1IRJA

Crystal structure of the mrp14 complexed with chaps
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
85
structure length
85
Chain Sequence
TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of human MRP14 (S100A9), a Ca(2+)-dependent regulator protein in inflammatory process.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Migration Inhibitory Factor-Related Protein 14
total genus 33
structure length 85
sequence length 85
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2001-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1irjA00
3FWCA 2PSRA 1BODA 3DF0B 4PALA 3CGAA 4QJ3B 5DKQA 1WRLA 1SMGA 2LC5A 4HRHA 5JOLA 1F70A 2F3ZA 1BOCA 3NSLA 1DJZA 1V1GA 4PHJA 5CSIA 1QLKA 1SW8A 1UWOA 1ZUZA 2LM5A 4YGEB 2CCMA 1KQMC 5ER4X 2ZRTA 3BUMB 5FYXA 2K2AA 1NPQA 3I5FB 2JC2A 2OS8B 4GBAA 2I18A 5AXIA 4C0KA 1LINA 1JBAA 2K7BA 5CPVA 1VRKA 1XFYO 2NCPA 3CR4X 2HQWA 4YGCB 2BKHB 3BUOB 1YR5A 3VRPA 1RWYA 2ZN8A 1CM1A 3DD4A 1GGZA 1TNXA 1M45A 2L51A 3PFVA 4JWQA 3TS5C 1DJXA 1TNPA 1J7PA 4N1GA 1YUSA 1SCVA 1L7ZA 5ER5A 3TZ1A 2JWWA 2QPTA 2LV7A 1S5GZ 1SYMA 1S6CA 1BR1B 2JT3A 1OSAA 1HT9A 3SG3A 2L50A 2VRGA 1IRJA 3TDZA 1WY9A 1FF1A 2L2EA 3CTNA 1S26D 1SRAA 2KFGA 3JTDC 1IJ6A 1K9PA 3CWGA 1G4YR 1QXPA 4WQ3A 2LNKA 1CDMA 3DVMA 2K0JA 3GK4X 2BL0C 2Y1MA 1Y1XA 1PVBA 4MZJA 4Q04A 2BBNA 1AVSA 1AJ5A 1IG5A 2CBLA 3VROA 1KWOB 3EK8A 4CLNA 1G8IA 2JT0A 1OOJA 2H2KA 3EK7A 4I5JA 1QX2A 4MZKA 3SG2A 3CR2A 4NDBA 2KAVA 4OKHA 4MVFA 1F71A 2FCDA 1R2UA 3M0WA 3WXAA 1LA0A 1EL4A 1K93D 1DF0B 1X02A 2KFHA 4A4BA 1IQ3A 1XFWO 4PE1A 1YURA 1TN4A 2FCEA 1UP5A 2KHNA 1XVJA 2BKIB 4ICBA 4YI9A 1DMOA 1LXFC 1XK4C 1YX8A 3FS7A 5D69A 1F54A 5CSJA 4YGBB 1N0YA 2LAPA 3PM8A 4N1FA 1PALA 1RFJA 2OTGC 1M63B 1IH0A 4YGAA 2ZRSA 1KSMA 1M31A 4PHNA 2FJUB 2NLNA 1KK7Y 2MJWB 2WCEA 3E3RA 4MLWA 5JJGA 2I2RE 1IGVA 1YUUA 3AAJA 1BF5A 2JTTA 1FI5A 3SG4A 1JWDA 1NX3A 4OR9B 2ZKMX 3VRNA 1QV0A 1ODBA 2BCAA 2M7LA 1QIWA 1W7IB 2JT8A 3DVJA 3O78A 5HLVA 4YI8A 1PK0D 2E30A 4I5KA 1MXEA 4GNKB 1B7TY 3QRXA 1K94A 2HF5A 2BL0B 4DS7A 2LE9B 3D0YB 2M49B 1NSHA 1Y0VH 2LLUA 1SPYA 1PSBA 4ZCUA 1RROA 1L2OC 3KF9A 2WCBA 1AHRA 2EC6C 1OZOA 4GGFA 5KSZA 2OTGB 1YRTB 2Y5IA 1NYAA 4GAOA 2F2OA 1B9AA 1UHKA 2BECA 1SCMB 1MXLC 2L4HA 1S1EA 4P5OE 1LVCD 1S6IA 3EK4A 5I2LA 2LANA 1Y6WA 4GGFC 3VRRA 1KQVA 4A4CA 2LMTA 4MZLA 1B1GA 4DRWA 1XYDA 4MSPA 2PMYA 4XJKA 4QJ4B 1LA3A 2COLB 2G9BA 2Y4QA 1IWQA 2CT9A 4QJ5B 4PE0A 2Y1NA 2M97A 1OQPA 2O60A 3A4UB 1ALWA 3D0YA 4F0ZB 1EG4A 2Q91A 2JULA 4N5XA 1TIZA 3HX4A 1AP4A 5GQQC 1TCFA 3CLNA 1XFZO 3NSKA 1RTP1 2OPOA 5KTYA 1MWNA 2I94A 2KGRA 1J7RA 1F4QA 2PVBA 2KQ6A 2SASA 3I5GC 5PALA 2F2PA 1K9UA 1KFXS 3VGOA 2MBXA 1UHJA 2JQ6A 4OCIA 4PE4A 2K61A 2D8NA 2M1KB 4IL1A 1U5IA 1S5GY 1UUSA 1NX2A 1WLMA 1XFXO 2EHBA 2KSPA 4DCKA 1V1FA 2JZIA 4XJKB 2L0PA 1IKUA 1G33A 1K96A 3BQ3A 3BUXB 3I5FC 5BPJA 2OS8C 4HSZA 2WCFA 1SY9A 3KEVA 4CFQA 2MRDA 1KK8C 1HQVA 2AUCA 4CIDA 1BR4B 1YVLA 1QATA 3OB1B 1TNQA 3CR5X 2HPSA 4P2YB 5CSFA 2JXLA 4PCWA 2MLEC 1Y1UA 4JQ0D 4TNCA 3ICBA 1OMDA 2P6BB 1ZMZA 3KO0A 1UHHA 1B47A 2PALA 4GGNA 4M2QA 3BOWB 2WC8A 2M3WA 1PRWA 2KAYA 4M2PA 2KBMA 3H4SE 4NDCA 3TDUA 2HETA 1SL7A 1E8AA 1TCOB 2BE6A 4MRYA 1BG1A 1IQ5A 1PULA 2WOSA 2KI4B 1S36A 1J7OA 2LVVA 1WDCB 1ZACA 1CLMA 2MHHA 1A75B 2KI6D 1GQMA 3FWBA 4WRIA 5HLOA 5HKZA 2BBMA 1H8BA 1RECA 3JTDB 3OB2B 1DGUA 1BMOA 4PE7A 2TN4A 3EVRA 1KFXL 2F33A 3WNXB 1CFCA 1PSRA 1QLSA 3A8RA 3CS1A 2IS9A 2K2FA 2KAXA 5DKRA 1GGWA 2F3YA 5DKNA 2KYCA 3NSIA 3TUYC 2KGBC 1K8UA 1RJVA 2JOJA 4MRXA 1B4CA 4BY5A 1NUBA 1KWOC 5D7FA 1MHOA 1OMRA 1JFKA 2FOTA 4AOMA 3CZTX 1KFUS 2LMVA 1FPWA 2LHIA 1OE9B 4XYNA 1JSAA 1XK4A 1NWDA 1B8LA 4L9MA 1XO5A 1J55A 1SK6D 1QTXA 3DVKA 2M1UA 1Y1AA 1DVIA 3OX5A 1CDNA 4CFRA 1R6PA 1TRFA 2MAZA 2MLFC 2V53A 4YRUA 3PLFB 3DVEA 1XFUO 2B1UA 2WNDA 1EG3A 5AEQA 1B7TZ 2ZNEA 1FI6A 1YVHA 1ZOTB 1RK9A 3KHEA 1J1EA 1U5IB 4PHMA 1NX0A 5B8IB 4MEWA 1CMFA 1DJYA 3RLZA 3C1VA 2LUCA 1TOPA 1DT7B 3NSOA 3OHMB 4MBEA 1N65A 1JFJA 5I2OA 2KDHA 4MN0A 4PHKA 2R2IA 3OX6A 1WDCC 1CMGA 2MA2A 3ZWHA 1IJ5A 1S3PA 2H61A 1S6JA 5IBWA 1TNWA 1JC2A 2JRFA 4FQOA 2KI6C 4DIRA 1KCYA 1CDPA 2NCOA 1N2DA 1KQMB 1WRZA 2CTNA 2JU0A 3BOWA 3SIAA 1DJHA 1KFUL 3AKAA 2K7OA 1UHIA 3TUYB 2LVIA 4JPZB 5KU1A 3AKBA 3D10A 1QV1A 1H4BA 5AERA 3EKJA 2EC6B 1JUOA 4GUKA 4OVNF 1A75A 2GV5A 2KQYA 3EVUA 2BE4A 1NIWA 2M9GA 3HCMA 3SJSA 2L5XB 2L4IA 1CFFA 2PASA 1DGVA 1WRKA 4U8DA 3WHUB 3BYAA 3I5IC 2DOQA 2RGIA 3BUNB 1CM4A 5G08A 1K95A 1XFVO 4UPGA 2KFFA 1GJYA 2BCBA 1QVIY 1NP8A 1MR8A 3SG7A 4FTGA 1UURA 4ORAB 3GOFA 4USLA 1SR6B 2KNEA 3RM1A 3BXKA 1SCMC 2LVJA 3TS5B 3I5HC 1YX7A 2K7CA 3KPXA 1MQ1A 2LUXA 1M46A 1CLBA 1D1OA 2M0RA 4I5LB 4ZCVA 3I5GB 1YUTA 3F45A 1K2HA 2A4JA 2NZ0A 3MSEB 5I8NA 1QX7A 3EVVA 3PSRA 1ALVA 1JF0A 2I7AA 4NQGA 1QASA 3PALA 2ZFDA 4ORBB 3TDIA 3I5IB 1BJFA 1CDLA 1B8RA 1YRUB 5AANA 1NCYA 2ZN9A 1KK8B 4GPLB 5CSNA 1SBJA 1DJWA 1J7QA 1QS7A 2HQ8A 2ZNDA 3LLEA 2EGDA 2KOTA 1NX1A 1SR6C 2WORA 4BY4A 1A29A 2JTZA 1F4OA 2SCPA 3I5HB 4WQ2A 1CLLA 4C0LA 1JF2A 2M29A 2LLTA 1NCZA 1Q80A 2O5GA 2H61C 2Q4UA 4E68A 5HKYA 1CFPA 1QIVA 1EJ3A 1NCXA 2KYFA 1A4PA 1AUIB 2M7NA 2KI4C 3NXAA 5F6TA 3SIBA 4HRGA 3PN7B 1UHNA 3O6BA 1A03A 3AAKA 1SL8A 4D1EA 4YGDB 3JVTC 4R1EA 4YBHB 1QJTA 3VRQA 4I5NB 1BLQA 3K21A 1TTXA 1B8CA 4HREE 2E6WA 1SL9A 2LCPA 2F8PA 2JXCA 2LLSA 1C07A 4PDZA 2JNFA 2GGZA 1CB1A 1MF8B 4GFTA 1A2XA 3GK1A 2LHLA 1L2OB 2BCXA 1K9KA 1AJ4A 1K90D 3LK1A 4AQJA 2KBIA 5K89A 1M39A 1DJIA 4OV2A 2LVKA 3O2PA 2M8UA 1OMVA 2CXJA 3GK2A 2PRUA 5HYDA 1MUXA 3LL8B 2AAOA 3ZNIA 2CNPA 1EXRA 3LCPC 2JNXA 2LP3A 1WLZA 2G2BA 4AQIA 1BU3A 1C7WA 1XA5A 3PATA 1BT6A 1LKJA 4ORCB 5TNCA 1C7VA 1DTLA 2LMUA 1FBVA 3O4YA 3SG5A 5HKWA 1FW4A 3PN7C 1J1DA 1OZSA 3IQOA 3DF0A 3JVTB 2JPTA 1F55A 3IQQA 3LK0A 3BUWB 2ISDA 2GGMA 4C0JA 1CFDA 4ETOA 1CKKA 4CPVA 3SG6A 1SNLA 2QACA 5J3XA 1PVAA 1CNPA 3OP0A 2NXQA 1DJGA 1F8HA 1ZFSA 2LP2A 3FIAA 1EH2A 4DUQA 1SKTA 1AK8A 4M2OA 1YTZC 2K7DA 3WHTB 1QX5B 1CTRA 1W7JB 3EKHA 3IF7A 2AMIA 1QVIZ 5I2QA 1KK7Z 1DF0A 2L98A 5AFPA 1KSOA 4NDDA 2K8MB
chains in the Genus database with same CATH superfamily
3FWCA 2PSRA 1BODA 3DF0B 3R1OA 4PALA 3CGAA 4QJ3B 5DKQA 1WRLA 1SMGA 2LC5A 4HRHA 5JOLA 3UO9A 2F3ZA 1F70A 1BOCA 3NSLA 3RZSA 1DJZA 1V1GA 3FE9A 4PHJA 3NHIA 3S0EA 5CSIA 1QLKA 1SW8A 1UWOA 1ZUZA 2LM5A 4YGEB 5EL2A 2CCMA 1KQMC 5ER4X 2ZRTA 3BUMB 5FYXA 2K2AA 1T14A 1NPQA 3I5FB 2JC2A 2OS8B 4GBAA 2I18A 5AXIA 4C0KA 3R1PA 3UNWA 1LINA 1JBAA 2K7BA 5CPVA 1VRKA 1XFYO 2NCPA 3CR4X 1C3YA 2HQWA 2QEHA 3DXLA 2BKHB 3BUOB 3O4XA 4YGCB 1YR5A 3VRPA 1RWYA 2ZN8A 1CM1A 3DD4A 1GGZA 1TNXA 1M45A 2L51A 3PFVA 4JWQA 3TS5C 1DJXA 1TNPA 1J7PA 4N1GA 1YUSA 1SCVA 1L7ZA 5ER5A 3TZ1A 2H8VA 2JWWA 2L2CA 2QPTA 2LV7A 1S5GZ 1SYMA 1S6CA 1BR1B 2JT3A 1OSAA 1HT9A 3SG3A 2ERBA 2L50A 2VRGA 1IRJA 3TDZA 1WY9A 1FF1A 2L2EA 3CTNA 2KLDA 1S26D 3NGVA 4OZDA 1SRAA 2KFGA 3JTDC 1IJ6A 1K9PA 1TUZA 1G4YR 3CWGA 1QXPA 4WQ3A 2LNKA 1CDMA 3DVMA 2K0JA 3GK4X 2BL0C 2Y1MA 1Y1XA 1PVBA 4MZJA 4Q04A 2BBNA 1AVSA 1AJ5A 1IG5A 2CBLA 3VROA 1KWOB 3EK8A 4CLNA 1G8IA 2JT0A 1OOJA 2H2KA 2WCMA 3EK7A 2WCKA 4I5JA 1QX2A 1TUJA 4MZKA 3SG2A 1LS8A 3CR2A 2QEOA 3L4AA 2KAVA 4NDBA 4OKHA 3OBVA 4MVFA 1F71A 2FCDA 1R2UA 3M0WA 3WXAA 1LA0A 1EL4A 1K93D 1DF0B 1X02A 2KFHA 3BJHA 4A4BA 1IQ3A 1XFWO 4PE1A 1YURA 1TN4A 2FCEA 2QEVA 1UP5A 2KHNA 1XVJA 2K60A 2BKIB 4ICBA 4YI9A 1DMOA 1LXFC 1XK4C 1YX8A 3FS7A 5D69A 1F54A 1Z2CB 5CSJA 1N0YA 2LAPA 3PM8A 4N1FA 4YGBB 1PALA 1RFJA 2OTGC 3CABA 2KPHA 1M63B 1IH0A 4YGAA 2ZRSA 2PQLA 1KSMA 1M31A 4FQTA 4PHNA 2FJUB 2NLNA 1KK7Y 2MJWB 2WCEA 3E3RA 4MLWA 5JJGA 3L47A 2I2RE 1IGVA 1YUUA 3AAJA 1BF5A 2JTTA 4KYNA 1FI5A 3SG4A 1JWDA 1NX3A 4OR9B 2ZKMX 3B6XA 2WC6A 3DYEA 3VRNA 1QV0A 1ODBA 2BCAA 2M7LA 1QIWA 1W7IB 2JT8A 3DVJA 3O78A 5HLVA 4YI8A 1PK0D 2E30A 4I5KA 1MXEA 4GNKB 1B7TY 3QRXA 1K94A 2HF5A 2BL0B 3PJIA 4DS7A 3D75A 2LE9B 3D0YB 2M49B 1NSHA 1Y0VH 2LLUA 1SPYA 1PSBA 3N7HA 1RROA 1L2OC 4ZCUA 3KF9A 2WCBA 2WC5A 1AHRA 2EC6C 1OZOA 4GGFA 3S0DA 5KSZA 2OTGB 1YRTB 2Y5IA 1NYAA 4GAOA 2F2OA 1B9AA 1UHKA 2BECA 1SCMB 1MXLC 2L4HA 1S1EA 4P5OE 1LVCD 1DEKA 1S6IA 3EK4A 5I2LA 2LANA 1Y6WA 4GGFC 3VRRA 1KQVA 4A4CA 2LMTA 4MZLA 1B1GA 4DRWA 3BFHA 1C3ZA 1XYDA 4MSPA 2PMYA 4XJKA 4QJ4B 1LA3A 2COLB 2G9BA 2Y4QA 3IVTA 1IWQA 2CT9A 3CZ2A 4PE0A 4QJ5B 2Y1NA 2M97A 1OQPA 2O60A 3A4UB 1ALWA 3D0YA 4F0ZB 1EG4A 2Q91A 2JULA 4N5XA 1TIZA 3HX4A 5FI7A 3SS5A 1AP4A 5GQQC 1TCFA 3CLNA 2BAPA 1XFZO 3NSKA 1RTP1 2OPOA 3R1VA 1MWNA 2I94A 2KGRA 1J7RA 5KTYA 1F4QA 1OOGA 2PVBA 2KQ6A 2SASA 3CDNA 3I5GC 2F2PA 1K9UA 1KFXS 5PALA 3S0BA 3VGOA 2MBXA 1UHJA 2JQ6A 4OCIA 4PE4A 2K61A 2D8NA 4PT1A 2M1KB 4IL1A 1U5IA 1S5GY 5FI2A 1UUSA 1NX2A 1WLMA 1XFXO 2EHBA 2KSPA 4DCKA 1V1FA 2JZIA 4XJKB 1DELA 2L0PA 1IKUA 1G33A 1K96A 3BQ3A 3BUXB 3I5FC 4JD9A 2OS8C 5BPJA 4HSZA 2WCFA 1SY9A 3KEVA 4CFQA 2MRDA 1KK8C 1HQVA 2AUCA 4CIDA 1BR4B 5HL1A 1YVLA 1QATA 3OB1B 1TNQA 3CR5X 3OGNA 2HPSA 4P2YB 5CSFA 2JXLA 4PCWA 2MLEC 1Y1UA 4JQ0D 3PM2A 4TNCA 3ICBA 1OMDA 2P6BB 1ZMZA 3FE6A 3KO0A 1UHHA 2KLEA 1B47A 2PALA 4GGNA 4M2QA 3BOWB 2WC8A 2M3WA 1PRWA 2KAYA 4M2PA 2KBMA 3H4SE 4NDCA 3TDUA 3CZ0A 2HETA 1SL7A 1E8AA 1TCOB 2BE6A 4MRYA 1BG1A 1IQ5A 1PULA 2WOSA 2KI4B 1S36A 1J7OA 2LVVA 1WDCB 4INWA 1OW4A 1ZACA 1CLMA 2MHHA 3BFAA 1A75B 2KI6D 1GQMA 3FWBA 4WRIA 5HLOA 4INXA 2BBMA 5HKZA 1RECA 1H8BA 3JTDB 3OB2B 1DGUA 1BMOA 4PE7A 2TN4A 3EVRA 1KFXL 2F33A 3WNXB 1CFCA 1PSRA 1QLSA 3A8RA 3CS1A 2IS9A 2K2FA 2KAXA 5DKRA 1GGWA 2F3YA 5DKNA 2KYCA 2PYQA 3NSIA 3TUYC 2KGBC 1K8UA 1RJVA 2JOJA 4MRXA 1B4CA 4BY5A 1NUBA 1KWOC 5D7FA 1MHOA 1OMRA 1JFKA 2FOTA 3VB1A 3CZTX 4AOMA 1KFUS 2LMVA 1FPWA 2LHIA 1OE9B 1OOFA 1OOHA 4XYNA 1JSAA 1XK4A 1NWDA 1B8LA 4L9MA 1XO5A 1J55A 1SK6D 1Z4HA 1QTXA 3DVKA 2M1UA 1Y1AA 1DVIA 3OX5A 4IJ7A 1CDNA 4CFRA 1R6PA 1TRFA 2MAZA 2MLFC 2V53A 4YRUA 3PLFB 3DVEA 1XFUO 2B1UA 2WNDA 1EG3A 5I94A 2L5YA 5AEQA 1IIOA 3Q8IA 1B7TZ 2ZNEA 1FI6A 1YVHA 1ZOTB 1RK9A 3B88A 2YGUA 1J1EA 3KHEA 1U5IB 4PHMA 1NX0A 5B8IB 3DZTA 4MEWA 1CMFA 1DJYA 3S0FA 3RLZA 3C1VA 2LUCA 1TOPA 1DT7B 3NSOA 3OHMB 4MBEA 1N65A 1JFJA 5I2OA 2KDHA 4MN0A 4PHKA 3L4LA 2R2IA 3OX6A 1WDCC 2WCHA 1CMGA 2MA2A 3ZWHA 1IJ5A 1S3PA 2H61A 1S6JA 5IBWA 1TNWA 1JC2A 2JRFA 2FJYA 3B86A 4FQOA 2KI6C 4DIRA 1KCYA 1CDPA 3SS4A 2NCOA 1N2DA 1KQMB 1WRZA 2CTNA 2JU0A 2P70A 3D77A 4JKTA 3BOWA 3SIAA 1DJHA 1KFUL 3AKAA 2K7OA 1UHIA 3TUYB 2LVIA 4JPZB 5KU1A 3FE8A 3AKBA 3D10A 1QV1A 1H4BA 5AERA 3EKJA 2QEBA 2EC6B 1JUOA 1OOIX 4GUKA 4OVNF 1A75A 2GV5A 3CZ1A 2KQYA 3EVUA 2BE4A 1NIWA 2M9GA 3HCMA 3SJSA 2L5XB 2L4IA 1CFFA 2PASA 2WCJA 1DGVA 1WRKA 4U8DA 3WHUB 1SSEB 3BYAA 3NHTA 3I5IC 3S0AA 2DOQA 2P71A 2RGIA 3BUNB 1CM4A 5G08A 1K95A 1XFVO 4UPGA 2KFFA 1GJYA 2BCBA 1QVIY 1NP8A 1MR8A 3SG7A 3DY9A 4FTGA 1UURA 4ORAB 3GOFA 4USLA 1SR6B 2KNEA 3RM1A 3BXKA 1SCMC 2LVJA 3TS5B 3I5HC 1YX7A 1ORGA 2K7CA 3CYZA 3KPXA 3V2LA 1GM0A 1MQ1A 3D78A 2LUXA 1M46A 3QMEA 1CLBA 1D1OA 2M0RA 4I5LB 4ZCVA 3B7AA 1QWVA 3I5GB 1YUTA 3F45A 1K2HA 2A4JA 2NZ0A 3MSEB 3K1EA 3SS3A 5I8NA 1QX7A 3EVVA 3PSRA 3EG5B 1ALVA 1JF0A 2I7AA 4NQGA 1QASA 3PALA 2ZFDA 1TWOA 4ORBB 3TDIA 3I5IB 1BJFA 1CDLA 1B8RA 2QDIA 1YRUB 5AANA 1NCYA 2ZN9A 1KK8B 4GPLB 5CSNA 1SBJA 1DJWA 1J7QA 1QS7A 2HQ8A 2ZNDA 3LLEA 2EGDA 2KOTA 5D3OA 1NX1A 1SR6C 2WORA 4BY4A 1A29A 2JTZA 1F4OA 2SCPA 3I5HB 4WQ2A 1CLLA 4C0LA 1JF2A 2M29A 1DQEA 1NCZA 1Q80A 2LLTA 2H61C 2O5GA 2Q4UA 4E68A 5HKYA 1CFPA 1QIVA 1EJ3A 1NCXA 1P28A 2KYFA 2BNXA 1A4PA 1AUIB 2M7NA 2KI4C 3NXAA 5F6TA 3SIBA 4HRGA 3PN7B 1UHNA 3O6BA 1A03A 3AAKA 1SL8A 4D1EA 4YGDB 3D74A 3JVTC 4R1EA 4YBHB 1QJTA 3VRQA 4I5NB 1BLQA 3K21A 1TTXA 1B8CA 3D76A 4HREE 2E6WA 1SL9A 2LCPA 2F8PA 2JXCA 2LLSA 1C07A 4PDZA 2JNFA 2GGZA 1CB1A 1MF8B 4GFTA 1A2XA 3GK1A 2LHLA 2JPOA 1L2OB 2BCXA 1K9KA 1AJ4A 1K90D 3LK1A 4AQJA 2KBIA 5K89A 1M39A 1DJIA 4OV2A 2LVKA 3O2PA 2M8UA 1OMVA 2CXJA 3GK2A 2PRUA 5HYDA 1MUXA 3LL8B 2AAOA 3S0GA 2GTEA 3ZNIA 3B87A 2CNPA 1EXRA 3LCPC 3D73A 2JNXA 2LP3A 3BFBA 1WLZA 2G2BA 4AQIA 1BU3A 1C7WA 1XFRA 1XA5A 1W9ZA 3PATA 3R72A 1BT6A 1LKJA 4ORCB 5TNCA 1C7VA 1DTLA 2LMUA 1FBVA 3O4YA 3SG5A 5HKWA 1FW4A 3PN7C 2WCLA 1J1DA 1OZSA 3IQOA 3DF0A 3JVTB 2JPTA 1DC1A 1F55A 3IQQA 3LK0A 3BUWB 2ISDA 2GGMA 4C0JA 1CFDA 4ETOA 1CKKA 4CPVA 3SG6A 1SNLA 2QACA 5J3XA 1PVAA 1CNPA 3OP0A 2NXQA 1DJGA 1F8HA 1ZFSA 2LP2A 3FIAA 1EH2A 4F7FA 4DUQA 1SKTA 5FI6A 5DICA 1AK8A 4M2OA 1YTZC 2K7DA 3WHTB 1QX5B 1CTRA 1W7JB 3EKHA 3IF7A 2AMIA 1QVIZ 5I2QA 1KK7Z 1DF0A 2L98A 5AFPA 1KSOA 4NDDA 2K8MB
chains in the Genus database with same CATH topology
3FWCA 2PSRA 1BODA 3DF0B 4PALA 3CGAA 4QJ3B 5DKQA 1WRLA 1SMGA 2LC5A 4HRHA 5JOLA 1F70A 2F3ZA 1BOCA 3NSLA 1DJZA 1V1GA 4PHJA 5CSIA 1QLKA 1SW8A 1UWOA 1ZUZA 2LM5A 4YGEB 2CCMA 1KQMC 5ER4X 2ZRTA 3BUMB 5FYXA 2K2AA 1NPQA 3I5FB 2JC2A 2OS8B 4GBAA 2I18A 5AXIA 4C0KA 1LINA 1JBAA 2K7BA 5CPVA 1VRKA 1XFYO 2NCPA 3CR4X 2HQWA 4YGCB 2BKHB 3BUOB 1YR5A 3VRPA 1RWYA 2ZN8A 1CM1A 3DD4A 1GGZA 1TNXA 1M45A 2L51A 3PFVA 4JWQA 3TS5C 1DJXA 1TNPA 1J7PA 4N1GA 1YUSA 1SCVA 1L7ZA 5ER5A 3TZ1A 2JWWA 2QPTA 2LV7A 1S5GZ 1SYMA 1S6CA 1BR1B 2JT3A 1OSAA 1HT9A 3SG3A 2L50A 2VRGA 1IRJA 3TDZA 1WY9A 1FF1A 2L2EA 3CTNA 1S26D 1SRAA 2KFGA 3JTDC 1IJ6A 1K9PA 3CWGA 1G4YR 1QXPA 4WQ3A 2LNKA 1CDMA 3DVMA 2K0JA 3GK4X 2BL0C 2Y1MA 1Y1XA 1PVBA 4MZJA 4Q04A 2BBNA 1AVSA 1AJ5A 1IG5A 2CBLA 3VROA 1KWOB 3EK8A 4CLNA 1G8IA 2JT0A 1OOJA 2H2KA 3EK7A 4I5JA 1QX2A 4MZKA 3SG2A 3CR2A 4NDBA 2KAVA 4OKHA 4MVFA 1F71A 2FCDA 1R2UA 3M0WA 3WXAA 1LA0A 1EL4A 1K93D 1DF0B 1X02A 2KFHA 4A4BA 1IQ3A 1XFWO 4PE1A 1YURA 1TN4A 2FCEA 1UP5A 2KHNA 1XVJA 2BKIB 4ICBA 4YI9A 1DMOA 1LXFC 1XK4C 1YX8A 3FS7A 5D69A 1F54A 5CSJA 4YGBB 1N0YA 2LAPA 3PM8A 4N1FA 1PALA 1RFJA 2OTGC 1M63B 1IH0A 4YGAA 2ZRSA 1KSMA 1M31A 4PHNA 2FJUB 2NLNA 1KK7Y 2MJWB 2WCEA 3E3RA 4MLWA 5JJGA 2I2RE 1IGVA 1YUUA 3AAJA 1BF5A 2JTTA 1FI5A 3SG4A 1JWDA 1NX3A 4OR9B 2ZKMX 3VRNA 1QV0A 1ODBA 2BCAA 2M7LA 1QIWA 1W7IB 2JT8A 3DVJA 3O78A 5HLVA 4YI8A 1PK0D 2E30A 4I5KA 1MXEA 4GNKB 1B7TY 3QRXA 1K94A 2HF5A 2BL0B 4DS7A 2LE9B 3D0YB 2M49B 1NSHA 1Y0VH 2LLUA 1SPYA 1PSBA 4ZCUA 1RROA 1L2OC 3KF9A 2WCBA 1AHRA 2EC6C 1OZOA 4GGFA 5KSZA 2OTGB 1YRTB 2Y5IA 1NYAA 4GAOA 2F2OA 1B9AA 1UHKA 2BECA 1SCMB 1MXLC 2L4HA 1S1EA 4P5OE 1LVCD 1S6IA 3EK4A 5I2LA 2LANA 1Y6WA 4GGFC 3VRRA 1KQVA 4A4CA 2LMTA 4MZLA 1B1GA 4DRWA 1XYDA 4MSPA 2PMYA 4XJKA 4QJ4B 1LA3A 2COLB 2G9BA 2Y4QA 1IWQA 2CT9A 4QJ5B 4PE0A 2Y1NA 2M97A 1OQPA 2O60A 3A4UB 1ALWA 3D0YA 4F0ZB 1EG4A 2Q91A 2JULA 4N5XA 1TIZA 3HX4A 1AP4A 5GQQC 1TCFA 3CLNA 1XFZO 3NSKA 1RTP1 2OPOA 5KTYA 1MWNA 2I94A 2KGRA 1J7RA 1F4QA 2PVBA 2KQ6A 2SASA 3I5GC 5PALA 2F2PA 1K9UA 1KFXS 3VGOA 2MBXA 1UHJA 2JQ6A 4OCIA 4PE4A 2K61A 2D8NA 2M1KB 4IL1A 1U5IA 1S5GY 1UUSA 1NX2A 1WLMA 1XFXO 2EHBA 2KSPA 4DCKA 1V1FA 2JZIA 4XJKB 2L0PA 1IKUA 1G33A 1K96A 3BQ3A 3BUXB 3I5FC 5BPJA 2OS8C 4HSZA 2WCFA 1SY9A 3KEVA 4CFQA 2MRDA 1KK8C 1HQVA 2AUCA 4CIDA 1BR4B 1YVLA 1QATA 3OB1B 1TNQA 3CR5X 2HPSA 4P2YB 5CSFA 2JXLA 4PCWA 2MLEC 1Y1UA 4JQ0D 4TNCA 3ICBA 1OMDA 2P6BB 1ZMZA 3KO0A 1UHHA 1B47A 2PALA 4GGNA 4M2QA 3BOWB 2WC8A 2M3WA 1PRWA 2KAYA 4M2PA 2KBMA 3H4SE 4NDCA 3TDUA 2HETA 1SL7A 1E8AA 1TCOB 2BE6A 4MRYA 1BG1A 1IQ5A 1PULA 2WOSA 2KI4B 1S36A 1J7OA 2LVVA 1WDCB 1ZACA 1CLMA 2MHHA 1A75B 2KI6D 1GQMA 3FWBA 4WRIA 5HLOA 5HKZA 2BBMA 1H8BA 1RECA 3JTDB 3OB2B 1DGUA 1BMOA 4PE7A 2TN4A 3EVRA 1KFXL 2F33A 3WNXB 1CFCA 1PSRA 1QLSA 3A8RA 3CS1A 2IS9A 2K2FA 2KAXA 5DKRA 1GGWA 2F3YA 5DKNA 2KYCA 3NSIA 3TUYC 2KGBC 1K8UA 1RJVA 2JOJA 4MRXA 1B4CA 4BY5A 1NUBA 1KWOC 5D7FA 1MHOA 1OMRA 1JFKA 2FOTA 4AOMA 3CZTX 1KFUS 2LMVA 1FPWA 2LHIA 1OE9B 4XYNA 1JSAA 1XK4A 1NWDA 1B8LA 4L9MA 1XO5A 1J55A 1SK6D 1QTXA 3DVKA 2M1UA 1Y1AA 1DVIA 3OX5A 1CDNA 4CFRA 1R6PA 1TRFA 2MAZA 2MLFC 2V53A 4YRUA 3PLFB 3DVEA 1XFUO 2B1UA 2WNDA 1EG3A 5AEQA 1B7TZ 2ZNEA 1FI6A 1YVHA 1ZOTB 1RK9A 3KHEA 1J1EA 1U5IB 4PHMA 1NX0A 5B8IB 4MEWA 1CMFA 1DJYA 3RLZA 3C1VA 2LUCA 1TOPA 1DT7B 3NSOA 3OHMB 4MBEA 1N65A 1JFJA 5I2OA 2KDHA 4MN0A 4PHKA 2R2IA 3OX6A 1WDCC 1CMGA 2MA2A 3ZWHA 1IJ5A 1S3PA 2H61A 1S6JA 5IBWA 1TNWA 1JC2A 2JRFA 4FQOA 2KI6C 4DIRA 1KCYA 1CDPA 2NCOA 1N2DA 1KQMB 1WRZA 2CTNA 2JU0A 3BOWA 3SIAA 1DJHA 1KFUL 3AKAA 2K7OA 1UHIA 3TUYB 2LVIA 4JPZB 5KU1A 3AKBA 3D10A 1QV1A 1H4BA 5AERA 3EKJA 2EC6B 1JUOA 4GUKA 4OVNF 1A75A 2GV5A 2KQYA 3EVUA 2BE4A 1NIWA 2M9GA 3HCMA 3SJSA 2L5XB 2L4IA 1CFFA 2PASA 1DGVA 1WRKA 4U8DA 3WHUB 3BYAA 3I5IC 2DOQA 2RGIA 3BUNB 1CM4A 5G08A 1K95A 1XFVO 4UPGA 2KFFA 1GJYA 2BCBA 1QVIY 1NP8A 1MR8A 3SG7A 4FTGA 1UURA 4ORAB 3GOFA 4USLA 1SR6B 2KNEA 3RM1A 3BXKA 1SCMC 2LVJA 3TS5B 3I5HC 1YX7A 2K7CA 3KPXA 1MQ1A 2LUXA 1M46A 1CLBA 1D1OA 2M0RA 4I5LB 4ZCVA 3I5GB 1YUTA 3F45A 1K2HA 2A4JA 2NZ0A 3MSEB 5I8NA 1QX7A 3EVVA 3PSRA 1ALVA 1JF0A 2I7AA 4NQGA 1QASA 3PALA 2ZFDA 4ORBB 3TDIA 3I5IB 1BJFA 1CDLA 1B8RA 1YRUB 5AANA 1NCYA 2ZN9A 1KK8B 4GPLB 5CSNA 1SBJA 1DJWA 1J7QA 1QS7A 2HQ8A 2ZNDA 3LLEA 2EGDA 2KOTA 1NX1A 1SR6C 2WORA 4BY4A 1A29A 2JTZA 1F4OA 2SCPA 3I5HB 4WQ2A 1CLLA 4C0LA 1JF2A 2M29A 2LLTA 1NCZA 1Q80A 2O5GA 2H61C 2Q4UA 4E68A 5HKYA 1CFPA 1QIVA 1EJ3A 1NCXA 2KYFA 1A4PA 1AUIB 2M7NA 2KI4C 3NXAA 5F6TA 3SIBA 4HRGA 3PN7B 1UHNA 3O6BA 1A03A 3AAKA 1SL8A 4D1EA 4YGDB 3JVTC 4R1EA 4YBHB 1QJTA 3VRQA 4I5NB 1BLQA 3K21A 1TTXA 1B8CA 4HREE 2E6WA 1SL9A 2LCPA 2F8PA 2JXCA 2LLSA 1C07A 4PDZA 2JNFA 2GGZA 1CB1A 1MF8B 4GFTA 1A2XA 3GK1A 2LHLA 1L2OB 2BCXA 1K9KA 1AJ4A 1K90D 3LK1A 4AQJA 2KBIA 5K89A 1M39A 1DJIA 4OV2A 2LVKA 3O2PA 2M8UA 1OMVA 2CXJA 3GK2A 2PRUA 5HYDA 1MUXA 3LL8B 2AAOA 3ZNIA 2CNPA 1EXRA 3LCPC 2JNXA 2LP3A 1WLZA 2G2BA 4AQIA 1BU3A 1C7WA 1XA5A 3PATA 1BT6A 1LKJA 4ORCB 5TNCA 1C7VA 1DTLA 2LMUA 1FBVA 3O4YA 3SG5A 5HKWA 1FW4A 3PN7C 1J1DA 1OZSA 3IQOA 3DF0A 3JVTB 2JPTA 1F55A 3IQQA 3LK0A 3BUWB 2ISDA 2GGMA 4C0JA 1CFDA 4ETOA 1CKKA 4CPVA 3SG6A 1SNLA 2QACA 5J3XA 1PVAA 1CNPA 3OP0A 2NXQA 1DJGA 1F8HA 1ZFSA 2LP2A 3FIAA 1EH2A 4DUQA 1SKTA 1AK8A 4M2OA 1YTZC 2K7DA 3WHTB 1QX5B 1CTRA 1W7JB 3EKHA 3IF7A 2AMIA 1QVIZ 5I2QA 1KK7Z 1DF0A 2L98A 5AFPA 1KSOA 4NDDA 2K8MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FWC A;  2PSR A;  1BOD A;  3DF0 B;  4PAL A;  3CGA A;  4QJ3 B;  5DKQ A;  1WRL A;  1SMG A;  2LC5 A;  4HRH A;  5JOL A;  1F70 A;  2F3Z A;  1BOC A;  3NSL A;  1DJZ A;  1V1G A;  4PHJ A;  5CSI A;  1QLK A;  1SW8 A;  1UWO A;  1ZUZ A;  2LM5 A;  4YGE B;  2CCM A;  1KQM C;  5ER4 X;  2ZRT A;  3BUM B;  5FYX A;  2K2A A;  1NPQ A;  3I5F B;  2JC2 A;  2OS8 B;  4GBA A;  2I18 A;  5AXI A;  4C0K A;  1LIN A;  1JBA A;  2K7B A;  5CPV A;  1VRK A;  1XFY O;  2NCP A;  3CR4 X;  2HQW A;  4YGC B;  2BKH B;  3BUO B;  1YR5 A;  3VRP A;  1RWY A;  2ZN8 A;  1CM1 A;  3DD4 A;  1GGZ A;  1TNX A;  1M45 A;  2L51 A;  3PFV A;  4JWQ A;  3TS5 C;  1DJX A;  1TNP A;  1J7P A;  4N1G A;  1YUS A;  1SCV A;  1L7Z A;  5ER5 A;  3TZ1 A;  2JWW A;  2QPT A;  2LV7 A;  1S5G Z;  1SYM A;  1S6C A;  1BR1 B;  2JT3 A;  1OSA A;  1HT9 A;  3SG3 A;  2L50 A;  2VRG A;  1IRJ A;  3TDZ A;  1WY9 A;  1FF1 A;  2L2E A;  3CTN A;  1S26 D;  1SRA A;  2KFG A;  3JTD C;  1IJ6 A;  1K9P A;  3CWG A;  1G4Y R;  1QXP A;  4WQ3 A;  2LNK A;  1CDM A;  3DVM A;  2K0J A;  3GK4 X;  2BL0 C;  2Y1M A;  1Y1X A;  1PVB A;  4MZJ A;  4Q04 A;  2BBN A;  1AVS A;  1AJ5 A;  1IG5 A;  2CBL A;  3VRO A;  1KWO B;  3EK8 A;  4CLN A;  1G8I A;  2JT0 A;  1OOJ A;  2H2K A;  3EK7 A;  4I5J A;  1QX2 A;  4MZK A;  3SG2 A;  3CR2 A;  4NDB A;  2KAV A;  4OKH A;  4MVF A;  1F71 A;  2FCD A;  1R2U A;  3M0W A;  3WXA A;  1LA0 A;  1EL4 A;  1K93 D;  1DF0 B;  1X02 A;  2KFH A;  4A4B A;  1IQ3 A;  1XFW O;  4PE1 A;  1YUR A;  1TN4 A;  2FCE A;  1UP5 A;  2KHN A;  1XVJ A;  2BKI B;  4ICB A;  4YI9 A;  1DMO A;  1LXF C;  1XK4 C;  1YX8 A;  3FS7 A;  5D69 A;  1F54 A;  5CSJ A;  4YGB B;  1N0Y A;  2LAP A;  3PM8 A;  4N1F A;  1PAL A;  1RFJ A;  2OTG C;  1M63 B;  1IH0 A;  4YGA A;  2ZRS A;  1KSM A;  1M31 A;  4PHN A;  2FJU B;  2NLN A;  1KK7 Y;  2MJW B;  2WCE A;  3E3R A;  4MLW A;  5JJG A;  2I2R E;  1IGV A;  1YUU A;  3AAJ A;  1BF5 A;  2JTT A;  1FI5 A;  3SG4 A;  1JWD A;  1NX3 A;  4OR9 B;  2ZKM X;  3VRN A;  1QV0 A;  1ODB A;  2BCA A;  2M7L A;  1QIW A;  1W7I B;  2JT8 A;  3DVJ A;  3O78 A;  5HLV A;  4YI8 A;  1PK0 D;  2E30 A;  4I5K A;  1MXE A;  4GNK B;  1B7T Y;  3QRX A;  1K94 A;  2HF5 A;  2BL0 B;  4DS7 A;  2LE9 B;  3D0Y B;  2M49 B;  1NSH A;  1Y0V H;  2LLU A;  1SPY A;  1PSB A;  4ZCU A;  1RRO A;  1L2O C;  3KF9 A;  2WCB A;  1AHR A;  2EC6 C;  1OZO A;  4GGF A;  5KSZ A;  2OTG B;  1YRT B;  2Y5I A;  1NYA A;  4GAO A;  2F2O A;  1B9A A;  1UHK A;  2BEC A;  1SCM B;  1MXL C;  2L4H A;  1S1E A;  4P5O E;  1LVC D;  1S6I A;  3EK4 A;  5I2L A;  2LAN A;  1Y6W A;  4GGF C;  3VRR A;  1KQV A;  4A4C A;  2LMT A;  4MZL A;  1B1G A;  4DRW A;  1XYD A;  4MSP A;  2PMY A;  4XJK A;  4QJ4 B;  1LA3 A;  2COL B;  2G9B A;  2Y4Q A;  1IWQ A;  2CT9 A;  4QJ5 B;  4PE0 A;  2Y1N A;  2M97 A;  1OQP A;  2O60 A;  3A4U B;  1ALW A;  3D0Y A;  4F0Z B;  1EG4 A;  2Q91 A;  2JUL A;  4N5X A;  1TIZ A;  3HX4 A;  1AP4 A;  5GQQ C;  1TCF A;  3CLN A;  1XFZ O;  3NSK A;  1RTP 1;  2OPO A;  5KTY A;  1MWN A;  2I94 A;  2KGR A;  1J7R A;  1F4Q A;  2PVB A;  2KQ6 A;  2SAS A;  3I5G C;  5PAL A;  2F2P A;  1K9U A;  1KFX S;  3VGO A;  2MBX A;  1UHJ A;  2JQ6 A;  4OCI A;  4PE4 A;  2K61 A;  2D8N A;  2M1K B;  4IL1 A;  1U5I A;  1S5G Y;  1UUS A;  1NX2 A;  1WLM A;  1XFX O;  2EHB A;  2KSP A;  4DCK A;  1V1F A;  2JZI A;  4XJK B;  2L0P A;  1IKU A;  1G33 A;  1K96 A;  3BQ3 A;  3BUX B;  3I5F C;  5BPJ A;  2OS8 C;  4HSZ A;  2WCF A;  1SY9 A;  3KEV A;  4CFQ A;  2MRD A;  1KK8 C;  1HQV A;  2AUC A;  4CID A;  1BR4 B;  1YVL A;  1QAT A;  3OB1 B;  1TNQ A;  3CR5 X;  2HPS A;  4P2Y B;  5CSF A;  2JXL A;  4PCW A;  2MLE C;  1Y1U A;  4JQ0 D;  4TNC A;  3ICB A;  1OMD A;  2P6B B;  1ZMZ A;  3KO0 A;  1UHH A;  1B47 A;  2PAL A;  4GGN A;  4M2Q A;  3BOW B;  2WC8 A;  2M3W A;  1PRW A;  2KAY A;  4M2P A;  2KBM A;  3H4S E;  4NDC A;  3TDU A;  2HET A;  1SL7 A;  1E8A A;  1TCO B;  2BE6 A;  4MRY A;  1BG1 A;  1IQ5 A;  1PUL A;  2WOS A;  2KI4 B;  1S36 A;  1J7O A;  2LVV A;  1WDC B;  1ZAC A;  1CLM A;  2MHH A;  1A75 B;  2KI6 D;  1GQM A;  3FWB A;  4WRI A;  5HLO A;  5HKZ A;  2BBM A;  1H8B A;  1REC A;  3JTD B;  3OB2 B;  1DGU A;  1BMO A;  4PE7 A;  2TN4 A;  3EVR A;  1KFX L;  2F33 A;  3WNX B;  1CFC A;  1PSR A;  1QLS A;  3A8R A;  3CS1 A;  2IS9 A;  2K2F A;  2KAX A;  5DKR A;  1GGW A;  2F3Y A;  5DKN A;  2KYC A;  3NSI A;  3TUY C;  2KGB C;  1K8U A;  1RJV A;  2JOJ A;  4MRX A;  1B4C A;  4BY5 A;  1NUB A;  1KWO C;  5D7F A;  1MHO A;  1OMR A;  1JFK A;  2FOT A;  4AOM A;  3CZT X;  1KFU S;  2LMV A;  1FPW A;  2LHI A;  1OE9 B;  4XYN A;  1JSA A;  1XK4 A;  1NWD A;  1B8L A;  4L9M A;  1XO5 A;  1J55 A;  1SK6 D;  1QTX A;  3DVK A;  2M1U A;  1Y1A A;  1DVI A;  3OX5 A;  1CDN A;  4CFR A;  1R6P A;  1TRF A;  2MAZ A;  2MLF C;  2V53 A;  4YRU A;  3PLF B;  3DVE A;  1XFU O;  2B1U A;  2WND A;  1EG3 A;  5AEQ A;  1B7T Z;  2ZNE A;  1FI6 A;  1YVH A;  1ZOT B;  1RK9 A;  3KHE A;  1J1E A;  1U5I B;  4PHM A;  1NX0 A;  5B8I B;  4MEW A;  1CMF A;  1DJY A;  3RLZ A;  3C1V A;  2LUC A;  1TOP A;  1DT7 B;  3NSO A;  3OHM B;  4MBE A;  1N65 A;  1JFJ A;  5I2O A;  2KDH A;  4MN0 A;  4PHK A;  2R2I A;  3OX6 A;  1WDC C;  1CMG A;  2MA2 A;  3ZWH A;  1IJ5 A;  1S3P A;  2H61 A;  1S6J A;  5IBW A;  1TNW A;  1JC2 A;  2JRF A;  4FQO A;  2KI6 C;  4DIR A;  1KCY A;  1CDP A;  2NCO A;  1N2D A;  1KQM B;  1WRZ A;  2CTN A;  2JU0 A;  3BOW A;  3SIA A;  1DJH A;  1KFU L;  3AKA A;  2K7O A;  1UHI A;  3TUY B;  2LVI A;  4JPZ B;  5KU1 A;  3AKB A;  3D10 A;  1QV1 A;  1H4B A;  5AER A;  3EKJ A;  2EC6 B;  1JUO A;  4GUK A;  4OVN F;  1A75 A;  2GV5 A;  2KQY A;  3EVU A;  2BE4 A;  1NIW A;  2M9G A;  3HCM A;  3SJS A;  2L5X B;  2L4I A;  1CFF A;  2PAS A;  1DGV A;  1WRK A;  4U8D A;  3WHU B;  3BYA A;  3I5I C;  2DOQ A;  2RGI A;  3BUN B;  1CM4 A;  5G08 A;  1K95 A;  1XFV O;  4UPG A;  2KFF A;  1GJY A;  2BCB A;  1QVI Y;  1NP8 A;  1MR8 A;  3SG7 A;  4FTG A;  1UUR A;  4ORA B;  3GOF A;  4USL A;  1SR6 B;  2KNE A;  3RM1 A;  3BXK A;  1SCM C;  2LVJ A;  3TS5 B;  3I5H C;  1YX7 A;  2K7C A;  3KPX A;  1MQ1 A;  2LUX A;  1M46 A;  1CLB A;  1D1O A;  2M0R A;  4I5L B;  4ZCV A;  3I5G B;  1YUT A;  3F45 A;  1K2H A;  2A4J A;  2NZ0 A;  3MSE B;  5I8N A;  1QX7 A;  3EVV A;  3PSR A;  1ALV A;  1JF0 A;  2I7A A;  4NQG A;  1QAS A;  3PAL A;  2ZFD A;  4ORB B;  3TDI A;  3I5I B;  1BJF A;  1CDL A;  1B8R A;  1YRU B;  5AAN A;  1NCY A;  2ZN9 A;  1KK8 B;  4GPL B;  5CSN A;  1SBJ A;  1DJW A;  1J7Q A;  1QS7 A;  2HQ8 A;  2ZND A;  3LLE A;  2EGD A;  2KOT A;  1NX1 A;  1SR6 C;  2WOR A;  4BY4 A;  1A29 A;  2JTZ A;  1F4O A;  2SCP A;  3I5H B;  4WQ2 A;  1CLL A;  4C0L A;  1JF2 A;  2M29 A;  2LLT A;  1NCZ A;  1Q80 A;  2O5G A;  2H61 C;  2Q4U A;  4E68 A;  5HKY A;  1CFP A;  1QIV A;  1EJ3 A;  1NCX A;  2KYF A;  1A4P A;  1AUI B;  2M7N A;  2KI4 C;  3NXA A;  5F6T A;  3SIB A;  4HRG A;  3PN7 B;  1UHN A;  3O6B A;  1A03 A;  3AAK A;  1SL8 A;  4D1E A;  4YGD B;  3JVT C;  4R1E A;  4YBH B;  1QJT A;  3VRQ A;  4I5N B;  1BLQ A;  3K21 A;  1TTX A;  1B8C A;  4HRE E;  2E6W A;  1SL9 A;  2LCP A;  2F8P A;  2JXC A;  2LLS A;  1C07 A;  4PDZ A;  2JNF A;  2GGZ A;  1CB1 A;  1MF8 B;  4GFT A;  1A2X A;  3GK1 A;  2LHL A;  1L2O B;  2BCX A;  1K9K A;  1AJ4 A;  1K90 D;  3LK1 A;  4AQJ A;  2KBI A;  5K89 A;  1M39 A;  1DJI A;  4OV2 A;  2LVK A;  3O2P A;  2M8U A;  1OMV A;  2CXJ A;  3GK2 A;  2PRU A;  5HYD A;  1MUX A;  3LL8 B;  2AAO A;  3ZNI A;  2CNP A;  1EXR A;  3LCP C;  2JNX A;  2LP3 A;  1WLZ A;  2G2B A;  4AQI A;  1BU3 A;  1C7W A;  1XA5 A;  3PAT A;  1BT6 A;  1LKJ A;  4ORC B;  5TNC A;  1C7V A;  1DTL A;  2LMU A;  1FBV A;  3O4Y A;  3SG5 A;  5HKW A;  1FW4 A;  3PN7 C;  1J1D A;  1OZS A;  3IQO A;  3DF0 A;  3JVT B;  2JPT A;  1F55 A;  3IQQ A;  3LK0 A;  3BUW B;  2ISD A;  2GGM A;  4C0J A;  1CFD A;  4ETO A;  1CKK A;  4CPV A;  3SG6 A;  1SNL A;  2QAC A;  5J3X A;  1PVA A;  1CNP A;  3OP0 A;  2NXQ A;  1DJG A;  1F8H A;  1ZFS A;  2LP2 A;  3FIA A;  1EH2 A;  4DUQ A;  1SKT A;  1AK8 A;  4M2O A;  1YTZ C;  2K7D A;  3WHT B;  1QX5 B;  1CTR A;  1W7J B;  3EKH A;  3IF7 A;  2AMI A;  1QVI Z;  5I2Q A;  1KK7 Z;  1DF0 A;  2L98 A;  5AFP A;  1KSO A;  4NDD A;  2K8M B; 
#chains in the Genus database with same CATH topology
 3FWC A;  2PSR A;  1BOD A;  3DF0 B;  3R1O A;  4PAL A;  3CGA A;  4QJ3 B;  5DKQ A;  1WRL A;  1SMG A;  2LC5 A;  4HRH A;  5JOL A;  3UO9 A;  2F3Z A;  1F70 A;  1BOC A;  3NSL A;  3RZS A;  1DJZ A;  1V1G A;  3FE9 A;  4PHJ A;  3NHI A;  3S0E A;  5CSI A;  1QLK A;  1SW8 A;  1UWO A;  1ZUZ A;  2LM5 A;  4YGE B;  5EL2 A;  2CCM A;  1KQM C;  5ER4 X;  2ZRT A;  3BUM B;  5FYX A;  2K2A A;  1T14 A;  1NPQ A;  3I5F B;  2JC2 A;  2OS8 B;  4GBA A;  2I18 A;  5AXI A;  4C0K A;  3R1P A;  3UNW A;  1LIN A;  1JBA A;  2K7B A;  5CPV A;  1VRK A;  1XFY O;  2NCP A;  3CR4 X;  1C3Y A;  2HQW A;  2QEH A;  3DXL A;  2BKH B;  3BUO B;  3O4X A;  4YGC B;  1YR5 A;  3VRP A;  1RWY A;  2ZN8 A;  1CM1 A;  3DD4 A;  1GGZ A;  1TNX A;  1M45 A;  2L51 A;  3PFV A;  4JWQ A;  3TS5 C;  1DJX A;  1TNP A;  1J7P A;  4N1G A;  1YUS A;  1SCV A;  1L7Z A;  5ER5 A;  3TZ1 A;  2H8V A;  2JWW A;  2L2C A;  2QPT A;  2LV7 A;  1S5G Z;  1SYM A;  1S6C A;  1BR1 B;  2JT3 A;  1OSA A;  1HT9 A;  3SG3 A;  2ERB A;  2L50 A;  2VRG A;  1IRJ A;  3TDZ A;  1WY9 A;  1FF1 A;  2L2E A;  3CTN A;  2KLD A;  1S26 D;  3NGV A;  4OZD A;  1SRA A;  2KFG A;  3JTD C;  1IJ6 A;  1K9P A;  1TUZ A;  1G4Y R;  3CWG A;  1QXP A;  4WQ3 A;  2LNK A;  1CDM A;  3DVM A;  2K0J A;  3GK4 X;  2BL0 C;  2Y1M A;  1Y1X A;  1PVB A;  4MZJ A;  4Q04 A;  2BBN A;  1AVS A;  1AJ5 A;  1IG5 A;  2CBL A;  3VRO A;  1KWO B;  3EK8 A;  4CLN A;  1G8I A;  2JT0 A;  1OOJ A;  2H2K A;  2WCM A;  3EK7 A;  2WCK A;  4I5J A;  1QX2 A;  1TUJ A;  4MZK A;  3SG2 A;  1LS8 A;  3CR2 A;  2QEO A;  3L4A A;  2KAV A;  4NDB A;  4OKH A;  3OBV A;  4MVF A;  1F71 A;  2FCD A;  1R2U A;  3M0W A;  3WXA A;  1LA0 A;  1EL4 A;  1K93 D;  1DF0 B;  1X02 A;  2KFH A;  3BJH A;  4A4B A;  1IQ3 A;  1XFW O;  4PE1 A;  1YUR A;  1TN4 A;  2FCE A;  2QEV A;  1UP5 A;  2KHN A;  1XVJ A;  2K60 A;  2BKI B;  4ICB A;  4YI9 A;  1DMO A;  1LXF C;  1XK4 C;  1YX8 A;  3FS7 A;  5D69 A;  1F54 A;  1Z2C B;  5CSJ A;  1N0Y A;  2LAP A;  3PM8 A;  4N1F A;  4YGB B;  1PAL A;  1RFJ A;  2OTG C;  3CAB A;  2KPH A;  1M63 B;  1IH0 A;  4YGA A;  2ZRS A;  2PQL A;  1KSM A;  1M31 A;  4FQT A;  4PHN A;  2FJU B;  2NLN A;  1KK7 Y;  2MJW B;  2WCE A;  3E3R A;  4MLW A;  5JJG A;  3L47 A;  2I2R E;  1IGV A;  1YUU A;  3AAJ A;  1BF5 A;  2JTT A;  4KYN A;  1FI5 A;  3SG4 A;  1JWD A;  1NX3 A;  4OR9 B;  2ZKM X;  3B6X A;  2WC6 A;  3DYE A;  3VRN A;  1QV0 A;  1ODB A;  2BCA A;  2M7L A;  1QIW A;  1W7I B;  2JT8 A;  3DVJ A;  3O78 A;  5HLV A;  4YI8 A;  1PK0 D;  2E30 A;  4I5K A;  1MXE A;  4GNK B;  1B7T Y;  3QRX A;  1K94 A;  2HF5 A;  2BL0 B;  3PJI A;  4DS7 A;  3D75 A;  2LE9 B;  3D0Y B;  2M49 B;  1NSH A;  1Y0V H;  2LLU A;  1SPY A;  1PSB A;  3N7H A;  1RRO A;  1L2O C;  4ZCU A;  3KF9 A;  2WCB A;  2WC5 A;  1AHR A;  2EC6 C;  1OZO A;  4GGF A;  3S0D A;  5KSZ A;  2OTG B;  1YRT B;  2Y5I A;  1NYA A;  4GAO A;  2F2O A;  1B9A A;  1UHK A;  2BEC A;  1SCM B;  1MXL C;  2L4H A;  1S1E A;  4P5O E;  1LVC D;  1DEK A;  1S6I A;  3EK4 A;  5I2L A;  2LAN A;  1Y6W A;  4GGF C;  3VRR A;  1KQV A;  4A4C A;  2LMT A;  4MZL A;  1B1G A;  4DRW A;  3BFH A;  1C3Z A;  1XYD A;  4MSP A;  2PMY A;  4XJK A;  4QJ4 B;  1LA3 A;  2COL B;  2G9B A;  2Y4Q A;  3IVT A;  1IWQ A;  2CT9 A;  3CZ2 A;  4PE0 A;  4QJ5 B;  2Y1N A;  2M97 A;  1OQP A;  2O60 A;  3A4U B;  1ALW A;  3D0Y A;  4F0Z B;  1EG4 A;  2Q91 A;  2JUL A;  4N5X A;  1TIZ A;  3HX4 A;  5FI7 A;  3SS5 A;  1AP4 A;  5GQQ C;  1TCF A;  3CLN A;  2BAP A;  1XFZ O;  3NSK A;  1RTP 1;  2OPO A;  3R1V A;  1MWN A;  2I94 A;  2KGR A;  1J7R A;  5KTY A;  1F4Q A;  1OOG A;  2PVB A;  2KQ6 A;  2SAS A;  3CDN A;  3I5G C;  2F2P A;  1K9U A;  1KFX S;  5PAL A;  3S0B A;  3VGO A;  2MBX A;  1UHJ A;  2JQ6 A;  4OCI A;  4PE4 A;  2K61 A;  2D8N A;  4PT1 A;  2M1K B;  4IL1 A;  1U5I A;  1S5G Y;  5FI2 A;  1UUS A;  1NX2 A;  1WLM A;  1XFX O;  2EHB A;  2KSP A;  4DCK A;  1V1F A;  2JZI A;  4XJK B;  1DEL A;  2L0P A;  1IKU A;  1G33 A;  1K96 A;  3BQ3 A;  3BUX B;  3I5F C;  4JD9 A;  2OS8 C;  5BPJ A;  4HSZ A;  2WCF A;  1SY9 A;  3KEV A;  4CFQ A;  2MRD A;  1KK8 C;  1HQV A;  2AUC A;  4CID A;  1BR4 B;  5HL1 A;  1YVL A;  1QAT A;  3OB1 B;  1TNQ A;  3CR5 X;  3OGN A;  2HPS A;  4P2Y B;  5CSF A;  2JXL A;  4PCW A;  2MLE C;  1Y1U A;  4JQ0 D;  3PM2 A;  4TNC A;  3ICB A;  1OMD A;  2P6B B;  1ZMZ A;  3FE6 A;  3KO0 A;  1UHH A;  2KLE A;  1B47 A;  2PAL A;  4GGN A;  4M2Q A;  3BOW B;  2WC8 A;  2M3W A;  1PRW A;  2KAY A;  4M2P A;  2KBM A;  3H4S E;  4NDC A;  3TDU A;  3CZ0 A;  2HET A;  1SL7 A;  1E8A A;  1TCO B;  2BE6 A;  4MRY A;  1BG1 A;  1IQ5 A;  1PUL A;  2WOS A;  2KI4 B;  1S36 A;  1J7O A;  2LVV A;  1WDC B;  4INW A;  1OW4 A;  1ZAC A;  1CLM A;  2MHH A;  3BFA A;  1A75 B;  2KI6 D;  1GQM A;  3FWB A;  4WRI A;  5HLO A;  4INX A;  2BBM A;  5HKZ A;  1REC A;  1H8B A;  3JTD B;  3OB2 B;  1DGU A;  1BMO A;  4PE7 A;  2TN4 A;  3EVR A;  1KFX L;  2F33 A;  3WNX B;  1CFC A;  1PSR A;  1QLS A;  3A8R A;  3CS1 A;  2IS9 A;  2K2F A;  2KAX A;  5DKR A;  1GGW A;  2F3Y A;  5DKN A;  2KYC A;  2PYQ A;  3NSI A;  3TUY C;  2KGB C;  1K8U A;  1RJV A;  2JOJ A;  4MRX A;  1B4C A;  4BY5 A;  1NUB A;  1KWO C;  5D7F A;  1MHO A;  1OMR A;  1JFK A;  2FOT A;  3VB1 A;  3CZT X;  4AOM A;  1KFU S;  2LMV A;  1FPW A;  2LHI A;  1OE9 B;  1OOF A;  1OOH A;  4XYN A;  1JSA A;  1XK4 A;  1NWD A;  1B8L A;  4L9M A;  1XO5 A;  1J55 A;  1SK6 D;  1Z4H A;  1QTX A;  3DVK A;  2M1U A;  1Y1A A;  1DVI A;  3OX5 A;  4IJ7 A;  1CDN A;  4CFR A;  1R6P A;  1TRF A;  2MAZ A;  2MLF C;  2V53 A;  4YRU A;  3PLF B;  3DVE A;  1XFU O;  2B1U A;  2WND A;  1EG3 A;  5I94 A;  2L5Y A;  5AEQ A;  1IIO A;  3Q8I A;  1B7T Z;  2ZNE A;  1FI6 A;  1YVH A;  1ZOT B;  1RK9 A;  3B88 A;  2YGU A;  1J1E A;  3KHE A;  1U5I B;  4PHM A;  1NX0 A;  5B8I B;  3DZT A;  4MEW A;  1CMF A;  1DJY A;  3S0F A;  3RLZ A;  3C1V A;  2LUC A;  1TOP A;  1DT7 B;  3NSO A;  3OHM B;  4MBE A;  1N65 A;  1JFJ A;  5I2O A;  2KDH A;  4MN0 A;  4PHK A;  3L4L A;  2R2I A;  3OX6 A;  1WDC C;  2WCH A;  1CMG A;  2MA2 A;  3ZWH A;  1IJ5 A;  1S3P A;  2H61 A;  1S6J A;  5IBW A;  1TNW A;  1JC2 A;  2JRF A;  2FJY A;  3B86 A;  4FQO A;  2KI6 C;  4DIR A;  1KCY A;  1CDP A;  3SS4 A;  2NCO A;  1N2D A;  1KQM B;  1WRZ A;  2CTN A;  2JU0 A;  2P70 A;  3D77 A;  4JKT A;  3BOW A;  3SIA A;  1DJH A;  1KFU L;  3AKA A;  2K7O A;  1UHI A;  3TUY B;  2LVI A;  4JPZ B;  5KU1 A;  3FE8 A;  3AKB A;  3D10 A;  1QV1 A;  1H4B A;  5AER A;  3EKJ A;  2QEB A;  2EC6 B;  1JUO A;  1OOI X;  4GUK A;  4OVN F;  1A75 A;  2GV5 A;  3CZ1 A;  2KQY A;  3EVU A;  2BE4 A;  1NIW A;  2M9G A;  3HCM A;  3SJS A;  2L5X B;  2L4I A;  1CFF A;  2PAS A;  2WCJ A;  1DGV A;  1WRK A;  4U8D A;  3WHU B;  1SSE B;  3BYA A;  3NHT A;  3I5I C;  3S0A A;  2DOQ A;  2P71 A;  2RGI A;  3BUN B;  1CM4 A;  5G08 A;  1K95 A;  1XFV O;  4UPG A;  2KFF A;  1GJY A;  2BCB A;  1QVI Y;  1NP8 A;  1MR8 A;  3SG7 A;  3DY9 A;  4FTG A;  1UUR A;  4ORA B;  3GOF A;  4USL A;  1SR6 B;  2KNE A;  3RM1 A;  3BXK A;  1SCM C;  2LVJ A;  3TS5 B;  3I5H C;  1YX7 A;  1ORG A;  2K7C A;  3CYZ A;  3KPX A;  3V2L A;  1GM0 A;  1MQ1 A;  3D78 A;  2LUX A;  1M46 A;  3QME A;  1CLB A;  1D1O A;  2M0R A;  4I5L B;  4ZCV A;  3B7A A;  1QWV A;  3I5G B;  1YUT A;  3F45 A;  1K2H A;  2A4J A;  2NZ0 A;  3MSE B;  3K1E A;  3SS3 A;  5I8N A;  1QX7 A;  3EVV A;  3PSR A;  3EG5 B;  1ALV A;  1JF0 A;  2I7A A;  4NQG A;  1QAS A;  3PAL A;  2ZFD A;  1TWO A;  4ORB B;  3TDI A;  3I5I B;  1BJF A;  1CDL A;  1B8R A;  2QDI A;  1YRU B;  5AAN A;  1NCY A;  2ZN9 A;  1KK8 B;  4GPL B;  5CSN A;  1SBJ A;  1DJW A;  1J7Q A;  1QS7 A;  2HQ8 A;  2ZND A;  3LLE A;  2EGD A;  2KOT A;  5D3O A;  1NX1 A;  1SR6 C;  2WOR A;  4BY4 A;  1A29 A;  2JTZ A;  1F4O A;  2SCP A;  3I5H B;  4WQ2 A;  1CLL A;  4C0L A;  1JF2 A;  2M29 A;  1DQE A;  1NCZ A;  1Q80 A;  2LLT A;  2H61 C;  2O5G A;  2Q4U A;  4E68 A;  5HKY A;  1CFP A;  1QIV A;  1EJ3 A;  1NCX A;  1P28 A;  2KYF A;  2BNX A;  1A4P A;  1AUI B;  2M7N A;  2KI4 C;  3NXA A;  5F6T A;  3SIB A;  4HRG A;  3PN7 B;  1UHN A;  3O6B A;  1A03 A;  3AAK A;  1SL8 A;  4D1E A;  4YGD B;  3D74 A;  3JVT C;  4R1E A;  4YBH B;  1QJT A;  3VRQ A;  4I5N B;  1BLQ A;  3K21 A;  1TTX A;  1B8C A;  3D76 A;  4HRE E;  2E6W A;  1SL9 A;  2LCP A;  2F8P A;  2JXC A;  2LLS A;  1C07 A;  4PDZ A;  2JNF A;  2GGZ A;  1CB1 A;  1MF8 B;  4GFT A;  1A2X A;  3GK1 A;  2LHL A;  2JPO A;  1L2O B;  2BCX A;  1K9K A;  1AJ4 A;  1K90 D;  3LK1 A;  4AQJ A;  2KBI A;  5K89 A;  1M39 A;  1DJI A;  4OV2 A;  2LVK A;  3O2P A;  2M8U A;  1OMV A;  2CXJ A;  3GK2 A;  2PRU A;  5HYD A;  1MUX A;  3LL8 B;  2AAO A;  3S0G A;  2GTE A;  3ZNI A;  3B87 A;  2CNP A;  1EXR A;  3LCP C;  3D73 A;  2JNX A;  2LP3 A;  3BFB A;  1WLZ A;  2G2B A;  4AQI A;  1BU3 A;  1C7W A;  1XFR A;  1XA5 A;  1W9Z A;  3PAT A;  3R72 A;  1BT6 A;  1LKJ A;  4ORC B;  5TNC A;  1C7V A;  1DTL A;  2LMU A;  1FBV A;  3O4Y A;  3SG5 A;  5HKW A;  1FW4 A;  3PN7 C;  2WCL A;  1J1D A;  1OZS A;  3IQO A;  3DF0 A;  3JVT B;  2JPT A;  1DC1 A;  1F55 A;  3IQQ A;  3LK0 A;  3BUW B;  2ISD A;  2GGM A;  4C0J A;  1CFD A;  4ETO A;  1CKK A;  4CPV A;  3SG6 A;  1SNL A;  2QAC A;  5J3X A;  1PVA A;  1CNP A;  3OP0 A;  2NXQ A;  1DJG A;  1F8H A;  1ZFS A;  2LP2 A;  3FIA A;  1EH2 A;  4F7F A;  4DUQ A;  1SKT A;  5FI6 A;  5DIC A;  1AK8 A;  4M2O A;  1YTZ C;  2K7D A;  3WHT B;  1QX5 B;  1CTR A;  1W7J B;  3EKH A;  3IF7 A;  2AMI A;  1QVI Z;  5I2Q A;  1KK7 Z;  1DF0 A;  2L98 A;  5AFP A;  1KSO A;  4NDD A;  2K8M B; 
#chains in the Genus database with same CATH homology
 3FWC A;  2PSR A;  1BOD A;  3DF0 B;  4PAL A;  3CGA A;  4QJ3 B;  5DKQ A;  1WRL A;  1SMG A;  2LC5 A;  4HRH A;  5JOL A;  1F70 A;  2F3Z A;  1BOC A;  3NSL A;  1DJZ A;  1V1G A;  4PHJ A;  5CSI A;  1QLK A;  1SW8 A;  1UWO A;  1ZUZ A;  2LM5 A;  4YGE B;  2CCM A;  1KQM C;  5ER4 X;  2ZRT A;  3BUM B;  5FYX A;  2K2A A;  1NPQ A;  3I5F B;  2JC2 A;  2OS8 B;  4GBA A;  2I18 A;  5AXI A;  4C0K A;  1LIN A;  1JBA A;  2K7B A;  5CPV A;  1VRK A;  1XFY O;  2NCP A;  3CR4 X;  2HQW A;  4YGC B;  2BKH B;  3BUO B;  1YR5 A;  3VRP A;  1RWY A;  2ZN8 A;  1CM1 A;  3DD4 A;  1GGZ A;  1TNX A;  1M45 A;  2L51 A;  3PFV A;  4JWQ A;  3TS5 C;  1DJX A;  1TNP A;  1J7P A;  4N1G A;  1YUS A;  1SCV A;  1L7Z A;  5ER5 A;  3TZ1 A;  2JWW A;  2QPT A;  2LV7 A;  1S5G Z;  1SYM A;  1S6C A;  1BR1 B;  2JT3 A;  1OSA A;  1HT9 A;  3SG3 A;  2L50 A;  2VRG A;  1IRJ A;  3TDZ A;  1WY9 A;  1FF1 A;  2L2E A;  3CTN A;  1S26 D;  1SRA A;  2KFG A;  3JTD C;  1IJ6 A;  1K9P A;  3CWG A;  1G4Y R;  1QXP A;  4WQ3 A;  2LNK A;  1CDM A;  3DVM A;  2K0J A;  3GK4 X;  2BL0 C;  2Y1M A;  1Y1X A;  1PVB A;  4MZJ A;  4Q04 A;  2BBN A;  1AVS A;  1AJ5 A;  1IG5 A;  2CBL A;  3VRO A;  1KWO B;  3EK8 A;  4CLN A;  1G8I A;  2JT0 A;  1OOJ A;  2H2K A;  3EK7 A;  4I5J A;  1QX2 A;  4MZK A;  3SG2 A;  3CR2 A;  4NDB A;  2KAV A;  4OKH A;  4MVF A;  1F71 A;  2FCD A;  1R2U A;  3M0W A;  3WXA A;  1LA0 A;  1EL4 A;  1K93 D;  1DF0 B;  1X02 A;  2KFH A;  4A4B A;  1IQ3 A;  1XFW O;  4PE1 A;  1YUR A;  1TN4 A;  2FCE A;  1UP5 A;  2KHN A;  1XVJ A;  2BKI B;  4ICB A;  4YI9 A;  1DMO A;  1LXF C;  1XK4 C;  1YX8 A;  3FS7 A;  5D69 A;  1F54 A;  5CSJ A;  4YGB B;  1N0Y A;  2LAP A;  3PM8 A;  4N1F A;  1PAL A;  1RFJ A;  2OTG C;  1M63 B;  1IH0 A;  4YGA A;  2ZRS A;  1KSM A;  1M31 A;  4PHN A;  2FJU B;  2NLN A;  1KK7 Y;  2MJW B;  2WCE A;  3E3R A;  4MLW A;  5JJG A;  2I2R E;  1IGV A;  1YUU A;  3AAJ A;  1BF5 A;  2JTT A;  1FI5 A;  3SG4 A;  1JWD A;  1NX3 A;  4OR9 B;  2ZKM X;  3VRN A;  1QV0 A;  1ODB A;  2BCA A;  2M7L A;  1QIW A;  1W7I B;  2JT8 A;  3DVJ A;  3O78 A;  5HLV A;  4YI8 A;  1PK0 D;  2E30 A;  4I5K A;  1MXE A;  4GNK B;  1B7T Y;  3QRX A;  1K94 A;  2HF5 A;  2BL0 B;  4DS7 A;  2LE9 B;  3D0Y B;  2M49 B;  1NSH A;  1Y0V H;  2LLU A;  1SPY A;  1PSB A;  4ZCU A;  1RRO A;  1L2O C;  3KF9 A;  2WCB A;  1AHR A;  2EC6 C;  1OZO A;  4GGF A;  5KSZ A;  2OTG B;  1YRT B;  2Y5I A;  1NYA A;  4GAO A;  2F2O A;  1B9A A;  1UHK A;  2BEC A;  1SCM B;  1MXL C;  2L4H A;  1S1E A;  4P5O E;  1LVC D;  1S6I A;  3EK4 A;  5I2L A;  2LAN A;  1Y6W A;  4GGF C;  3VRR A;  1KQV A;  4A4C A;  2LMT A;  4MZL A;  1B1G A;  4DRW A;  1XYD A;  4MSP A;  2PMY A;  4XJK A;  4QJ4 B;  1LA3 A;  2COL B;  2G9B A;  2Y4Q A;  1IWQ A;  2CT9 A;  4QJ5 B;  4PE0 A;  2Y1N A;  2M97 A;  1OQP A;  2O60 A;  3A4U B;  1ALW A;  3D0Y A;  4F0Z B;  1EG4 A;  2Q91 A;  2JUL A;  4N5X A;  1TIZ A;  3HX4 A;  1AP4 A;  5GQQ C;  1TCF A;  3CLN A;  1XFZ O;  3NSK A;  1RTP 1;  2OPO A;  5KTY A;  1MWN A;  2I94 A;  2KGR A;  1J7R A;  1F4Q A;  2PVB A;  2KQ6 A;  2SAS A;  3I5G C;  5PAL A;  2F2P A;  1K9U A;  1KFX S;  3VGO A;  2MBX A;  1UHJ A;  2JQ6 A;  4OCI A;  4PE4 A;  2K61 A;  2D8N A;  2M1K B;  4IL1 A;  1U5I A;  1S5G Y;  1UUS A;  1NX2 A;  1WLM A;  1XFX O;  2EHB A;  2KSP A;  4DCK A;  1V1F A;  2JZI A;  4XJK B;  2L0P A;  1IKU A;  1G33 A;  1K96 A;  3BQ3 A;  3BUX B;  3I5F C;  5BPJ A;  2OS8 C;  4HSZ A;  2WCF A;  1SY9 A;  3KEV A;  4CFQ A;  2MRD A;  1KK8 C;  1HQV A;  2AUC A;  4CID A;  1BR4 B;  1YVL A;  1QAT A;  3OB1 B;  1TNQ A;  3CR5 X;  2HPS A;  4P2Y B;  5CSF A;  2JXL A;  4PCW A;  2MLE C;  1Y1U A;  4JQ0 D;  4TNC A;  3ICB A;  1OMD A;  2P6B B;  1ZMZ A;  3KO0 A;  1UHH A;  1B47 A;  2PAL A;  4GGN A;  4M2Q A;  3BOW B;  2WC8 A;  2M3W A;  1PRW A;  2KAY A;  4M2P A;  2KBM A;  3H4S E;  4NDC A;  3TDU A;  2HET A;  1SL7 A;  1E8A A;  1TCO B;  2BE6 A;  4MRY A;  1BG1 A;  1IQ5 A;  1PUL A;  2WOS A;  2KI4 B;  1S36 A;  1J7O A;  2LVV A;  1WDC B;  1ZAC A;  1CLM A;  2MHH A;  1A75 B;  2KI6 D;  1GQM A;  3FWB A;  4WRI A;  5HLO A;  5HKZ A;  2BBM A;  1H8B A;  1REC A;  3JTD B;  3OB2 B;  1DGU A;  1BMO A;  4PE7 A;  2TN4 A;  3EVR A;  1KFX L;  2F33 A;  3WNX B;  1CFC A;  1PSR A;  1QLS A;  3A8R A;  3CS1 A;  2IS9 A;  2K2F A;  2KAX A;  5DKR A;  1GGW A;  2F3Y A;  5DKN A;  2KYC A;  3NSI A;  3TUY C;  2KGB C;  1K8U A;  1RJV A;  2JOJ A;  4MRX A;  1B4C A;  4BY5 A;  1NUB A;  1KWO C;  5D7F A;  1MHO A;  1OMR A;  1JFK A;  2FOT A;  4AOM A;  3CZT X;  1KFU S;  2LMV A;  1FPW A;  2LHI A;  1OE9 B;  4XYN A;  1JSA A;  1XK4 A;  1NWD A;  1B8L A;  4L9M A;  1XO5 A;  1J55 A;  1SK6 D;  1QTX A;  3DVK A;  2M1U A;  1Y1A A;  1DVI A;  3OX5 A;  1CDN A;  4CFR A;  1R6P A;  1TRF A;  2MAZ A;  2MLF C;  2V53 A;  4YRU A;  3PLF B;  3DVE A;  1XFU O;  2B1U A;  2WND A;  1EG3 A;  5AEQ A;  1B7T Z;  2ZNE A;  1FI6 A;  1YVH A;  1ZOT B;  1RK9 A;  3KHE A;  1J1E A;  1U5I B;  4PHM A;  1NX0 A;  5B8I B;  4MEW A;  1CMF A;  1DJY A;  3RLZ A;  3C1V A;  2LUC A;  1TOP A;  1DT7 B;  3NSO A;  3OHM B;  4MBE A;  1N65 A;  1JFJ A;  5I2O A;  2KDH A;  4MN0 A;  4PHK A;  2R2I A;  3OX6 A;  1WDC C;  1CMG A;  2MA2 A;  3ZWH A;  1IJ5 A;  1S3P A;  2H61 A;  1S6J A;  5IBW A;  1TNW A;  1JC2 A;  2JRF A;  4FQO A;  2KI6 C;  4DIR A;  1KCY A;  1CDP A;  2NCO A;  1N2D A;  1KQM B;  1WRZ A;  2CTN A;  2JU0 A;  3BOW A;  3SIA A;  1DJH A;  1KFU L;  3AKA A;  2K7O A;  1UHI A;  3TUY B;  2LVI A;  4JPZ B;  5KU1 A;  3AKB A;  3D10 A;  1QV1 A;  1H4B A;  5AER A;  3EKJ A;  2EC6 B;  1JUO A;  4GUK A;  4OVN F;  1A75 A;  2GV5 A;  2KQY A;  3EVU A;  2BE4 A;  1NIW A;  2M9G A;  3HCM A;  3SJS A;  2L5X B;  2L4I A;  1CFF A;  2PAS A;  1DGV A;  1WRK A;  4U8D A;  3WHU B;  3BYA A;  3I5I C;  2DOQ A;  2RGI A;  3BUN B;  1CM4 A;  5G08 A;  1K95 A;  1XFV O;  4UPG A;  2KFF A;  1GJY A;  2BCB A;  1QVI Y;  1NP8 A;  1MR8 A;  3SG7 A;  4FTG A;  1UUR A;  4ORA B;  3GOF A;  4USL A;  1SR6 B;  2KNE A;  3RM1 A;  3BXK A;  1SCM C;  2LVJ A;  3TS5 B;  3I5H C;  1YX7 A;  2K7C A;  3KPX A;  1MQ1 A;  2LUX A;  1M46 A;  1CLB A;  1D1O A;  2M0R A;  4I5L B;  4ZCV A;  3I5G B;  1YUT A;  3F45 A;  1K2H A;  2A4J A;  2NZ0 A;  3MSE B;  5I8N A;  1QX7 A;  3EVV A;  3PSR A;  1ALV A;  1JF0 A;  2I7A A;  4NQG A;  1QAS A;  3PAL A;  2ZFD A;  4ORB B;  3TDI A;  3I5I B;  1BJF A;  1CDL A;  1B8R A;  1YRU B;  5AAN A;  1NCY A;  2ZN9 A;  1KK8 B;  4GPL B;  5CSN A;  1SBJ A;  1DJW A;  1J7Q A;  1QS7 A;  2HQ8 A;  2ZND A;  3LLE A;  2EGD A;  2KOT A;  1NX1 A;  1SR6 C;  2WOR A;  4BY4 A;  1A29 A;  2JTZ A;  1F4O A;  2SCP A;  3I5H B;  4WQ2 A;  1CLL A;  4C0L A;  1JF2 A;  2M29 A;  2LLT A;  1NCZ A;  1Q80 A;  2O5G A;  2H61 C;  2Q4U A;  4E68 A;  5HKY A;  1CFP A;  1QIV A;  1EJ3 A;  1NCX A;  2KYF A;  1A4P A;  1AUI B;  2M7N A;  2KI4 C;  3NXA A;  5F6T A;  3SIB A;  4HRG A;  3PN7 B;  1UHN A;  3O6B A;  1A03 A;  3AAK A;  1SL8 A;  4D1E A;  4YGD B;  3JVT C;  4R1E A;  4YBH B;  1QJT A;  3VRQ A;  4I5N B;  1BLQ A;  3K21 A;  1TTX A;  1B8C A;  4HRE E;  2E6W A;  1SL9 A;  2LCP A;  2F8P A;  2JXC A;  2LLS A;  1C07 A;  4PDZ A;  2JNF A;  2GGZ A;  1CB1 A;  1MF8 B;  4GFT A;  1A2X A;  3GK1 A;  2LHL A;  1L2O B;  2BCX A;  1K9K A;  1AJ4 A;  1K90 D;  3LK1 A;  4AQJ A;  2KBI A;  5K89 A;  1M39 A;  1DJI A;  4OV2 A;  2LVK A;  3O2P A;  2M8U A;  1OMV A;  2CXJ A;  3GK2 A;  2PRU A;  5HYD A;  1MUX A;  3LL8 B;  2AAO A;  3ZNI A;  2CNP A;  1EXR A;  3LCP C;  2JNX A;  2LP3 A;  1WLZ A;  2G2B A;  4AQI A;  1BU3 A;  1C7W A;  1XA5 A;  3PAT A;  1BT6 A;  1LKJ A;  4ORC B;  5TNC A;  1C7V A;  1DTL A;  2LMU A;  1FBV A;  3O4Y A;  3SG5 A;  5HKW A;  1FW4 A;  3PN7 C;  1J1D A;  1OZS A;  3IQO A;  3DF0 A;  3JVT B;  2JPT A;  1F55 A;  3IQQ A;  3LK0 A;  3BUW B;  2ISD A;  2GGM A;  4C0J A;  1CFD A;  4ETO A;  1CKK A;  4CPV A;  3SG6 A;  1SNL A;  2QAC A;  5J3X A;  1PVA A;  1CNP A;  3OP0 A;  2NXQ A;  1DJG A;  1F8H A;  1ZFS A;  2LP2 A;  3FIA A;  1EH2 A;  4DUQ A;  1SKT A;  1AK8 A;  4M2O A;  1YTZ C;  2K7D A;  3WHT B;  1QX5 B;  1CTR A;  1W7J B;  3EKH A;  3IF7 A;  2AMI A;  1QVI Z;  5I2Q A;  1KK7 Z;  1DF0 A;  2L98 A;  5AFP A;  1KSO A;  4NDD A;  2K8M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...