1IRJA

Crystal structure of the mrp14 complexed with chaps
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
85
structure length
85
Chain Sequence
TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Migration Inhibitory Factor-Related Protein 14
publication title The crystal structure of human MRP14 (S100A9), a Ca(2+)-dependent regulator protein in inflammatory process.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 33
structure length 85
sequence length 85
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2001-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1irjA00
1IQ5A 1Y1XA 2KAVA 2KI4C 3EVUA 1ODBA 1DF0B 1OQPA 3OX5A 4YGDB 2EC6B 4DS7A 4MEWA 2FCDA 3SJSA 4GPLB 2H2KA 1OMVA 1KQMC 5AFPA 1L7ZA 4XJKB 2Y5IA 1DT7B 2OS8B 1Q80A 1UHKA 2M8UA 3CS1A 4XYNA 1GQMA 4YRUA 1NIWA 1RROA 3A8RA 1SW8A 1XFVO 2AMIA 3GK1A 1L2OB 1BJFA 4N1FA 4DUQA 1CMGA 4ZCVA 3IQQA 1FF1A 2MBXA 2BL0C 3TUYB 3QRXA 1F8HA 1S6IA 1JSAA 2KYCA 3EK8A 1JFJA 2PVBA 3I5FB 4NDCA 4JPZB 2LCPA 1NCXA 1AK8A 2K2AA 1WLZA 2EHBA 1B4CA 1D1OA 1OE9B 2WC8A 5CSNA 1PRWA 1SPYA 3D10A 4M2PA 3CTNA 2M7NA 4QJ4B 1XFZO 1DGVA 1C7VA 1A4PA 1S6JA 4PCWA 3CR4X 3OP0A 2R2IA 3DVKA 3VRQA 1QS7A 5AERA 1QATA 1UHJA 3ZWHA 4AQIA 4CFQA 3O4YA 4YI9A 4WQ2A 1BT6A 1DMOA 2KYFA 3AAJA 1XVJA 2H61A 4OR9B 1M46A 2B1UA 2E6WA 2ZNEA 1ALWA 1A03A 1FI5A 3KHEA 4BY5A 5D7FA 3PM8A 2CT9A 2OTGB 4Q04A 2KQYA 4GFTA 1EG4A 3TDUA 2JTZA 2L98A 3JVTC 1AJ4A 3WNXB 5AEQA 5JOLA 1B8LA 3TZ1A 2LE9B 3PALA 1SCVA 1SMGA 1XA5A 2AAOA 4GGNA 4YI8A 1UHIA 2JRFA 1KWOC 2LHIA 5CSJA 4YGCB 1CFFA 3D0YB 1HQVA 2WNDA 2MLEC 3HCMA 2MJWB 4C0JA 4MZJA 2LLTA 1QJTA 1B7TZ 2D8NA 3WHUB 1BG1A 2ZFDA 1XFWO 1CLMA 2BBNA 2MA2A 4YGBB 1AVSA 2KAXA 1MHOA 3FIAA 5GQQC 2JTTA 2LLSA 2WCBA 1PK0D 2HF5A 1YRUB 2JT3A 2I7AA 1S5GZ 1PVAA 2BCAA 3I5IC 2KFFA 2BE6A 2F3ZA 1W7JB 2WOSA 1G4YR 2JT8A 5CSIA 2JOJA 1CLBA 3LCPC 1A75A 4R1EA 5I2QA 1KFXL 3TS5C 4ETOA 1J1DA 1M45A 2MLFC 3M0WA 2JC2A 1X02A 1YUTA 2KDHA 3BQ3A 4I5NB 4QJ3B 3BUNB 3SIAA 1ZFSA 3VRNA 1DJIA 1A29A 1OSAA 4CPVA 4P5OE 1QLSA 2GGZA 4MLWA 2OS8C 2O60A 5J3XA 1YVHA 4CLNA 1GGWA 1KSMA 1NPQA 2L50A 2WORA 5DKNA 1K2HA 1N2DA 1ZMZA 2L4HA 2LANA 2JULA 4AOMA 2P6BB 3DF0A 3PN7B 4GAOA 3IF7A 2F2PA 1MWNA 4MVFA 4E68A 1Y6WA 2KI6C 3JTDB 2ZKMX 4PE0A 1C7WA 1F4OA 1JUOA 1SL8A 2JNXA 3BUWB 1YRTB 4U8DA 3O6BA 3TUYC 2LNKA 1DJXA 1NWDA 1J7PA 4QJ5B 2L2EA 1U5IB 1XFUO 2KHNA 5D69A 1B47A 1F4QA 1M39A 2CNPA 2LUCA 3GOFA 1QTXA 4I5JA 1KK7Y 1TN4A 4F0ZB 1DTLA 3I5HC 3DVJA 1SRAA 1EG3A 4PHJA 3PFVA 1RTP1 3DVMA 4JQ0D 1KFXS 2M9GA 3NSKA 2PASA 2LVVA 4A4BA 1NCYA 1J7QA 1R2UA 1CM1A 3I5GB 1RWYA 1NX1A 1N0YA 2EGDA 1R6PA 1J1EA 2F33A 1M63B 1SNLA 1YR5A 1DGUA 1YURA 5B8IB 1A75B 4HSZA 1WLMA 2JWWA 1KSOA 2LV7A 4PALA 1CFDA 1ZUZA 2LP3A 1YUSA 3D0YA 1XK4A 2MRDA 1ZACA 4PE4A 4ICBA 4MRYA 2MHHA 1QV1A 1TCFA 2OTGC 1AHRA 2NZ0A 2WCFA 5BPJA 2OPOA 1XYDA 2KNEA 2LMTA 3K21A 3BUOB 1H8BA 1OOJA 2LHLA 1CNPA 1PVBA 1SR6C 2KGBC 4BY4A 1OMRA 1QVIY 3DF0B 1KFUL 1S3PA 4UPGA 1QASA 3KPXA 1WRKA 2TN4A 1E8AA 1B9AA 3AAKA 4HRGA 1MXLC 2M1KB 1SCMB 1W7IB 1UUSA 2FOTA 3E3RA 1J7RA 2LLUA 2LVIA 2VRGA 2L4IA 1S1EA 4IL1A 4GNKB 1IH0A 1DJWA 4PHMA 3FS7A 1MUXA 4ORAB 1DJGA 4GGFA 4MN0A 2Q4UA 2BCXA 4PDZA 2M29A 1KCYA 1LVCD 1TNXA 2K8MB 4AQJA 2G2BA 4DCKA 3RLZA 2BL0B 2CXJA 1FBVA 2WCEA 1NYAA 1U5IA 2H61C 5ER4X 2KSPA 1EL4A 3NSLA 1CFCA 3GK2A 2Y1NA 5JJGA 3O2PA 1SYMA 3SG3A 2BECA 1WRZA 1KFUS 2HETA 1TNPA 2ZN9A 1KK8C 1SKTA 1RJVA 4NDBA 5I8NA 4MBEA 5ER5A 1SK6D 1LXFC 2Y1MA 1DJHA 2O5GA 2FJUB 2JXLA 1MXEA 1OZOA 2JXCA 1CTRA 2K7OA 4PHKA 1IJ5A 3JTDC 1BOCA 5G08A 4CFRA 1OMDA 1Y1AA 1LA0A 2BKIB 2M3WA 3EK7A 2LMVA 1K8UA 1SBJA 4PE1A 5F6TA 3KEVA 5K89A 4ORBB 5DKQA 5HKYA 3NSIA 2A4JA 1MQ1A 4TNCA 4DRWA 1S36A 1GGZA 3ICBA 2EC6C 1RFJA 2V53A 2NCOA 3DD4A 1QIVA 3OHMB 1CKKA 2M97A 5I2LA 1K96A 5IBWA 1XFXO 3JVTB 1NSHA 1BODA 2K7CA 1UP5A 1G8IA 4WQ3A 1EJ3A 1DJYA 1TIZA 1Y1UA 4N1GA 1EH2A 2F2OA 1L2OC 4YGAA 2HPSA 1QV0A 2HQ8A 1JWDA 4WRIA 2COLB 3SG5A 4JWQA 1SL7A 2MAZA 5AANA 1NX0A 4N5XA 2K0JA 3VGOA 3I5FC 1AJ5A 1Y0VH 3TDZA 1DJZA 1K90D 1CDMA 5AXIA 3AKAA 4P2YB 1CFPA 1G33A 1WDCB 4MRXA 5HLOA 2GV5A 3VROA 1B1GA 1K94A 3FWCA 1NX2A 1CM4A 2JT0A 1PALA 5CSFA 3SIBA 1ALVA 4MZKA 2K61A 1A2XA 1QIWA 2KAYA 2ZN8A 1BR4B 3PLFB 4FQOA 4GBAA 5CPVA 1S5GY 2F8PA 2AUCA 2JPTA 1UHHA 1TNQA 4ZCUA 4C0LA 3H4SE 3TS5B 3CR5X 1K9PA 2E30A 4HRHA 3LL8B 2IS9A 1B8CA 1GJYA 1PSBA 2DOQA 2KGRA 1QX2A 2FCEA 2HQWA 2LUXA 1K9UA 2M1UA 2NCPA 2QPTA 3OB1B 1JC2A 1F55A 3LK1A 3AKBA 1MF8B 3HX4A 1QXPA 2ISDA 3BUXB 4C0KA 2KBIA 3FWBA 3EVVA 1KQVA 3WHTB 1VRKA 4PE7A 5KU1A 3CWGA 2F3YA 2PMYA 1IWQA 1XO5A 1YVLA 1M31A 1YUUA 1UHNA 3IQOA 2QACA 3DVEA 2RGIA 1PSRA 2G9BA 2KI4B 1XK4C 1LA3A 3I5HB 4D1EA 1BR1B 3EKHA 2SASA 2SCPA 3MSEB 1KQMB 3BOWA 1RK9A 2K7DA 1CDPA 5I2OA 4OKHA 3SG6A 1IGVA 5PALA 1S6CA 2I18A 2KQ6A 2LMUA 1OZSA 2LM5A 1CB1A 4MZLA 4OV2A 3SG4A 1FI6A 2PALA 2M0RA 1CDLA 5KSZA 1BU3A 1NX3A 1RECA 1XFYO 3VRPA 1V1FA 3CR2A 1IQ3A 1C07A 3NSOA 3EVRA 3EKJA 1FW4A 2I94A 1YX8A 2GGMA 4M2OA 3TDIA 4NDDA 1YX7A 2ZRTA 1BF5A 2K2FA 1F54A 4I5LB 2BE4A 5HKZA 4USLA 3A4UB 1IG5A 3ZNIA 1J7OA 5TNCA 1UWOA 4GGFC 1AP4A 1SR6B 3VRRA 1TOPA 3PN7C 4YGEB 1QX5B 1S26D 3LK0A 3CZTX 1WY9A 4NQGA 1KK7Z 1AUIB 1SY9A 1TCOB 4YBHB 2KOTA 2M49B 1CLLA 1EXRA 3KF9A 1TNWA 1JFKA 1K9KA 2CTNA 3KO0A 3O78A 1SL9A 2CCMA 1DF0A 4A4CA 4CIDA 2PRUA 1DVIA 1QLKA 4DIRA 4MSPA 1WDCC 3SG7A 4XJKA 1N65A 1F71A 3BOWB 5KTYA 2JU0A 1NCZA 1F70A 1LINA 1ZOTB 4L9MA 4ORCB 1H4BA 3I5GC 2LVKA 4HREE 3BUMB 3BYAA 2BKHB 2BBMA 1NUBA 1V1GA 3RM1A 2L0PA 1QX7A 4GUKA 1PULA 2KFGA 3F45A 5FYXA 1TTXA 2KBMA 3NXAA 2LVJA 3LLEA 1KWOB 1MR8A 1YTZC 2LAPA 3OB2B 4FTGA 3SG2A 1FPWA 1NP8A 4M2QA 2CBLA 2M7LA 3CGAA 1LKJA 2JZIA 1K95A 2PSRA 3EK4A 1TRFA 3PSRA 1IRJA 2KI6D 1KK8B 4OVNF 1JBAA 2KFHA 4PHNA 2I2RE 1QVIZ 1J55A 2JNFA 2K7BA 1CDNA 1WRLA 2L5XB 3GK4X 1JF0A 1IKUA 4I5KA 1B8RA 2ZNDA 1CMFA 5HYDA 1BLQA 1B7TY 5HLVA 2JQ6A 2L51A 3WXAA 3I5IB 2ZRSA 3CLNA 5HKWA 1UURA 1K93D 3OX6A 3PATA 1IJ6A 2NXQA 1BMOA 3BXKA 2NLNA 3C1VA 2LP2A 2BCBA 2LC5A 5DKRA 1HT9A 2Q91A 4OCIA 1SCMC 2Y4QA 1JF2A
chains in the Genus database with same CATH superfamily
1IQ5A 1Y1XA 2KAVA 2KI4C 3EVUA 1ODBA 1DF0B 1OQPA 3OX5A 4YGDB 2EC6B 4DS7A 4MEWA 2FCDA 3SJSA 4GPLB 2H2KA 1OMVA 1KQMC 5AFPA 1L7ZA 4XJKB 2Y5IA 1DT7B 2L5YA 2OS8B 1Q80A 1UHKA 4JKTA 2M8UA 3CS1A 4F7FA 4XYNA 1GQMA 4YRUA 1NIWA 1RROA 3A8RA 3L47A 1SW8A 1XFVO 2AMIA 3GK1A 1L2OB 1BJFA 4N1FA 4DUQA 1CMGA 4ZCVA 2P71A 3IQQA 1FF1A 2MBXA 2BL0C 3TUYB 3QRXA 1F8HA 1S6IA 1JSAA 2KYCA 3EK8A 3UNWA 1JFJA 2PVBA 3I5FB 4NDCA 4JPZB 2LCPA 1NCXA 1AK8A 2K2AA 1WLZA 2EHBA 1B4CA 1D1OA 1OE9B 2WC8A 5CSNA 1PRWA 1SPYA 3D10A 4M2PA 3CTNA 2M7NA 4QJ4B 4OZDA 1XFZO 1DGVA 1C7VA 1A4PA 1S6JA 4PCWA 3CR4X 3OP0A 2R2IA 3DVKA 3VRQA 1QS7A 1TUZA 5AERA 1QATA 1UHJA 2H8VA 3ZWHA 4AQIA 4CFQA 3O4YA 4YI9A 4WQ2A 1BT6A 3S0BA 3B6XA 1DMOA 2KYFA 3AAJA 1XVJA 2H61A 4OR9B 1M46A 2BNXA 3RZSA 2B1UA 2E6WA 2ZNEA 3S0DA 1ALWA 1A03A 3CABA 1FI5A 3KHEA 4BY5A 5D7FA 3PM8A 2CT9A 2OTGB 2QEVA 4Q04A 2KQYA 4GFTA 1EG4A 3TDUA 2JTZA 1QWVA 2L98A 1AJ4A 3JVTC 3S0EA 3WNXB 5AEQA 5JOLA 1B8LA 4INXA 3TZ1A 2LE9B 3PALA 1SCVA 1SMGA 1XA5A 2L2CA 3S0GA 2AAOA 4GGNA 4YI8A 1UHIA 2JRFA 1KWOC 1ORGA 2LHIA 5CSJA 4YGCB 1CFFA 3D0YB 1HQVA 2WNDA 2JPOA 2MLEC 3HCMA 2MJWB 2QEBA 4C0JA 4MZJA 2LLTA 1QJTA 1B7TZ 2D8NA 3WHUB 1BG1A 2ZFDA 1XFWO 1CLMA 2BBNA 2MA2A 4YGBB 1AVSA 2KAXA 1MHOA 3FIAA 5GQQC 2JTTA 2LLSA 2WCBA 1PK0D 2HF5A 1YRUB 2JT3A 2WC6A 2I7AA 1S5GZ 1PVAA 2BCAA 3I5IC 2KFFA 2BE6A 2F3ZA 1W7JB 2WOSA 1G4YR 2JT8A 5CSIA 5EL2A 2JOJA 1CLBA 3LCPC 1A75A 4R1EA 5I2QA 1KFXL 3TS5C 4ETOA 1J1DA 1M45A 2MLFC 3BFBA 2JC2A 1X02A 1YUTA 2KDHA 3BQ3A 3M0WA 4I5NB 4QJ3B 3BUNB 3SIAA 1ZFSA 2K60A 3VRNA 3IVTA 1DJIA 1A29A 1OSAA 4CPVA 4P5OE 5I94A 1QLSA 2GGZA 4MLWA 2OS8C 2O60A 5J3XA 1YVHA 2KLEA 4CLNA 1GGWA 1KSMA 1NPQA 2L50A 2WORA 5DKNA 1K2HA 3D74A 1N2DA 2WCJA 1ZMZA 2L4HA 2LANA 2JULA 4AOMA 2P6BB 3DF0A 3PN7B 4GAOA 3IF7A 2F2PA 1MWNA 4MVFA 4E68A 1Y6WA 2KI6C 3JTDB 2ZKMX 4PE0A 1C7WA 1F4OA 2WCMA 1JUOA 1SL8A 2JNXA 3BUWB 1YRTB 4U8DA 3O6BA 3R1PA 2LNKA 3TUYC 1DJXA 1NWDA 1J7PA 4QJ5B 2L2EA 1U5IB 1XFUO 2KHNA 5D69A 1C3YA 1B47A 1F4QA 1M39A 2CNPA 2LUCA 3GOFA 1QTXA 4I5JA 1KK7Y 1TN4A 4F0ZB 1DTLA 3I5HC 3DVJA 1SRAA 1EG3A 4PHJA 3PFVA 1RTP1 3DVMA 4JQ0D 1IIOA 1KFXS 3S0AA 2M9GA 3NSKA 2PASA 2LVVA 3SS4A 3QMEA 3R1VA 4A4BA 1GM0A 1NCYA 1J7QA 1R2UA 1CM1A 3I5GB 1RWYA 1NX1A 1N0YA 2EGDA 1R6PA 3FE6A 1J1EA 2F33A 1M63B 1SNLA 1YR5A 1DGUA 1YURA 3D75A 3SS3A 5B8IB 1A75B 4HSZA 1WLMA 2JWWA 1KSOA 2LV7A 4PALA 1CFDA 1ZUZA 2LP3A 2QEOA 1Z4HA 1YUSA 3D0YA 1XK4A 2MRDA 1ZACA 4PE4A 4ICBA 4MRYA 2MHHA 1QV1A 3L4AA 1TCFA 5HL1A 2OTGC 1AHRA 2NZ0A 2WCFA 3B86A 5BPJA 2OPOA 1DQEA 1XYDA 2KNEA 2LMTA 3K21A 1OOGA 2YGUA 3BUOB 1OOJA 1H8BA 2LHLA 4JD9A 1CNPA 1PVBA 1SR6C 2KGBC 4BY4A 1OMRA 1QVIY 3DF0B 1KFUL 1S3PA 4UPGA 1QASA 3KPXA 1WRKA 2TN4A 1E8AA 1B9AA 3AAKA 1OOFA 3CDNA 1C3ZA 4HRGA 2KPHA 1MXLC 2M1KB 1SCMB 1W7IB 3D77A 3DZTA 1UUSA 2FOTA 3E3RA 1J7RA 4INWA 2LLUA 3B7AA 2LVIA 2QEHA 2VRGA 2L4IA 1S1EA 5CPVA 4IL1A 4GNKB 3FE9A 2QDIA 1IH0A 1T14A 1DJWA 4PHMA 3FS7A 1MUXA 4ORAB 1DJGA 4GGFA 3NGVA 4MN0A 2Q4UA 2BCXA 4PDZA 2M29A 1KCYA 1LVCD 2WCHA 1TNXA 2K8MB 3PJIA 4AQJA 2G2BA 4DCKA 3RLZA 2BL0B 2CXJA 1FBVA 2WCEA 1NYAA 1U5IA 2H61C 5ER4X 2KSPA 1EL4A 3NSLA 1CFCA 3GK2A 3D76A 2Y1NA 5JJGA 3O2PA 1SYMA 2WC5A 2BECA 3BFHA 1WRZA 1KFUS 3SG3A 2HETA 1TNPA 2ZN9A 1KK8C 1SKTA 1RJVA 4NDBA 5FI7A 5I8NA 4MBEA 4KYNA 5ER5A 1SK6D 1LXFC 2Y1MA 1DJHA 2O5GA 2FJUB 2JXLA 3EG5B 1MXEA 1OZOA 2JXCA 1CTRA 2K7OA 4PHKA 1IJ5A 3JTDC 1BOCA 3BJHA 5G08A 4CFRA 1OMDA 1Y1AA 1LA0A 2BKIB 2M3WA 3EK7A 2LMVA 1K8UA 1SBJA 4PE1A 5F6TA 1LS8A 2FJYA 3KEVA 5K89A 4ORBB 3PM2A 1XFRA 5DKQA 5HKYA 3NSIA 2A4JA 1MQ1A 4TNCA 4DRWA 1S36A 1GGZA 3ICBA 2EC6C 1RFJA 2V53A 2NCOA 3DD4A 1QIVA 3OHMB 1CKKA 2M97A 5I2LA 1K96A 5IBWA 3NHTA 1XFXO 3JVTB 1NSHA 1BODA 2K7CA 1UP5A 1G8IA 4WQ3A 1EJ3A 1DJYA 1TIZA 1Y1UA 4N1GA 1EH2A 5FI2A 2F2OA 1L2OC 4YGAA 2HPSA 1QV0A 2HQ8A 1JWDA 1Z2CB 4WRIA 2COLB 3SG5A 4JWQA 1SL7A 2MAZA 5AANA 1NX0A 4N5XA 2K0JA 3VGOA 3I5FC 1AJ5A 1Y0VH 3TDZA 1DJZA 1K90D 1CDMA 5AXIA 3S0FA 3AKAA 4P2YB 1CFPA 1G33A 1WDCB 2WCKA 2PQLA 4MRXA 3Q8IA 5HLOA 2GV5A 3VROA 1DEKA 1B1GA 1K94A 3FWCA 1NX2A 1CM4A 2JT0A 3N7HA 1PALA 5CSFA 3SIBA 1OOHA 2ERBA 3OBVA 1ALVA 4MZKA 2K61A 1A2XA 1QIWA 2KAYA 2ZN8A 1BR4B 3B88A 3PLFB 4FQOA 2GTEA 1S5GY 2F8PA 2AUCA 2JPTA 1UHHA 1TNQA 4GBAA 4ZCUA 4C0LA 3H4SE 3TS5B 3CR5X 1K9PA 2E30A 4HRHA 3LL8B 2IS9A 1P28A 1B8CA 1GJYA 3CZ2A 3B87A 1PSBA 2DOQA 2KGRA 1QX2A 3OGNA 3D73A 2FCEA 2HQWA 2LUXA 1K9UA 2M1UA 2NCPA 2QPTA 3OB1B 1JC2A 1F55A 3LK1A 3AKBA 1MF8B 3HX4A 3R1OA 1QXPA 2ISDA 3BUXB 4C0KA 2KBIA 3FWBA 3EVVA 1KQVA 3WHTB 1VRKA 4PE7A 5KU1A 3CWGA 2F3YA 2PMYA 1IWQA 1XO5A 3K1EA 1YVLA 1M31A 1YUUA 1UHNA 3IQOA 2QACA 3DVEA 2RGIA 1PSRA 2G9BA 2KI4B 1XK4C 1LA3A 3I5HB 4D1EA 1BR1B 3EKHA 2SASA 2SCPA 3MSEB 1DELA 1KQMB 3BOWA 3FE8A 3SS5A 1RK9A 1TWOA 2K7DA 1CDPA 5I2OA 4OKHA 3SG6A 1IGVA 5PALA 1S6CA 2I18A 2KQ6A 2LMUA 1OZSA 2LM5A 1CB1A 4MZLA 5DICA 4OV2A 3SG4A 1FI6A 2PALA 2M0RA 1CDLA 5KSZA 1BU3A 1NX3A 1RECA 1XFYO 3CYZA 3VRPA 3UO9A 1V1FA 3CR2A 1IQ3A 1C07A 3NSOA 3V2LA 3EVRA 3EKJA 1FW4A 2I94A 4IJ7A 1YX8A 3R72A 1OW4A 1W9ZA 2GGMA 4M2OA 3TDIA 4NDDA 1YX7A 2ZRTA 1BF5A 2K2FA 1F54A 4I5LB 2BE4A 5HKZA 2P70A 4USLA 3A4UB 3CZ1A 1IG5A 3ZNIA 1J7OA 5TNCA 1UWOA 4GGFC 1AP4A 1SR6B 3VRRA 4FQTA 1TOPA 3PN7C 4YGEB 1QX5B 1S26D 3LK0A 3CZTX 1WY9A 1DC1A 4NQGA 1KK7Z 1AUIB 1SY9A 1TCOB 2WCLA 4YBHB 2KOTA 3L4LA 3CZ0A 2M49B 1CLLA 2BAPA 1EXRA 1SSEB 1TNWA 3KF9A 1JFKA 1K9KA 2CTNA 3KO0A 3O78A 1SL9A 2CCMA 1DF0A 3DY9A 4A4CA 2PRUA 4CIDA 1DVIA 3DYEA 1QLKA 3VB1A 4DIRA 4MSPA 1WDCC 3SG7A 4XJKA 1N65A 1F71A 3BOWB 5D3OA 5KTYA 3BFAA 2JU0A 1NCZA 1F70A 2KLDA 1LINA 1ZOTB 4L9MA 4ORCB 1H4BA 3I5GC 2LVKA 4HREE 3BUMB 3BYAA 4PT1A 2BKHB 2BBMA 1NUBA 1V1GA 3RM1A 2L0PA 1QX7A 4GUKA 1PULA 2KFGA 3F45A 5FYXA 1TTXA 2KBMA 3NXAA 2LVJA 3LLEA 1KWOB 1MR8A 1YTZC 2LAPA 3OB2B 4FTGA 3SG2A 1FPWA 1NP8A 3DXLA 4M2QA 2CBLA 2M7LA 3CGAA 1LKJA 2JZIA 1K95A 2PSRA 3EK4A 1TRFA 3PSRA 5FI6A 1IRJA 2KI6D 1KK8B 4OVNF 1JBAA 2KFHA 4PHNA 2I2RE 1QVIZ 1J55A 2JNFA 2K7BA 1CDNA 1WRLA 2L5XB 3D78A 3GK4X 1JF0A 1IKUA 4I5KA 1B8RA 2ZNDA 1CMFA 5HYDA 1TUJA 1B7TY 5HLVA 2JQ6A 2L51A 3WXAA 3I5IB 1BLQA 3O4XA 2ZRSA 3CLNA 5HKWA 2PYQA 1UURA 1K93D 3OX6A 3PATA 1IJ6A 2NXQA 1BMOA 3NHIA 3BXKA 2NLNA 3C1VA 2LP2A 2BCBA 2LC5A 1OOIX 5DKRA 1HT9A 2Q91A 4OCIA 1SCMC 2Y4QA 1JF2A
chains in the Genus database with same CATH topology
1IQ5A 1Y1XA 2KAVA 2KI4C 3EVUA 1ODBA 1DF0B 1OQPA 3OX5A 4YGDB 2EC6B 4DS7A 4MEWA 2FCDA 3SJSA 4GPLB 2H2KA 1OMVA 1KQMC 5AFPA 1L7ZA 4XJKB 2Y5IA 1DT7B 2OS8B 1Q80A 1UHKA 2M8UA 3CS1A 4XYNA 1GQMA 4YRUA 1NIWA 1RROA 3A8RA 1SW8A 1XFVO 2AMIA 3GK1A 1L2OB 1BJFA 4N1FA 4DUQA 1CMGA 4ZCVA 3IQQA 1FF1A 2MBXA 2BL0C 3TUYB 3QRXA 1F8HA 1S6IA 1JSAA 2KYCA 3EK8A 1JFJA 2PVBA 3I5FB 4NDCA 4JPZB 2LCPA 1NCXA 1AK8A 2K2AA 1WLZA 2EHBA 1B4CA 1D1OA 1OE9B 2WC8A 5CSNA 1PRWA 1SPYA 3D10A 4M2PA 3CTNA 2M7NA 4QJ4B 1XFZO 1DGVA 1C7VA 1A4PA 1S6JA 4PCWA 3CR4X 3OP0A 2R2IA 3DVKA 3VRQA 1QS7A 5AERA 1QATA 1UHJA 3ZWHA 4AQIA 4CFQA 3O4YA 4YI9A 4WQ2A 1BT6A 1DMOA 2KYFA 3AAJA 1XVJA 2H61A 4OR9B 1M46A 2B1UA 2E6WA 2ZNEA 1ALWA 1A03A 1FI5A 3KHEA 4BY5A 5D7FA 3PM8A 2CT9A 2OTGB 4Q04A 2KQYA 4GFTA 1EG4A 3TDUA 2JTZA 2L98A 3JVTC 1AJ4A 3WNXB 5AEQA 5JOLA 1B8LA 3TZ1A 2LE9B 3PALA 1SCVA 1SMGA 1XA5A 2AAOA 4GGNA 4YI8A 1UHIA 2JRFA 1KWOC 2LHIA 5CSJA 4YGCB 1CFFA 3D0YB 1HQVA 2WNDA 2MLEC 3HCMA 2MJWB 4C0JA 4MZJA 2LLTA 1QJTA 1B7TZ 2D8NA 3WHUB 1BG1A 2ZFDA 1XFWO 1CLMA 2BBNA 2MA2A 4YGBB 1AVSA 2KAXA 1MHOA 3FIAA 5GQQC 2JTTA 2LLSA 2WCBA 1PK0D 2HF5A 1YRUB 2JT3A 2I7AA 1S5GZ 1PVAA 2BCAA 3I5IC 2KFFA 2BE6A 2F3ZA 1W7JB 2WOSA 1G4YR 2JT8A 5CSIA 2JOJA 1CLBA 3LCPC 1A75A 4R1EA 5I2QA 1KFXL 3TS5C 4ETOA 1J1DA 1M45A 2MLFC 3M0WA 2JC2A 1X02A 1YUTA 2KDHA 3BQ3A 4I5NB 4QJ3B 3BUNB 3SIAA 1ZFSA 3VRNA 1DJIA 1A29A 1OSAA 4CPVA 4P5OE 1QLSA 2GGZA 4MLWA 2OS8C 2O60A 5J3XA 1YVHA 4CLNA 1GGWA 1KSMA 1NPQA 2L50A 2WORA 5DKNA 1K2HA 1N2DA 1ZMZA 2L4HA 2LANA 2JULA 4AOMA 2P6BB 3DF0A 3PN7B 4GAOA 3IF7A 2F2PA 1MWNA 4MVFA 4E68A 1Y6WA 2KI6C 3JTDB 2ZKMX 4PE0A 1C7WA 1F4OA 1JUOA 1SL8A 2JNXA 3BUWB 1YRTB 4U8DA 3O6BA 3TUYC 2LNKA 1DJXA 1NWDA 1J7PA 4QJ5B 2L2EA 1U5IB 1XFUO 2KHNA 5D69A 1B47A 1F4QA 1M39A 2CNPA 2LUCA 3GOFA 1QTXA 4I5JA 1KK7Y 1TN4A 4F0ZB 1DTLA 3I5HC 3DVJA 1SRAA 1EG3A 4PHJA 3PFVA 1RTP1 3DVMA 4JQ0D 1KFXS 2M9GA 3NSKA 2PASA 2LVVA 4A4BA 1NCYA 1J7QA 1R2UA 1CM1A 3I5GB 1RWYA 1NX1A 1N0YA 2EGDA 1R6PA 1J1EA 2F33A 1M63B 1SNLA 1YR5A 1DGUA 1YURA 5B8IB 1A75B 4HSZA 1WLMA 2JWWA 1KSOA 2LV7A 4PALA 1CFDA 1ZUZA 2LP3A 1YUSA 3D0YA 1XK4A 2MRDA 1ZACA 4PE4A 4ICBA 4MRYA 2MHHA 1QV1A 1TCFA 2OTGC 1AHRA 2NZ0A 2WCFA 5BPJA 2OPOA 1XYDA 2KNEA 2LMTA 3K21A 3BUOB 1H8BA 1OOJA 2LHLA 1CNPA 1PVBA 1SR6C 2KGBC 4BY4A 1OMRA 1QVIY 3DF0B 1KFUL 1S3PA 4UPGA 1QASA 3KPXA 1WRKA 2TN4A 1E8AA 1B9AA 3AAKA 4HRGA 1MXLC 2M1KB 1SCMB 1W7IB 1UUSA 2FOTA 3E3RA 1J7RA 2LLUA 2LVIA 2VRGA 2L4IA 1S1EA 4IL1A 4GNKB 1IH0A 1DJWA 4PHMA 3FS7A 1MUXA 4ORAB 1DJGA 4GGFA 4MN0A 2Q4UA 2BCXA 4PDZA 2M29A 1KCYA 1LVCD 1TNXA 2K8MB 4AQJA 2G2BA 4DCKA 3RLZA 2BL0B 2CXJA 1FBVA 2WCEA 1NYAA 1U5IA 2H61C 5ER4X 2KSPA 1EL4A 3NSLA 1CFCA 3GK2A 2Y1NA 5JJGA 3O2PA 1SYMA 3SG3A 2BECA 1WRZA 1KFUS 2HETA 1TNPA 2ZN9A 1KK8C 1SKTA 1RJVA 4NDBA 5I8NA 4MBEA 5ER5A 1SK6D 1LXFC 2Y1MA 1DJHA 2O5GA 2FJUB 2JXLA 1MXEA 1OZOA 2JXCA 1CTRA 2K7OA 4PHKA 1IJ5A 3JTDC 1BOCA 5G08A 4CFRA 1OMDA 1Y1AA 1LA0A 2BKIB 2M3WA 3EK7A 2LMVA 1K8UA 1SBJA 4PE1A 5F6TA 3KEVA 5K89A 4ORBB 5DKQA 5HKYA 3NSIA 2A4JA 1MQ1A 4TNCA 4DRWA 1S36A 1GGZA 3ICBA 2EC6C 1RFJA 2V53A 2NCOA 3DD4A 1QIVA 3OHMB 1CKKA 2M97A 5I2LA 1K96A 5IBWA 1XFXO 3JVTB 1NSHA 1BODA 2K7CA 1UP5A 1G8IA 4WQ3A 1EJ3A 1DJYA 1TIZA 1Y1UA 4N1GA 1EH2A 2F2OA 1L2OC 4YGAA 2HPSA 1QV0A 2HQ8A 1JWDA 4WRIA 2COLB 3SG5A 4JWQA 1SL7A 2MAZA 5AANA 1NX0A 4N5XA 2K0JA 3VGOA 3I5FC 1AJ5A 1Y0VH 3TDZA 1DJZA 1K90D 1CDMA 5AXIA 3AKAA 4P2YB 1CFPA 1G33A 1WDCB 4MRXA 5HLOA 2GV5A 3VROA 1B1GA 1K94A 3FWCA 1NX2A 1CM4A 2JT0A 1PALA 5CSFA 3SIBA 1ALVA 4MZKA 2K61A 1A2XA 1QIWA 2KAYA 2ZN8A 1BR4B 3PLFB 4FQOA 4GBAA 5CPVA 1S5GY 2F8PA 2AUCA 2JPTA 1UHHA 1TNQA 4ZCUA 4C0LA 3H4SE 3TS5B 3CR5X 1K9PA 2E30A 4HRHA 3LL8B 2IS9A 1B8CA 1GJYA 1PSBA 2DOQA 2KGRA 1QX2A 2FCEA 2HQWA 2LUXA 1K9UA 2M1UA 2NCPA 2QPTA 3OB1B 1JC2A 1F55A 3LK1A 3AKBA 1MF8B 3HX4A 1QXPA 2ISDA 3BUXB 4C0KA 2KBIA 3FWBA 3EVVA 1KQVA 3WHTB 1VRKA 4PE7A 5KU1A 3CWGA 2F3YA 2PMYA 1IWQA 1XO5A 1YVLA 1M31A 1YUUA 1UHNA 3IQOA 2QACA 3DVEA 2RGIA 1PSRA 2G9BA 2KI4B 1XK4C 1LA3A 3I5HB 4D1EA 1BR1B 3EKHA 2SASA 2SCPA 3MSEB 1KQMB 3BOWA 1RK9A 2K7DA 1CDPA 5I2OA 4OKHA 3SG6A 1IGVA 5PALA 1S6CA 2I18A 2KQ6A 2LMUA 1OZSA 2LM5A 1CB1A 4MZLA 4OV2A 3SG4A 1FI6A 2PALA 2M0RA 1CDLA 5KSZA 1BU3A 1NX3A 1RECA 1XFYO 3VRPA 1V1FA 3CR2A 1IQ3A 1C07A 3NSOA 3EVRA 3EKJA 1FW4A 2I94A 1YX8A 2GGMA 4M2OA 3TDIA 4NDDA 1YX7A 2ZRTA 1BF5A 2K2FA 1F54A 4I5LB 2BE4A 5HKZA 4USLA 3A4UB 1IG5A 3ZNIA 1J7OA 5TNCA 1UWOA 4GGFC 1AP4A 1SR6B 3VRRA 1TOPA 3PN7C 4YGEB 1QX5B 1S26D 3LK0A 3CZTX 1WY9A 4NQGA 1KK7Z 1AUIB 1SY9A 1TCOB 4YBHB 2KOTA 2M49B 1CLLA 1EXRA 3KF9A 1TNWA 1JFKA 1K9KA 2CTNA 3KO0A 3O78A 1SL9A 2CCMA 1DF0A 4A4CA 4CIDA 2PRUA 1DVIA 1QLKA 4DIRA 4MSPA 1WDCC 3SG7A 4XJKA 1N65A 1F71A 3BOWB 5KTYA 2JU0A 1NCZA 1F70A 1LINA 1ZOTB 4L9MA 4ORCB 1H4BA 3I5GC 2LVKA 4HREE 3BUMB 3BYAA 2BKHB 2BBMA 1NUBA 1V1GA 3RM1A 2L0PA 1QX7A 4GUKA 1PULA 2KFGA 3F45A 5FYXA 1TTXA 2KBMA 3NXAA 2LVJA 3LLEA 1KWOB 1MR8A 1YTZC 2LAPA 3OB2B 4FTGA 3SG2A 1FPWA 1NP8A 4M2QA 2CBLA 2M7LA 3CGAA 1LKJA 2JZIA 1K95A 2PSRA 3EK4A 1TRFA 3PSRA 1IRJA 2KI6D 1KK8B 4OVNF 1JBAA 2KFHA 4PHNA 2I2RE 1QVIZ 1J55A 2JNFA 2K7BA 1CDNA 1WRLA 2L5XB 3GK4X 1JF0A 1IKUA 4I5KA 1B8RA 2ZNDA 1CMFA 5HYDA 1BLQA 1B7TY 5HLVA 2JQ6A 2L51A 3WXAA 3I5IB 2ZRSA 3CLNA 5HKWA 1UURA 1K93D 3OX6A 3PATA 1IJ6A 2NXQA 1BMOA 3BXKA 2NLNA 3C1VA 2LP2A 2BCBA 2LC5A 5DKRA 1HT9A 2Q91A 4OCIA 1SCMC 2Y4QA 1JF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IQ5 A;  1Y1X A;  2KAV A;  2KI4 C;  3EVU A;  1ODB A;  1DF0 B;  1OQP A;  3OX5 A;  4YGD B;  2EC6 B;  4DS7 A;  4MEW A;  2FCD A;  3SJS A;  4GPL B;  2H2K A;  1OMV A;  1KQM C;  5AFP A;  1L7Z A;  4XJK B;  2Y5I A;  1DT7 B;  2OS8 B;  1Q80 A;  1UHK A;  2M8U A;  3CS1 A;  4XYN A;  1GQM A;  4YRU A;  1NIW A;  1RRO A;  3A8R A;  1SW8 A;  1XFV O;  2AMI A;  3GK1 A;  1L2O B;  1BJF A;  4N1F A;  4DUQ A;  1CMG A;  4ZCV A;  3IQQ A;  1FF1 A;  2MBX A;  2BL0 C;  3TUY B;  3QRX A;  1F8H A;  1S6I A;  1JSA A;  2KYC A;  3EK8 A;  1JFJ A;  2PVB A;  3I5F B;  4NDC A;  4JPZ B;  2LCP A;  1NCX A;  1AK8 A;  2K2A A;  1WLZ A;  2EHB A;  1B4C A;  1D1O A;  1OE9 B;  2WC8 A;  5CSN A;  1PRW A;  1SPY A;  3D10 A;  4M2P A;  3CTN A;  2M7N A;  4QJ4 B;  1XFZ O;  1DGV A;  1C7V A;  1A4P A;  1S6J A;  4PCW A;  3CR4 X;  3OP0 A;  2R2I A;  3DVK A;  3VRQ A;  1QS7 A;  5AER A;  1QAT A;  1UHJ A;  3ZWH A;  4AQI A;  4CFQ A;  3O4Y A;  4YI9 A;  4WQ2 A;  1BT6 A;  1DMO A;  2KYF A;  3AAJ A;  1XVJ A;  2H61 A;  4OR9 B;  1M46 A;  2B1U A;  2E6W A;  2ZNE A;  1ALW A;  1A03 A;  1FI5 A;  3KHE A;  4BY5 A;  5D7F A;  3PM8 A;  2CT9 A;  2OTG B;  4Q04 A;  2KQY A;  4GFT A;  1EG4 A;  3TDU A;  2JTZ A;  2L98 A;  3JVT C;  1AJ4 A;  3WNX B;  5AEQ A;  5JOL A;  1B8L A;  3TZ1 A;  2LE9 B;  3PAL A;  1SCV A;  1SMG A;  1XA5 A;  2AAO A;  4GGN A;  4YI8 A;  1UHI A;  2JRF A;  1KWO C;  2LHI A;  5CSJ A;  4YGC B;  1CFF A;  3D0Y B;  1HQV A;  2WND A;  2MLE C;  3HCM A;  2MJW B;  4C0J A;  4MZJ A;  2LLT A;  1QJT A;  1B7T Z;  2D8N A;  3WHU B;  1BG1 A;  2ZFD A;  1XFW O;  1CLM A;  2BBN A;  2MA2 A;  4YGB B;  1AVS A;  2KAX A;  1MHO A;  3FIA A;  5GQQ C;  2JTT A;  2LLS A;  2WCB A;  1PK0 D;  2HF5 A;  1YRU B;  2JT3 A;  2I7A A;  1S5G Z;  1PVA A;  2BCA A;  3I5I C;  2KFF A;  2BE6 A;  2F3Z A;  1W7J B;  2WOS A;  1G4Y R;  2JT8 A;  5CSI A;  2JOJ A;  1CLB A;  3LCP C;  1A75 A;  4R1E A;  5I2Q A;  1KFX L;  3TS5 C;  4ETO A;  1J1D A;  1M45 A;  2MLF C;  3M0W A;  2JC2 A;  1X02 A;  1YUT A;  2KDH A;  3BQ3 A;  4I5N B;  4QJ3 B;  3BUN B;  3SIA A;  1ZFS A;  3VRN A;  1DJI A;  1A29 A;  1OSA A;  4CPV A;  4P5O E;  1QLS A;  2GGZ A;  4MLW A;  2OS8 C;  2O60 A;  5J3X A;  1YVH A;  4CLN A;  1GGW A;  1KSM A;  1NPQ A;  2L50 A;  2WOR A;  5DKN A;  1K2H A;  1N2D A;  1ZMZ A;  2L4H A;  2LAN A;  2JUL A;  4AOM A;  2P6B B;  3DF0 A;  3PN7 B;  4GAO A;  3IF7 A;  2F2P A;  1MWN A;  4MVF A;  4E68 A;  1Y6W A;  2KI6 C;  3JTD B;  2ZKM X;  4PE0 A;  1C7W A;  1F4O A;  1JUO A;  1SL8 A;  2JNX A;  3BUW B;  1YRT B;  4U8D A;  3O6B A;  3TUY C;  2LNK A;  1DJX A;  1NWD A;  1J7P A;  4QJ5 B;  2L2E A;  1U5I B;  1XFU O;  2KHN A;  5D69 A;  1B47 A;  1F4Q A;  1M39 A;  2CNP A;  2LUC A;  3GOF A;  1QTX A;  4I5J A;  1KK7 Y;  1TN4 A;  4F0Z B;  1DTL A;  3I5H C;  3DVJ A;  1SRA A;  1EG3 A;  4PHJ A;  3PFV A;  1RTP 1;  3DVM A;  4JQ0 D;  1KFX S;  2M9G A;  3NSK A;  2PAS A;  2LVV A;  4A4B A;  1NCY A;  1J7Q A;  1R2U A;  1CM1 A;  3I5G B;  1RWY A;  1NX1 A;  1N0Y A;  2EGD A;  1R6P A;  1J1E A;  2F33 A;  1M63 B;  1SNL A;  1YR5 A;  1DGU A;  1YUR A;  5B8I B;  1A75 B;  4HSZ A;  1WLM A;  2JWW A;  1KSO A;  2LV7 A;  4PAL A;  1CFD A;  1ZUZ A;  2LP3 A;  1YUS A;  3D0Y A;  1XK4 A;  2MRD A;  1ZAC A;  4PE4 A;  4ICB A;  4MRY A;  2MHH A;  1QV1 A;  1TCF A;  2OTG C;  1AHR A;  2NZ0 A;  2WCF A;  5BPJ A;  2OPO A;  1XYD A;  2KNE A;  2LMT A;  3K21 A;  3BUO B;  1H8B A;  1OOJ A;  2LHL A;  1CNP A;  1PVB A;  1SR6 C;  2KGB C;  4BY4 A;  1OMR A;  1QVI Y;  3DF0 B;  1KFU L;  1S3P A;  4UPG A;  1QAS A;  3KPX A;  1WRK A;  2TN4 A;  1E8A A;  1B9A A;  3AAK A;  4HRG A;  1MXL C;  2M1K B;  1SCM B;  1W7I B;  1UUS A;  2FOT A;  3E3R A;  1J7R A;  2LLU A;  2LVI A;  2VRG A;  2L4I A;  1S1E A;  4IL1 A;  4GNK B;  1IH0 A;  1DJW A;  4PHM A;  3FS7 A;  1MUX A;  4ORA B;  1DJG A;  4GGF A;  4MN0 A;  2Q4U A;  2BCX A;  4PDZ A;  2M29 A;  1KCY A;  1LVC D;  1TNX A;  2K8M B;  4AQJ A;  2G2B A;  4DCK A;  3RLZ A;  2BL0 B;  2CXJ A;  1FBV A;  2WCE A;  1NYA A;  1U5I A;  2H61 C;  5ER4 X;  2KSP A;  1EL4 A;  3NSL A;  1CFC A;  3GK2 A;  2Y1N A;  5JJG A;  3O2P A;  1SYM A;  3SG3 A;  2BEC A;  1WRZ A;  1KFU S;  2HET A;  1TNP A;  2ZN9 A;  1KK8 C;  1SKT A;  1RJV A;  4NDB A;  5I8N A;  4MBE A;  5ER5 A;  1SK6 D;  1LXF C;  2Y1M A;  1DJH A;  2O5G A;  2FJU B;  2JXL A;  1MXE A;  1OZO A;  2JXC A;  1CTR A;  2K7O A;  4PHK A;  1IJ5 A;  3JTD C;  1BOC A;  5G08 A;  4CFR A;  1OMD A;  1Y1A A;  1LA0 A;  2BKI B;  2M3W A;  3EK7 A;  2LMV A;  1K8U A;  1SBJ A;  4PE1 A;  5F6T A;  3KEV A;  5K89 A;  4ORB B;  5DKQ A;  5HKY A;  3NSI A;  2A4J A;  1MQ1 A;  4TNC A;  4DRW A;  1S36 A;  1GGZ A;  3ICB A;  2EC6 C;  1RFJ A;  2V53 A;  2NCO A;  3DD4 A;  1QIV A;  3OHM B;  1CKK A;  2M97 A;  5I2L A;  1K96 A;  5IBW A;  1XFX O;  3JVT B;  1NSH A;  1BOD A;  2K7C A;  1UP5 A;  1G8I A;  4WQ3 A;  1EJ3 A;  1DJY A;  1TIZ A;  1Y1U A;  4N1G A;  1EH2 A;  2F2O A;  1L2O C;  4YGA A;  2HPS A;  1QV0 A;  2HQ8 A;  1JWD A;  4WRI A;  2COL B;  3SG5 A;  4JWQ A;  1SL7 A;  2MAZ A;  5AAN A;  1NX0 A;  4N5X A;  2K0J A;  3VGO A;  3I5F C;  1AJ5 A;  1Y0V H;  3TDZ A;  1DJZ A;  1K90 D;  1CDM A;  5AXI A;  3AKA A;  4P2Y B;  1CFP A;  1G33 A;  1WDC B;  4MRX A;  5HLO A;  2GV5 A;  3VRO A;  1B1G A;  1K94 A;  3FWC A;  1NX2 A;  1CM4 A;  2JT0 A;  1PAL A;  5CSF A;  3SIB A;  1ALV A;  4MZK A;  2K61 A;  1A2X A;  1QIW A;  2KAY A;  2ZN8 A;  1BR4 B;  3PLF B;  4FQO A;  4GBA A;  5CPV A;  1S5G Y;  2F8P A;  2AUC A;  2JPT A;  1UHH A;  1TNQ A;  4ZCU A;  4C0L A;  3H4S E;  3TS5 B;  3CR5 X;  1K9P A;  2E30 A;  4HRH A;  3LL8 B;  2IS9 A;  1B8C A;  1GJY A;  1PSB A;  2DOQ A;  2KGR A;  1QX2 A;  2FCE A;  2HQW A;  2LUX A;  1K9U A;  2M1U A;  2NCP A;  2QPT A;  3OB1 B;  1JC2 A;  1F55 A;  3LK1 A;  3AKB A;  1MF8 B;  3HX4 A;  1QXP A;  2ISD A;  3BUX B;  4C0K A;  2KBI A;  3FWB A;  3EVV A;  1KQV A;  3WHT B;  1VRK A;  4PE7 A;  5KU1 A;  3CWG A;  2F3Y A;  2PMY A;  1IWQ A;  1XO5 A;  1YVL A;  1M31 A;  1YUU A;  1UHN A;  3IQO A;  2QAC A;  3DVE A;  2RGI A;  1PSR A;  2G9B A;  2KI4 B;  1XK4 C;  1LA3 A;  3I5H B;  4D1E A;  1BR1 B;  3EKH A;  2SAS A;  2SCP A;  3MSE B;  1KQM B;  3BOW A;  1RK9 A;  2K7D A;  1CDP A;  5I2O A;  4OKH A;  3SG6 A;  1IGV A;  5PAL A;  1S6C A;  2I18 A;  2KQ6 A;  2LMU A;  1OZS A;  2LM5 A;  1CB1 A;  4MZL A;  4OV2 A;  3SG4 A;  1FI6 A;  2PAL A;  2M0R A;  1CDL A;  5KSZ A;  1BU3 A;  1NX3 A;  1REC A;  1XFY O;  3VRP A;  1V1F A;  3CR2 A;  1IQ3 A;  1C07 A;  3NSO A;  3EVR A;  3EKJ A;  1FW4 A;  2I94 A;  1YX8 A;  2GGM A;  4M2O A;  3TDI A;  4NDD A;  1YX7 A;  2ZRT A;  1BF5 A;  2K2F A;  1F54 A;  4I5L B;  2BE4 A;  5HKZ A;  4USL A;  3A4U B;  1IG5 A;  3ZNI A;  1J7O A;  5TNC A;  1UWO A;  4GGF C;  1AP4 A;  1SR6 B;  3VRR A;  1TOP A;  3PN7 C;  4YGE B;  1QX5 B;  1S26 D;  3LK0 A;  3CZT X;  1WY9 A;  4NQG A;  1KK7 Z;  1AUI B;  1SY9 A;  1TCO B;  4YBH B;  2KOT A;  2M49 B;  1CLL A;  1EXR A;  3KF9 A;  1TNW A;  1JFK A;  1K9K A;  2CTN A;  3KO0 A;  3O78 A;  1SL9 A;  2CCM A;  1DF0 A;  4A4C A;  4CID A;  2PRU A;  1DVI A;  1QLK A;  4DIR A;  4MSP A;  1WDC C;  3SG7 A;  4XJK A;  1N65 A;  1F71 A;  3BOW B;  5KTY A;  2JU0 A;  1NCZ A;  1F70 A;  1LIN A;  1ZOT B;  4L9M A;  4ORC B;  1H4B A;  3I5G C;  2LVK A;  4HRE E;  3BUM B;  3BYA A;  2BKH B;  2BBM A;  1NUB A;  1V1G A;  3RM1 A;  2L0P A;  1QX7 A;  4GUK A;  1PUL A;  2KFG A;  3F45 A;  5FYX A;  1TTX A;  2KBM A;  3NXA A;  2LVJ A;  3LLE A;  1KWO B;  1MR8 A;  1YTZ C;  2LAP A;  3OB2 B;  4FTG A;  3SG2 A;  1FPW A;  1NP8 A;  4M2Q A;  2CBL A;  2M7L A;  3CGA A;  1LKJ A;  2JZI A;  1K95 A;  2PSR A;  3EK4 A;  1TRF A;  3PSR A;  1IRJ A;  2KI6 D;  1KK8 B;  4OVN F;  1JBA A;  2KFH A;  4PHN A;  2I2R E;  1QVI Z;  1J55 A;  2JNF A;  2K7B A;  1CDN A;  1WRL A;  2L5X B;  3GK4 X;  1JF0 A;  1IKU A;  4I5K A;  1B8R A;  2ZND A;  1CMF A;  5HYD A;  1BLQ A;  1B7T Y;  5HLV A;  2JQ6 A;  2L51 A;  3WXA A;  3I5I B;  2ZRS A;  3CLN A;  5HKW A;  1UUR A;  1K93 D;  3OX6 A;  3PAT A;  1IJ6 A;  2NXQ A;  1BMO A;  3BXK A;  2NLN A;  3C1V A;  2LP2 A;  2BCB A;  2LC5 A;  5DKR A;  1HT9 A;  2Q91 A;  4OCI A;  1SCM C;  2Y4Q A;  1JF2 A; 
#chains in the Genus database with same CATH topology
 1IQ5 A;  1Y1X A;  2KAV A;  2KI4 C;  3EVU A;  1ODB A;  1DF0 B;  1OQP A;  3OX5 A;  4YGD B;  2EC6 B;  4DS7 A;  4MEW A;  2FCD A;  3SJS A;  4GPL B;  2H2K A;  1OMV A;  1KQM C;  5AFP A;  1L7Z A;  4XJK B;  2Y5I A;  1DT7 B;  2L5Y A;  2OS8 B;  1Q80 A;  1UHK A;  4JKT A;  2M8U A;  3CS1 A;  4F7F A;  4XYN A;  1GQM A;  4YRU A;  1NIW A;  1RRO A;  3A8R A;  3L47 A;  1SW8 A;  1XFV O;  2AMI A;  3GK1 A;  1L2O B;  1BJF A;  4N1F A;  4DUQ A;  1CMG A;  4ZCV A;  2P71 A;  3IQQ A;  1FF1 A;  2MBX A;  2BL0 C;  3TUY B;  3QRX A;  1F8H A;  1S6I A;  1JSA A;  2KYC A;  3EK8 A;  3UNW A;  1JFJ A;  2PVB A;  3I5F B;  4NDC A;  4JPZ B;  2LCP A;  1NCX A;  1AK8 A;  2K2A A;  1WLZ A;  2EHB A;  1B4C A;  1D1O A;  1OE9 B;  2WC8 A;  5CSN A;  1PRW A;  1SPY A;  3D10 A;  4M2P A;  3CTN A;  2M7N A;  4QJ4 B;  4OZD A;  1XFZ O;  1DGV A;  1C7V A;  1A4P A;  1S6J A;  4PCW A;  3CR4 X;  3OP0 A;  2R2I A;  3DVK A;  3VRQ A;  1QS7 A;  1TUZ A;  5AER A;  1QAT A;  1UHJ A;  2H8V A;  3ZWH A;  4AQI A;  4CFQ A;  3O4Y A;  4YI9 A;  4WQ2 A;  1BT6 A;  3S0B A;  3B6X A;  1DMO A;  2KYF A;  3AAJ A;  1XVJ A;  2H61 A;  4OR9 B;  1M46 A;  2BNX A;  3RZS A;  2B1U A;  2E6W A;  2ZNE A;  3S0D A;  1ALW A;  1A03 A;  3CAB A;  1FI5 A;  3KHE A;  4BY5 A;  5D7F A;  3PM8 A;  2CT9 A;  2OTG B;  2QEV A;  4Q04 A;  2KQY A;  4GFT A;  1EG4 A;  3TDU A;  2JTZ A;  1QWV A;  2L98 A;  1AJ4 A;  3JVT C;  3S0E A;  3WNX B;  5AEQ A;  5JOL A;  1B8L A;  4INX A;  3TZ1 A;  2LE9 B;  3PAL A;  1SCV A;  1SMG A;  1XA5 A;  2L2C A;  3S0G A;  2AAO A;  4GGN A;  4YI8 A;  1UHI A;  2JRF A;  1KWO C;  1ORG A;  2LHI A;  5CSJ A;  4YGC B;  1CFF A;  3D0Y B;  1HQV A;  2WND A;  2JPO A;  2MLE C;  3HCM A;  2MJW B;  2QEB A;  4C0J A;  4MZJ A;  2LLT A;  1QJT A;  1B7T Z;  2D8N A;  3WHU B;  1BG1 A;  2ZFD A;  1XFW O;  1CLM A;  2BBN A;  2MA2 A;  4YGB B;  1AVS A;  2KAX A;  1MHO A;  3FIA A;  5GQQ C;  2JTT A;  2LLS A;  2WCB A;  1PK0 D;  2HF5 A;  1YRU B;  2JT3 A;  2WC6 A;  2I7A A;  1S5G Z;  1PVA A;  2BCA A;  3I5I C;  2KFF A;  2BE6 A;  2F3Z A;  1W7J B;  2WOS A;  1G4Y R;  2JT8 A;  5CSI A;  5EL2 A;  2JOJ A;  1CLB A;  3LCP C;  1A75 A;  4R1E A;  5I2Q A;  1KFX L;  3TS5 C;  4ETO A;  1J1D A;  1M45 A;  2MLF C;  3BFB A;  2JC2 A;  1X02 A;  1YUT A;  2KDH A;  3BQ3 A;  3M0W A;  4I5N B;  4QJ3 B;  3BUN B;  3SIA A;  1ZFS A;  2K60 A;  3VRN A;  3IVT A;  1DJI A;  1A29 A;  1OSA A;  4CPV A;  4P5O E;  5I94 A;  1QLS A;  2GGZ A;  4MLW A;  2OS8 C;  2O60 A;  5J3X A;  1YVH A;  2KLE A;  4CLN A;  1GGW A;  1KSM A;  1NPQ A;  2L50 A;  2WOR A;  5DKN A;  1K2H A;  3D74 A;  1N2D A;  2WCJ A;  1ZMZ A;  2L4H A;  2LAN A;  2JUL A;  4AOM A;  2P6B B;  3DF0 A;  3PN7 B;  4GAO A;  3IF7 A;  2F2P A;  1MWN A;  4MVF A;  4E68 A;  1Y6W A;  2KI6 C;  3JTD B;  2ZKM X;  4PE0 A;  1C7W A;  1F4O A;  2WCM A;  1JUO A;  1SL8 A;  2JNX A;  3BUW B;  1YRT B;  4U8D A;  3O6B A;  3R1P A;  2LNK A;  3TUY C;  1DJX A;  1NWD A;  1J7P A;  4QJ5 B;  2L2E A;  1U5I B;  1XFU O;  2KHN A;  5D69 A;  1C3Y A;  1B47 A;  1F4Q A;  1M39 A;  2CNP A;  2LUC A;  3GOF A;  1QTX A;  4I5J A;  1KK7 Y;  1TN4 A;  4F0Z B;  1DTL A;  3I5H C;  3DVJ A;  1SRA A;  1EG3 A;  4PHJ A;  3PFV A;  1RTP 1;  3DVM A;  4JQ0 D;  1IIO A;  1KFX S;  3S0A A;  2M9G A;  3NSK A;  2PAS A;  2LVV A;  3SS4 A;  3QME A;  3R1V A;  4A4B A;  1GM0 A;  1NCY A;  1J7Q A;  1R2U A;  1CM1 A;  3I5G B;  1RWY A;  1NX1 A;  1N0Y A;  2EGD A;  1R6P A;  3FE6 A;  1J1E A;  2F33 A;  1M63 B;  1SNL A;  1YR5 A;  1DGU A;  1YUR A;  3D75 A;  3SS3 A;  5B8I B;  1A75 B;  4HSZ A;  1WLM A;  2JWW A;  1KSO A;  2LV7 A;  4PAL A;  1CFD A;  1ZUZ A;  2LP3 A;  2QEO A;  1Z4H A;  1YUS A;  3D0Y A;  1XK4 A;  2MRD A;  1ZAC A;  4PE4 A;  4ICB A;  4MRY A;  2MHH A;  1QV1 A;  3L4A A;  1TCF A;  5HL1 A;  2OTG C;  1AHR A;  2NZ0 A;  2WCF A;  3B86 A;  5BPJ A;  2OPO A;  1DQE A;  1XYD A;  2KNE A;  2LMT A;  3K21 A;  1OOG A;  2YGU A;  3BUO B;  1OOJ A;  1H8B A;  2LHL A;  4JD9 A;  1CNP A;  1PVB A;  1SR6 C;  2KGB C;  4BY4 A;  1OMR A;  1QVI Y;  3DF0 B;  1KFU L;  1S3P A;  4UPG A;  1QAS A;  3KPX A;  1WRK A;  2TN4 A;  1E8A A;  1B9A A;  3AAK A;  1OOF A;  3CDN A;  1C3Z A;  4HRG A;  2KPH A;  1MXL C;  2M1K B;  1SCM B;  1W7I B;  3D77 A;  3DZT A;  1UUS A;  2FOT A;  3E3R A;  1J7R A;  4INW A;  2LLU A;  3B7A A;  2LVI A;  2QEH A;  2VRG A;  2L4I A;  1S1E A;  5CPV A;  4IL1 A;  4GNK B;  3FE9 A;  2QDI A;  1IH0 A;  1T14 A;  1DJW A;  4PHM A;  3FS7 A;  1MUX A;  4ORA B;  1DJG A;  4GGF A;  3NGV A;  4MN0 A;  2Q4U A;  2BCX A;  4PDZ A;  2M29 A;  1KCY A;  1LVC D;  2WCH A;  1TNX A;  2K8M B;  3PJI A;  4AQJ A;  2G2B A;  4DCK A;  3RLZ A;  2BL0 B;  2CXJ A;  1FBV A;  2WCE A;  1NYA A;  1U5I A;  2H61 C;  5ER4 X;  2KSP A;  1EL4 A;  3NSL A;  1CFC A;  3GK2 A;  3D76 A;  2Y1N A;  5JJG A;  3O2P A;  1SYM A;  2WC5 A;  2BEC A;  3BFH A;  1WRZ A;  1KFU S;  3SG3 A;  2HET A;  1TNP A;  2ZN9 A;  1KK8 C;  1SKT A;  1RJV A;  4NDB A;  5FI7 A;  5I8N A;  4MBE A;  4KYN A;  5ER5 A;  1SK6 D;  1LXF C;  2Y1M A;  1DJH A;  2O5G A;  2FJU B;  2JXL A;  3EG5 B;  1MXE A;  1OZO A;  2JXC A;  1CTR A;  2K7O A;  4PHK A;  1IJ5 A;  3JTD C;  1BOC A;  3BJH A;  5G08 A;  4CFR A;  1OMD A;  1Y1A A;  1LA0 A;  2BKI B;  2M3W A;  3EK7 A;  2LMV A;  1K8U A;  1SBJ A;  4PE1 A;  5F6T A;  1LS8 A;  2FJY A;  3KEV A;  5K89 A;  4ORB B;  3PM2 A;  1XFR A;  5DKQ A;  5HKY A;  3NSI A;  2A4J A;  1MQ1 A;  4TNC A;  4DRW A;  1S36 A;  1GGZ A;  3ICB A;  2EC6 C;  1RFJ A;  2V53 A;  2NCO A;  3DD4 A;  1QIV A;  3OHM B;  1CKK A;  2M97 A;  5I2L A;  1K96 A;  5IBW A;  3NHT A;  1XFX O;  3JVT B;  1NSH A;  1BOD A;  2K7C A;  1UP5 A;  1G8I A;  4WQ3 A;  1EJ3 A;  1DJY A;  1TIZ A;  1Y1U A;  4N1G A;  1EH2 A;  5FI2 A;  2F2O A;  1L2O C;  4YGA A;  2HPS A;  1QV0 A;  2HQ8 A;  1JWD A;  1Z2C B;  4WRI A;  2COL B;  3SG5 A;  4JWQ A;  1SL7 A;  2MAZ A;  5AAN A;  1NX0 A;  4N5X A;  2K0J A;  3VGO A;  3I5F C;  1AJ5 A;  1Y0V H;  3TDZ A;  1DJZ A;  1K90 D;  1CDM A;  5AXI A;  3S0F A;  3AKA A;  4P2Y B;  1CFP A;  1G33 A;  1WDC B;  2WCK A;  2PQL A;  4MRX A;  3Q8I A;  5HLO A;  2GV5 A;  3VRO A;  1DEK A;  1B1G A;  1K94 A;  3FWC A;  1NX2 A;  1CM4 A;  2JT0 A;  3N7H A;  1PAL A;  5CSF A;  3SIB A;  1OOH A;  2ERB A;  3OBV A;  1ALV A;  4MZK A;  2K61 A;  1A2X A;  1QIW A;  2KAY A;  2ZN8 A;  1BR4 B;  3B88 A;  3PLF B;  4FQO A;  2GTE A;  1S5G Y;  2F8P A;  2AUC A;  2JPT A;  1UHH A;  1TNQ A;  4GBA A;  4ZCU A;  4C0L A;  3H4S E;  3TS5 B;  3CR5 X;  1K9P A;  2E30 A;  4HRH A;  3LL8 B;  2IS9 A;  1P28 A;  1B8C A;  1GJY A;  3CZ2 A;  3B87 A;  1PSB A;  2DOQ A;  2KGR A;  1QX2 A;  3OGN A;  3D73 A;  2FCE A;  2HQW A;  2LUX A;  1K9U A;  2M1U A;  2NCP A;  2QPT A;  3OB1 B;  1JC2 A;  1F55 A;  3LK1 A;  3AKB A;  1MF8 B;  3HX4 A;  3R1O A;  1QXP A;  2ISD A;  3BUX B;  4C0K A;  2KBI A;  3FWB A;  3EVV A;  1KQV A;  3WHT B;  1VRK A;  4PE7 A;  5KU1 A;  3CWG A;  2F3Y A;  2PMY A;  1IWQ A;  1XO5 A;  3K1E A;  1YVL A;  1M31 A;  1YUU A;  1UHN A;  3IQO A;  2QAC A;  3DVE A;  2RGI A;  1PSR A;  2G9B A;  2KI4 B;  1XK4 C;  1LA3 A;  3I5H B;  4D1E A;  1BR1 B;  3EKH A;  2SAS A;  2SCP A;  3MSE B;  1DEL A;  1KQM B;  3BOW A;  3FE8 A;  3SS5 A;  1RK9 A;  1TWO A;  2K7D A;  1CDP A;  5I2O A;  4OKH A;  3SG6 A;  1IGV A;  5PAL A;  1S6C A;  2I18 A;  2KQ6 A;  2LMU A;  1OZS A;  2LM5 A;  1CB1 A;  4MZL A;  5DIC A;  4OV2 A;  3SG4 A;  1FI6 A;  2PAL A;  2M0R A;  1CDL A;  5KSZ A;  1BU3 A;  1NX3 A;  1REC A;  1XFY O;  3CYZ A;  3VRP A;  3UO9 A;  1V1F A;  3CR2 A;  1IQ3 A;  1C07 A;  3NSO A;  3V2L A;  3EVR A;  3EKJ A;  1FW4 A;  2I94 A;  4IJ7 A;  1YX8 A;  3R72 A;  1OW4 A;  1W9Z A;  2GGM A;  4M2O A;  3TDI A;  4NDD A;  1YX7 A;  2ZRT A;  1BF5 A;  2K2F A;  1F54 A;  4I5L B;  2BE4 A;  5HKZ A;  2P70 A;  4USL A;  3A4U B;  3CZ1 A;  1IG5 A;  3ZNI A;  1J7O A;  5TNC A;  1UWO A;  4GGF C;  1AP4 A;  1SR6 B;  3VRR A;  4FQT A;  1TOP A;  3PN7 C;  4YGE B;  1QX5 B;  1S26 D;  3LK0 A;  3CZT X;  1WY9 A;  1DC1 A;  4NQG A;  1KK7 Z;  1AUI B;  1SY9 A;  1TCO B;  2WCL A;  4YBH B;  2KOT A;  3L4L A;  3CZ0 A;  2M49 B;  1CLL A;  2BAP A;  1EXR A;  1SSE B;  1TNW A;  3KF9 A;  1JFK A;  1K9K A;  2CTN A;  3KO0 A;  3O78 A;  1SL9 A;  2CCM A;  1DF0 A;  3DY9 A;  4A4C A;  2PRU A;  4CID A;  1DVI A;  3DYE A;  1QLK A;  3VB1 A;  4DIR A;  4MSP A;  1WDC C;  3SG7 A;  4XJK A;  1N65 A;  1F71 A;  3BOW B;  5D3O A;  5KTY A;  3BFA A;  2JU0 A;  1NCZ A;  1F70 A;  2KLD A;  1LIN A;  1ZOT B;  4L9M A;  4ORC B;  1H4B A;  3I5G C;  2LVK A;  4HRE E;  3BUM B;  3BYA A;  4PT1 A;  2BKH B;  2BBM A;  1NUB A;  1V1G A;  3RM1 A;  2L0P A;  1QX7 A;  4GUK A;  1PUL A;  2KFG A;  3F45 A;  5FYX A;  1TTX A;  2KBM A;  3NXA A;  2LVJ A;  3LLE A;  1KWO B;  1MR8 A;  1YTZ C;  2LAP A;  3OB2 B;  4FTG A;  3SG2 A;  1FPW A;  1NP8 A;  3DXL A;  4M2Q A;  2CBL A;  2M7L A;  3CGA A;  1LKJ A;  2JZI A;  1K95 A;  2PSR A;  3EK4 A;  1TRF A;  3PSR A;  5FI6 A;  1IRJ A;  2KI6 D;  1KK8 B;  4OVN F;  1JBA A;  2KFH A;  4PHN A;  2I2R E;  1QVI Z;  1J55 A;  2JNF A;  2K7B A;  1CDN A;  1WRL A;  2L5X B;  3D78 A;  3GK4 X;  1JF0 A;  1IKU A;  4I5K A;  1B8R A;  2ZND A;  1CMF A;  5HYD A;  1TUJ A;  1B7T Y;  5HLV A;  2JQ6 A;  2L51 A;  3WXA A;  3I5I B;  1BLQ A;  3O4X A;  2ZRS A;  3CLN A;  5HKW A;  2PYQ A;  1UUR A;  1K93 D;  3OX6 A;  3PAT A;  1IJ6 A;  2NXQ A;  1BMO A;  3NHI A;  3BXK A;  2NLN A;  3C1V A;  2LP2 A;  2BCB A;  2LC5 A;  1OOI X;  5DKR A;  1HT9 A;  2Q91 A;  4OCI A;  1SCM C;  2Y4Q A;  1JF2 A; 
#chains in the Genus database with same CATH homology
 1IQ5 A;  1Y1X A;  2KAV A;  2KI4 C;  3EVU A;  1ODB A;  1DF0 B;  1OQP A;  3OX5 A;  4YGD B;  2EC6 B;  4DS7 A;  4MEW A;  2FCD A;  3SJS A;  4GPL B;  2H2K A;  1OMV A;  1KQM C;  5AFP A;  1L7Z A;  4XJK B;  2Y5I A;  1DT7 B;  2OS8 B;  1Q80 A;  1UHK A;  2M8U A;  3CS1 A;  4XYN A;  1GQM A;  4YRU A;  1NIW A;  1RRO A;  3A8R A;  1SW8 A;  1XFV O;  2AMI A;  3GK1 A;  1L2O B;  1BJF A;  4N1F A;  4DUQ A;  1CMG A;  4ZCV A;  3IQQ A;  1FF1 A;  2MBX A;  2BL0 C;  3TUY B;  3QRX A;  1F8H A;  1S6I A;  1JSA A;  2KYC A;  3EK8 A;  1JFJ A;  2PVB A;  3I5F B;  4NDC A;  4JPZ B;  2LCP A;  1NCX A;  1AK8 A;  2K2A A;  1WLZ A;  2EHB A;  1B4C A;  1D1O A;  1OE9 B;  2WC8 A;  5CSN A;  1PRW A;  1SPY A;  3D10 A;  4M2P A;  3CTN A;  2M7N A;  4QJ4 B;  1XFZ O;  1DGV A;  1C7V A;  1A4P A;  1S6J A;  4PCW A;  3CR4 X;  3OP0 A;  2R2I A;  3DVK A;  3VRQ A;  1QS7 A;  5AER A;  1QAT A;  1UHJ A;  3ZWH A;  4AQI A;  4CFQ A;  3O4Y A;  4YI9 A;  4WQ2 A;  1BT6 A;  1DMO A;  2KYF A;  3AAJ A;  1XVJ A;  2H61 A;  4OR9 B;  1M46 A;  2B1U A;  2E6W A;  2ZNE A;  1ALW A;  1A03 A;  1FI5 A;  3KHE A;  4BY5 A;  5D7F A;  3PM8 A;  2CT9 A;  2OTG B;  4Q04 A;  2KQY A;  4GFT A;  1EG4 A;  3TDU A;  2JTZ A;  2L98 A;  3JVT C;  1AJ4 A;  3WNX B;  5AEQ A;  5JOL A;  1B8L A;  3TZ1 A;  2LE9 B;  3PAL A;  1SCV A;  1SMG A;  1XA5 A;  2AAO A;  4GGN A;  4YI8 A;  1UHI A;  2JRF A;  1KWO C;  2LHI A;  5CSJ A;  4YGC B;  1CFF A;  3D0Y B;  1HQV A;  2WND A;  2MLE C;  3HCM A;  2MJW B;  4C0J A;  4MZJ A;  2LLT A;  1QJT A;  1B7T Z;  2D8N A;  3WHU B;  1BG1 A;  2ZFD A;  1XFW O;  1CLM A;  2BBN A;  2MA2 A;  4YGB B;  1AVS A;  2KAX A;  1MHO A;  3FIA A;  5GQQ C;  2JTT A;  2LLS A;  2WCB A;  1PK0 D;  2HF5 A;  1YRU B;  2JT3 A;  2I7A A;  1S5G Z;  1PVA A;  2BCA A;  3I5I C;  2KFF A;  2BE6 A;  2F3Z A;  1W7J B;  2WOS A;  1G4Y R;  2JT8 A;  5CSI A;  2JOJ A;  1CLB A;  3LCP C;  1A75 A;  4R1E A;  5I2Q A;  1KFX L;  3TS5 C;  4ETO A;  1J1D A;  1M45 A;  2MLF C;  3M0W A;  2JC2 A;  1X02 A;  1YUT A;  2KDH A;  3BQ3 A;  4I5N B;  4QJ3 B;  3BUN B;  3SIA A;  1ZFS A;  3VRN A;  1DJI A;  1A29 A;  1OSA A;  4CPV A;  4P5O E;  1QLS A;  2GGZ A;  4MLW A;  2OS8 C;  2O60 A;  5J3X A;  1YVH A;  4CLN A;  1GGW A;  1KSM A;  1NPQ A;  2L50 A;  2WOR A;  5DKN A;  1K2H A;  1N2D A;  1ZMZ A;  2L4H A;  2LAN A;  2JUL A;  4AOM A;  2P6B B;  3DF0 A;  3PN7 B;  4GAO A;  3IF7 A;  2F2P A;  1MWN A;  4MVF A;  4E68 A;  1Y6W A;  2KI6 C;  3JTD B;  2ZKM X;  4PE0 A;  1C7W A;  1F4O A;  1JUO A;  1SL8 A;  2JNX A;  3BUW B;  1YRT B;  4U8D A;  3O6B A;  3TUY C;  2LNK A;  1DJX A;  1NWD A;  1J7P A;  4QJ5 B;  2L2E A;  1U5I B;  1XFU O;  2KHN A;  5D69 A;  1B47 A;  1F4Q A;  1M39 A;  2CNP A;  2LUC A;  3GOF A;  1QTX A;  4I5J A;  1KK7 Y;  1TN4 A;  4F0Z B;  1DTL A;  3I5H C;  3DVJ A;  1SRA A;  1EG3 A;  4PHJ A;  3PFV A;  1RTP 1;  3DVM A;  4JQ0 D;  1KFX S;  2M9G A;  3NSK A;  2PAS A;  2LVV A;  4A4B A;  1NCY A;  1J7Q A;  1R2U A;  1CM1 A;  3I5G B;  1RWY A;  1NX1 A;  1N0Y A;  2EGD A;  1R6P A;  1J1E A;  2F33 A;  1M63 B;  1SNL A;  1YR5 A;  1DGU A;  1YUR A;  5B8I B;  1A75 B;  4HSZ A;  1WLM A;  2JWW A;  1KSO A;  2LV7 A;  4PAL A;  1CFD A;  1ZUZ A;  2LP3 A;  1YUS A;  3D0Y A;  1XK4 A;  2MRD A;  1ZAC A;  4PE4 A;  4ICB A;  4MRY A;  2MHH A;  1QV1 A;  1TCF A;  2OTG C;  1AHR A;  2NZ0 A;  2WCF A;  5BPJ A;  2OPO A;  1XYD A;  2KNE A;  2LMT A;  3K21 A;  3BUO B;  1H8B A;  1OOJ A;  2LHL A;  1CNP A;  1PVB A;  1SR6 C;  2KGB C;  4BY4 A;  1OMR A;  1QVI Y;  3DF0 B;  1KFU L;  1S3P A;  4UPG A;  1QAS A;  3KPX A;  1WRK A;  2TN4 A;  1E8A A;  1B9A A;  3AAK A;  4HRG A;  1MXL C;  2M1K B;  1SCM B;  1W7I B;  1UUS A;  2FOT A;  3E3R A;  1J7R A;  2LLU A;  2LVI A;  2VRG A;  2L4I A;  1S1E A;  4IL1 A;  4GNK B;  1IH0 A;  1DJW A;  4PHM A;  3FS7 A;  1MUX A;  4ORA B;  1DJG A;  4GGF A;  4MN0 A;  2Q4U A;  2BCX A;  4PDZ A;  2M29 A;  1KCY A;  1LVC D;  1TNX A;  2K8M B;  4AQJ A;  2G2B A;  4DCK A;  3RLZ A;  2BL0 B;  2CXJ A;  1FBV A;  2WCE A;  1NYA A;  1U5I A;  2H61 C;  5ER4 X;  2KSP A;  1EL4 A;  3NSL A;  1CFC A;  3GK2 A;  2Y1N A;  5JJG A;  3O2P A;  1SYM A;  3SG3 A;  2BEC A;  1WRZ A;  1KFU S;  2HET A;  1TNP A;  2ZN9 A;  1KK8 C;  1SKT A;  1RJV A;  4NDB A;  5I8N A;  4MBE A;  5ER5 A;  1SK6 D;  1LXF C;  2Y1M A;  1DJH A;  2O5G A;  2FJU B;  2JXL A;  1MXE A;  1OZO A;  2JXC A;  1CTR A;  2K7O A;  4PHK A;  1IJ5 A;  3JTD C;  1BOC A;  5G08 A;  4CFR A;  1OMD A;  1Y1A A;  1LA0 A;  2BKI B;  2M3W A;  3EK7 A;  2LMV A;  1K8U A;  1SBJ A;  4PE1 A;  5F6T A;  3KEV A;  5K89 A;  4ORB B;  5DKQ A;  5HKY A;  3NSI A;  2A4J A;  1MQ1 A;  4TNC A;  4DRW A;  1S36 A;  1GGZ A;  3ICB A;  2EC6 C;  1RFJ A;  2V53 A;  2NCO A;  3DD4 A;  1QIV A;  3OHM B;  1CKK A;  2M97 A;  5I2L A;  1K96 A;  5IBW A;  1XFX O;  3JVT B;  1NSH A;  1BOD A;  2K7C A;  1UP5 A;  1G8I A;  4WQ3 A;  1EJ3 A;  1DJY A;  1TIZ A;  1Y1U A;  4N1G A;  1EH2 A;  2F2O A;  1L2O C;  4YGA A;  2HPS A;  1QV0 A;  2HQ8 A;  1JWD A;  4WRI A;  2COL B;  3SG5 A;  4JWQ A;  1SL7 A;  2MAZ A;  5AAN A;  1NX0 A;  4N5X A;  2K0J A;  3VGO A;  3I5F C;  1AJ5 A;  1Y0V H;  3TDZ A;  1DJZ A;  1K90 D;  1CDM A;  5AXI A;  3AKA A;  4P2Y B;  1CFP A;  1G33 A;  1WDC B;  4MRX A;  5HLO A;  2GV5 A;  3VRO A;  1B1G A;  1K94 A;  3FWC A;  1NX2 A;  1CM4 A;  2JT0 A;  1PAL A;  5CSF A;  3SIB A;  1ALV A;  4MZK A;  2K61 A;  1A2X A;  1QIW A;  2KAY A;  2ZN8 A;  1BR4 B;  3PLF B;  4FQO A;  4GBA A;  5CPV A;  1S5G Y;  2F8P A;  2AUC A;  2JPT A;  1UHH A;  1TNQ A;  4ZCU A;  4C0L A;  3H4S E;  3TS5 B;  3CR5 X;  1K9P A;  2E30 A;  4HRH A;  3LL8 B;  2IS9 A;  1B8C A;  1GJY A;  1PSB A;  2DOQ A;  2KGR A;  1QX2 A;  2FCE A;  2HQW A;  2LUX A;  1K9U A;  2M1U A;  2NCP A;  2QPT A;  3OB1 B;  1JC2 A;  1F55 A;  3LK1 A;  3AKB A;  1MF8 B;  3HX4 A;  1QXP A;  2ISD A;  3BUX B;  4C0K A;  2KBI A;  3FWB A;  3EVV A;  1KQV A;  3WHT B;  1VRK A;  4PE7 A;  5KU1 A;  3CWG A;  2F3Y A;  2PMY A;  1IWQ A;  1XO5 A;  1YVL A;  1M31 A;  1YUU A;  1UHN A;  3IQO A;  2QAC A;  3DVE A;  2RGI A;  1PSR A;  2G9B A;  2KI4 B;  1XK4 C;  1LA3 A;  3I5H B;  4D1E A;  1BR1 B;  3EKH A;  2SAS A;  2SCP A;  3MSE B;  1KQM B;  3BOW A;  1RK9 A;  2K7D A;  1CDP A;  5I2O A;  4OKH A;  3SG6 A;  1IGV A;  5PAL A;  1S6C A;  2I18 A;  2KQ6 A;  2LMU A;  1OZS A;  2LM5 A;  1CB1 A;  4MZL A;  4OV2 A;  3SG4 A;  1FI6 A;  2PAL A;  2M0R A;  1CDL A;  5KSZ A;  1BU3 A;  1NX3 A;  1REC A;  1XFY O;  3VRP A;  1V1F A;  3CR2 A;  1IQ3 A;  1C07 A;  3NSO A;  3EVR A;  3EKJ A;  1FW4 A;  2I94 A;  1YX8 A;  2GGM A;  4M2O A;  3TDI A;  4NDD A;  1YX7 A;  2ZRT A;  1BF5 A;  2K2F A;  1F54 A;  4I5L B;  2BE4 A;  5HKZ A;  4USL A;  3A4U B;  1IG5 A;  3ZNI A;  1J7O A;  5TNC A;  1UWO A;  4GGF C;  1AP4 A;  1SR6 B;  3VRR A;  1TOP A;  3PN7 C;  4YGE B;  1QX5 B;  1S26 D;  3LK0 A;  3CZT X;  1WY9 A;  4NQG A;  1KK7 Z;  1AUI B;  1SY9 A;  1TCO B;  4YBH B;  2KOT A;  2M49 B;  1CLL A;  1EXR A;  3KF9 A;  1TNW A;  1JFK A;  1K9K A;  2CTN A;  3KO0 A;  3O78 A;  1SL9 A;  2CCM A;  1DF0 A;  4A4C A;  4CID A;  2PRU A;  1DVI A;  1QLK A;  4DIR A;  4MSP A;  1WDC C;  3SG7 A;  4XJK A;  1N65 A;  1F71 A;  3BOW B;  5KTY A;  2JU0 A;  1NCZ A;  1F70 A;  1LIN A;  1ZOT B;  4L9M A;  4ORC B;  1H4B A;  3I5G C;  2LVK A;  4HRE E;  3BUM B;  3BYA A;  2BKH B;  2BBM A;  1NUB A;  1V1G A;  3RM1 A;  2L0P A;  1QX7 A;  4GUK A;  1PUL A;  2KFG A;  3F45 A;  5FYX A;  1TTX A;  2KBM A;  3NXA A;  2LVJ A;  3LLE A;  1KWO B;  1MR8 A;  1YTZ C;  2LAP A;  3OB2 B;  4FTG A;  3SG2 A;  1FPW A;  1NP8 A;  4M2Q A;  2CBL A;  2M7L A;  3CGA A;  1LKJ A;  2JZI A;  1K95 A;  2PSR A;  3EK4 A;  1TRF A;  3PSR A;  1IRJ A;  2KI6 D;  1KK8 B;  4OVN F;  1JBA A;  2KFH A;  4PHN A;  2I2R E;  1QVI Z;  1J55 A;  2JNF A;  2K7B A;  1CDN A;  1WRL A;  2L5X B;  3GK4 X;  1JF0 A;  1IKU A;  4I5K A;  1B8R A;  2ZND A;  1CMF A;  5HYD A;  1BLQ A;  1B7T Y;  5HLV A;  2JQ6 A;  2L51 A;  3WXA A;  3I5I B;  2ZRS A;  3CLN A;  5HKW A;  1UUR A;  1K93 D;  3OX6 A;  3PAT A;  1IJ6 A;  2NXQ A;  1BMO A;  3BXK A;  2NLN A;  3C1V A;  2LP2 A;  2BCB A;  2LC5 A;  5DKR A;  1HT9 A;  2Q91 A;  4OCI A;  1SCM C;  2Y4Q A;  1JF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...