;  1H4B A;  2KYF A;  5J3X A;  1C7W A;  1EL4 A;  1XYD A;  1B8C A;  2CTN A;  2WC8 A;  2KHN A;  1KWO B;  3TS5 B;  4MRY A;  1J7O A;  1XFX O;  2JWW A;  1DJY A;  2JXC A;  1K9P A;  2M97 A;  2BL0 C;  1UHN A;  1WLM A;  3NSI A;  2HQ8 A;  1A75 B;  1NWD A;  2PMY A;  2LVI A;  4AQI A;  3OB1 B;  4MSP A;  2ISD A;  1WRZ A;  1DJZ A;  1LKJ A;  4DUQ A;  1UUR A;  3EKJ A;  3CTN A;  3IF7 A;  4CPV A;  5B8I B;  2KFG A;  1UHK A;  2K7C A;  3LK0 A;  3RLZ A;  1PSB A;  2RGI A;  4PE7 A;  1FF1 A;  1F70 A;  4Q04 A;  3AKA A;  2BCA A;  2KI4 C;  1B8R A;  2LC5 A;  1F4Q A;  2K61 A;  5I8N A;  1L2O B;  1QV0 A;  2JU0 A;  1OMR A;  3I5F B;  2MAZ A;  1NCY A;  1KQV A;  4GUK A;  2JPT A;  1NSH A;  2M0R A;  1J7Q A;  3CGA A;  3NSO A;  4I5N B;  1XVJ A;  3PLF B;  4CFQ A;  3ZWH A;  4N5X A;  2LV7 A;  3SG3 A;  2KQ6 A;  3NSL A;  1NX3 A;  2LMT A;  2NCP A;  1QAT A;  1BU3 A;  5K89 A;  1KCY A;  1W7I B;  3BOW B;  3JVT B;  4FQO A;  1H8B A;  2OTG C;  2ZFD A;  2NLN A;  1XFY O;  2I94 A;  2KAX A;  1DT7 B;  5F6T A;  3OB2 B;  3DF0 B;  2M7N A;  4ORA B;  4HSZ A;  3IQO A;  4DS7 A;  1RRO A;  4XJK B;  4ETO A;  1A75 A;  1QIW A;  1WY9 A;  4D1E A;  1MXE A;  3BQ3 A;  3AAJ A;  3OP0 A;  1FI6 A;  3FS7 A;  1ZFS A;  1AP4 A;  1KWO C;  2P6B B;  3TS5 C;  4CID A;  2ZKM X;  1DGV A;  1TNX A;  1J55 A;  1MXL C;  1F55 A;  4BY5 A;  4WQ2 A;  1G33 A;  1PRW A;  1RWY A;  1RJV A;  3MSE B;  3VGO A;  1IGV A;  4GBA A;  1M46 A;  5I2O A;  2LP2 A;  1KSO A;  3BUW B;  4GNK B;  1NP8 A;  1K9K A;  4BY4 A;  3TDU A;  1S26 D;  2L50 A;  4PHK A;  1NX0 A;  3BUM B;  5AXI A;  4GAO A;  2QPT A;  3WXA A;  2L5X B;  3VRR A;  1FPW A;  1B9A A;  1TN4 A;  2K7D A;  1L2O C;  3PAL A;  3I5F C;  5KTY A;  4JPZ B;  2A4J A;  1Y1A A;  5TNC A;  1DJX A;  1KK7 Y;  2LMV A;  3GK2 A;  1GQM A;  2LLS A;  1EG4 A;  1QVI Y;  2K7B A;  4DCK A;  2K2F A;  2JUL A;  1X02 A;  1G4Y R;  2V53 A;  1S5G Z;  1TRF A;  5CSJ A;  1BJF A;  2VRG A;  5HYD A;  5DKR A;  4MEW A;  1UP5 A;  1F8H A;  1N0Y A;  3D10 A;  3SG5 A;  1JSA A;  3PN7 B;  1S3P A;  2KSP A;  2JOJ A;  1F71 A;  5D69 A;  4I5J A;  3FWB A;  5CSN A;  1K2H A;  2GGM A;  1OE9 B;  1V1F A;  3DF0 A;  2BBM A;  1YR5 A;  1KK8 B;  1V1G A;  2K2A A;  1XFU O;  1CDM A;  3JVT C;  1BG1 A;  3I5H B;  1RTP 1;  2KFF A;  1DMO A;  2K7O A;  3OHM B;  2CBL A;  1DJG A;  1PUL A;  2MRD A;  1E8A A;  1TTX A;  3CR4 X;  2LUX A;  2JRF A;  2GV5 A;  1K94 A;  2F2O A;  4A4B A;  2Q91 A;  1KFX L;  1TCF A;  4OV2 A;  4ORC B;  2PAL A;  3D0Y B;  1M45 A;  5IBW A;  1WRL A;  2WCE A;  2M1U A;  5CSF A;  1Y1X A;  2O60 A;  1LVC D;  2NZ0 A;  1QLK A;  3OX5 A;  1CMG A;  1QTX A;  2BKI B;  3KF9 A;  1CLL A;  1CKK A;  2HQW A;  1B7T Y;  2ZND A;  2ZRT A;  1AJ4 A;  1OZO A;  1B47 A;  2PRU A;  1MQ1 A;  2BKH B;  2JNX A;  4MZJ A;  3LK1 A;  1YUS A;  1S6C A;  2MHH A;  1CMF A;  5CPV A;  3DVK A;  1J1D A;  1AUI B;  2L4H A;  2D8N A;  1GGW A;  1KFU S;  3K21 A;  1SYM A;  5PAL A;  4QJ5 B;  5JJG A;  1Y6W A;  1OSA A;  1F54 A;  4WRI A;  4YGC B;  1SPY A;  1CB1 A;  4NDD A;  4PAL A;  1BMO A;  2KBI A;  2ZRS A;  5AER A;  2LHI A;  3PN7 C;  1B1G A;  1N2D A;  1AK8 A;  2K8M B;  2G2B A;  4L9M A;  1EH2 A;  1FBV A;  3I5G B;  2JXL A;  4USL A;  2BCB A;  1GGZ A;  1KK8 C;  4P5O E;  3CR5 X;  1ZOT B;  3CS1 A;  3I5H C;  5AFP A;  1UHH A;  3SIA A;  2KYC A;  3WHT B;  1DF0 B;  3HX4 A;  5AAN A;  3D0Y A;  5HKY A;  4CFR A;  4WQ3 A;  2LLU A;  1JUO A;  3CWG A;  1AVS A;  2CNP A;  4OR9 B;  5D7F A;  1K8U A;  3AKB A;  4NDC A;  5HLV A;  1WLZ A;  1IKU A;  1XFZ O;  5FYX A;  3M0W A;  1M31 A;  2M29 A;  2LAP A;  4GPL B;  4HRH A;  2PVB A;  2MJW B;  1R2U A;  2F3Y A;  1XK4 A;  4YGB B;  1J1E A;  2WND A;  1BOC A;  1JF2 A;  4GGN A;  3CZT X;  4MRX A;  2M9G A;  2Y1M A;  1ZAC A;  4YI8 A;  3NXA A;  1SK6 D;  1IG5 A;  3H4S E;  4YBH B;  1LA3 A;  2KBM A;  4N1G A;  1XK4 C;  4DIR A;  3PSR A;  1NCZ A;  1Q80 A;  1SCM B;  4OCI A;  1YUR A;  4PCW A;  1JC2 A;  3AAK A;  3IQQ A;  2EGD A;  4HRG A;  3O6B A;  1NUB A;  1NYA A;  1QXP A;  2HF5 A;  2H2K A;  2JT3 A;  1IQ3 A;  3QRX A;  5DKN A;  4IL1 A;  3KPX A;  2L0P A;  3SG2 A;  1YRU B;  1YVH A;  4M2P A;  3DVJ A;  1N65 A;  1R6P A;  2BCX A;  1BF5 A;  3TZ1 A;  1FI5 A;  3WHU B;  1NX2 A;  3LLE A;  2DOQ A;  3SIB A;  2KAY A;  4ZCU A;  1Y0V H;  2AUC A;  3LCP C;  4MLW A;  3KEV A;  1QLS A;  4I5L B;  1DF0 A;  2KI6 D;  2BBN A;  1DJH A;  1C7V A;  3I5G C;  4OVN F;  1UWO A;  2G9B A;  2JTZ A;  3F45 A;  2M7L A;  2KAV A;  3PM8 A;  4DRW A;  3DVM A;  1CFP A;  1XO5 A;  1CFF A;  5HKZ A;  1SNL A;  1DVI A;  2JT0 A;  1MR8 A;  3SG6 A;  2KGB C;  3GK1 A;  4MN0 A;  2KGR A;  2WOS A;  1WDC B;  4ZCV A;  2FCD A;  2AAO A;  1TIZ A;  1UHI A;  2ZN8 A;  2ZNE A;  1REC A;  3EK7 A;  2SCP A;  3VRN A;  3A8R A;  2MA2 A;  5KU1 A;  1Y1U A;  1S1E A;  3BXK A;  1KK7 Z;  1LA0 A;  1TNQ A;  2SAS A;  2WCF A;  2LVJ A;  1QVI Z;  4ORB B;  1BOD A;  1CM1 A;  4QJ4 B;  1IRJ A;  2H61 A;  1SCM C;  4U8D A;  3CR2 A;  3EK8 A;  4C0L A;  1UUS A;  1IJ5 A;  1W7J B;  1A29 A;  3GK4 X;  4UPG A;  1SL9 A;  3ICB A;  3OX6 A;  4AQJ A;  2PSR A;  4F0Z B;  2LNK A;  1SCV A;  3TDI A;  4YI9 A;  3VRO A;  1PVA A;  2JTT A;  2LVK A;  3BUX B;  3TUY B;  4C0J A;  4E68 A;  3BUN B;  1DJW A;  2H61 C;  2L51 A;  1CM4 A;  1K95 A;  4CLN A;  1DTL A;  1M39 A;  2IS9 A;  1UHJ A;  3HCM A;  1YRT B;  1BT6 A;  1SY9 A;  4FTG A;  2F3Z A;  2EC6 B;  1SMG A;  5AEQ A;  1SL7 A;  3O78 A;  2JT8 A;  2HPS A;  3EVU A;  4GGF A;  2BEC A;  1YUT A;  5HLO A;  4I5K A;  5KSZ A;  1U5I B;  1QX2 A;  2CCM A;  2JZI A;  2LM5 A;  2KQY A;  1A03 A;  1DGU A;  1OMV A;  1NIW A;  1PSR A;  1S6I A;  1ZMZ A;  3EVV A;  5JOL A;  1YVL A;  3CLN A;  4MZL A;  1S36 A;  3I5I B;  2LHL A;  2COL B;  1TOP A;  5ER5 A;  2FOT A;  1K93 D;  4JQ0 D;  2NCO A;  4XYN A;  3DVE A;  1KFU L;  1SR6 B;  3TDZ A;  1B7T Z;  5CSI A;  3WNX B;  1WDC C;  1KQM B;  3EKH A;  1PK0 D;  1CLM A;  2JQ6 A;  1CDP A;  4YRU A;  1NPQ A;  2LP3 A;  1OZS A;  4PDZ A;  2MBX A;  3PFV A;  1CFC A;  2OPO A;  1CDN A; 
#chains in the Genus database with same CATH topology
 3VRQ A;  1RFJ A;  4INW A;  1YTZ C;  3PAT A;  2I18 A;  1HT9 A;  2CT9 A;  2ZN9 A;  5DKQ A;  3B7A A;  2KOT A;  2Q4U A;  1ZUZ A;  1QIV A;  3CAB A;  4R1E A;  1XFW O;  1K96 A;  2HET A;  3S0B A;  2M1K B;  1MWN A;  1OOH A;  1EJ3 A;  3D75 A;  3FIA A;  1QX7 A;  4MZK A;  4GFT A;  2JC2 A;  1CTR A;  1JF0 A;  1SKT A;  1YX8 A;  2E6W A;  2WCB A;  3TUY C;  1QS7 A;  4PE1 A;  2WCK A;  4N1F A;  1L7Z A;  1U5I A;  1CDL A;  1XA5 A;  2GGZ A;  2GTE A;  1SSE B;  3SJS A;  3K1E A;  3SG4 A;  2BE6 A;  2OS8 B;  4OKH A;  1MHO A;  2EC6 C;  1WRK A;  3BYA A;  3DD4 A;  3JTD B;  5BPJ A;  1LIN A;  1EXR A;  2JNF A;  2KLE A;  5I2L A;  2WOR A;  3VRP A;  3E3R A;  2KNE A;  1F4O A;  1CLB A;  1SW8 A;  1K9U A;  1GJY A;  2Y1N A;  3R72 A;  4A4C A;  3PJI A;  2K0J A;  3PM2 A;  1RK9 A;  4PHJ A;  3IVT A;  4YGA A;  3I5I C;  1BR1 B;  1BR4 B;  4PHM A;  1SRA A;  1B4C A;  4NDB A;  2L4I A;  2FCE A;  2PAS A;  1MUX A;  3KO0 A;  1C3Y A;  3EK4 A;  1QX5 B;  5HKW A;  2FJU B;  2B1U A;  5GQQ C;  2NXQ A;  3D74 A;  2R2I A;  1SR6 C;  1KQM C;  3S0G A;  1M63 B;  1G8I A;  3O4X A;  5I2Q A;  1JFK A;  1B8L A;  1KSM A;  1QV1 A;  2CXJ A;  2AMI A;  4TNC A;  2KFH A;  2LE9 B;  1S5G Y;  3S0D A;  3O4Y A;  1A2X A;  3DXL A;  3O2P A;  3LL8 B;  1TNP A;  1SL8 A;  3KHE A;  1JFJ A;  3C1V A;  1HQV A;  1DC1 A;  1VRK A;  3EVR A;  1FW4 A;  1XFR A;  2LAN A;  2O5G A;  4AOM A;  1QJT A;  1ODB A;  2WC5 A;  4P2Y B;  3NSK A;  2F8P A;  4MBE A;  5FI2 A;  2BL0 B;  2LLT A;  2EHB A;  4HRE E;  1TNW A;  1PAL A;  4YGD B;  4YGE B;  1AHR A;  2LVV A;  1IJ6 A;  2F2P A;  2TN4 A;  4FQT A;  1QAS A;  2F33 A;  1YX7 A;  2LCP A;  5G08 A;  1XFV O;  2Y5I A;  1PVB A;  3GOF A;  3BOW A;  3N7H A;  2OS8 C;  1EG3 A;  1J7P A;  2KI4 B;  3VB1 A;  1ALV A;  1DJI A;  1LXF C;  3JTD C;  4PHN A;  4QJ3 B;  1JBA A;  1AJ5 A;  1IWQ A;  3SS5 A;  3ZNI A;  2M8U A;  3FWC A;  4OZD A;  4JWQ A;  1JWD A;  4ICB A;  4XJK A;  3A4U B;  1SBJ A;  1NCX A;  1IQ5 A;  1OQP A;  2L98 A;  1ALW A;  1KFX S;  1K90 D;  1OMD A;  4KYN A;  4M2Q A;  2I7A A;  1W9Z A;  2M49 B;  2P70 A;  1NX1 A;  4PE4 A;  2Y4Q A;  4NQG A;  3SS3 A;  3NHI A;  3SG7 A;  2MLE C;  4MVF A;  2E30 A;  3S0A A;  1IH0 A;  2KI6 C;  2WC6 A;  1J7R A;  1YUU A;  1CFD A;  1CNP A;  3BFB A;  1C07 A;  1TCO B;  1A4P A;  2BE4 A;  4M2O A;  4PE0 A;  2QAC A;  1S6J A;  5ER4 X;  1D1O A;  2KDH A;  2OTG B;  3BUO B;  2LUC A;  2MLF C;  3R1O A;  2I2R E;  3RM1 A;  2M3W A;  4GGF C;  1OOJ A;  1BLQ A;  4C0K A;  2LMU A;  2L2E A;  1MF8 B;  1H4B A;  2KYF A;  5J3X A;  1C7W A;  1EL4 A;  1XYD A;  1B8C A;  2CTN A;  2WC8 A;  2KHN A;  1KWO B;  3TS5 B;  4MRY A;  1J7O A;  1XFX O;  2JWW A;  1DJY A;  2JXC A;  1K9P A;  2M97 A;  2BL0 C;  1UHN A;  1WLM A;  3NSI A;  5I94 A;  2HQ8 A;  1A75 B;  1NWD A;  2PMY A;  2LVI A;  3CZ0 A;  3OB1 B;  4MSP A;  4AQI A;  2ISD A;  1WRZ A;  1DJZ A;  1LKJ A;  4DUQ A;  1UUR A;  3EKJ A;  3CTN A;  3IF7 A;  4CPV A;  5B8I B;  2KFG A;  1UHK A;  3BJH A;  2K7C A;  4JD9 A;  3LK0 A;  3NGV A;  3RLZ A;  1PSB A;  2RGI A;  4PE7 A;  1FF1 A;  1F70 A;  4Q04 A;  3AKA A;  2BCA A;  2KI4 C;  1B8R A;  2LC5 A;  1F4Q A;  2K61 A;  5I8N A;  1L2O B;  1QV0 A;  2JU0 A;  1OMR A;  1DQE A;  2MAZ A;  1NCY A;  3I5F B;  3UNW A;  1KQV A;  4GUK A;  2JPT A;  1NSH A;  2M0R A;  3Q8I A;  1J7Q A;  3CGA A;  3NSO A;  4I5N B;  1XVJ A;  3PLF B;  4CFQ A;  3ZWH A;  4N5X A;  2LV7 A;  2QEV A;  3SG3 A;  2KQ6 A;  3NSL A;  1NX3 A;  3FE8 A;  2LMT A;  2NCP A;  1OW4 A;  1IIO A;  1QAT A;  3CZ1 A;  1BU3 A;  5K89 A;  1KCY A;  1W7I B;  3BOW B;  3JVT B;  2WCJ A;  4FQO A;  1H8B A;  2OTG C;  2ZFD A;  3S0F A;  2NLN A;  1LS8 A;  1XFY O;  2I94 A;  2KAX A;  1DT7 B;  5F6T A;  2ERB A;  3OB2 B;  3DF0 B;  2M7N A;  4ORA B;  2WCL A;  3IQO A;  3R1P A;  1RRO A;  4HSZ A;  4XJK B;  4DS7 A;  4ETO A;  1A75 A;  1QIW A;  1WY9 A;  4D1E A;  1MXE A;  3BQ3 A;  3AAJ A;  3OP0 A;  1FI6 A;  3FS7 A;  1ZFS A;  1AP4 A;  1KWO C;  2P6B B;  3TS5 C;  4CID A;  2PQL A;  2ZKM X;  1DGV A;  1TNX A;  1J55 A;  1MXL C;  1F55 A;  4BY5 A;  4WQ2 A;  1OOG A;  1G33 A;  1PRW A;  1RWY A;  1RJV A;  3MSE B;  3VGO A;  1IGV A;  1T14 A;  2QDI A;  4GBA A;  1M46 A;  3FE9 A;  5I2O A;  2LP2 A;  1KSO A;  3BUW B;  4GNK B;  1NP8 A;  1K9K A;  4BY4 A;  3TDU A;  1S26 D;  2L50 A;  4PHK A;  1NX0 A;  3BUM B;  5AXI A;  4GAO A;  1Z2C B;  2QPT A;  3WXA A;  2L5X B;  3VRR A;  1FPW A;  1B9A A;  1TN4 A;  2K7D A;  1L2O C;  3PAL A;  3I5F C;  5KTY A;  4JPZ B;  2A4J A;  1Y1A A;  5TNC A;  1DJX A;  1KK7 Y;  2LMV A;  3GK2 A;  1GQM A;  2LLS A;  1EG4 A;  1QVI Y;  2K7B A;  2PYQ A;  2K2F A;  4DCK A;  2JUL A;  1X02 A;  1G4Y R;  2V53 A;  1S5G Z;  1TRF A;  5CSJ A;  1BJF A;  2VRG A;  3S0E A;  5HYD A;  5DKR A;  4MEW A;  1UP5 A;  1F8H A;  1N0Y A;  3D10 A;  3SG5 A;  1JSA A;  3PN7 B;  1S3P A;  2KSP A;  2JOJ A;  1F71 A;  5D69 A;  4I5J A;  3FWB A;  5CSN A;  1K2H A;  2GGM A;  1OE9 B;  1V1F A;  3DF0 A;  2BBM A;  1YR5 A;  1KK8 B;  1V1G A;  2K2A A;  1XFU O;  1CDM A;  3JVT C;  1BG1 A;  3I5H B;  1RTP 1;  2KFF A;  1DMO A;  2K7O A;  3OHM B;  2CBL A;  1DJG A;  1PUL A;  1DEK A;  2MRD A;  1E8A A;  1TTX A;  3CR4 X;  2LUX A;  2JRF A;  2GV5 A;  1K94 A;  2F2O A;  4A4B A;  2Q91 A;  1KFX L;  1TCF A;  4OV2 A;  4ORC B;  2PAL A;  3D0Y B;  1M45 A;  5IBW A;  1WRL A;  2WCE A;  2M1U A;  1ORG A;  3R1V A;  5CSF A;  1Y1X A;  2O60 A;  1LVC D;  3UO9 A;  2K60 A;  2NZ0 A;  1QLK A;  1P28 A;  2JPO A;  3DZT A;  3OX5 A;  1CMG A;  1QTX A;  2BKI B;  3KF9 A;  1CLL A;  1CKK A;  2HQW A;  1B7T Y;  2ZND A;  2ZRT A;  2H8V A;  1AJ4 A;  1OZO A;  1B47 A;  2PRU A;  1MQ1 A;  2BAP A;  2BKH B;  2JNX A;  4MZJ A;  1GM0 A;  3LK1 A;  2BNX A;  1YUS A;  1S6C A;  2MHH A;  1CMF A;  5CPV A;  3DVK A;  1J1D A;  1AUI B;  5D3O A;  2L4H A;  2D8N A;  2L5Y A;  1GGW A;  1KFU S;  3K21 A;  1SYM A;  3BFA A;  5PAL A;  4QJ5 B;  1OOI X;  1Y6W A;  5JJG A;  5DIC A;  1OSA A;  1F54 A;  4WRI A;  4YGC B;  1SPY A;  3RZS A;  1CB1 A;  4NDD A;  4PAL A;  1BMO A;  1TUJ A;  1TWO A;  3CZ2 A;  2QEB A;  2KBI A;  2ZRS A;  5AER A;  2LHI A;  3PN7 C;  1B1G A;  1N2D A;  1AK8 A;  2K8M B;  2G2B A;  3EG5 B;  4L9M A;  1EH2 A;  1FBV A;  3I5G B;  2JXL A;  3QME A;  4USL A;  2BCB A;  3D77 A;  1GGZ A;  1KK8 C;  4P5O E;  3CR5 X;  1ZOT B;  3CS1 A;  3I5H C;  5AFP A;  1UHH A;  3SIA A;  2KYC A;  3DY9 A;  3WHT B;  4IJ7 A;  1DF0 B;  3HX4 A;  1OOF A;  3D0Y A;  5AAN A;  5HKY A;  4CFR A;  4WQ3 A;  2LLU A;  1JUO A;  3CWG A;  1AVS A;  2CNP A;  4OR9 B;  2P71 A;  5D7F A;  1K8U A;  3AKB A;  4NDC A;  5HLV A;  1WLZ A;  1IKU A;  1XFZ O;  5FYX A;  3M0W A;  1M31 A;  2M29 A;  2LAP A;  4GPL B;  4HRH A;  2PVB A;  2MJW B;  1R2U A;  2F3Y A;  3V2L A;  3FE6 A;  1XK4 A;  4YGB B;  1J1E A;  2WND A;  2YGU A;  1BOC A;  1JF2 A;  4GGN A;  3CZT X;  4MRX A;  1QWV A;  2M9G A;  2Y1M A;  1ZAC A;  4YI8 A;  3NXA A;  1SK6 D;  1IG5 A;  3H4S E;  4YBH B;  1LA3 A;  2KBM A;  4N1G A;  1XK4 C;  4DIR A;  3PSR A;  1NCZ A;  1Q80 A;  1SCM B;  4OCI A;  1YUR A;  4PCW A;  1JC2 A;  3AAK A;  3IQQ A;  2EGD A;  4HRG A;  3DYE A;  3O6B A;  1NUB A;  1NYA A;  1QXP A;  2HF5 A;  2H2K A;  2JT3 A;  1IQ3 A;  3QRX A;  2QEO A;  5DKN A;  4IL1 A;  3KPX A;  2L0P A;  3SG2 A;  1YRU B;  1YVH A;  4M2P A;  3DVJ A;  1N65 A;  1R6P A;  2BCX A;  1BF5 A;  3TZ1 A;  1FI5 A;  3WHU B;  2FJY A;  2WCM A;  1NX2 A;  3LLE A;  2DOQ A;  3SIB A;  2KAY A;  4ZCU A;  1Y0V H;  2AUC A;  3LCP C;  1Z4H A;  4MLW A;  3L4A A;  3KEV A;  1QLS A;  4I5L B;  1C3Z A;  3SS4 A;  1DF0 A;  2KI6 D;  2BBN A;  1DJH A;  1C7V A;  3I5G C;  4OVN F;  1DEL A;  1UWO A;  2G9B A;  2JTZ A;  3F45 A;  2M7L A;  2KAV A;  3PM8 A;  4DRW A;  3DVM A;  5FI6 A;  1CFP A;  2QEH A;  1XO5 A;  3NHT A;  5HKZ A;  1SNL A;  3B86 A;  1CFF A;  1DVI A;  2JT0 A;  1MR8 A;  3D78 A;  3SG6 A;  3B6X A;  2KGB C;  3GK1 A;  3OGN A;  2KGR A;  4MN0 A;  2WOS A;  1WDC B;  4ZCV A;  2FCD A;  2AAO A;  1TIZ A;  1UHI A;  2ZN8 A;  2ZNE A;  1REC A;  3EK7 A;  2SCP A;  3VRN A;  3A8R A;  1TUZ A;  2MA2 A;  5KU1 A;  1Y1U A;  1S1E A;  2KLD A;  3BXK A;  1KK7 Z;  1LA0 A;  1TNQ A;  2SAS A;  2WCF A;  2LVJ A;  1QVI Z;  4ORB B;  3D73 A;  1BOD A;  1CM1 A;  4QJ4 B;  1IRJ A;  2H61 A;  1SCM C;  4U8D A;  3CR2 A;  3EK8 A;  4C0L A;  1UUS A;  1IJ5 A;  1W7J B;  1A29 A;  3GK4 X;  4UPG A;  1SL9 A;  3ICB A;  3OX6 A;  4AQJ A;  2PSR A;  4F0Z B;  4PT1 A;  2LNK A;  1SCV A;  3TDI A;  4YI9 A;  3VRO A;  1PVA A;  4F7F A;  2JTT A;  2LVK A;  3BUX B;  3TUY B;  4C0J A;  4E68 A;  3BUN B;  1DJW A;  2H61 C;  2L51 A;  2L2C A;  1CM4 A;  1K95 A;  4CLN A;  1DTL A;  1M39 A;  2IS9 A;  1UHJ A;  3HCM A;  1YRT B;  1BT6 A;  1SY9 A;  5FI7 A;  4FTG A;  2F3Z A;  2EC6 B;  1SMG A;  3B88 A;  5AEQ A;  1SL7 A;  3O78 A;  2JT8 A;  2HPS A;  2KPH A;  3EVU A;  4GGF A;  3D76 A;  2BEC A;  1YUT A;  3CDN A;  4I5K A;  4JKT A;  1U5I B;  5HLO A;  5KSZ A;  1QX2 A;  2CCM A;  2JZI A;  2LM5 A;  2KQY A;  5EL2 A;  1A03 A;  1DGU A;  1OMV A;  1NIW A;  1PSR A;  1S6I A;  1ZMZ A;  3EVV A;  5JOL A;  1YVL A;  3CLN A;  4MZL A;  1S36 A;  3I5I B;  2LHL A;  3B87 A;  2COL B;  1TOP A;  5ER5 A;  2FOT A;  1K93 D;  4JQ0 D;  2NCO A;  4XYN A;  3DVE A;  1KFU L;  1SR6 B;  2WCH A;  3TDZ A;  1B7T Z;  3BFH A;  5CSI A;  3WNX B;  1WDC C;  1KQM B;  3EKH A;  1PK0 D;  1CLM A;  2JQ6 A;  1CDP A;  3L47 A;  4INX A;  4YRU A;  1NPQ A;  2LP3 A;  1OZS A;  3L4L A;  4PDZ A;  2MBX A;  3PFV A;  1CFC A;  3OBV A;  5HL1 A;  3CYZ A;  2OPO A;  1CDN A; 
#chains in the Genus database with same CATH homology
 3VRQ A;  1RFJ A;  1YTZ C;  3PAT A;  2I18 A;  1HT9 A;  2CT9 A;  2ZN9 A;  5DKQ A;  2KOT A;  2Q4U A;  1ZUZ A;  1QIV A;  4R1E A;  1XFW O;  1K96 A;  2HET A;  2M1K B;  1MWN A;  1EJ3 A;  3FIA A;  1QX7 A;  4MZK A;  4GFT A;  2JC2 A;  1CTR A;  1JF0 A;  1SKT A;  1YX8 A;  2E6W A;  2WCB A;  3TUY C;  1QS7 A;  4PE1 A;  4N1F A;  1L7Z A;  1U5I A;  1CDL A;  1XA5 A;  2GGZ A;  3SJS A;  3SG4 A;  2BE6 A;  2OS8 B;  4OKH A;  1MHO A;  2EC6 C;  1WRK A;  3BYA A;  3DD4 A;  3JTD B;  5BPJ A;  1LIN A;  1EXR A;  2JNF A;  5I2L A;  2WOR A;  3VRP A;  3E3R A;  2KNE A;  1F4O A;  1CLB A;  1SW8 A;  1K9U A;  1GJY A;  2Y1N A;  4A4C A;  2K0J A;  1RK9 A;  4PHJ A;  4YGA A;  3I5I C;  1BR1 B;  1BR4 B;  4PHM A;  1SRA A;  1B4C A;  4NDB A;  2L4I A;  2FCE A;  2PAS A;  1MUX A;  3KO0 A;  3EK4 A;  1QX5 B;  5HKW A;  2FJU B;  2B1U A;  5GQQ C;  2NXQ A;  2R2I A;  1SR6 C;  1KQM C;  5I2Q A;  1M63 B;  1G8I A;  1JFK A;  1B8L A;  1KSM A;  1QV1 A;  2CXJ A;  2AMI A;  4TNC A;  2KFH A;  2LE9 B;  1S5G Y;  3O4Y A;  1A2X A;  3O2P A;  3LL8 B;  1TNP A;  1SL8 A;  3KHE A;  1JFJ A;  3C1V A;  1HQV A;  1VRK A;  3EVR A;  1FW4 A;  2LAN A;  2O5G A;  4AOM A;  1QJT A;  1ODB A;  4P2Y B;  3NSK A;  2F8P A;  4MBE A;  2BL0 B;  2LLT A;  2EHB A;  4HRE E;  1TNW A;  1PAL A;  4YGD B;  4YGE B;  1AHR A;  2LVV A;  1IJ6 A;  2F2P A;  2TN4 A;  1QAS A;  2F33 A;  1YX7 A;  2LCP A;  5G08 A;  1XFV O;  2Y5I A;  1PVB A;  3GOF A;  3BOW A;  2OS8 C;  1EG3 A;  1J7P A;  2KI4 B;  1ALV A;  1DJI A;  1LXF C;  3JTD C;  4PHN A;  4QJ3 B;  1JBA A;  1AJ5 A;  1IWQ A;  3ZNI A;  2M8U A;  3FWC A;  4JWQ A;  1JWD A;  4ICB A;  4XJK A;  3A4U B;  1SBJ A;  1NCX A;  1IQ5 A;  1OQP A;  2L98 A;  1ALW A;  1KFX S;  1K90 D;  1OMD A;  4M2Q A;  2I7A A;  2M49 B;  1NX1 A;  4PE4 A;  2Y4Q A;  4NQG A;  3SG7 A;  2MLE C;  4MVF A;  2E30 A;  1IH0 A;  2KI6 C;  1J7R A;  1YUU A;  1CFD A;  1CNP A;  1C07 A;  1TCO B;  1A4P A;  2BE4 A;  4M2O A;  4PE0 A;  2QAC A;  1S6J A;  5ER4 X;  1D1O A;  2KDH A;  2OTG B;  3BUO B;  2LUC A;  2MLF C;  2I2R E;  3RM1 A;  2M3W A;  4GGF C;  1OOJ A;  1BLQ A;  4C0K A;  2LMU A;  2L2E A;  1MF8 B;  1H4B A;  2KYF A;  5J3X A;  1C7W A;  1EL4 A;  1XYD A;  1B8C A;  2CTN A;  2WC8 A;  2KHN A;  1KWO B;  3TS5 B;  4MRY A;  1J7O A;  1XFX O;  2JWW A;  1DJY A;  2JXC A;  1K9P A;  2M97 A;  2BL0 C;  1UHN A;  1WLM A;  3NSI A;  2HQ8 A;  1A75 B;  1NWD A;  2PMY A;  2LVI A;  4AQI A;  3OB1 B;  4MSP A;  2ISD A;  1WRZ A;  1DJZ A;  1LKJ A;  4DUQ A;  1UUR A;  3EKJ A;  3CTN A;  3IF7 A;  4CPV A;  5B8I B;  2KFG A;  1UHK A;  2K7C A;  3LK0 A;  3RLZ A;  1PSB A;  2RGI A;  4PE7 A;  1FF1 A;  1F70 A;  4Q04 A;  3AKA A;  2BCA A;  2KI4 C;  1B8R A;  2LC5 A;  1F4Q A;  2K61 A;  5I8N A;  1L2O B;  1QV0 A;  2JU0 A;  1OMR A;  3I5F B;  2MAZ A;  1NCY A;  1KQV A;  4GUK A;  2JPT A;  1NSH A;  2M0R A;  1J7Q A;  3CGA A;  3NSO A;  4I5N B;  1XVJ A;  3PLF B;  4CFQ A;  3ZWH A;  4N5X A;  2LV7 A;  3SG3 A;  2KQ6 A;  3NSL A;  1NX3 A;  2LMT A;  2NCP A;  1QAT A;  1BU3 A;  5K89 A;  1KCY A;  1W7I B;  3BOW B;  3JVT B;  4FQO A;  1H8B A;  2OTG C;  2ZFD A;  2NLN A;  1XFY O;  2I94 A;  2KAX A;  1DT7 B;  5F6T A;  3OB2 B;  3DF0 B;  2M7N A;  4ORA B;  4HSZ A;  3IQO A;  4DS7 A;  1RRO A;  4XJK B;  4ETO A;  1A75 A;  1QIW A;  1WY9 A;  4D1E A;  1MXE A;  3BQ3 A;  3AAJ A;  3OP0 A;  1FI6 A;  3FS7 A;  1ZFS A;  1AP4 A;  1KWO C;  2P6B B;  3TS5 C;  4CID A;  2ZKM X;  1DGV A;  1TNX A;  1J55 A;  1MXL C;  1F55 A;  4BY5 A;  4WQ2 A;  1G33 A;  1PRW A;  1RWY A;  1RJV A;  3MSE B;  3VGO A;  1IGV A;  4GBA A;  1M46 A;  5I2O A;  2LP2 A;  1KSO A;  3BUW B;  4GNK B;  1NP8 A;  1K9K A;  4BY4 A;  3TDU A;  1S26 D;  2L50 A;  4PHK A;  1NX0 A;  3BUM B;  5AXI A;  4GAO A;  2QPT A;  3WXA A;  2L5X B;  3VRR A;  1FPW A;  1B9A A;  1TN4 A;  2K7D A;  1L2O C;  3PAL A;  3I5F C;  5KTY A;  4JPZ B;  2A4J A;  1Y1A A;  5TNC A;  1DJX A;  1KK7 Y;  2LMV A;  3GK2 A;  1GQM A;  2LLS A;  1EG4 A;  1QVI Y;  2K7B A;  4DCK A;  2K2F A;  2JUL A;  1X02 A;  1G4Y R;  2V53 A;  1S5G Z;  1TRF A;  5CSJ A;  1BJF A;  2VRG A;  5HYD A;  5DKR A;  4MEW A;  1UP5 A;  1F8H A;  1N0Y A;  3D10 A;  3SG5 A;  1JSA A;  3PN7 B;  1S3P A;  2KSP A;  2JOJ A;  1F71 A;  5D69 A;  4I5J A;  3FWB A;  5CSN A;  1K2H A;  2GGM A;  1OE9 B;  1V1F A;  3DF0 A;  2BBM A;  1YR5 A;  1KK8 B;  1V1G A;  2K2A A;  1XFU O;  1CDM A;  3JVT C;  1BG1 A;  3I5H B;  1RTP 1;  2KFF A;  1DMO A;  2K7O A;  3OHM B;  2CBL A;  1DJG A;  1PUL A;  2MRD A;  1E8A A;  1TTX A;  3CR4 X;  2LUX A;  2JRF A;  2GV5 A;  1K94 A;  2F2O A;  4A4B A;  2Q91 A;  1KFX L;  1TCF A;  4OV2 A;  4ORC B;  2PAL A;  3D0Y B;  1M45 A;  5IBW A;  1WRL A;  2WCE A;  2M1U A;  5CSF A;  1Y1X A;  2O60 A;  1LVC D;  2NZ0 A;  1QLK A;  3OX5 A;  1CMG A;  1QTX A;  2BKI B;  3KF9 A;  1CLL A;  1CKK A;  2HQW A;  1B7T Y;  2ZND A;  2ZRT A;  1AJ4 A;  1OZO A;  1B47 A;  2PRU A;  1MQ1 A;  2BKH B;  2JNX A;  4MZJ A;  3LK1 A;  1YUS A;  1S6C A;  2MHH A;  1CMF A;  5CPV A;  3DVK A;  1J1D A;  1AUI B;  2L4H A;  2D8N A;  1GGW A;  1KFU S;  3K21 A;  1SYM A;  5PAL A;  4QJ5 B;  5JJG A;  1Y6W A;  1OSA A;  1F54 A;  4WRI A;  4YGC B;  1SPY A;  1CB1 A;  4NDD A;  4PAL A;  1BMO A;  2KBI A;  2ZRS A;  5AER A;  2LHI A;  3PN7 C;  1B1G A;  1N2D A;  1AK8 A;  2K8M B;  2G2B A;  4L9M A;  1EH2 A;  1FBV A;  3I5G B;  2JXL A;  4USL A;  2BCB A;  1GGZ A;  1KK8 C;  4P5O E;  3CR5 X;  1ZOT B;  3CS1 A;  3I5H C;  5AFP A;  1UHH A;  3SIA A;  2KYC A;  3WHT B;  1DF0 B;  3HX4 A;  5AAN A;  3D0Y A;  5HKY A;  4CFR A;  4WQ3 A;  2LLU A;  1JUO A;  3CWG A;  1AVS A;  2CNP A;  4OR9 B;  5D7F A;  1K8U A;  3AKB A;  4NDC A;  5HLV A;  1WLZ A;  1IKU A;  1XFZ O;  5FYX A;  3M0W A;  1M31 A;  2M29 A;  2LAP A;  4GPL B;  4HRH A;  2PVB A;  2MJW B;  1R2U A;  2F3Y A;  1XK4 A;  4YGB B;  1J1E A;  2WND A;  1BOC A;  1JF2 A;  4GGN A;  3CZT X;  4MRX A;  2M9G A;  2Y1M A;  1ZAC A;  4YI8 A;  3NXA A;  1SK6 D;  1IG5 A;  3H4S E;  4YBH B;  1LA3 A;  2KBM A;  4N1G A;  1XK4 C;  4DIR A;  3PSR A;  1NCZ A;  1Q80 A;  1SCM B;  4OCI A;  1YUR A;  4PCW A;  1JC2 A;  3AAK A;  3IQQ A;  2EGD A;  4HRG A;  3O6B A;  1NUB A;  1NYA A;  1QXP A;  2HF5 A;  2H2K A;  2JT3 A;  1IQ3 A;  3QRX A;  5DKN A;  4IL1 A;  3KPX A;  2L0P A;  3SG2 A;  1YRU B;  1YVH A;  4M2P A;  3DVJ A;  1N65 A;  1R6P A;  2BCX A;  1BF5 A;  3TZ1 A;  1FI5 A;  3WHU B;  1NX2 A;  3LLE A;  2DOQ A;  3SIB A;  2KAY A;  4ZCU A;  1Y0V H;  2AUC A;  3LCP C;  4MLW A;  3KEV A;  1QLS A;  4I5L B;  1DF0 A;  2KI6 D;  2BBN A;  1DJH A;  1C7V A;  3I5G C;  4OVN F;  1UWO A;  2G9B A;  2JTZ A;  3F45 A;  2M7L A;  2KAV A;  3PM8 A;  4DRW A;  3DVM A;  1CFP A;  1XO5 A;  1CFF A;  5HKZ A;  1SNL A;  1DVI A;  2JT0 A;  1MR8 A;  3SG6 A;  2KGB C;  3GK1 A;  4MN0 A;  2KGR A;  2WOS A;  1WDC B;  4ZCV A;  2FCD A;  2AAO A;  1TIZ A;  1UHI A;  2ZN8 A;  2ZNE A;  1REC A;  3EK7 A;  2SCP A;  3VRN A;  3A8R A;  2MA2 A;  5KU1 A;  1Y1U A;  1S1E A;  3BXK A;  1KK7 Z;  1LA0 A;  1TNQ A;  2SAS A;  2WCF A;  2LVJ A;  1QVI Z;  4ORB B;  1BOD A;  1CM1 A;  4QJ4 B;  1IRJ A;  2H61 A;  1SCM C;  4U8D A;  3CR2 A;  3EK8 A;  4C0L A;  1UUS A;  1IJ5 A;  1W7J B;  1A29 A;  3GK4 X;  4UPG A;  1SL9 A;  3ICB A;  3OX6 A;  4AQJ A;  2PSR A;  4F0Z B;  2LNK A;  1SCV A;  3TDI A;  4YI9 A;  3VRO A;  1PVA A;  2JTT A;  2LVK A;  3BUX B;  3TUY B;  4C0J A;  4E68 A;  3BUN B;  1DJW A;  2H61 C;  2L51 A;  1CM4 A;  1K95 A;  4CLN A;  1DTL A;  1M39 A;  2IS9 A;  1UHJ A;  3HCM A;  1YRT B;  1BT6 A;  1SY9 A;  4FTG A;  2F3Z A;  2EC6 B;  1SMG A;  5AEQ A;  1SL7 A;  3O78 A;  2JT8 A;  2HPS A;  3EVU A;  4GGF A;  2BEC A;  1YUT A;  5HLO A;  4I5K A;  5KSZ A;  1U5I B;  1QX2 A;  2CCM A;  2JZI A;  2LM5 A;  2KQY A;  1A03 A;  1DGU A;  1OMV A;  1NIW A;  1PSR A;  1S6I A;  1ZMZ A;  3EVV A;  5JOL A;  1YVL A;  3CLN A;  4MZL A;  1S36 A;  3I5I B;  2LHL A;  2COL B;  1TOP A;  5ER5 A;  2FOT A;  1K93 D;  4JQ0 D;  2NCO A;  4XYN A;  3DVE A;  1KFU L;  1SR6 B;  3TDZ A;  1B7T Z;  5CSI A;  3WNX B;  1WDC C;  1KQM B;  3EKH A;  1PK0 D;  1CLM A;  2JQ6 A;  1CDP A;  4YRU A;  1NPQ A;  2LP3 A;  1OZS A;  4PDZ A;  2MBX A;  3PFV A;  1CFC A;  2OPO A;  1CDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...