2HETA

Non-myristoylated bovine recoverin (truncated at c-terminus) with calcium bound to ef-hand 3
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
182
structure length
182
Chain Sequence
LSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Recoverin
publication title Tuning of a neuronal calcium sensor.
pubmed doi rcsb
source organism Bos taurus
total genus 55
structure length 182
sequence length 182
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2hetA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2hetA01
2KOTA 5HKZA 3AKAA 2JOJA 3HX4A 1SCMB 1RWYA 1JFKA 4PCWA 2GGMA 1VRKA 3I5GB 2M1UA 3RLZA 4CIDA 4AOMA 4YBHB 1Y1XA 3JVTB 1WDCC 1DF0B 2AAOA 2JWWA 3EKJA 4GGFC 3IQQA 1F8HA 3DVEA 5JJGA 3I5FC 3C1VA 4GUKA 2I7AA 4M2OA 2LANA 1B9AA 3BYAA 2KBIA 3AAJA 2CXJA 3D0YA 4USLA 5CSNA 1TNQA 1YR5A 1GGZA 2I18A 3NSKA 4XJKA 2LNKA 3GK2A 1SR6B 1SW8A 1TIZA 2M9GA 1K2HA 1DJGA 5FYXA 5CSFA 1BF5A 1KK7Y 2L2EA 5HLOA 3SIBA 1V1FA 2PVBA 1JBAA 2L5XB 3OB2B 1CLBA 1BT6A 2TN4A 2KI4B 2KI6C 3IQOA 1W7JB 2WCBA 1EL4A 3D10A 1DJXA 4I5JA 1J55A 4GNKB 4GAOA 1L7ZA 2RGIA 4ICBA 4TNCA 5ER5A 2NCOA 2ZN8A 1F70A 1C07A 1B4CA 1N2DA 1XK4C 2LC5A 4JWQA 2M8UA 3BOWB 3DVMA 1QXPA 2IS9A 3SIAA 4N5XA 1XFUO 2KQ6A 3TUYB 1GGWA 3JTDB 2WOSA 3SG2A 1IJ5A 3BXKA 2MBXA 1BG1A 2K7CA 1MR8A 1RJVA 1PSBA 2PASA 2ZRTA 1B7TZ 5HKYA 2Y5IA 3EVUA 1JF0A 1JF2A 4MZJA 4GGNA 1FF1A 2ZN9A 1J1DA 1R2UA 1K95A 2WNDA 4E68A 1ALVA 4P2YB 1MHOA 1CDLA 2K0JA 2KQYA 5PALA 2MAZA 1DJIA 1B8LA 1SK6D 1TCOB 2CTNA 2WC8A 2KI6D 5CSJA 3SG7A 1PSRA 3VROA 1BJFA 3RM1A 4OKHA 3IF7A 1EJ3A 2LLUA 1IG5A 2MRDA 1KK7Z 1MUXA 2P6BB 2KGRA 1M31A 4A4BA 4L9MA 1K8UA 1F71A 2KFFA 1AJ4A 1XO5A 2JPTA 2MHHA 5AERA 1DMOA 1F54A 4P5OE 1PK0D 2I2RE 1CLMA 2LP2A 5IBWA 4MZLA 2CCMA 3FWBA 3WHUB 1AHRA 2BBMA 1MXEA 2L0PA 1OQPA 1XA5A 2DOQA 2EC6C 4Q04A 2NCPA 3CGAA 3SJSA 5D7FA 5AEQA 2ISDA 4M2PA 1JWDA 1Y1AA 2LHLA 1YURA 1RK9A 1DGUA 2LM5A 4GGFA 3ZNIA 1JSAA 4MZKA 3FIAA 4PHJA 4XJKB 4YRUA 4OR9B 5B8IB 1Y1UA 1JFJA 2PRUA 1CTRA 1XVJA 2CBLA 2OS8C 1F55A 1NCYA 1NP8A 3BUOB 4DRWA 2BECA 3LCPC 2AMIA 2K7DA 2JXCA 1SCMC 2JULA 2JTTA 4YGBB 3SG5A 1NPQA 3I5GC 4CLNA 1KK8B 1NYAA 3DF0A 3PLFB 1IQ5A 2HPSA 3E3RA 3I5HB 4OV2A 1S6CA 2JC2A 3EVRA 4QJ3B 4WRIA 3JVTC 4YGCB 3A8RA 1GJYA 1PULA 3LK0A 4YI9A 1OOJA 2JRFA 1CB1A 4MN0A 3KHEA 3H4SE 2KSPA 1L2OB 4YI8A 1XK4A 4PALA 1JUOA 5K89A 3F45A 2KNEA 1FI6A 1SR6C 2COLB 2BE6A 3KO0A 1ZOTB 2NXQA 3KPXA 1QX2A 4MVFA 1FW4A 3TDZA 2KI4C 1AK8A 1U5IA 1DT7B 3HCMA 1CM4A 3CS1A 1A29A 3DD4A 1S3PA 4NDBA 4FTGA 1CDNA 1S5GY 1Y0VH 1D1OA 2BL0B 2OPOA 5I2OA 1OSAA 1S6IA 1YVLA 3PM8A 1OZSA 4BY4A 1NIWA 1CM1A 2KBMA 3BUWB 1CFCA 3O6BA 2HQWA 5CSIA 2LMTA 2F8PA 1SL7A 3OX6A 1A4PA 3I5IB 1CFPA 5G08A 1MF8B 1A2XA 1QTXA 3TUYC 1OMVA 2MA2A 2F2PA 3JTDC 4PE1A 1SRAA 1SMGA 2KYFA 4WQ2A 4GBAA 1NCZA 1NWDA 3PSRA 1WY9A 4I5NB 1LXFC 2KHNA 2H2KA 2L98A 2NLNA 1GQMA 2QPTA 2BCAA 2K8MB 3AAKA 2HETA 4YGAA 3SG4A 4QJ5B 2KGBC 3TDIA 1K9PA 1NUBA 1X02A 1IH0A 1V1GA 1DVIA 3NSLA 5I2LA 3O2PA 2PSRA 1ZMZA 1UHKA 3NXAA 1DJWA 2O60A 1YVHA 1WDCB 2EHBA 3NSIA 2D8NA 2EGDA 3OB1B 4ORBB 1FPWA 1QATA 2CNPA 1CMFA 1F4OA 1OMDA 4I5KA 2M3WA 4DIRA 3BUXB 3WNXB 5DKQA 2JT8A 4NQGA 2BCBA 3M0WA 2PMYA 2ZRSA 4MEWA 1HQVA 1YRTB 2ZKMX 4YGDB 1IKUA 1FI5A 3CR5X 2G9BA 3DF0B 1QVIY 4AQIA 2VRGA 4MSPA 1S5GZ 2M0RA 1KQVA 1CMGA 2HQ8A 1UURA 1W7IB 1TRFA 2NZ0A 2WCFA 2LVKA 1RROA 5TNCA 1UP5A 2KFGA 4GPLB 1BR4B 2Y4QA 2OTGB 1KSOA 1KCYA 3PFVA 1YTZC 1NX0A 2M29A 2L50A 1PVAA 2JNFA 1AUIB 1IJ6A 1KQMB 2JU0A 1CNPA 4OCIA 4HRGA 2LMUA 3PN7C 1DGVA 4AQJA 1B47A 1AJ5A 1Y6WA 2FJUB 2GGZA 3WXAA 1WRLA 1SL9A 5BPJA 1NX3A 2O5GA 2LUCA 1BOCA 2JZIA 1ZACA 4PE4A 1CDPA 1XFXO 2SASA 4C0JA 2Y1MA 5DKNA 1Q80A 3D0YB 2LMVA 4A4CA 1SL8A 4HREE 2E6WA 3CR4X 3CTNA 1M39A 2JT3A 1NX1A 2L4HA 1L2OC 3GK4X 2HF5A 3VRQA 1WLZA 2AUCA 2LLSA 1YX8A 3BOWA 2F33A 1SPYA 3EK8A 2K2FA 1IGVA 3OX5A 1BODA 4C0LA 4CFQA 1OMRA 5JOLA 4CPVA 2K7BA 3KF9A 1IQ3A 1B8RA 1QVIZ 1B1GA 2G2BA 1TTXA 1M46A 2BE4A 1J7RA 1CKKA 1DJZA 1UUSA 2LV7A 3A4UB 4ETOA 1TCFA 2A4JA 2FCEA 1N65A 1BU3A 1QV0A 4UPGA 2JT0A 1SNLA 2B1UA 4N1GA 1J7PA 1NSHA 1EXRA 1S1EA 3I5IC 3GOFA 4R1EA 1XFWO 4ORCB 4XYNA 5I8NA 1WRKA 5CPVA 3FWCA 1TN4A 2FOTA 3EK7A 3EKHA 4MRYA 2LCPA 1EG3A 2M7LA 1MQ1A 2H61C 5HKWA 2JXLA 3TS5B 1PRWA 1IWQA 4QJ4B 1NCXA 1YRUB 1A03A 1B7TY 5KU1A 1LVCD 1BMOA 1KFXS 1KWOB 5F6TA 3GK1A 1SYMA 3VRPA 1CFFA 1BLQA 1TNXA 1K96A 2PALA 1PVBA 1S6JA 3KEVA 3CR2A 2LVVA 1AVSA 3FS7A 5AANA 4MLWA 4U8DA 4HSZA 3EVVA 1MXLC 1SKTA 1SY9A 1G33A 3BUMB 2MLFC 3TZ1A 1G8IA 2I94A 3CWGA 1QX5B 3BUNB 1KFUL 2BBNA 1M63B 1XYDA 2MJWB 4MRXA 1ALWA 1IRJA 1A75A 1LA0A 1S26D 2JTZA 1R6PA 1UWOA 5I2QA 1J7OA 2JNXA 4NDDA 3ICBA 1CDMA 1KFUS 1QLSA 1ZUZA 2E30A 3I5FB 3TDUA 4D1EA 4WQ3A 2M97A 1TNWA 1QS7A 2KAXA 4YGEB 3ZWHA 3DVJA 3SG6A 2LAPA 2WCEA 1WLMA 2ZFDA 2L4IA 2FCDA 2OTGC 1H8BA 3BQ3A 1KSMA 2V53A 1PALA 5DKRA 1KQMC 2BKIB 4NDCA 2Q91A 1DJHA 2M7NA 1K9KA 1G4YR 5GQQC 1HT9A 1F4QA 1NX2A 1XFYO 2F3YA 3SG3A 1QV1A 4I5LB 2K61A 1TNPA 1ZFSA 2F2OA 1FBVA 1UHIA 1K93D 4F0ZB 2LHIA 1S36A 4HRHA 1DF0A 2LP3A 4PHKA 2KAYA 2K2AA 2KFHA 1WRZA 2LVJA 4JPZB 2SCPA 2KAVA 4ZCVA 1LKJA 2LLTA 4ZCUA 1N0YA 1DTLA 4N1FA 1JC2A 1YUSA 1QIWA 1U5IB 2KDHA 1CFDA 1K9UA 4BY5A 4M2QA 3OP0A 4MBEA 1KK8C 1AP4A 1OZOA 4ORAB 1QIVA 1YX7A 3VGOA 3VRNA 4CFRA 1QASA 5KSZA 1K94A 2LE9B 3I5HC 3MSEB 1QLKA 3DVKA 4FQOA 3CLNA 2H61A 3WHTB 4PHMA 5D69A 4PHNA 5J3XA 2F3ZA 3LL8B 3O78A 1UHHA 3OHMB 3CZTX 1XFVO 2LVIA 5KTYA 1M45A 3K21A 5AXIA 1J7QA 1H4BA 3EK4A 1TOPA 2R2IA 1UHNA 1C7WA 4JQ0D 2JQ6A 4DCKA 4OVNF 1C7VA 3LLEA 1QJTA 2QACA 1YUTA 1RFJA 1B8CA 1K90D 2L51A 3PN7B 4PE7A 4C0KA 1OE9B 2GV5A 1A75B 5HLVA 2ZNEA 5AFPA 1SCVA 3LK1A 2BL0C 2ZNDA 2LUXA 1BR1B 3TS5C 1LINA 2KYCA 1LA3A 2M1KB 1RECA 4PE0A 3AKBA 2EC6B 1EG4A 2MLEC 1KWOC 1E8AA 5HYDA 4DS7A 5ER4X 1EH2A 2BKHB 1RTP1 4DUQA 1QX7A 3O4YA 1UHJA 3NSOA 1J1EA 3VRRA 1MWNA 1CLLA 4GFTA 1DJYA 3PALA 4PDZA 2CT9A 2K7OA 2OS8B 4IL1A 1KFXL 2Q4UA 2WORA 1YUUA 1ODBA 3PATA 2M49B 1SBJA 2BCXA 3QRXA 1XFZO 2Y1NA
chains in the Genus database with same CATH superfamily
2KOTA 5HKZA 3AKAA 2JOJA 3HX4A 1SCMB 1RWYA 1JFKA 4PCWA 2GGMA 1VRKA 3I5GB 3S0BA 2M1UA 3RLZA 4CIDA 4AOMA 4YBHB 1Y1XA 3JVTB 1WDCC 1DF0B 2AAOA 2JWWA 3EKJA 4GGFC 3IQQA 1F8HA 3DVEA 5JJGA 3I5FC 3C1VA 4GUKA 2I7AA 4M2OA 2LANA 1B9AA 3BYAA 2KBIA 3AAJA 2CXJA 3D0YA 4USLA 5CSNA 1TNQA 1YR5A 1GGZA 2I18A 3NSKA 4OZDA 4XJKA 2LNKA 3GK2A 1SR6B 1SW8A 1TIZA 2M9GA 1K2HA 1DJGA 5FYXA 5CSFA 1BF5A 1KK7Y 2L2EA 5HLOA 3SIBA 1V1FA 2PVBA 1JBAA 2L5XB 3OB2B 1CLBA 1BT6A 2TN4A 2KI4B 2KI6C 3IQOA 2P71A 1W7JB 3QMEA 2WCBA 1EL4A 3Q8IA 3D10A 1DJXA 4I5JA 1J55A 4GNKB 4GAOA 1L7ZA 2RGIA 4ICBA 4TNCA 5ER5A 2NCOA 2ZN8A 1F70A 1C07A 1B4CA 1N2DA 1OOIX 1XK4C 2LC5A 2M8UA 4IJ7A 4JWQA 3BOWB 3DVMA 1QXPA 2IS9A 3SIAA 4N5XA 1XFUO 2KQ6A 3TUYB 1GGWA 3JTDB 2WOSA 3SG2A 1IJ5A 2L2CA 2BAPA 3BXKA 2MBXA 1BG1A 2K7CA 5FI2A 1MR8A 1RJVA 1PSBA 2PASA 3S0DA 2ZRTA 1B7TZ 5HKYA 2Y5IA 3EVUA 1JF0A 1JF2A 4MZJA 1DC1A 4GGNA 1FF1A 1P28A 2ZN9A 1J1DA 1R2UA 1K95A 2WNDA 2H8VA 4E68A 1QWVA 3CZ1A 1ALVA 4P2YB 1MHOA 1CDLA 2K0JA 1OOFA 2KQYA 5PALA 2MAZA 1TWOA 1DJIA 4PT1A 1B8LA 1SK6D 1TCOB 2CTNA 2WC8A 2KI6D 5CSJA 3SG7A 1PSRA 3VROA 1BJFA 3RM1A 4OKHA 3IF7A 1EJ3A 2LLUA 3RZSA 1IG5A 2MRDA 1KK7Z 1MUXA 2P6BB 2PQLA 2KGRA 1M31A 4A4BA 4L9MA 1K8UA 1F71A 2KFFA 1AJ4A 1XO5A 2JPTA 2MHHA 5AERA 1DMOA 1F54A 4P5OE 1PK0D 2I2RE 1CLMA 2LP2A 5IBWA 4MZLA 3VB1A 3B87A 2CCMA 3FWBA 3WHUB 1AHRA 2BBMA 1MXEA 2L0PA 1OQPA 3CZ2A 1XA5A 2DOQA 2EC6C 4Q04A 2NCPA 3CGAA 3SJSA 5D7FA 5AEQA 2ISDA 4M2PA 1JWDA 1Y1AA 2LHLA 1YURA 1RK9A 1DGUA 2LM5A 3CZ0A 4GGFA 3ZNIA 1JSAA 4MZKA 3FIAA 4PHJA 4XJKB 4YRUA 4OR9B 5B8IB 1Y1UA 1JFJA 2PRUA 1CTRA 2QEOA 1XVJA 2CBLA 2OS8C 1Z4HA 1NCYA 1NP8A 3BUOB 3NGVA 2BECA 3LCPC 4DRWA 1F55A 2AMIA 3L4AA 2K7DA 1ORGA 2JXCA 3B86A 1SCMC 2JULA 2JTTA 4YGBB 3SG5A 1NPQA 3I5GC 4CLNA 1KK8B 1NYAA 3D74A 3DF0A 3PLFB 3SS5A 1IQ5A 2HPSA 3E3RA 3I5HB 4OV2A 1S6CA 2JC2A 3EVRA 4QJ3B 4WRIA 3JVTC 4YGCB 3A8RA 1GJYA 1W9ZA 2GTEA 1PULA 3LK0A 4YI9A 1OOJA 2JRFA 1CB1A 4MN0A 3KHEA 3H4SE 2KSPA 3D75A 1L2OB 1OOHA 1OW4A 4YI8A 1XK4A 4PALA 1JUOA 5K89A 3F45A 2KNEA 1FI6A 1SR6C 2COLB 2KLEA 1GM0A 2BE6A 3KO0A 1ZOTB 2NXQA 3KPXA 1QX2A 4MVFA 3K1EA 1FW4A 3TDZA 2KI4C 3DY9A 3BFBA 1AK8A 1U5IA 1DT7B 3HCMA 1CM4A 3CS1A 1A29A 3DD4A 1S3PA 4NDBA 4FTGA 1CDNA 1S5GY 1Y0VH 1D1OA 2BL0B 2OPOA 5I2OA 1OSAA 1S6IA 1YVLA 2P70A 3PM8A 1OZSA 4BY4A 1NIWA 1CM1A 3D73A 2KBMA 3BUWB 1CFCA 3R1PA 3O6BA 2HQWA 5CSIA 2LMTA 2F8PA 1SL7A 1DEKA 1A4PA 3I5IB 3OX6A 1CFPA 3OBVA 5G08A 1MF8B 1A2XA 1QTXA 4INXA 3TUYC 1OMVA 3B6XA 2MA2A 2F2PA 3JTDC 4PE1A 1SRAA 1SMGA 2KYFA 4WQ2A 4GBAA 1NCZA 1NWDA 3PSRA 1WY9A 4I5NB 1LXFC 2KHNA 2H2KA 2L98A 2NLNA 1GQMA 2QPTA 2BCAA 2K8MB 3AAKA 2HETA 4YGAA 3SG4A 4QJ5B 2KGBC 3NHTA 3TDIA 1K9PA 1NUBA 1X02A 1IH0A 1V1GA 1DVIA 3NSLA 3EG5B 5I2LA 3O2PA 2PSRA 1ZMZA 1UHKA 3NXAA 5I94A 1DJWA 2O60A 1YVHA 1WDCB 2EHBA 3NSIA 2D8NA 2EGDA 3OB1B 4ORBB 1FPWA 2WC5A 1QATA 2CNPA 1CMFA 1F4OA 1OMDA 3CDNA 4I5KA 2M3WA 4DIRA 3BUXB 3WNXB 5DKQA 2JT8A 4NQGA 2BCBA 1C3ZA 3M0WA 2PMYA 2ZRSA 4MEWA 1HQVA 1YRTB 2ZKMX 3DZTA 4YGDB 4JKTA 1TUZA 1IKUA 1FI5A 3CR5X 3SS4A 2G9BA 2WCMA 2WCKA 3DF0B 1QVIY 4AQIA 2VRGA 4MSPA 1S5GZ 2M0RA 1KQVA 1CMGA 2HQ8A 3S0FA 1T14A 1UURA 1W7IB 1TRFA 2NZ0A 2WCFA 2LVKA 2FJYA 1RROA 5TNCA 3S0AA 1UP5A 2KFGA 4GPLB 1BR4B 2Y4QA 2OTGB 1KSOA 1KCYA 3PFVA 1YTZC 1NX0A 2M29A 2L50A 1PVAA 2JNFA 1AUIB 1IJ6A 1KQMB 2JU0A 3D77A 5FI7A 1CNPA 4OCIA 4HRGA 2LMUA 3PN7C 1DGVA 4AQJA 1DQEA 1B47A 1AJ5A 1Y6WA 2FJUB 2GGZA 3WXAA 1WRLA 1SL9A 5EL2A 1NX3A 2O5GA 3IVTA 2LUCA 3OGNA 5BPJA 1BOCA 2JZIA 4JD9A 1ZACA 4PE4A 1CDPA 1XFXO 2SASA 4C0JA 2Y1MA 5DKNA 1Q80A 5DICA 3D0YB 3DXLA 2LMVA 4A4CA 1SL8A 3DYEA 2WCJA 3FE6A 4HREE 3O4XA 2E6WA 3CR4X 3CTNA 1M39A 2JT3A 1NX1A 2L4HA 1L2OC 3GK4X 2HF5A 3VRQA 1WLZA 2AUCA 2LLSA 1YX8A 3BOWA 4F7FA 2F33A 1SPYA 3EK8A 2K2FA 1IGVA 1TUJA 3OX5A 1BODA 4C0LA 4CFQA 1OMRA 5JOLA 4FQTA 2QEVA 4CPVA 3BJHA 2K7BA 3KF9A 1IQ3A 1B8RA 1QVIZ 1B1GA 2G2BA 1TTXA 1M46A 2BE4A 1J7RA 1CKKA 2KPHA 1DJZA 1UUSA 2LV7A 3A4UB 4ETOA 1TCFA 2A4JA 2FCEA 1N65A 1BU3A 1QV0A 4UPGA 2JT0A 4KYNA 1SNLA 2B1UA 4N1GA 1J7PA 3R1OA 1NSHA 1EXRA 1S1EA 2WC6A 3I5IC 3GOFA 4R1EA 3S0EA 1XFWO 4ORCB 4XYNA 5I8NA 1WRKA 5CPVA 3FWCA 1TN4A 2FOTA 3EK7A 3EKHA 4MRYA 2LCPA 2QEBA 1EG3A 2M7LA 1MQ1A 2H61C 5HKWA 2JXLA 3TS5B 1PRWA 1IWQA 4QJ4B 1NCXA 2YGUA 1YRUB 1A03A 1B7TY 5KU1A 1LVCD 1BMOA 1KFXS 1KWOB 5F6TA 1SSEB 3GK1A 1SYMA 3VRPA 1CFFA 1BLQA 1TNXA 1K96A 2PALA 1DELA 1PVBA 1XFRA 1S6JA 3KEVA 3CR2A 3BFHA 2LVVA 1AVSA 3FS7A 5AANA 4MLWA 4U8DA 4HSZA 3EVVA 1MXLC 1SKTA 1SY9A 1G33A 3BUMB 2MLFC 3TZ1A 1G8IA 2I94A 3CWGA 1QX5B 3BUNB 1KFUL 1M63B 2BBNA 1XYDA 2MJWB 4MRXA 1ALWA 1IRJA 1A75A 1LA0A 1S26D 2JTZA 3BFAA 1R6PA 1UWOA 5I2QA 1J7OA 2JNXA 4NDDA 3ICBA 1CDMA 1KFUS 1QLSA 1ZUZA 2E30A 3I5FB 3TDUA 4D1EA 4WQ3A 2M97A 1TNWA 1QS7A 2KAXA 4YGEB 3S0GA 3ZWHA 3DVJA 3SG6A 3UO9A 2LAPA 2WCEA 1WLMA 3R1VA 2ZFDA 2L4IA 2FCDA 2OTGC 1H8BA 1C3YA 3BQ3A 1KSMA 2V53A 1PALA 5DKRA 1KQMC 2BKIB 4NDCA 2Q91A 1DJHA 2M7NA 1K9KA 2WCHA 3FE8A 3PJIA 1G4YR 5GQQC 1HT9A 2K60A 1F4QA 1NX2A 3L4LA 1XFYO 3PM2A 2F3YA 3SS3A 1QV1A 3SG3A 4I5LB 2K61A 1TNPA 1ZFSA 2F2OA 1FBVA 1UHIA 1K93D 4F0ZB 5FI6A 2LHIA 1S36A 4HRHA 1DF0A 2LP3A 4PHKA 1Z2CB 2K2AA 2KAYA 2KFHA 1WRZA 2LVJA 4JPZB 2SCPA 2KAVA 4ZCVA 1LKJA 2QEHA 4INWA 2LLTA 3FE9A 4ZCUA 3UNWA 1N0YA 1DTLA 4N1FA 1JC2A 1YUSA 3R72A 1QIWA 1U5IB 2KDHA 2PYQA 1CFDA 1K9UA 4BY5A 2WCLA 4M2QA 3OP0A 4MBEA 1KK8C 1AP4A 1OZOA 4ORAB 1QIVA 1YX7A 3VGOA 3VRNA 4CFRA 1QASA 5KSZA 1K94A 2LE9B 3I5HC 3MSEB 1QLKA 3DVKA 1IIOA 4FQOA 3CLNA 3CYZA 2BNXA 5HL1A 2H61A 3WHTB 4PHMA 5D69A 3CABA 4PHNA 5J3XA 2F3ZA 3LL8B 3O78A 1UHHA 3OHMB 3CZTX 1XFVO 2LVIA 5KTYA 1M45A 3K21A 5AXIA 1J7QA 1H4BA 3EK4A 3N7HA 1TOPA 2R2IA 3V2LA 2KLDA 1UHNA 3D76A 1C7WA 1OOGA 4JQ0D 2JQ6A 4DCKA 4OVNF 5D3OA 1C7VA 3LLEA 1QJTA 2QACA 1YUTA 1RFJA 1B8CA 1K90D 2JPOA 2L51A 3PN7B 4PE7A 4C0KA 1OE9B 2GV5A 1A75B 5HLVA 2ZNEA 3QRXA 1SCVA 3LK1A 5AFPA 2BL0C 2ZNDA 2LUXA 1BR1B 3TS5C 1LINA 2KYCA 1LA3A 2M1KB 1RECA 2ERBA 3L47A 3AKBA 2EC6B 4PE0A 1EG4A 2MLEC 1KWOC 1E8AA 5HYDA 4DS7A 3NHIA 5ER4X 1EH2A 2BKHB 1RTP1 4DUQA 1QX7A 3O4YA 1UHJA 3NSOA 1J1EA 3VRRA 1MWNA 1CLLA 4GFTA 1DJYA 1LS8A 3PALA 4PDZA 2CT9A 2K7OA 2OS8B 4IL1A 1KFXL 2Q4UA 2WORA 1YUUA 1ODBA 2L5YA 3B88A 2M49B 1SBJA 3B7AA 2BCXA 3PATA 1XFZO 2Y1NA 3D78A 2QDIA
chains in the Genus database with same CATH topology
2KOTA 5HKZA 3AKAA 2JOJA 3HX4A 1SCMB 1RWYA 1JFKA 4PCWA 2GGMA 1VRKA 3I5GB 2M1UA 3RLZA 4CIDA 4AOMA 4YBHB 1Y1XA 3JVTB 1WDCC 1DF0B 2AAOA 2JWWA 3EKJA 4GGFC 3IQQA 1F8HA 3DVEA 5JJGA 3I5FC 3C1VA 4GUKA 2I7AA 4M2OA 2LANA 1B9AA 3BYAA 2KBIA 3AAJA 2CXJA 3D0YA 4USLA 5CSNA 1TNQA 1YR5A 1GGZA 2I18A 3NSKA 4XJKA 2LNKA 3GK2A 1SR6B 1SW8A 1TIZA 2M9GA 1K2HA 1DJGA 5FYXA 5CSFA 1BF5A 1KK7Y 2L2EA 5HLOA 3SIBA 1V1FA 2PVBA 1JBAA 2L5XB 3OB2B 1CLBA 1BT6A 2TN4A 2KI4B 2KI6C 3IQOA 1W7JB 2WCBA 1EL4A 3D10A 1DJXA 4I5JA 1J55A 4GNKB 4GAOA 1L7ZA 2RGIA 4ICBA 4TNCA 5ER5A 2NCOA 2ZN8A 1F70A 1C07A 1B4CA 1N2DA 1XK4C 2LC5A 4JWQA 2M8UA 3BOWB 3DVMA 1QXPA 2IS9A 3SIAA 4N5XA 1XFUO 2KQ6A 3TUYB 1GGWA 3JTDB 2WOSA 3SG2A 1IJ5A 3BXKA 2MBXA 1BG1A 2K7CA 1MR8A 1RJVA 1PSBA 2PASA 2ZRTA 1B7TZ 5HKYA 2Y5IA 3EVUA 1JF0A 1JF2A 4MZJA 4GGNA 1FF1A 2ZN9A 1J1DA 1R2UA 1K95A 2WNDA 4E68A 1ALVA 4P2YB 1MHOA 1CDLA 2K0JA 2KQYA 5PALA 2MAZA 1DJIA 1B8LA 1SK6D 1TCOB 2CTNA 2WC8A 2KI6D 5CSJA 3SG7A 1PSRA 3VROA 1BJFA 3RM1A 4OKHA 3IF7A 1EJ3A 2LLUA 1IG5A 2MRDA 1KK7Z 1MUXA 2P6BB 2KGRA 1M31A 4A4BA 4L9MA 1K8UA 1F71A 2KFFA 1AJ4A 1XO5A 2JPTA 2MHHA 5AERA 1DMOA 1F54A 4P5OE 1PK0D 2I2RE 1CLMA 2LP2A 5IBWA 4MZLA 2CCMA 3FWBA 3WHUB 1AHRA 2BBMA 1MXEA 2L0PA 1OQPA 1XA5A 2DOQA 2EC6C 4Q04A 2NCPA 3CGAA 3SJSA 5D7FA 5AEQA 2ISDA 4M2PA 1JWDA 1Y1AA 2LHLA 1YURA 1RK9A 1DGUA 2LM5A 4GGFA 3ZNIA 1JSAA 4MZKA 3FIAA 4PHJA 4XJKB 4YRUA 4OR9B 5B8IB 1Y1UA 1JFJA 2PRUA 1CTRA 1XVJA 2CBLA 2OS8C 1F55A 1NCYA 1NP8A 3BUOB 4DRWA 2BECA 3LCPC 2AMIA 2K7DA 2JXCA 1SCMC 2JULA 2JTTA 4YGBB 3SG5A 1NPQA 3I5GC 4CLNA 1KK8B 1NYAA 3DF0A 3PLFB 1IQ5A 2HPSA 3E3RA 3I5HB 4OV2A 1S6CA 2JC2A 3EVRA 4QJ3B 4WRIA 3JVTC 4YGCB 3A8RA 1GJYA 1PULA 3LK0A 4YI9A 1OOJA 2JRFA 1CB1A 4MN0A 3KHEA 3H4SE 2KSPA 1L2OB 4YI8A 1XK4A 4PALA 1JUOA 5K89A 3F45A 2KNEA 1FI6A 1SR6C 2COLB 2BE6A 3KO0A 1ZOTB 2NXQA 3KPXA 1QX2A 4MVFA 1FW4A 3TDZA 2KI4C 1AK8A 1U5IA 1DT7B 3HCMA 1CM4A 3CS1A 1A29A 3DD4A 1S3PA 4NDBA 4FTGA 1CDNA 1S5GY 1Y0VH 1D1OA 2BL0B 2OPOA 5I2OA 1OSAA 1S6IA 1YVLA 3PM8A 1OZSA 4BY4A 1NIWA 1CM1A 2KBMA 3BUWB 1CFCA 3O6BA 2HQWA 5CSIA 2LMTA 2F8PA 1SL7A 3OX6A 1A4PA 3I5IB 1CFPA 5G08A 1MF8B 1A2XA 1QTXA 3TUYC 1OMVA 2MA2A 2F2PA 3JTDC 4PE1A 1SRAA 1SMGA 2KYFA 4WQ2A 4GBAA 1NCZA 1NWDA 3PSRA 1WY9A 4I5NB 1LXFC 2KHNA 2H2KA 2L98A 2NLNA 1GQMA 2QPTA 2BCAA 2K8MB 3AAKA 2HETA 4YGAA 3SG4A 4QJ5B 2KGBC 3TDIA 1K9PA 1NUBA 1X02A 1IH0A 1V1GA 1DVIA 3NSLA 5I2LA 3O2PA 2PSRA 1ZMZA 1UHKA 3NXAA 1DJWA 2O60A 1YVHA 1WDCB 2EHBA 3NSIA 2D8NA 2EGDA 3OB1B 4ORBB 1FPWA 1QATA 2CNPA 1CMFA 1F4OA 1OMDA 4I5KA 2M3WA 4DIRA 3BUXB 3WNXB 5DKQA 2JT8A 4NQGA 2BCBA 3M0WA 2PMYA 2ZRSA 4MEWA 1HQVA 1YRTB 2ZKMX 4YGDB 1IKUA 1FI5A 3CR5X 2G9BA 3DF0B 1QVIY 4AQIA 2VRGA 4MSPA 1S5GZ 2M0RA 1KQVA 1CMGA 2HQ8A 1UURA 1W7IB 1TRFA 2NZ0A 2WCFA 2LVKA 1RROA 5TNCA 1UP5A 2KFGA 4GPLB 1BR4B 2Y4QA 2OTGB 1KSOA 1KCYA 3PFVA 1YTZC 1NX0A 2M29A 2L50A 1PVAA 2JNFA 1AUIB 1IJ6A 1KQMB 2JU0A 1CNPA 4OCIA 4HRGA 2LMUA 3PN7C 1DGVA 4AQJA 1B47A 1AJ5A 1Y6WA 2FJUB 2GGZA 3WXAA 1WRLA 1SL9A 5BPJA 1NX3A 2O5GA 2LUCA 1BOCA 2JZIA 1ZACA 4PE4A 1CDPA 1XFXO 2SASA 4C0JA 2Y1MA 5DKNA 1Q80A 3D0YB 2LMVA 4A4CA 1SL8A 4HREE 2E6WA 3CR4X 3CTNA 1M39A 2JT3A 1NX1A 2L4HA 1L2OC 3GK4X 2HF5A 3VRQA 1WLZA 2AUCA 2LLSA 1YX8A 3BOWA 2F33A 1SPYA 3EK8A 2K2FA 1IGVA 3OX5A 1BODA 4C0LA 4CFQA 1OMRA 5JOLA 4CPVA 2K7BA 3KF9A 1IQ3A 1B8RA 1QVIZ 1B1GA 2G2BA 1TTXA 1M46A 2BE4A 1J7RA 1CKKA 1DJZA 1UUSA 2LV7A 3A4UB 4ETOA 1TCFA 2A4JA 2FCEA 1N65A 1BU3A 1QV0A 4UPGA 2JT0A 1SNLA 2B1UA 4N1GA 1J7PA 1NSHA 1EXRA 1S1EA 3I5IC 3GOFA 4R1EA 1XFWO 4ORCB 4XYNA 5I8NA 1WRKA 5CPVA 3FWCA 1TN4A 2FOTA 3EK7A 3EKHA 4MRYA 2LCPA 1EG3A 2M7LA 1MQ1A 2H61C 5HKWA 2JXLA 3TS5B 1PRWA 1IWQA 4QJ4B 1NCXA 1YRUB 1A03A 1B7TY 5KU1A 1LVCD 1BMOA 1KFXS 1KWOB 5F6TA 3GK1A 1SYMA 3VRPA 1CFFA 1BLQA 1TNXA 1K96A 2PALA 1PVBA 1S6JA 3KEVA 3CR2A 2LVVA 1AVSA 3FS7A 5AANA 4MLWA 4U8DA 4HSZA 3EVVA 1MXLC 1SKTA 1SY9A 1G33A 3BUMB 2MLFC 3TZ1A 1G8IA 2I94A 3CWGA 1QX5B 3BUNB 1KFUL 2BBNA 1M63B 1XYDA 2MJWB 4MRXA 1ALWA 1IRJA 1A75A 1LA0A 1S26D 2JTZA 1R6PA 1UWOA 5I2QA 1J7OA 2JNXA 4NDDA 3ICBA 1CDMA 1KFUS 1QLSA 1ZUZA 2E30A 3I5FB 3TDUA 4D1EA 4WQ3A 2M97A 1TNWA 1QS7A 2KAXA 4YGEB 3ZWHA 3DVJA 3SG6A 2LAPA 2WCEA 1WLMA 2ZFDA 2L4IA 2FCDA 2OTGC 1H8BA 3BQ3A 1KSMA 2V53A 1PALA 5DKRA 1KQMC 2BKIB 4NDCA 2Q91A 1DJHA 2M7NA 1K9KA 1G4YR 5GQQC 1HT9A 1F4QA 1NX2A 1XFYO 2F3YA 3SG3A 1QV1A 4I5LB 2K61A 1TNPA 1ZFSA 2F2OA 1FBVA 1UHIA 1K93D 4F0ZB 2LHIA 1S36A 4HRHA 1DF0A 2LP3A 4PHKA 2KAYA 2K2AA 2KFHA 1WRZA 2LVJA 4JPZB 2SCPA 2KAVA 4ZCVA 1LKJA 2LLTA 4ZCUA 1N0YA 1DTLA 4N1FA 1JC2A 1YUSA 1QIWA 1U5IB 2KDHA 1CFDA 1K9UA 4BY5A 4M2QA 3OP0A 4MBEA 1KK8C 1AP4A 1OZOA 4ORAB 1QIVA 1YX7A 3VGOA 3VRNA 4CFRA 1QASA 5KSZA 1K94A 2LE9B 3I5HC 3MSEB 1QLKA 3DVKA 4FQOA 3CLNA 2H61A 3WHTB 4PHMA 5D69A 4PHNA 5J3XA 2F3ZA 3LL8B 3O78A 1UHHA 3OHMB 3CZTX 1XFVO 2LVIA 5KTYA 1M45A 3K21A 5AXIA 1J7QA 1H4BA 3EK4A 1TOPA 2R2IA 1UHNA 1C7WA 4JQ0D 2JQ6A 4DCKA 4OVNF 1C7VA 3LLEA 1QJTA 2QACA 1YUTA 1RFJA 1B8CA 1K90D 2L51A 3PN7B 4PE7A 4C0KA 1OE9B 2GV5A 1A75B 5HLVA 2ZNEA 5AFPA 1SCVA 3LK1A 2BL0C 2ZNDA 2LUXA 1BR1B 3TS5C 1LINA 2KYCA 1LA3A 2M1KB 1RECA 4PE0A 3AKBA 2EC6B 1EG4A 2MLEC 1KWOC 1E8AA 5HYDA 4DS7A 5ER4X 1EH2A 2BKHB 1RTP1 4DUQA 1QX7A 3O4YA 1UHJA 3NSOA 1J1EA 3VRRA 1MWNA 1CLLA 4GFTA 1DJYA 3PALA 4PDZA 2CT9A 2K7OA 2OS8B 4IL1A 1KFXL 2Q4UA 2WORA 1YUUA 1ODBA 3PATA 2M49B 1SBJA 2BCXA 3QRXA 1XFZO 2Y1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOT A;  5HKZ A;  3AKA A;  2JOJ A;  3HX4 A;  1SCM B;  1RWY A;  1JFK A;  4PCW A;  2GGM A;  1VRK A;  3I5G B;  2M1U A;  3RLZ A;  4CID A;  4AOM A;  4YBH B;  1Y1X A;  3JVT B;  1WDC C;  1DF0 B;  2AAO A;  2JWW A;  3EKJ A;  4GGF C;  3IQQ A;  1F8H A;  3DVE A;  5JJG A;  3I5F C;  3C1V A;  4GUK A;  2I7A A;  4M2O A;  2LAN A;  1B9A A;  3BYA A;  2KBI A;  3AAJ A;  2CXJ A;  3D0Y A;  4USL A;  5CSN A;  1TNQ A;  1YR5 A;  1GGZ A;  2I18 A;  3NSK A;  4XJK A;  2LNK A;  3GK2 A;  1SR6 B;  1SW8 A;  1TIZ A;  2M9G A;  1K2H A;  1DJG A;  5FYX A;  5CSF A;  1BF5 A;  1KK7 Y;  2L2E A;  5HLO A;  3SIB A;  1V1F A;  2PVB A;  1JBA A;  2L5X B;  3OB2 B;  1CLB A;  1BT6 A;  2TN4 A;  2KI4 B;  2KI6 C;  3IQO A;  1W7J B;  2WCB A;  1EL4 A;  3D10 A;  1DJX A;  4I5J A;  1J55 A;  4GNK B;  4GAO A;  1L7Z A;  2RGI A;  4ICB A;  4TNC A;  5ER5 A;  2NCO A;  2ZN8 A;  1F70 A;  1C07 A;  1B4C A;  1N2D A;  1XK4 C;  2LC5 A;  4JWQ A;  2M8U A;  3BOW B;  3DVM A;  1QXP A;  2IS9 A;  3SIA A;  4N5X A;  1XFU O;  2KQ6 A;  3TUY B;  1GGW A;  3JTD B;  2WOS A;  3SG2 A;  1IJ5 A;  3BXK A;  2MBX A;  1BG1 A;  2K7C A;  1MR8 A;  1RJV A;  1PSB A;  2PAS A;  2ZRT A;  1B7T Z;  5HKY A;  2Y5I A;  3EVU A;  1JF0 A;  1JF2 A;  4MZJ A;  4GGN A;  1FF1 A;  2ZN9 A;  1J1D A;  1R2U A;  1K95 A;  2WND A;  4E68 A;  1ALV A;  4P2Y B;  1MHO A;  1CDL A;  2K0J A;  2KQY A;  5PAL A;  2MAZ A;  1DJI A;  1B8L A;  1SK6 D;  1TCO B;  2CTN A;  2WC8 A;  2KI6 D;  5CSJ A;  3SG7 A;  1PSR A;  3VRO A;  1BJF A;  3RM1 A;  4OKH A;  3IF7 A;  1EJ3 A;  2LLU A;  1IG5 A;  2MRD A;  1KK7 Z;  1MUX A;  2P6B B;  2KGR A;  1M31 A;  4A4B A;  4L9M A;  1K8U A;  1F71 A;  2KFF A;  1AJ4 A;  1XO5 A;  2JPT A;  2MHH A;  5AER A;  1DMO A;  1F54 A;  4P5O E;  1PK0 D;  2I2R E;  1CLM A;  2LP2 A;  5IBW A;  4MZL A;  2CCM A;  3FWB A;  3WHU B;  1AHR A;  2BBM A;  1MXE A;  2L0P A;  1OQP A;  1XA5 A;  2DOQ A;  2EC6 C;  4Q04 A;  2NCP A;  3CGA A;  3SJS A;  5D7F A;  5AEQ A;  2ISD A;  4M2P A;  1JWD A;  1Y1A A;  2LHL A;  1YUR A;  1RK9 A;  1DGU A;  2LM5 A;  4GGF A;  3ZNI A;  1JSA A;  4MZK A;  3FIA A;  4PHJ A;  4XJK B;  4YRU A;  4OR9 B;  5B8I B;  1Y1U A;  1JFJ A;  2PRU A;  1CTR A;  1XVJ A;  2CBL A;  2OS8 C;  1F55 A;  1NCY A;  1NP8 A;  3BUO B;  4DRW A;  2BEC A;  3LCP C;  2AMI A;  2K7D A;  2JXC A;  1SCM C;  2JUL A;  2JTT A;  4YGB B;  3SG5 A;  1NPQ A;  3I5G C;  4CLN A;  1KK8 B;  1NYA A;  3DF0 A;  3PLF B;  1IQ5 A;  2HPS A;  3E3R A;  3I5H B;  4OV2 A;  1S6C A;  2JC2 A;  3EVR A;  4QJ3 B;  4WRI A;  3JVT C;  4YGC B;  3A8R A;  1GJY A;  1PUL A;  3LK0 A;  4YI9 A;  1OOJ A;  2JRF A;  1CB1 A;  4MN0 A;  3KHE A;  3H4S E;  2KSP A;  1L2O B;  4YI8 A;  1XK4 A;  4PAL A;  1JUO A;  5K89 A;  3F45 A;  2KNE A;  1FI6 A;  1SR6 C;  2COL B;  2BE6 A;  3KO0 A;  1ZOT B;  2NXQ A;  3KPX A;  1QX2 A;  4MVF A;  1FW4 A;  3TDZ A;  2KI4 C;  1AK8 A;  1U5I A;  1DT7 B;  3HCM A;  1CM4 A;  3CS1 A;  1A29 A;  3DD4 A;  1S3P A;  4NDB A;  4FTG A;  1CDN A;  1S5G Y;  1Y0V H;  1D1O A;  2BL0 B;  2OPO A;  5I2O A;  1OSA A;  1S6I A;  1YVL A;  3PM8 A;  1OZS A;  4BY4 A;  1NIW A;  1CM1 A;  2KBM A;  3BUW B;  1CFC A;  3O6B A;  2HQW A;  5CSI A;  2LMT A;  2F8P A;  1SL7 A;  3OX6 A;  1A4P A;  3I5I B;  1CFP A;  5G08 A;  1MF8 B;  1A2X A;  1QTX A;  3TUY C;  1OMV A;  2MA2 A;  2F2P A;  3JTD C;  4PE1 A;  1SRA A;  1SMG A;  2KYF A;  4WQ2 A;  4GBA A;  1NCZ A;  1NWD A;  3PSR A;  1WY9 A;  4I5N B;  1LXF C;  2KHN A;  2H2K A;  2L98 A;  2NLN A;  1GQM A;  2QPT A;  2BCA A;  2K8M B;  3AAK A;  2HET A;  4YGA A;  3SG4 A;  4QJ5 B;  2KGB C;  3TDI A;  1K9P A;  1NUB A;  1X02 A;  1IH0 A;  1V1G A;  1DVI A;  3NSL A;  5I2L A;  3O2P A;  2PSR A;  1ZMZ A;  1UHK A;  3NXA A;  1DJW A;  2O60 A;  1YVH A;  1WDC B;  2EHB A;  3NSI A;  2D8N A;  2EGD A;  3OB1 B;  4ORB B;  1FPW A;  1QAT A;  2CNP A;  1CMF A;  1F4O A;  1OMD A;  4I5K A;  2M3W A;  4DIR A;  3BUX B;  3WNX B;  5DKQ A;  2JT8 A;  4NQG A;  2BCB A;  3M0W A;  2PMY A;  2ZRS A;  4MEW A;  1HQV A;  1YRT B;  2ZKM X;  4YGD B;  1IKU A;  1FI5 A;  3CR5 X;  2G9B A;  3DF0 B;  1QVI Y;  4AQI A;  2VRG A;  4MSP A;  1S5G Z;  2M0R A;  1KQV A;  1CMG A;  2HQ8 A;  1UUR A;  1W7I B;  1TRF A;  2NZ0 A;  2WCF A;  2LVK A;  1RRO A;  5TNC A;  1UP5 A;  2KFG A;  4GPL B;  1BR4 B;  2Y4Q A;  2OTG B;  1KSO A;  1KCY A;  3PFV A;  1YTZ C;  1NX0 A;  2M29 A;  2L50 A;  1PVA A;  2JNF A;  1AUI B;  1IJ6 A;  1KQM B;  2JU0 A;  1CNP A;  4OCI A;  4HRG A;  2LMU A;  3PN7 C;  1DGV A;  4AQJ A;  1B47 A;  1AJ5 A;  1Y6W A;  2FJU B;  2GGZ A;  3WXA A;  1WRL A;  1SL9 A;  5BPJ A;  1NX3 A;  2O5G A;  2LUC A;  1BOC A;  2JZI A;  1ZAC A;  4PE4 A;  1CDP A;  1XFX O;  2SAS A;  4C0J A;  2Y1M A;  5DKN A;  1Q80 A;  3D0Y B;  2LMV A;  4A4C A;  1SL8 A;  4HRE E;  2E6W A;  3CR4 X;  3CTN A;  1M39 A;  2JT3 A;  1NX1 A;  2L4H A;  1L2O C;  3GK4 X;  2HF5 A;  3VRQ A;  1WLZ A;  2AUC A;  2LLS A;  1YX8 A;  3BOW A;  2F33 A;  1SPY A;  3EK8 A;  2K2F A;  1IGV A;  3OX5 A;  1BOD A;  4C0L A;  4CFQ A;  1OMR A;  5JOL A;  4CPV A;  2K7B A;  3KF9 A;  1IQ3 A;  1B8R A;  1QVI Z;  1B1G A;  2G2B A;  1TTX A;  1M46 A;  2BE4 A;  1J7R A;  1CKK A;  1DJZ A;  1UUS A;  2LV7 A;  3A4U B;  4ETO A;  1TCF A;  2A4J A;  2FCE A;  1N65 A;  1BU3 A;  1QV0 A;  4UPG A;  2JT0 A;  1SNL A;  2B1U A;  4N1G A;  1J7P A;  1NSH A;  1EXR A;  1S1E A;  3I5I C;  3GOF A;  4R1E A;  1XFW O;  4ORC B;  4XYN A;  5I8N A;  1WRK A;  5CPV A;  3FWC A;  1TN4 A;  2FOT A;  3EK7 A;  3EKH A;  4MRY A;  2LCP A;  1EG3 A;  2M7L A;  1MQ1 A;  2H61 C;  5HKW A;  2JXL A;  3TS5 B;  1PRW A;  1IWQ A;  4QJ4 B;  1NCX A;  1YRU B;  1A03 A;  1B7T Y;  5KU1 A;  1LVC D;  1BMO A;  1KFX S;  1KWO B;  5F6T A;  3GK1 A;  1SYM A;  3VRP A;  1CFF A;  1BLQ A;  1TNX A;  1K96 A;  2PAL A;  1PVB A;  1S6J A;  3KEV A;  3CR2 A;  2LVV A;  1AVS A;  3FS7 A;  5AAN A;  4MLW A;  4U8D A;  4HSZ A;  3EVV A;  1MXL C;  1SKT A;  1SY9 A;  1G33 A;  3BUM B;  2MLF C;  3TZ1 A;  1G8I A;  2I94 A;  3CWG A;  1QX5 B;  3BUN B;  1KFU L;  2BBN A;  1M63 B;  1XYD A;  2MJW B;  4MRX A;  1ALW A;  1IRJ A;  1A75 A;  1LA0 A;  1S26 D;  2JTZ A;  1R6P A;  1UWO A;  5I2Q A;  1J7O A;  2JNX A;  4NDD A;  3ICB A;  1CDM A;  1KFU S;  1QLS A;  1ZUZ A;  2E30 A;  3I5F B;  3TDU A;  4D1E A;  4WQ3 A;  2M97 A;  1TNW A;  1QS7 A;  2KAX A;  4YGE B;  3ZWH A;  3DVJ A;  3SG6 A;  2LAP A;  2WCE A;  1WLM A;  2ZFD A;  2L4I A;  2FCD A;  2OTG C;  1H8B A;  3BQ3 A;  1KSM A;  2V53 A;  1PAL A;  5DKR A;  1KQM C;  2BKI B;  4NDC A;  2Q91 A;  1DJH A;  2M7N A;  1K9K A;  1G4Y R;  5GQQ C;  1HT9 A;  1F4Q A;  1NX2 A;  1XFY O;  2F3Y A;  3SG3 A;  1QV1 A;  4I5L B;  2K61 A;  1TNP A;  1ZFS A;  2F2O A;  1FBV A;  1UHI A;  1K93 D;  4F0Z B;  2LHI A;  1S36 A;  4HRH A;  1DF0 A;  2LP3 A;  4PHK A;  2KAY A;  2K2A A;  2KFH A;  1WRZ A;  2LVJ A;  4JPZ B;  2SCP A;  2KAV A;  4ZCV A;  1LKJ A;  2LLT A;  4ZCU A;  1N0Y A;  1DTL A;  4N1F A;  1JC2 A;  1YUS A;  1QIW A;  1U5I B;  2KDH A;  1CFD A;  1K9U A;  4BY5 A;  4M2Q A;  3OP0 A;  4MBE A;  1KK8 C;  1AP4 A;  1OZO A;  4ORA B;  1QIV A;  1YX7 A;  3VGO A;  3VRN A;  4CFR A;  1QAS A;  5KSZ A;  1K94 A;  2LE9 B;  3I5H C;  3MSE B;  1QLK A;  3DVK A;  4FQO A;  3CLN A;  2H61 A;  3WHT B;  4PHM A;  5D69 A;  4PHN A;  5J3X A;  2F3Z A;  3LL8 B;  3O78 A;  1UHH A;  3OHM B;  3CZT X;  1XFV O;  2LVI A;  5KTY A;  1M45 A;  3K21 A;  5AXI A;  1J7Q A;  1H4B A;  3EK4 A;  1TOP A;  2R2I A;  1UHN A;  1C7W A;  4JQ0 D;  2JQ6 A;  4DCK A;  4OVN F;  1C7V A;  3LLE A;  1QJT A;  2QAC A;  1YUT A;  1RFJ A;  1B8C A;  1K90 D;  2L51 A;  3PN7 B;  4PE7 A;  4C0K A;  1OE9 B;  2GV5 A;  1A75 B;  5HLV A;  2ZNE A;  5AFP A;  1SCV A;  3LK1 A;  2BL0 C;  2ZND A;  2LUX A;  1BR1 B;  3TS5 C;  1LIN A;  2KYC A;  1LA3 A;  2M1K B;  1REC A;  4PE0 A;  3AKB A;  2EC6 B;  1EG4 A;  2MLE C;  1KWO C;  1E8A A;  5HYD A;  4DS7 A;  5ER4 X;  1EH2 A;  2BKH B;  1RTP 1;  4DUQ A;  1QX7 A;  3O4Y A;  1UHJ A;  3NSO A;  1J1E A;  3VRR A;  1MWN A;  1CLL A;  4GFT A;  1DJY A;  3PAL A;  4PDZ A;  2CT9 A;  2K7O A;  2OS8 B;  4IL1 A;  1KFX L;  2Q4U A;  2WOR A;  1YUU A;  1ODB A;  3PAT A;  2M49 B;  1SBJ A;  2BCX A;  3QRX A;  1XFZ O;  2Y1N A; 
#chains in the Genus database with same CATH topology
 2KOT A;  5HKZ A;  3AKA A;  2JOJ A;  3HX4 A;  1SCM B;  1RWY A;  1JFK A;  4PCW A;  2GGM A;  1VRK A;  3I5G B;  3S0B A;  2M1U A;  3RLZ A;  4CID A;  4AOM A;  4YBH B;  1Y1X A;  3JVT B;  1WDC C;  1DF0 B;  2AAO A;  2JWW A;  3EKJ A;  4GGF C;  3IQQ A;  1F8H A;  3DVE A;  5JJG A;  3I5F C;  3C1V A;  4GUK A;  2I7A A;  4M2O A;  2LAN A;  1B9A A;  3BYA A;  2KBI A;  3AAJ A;  2CXJ A;  3D0Y A;  4USL A;  5CSN A;  1TNQ A;  1YR5 A;  1GGZ A;  2I18 A;  3NSK A;  4OZD A;  4XJK A;  2LNK A;  3GK2 A;  1SR6 B;  1SW8 A;  1TIZ A;  2M9G A;  1K2H A;  1DJG A;  5FYX A;  5CSF A;  1BF5 A;  1KK7 Y;  2L2E A;  5HLO A;  3SIB A;  1V1F A;  2PVB A;  1JBA A;  2L5X B;  3OB2 B;  1CLB A;  1BT6 A;  2TN4 A;  2KI4 B;  2KI6 C;  3IQO A;  2P71 A;  1W7J B;  3QME A;  2WCB A;  1EL4 A;  3Q8I A;  3D10 A;  1DJX A;  4I5J A;  1J55 A;  4GNK B;  4GAO A;  1L7Z A;  2RGI A;  4ICB A;  4TNC A;  5ER5 A;  2NCO A;  2ZN8 A;  1F70 A;  1C07 A;  1B4C A;  1N2D A;  1OOI X;  1XK4 C;  2LC5 A;  2M8U A;  4IJ7 A;  4JWQ A;  3BOW B;  3DVM A;  1QXP A;  2IS9 A;  3SIA A;  4N5X A;  1XFU O;  2KQ6 A;  3TUY B;  1GGW A;  3JTD B;  2WOS A;  3SG2 A;  1IJ5 A;  2L2C A;  2BAP A;  3BXK A;  2MBX A;  1BG1 A;  2K7C A;  5FI2 A;  1MR8 A;  1RJV A;  1PSB A;  2PAS A;  3S0D A;  2ZRT A;  1B7T Z;  5HKY A;  2Y5I A;  3EVU A;  1JF0 A;  1JF2 A;  4MZJ A;  1DC1 A;  4GGN A;  1FF1 A;  1P28 A;  2ZN9 A;  1J1D A;  1R2U A;  1K95 A;  2WND A;  2H8V A;  4E68 A;  1QWV A;  3CZ1 A;  1ALV A;  4P2Y B;  1MHO A;  1CDL A;  2K0J A;  1OOF A;  2KQY A;  5PAL A;  2MAZ A;  1TWO A;  1DJI A;  4PT1 A;  1B8L A;  1SK6 D;  1TCO B;  2CTN A;  2WC8 A;  2KI6 D;  5CSJ A;  3SG7 A;  1PSR A;  3VRO A;  1BJF A;  3RM1 A;  4OKH A;  3IF7 A;  1EJ3 A;  2LLU A;  3RZS A;  1IG5 A;  2MRD A;  1KK7 Z;  1MUX A;  2P6B B;  2PQL A;  2KGR A;  1M31 A;  4A4B A;  4L9M A;  1K8U A;  1F71 A;  2KFF A;  1AJ4 A;  1XO5 A;  2JPT A;  2MHH A;  5AER A;  1DMO A;  1F54 A;  4P5O E;  1PK0 D;  2I2R E;  1CLM A;  2LP2 A;  5IBW A;  4MZL A;  3VB1 A;  3B87 A;  2CCM A;  3FWB A;  3WHU B;  1AHR A;  2BBM A;  1MXE A;  2L0P A;  1OQP A;  3CZ2 A;  1XA5 A;  2DOQ A;  2EC6 C;  4Q04 A;  2NCP A;  3CGA A;  3SJS A;  5D7F A;  5AEQ A;  2ISD A;  4M2P A;  1JWD A;  1Y1A A;  2LHL A;  1YUR A;  1RK9 A;  1DGU A;  2LM5 A;  3CZ0 A;  4GGF A;  3ZNI A;  1JSA A;  4MZK A;  3FIA A;  4PHJ A;  4XJK B;  4YRU A;  4OR9 B;  5B8I B;  1Y1U A;  1JFJ A;  2PRU A;  1CTR A;  2QEO A;  1XVJ A;  2CBL A;  2OS8 C;  1Z4H A;  1NCY A;  1NP8 A;  3BUO B;  3NGV A;  2BEC A;  3LCP C;  4DRW A;  1F55 A;  2AMI A;  3L4A A;  2K7D A;  1ORG A;  2JXC A;  3B86 A;  1SCM C;  2JUL A;  2JTT A;  4YGB B;  3SG5 A;  1NPQ A;  3I5G C;  4CLN A;  1KK8 B;  1NYA A;  3D74 A;  3DF0 A;  3PLF B;  3SS5 A;  1IQ5 A;  2HPS A;  3E3R A;  3I5H B;  4OV2 A;  1S6C A;  2JC2 A;  3EVR A;  4QJ3 B;  4WRI A;  3JVT C;  4YGC B;  3A8R A;  1GJY A;  1W9Z A;  2GTE A;  1PUL A;  3LK0 A;  4YI9 A;  1OOJ A;  2JRF A;  1CB1 A;  4MN0 A;  3KHE A;  3H4S E;  2KSP A;  3D75 A;  1L2O B;  1OOH A;  1OW4 A;  4YI8 A;  1XK4 A;  4PAL A;  1JUO A;  5K89 A;  3F45 A;  2KNE A;  1FI6 A;  1SR6 C;  2COL B;  2KLE A;  1GM0 A;  2BE6 A;  3KO0 A;  1ZOT B;  2NXQ A;  3KPX A;  1QX2 A;  4MVF A;  3K1E A;  1FW4 A;  3TDZ A;  2KI4 C;  3DY9 A;  3BFB A;  1AK8 A;  1U5I A;  1DT7 B;  3HCM A;  1CM4 A;  3CS1 A;  1A29 A;  3DD4 A;  1S3P A;  4NDB A;  4FTG A;  1CDN A;  1S5G Y;  1Y0V H;  1D1O A;  2BL0 B;  2OPO A;  5I2O A;  1OSA A;  1S6I A;  1YVL A;  2P70 A;  3PM8 A;  1OZS A;  4BY4 A;  1NIW A;  1CM1 A;  3D73 A;  2KBM A;  3BUW B;  1CFC A;  3R1P A;  3O6B A;  2HQW A;  5CSI A;  2LMT A;  2F8P A;  1SL7 A;  1DEK A;  1A4P A;  3I5I B;  3OX6 A;  1CFP A;  3OBV A;  5G08 A;  1MF8 B;  1A2X A;  1QTX A;  4INX A;  3TUY C;  1OMV A;  3B6X A;  2MA2 A;  2F2P A;  3JTD C;  4PE1 A;  1SRA A;  1SMG A;  2KYF A;  4WQ2 A;  4GBA A;  1NCZ A;  1NWD A;  3PSR A;  1WY9 A;  4I5N B;  1LXF C;  2KHN A;  2H2K A;  2L98 A;  2NLN A;  1GQM A;  2QPT A;  2BCA A;  2K8M B;  3AAK A;  2HET A;  4YGA A;  3SG4 A;  4QJ5 B;  2KGB C;  3NHT A;  3TDI A;  1K9P A;  1NUB A;  1X02 A;  1IH0 A;  1V1G A;  1DVI A;  3NSL A;  3EG5 B;  5I2L A;  3O2P A;  2PSR A;  1ZMZ A;  1UHK A;  3NXA A;  5I94 A;  1DJW A;  2O60 A;  1YVH A;  1WDC B;  2EHB A;  3NSI A;  2D8N A;  2EGD A;  3OB1 B;  4ORB B;  1FPW A;  2WC5 A;  1QAT A;  2CNP A;  1CMF A;  1F4O A;  1OMD A;  3CDN A;  4I5K A;  2M3W A;  4DIR A;  3BUX B;  3WNX B;  5DKQ A;  2JT8 A;  4NQG A;  2BCB A;  1C3Z A;  3M0W A;  2PMY A;  2ZRS A;  4MEW A;  1HQV A;  1YRT B;  2ZKM X;  3DZT A;  4YGD B;  4JKT A;  1TUZ A;  1IKU A;  1FI5 A;  3CR5 X;  3SS4 A;  2G9B A;  2WCM A;  2WCK A;  3DF0 B;  1QVI Y;  4AQI A;  2VRG A;  4MSP A;  1S5G Z;  2M0R A;  1KQV A;  1CMG A;  2HQ8 A;  3S0F A;  1T14 A;  1UUR A;  1W7I B;  1TRF A;  2NZ0 A;  2WCF A;  2LVK A;  2FJY A;  1RRO A;  5TNC A;  3S0A A;  1UP5 A;  2KFG A;  4GPL B;  1BR4 B;  2Y4Q A;  2OTG B;  1KSO A;  1KCY A;  3PFV A;  1YTZ C;  1NX0 A;  2M29 A;  2L50 A;  1PVA A;  2JNF A;  1AUI B;  1IJ6 A;  1KQM B;  2JU0 A;  3D77 A;  5FI7 A;  1CNP A;  4OCI A;  4HRG A;  2LMU A;  3PN7 C;  1DGV A;  4AQJ A;  1DQE A;  1B47 A;  1AJ5 A;  1Y6W A;  2FJU B;  2GGZ A;  3WXA A;  1WRL A;  1SL9 A;  5EL2 A;  1NX3 A;  2O5G A;  3IVT A;  2LUC A;  3OGN A;  5BPJ A;  1BOC A;  2JZI A;  4JD9 A;  1ZAC A;  4PE4 A;  1CDP A;  1XFX O;  2SAS A;  4C0J A;  2Y1M A;  5DKN A;  1Q80 A;  5DIC A;  3D0Y B;  3DXL A;  2LMV A;  4A4C A;  1SL8 A;  3DYE A;  2WCJ A;  3FE6 A;  4HRE E;  3O4X A;  2E6W A;  3CR4 X;  3CTN A;  1M39 A;  2JT3 A;  1NX1 A;  2L4H A;  1L2O C;  3GK4 X;  2HF5 A;  3VRQ A;  1WLZ A;  2AUC A;  2LLS A;  1YX8 A;  3BOW A;  4F7F A;  2F33 A;  1SPY A;  3EK8 A;  2K2F A;  1IGV A;  1TUJ A;  3OX5 A;  1BOD A;  4C0L A;  4CFQ A;  1OMR A;  5JOL A;  4FQT A;  2QEV A;  4CPV A;  3BJH A;  2K7B A;  3KF9 A;  1IQ3 A;  1B8R A;  1QVI Z;  1B1G A;  2G2B A;  1TTX A;  1M46 A;  2BE4 A;  1J7R A;  1CKK A;  2KPH A;  1DJZ A;  1UUS A;  2LV7 A;  3A4U B;  4ETO A;  1TCF A;  2A4J A;  2FCE A;  1N65 A;  1BU3 A;  1QV0 A;  4UPG A;  2JT0 A;  4KYN A;  1SNL A;  2B1U A;  4N1G A;  1J7P A;  3R1O A;  1NSH A;  1EXR A;  1S1E A;  2WC6 A;  3I5I C;  3GOF A;  4R1E A;  3S0E A;  1XFW O;  4ORC B;  4XYN A;  5I8N A;  1WRK A;  5CPV A;  3FWC A;  1TN4 A;  2FOT A;  3EK7 A;  3EKH A;  4MRY A;  2LCP A;  2QEB A;  1EG3 A;  2M7L A;  1MQ1 A;  2H61 C;  5HKW A;  2JXL A;  3TS5 B;  1PRW A;  1IWQ A;  4QJ4 B;  1NCX A;  2YGU A;  1YRU B;  1A03 A;  1B7T Y;  5KU1 A;  1LVC D;  1BMO A;  1KFX S;  1KWO B;  5F6T A;  1SSE B;  3GK1 A;  1SYM A;  3VRP A;  1CFF A;  1BLQ A;  1TNX A;  1K96 A;  2PAL A;  1DEL A;  1PVB A;  1XFR A;  1S6J A;  3KEV A;  3CR2 A;  3BFH A;  2LVV A;  1AVS A;  3FS7 A;  5AAN A;  4MLW A;  4U8D A;  4HSZ A;  3EVV A;  1MXL C;  1SKT A;  1SY9 A;  1G33 A;  3BUM B;  2MLF C;  3TZ1 A;  1G8I A;  2I94 A;  3CWG A;  1QX5 B;  3BUN B;  1KFU L;  1M63 B;  2BBN A;  1XYD A;  2MJW B;  4MRX A;  1ALW A;  1IRJ A;  1A75 A;  1LA0 A;  1S26 D;  2JTZ A;  3BFA A;  1R6P A;  1UWO A;  5I2Q A;  1J7O A;  2JNX A;  4NDD A;  3ICB A;  1CDM A;  1KFU S;  1QLS A;  1ZUZ A;  2E30 A;  3I5F B;  3TDU A;  4D1E A;  4WQ3 A;  2M97 A;  1TNW A;  1QS7 A;  2KAX A;  4YGE B;  3S0G A;  3ZWH A;  3DVJ A;  3SG6 A;  3UO9 A;  2LAP A;  2WCE A;  1WLM A;  3R1V A;  2ZFD A;  2L4I A;  2FCD A;  2OTG C;  1H8B A;  1C3Y A;  3BQ3 A;  1KSM A;  2V53 A;  1PAL A;  5DKR A;  1KQM C;  2BKI B;  4NDC A;  2Q91 A;  1DJH A;  2M7N A;  1K9K A;  2WCH A;  3FE8 A;  3PJI A;  1G4Y R;  5GQQ C;  1HT9 A;  2K60 A;  1F4Q A;  1NX2 A;  3L4L A;  1XFY O;  3PM2 A;  2F3Y A;  3SS3 A;  1QV1 A;  3SG3 A;  4I5L B;  2K61 A;  1TNP A;  1ZFS A;  2F2O A;  1FBV A;  1UHI A;  1K93 D;  4F0Z B;  5FI6 A;  2LHI A;  1S36 A;  4HRH A;  1DF0 A;  2LP3 A;  4PHK A;  1Z2C B;  2K2A A;  2KAY A;  2KFH A;  1WRZ A;  2LVJ A;  4JPZ B;  2SCP A;  2KAV A;  4ZCV A;  1LKJ A;  2QEH A;  4INW A;  2LLT A;  3FE9 A;  4ZCU A;  3UNW A;  1N0Y A;  1DTL A;  4N1F A;  1JC2 A;  1YUS A;  3R72 A;  1QIW A;  1U5I B;  2KDH A;  2PYQ A;  1CFD A;  1K9U A;  4BY5 A;  2WCL A;  4M2Q A;  3OP0 A;  4MBE A;  1KK8 C;  1AP4 A;  1OZO A;  4ORA B;  1QIV A;  1YX7 A;  3VGO A;  3VRN A;  4CFR A;  1QAS A;  5KSZ A;  1K94 A;  2LE9 B;  3I5H C;  3MSE B;  1QLK A;  3DVK A;  1IIO A;  4FQO A;  3CLN A;  3CYZ A;  2BNX A;  5HL1 A;  2H61 A;  3WHT B;  4PHM A;  5D69 A;  3CAB A;  4PHN A;  5J3X A;  2F3Z A;  3LL8 B;  3O78 A;  1UHH A;  3OHM B;  3CZT X;  1XFV O;  2LVI A;  5KTY A;  1M45 A;  3K21 A;  5AXI A;  1J7Q A;  1H4B A;  3EK4 A;  3N7H A;  1TOP A;  2R2I A;  3V2L A;  2KLD A;  1UHN A;  3D76 A;  1C7W A;  1OOG A;  4JQ0 D;  2JQ6 A;  4DCK A;  4OVN F;  5D3O A;  1C7V A;  3LLE A;  1QJT A;  2QAC A;  1YUT A;  1RFJ A;  1B8C A;  1K90 D;  2JPO A;  2L51 A;  3PN7 B;  4PE7 A;  4C0K A;  1OE9 B;  2GV5 A;  1A75 B;  5HLV A;  2ZNE A;  3QRX A;  1SCV A;  3LK1 A;  5AFP A;  2BL0 C;  2ZND A;  2LUX A;  1BR1 B;  3TS5 C;  1LIN A;  2KYC A;  1LA3 A;  2M1K B;  1REC A;  2ERB A;  3L47 A;  3AKB A;  2EC6 B;  4PE0 A;  1EG4 A;  2MLE C;  1KWO C;  1E8A A;  5HYD A;  4DS7 A;  3NHI A;  5ER4 X;  1EH2 A;  2BKH B;  1RTP 1;  4DUQ A;  1QX7 A;  3O4Y A;  1UHJ A;  3NSO A;  1J1E A;  3VRR A;  1MWN A;  1CLL A;  4GFT A;  1DJY A;  1LS8 A;  3PAL A;  4PDZ A;  2CT9 A;  2K7O A;  2OS8 B;  4IL1 A;  1KFX L;  2Q4U A;  2WOR A;  1YUU A;  1ODB A;  2L5Y A;  3B88 A;  2M49 B;  1SBJ A;  3B7A A;  2BCX A;  3PAT A;  1XFZ O;  2Y1N A;  3D78 A;  2QDI A; 
#chains in the Genus database with same CATH homology
 2KOT A;  5HKZ A;  3AKA A;  2JOJ A;  3HX4 A;  1SCM B;  1RWY A;  1JFK A;  4PCW A;  2GGM A;  1VRK A;  3I5G B;  2M1U A;  3RLZ A;  4CID A;  4AOM A;  4YBH B;  1Y1X A;  3JVT B;  1WDC C;  1DF0 B;  2AAO A;  2JWW A;  3EKJ A;  4GGF C;  3IQQ A;  1F8H A;  3DVE A;  5JJG A;  3I5F C;  3C1V A;  4GUK A;  2I7A A;  4M2O A;  2LAN A;  1B9A A;  3BYA A;  2KBI A;  3AAJ A;  2CXJ A;  3D0Y A;  4USL A;  5CSN A;  1TNQ A;  1YR5 A;  1GGZ A;  2I18 A;  3NSK A;  4XJK A;  2LNK A;  3GK2 A;  1SR6 B;  1SW8 A;  1TIZ A;  2M9G A;  1K2H A;  1DJG A;  5FYX A;  5CSF A;  1BF5 A;  1KK7 Y;  2L2E A;  5HLO A;  3SIB A;  1V1F A;  2PVB A;  1JBA A;  2L5X B;  3OB2 B;  1CLB A;  1BT6 A;  2TN4 A;  2KI4 B;  2KI6 C;  3IQO A;  1W7J B;  2WCB A;  1EL4 A;  3D10 A;  1DJX A;  4I5J A;  1J55 A;  4GNK B;  4GAO A;  1L7Z A;  2RGI A;  4ICB A;  4TNC A;  5ER5 A;  2NCO A;  2ZN8 A;  1F70 A;  1C07 A;  1B4C A;  1N2D A;  1XK4 C;  2LC5 A;  4JWQ A;  2M8U A;  3BOW B;  3DVM A;  1QXP A;  2IS9 A;  3SIA A;  4N5X A;  1XFU O;  2KQ6 A;  3TUY B;  1GGW A;  3JTD B;  2WOS A;  3SG2 A;  1IJ5 A;  3BXK A;  2MBX A;  1BG1 A;  2K7C A;  1MR8 A;  1RJV A;  1PSB A;  2PAS A;  2ZRT A;  1B7T Z;  5HKY A;  2Y5I A;  3EVU A;  1JF0 A;  1JF2 A;  4MZJ A;  4GGN A;  1FF1 A;  2ZN9 A;  1J1D A;  1R2U A;  1K95 A;  2WND A;  4E68 A;  1ALV A;  4P2Y B;  1MHO A;  1CDL A;  2K0J A;  2KQY A;  5PAL A;  2MAZ A;  1DJI A;  1B8L A;  1SK6 D;  1TCO B;  2CTN A;  2WC8 A;  2KI6 D;  5CSJ A;  3SG7 A;  1PSR A;  3VRO A;  1BJF A;  3RM1 A;  4OKH A;  3IF7 A;  1EJ3 A;  2LLU A;  1IG5 A;  2MRD A;  1KK7 Z;  1MUX A;  2P6B B;  2KGR A;  1M31 A;  4A4B A;  4L9M A;  1K8U A;  1F71 A;  2KFF A;  1AJ4 A;  1XO5 A;  2JPT A;  2MHH A;  5AER A;  1DMO A;  1F54 A;  4P5O E;  1PK0 D;  2I2R E;  1CLM A;  2LP2 A;  5IBW A;  4MZL A;  2CCM A;  3FWB A;  3WHU B;  1AHR A;  2BBM A;  1MXE A;  2L0P A;  1OQP A;  1XA5 A;  2DOQ A;  2EC6 C;  4Q04 A;  2NCP A;  3CGA A;  3SJS A;  5D7F A;  5AEQ A;  2ISD A;  4M2P A;  1JWD A;  1Y1A A;  2LHL A;  1YUR A;  1RK9 A;  1DGU A;  2LM5 A;  4GGF A;  3ZNI A;  1JSA A;  4MZK A;  3FIA A;  4PHJ A;  4XJK B;  4YRU A;  4OR9 B;  5B8I B;  1Y1U A;  1JFJ A;  2PRU A;  1CTR A;  1XVJ A;  2CBL A;  2OS8 C;  1F55 A;  1NCY A;  1NP8 A;  3BUO B;  4DRW A;  2BEC A;  3LCP C;  2AMI A;  2K7D A;  2JXC A;  1SCM C;  2JUL A;  2JTT A;  4YGB B;  3SG5 A;  1NPQ A;  3I5G C;  4CLN A;  1KK8 B;  1NYA A;  3DF0 A;  3PLF B;  1IQ5 A;  2HPS A;  3E3R A;  3I5H B;  4OV2 A;  1S6C A;  2JC2 A;  3EVR A;  4QJ3 B;  4WRI A;  3JVT C;  4YGC B;  3A8R A;  1GJY A;  1PUL A;  3LK0 A;  4YI9 A;  1OOJ A;  2JRF A;  1CB1 A;  4MN0 A;  3KHE A;  3H4S E;  2KSP A;  1L2O B;  4YI8 A;  1XK4 A;  4PAL A;  1JUO A;  5K89 A;  3F45 A;  2KNE A;  1FI6 A;  1SR6 C;  2COL B;  2BE6 A;  3KO0 A;  1ZOT B;  2NXQ A;  3KPX A;  1QX2 A;  4MVF A;  1FW4 A;  3TDZ A;  2KI4 C;  1AK8 A;  1U5I A;  1DT7 B;  3HCM A;  1CM4 A;  3CS1 A;  1A29 A;  3DD4 A;  1S3P A;  4NDB A;  4FTG A;  1CDN A;  1S5G Y;  1Y0V H;  1D1O A;  2BL0 B;  2OPO A;  5I2O A;  1OSA A;  1S6I A;  1YVL A;  3PM8 A;  1OZS A;  4BY4 A;  1NIW A;  1CM1 A;  2KBM A;  3BUW B;  1CFC A;  3O6B A;  2HQW A;  5CSI A;  2LMT A;  2F8P A;  1SL7 A;  3OX6 A;  1A4P A;  3I5I B;  1CFP A;  5G08 A;  1MF8 B;  1A2X A;  1QTX A;  3TUY C;  1OMV A;  2MA2 A;  2F2P A;  3JTD C;  4PE1 A;  1SRA A;  1SMG A;  2KYF A;  4WQ2 A;  4GBA A;  1NCZ A;  1NWD A;  3PSR A;  1WY9 A;  4I5N B;  1LXF C;  2KHN A;  2H2K A;  2L98 A;  2NLN A;  1GQM A;  2QPT A;  2BCA A;  2K8M B;  3AAK A;  2HET A;  4YGA A;  3SG4 A;  4QJ5 B;  2KGB C;  3TDI A;  1K9P A;  1NUB A;  1X02 A;  1IH0 A;  1V1G A;  1DVI A;  3NSL A;  5I2L A;  3O2P A;  2PSR A;  1ZMZ A;  1UHK A;  3NXA A;  1DJW A;  2O60 A;  1YVH A;  1WDC B;  2EHB A;  3NSI A;  2D8N A;  2EGD A;  3OB1 B;  4ORB B;  1FPW A;  1QAT A;  2CNP A;  1CMF A;  1F4O A;  1OMD A;  4I5K A;  2M3W A;  4DIR A;  3BUX B;  3WNX B;  5DKQ A;  2JT8 A;  4NQG A;  2BCB A;  3M0W A;  2PMY A;  2ZRS A;  4MEW A;  1HQV A;  1YRT B;  2ZKM X;  4YGD B;  1IKU A;  1FI5 A;  3CR5 X;  2G9B A;  3DF0 B;  1QVI Y;  4AQI A;  2VRG A;  4MSP A;  1S5G Z;  2M0R A;  1KQV A;  1CMG A;  2HQ8 A;  1UUR A;  1W7I B;  1TRF A;  2NZ0 A;  2WCF A;  2LVK A;  1RRO A;  5TNC A;  1UP5 A;  2KFG A;  4GPL B;  1BR4 B;  2Y4Q A;  2OTG B;  1KSO A;  1KCY A;  3PFV A;  1YTZ C;  1NX0 A;  2M29 A;  2L50 A;  1PVA A;  2JNF A;  1AUI B;  1IJ6 A;  1KQM B;  2JU0 A;  1CNP A;  4OCI A;  4HRG A;  2LMU A;  3PN7 C;  1DGV A;  4AQJ A;  1B47 A;  1AJ5 A;  1Y6W A;  2FJU B;  2GGZ A;  3WXA A;  1WRL A;  1SL9 A;  5BPJ A;  1NX3 A;  2O5G A;  2LUC A;  1BOC A;  2JZI A;  1ZAC A;  4PE4 A;  1CDP A;  1XFX O;  2SAS A;  4C0J A;  2Y1M A;  5DKN A;  1Q80 A;  3D0Y B;  2LMV A;  4A4C A;  1SL8 A;  4HRE E;  2E6W A;  3CR4 X;  3CTN A;  1M39 A;  2JT3 A;  1NX1 A;  2L4H A;  1L2O C;  3GK4 X;  2HF5 A;  3VRQ A;  1WLZ A;  2AUC A;  2LLS A;  1YX8 A;  3BOW A;  2F33 A;  1SPY A;  3EK8 A;  2K2F A;  1IGV A;  3OX5 A;  1BOD A;  4C0L A;  4CFQ A;  1OMR A;  5JOL A;  4CPV A;  2K7B A;  3KF9 A;  1IQ3 A;  1B8R A;  1QVI Z;  1B1G A;  2G2B A;  1TTX A;  1M46 A;  2BE4 A;  1J7R A;  1CKK A;  1DJZ A;  1UUS A;  2LV7 A;  3A4U B;  4ETO A;  1TCF A;  2A4J A;  2FCE A;  1N65 A;  1BU3 A;  1QV0 A;  4UPG A;  2JT0 A;  1SNL A;  2B1U A;  4N1G A;  1J7P A;  1NSH A;  1EXR A;  1S1E A;  3I5I C;  3GOF A;  4R1E A;  1XFW O;  4ORC B;  4XYN A;  5I8N A;  1WRK A;  5CPV A;  3FWC A;  1TN4 A;  2FOT A;  3EK7 A;  3EKH A;  4MRY A;  2LCP A;  1EG3 A;  2M7L A;  1MQ1 A;  2H61 C;  5HKW A;  2JXL A;  3TS5 B;  1PRW A;  1IWQ A;  4QJ4 B;  1NCX A;  1YRU B;  1A03 A;  1B7T Y;  5KU1 A;  1LVC D;  1BMO A;  1KFX S;  1KWO B;  5F6T A;  3GK1 A;  1SYM A;  3VRP A;  1CFF A;  1BLQ A;  1TNX A;  1K96 A;  2PAL A;  1PVB A;  1S6J A;  3KEV A;  3CR2 A;  2LVV A;  1AVS A;  3FS7 A;  5AAN A;  4MLW A;  4U8D A;  4HSZ A;  3EVV A;  1MXL C;  1SKT A;  1SY9 A;  1G33 A;  3BUM B;  2MLF C;  3TZ1 A;  1G8I A;  2I94 A;  3CWG A;  1QX5 B;  3BUN B;  1KFU L;  2BBN A;  1M63 B;  1XYD A;  2MJW B;  4MRX A;  1ALW A;  1IRJ A;  1A75 A;  1LA0 A;  1S26 D;  2JTZ A;  1R6P A;  1UWO A;  5I2Q A;  1J7O A;  2JNX A;  4NDD A;  3ICB A;  1CDM A;  1KFU S;  1QLS A;  1ZUZ A;  2E30 A;  3I5F B;  3TDU A;  4D1E A;  4WQ3 A;  2M97 A;  1TNW A;  1QS7 A;  2KAX A;  4YGE B;  3ZWH A;  3DVJ A;  3SG6 A;  2LAP A;  2WCE A;  1WLM A;  2ZFD A;  2L4I A;  2FCD A;  2OTG C;  1H8B A;  3BQ3 A;  1KSM A;  2V53 A;  1PAL A;  5DKR A;  1KQM C;  2BKI B;  4NDC A;  2Q91 A;  1DJH A;  2M7N A;  1K9K A;  1G4Y R;  5GQQ C;  1HT9 A;  1F4Q A;  1NX2 A;  1XFY O;  2F3Y A;  3SG3 A;  1QV1 A;  4I5L B;  2K61 A;  1TNP A;  1ZFS A;  2F2O A;  1FBV A;  1UHI A;  1K93 D;  4F0Z B;  2LHI A;  1S36 A;  4HRH A;  1DF0 A;  2LP3 A;  4PHK A;  2KAY A;  2K2A A;  2KFH A;  1WRZ A;  2LVJ A;  4JPZ B;  2SCP A;  2KAV A;  4ZCV A;  1LKJ A;  2LLT A;  4ZCU A;  1N0Y A;  1DTL A;  4N1F A;  1JC2 A;  1YUS A;  1QIW A;  1U5I B;  2KDH A;  1CFD A;  1K9U A;  4BY5 A;  4M2Q A;  3OP0 A;  4MBE A;  1KK8 C;  1AP4 A;  1OZO A;  4ORA B;  1QIV A;  1YX7 A;  3VGO A;  3VRN A;  4CFR A;  1QAS A;  5KSZ A;  1K94 A;  2LE9 B;  3I5H C;  3MSE B;  1QLK A;  3DVK A;  4FQO A;  3CLN A;  2H61 A;  3WHT B;  4PHM A;  5D69 A;  4PHN A;  5J3X A;  2F3Z A;  3LL8 B;  3O78 A;  1UHH A;  3OHM B;  3CZT X;  1XFV O;  2LVI A;  5KTY A;  1M45 A;  3K21 A;  5AXI A;  1J7Q A;  1H4B A;  3EK4 A;  1TOP A;  2R2I A;  1UHN A;  1C7W A;  4JQ0 D;  2JQ6 A;  4DCK A;  4OVN F;  1C7V A;  3LLE A;  1QJT A;  2QAC A;  1YUT A;  1RFJ A;  1B8C A;  1K90 D;  2L51 A;  3PN7 B;  4PE7 A;  4C0K A;  1OE9 B;  2GV5 A;  1A75 B;  5HLV A;  2ZNE A;  5AFP A;  1SCV A;  3LK1 A;  2BL0 C;  2ZND A;  2LUX A;  1BR1 B;  3TS5 C;  1LIN A;  2KYC A;  1LA3 A;  2M1K B;  1REC A;  4PE0 A;  3AKB A;  2EC6 B;  1EG4 A;  2MLE C;  1KWO C;  1E8A A;  5HYD A;  4DS7 A;  5ER4 X;  1EH2 A;  2BKH B;  1RTP 1;  4DUQ A;  1QX7 A;  3O4Y A;  1UHJ A;  3NSO A;  1J1E A;  3VRR A;  1MWN A;  1CLL A;  4GFT A;  1DJY A;  3PAL A;  4PDZ A;  2CT9 A;  2K7O A;  2OS8 B;  4IL1 A;  1KFX L;  2Q4U A;  2WOR A;  1YUU A;  1ODB A;  3PAT A;  2M49 B;  1SBJ A;  2BCX A;  3QRX A;  1XFZ O;  2Y1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...