3RM1A

1.24 angstrom x-ray structure of bovine trtk12-ca(2+)-s100b d63n
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
89
structure length
89
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSNGDGECDFQEFMAFVAMITTACHEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein/protein binding
molecule keywords Protein S100-B
publication title The effects of CapZ peptide (TRTK12) on the protein dynamics of S100B and S100B D63N
rcsb
source organism Bos taurus
total genus 32
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3rm1A00
1BR4B 1ALVA 1FPWA 1LXFC 1S6JA 1XFYO 1TN4A 2JNXA 3BUWB 2Q4UA 1CDLA 2WC8A 1GJYA 4MRYA 3FWCA 1NX2A 1A75A 1BMOA 1QTXA 3CZTX 3EVVA 1JF0A 3PN7B 1OOJA 4PDZA 1IG5A 5CSNA 3SG4A 1BR1B 3BOWB 5I8NA 1NCYA 4DCKA 2R2IA 1DJYA 2K2FA 4PHKA 4YBHB 1DJWA 5HYDA 1J7RA 5CSIA 1CFFA 2KQYA 1LVCD 2CXJA 1C7VA 2M8UA 1CLMA 2NZ0A 3BXKA 4GPLB 4HRGA 1A2XA 1WLZA 5D7FA 3VROA 1WRZA 2GGMA 3LK0A 1SR6B 2PRUA 4PE0A 1FW4A 3I5HB 1N2DA 5KU1A 1CMGA 1IWQA 4USLA 2CBLA 3A4UB 2KSPA 1J7QA 1B8RA 1FBVA 4DRWA 1NCZA 1SNLA 2H2KA 1MQ1A 4N1FA 2HQWA 1QIWA 3GK1A 3PFVA 2K8MB 1L2OC 2BBMA 1OE9B 5GQQC 4BY4A 1QX2A 2M9GA 3VGOA 1ZACA 2LANA 2MRDA 1K95A 2MAZA 1CLLA 1AHRA 2MLFC 3D0YA 4HREE 1Y1UA 3GK4X 4OVNF 1MF8B 1QJTA 3H4SE 1SCVA 2K7CA 2WCFA 2M1KB 3RM1A 3VRRA 4I5LB 2L0PA 1XFVO 3JVTB 4TNCA 3DVJA 4Q04A 3NSOA 3NXAA 1OZOA 1XO5A 4MBEA 4ORCB 1CFDA 2KOTA 1QV1A 2K0JA 1YUSA 1CTRA 1NSHA 3SG2A 1GGZA 2IS9A 1TOPA 1UHJA 2CT9A 2M97A 3VRPA 1SRAA 4MZKA 2M3WA 4DS7A 1H8BA 2MJWB 3PM8A 1A29A 2EC6C 1KCYA 4YGAA 2JULA 3PN7C 1CLBA 3D10A 1F54A 1JC2A 2Y5IA 2CNPA 1G8IA 3ICBA 4ICBA 1G4YR 2G2BA 1PVAA 5ER5A 3PATA 1IQ3A 4NQGA 1QX7A 3VRNA 2Y1MA 3TDIA 2KGBC 4M2PA 1CKKA 2F2OA 4I5KA 1KQMB 2GV5A 4CLNA 1XK4A 5AFPA 2JPTA 1IGVA 1NPQA 4NDCA 4PE4A 5G08A 2JT0A 3DF0B 2FCDA 2OTGB 1S5GZ 3BQ3A 2CTNA 2GGZA 3I5GC 3O4YA 1SCMB 3TDZA 3O6BA 1B7TZ 2KBIA 1PVBA 2JQ6A 2JXCA 1SL8A 3NSLA 4MN0A 4IL1A 1A03A 1OMDA 3OX5A 1DGUA 1TNWA 5KTYA 1XFUO 2K7BA 3GK2A 4GUKA 2DOQA 1JFJA 2QPTA 1J55A 2ZKMX 4QJ3B 2JC2A 2BL0B 1DJZA 1XFWO 2PMYA 2BCAA 3I5IC 2F3YA 4XYNA 1F8HA 2PALA 1UHHA 2BE4A 5HKYA 2JOJA 1RROA 2MLEC 2BCXA 2E6WA 4MZLA 2L2EA 1XK4C 5DKRA 4HSZA 2LC5A 4C0JA 2WCEA 1RJVA 3LL8B 1IRJA 1TIZA 3WNXB 3WXAA 1SPYA 2FJUB 1X02A 4XJKA 5I2LA 3BUNB 5JJGA 4E68A 1CDMA 1SKTA 2HPSA 1CDNA 1UP5A 1C7WA 1CM4A 3SG6A 3CS1A 1SK6D 1XYDA 1EG4A 4WQ2A 1K9PA 2JU0A 1CFCA 1DMOA 3TS5B 3O78A 1TNPA 2ZN9A 4ZCUA 2M29A 2CCMA 4GAOA 1FF1A 1DT7B 3BUXB 1K96A 1PRWA 1SL9A 2LNKA 3SIBA 3F45A 1DJHA 1KQMC 2ZNEA 1UHIA 3PLFB 3RLZA 3K21A 5BPJA 4YGDB 5B8IB 1GQMA 1QX5B 1Y6WA 3JTDB 5DKQA 2G9BA 2L4IA 4MRXA 2EGDA 2COLB 1J1DA 3EK4A 1TNQA 3AAJA 3BUOB 1WRLA 3C1VA 2BKHB 1WRKA 1AJ4A 3HX4A 1MHOA 4YGBB 4OCIA 2KI4C 1RWYA 1WDCB 3LK1A 3FWBA 4PALA 1DJIA 1BU3A 1BODA 4DIRA 2JT8A 3BOWA 2LHIA 3DVEA 2NCOA 1LKJA 1S6IA 3CLNA 1YVLA 1NX3A 2BL0C 2I94A 4YGCB 1JF2A 2LP2A 2JT3A 3EK8A 1ALWA 1U5IB 1KSOA 1CB1A 2NXQA 1IJ6A 3OB2B 1AJ5A 4GNKB 2V53A 5CSJA 1UHNA 1DVIA 3I5FC 4GFTA 1KFXS 2LLSA 2OS8B 5HLVA 1NUBA 3TUYB 1EXRA 3GOFA 4M2QA 2L4HA 3IQQA 3EVRA 3KF9A 1J7PA 2JTZA 4C0KA 3AKBA 2F33A 3A8RA 1NP8A 4WRIA 2LLTA 1MUXA 1KK8B 1YRTB 2LVIA 2KDHA 4WQ3A 4C0LA 1SW8A 1OSAA 2D8NA 3M0WA 4P5OE 1HT9A 1YURA 2AAOA 3IQOA 1MXEA 2LV7A 3TS5C 3DD4A 5HLOA 3KPXA 1DJXA 3SIAA 1KFXL 1Y1XA 2TN4A 5PALA 3DVKA 1RFJA 5JOLA 3SG7A 1ZOTB 3E3RA 3AAKA 1IQ5A 1DF0B 1M31A 1NWDA 1NYAA 1YX8A 3LCPC 1K90D 1QVIZ 3TZ1A 1QVIY 4CIDA 2LP3A 1KFUS 3O2PA 1K2HA 2L98A 1V1GA 1M39A 1SL7A 5ER4X 1MXLC 2PVBA 2EHBA 5TNCA 1SR6C 2SASA 3I5HC 1QASA 5DKNA 1RECA 2BE6A 4PCWA 4DUQA 1S5GY 1UURA 2WOSA 1QLKA 3CTNA 3WHUB 1EJ3A 1B7TY 1K8UA 1UWOA 3OX6A 3QRXA 4GGNA 4PHJA 5F6TA 1YX7A 5CSFA 1PSRA 1BOCA 1WLMA 4YRUA 2KAXA 4GBAA 1WY9A 2K7DA 2KYFA 3OHMB 4PHNA 2ISDA 1KFUL 1KK7Z 1CNPA 1FI5A 4P2YB 1CDPA 1KWOB 2RGIA 3LLEA 4MEWA 4ZCVA 1PULA 4JPZB 1N0YA 2I2RE 2KFGA 4JWQA 2FOTA 1QIVA 2F2PA 1JWDA 4N1GA 1DTLA 3EK7A 1SBJA 3JVTC 2L5XB 4D1EA 2L50A 1BJFA 2KNEA 1XFXO 1SY9A 3DF0A 1ODBA 2KYCA 4NDDA 1YUTA 4F0ZB 1BF5A 1RK9A 4CFRA 1XA5A 1BG1A 2WORA 1XFZO 1E8AA 2Y4QA 4I5NB 3SJSA 1L2OB 2MA2A 1A75B 1B8LA 1JSAA 2KI6C 3BYAA 4ORAB 1V1FA 4AQJA 2JTTA 5IBWA 1SMGA 4QJ4B 4R1EA 2L51A 2P6BB 5CPVA 3KEVA 1QV0A 3WHTB 3EKHA 4BY5A 1K9KA 5AANA 1S26D 2I7AA 1GGWA 2LCPA 1B8CA 1W7JB 4PE7A 3NSKA 2KAVA 4FTGA 3KO0A 2WCBA 1OMVA 1Y1AA 4OR9B 4AOMA 1ZFSA 2K2AA 1HQVA 4MSPA 1CMFA 1QS7A 1Q80A 1S36A 1B4CA 2KHNA 1CM1A 3OB1B 3HCMA 3SG3A 3SG5A 2LMVA 2OTGC 3EKJA 4PE1A 1F71A 2K61A 2EC6B 5J3XA 4CPVA 1BLQA 1SCMC 1F4QA 2ZN8A 4YI9A 1NX1A 2HF5A 1TRFA 1TCOB 2HETA 1Y0VH 2KFFA 2M0RA 3D0YB 1IJ5A 1XVJA 1J7OA 2M7NA 2NLNA 1OQPA 4GGFA 3ZWHA 1QLSA 1KWOC 2KQ6A 5I2QA 1IH0A 2E30A 1EL4A 5I2OA 2PSRA 4YGEB 1RTP1 1D1OA 2I18A 1QATA 2LUXA 2BKIB 1YR5A 2H61A 1NX0A 2QACA 4N5XA 4A4BA 1SYMA 2NCPA 1YVHA 3I5GB 1M63B 4AQIA 4UPGA 1LA3A 2LVKA 2KGRA 2M1UA 2LVJA 4A4CA 1S3PA 2M49B 1K9UA 2LMTA 2ZRSA 3CR2A 1B47A 2BBNA 1NCXA 3CR5X 1YTZC 4CFQA 4I5JA 2LHLA 3I5IB 3PALA 2LLUA 4MZJA 2HQ8A 1DJGA 1N65A 1ZMZA 4HRHA 1K94A 2LE9B 1VRKA 1U5IA 1KQVA 1PSBA 1UHKA 3OP0A 4GGFC 3CGAA 4ETOA 2M7LA 1AK8A 2LAPA 1JBAA 3KHEA 1R6PA 2Q91A 1MWNA 1R2UA 3NSIA 4PHMA 4YI8A 2H61C 1AUIB 1NIWA 1L7ZA 3TDUA 1G33A 1TTXA 3JTDC 1PALA 2Y1NA 2MBXA 1JFKA 2KI6D 3MSEB 4M2OA 1K93D 1S6CA 2JNFA 2F3ZA 2MHHA 2WNDA 2ZFDA 2ZNDA 3FS7A 4L9MA 4ORBB 1AVSA 2JRFA 1H4BA 1OMRA 1WDCC 2AUCA 1TCFA 3FIAA 5HKZA 1F55A 2O60A 5K89A 1LA0A 1OZSA 1PK0D 1LINA 4OV2A 1UUSA 3CWGA 1KK7Y 3ZNIA 1ZUZA 4QJ5B 1MR8A 3DVMA 1DF0A 2KFHA 1EG3A 2AMIA 2F8PA 3VRQA 2JZIA 3BUMB 1M45A 1AP4A 2OS8C 1FI6A 5HKWA 2JWWA 4U8DA 3TUYC 2OPOA 1EH2A 1KSMA 1TNXA 2FCEA 5D69A 2K7OA 4XJKB 2KI4B 1YUUA 3CR4X 4FQOA 2KAYA 5AEQA 1B1GA 1CFPA 1M46A 2JXLA 2VRGA 1KK8C 2BECA 2LM5A 3EVUA 1C07A 5FYXA 1QXPA 1BT6A 1S1EA 2ZRTA 2BCBA 1IKUA 3PSRA 1W7IB 1B9AA 2LUCA 5KSZA 4NDBA 3IF7A 2SCPA 2LMUA 4OKHA 2O5GA 2PASA 2KBMA 3I5FB 1YRUB 1JUOA 1F4OA 2B1UA 1F70A 2LVVA 2A4JA 1A4PA 1DGVA 5AERA 4JQ0D 4MLWA 3AKAA 1J1EA 4MVFA 5AXIA
chains in the Genus database with same CATH superfamily
1BR4B 1ALVA 1FPWA 1LXFC 5D3OA 1S6JA 1XFYO 1TN4A 3BJHA 3L47A 2JNXA 2KLEA 3BUWB 2Q4UA 1CDLA 2WC8A 1GJYA 4MRYA 3FWCA 1NX2A 1A75A 1BMOA 3CZ0A 1QTXA 3B88A 3CZTX 3EVVA 1JF0A 3PN7B 1OOJA 4PDZA 1IG5A 5CSNA 3SG4A 1BR1B 3BOWB 5I8NA 1NCYA 4DCKA 2R2IA 1DJYA 2K2FA 4PHKA 4YBHB 1DJWA 5HYDA 1J7RA 5CSIA 1CFFA 2KQYA 1LVCD 2CXJA 4FQTA 1C7VA 2M8UA 1CLMA 2NZ0A 3BXKA 3BFHA 1TUJA 4GPLB 4HRGA 1A2XA 1WLZA 3R1VA 5D7FA 1WRZA 2GGMA 3LK0A 3VROA 1SR6B 2PRUA 4PE0A 1FW4A 3I5HB 1N2DA 5KU1A 2GTEA 1CMGA 1IWQA 1TUZA 3D75A 4USLA 2CBLA 3A4UB 2KSPA 1J7QA 1B8RA 1FBVA 3S0GA 3R1OA 4DRWA 1NCZA 1SNLA 2H2KA 1MQ1A 2WCHA 4N1FA 2HQWA 1QIWA 3GK1A 3PFVA 2K8MB 1L2OC 2BBMA 1OE9B 5GQQC 4BY4A 1QX2A 2M9GA 3VGOA 1ZACA 1QWVA 2LANA 2MRDA 1K95A 1OOGA 2MAZA 1CLLA 1AHRA 2MLFC 3D0YA 4HREE 1Y1UA 3B87A 3GK4X 4OVNF 1MF8B 1QJTA 3H4SE 1SCVA 2K7CA 2WCFA 2M1KB 3RM1A 3VRRA 4I5LB 3SS4A 2L0PA 1XFVO 3JVTB 4TNCA 3DVJA 4Q04A 3NSOA 3NXAA 1OZOA 1XO5A 4MBEA 4ORCB 1CFDA 2KOTA 1QV1A 2K0JA 1YUSA 1CTRA 1NSHA 3SG2A 1GGZA 2IS9A 1TOPA 1UHJA 2CT9A 2M97A 3VRPA 1SRAA 1Z4HA 3UO9A 4MZKA 2M3WA 4DS7A 1H8BA 2MJWB 3PM8A 1A29A 2EC6C 1KCYA 4YGAA 2JULA 3PN7C 1CLBA 3D10A 1F54A 2BAPA 1JC2A 2Y5IA 2CNPA 1G8IA 3ICBA 4ICBA 1G4YR 2G2BA 1PVAA 5ER5A 3BFBA 3PATA 1IQ3A 4NQGA 1QX7A 3VRNA 2Y1MA 3TDIA 2KGBC 4M2PA 1CKKA 3CZ2A 2K60A 2PYQA 2F2OA 4I5KA 1KQMB 2GV5A 4CLNA 1XK4A 4F7FA 5AFPA 2JPTA 1IGVA 1NPQA 4NDCA 4PE4A 5G08A 2JT0A 3DF0B 2FCDA 2OTGB 1S5GZ 3BQ3A 2CTNA 2GGZA 3I5GC 3IVTA 1SCMB 3B6XA 3O4YA 3O6BA 3TDZA 1B7TZ 2KBIA 1PVBA 2JQ6A 2JXCA 1SL8A 3NSLA 4MN0A 3FE9A 4IL1A 1A03A 2FJYA 1OMDA 3OX5A 1DGUA 1TNWA 5KTYA 1XFUO 2K7BA 3GK2A 4GUKA 2DOQA 1JFJA 2QPTA 1J55A 2ZKMX 4QJ3B 4INWA 2JC2A 2BL0B 1DJZA 1XFWO 2PMYA 2BCAA 3I5IC 2F3YA 1SSEB 4XYNA 1F8HA 2PALA 1UHHA 2BE4A 5HKYA 2JOJA 1RROA 2MLEC 2BCXA 3FE6A 2E6WA 4MZLA 2L2EA 1XK4C 5DKRA 4HSZA 2LC5A 4C0JA 2WCEA 1RJVA 1DEKA 3LL8B 1IRJA 1TIZA 3WNXB 3WXAA 1SPYA 2FJUB 1X02A 4XJKA 5I2LA 3BUNB 5JJGA 4E68A 1CDMA 1SKTA 2HPSA 1CDNA 1UP5A 3UNWA 1C7WA 1CM4A 3SG6A 2WCKA 1SK6D 1XYDA 1EG4A 3CS1A 1K9PA 2JU0A 4WQ2A 1CFCA 3TS5B 3O78A 1TNPA 1DMOA 2ZN9A 4ZCUA 2M29A 2CCMA 1C3YA 4GAOA 1FF1A 1DT7B 3BUXB 1K96A 1PRWA 1SL9A 2LNKA 4JKTA 3F45A 3SIBA 1DJHA 1KQMC 2H8VA 2ZNEA 1OW4A 1UHIA 3PLFB 3RLZA 3K21A 5BPJA 4YGDB 5B8IB 1GQMA 1QX5B 3V2LA 1Y6WA 3JTDB 5DICA 5DKQA 2G9BA 2KLDA 2L4IA 2EGDA 2COLB 4KYNA 1J1DA 4MRXA 3EK4A 1TNQA 3AAJA 3BUOB 1WRLA 3C1VA 2BKHB 3D77A 1WRKA 1AJ4A 3HX4A 1MHOA 4YGBB 4OCIA 4INXA 2KI4C 1RWYA 3K1EA 1WDCB 3LK1A 3FWBA 3D73A 4PALA 4OZDA 1DJIA 1BU3A 1BODA 4DIRA 1OOHA 2JT8A 3BOWA 2LHIA 3DVEA 2NCOA 1TWOA 1LKJA 3S0FA 1S6IA 3CLNA 2WC6A 1YVLA 1NX3A 2BL0C 2I94A 4YGCB 1JF2A 2LP2A 2JT3A 3EK8A 1ALWA 1U5IB 1KSOA 1CB1A 2NXQA 3CDNA 1IJ6A 3OB2B 3O4XA 1AJ5A 2JPOA 2V53A 3CABA 1UHNA 4GNKB 1DVIA 5CSJA 3I5FC 4GFTA 1KFXS 2LLSA 2OS8B 5HLVA 1IIOA 1NUBA 3TUYB 1EXRA 3GOFA 4M2QA 2L4HA 3IQQA 3EVRA 3KF9A 1J7PA 2JTZA 4C0KA 3AKBA 2F33A 3A8RA 1NP8A 4WRIA 2LLTA 2QDIA 5FI7A 1MUXA 1KK8B 1YRTB 2LVIA 2PQLA 2KDHA 4WQ3A 4C0LA 1SW8A 1OSAA 3Q8IA 3D78A 3PM2A 2D8NA 3M0WA 4P5OE 1HT9A 1YURA 2AAOA 3IQOA 1MXEA 2P71A 2LV7A 3TS5C 3DD4A 5HLOA 3KPXA 5I94A 1DJXA 1XFRA 1DC1A 3SIAA 1KFXL 1Y1XA 2TN4A 5PALA 3DVKA 1RFJA 5JOLA 3SG7A 1ZOTB 2QEVA 3E3RA 3AAKA 3SS3A 1IQ5A 1DF0B 1M31A 1NWDA 1NYAA 1YX8A 3LCPC 1K90D 1QVIZ 3TZ1A 1QVIY 4CIDA 2LP3A 1KFUS 3O2PA 1K2HA 2L98A 1V1GA 1M39A 1SL7A 5ER4X 1MXLC 2PVBA 2EHBA 5TNCA 1SR6C 2SASA 3I5HC 1QASA 5DKNA 1RECA 2BE6A 4PCWA 4DUQA 1S5GY 1UURA 2WOSA 5HL1A 1QLKA 3CTNA 3WHUB 1EJ3A 4PT1A 2L5YA 1B7TY 1K8UA 4IJ7A 1UWOA 3OX6A 3QRXA 4GGNA 1DELA 4PHJA 5F6TA 1YX7A 3L4LA 5CSFA 1PSRA 1BOCA 1WLMA 4YRUA 2KAXA 3D74A 4GBAA 1WY9A 2K7DA 2KYFA 3OHMB 4PHNA 2L2CA 1KFUL 2ISDA 1KK7Z 1CNPA 3OGNA 1FI5A 4P2YB 1CDPA 1KWOB 2RGIA 3LLEA 4MEWA 4ZCVA 1PULA 4JPZB 1N0YA 3DZTA 2I2RE 2KFGA 4JWQA 2FOTA 1QIVA 2F2PA 1JWDA 4N1GA 1DTLA 3EK7A 1SBJA 3JVTC 2L5XB 5FI6A 2L50A 4D1EA 1BJFA 2KNEA 1XFXO 3S0AA 1SY9A 3DF0A 1ODBA 2KYCA 3BFAA 4NDDA 1YUTA 4F0ZB 1BF5A 3FE8A 1RK9A 4CFRA 1XA5A 1BG1A 3S0BA 2WORA 1XFZO 1E8AA 2Y4QA 4I5NB 3SJSA 1L2OB 1Z2CB 1A75B 2MA2A 1B8LA 1JSAA 2KI6C 3BYAA 4ORAB 1V1FA 4AQJA 2JTTA 1OOIX 5IBWA 1SMGA 4QJ4B 2P70A 4R1EA 2L51A 2P6BB 5CPVA 3OBVA 3KEVA 1QV0A 3WHTB 3EKHA 4BY5A 1K9KA 5AANA 1S26D 2I7AA 1GGWA 2LCPA 1B8CA 5FI2A 1W7JB 4PE7A 3PJIA 3NSKA 2KAVA 1DQEA 3KO0A 4FTGA 2WCBA 3D76A 1OMVA 1Y1AA 4OR9B 2YGUA 3EG5B 3L4AA 4AOMA 1ZFSA 2K2AA 1HQVA 4MSPA 1CMFA 3DYEA 2WCJA 1QS7A 1Q80A 1S36A 1B4CA 2KHNA 1CM1A 3OB1B 3HCMA 3SG3A 3SG5A 2LMVA 2OTGC 3EKJA 4PE1A 1F71A 2WC5A 1LS8A 2K61A 2EC6B 5J3XA 4CPVA 1BLQA 1SCMC 1F4QA 2ZN8A 4YI9A 1NX1A 2HF5A 1TRFA 1TCOB 2HETA 1Y0VH 2KFFA 2M0RA 3D0YB 1IJ5A 1XVJA 1J7OA 3RZSA 2M7NA 2NLNA 1OQPA 4GGFA 3ZWHA 1QLSA 1KWOC 2KQ6A 5I2QA 1IH0A 2E30A 1EL4A 5I2OA 2PSRA 4YGEB 1RTP1 3B7AA 1D1OA 2I18A 1QATA 2LUXA 2BKIB 1YR5A 2H61A 1NX0A 2QACA 4N5XA 4A4BA 1SYMA 2NCPA 1YVHA 3SS5A 3I5GB 1T14A 1M63B 4AQIA 4UPGA 3NHIA 1LA3A 2LVKA 2KGRA 2M1UA 2LVJA 4A4CA 1S3PA 2M49B 1K9UA 2LMTA 1W9ZA 3CYZA 2ZRSA 3CR2A 2KPHA 1B47A 2BBNA 1NCXA 3CR5X 1YTZC 1C3ZA 4CFQA 4I5JA 2LHLA 3I5IB 3PALA 2LLUA 4MZJA 2HQ8A 1DJGA 1N65A 1ZMZA 4HRHA 1K94A 2LE9B 1VRKA 1U5IA 3VB1A 1PSBA 1UHKA 3OP0A 5EL2A 1KQVA 4GGFC 3CGAA 4ETOA 2M7LA 1AK8A 2LAPA 1JBAA 3KHEA 3S0DA 1R6PA 2Q91A 2ERBA 1MWNA 1R2UA 3NSIA 4PHMA 1OOFA 1P28A 4YI8A 2H61C 1AUIB 1NIWA 1L7ZA 3TDUA 1G33A 1TTXA 3JTDC 1PALA 2Y1NA 2MBXA 1JFKA 2KI6D 3MSEB 4M2OA 1K93D 1S6CA 2JNFA 2F3ZA 2MHHA 2WNDA 2ZFDA 2ZNDA 3DXLA 3FS7A 4L9MA 4ORBB 1AVSA 2JRFA 1H4BA 1OMRA 1WDCC 2AUCA 1TCFA 3FIAA 5HKZA 1F55A 2O60A 2WCLA 5K89A 1LA0A 1OZSA 1PK0D 1LINA 3NGVA 3NHTA 4OV2A 1UUSA 3CWGA 1KK7Y 2WCMA 3ZNIA 1ZUZA 4QJ5B 1MR8A 3DVMA 1DF0A 2KFHA 2QEOA 1EG3A 3S0EA 2AMIA 2F8PA 3DY9A 2JZIA 3VRQA 3BUMB 2BNXA 1ORGA 1M45A 2QEBA 3N7HA 1AP4A 2OS8C 1FI6A 5HKWA 2JWWA 4U8DA 3TUYC 2OPOA 1EH2A 1KSMA 1TNXA 2FCEA 5D69A 2K7OA 4XJKB 2KI4B 1YUUA 3CR4X 4FQOA 2KAYA 5AEQA 1B1GA 3B86A 1CFPA 1M46A 1GM0A 2JXLA 2VRGA 3R72A 1KK8C 2BECA 2LM5A 3EVUA 1C07A 3R1PA 5FYXA 1QXPA 1BT6A 1S1EA 2ZRTA 2BCBA 2QEHA 3PSRA 1IKUA 1W7IB 1B9AA 2LUCA 5KSZA 4NDBA 3IF7A 2SCPA 2LMUA 3QMEA 4OKHA 2O5GA 2PASA 2KBMA 3I5FB 1YRUB 1JUOA 1F4OA 2B1UA 1F70A 2LVVA 2A4JA 3CZ1A 1A4PA 1DGVA 4JD9A 5AERA 4JQ0D 4MLWA 3AKAA 1J1EA 4MVFA 5AXIA
chains in the Genus database with same CATH topology
1BR4B 1ALVA 1FPWA 1LXFC 1S6JA 1XFYO 1TN4A 2JNXA 3BUWB 2Q4UA 1CDLA 2WC8A 1GJYA 4MRYA 3FWCA 1NX2A 1A75A 1BMOA 1QTXA 3CZTX 3EVVA 1JF0A 3PN7B 1OOJA 4PDZA 1IG5A 5CSNA 3SG4A 1BR1B 3BOWB 5I8NA 1NCYA 4DCKA 2R2IA 1DJYA 2K2FA 4PHKA 4YBHB 1DJWA 5HYDA 1J7RA 5CSIA 1CFFA 2KQYA 1LVCD 2CXJA 1C7VA 2M8UA 1CLMA 2NZ0A 3BXKA 4GPLB 4HRGA 1A2XA 1WLZA 5D7FA 3VROA 1WRZA 2GGMA 3LK0A 1SR6B 2PRUA 4PE0A 1FW4A 3I5HB 1N2DA 5KU1A 1CMGA 1IWQA 4USLA 2CBLA 3A4UB 2KSPA 1J7QA 1B8RA 1FBVA 4DRWA 1NCZA 1SNLA 2H2KA 1MQ1A 4N1FA 2HQWA 1QIWA 3GK1A 3PFVA 2K8MB 1L2OC 2BBMA 1OE9B 5GQQC 4BY4A 1QX2A 2M9GA 3VGOA 1ZACA 2LANA 2MRDA 1K95A 2MAZA 1CLLA 1AHRA 2MLFC 3D0YA 4HREE 1Y1UA 3GK4X 4OVNF 1MF8B 1QJTA 3H4SE 1SCVA 2K7CA 2WCFA 2M1KB 3RM1A 3VRRA 4I5LB 2L0PA 1XFVO 3JVTB 4TNCA 3DVJA 4Q04A 3NSOA 3NXAA 1OZOA 1XO5A 4MBEA 4ORCB 1CFDA 2KOTA 1QV1A 2K0JA 1YUSA 1CTRA 1NSHA 3SG2A 1GGZA 2IS9A 1TOPA 1UHJA 2CT9A 2M97A 3VRPA 1SRAA 4MZKA 2M3WA 4DS7A 1H8BA 2MJWB 3PM8A 1A29A 2EC6C 1KCYA 4YGAA 2JULA 3PN7C 1CLBA 3D10A 1F54A 1JC2A 2Y5IA 2CNPA 1G8IA 3ICBA 4ICBA 1G4YR 2G2BA 1PVAA 5ER5A 3PATA 1IQ3A 4NQGA 1QX7A 3VRNA 2Y1MA 3TDIA 2KGBC 4M2PA 1CKKA 2F2OA 4I5KA 1KQMB 2GV5A 4CLNA 1XK4A 5AFPA 2JPTA 1IGVA 1NPQA 4NDCA 4PE4A 5G08A 2JT0A 3DF0B 2FCDA 2OTGB 1S5GZ 3BQ3A 2CTNA 2GGZA 3I5GC 3O4YA 1SCMB 3TDZA 3O6BA 1B7TZ 2KBIA 1PVBA 2JQ6A 2JXCA 1SL8A 3NSLA 4MN0A 4IL1A 1A03A 1OMDA 3OX5A 1DGUA 1TNWA 5KTYA 1XFUO 2K7BA 3GK2A 4GUKA 2DOQA 1JFJA 2QPTA 1J55A 2ZKMX 4QJ3B 2JC2A 2BL0B 1DJZA 1XFWO 2PMYA 2BCAA 3I5IC 2F3YA 4XYNA 1F8HA 2PALA 1UHHA 2BE4A 5HKYA 2JOJA 1RROA 2MLEC 2BCXA 2E6WA 4MZLA 2L2EA 1XK4C 5DKRA 4HSZA 2LC5A 4C0JA 2WCEA 1RJVA 3LL8B 1IRJA 1TIZA 3WNXB 3WXAA 1SPYA 2FJUB 1X02A 4XJKA 5I2LA 3BUNB 5JJGA 4E68A 1CDMA 1SKTA 2HPSA 1CDNA 1UP5A 1C7WA 1CM4A 3SG6A 3CS1A 1SK6D 1XYDA 1EG4A 4WQ2A 1K9PA 2JU0A 1CFCA 1DMOA 3TS5B 3O78A 1TNPA 2ZN9A 4ZCUA 2M29A 2CCMA 4GAOA 1FF1A 1DT7B 3BUXB 1K96A 1PRWA 1SL9A 2LNKA 3SIBA 3F45A 1DJHA 1KQMC 2ZNEA 1UHIA 3PLFB 3RLZA 3K21A 5BPJA 4YGDB 5B8IB 1GQMA 1QX5B 1Y6WA 3JTDB 5DKQA 2G9BA 2L4IA 4MRXA 2EGDA 2COLB 1J1DA 3EK4A 1TNQA 3AAJA 3BUOB 1WRLA 3C1VA 2BKHB 1WRKA 1AJ4A 3HX4A 1MHOA 4YGBB 4OCIA 2KI4C 1RWYA 1WDCB 3LK1A 3FWBA 4PALA 1DJIA 1BU3A 1BODA 4DIRA 2JT8A 3BOWA 2LHIA 3DVEA 2NCOA 1LKJA 1S6IA 3CLNA 1YVLA 1NX3A 2BL0C 2I94A 4YGCB 1JF2A 2LP2A 2JT3A 3EK8A 1ALWA 1U5IB 1KSOA 1CB1A 2NXQA 1IJ6A 3OB2B 1AJ5A 4GNKB 2V53A 5CSJA 1UHNA 1DVIA 3I5FC 4GFTA 1KFXS 2LLSA 2OS8B 5HLVA 1NUBA 3TUYB 1EXRA 3GOFA 4M2QA 2L4HA 3IQQA 3EVRA 3KF9A 1J7PA 2JTZA 4C0KA 3AKBA 2F33A 3A8RA 1NP8A 4WRIA 2LLTA 1MUXA 1KK8B 1YRTB 2LVIA 2KDHA 4WQ3A 4C0LA 1SW8A 1OSAA 2D8NA 3M0WA 4P5OE 1HT9A 1YURA 2AAOA 3IQOA 1MXEA 2LV7A 3TS5C 3DD4A 5HLOA 3KPXA 1DJXA 3SIAA 1KFXL 1Y1XA 2TN4A 5PALA 3DVKA 1RFJA 5JOLA 3SG7A 1ZOTB 3E3RA 3AAKA 1IQ5A 1DF0B 1M31A 1NWDA 1NYAA 1YX8A 3LCPC 1K90D 1QVIZ 3TZ1A 1QVIY 4CIDA 2LP3A 1KFUS 3O2PA 1K2HA 2L98A 1V1GA 1M39A 1SL7A 5ER4X 1MXLC 2PVBA 2EHBA 5TNCA 1SR6C 2SASA 3I5HC 1QASA 5DKNA 1RECA 2BE6A 4PCWA 4DUQA 1S5GY 1UURA 2WOSA 1QLKA 3CTNA 3WHUB 1EJ3A 1B7TY 1K8UA 1UWOA 3OX6A 3QRXA 4GGNA 4PHJA 5F6TA 1YX7A 5CSFA 1PSRA 1BOCA 1WLMA 4YRUA 2KAXA 4GBAA 1WY9A 2K7DA 2KYFA 3OHMB 4PHNA 2ISDA 1KFUL 1KK7Z 1CNPA 1FI5A 4P2YB 1CDPA 1KWOB 2RGIA 3LLEA 4MEWA 4ZCVA 1PULA 4JPZB 1N0YA 2I2RE 2KFGA 4JWQA 2FOTA 1QIVA 2F2PA 1JWDA 4N1GA 1DTLA 3EK7A 1SBJA 3JVTC 2L5XB 4D1EA 2L50A 1BJFA 2KNEA 1XFXO 1SY9A 3DF0A 1ODBA 2KYCA 4NDDA 1YUTA 4F0ZB 1BF5A 1RK9A 4CFRA 1XA5A 1BG1A 2WORA 1XFZO 1E8AA 2Y4QA 4I5NB 3SJSA 1L2OB 2MA2A 1A75B 1B8LA 1JSAA 2KI6C 3BYAA 4ORAB 1V1FA 4AQJA 2JTTA 5IBWA 1SMGA 4QJ4B 4R1EA 2L51A 2P6BB 5CPVA 3KEVA 1QV0A 3WHTB 3EKHA 4BY5A 1K9KA 5AANA 1S26D 2I7AA 1GGWA 2LCPA 1B8CA 1W7JB 4PE7A 3NSKA 2KAVA 4FTGA 3KO0A 2WCBA 1OMVA 1Y1AA 4OR9B 4AOMA 1ZFSA 2K2AA 1HQVA 4MSPA 1CMFA 1QS7A 1Q80A 1S36A 1B4CA 2KHNA 1CM1A 3OB1B 3HCMA 3SG3A 3SG5A 2LMVA 2OTGC 3EKJA 4PE1A 1F71A 2K61A 2EC6B 5J3XA 4CPVA 1BLQA 1SCMC 1F4QA 2ZN8A 4YI9A 1NX1A 2HF5A 1TRFA 1TCOB 2HETA 1Y0VH 2KFFA 2M0RA 3D0YB 1IJ5A 1XVJA 1J7OA 2M7NA 2NLNA 1OQPA 4GGFA 3ZWHA 1QLSA 1KWOC 2KQ6A 5I2QA 1IH0A 2E30A 1EL4A 5I2OA 2PSRA 4YGEB 1RTP1 1D1OA 2I18A 1QATA 2LUXA 2BKIB 1YR5A 2H61A 1NX0A 2QACA 4N5XA 4A4BA 1SYMA 2NCPA 1YVHA 3I5GB 1M63B 4AQIA 4UPGA 1LA3A 2LVKA 2KGRA 2M1UA 2LVJA 4A4CA 1S3PA 2M49B 1K9UA 2LMTA 2ZRSA 3CR2A 1B47A 2BBNA 1NCXA 3CR5X 1YTZC 4CFQA 4I5JA 2LHLA 3I5IB 3PALA 2LLUA 4MZJA 2HQ8A 1DJGA 1N65A 1ZMZA 4HRHA 1K94A 2LE9B 1VRKA 1U5IA 1KQVA 1PSBA 1UHKA 3OP0A 4GGFC 3CGAA 4ETOA 2M7LA 1AK8A 2LAPA 1JBAA 3KHEA 1R6PA 2Q91A 1MWNA 1R2UA 3NSIA 4PHMA 4YI8A 2H61C 1AUIB 1NIWA 1L7ZA 3TDUA 1G33A 1TTXA 3JTDC 1PALA 2Y1NA 2MBXA 1JFKA 2KI6D 3MSEB 4M2OA 1K93D 1S6CA 2JNFA 2F3ZA 2MHHA 2WNDA 2ZFDA 2ZNDA 3FS7A 4L9MA 4ORBB 1AVSA 2JRFA 1H4BA 1OMRA 1WDCC 2AUCA 1TCFA 3FIAA 5HKZA 1F55A 2O60A 5K89A 1LA0A 1OZSA 1PK0D 1LINA 4OV2A 1UUSA 3CWGA 1KK7Y 3ZNIA 1ZUZA 4QJ5B 1MR8A 3DVMA 1DF0A 2KFHA 1EG3A 2AMIA 2F8PA 3VRQA 2JZIA 3BUMB 1M45A 1AP4A 2OS8C 1FI6A 5HKWA 2JWWA 4U8DA 3TUYC 2OPOA 1EH2A 1KSMA 1TNXA 2FCEA 5D69A 2K7OA 4XJKB 2KI4B 1YUUA 3CR4X 4FQOA 2KAYA 5AEQA 1B1GA 1CFPA 1M46A 2JXLA 2VRGA 1KK8C 2BECA 2LM5A 3EVUA 1C07A 5FYXA 1QXPA 1BT6A 1S1EA 2ZRTA 2BCBA 1IKUA 3PSRA 1W7IB 1B9AA 2LUCA 5KSZA 4NDBA 3IF7A 2SCPA 2LMUA 4OKHA 2O5GA 2PASA 2KBMA 3I5FB 1YRUB 1JUOA 1F4OA 2B1UA 1F70A 2LVVA 2A4JA 1A4PA 1DGVA 5AERA 4JQ0D 4MLWA 3AKAA 1J1EA 4MVFA 5AXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BR4 B;  1ALV A;  1FPW A;  1LXF C;  1S6J A;  1XFY O;  1TN4 A;  2JNX A;  3BUW B;  2Q4U A;  1CDL A;  2WC8 A;  1GJY A;  4MRY A;  3FWC A;  1NX2 A;  1A75 A;  1BMO A;  1QTX A;  3CZT X;  3EVV A;  1JF0 A;  3PN7 B;  1OOJ A;  4PDZ A;  1IG5 A;  5CSN A;  3SG4 A;  1BR1 B;  3BOW B;  5I8N A;  1NCY A;  4DCK A;  2R2I A;  1DJY A;  2K2F A;  4PHK A;  4YBH B;  1DJW A;  5HYD A;  1J7R A;  5CSI A;  1CFF A;  2KQY A;  1LVC D;  2CXJ A;  1C7V A;  2M8U A;  1CLM A;  2NZ0 A;  3BXK A;  4GPL B;  4HRG A;  1A2X A;  1WLZ A;  5D7F A;  3VRO A;  1WRZ A;  2GGM A;  3LK0 A;  1SR6 B;  2PRU A;  4PE0 A;  1FW4 A;  3I5H B;  1N2D A;  5KU1 A;  1CMG A;  1IWQ A;  4USL A;  2CBL A;  3A4U B;  2KSP A;  1J7Q A;  1B8R A;  1FBV A;  4DRW A;  1NCZ A;  1SNL A;  2H2K A;  1MQ1 A;  4N1F A;  2HQW A;  1QIW A;  3GK1 A;  3PFV A;  2K8M B;  1L2O C;  2BBM A;  1OE9 B;  5GQQ C;  4BY4 A;  1QX2 A;  2M9G A;  3VGO A;  1ZAC A;  2LAN A;  2MRD A;  1K95 A;  2MAZ A;  1CLL A;  1AHR A;  2MLF C;  3D0Y A;  4HRE E;  1Y1U A;  3GK4 X;  4OVN F;  1MF8 B;  1QJT A;  3H4S E;  1SCV A;  2K7C A;  2WCF A;  2M1K B;  3RM1 A;  3VRR A;  4I5L B;  2L0P A;  1XFV O;  3JVT B;  4TNC A;  3DVJ A;  4Q04 A;  3NSO A;  3NXA A;  1OZO A;  1XO5 A;  4MBE A;  4ORC B;  1CFD A;  2KOT A;  1QV1 A;  2K0J A;  1YUS A;  1CTR A;  1NSH A;  3SG2 A;  1GGZ A;  2IS9 A;  1TOP A;  1UHJ A;  2CT9 A;  2M97 A;  3VRP A;  1SRA A;  4MZK A;  2M3W A;  4DS7 A;  1H8B A;  2MJW B;  3PM8 A;  1A29 A;  2EC6 C;  1KCY A;  4YGA A;  2JUL A;  3PN7 C;  1CLB A;  3D10 A;  1F54 A;  1JC2 A;  2Y5I A;  2CNP A;  1G8I A;  3ICB A;  4ICB A;  1G4Y R;  2G2B A;  1PVA A;  5ER5 A;  3PAT A;  1IQ3 A;  4NQG A;  1QX7 A;  3VRN A;  2Y1M A;  3TDI A;  2KGB C;  4M2P A;  1CKK A;  2F2O A;  4I5K A;  1KQM B;  2GV5 A;  4CLN A;  1XK4 A;  5AFP A;  2JPT A;  1IGV A;  1NPQ A;  4NDC A;  4PE4 A;  5G08 A;  2JT0 A;  3DF0 B;  2FCD A;  2OTG B;  1S5G Z;  3BQ3 A;  2CTN A;  2GGZ A;  3I5G C;  3O4Y A;  1SCM B;  3TDZ A;  3O6B A;  1B7T Z;  2KBI A;  1PVB A;  2JQ6 A;  2JXC A;  1SL8 A;  3NSL A;  4MN0 A;  4IL1 A;  1A03 A;  1OMD A;  3OX5 A;  1DGU A;  1TNW A;  5KTY A;  1XFU O;  2K7B A;  3GK2 A;  4GUK A;  2DOQ A;  1JFJ A;  2QPT A;  1J55 A;  2ZKM X;  4QJ3 B;  2JC2 A;  2BL0 B;  1DJZ A;  1XFW O;  2PMY A;  2BCA A;  3I5I C;  2F3Y A;  4XYN A;  1F8H A;  2PAL A;  1UHH A;  2BE4 A;  5HKY A;  2JOJ A;  1RRO A;  2MLE C;  2BCX A;  2E6W A;  4MZL A;  2L2E A;  1XK4 C;  5DKR A;  4HSZ A;  2LC5 A;  4C0J A;  2WCE A;  1RJV A;  3LL8 B;  1IRJ A;  1TIZ A;  3WNX B;  3WXA A;  1SPY A;  2FJU B;  1X02 A;  4XJK A;  5I2L A;  3BUN B;  5JJG A;  4E68 A;  1CDM A;  1SKT A;  2HPS A;  1CDN A;  1UP5 A;  1C7W A;  1CM4 A;  3SG6 A;  3CS1 A;  1SK6 D;  1XYD A;  1EG4 A;  4WQ2 A;  1K9P A;  2JU0 A;  1CFC A;  1DMO A;  3TS5 B;  3O78 A;  1TNP A;  2ZN9 A;  4ZCU A;  2M29 A;  2CCM A;  4GAO A;  1FF1 A;  1DT7 B;  3BUX B;  1K96 A;  1PRW A;  1SL9 A;  2LNK A;  3SIB A;  3F45 A;  1DJH A;  1KQM C;  2ZNE A;  1UHI A;  3PLF B;  3RLZ A;  3K21 A;  5BPJ A;  4YGD B;  5B8I B;  1GQM A;  1QX5 B;  1Y6W A;  3JTD B;  5DKQ A;  2G9B A;  2L4I A;  4MRX A;  2EGD A;  2COL B;  1J1D A;  3EK4 A;  1TNQ A;  3AAJ A;  3BUO B;  1WRL A;  3C1V A;  2BKH B;  1WRK A;  1AJ4 A;  3HX4 A;  1MHO A;  4YGB B;  4OCI A;  2KI4 C;  1RWY A;  1WDC B;  3LK1 A;  3FWB A;  4PAL A;  1DJI A;  1BU3 A;  1BOD A;  4DIR A;  2JT8 A;  3BOW A;  2LHI A;  3DVE A;  2NCO A;  1LKJ A;  1S6I A;  3CLN A;  1YVL A;  1NX3 A;  2BL0 C;  2I94 A;  4YGC B;  1JF2 A;  2LP2 A;  2JT3 A;  3EK8 A;  1ALW A;  1U5I B;  1KSO A;  1CB1 A;  2NXQ A;  1IJ6 A;  3OB2 B;  1AJ5 A;  4GNK B;  2V53 A;  5CSJ A;  1UHN A;  1DVI A;  3I5F C;  4GFT A;  1KFX S;  2LLS A;  2OS8 B;  5HLV A;  1NUB A;  3TUY B;  1EXR A;  3GOF A;  4M2Q A;  2L4H A;  3IQQ A;  3EVR A;  3KF9 A;  1J7P A;  2JTZ A;  4C0K A;  3AKB A;  2F33 A;  3A8R A;  1NP8 A;  4WRI A;  2LLT A;  1MUX A;  1KK8 B;  1YRT B;  2LVI A;  2KDH A;  4WQ3 A;  4C0L A;  1SW8 A;  1OSA A;  2D8N A;  3M0W A;  4P5O E;  1HT9 A;  1YUR A;  2AAO A;  3IQO A;  1MXE A;  2LV7 A;  3TS5 C;  3DD4 A;  5HLO A;  3KPX A;  1DJX A;  3SIA A;  1KFX L;  1Y1X A;  2TN4 A;  5PAL A;  3DVK A;  1RFJ A;  5JOL A;  3SG7 A;  1ZOT B;  3E3R A;  3AAK A;  1IQ5 A;  1DF0 B;  1M31 A;  1NWD A;  1NYA A;  1YX8 A;  3LCP C;  1K90 D;  1QVI Z;  3TZ1 A;  1QVI Y;  4CID A;  2LP3 A;  1KFU S;  3O2P A;  1K2H A;  2L98 A;  1V1G A;  1M39 A;  1SL7 A;  5ER4 X;  1MXL C;  2PVB A;  2EHB A;  5TNC A;  1SR6 C;  2SAS A;  3I5H C;  1QAS A;  5DKN A;  1REC A;  2BE6 A;  4PCW A;  4DUQ A;  1S5G Y;  1UUR A;  2WOS A;  1QLK A;  3CTN A;  3WHU B;  1EJ3 A;  1B7T Y;  1K8U A;  1UWO A;  3OX6 A;  3QRX A;  4GGN A;  4PHJ A;  5F6T A;  1YX7 A;  5CSF A;  1PSR A;  1BOC A;  1WLM A;  4YRU A;  2KAX A;  4GBA A;  1WY9 A;  2K7D A;  2KYF A;  3OHM B;  4PHN A;  2ISD A;  1KFU L;  1KK7 Z;  1CNP A;  1FI5 A;  4P2Y B;  1CDP A;  1KWO B;  2RGI A;  3LLE A;  4MEW A;  4ZCV A;  1PUL A;  4JPZ B;  1N0Y A;  2I2R E;  2KFG A;  4JWQ A;  2FOT A;  1QIV A;  2F2P A;  1JWD A;  4N1G A;  1DTL A;  3EK7 A;  1SBJ A;  3JVT C;  2L5X B;  4D1E A;  2L50 A;  1BJF A;  2KNE A;  1XFX O;  1SY9 A;  3DF0 A;  1ODB A;  2KYC A;  4NDD A;  1YUT A;  4F0Z B;  1BF5 A;  1RK9 A;  4CFR A;  1XA5 A;  1BG1 A;  2WOR A;  1XFZ O;  1E8A A;  2Y4Q A;  4I5N B;  3SJS A;  1L2O B;  2MA2 A;  1A75 B;  1B8L A;  1JSA A;  2KI6 C;  3BYA A;  4ORA B;  1V1F A;  4AQJ A;  2JTT A;  5IBW A;  1SMG A;  4QJ4 B;  4R1E A;  2L51 A;  2P6B B;  5CPV A;  3KEV A;  1QV0 A;  3WHT B;  3EKH A;  4BY5 A;  1K9K A;  5AAN A;  1S26 D;  2I7A A;  1GGW A;  2LCP A;  1B8C A;  1W7J B;  4PE7 A;  3NSK A;  2KAV A;  4FTG A;  3KO0 A;  2WCB A;  1OMV A;  1Y1A A;  4OR9 B;  4AOM A;  1ZFS A;  2K2A A;  1HQV A;  4MSP A;  1CMF A;  1QS7 A;  1Q80 A;  1S36 A;  1B4C A;  2KHN A;  1CM1 A;  3OB1 B;  3HCM A;  3SG3 A;  3SG5 A;  2LMV A;  2OTG C;  3EKJ A;  4PE1 A;  1F71 A;  2K61 A;  2EC6 B;  5J3X A;  4CPV A;  1BLQ A;  1SCM C;  1F4Q A;  2ZN8 A;  4YI9 A;  1NX1 A;  2HF5 A;  1TRF A;  1TCO B;  2HET A;  1Y0V H;  2KFF A;  2M0R A;  3D0Y B;  1IJ5 A;  1XVJ A;  1J7O A;  2M7N A;  2NLN A;  1OQP A;  4GGF A;  3ZWH A;  1QLS A;  1KWO C;  2KQ6 A;  5I2Q A;  1IH0 A;  2E30 A;  1EL4 A;  5I2O A;  2PSR A;  4YGE B;  1RTP 1;  1D1O A;  2I18 A;  1QAT A;  2LUX A;  2BKI B;  1YR5 A;  2H61 A;  1NX0 A;  2QAC A;  4N5X A;  4A4B A;  1SYM A;  2NCP A;  1YVH A;  3I5G B;  1M63 B;  4AQI A;  4UPG A;  1LA3 A;  2LVK A;  2KGR A;  2M1U A;  2LVJ A;  4A4C A;  1S3P A;  2M49 B;  1K9U A;  2LMT A;  2ZRS A;  3CR2 A;  1B47 A;  2BBN A;  1NCX A;  3CR5 X;  1YTZ C;  4CFQ A;  4I5J A;  2LHL A;  3I5I B;  3PAL A;  2LLU A;  4MZJ A;  2HQ8 A;  1DJG A;  1N65 A;  1ZMZ A;  4HRH A;  1K94 A;  2LE9 B;  1VRK A;  1U5I A;  1KQV A;  1PSB A;  1UHK A;  3OP0 A;  4GGF C;  3CGA A;  4ETO A;  2M7L A;  1AK8 A;  2LAP A;  1JBA A;  3KHE A;  1R6P A;  2Q91 A;  1MWN A;  1R2U A;  3NSI A;  4PHM A;  4YI8 A;  2H61 C;  1AUI B;  1NIW A;  1L7Z A;  3TDU A;  1G33 A;  1TTX A;  3JTD C;  1PAL A;  2Y1N A;  2MBX A;  1JFK A;  2KI6 D;  3MSE B;  4M2O A;  1K93 D;  1S6C A;  2JNF A;  2F3Z A;  2MHH A;  2WND A;  2ZFD A;  2ZND A;  3FS7 A;  4L9M A;  4ORB B;  1AVS A;  2JRF A;  1H4B A;  1OMR A;  1WDC C;  2AUC A;  1TCF A;  3FIA A;  5HKZ A;  1F55 A;  2O60 A;  5K89 A;  1LA0 A;  1OZS A;  1PK0 D;  1LIN A;  4OV2 A;  1UUS A;  3CWG A;  1KK7 Y;  3ZNI A;  1ZUZ A;  4QJ5 B;  1MR8 A;  3DVM A;  1DF0 A;  2KFH A;  1EG3 A;  2AMI A;  2F8P A;  3VRQ A;  2JZI A;  3BUM B;  1M45 A;  1AP4 A;  2OS8 C;  1FI6 A;  5HKW A;  2JWW A;  4U8D A;  3TUY C;  2OPO A;  1EH2 A;  1KSM A;  1TNX A;  2FCE A;  5D69 A;  2K7O A;  4XJK B;  2KI4 B;  1YUU A;  3CR4 X;  4FQO A;  2KAY A;  5AEQ A;  1B1G A;  1CFP A;  1M46 A;  2JXL A;  2VRG A;  1KK8 C;  2BEC A;  2LM5 A;  3EVU A;  1C07 A;  5FYX A;  1QXP A;  1BT6 A;  1S1E A;  2ZRT A;  2BCB A;  1IKU A;  3PSR A;  1W7I B;  1B9A A;  2LUC A;  5KSZ A;  4NDB A;  3IF7 A;  2SCP A;  2LMU A;  4OKH A;  2O5G A;  2PAS A;  2KBM A;  3I5F B;  1YRU B;  1JUO A;  1F4O A;  2B1U A;  1F70 A;  2LVV A;  2A4J A;  1A4P A;  1DGV A;  5AER A;  4JQ0 D;  4MLW A;  3AKA A;  1J1E A;  4MVF A;  5AXI A; 
#chains in the Genus database with same CATH topology
 1BR4 B;  1ALV A;  1FPW A;  1LXF C;  5D3O A;  1S6J A;  1XFY O;  1TN4 A;  3BJH A;  3L47 A;  2JNX A;  2KLE A;  3BUW B;  2Q4U A;  1CDL A;  2WC8 A;  1GJY A;  4MRY A;  3FWC A;  1NX2 A;  1A75 A;  1BMO A;  3CZ0 A;  1QTX A;  3B88 A;  3CZT X;  3EVV A;  1JF0 A;  3PN7 B;  1OOJ A;  4PDZ A;  1IG5 A;  5CSN A;  3SG4 A;  1BR1 B;  3BOW B;  5I8N A;  1NCY A;  4DCK A;  2R2I A;  1DJY A;  2K2F A;  4PHK A;  4YBH B;  1DJW A;  5HYD A;  1J7R A;  5CSI A;  1CFF A;  2KQY A;  1LVC D;  2CXJ A;  4FQT A;  1C7V A;  2M8U A;  1CLM A;  2NZ0 A;  3BXK A;  3BFH A;  1TUJ A;  4GPL B;  4HRG A;  1A2X A;  1WLZ A;  3R1V A;  5D7F A;  1WRZ A;  2GGM A;  3LK0 A;  3VRO A;  1SR6 B;  2PRU A;  4PE0 A;  1FW4 A;  3I5H B;  1N2D A;  5KU1 A;  2GTE A;  1CMG A;  1IWQ A;  1TUZ A;  3D75 A;  4USL A;  2CBL A;  3A4U B;  2KSP A;  1J7Q A;  1B8R A;  1FBV A;  3S0G A;  3R1O A;  4DRW A;  1NCZ A;  1SNL A;  2H2K A;  1MQ1 A;  2WCH A;  4N1F A;  2HQW A;  1QIW A;  3GK1 A;  3PFV A;  2K8M B;  1L2O C;  2BBM A;  1OE9 B;  5GQQ C;  4BY4 A;  1QX2 A;  2M9G A;  3VGO A;  1ZAC A;  1QWV A;  2LAN A;  2MRD A;  1K95 A;  1OOG A;  2MAZ A;  1CLL A;  1AHR A;  2MLF C;  3D0Y A;  4HRE E;  1Y1U A;  3B87 A;  3GK4 X;  4OVN F;  1MF8 B;  1QJT A;  3H4S E;  1SCV A;  2K7C A;  2WCF A;  2M1K B;  3RM1 A;  3VRR A;  4I5L B;  3SS4 A;  2L0P A;  1XFV O;  3JVT B;  4TNC A;  3DVJ A;  4Q04 A;  3NSO A;  3NXA A;  1OZO A;  1XO5 A;  4MBE A;  4ORC B;  1CFD A;  2KOT A;  1QV1 A;  2K0J A;  1YUS A;  1CTR A;  1NSH A;  3SG2 A;  1GGZ A;  2IS9 A;  1TOP A;  1UHJ A;  2CT9 A;  2M97 A;  3VRP A;  1SRA A;  1Z4H A;  3UO9 A;  4MZK A;  2M3W A;  4DS7 A;  1H8B A;  2MJW B;  3PM8 A;  1A29 A;  2EC6 C;  1KCY A;  4YGA A;  2JUL A;  3PN7 C;  1CLB A;  3D10 A;  1F54 A;  2BAP A;  1JC2 A;  2Y5I A;  2CNP A;  1G8I A;  3ICB A;  4ICB A;  1G4Y R;  2G2B A;  1PVA A;  5ER5 A;  3BFB A;  3PAT A;  1IQ3 A;  4NQG A;  1QX7 A;  3VRN A;  2Y1M A;  3TDI A;  2KGB C;  4M2P A;  1CKK A;  3CZ2 A;  2K60 A;  2PYQ A;  2F2O A;  4I5K A;  1KQM B;  2GV5 A;  4CLN A;  1XK4 A;  4F7F A;  5AFP A;  2JPT A;  1IGV A;  1NPQ A;  4NDC A;  4PE4 A;  5G08 A;  2JT0 A;  3DF0 B;  2FCD A;  2OTG B;  1S5G Z;  3BQ3 A;  2CTN A;  2GGZ A;  3I5G C;  3IVT A;  1SCM B;  3B6X A;  3O4Y A;  3O6B A;  3TDZ A;  1B7T Z;  2KBI A;  1PVB A;  2JQ6 A;  2JXC A;  1SL8 A;  3NSL A;  4MN0 A;  3FE9 A;  4IL1 A;  1A03 A;  2FJY A;  1OMD A;  3OX5 A;  1DGU A;  1TNW A;  5KTY A;  1XFU O;  2K7B A;  3GK2 A;  4GUK A;  2DOQ A;  1JFJ A;  2QPT A;  1J55 A;  2ZKM X;  4QJ3 B;  4INW A;  2JC2 A;  2BL0 B;  1DJZ A;  1XFW O;  2PMY A;  2BCA A;  3I5I C;  2F3Y A;  1SSE B;  4XYN A;  1F8H A;  2PAL A;  1UHH A;  2BE4 A;  5HKY A;  2JOJ A;  1RRO A;  2MLE C;  2BCX A;  3FE6 A;  2E6W A;  4MZL A;  2L2E A;  1XK4 C;  5DKR A;  4HSZ A;  2LC5 A;  4C0J A;  2WCE A;  1RJV A;  1DEK A;  3LL8 B;  1IRJ A;  1TIZ A;  3WNX B;  3WXA A;  1SPY A;  2FJU B;  1X02 A;  4XJK A;  5I2L A;  3BUN B;  5JJG A;  4E68 A;  1CDM A;  1SKT A;  2HPS A;  1CDN A;  1UP5 A;  3UNW A;  1C7W A;  1CM4 A;  3SG6 A;  2WCK A;  1SK6 D;  1XYD A;  1EG4 A;  3CS1 A;  1K9P A;  2JU0 A;  4WQ2 A;  1CFC A;  3TS5 B;  3O78 A;  1TNP A;  1DMO A;  2ZN9 A;  4ZCU A;  2M29 A;  2CCM A;  1C3Y A;  4GAO A;  1FF1 A;  1DT7 B;  3BUX B;  1K96 A;  1PRW A;  1SL9 A;  2LNK A;  4JKT A;  3F45 A;  3SIB A;  1DJH A;  1KQM C;  2H8V A;  2ZNE A;  1OW4 A;  1UHI A;  3PLF B;  3RLZ A;  3K21 A;  5BPJ A;  4YGD B;  5B8I B;  1GQM A;  1QX5 B;  3V2L A;  1Y6W A;  3JTD B;  5DIC A;  5DKQ A;  2G9B A;  2KLD A;  2L4I A;  2EGD A;  2COL B;  4KYN A;  1J1D A;  4MRX A;  3EK4 A;  1TNQ A;  3AAJ A;  3BUO B;  1WRL A;  3C1V A;  2BKH B;  3D77 A;  1WRK A;  1AJ4 A;  3HX4 A;  1MHO A;  4YGB B;  4OCI A;  4INX A;  2KI4 C;  1RWY A;  3K1E A;  1WDC B;  3LK1 A;  3FWB A;  3D73 A;  4PAL A;  4OZD A;  1DJI A;  1BU3 A;  1BOD A;  4DIR A;  1OOH A;  2JT8 A;  3BOW A;  2LHI A;  3DVE A;  2NCO A;  1TWO A;  1LKJ A;  3S0F A;  1S6I A;  3CLN A;  2WC6 A;  1YVL A;  1NX3 A;  2BL0 C;  2I94 A;  4YGC B;  1JF2 A;  2LP2 A;  2JT3 A;  3EK8 A;  1ALW A;  1U5I B;  1KSO A;  1CB1 A;  2NXQ A;  3CDN A;  1IJ6 A;  3OB2 B;  3O4X A;  1AJ5 A;  2JPO A;  2V53 A;  3CAB A;  1UHN A;  4GNK B;  1DVI A;  5CSJ A;  3I5F C;  4GFT A;  1KFX S;  2LLS A;  2OS8 B;  5HLV A;  1IIO A;  1NUB A;  3TUY B;  1EXR A;  3GOF A;  4M2Q A;  2L4H A;  3IQQ A;  3EVR A;  3KF9 A;  1J7P A;  2JTZ A;  4C0K A;  3AKB A;  2F33 A;  3A8R A;  1NP8 A;  4WRI A;  2LLT A;  2QDI A;  5FI7 A;  1MUX A;  1KK8 B;  1YRT B;  2LVI A;  2PQL A;  2KDH A;  4WQ3 A;  4C0L A;  1SW8 A;  1OSA A;  3Q8I A;  3D78 A;  3PM2 A;  2D8N A;  3M0W A;  4P5O E;  1HT9 A;  1YUR A;  2AAO A;  3IQO A;  1MXE A;  2P71 A;  2LV7 A;  3TS5 C;  3DD4 A;  5HLO A;  3KPX A;  5I94 A;  1DJX A;  1XFR A;  1DC1 A;  3SIA A;  1KFX L;  1Y1X A;  2TN4 A;  5PAL A;  3DVK A;  1RFJ A;  5JOL A;  3SG7 A;  1ZOT B;  2QEV A;  3E3R A;  3AAK A;  3SS3 A;  1IQ5 A;  1DF0 B;  1M31 A;  1NWD A;  1NYA A;  1YX8 A;  3LCP C;  1K90 D;  1QVI Z;  3TZ1 A;  1QVI Y;  4CID A;  2LP3 A;  1KFU S;  3O2P A;  1K2H A;  2L98 A;  1V1G A;  1M39 A;  1SL7 A;  5ER4 X;  1MXL C;  2PVB A;  2EHB A;  5TNC A;  1SR6 C;  2SAS A;  3I5H C;  1QAS A;  5DKN A;  1REC A;  2BE6 A;  4PCW A;  4DUQ A;  1S5G Y;  1UUR A;  2WOS A;  5HL1 A;  1QLK A;  3CTN A;  3WHU B;  1EJ3 A;  4PT1 A;  2L5Y A;  1B7T Y;  1K8U A;  4IJ7 A;  1UWO A;  3OX6 A;  3QRX A;  4GGN A;  1DEL A;  4PHJ A;  5F6T A;  1YX7 A;  3L4L A;  5CSF A;  1PSR A;  1BOC A;  1WLM A;  4YRU A;  2KAX A;  3D74 A;  4GBA A;  1WY9 A;  2K7D A;  2KYF A;  3OHM B;  4PHN A;  2L2C A;  1KFU L;  2ISD A;  1KK7 Z;  1CNP A;  3OGN A;  1FI5 A;  4P2Y B;  1CDP A;  1KWO B;  2RGI A;  3LLE A;  4MEW A;  4ZCV A;  1PUL A;  4JPZ B;  1N0Y A;  3DZT A;  2I2R E;  2KFG A;  4JWQ A;  2FOT A;  1QIV A;  2F2P A;  1JWD A;  4N1G A;  1DTL A;  3EK7 A;  1SBJ A;  3JVT C;  2L5X B;  5FI6 A;  2L50 A;  4D1E A;  1BJF A;  2KNE A;  1XFX O;  3S0A A;  1SY9 A;  3DF0 A;  1ODB A;  2KYC A;  3BFA A;  4NDD A;  1YUT A;  4F0Z B;  1BF5 A;  3FE8 A;  1RK9 A;  4CFR A;  1XA5 A;  1BG1 A;  3S0B A;  2WOR A;  1XFZ O;  1E8A A;  2Y4Q A;  4I5N B;  3SJS A;  1L2O B;  1Z2C B;  1A75 B;  2MA2 A;  1B8L A;  1JSA A;  2KI6 C;  3BYA A;  4ORA B;  1V1F A;  4AQJ A;  2JTT A;  1OOI X;  5IBW A;  1SMG A;  4QJ4 B;  2P70 A;  4R1E A;  2L51 A;  2P6B B;  5CPV A;  3OBV A;  3KEV A;  1QV0 A;  3WHT B;  3EKH A;  4BY5 A;  1K9K A;  5AAN A;  1S26 D;  2I7A A;  1GGW A;  2LCP A;  1B8C A;  5FI2 A;  1W7J B;  4PE7 A;  3PJI A;  3NSK A;  2KAV A;  1DQE A;  3KO0 A;  4FTG A;  2WCB A;  3D76 A;  1OMV A;  1Y1A A;  4OR9 B;  2YGU A;  3EG5 B;  3L4A A;  4AOM A;  1ZFS A;  2K2A A;  1HQV A;  4MSP A;  1CMF A;  3DYE A;  2WCJ A;  1QS7 A;  1Q80 A;  1S36 A;  1B4C A;  2KHN A;  1CM1 A;  3OB1 B;  3HCM A;  3SG3 A;  3SG5 A;  2LMV A;  2OTG C;  3EKJ A;  4PE1 A;  1F71 A;  2WC5 A;  1LS8 A;  2K61 A;  2EC6 B;  5J3X A;  4CPV A;  1BLQ A;  1SCM C;  1F4Q A;  2ZN8 A;  4YI9 A;  1NX1 A;  2HF5 A;  1TRF A;  1TCO B;  2HET A;  1Y0V H;  2KFF A;  2M0R A;  3D0Y B;  1IJ5 A;  1XVJ A;  1J7O A;  3RZS A;  2M7N A;  2NLN A;  1OQP A;  4GGF A;  3ZWH A;  1QLS A;  1KWO C;  2KQ6 A;  5I2Q A;  1IH0 A;  2E30 A;  1EL4 A;  5I2O A;  2PSR A;  4YGE B;  1RTP 1;  3B7A A;  1D1O A;  2I18 A;  1QAT A;  2LUX A;  2BKI B;  1YR5 A;  2H61 A;  1NX0 A;  2QAC A;  4N5X A;  4A4B A;  1SYM A;  2NCP A;  1YVH A;  3SS5 A;  3I5G B;  1T14 A;  1M63 B;  4AQI A;  4UPG A;  3NHI A;  1LA3 A;  2LVK A;  2KGR A;  2M1U A;  2LVJ A;  4A4C A;  1S3P A;  2M49 B;  1K9U A;  2LMT A;  1W9Z A;  3CYZ A;  2ZRS A;  3CR2 A;  2KPH A;  1B47 A;  2BBN A;  1NCX A;  3CR5 X;  1YTZ C;  1C3Z A;  4CFQ A;  4I5J A;  2LHL A;  3I5I B;  3PAL A;  2LLU A;  4MZJ A;  2HQ8 A;  1DJG A;  1N65 A;  1ZMZ A;  4HRH A;  1K94 A;  2LE9 B;  1VRK A;  1U5I A;  3VB1 A;  1PSB A;  1UHK A;  3OP0 A;  5EL2 A;  1KQV A;  4GGF C;  3CGA A;  4ETO A;  2M7L A;  1AK8 A;  2LAP A;  1JBA A;  3KHE A;  3S0D A;  1R6P A;  2Q91 A;  2ERB A;  1MWN A;  1R2U A;  3NSI A;  4PHM A;  1OOF A;  1P28 A;  4YI8 A;  2H61 C;  1AUI B;  1NIW A;  1L7Z A;  3TDU A;  1G33 A;  1TTX A;  3JTD C;  1PAL A;  2Y1N A;  2MBX A;  1JFK A;  2KI6 D;  3MSE B;  4M2O A;  1K93 D;  1S6C A;  2JNF A;  2F3Z A;  2MHH A;  2WND A;  2ZFD A;  2ZND A;  3DXL A;  3FS7 A;  4L9M A;  4ORB B;  1AVS A;  2JRF A;  1H4B A;  1OMR A;  1WDC C;  2AUC A;  1TCF A;  3FIA A;  5HKZ A;  1F55 A;  2O60 A;  2WCL A;  5K89 A;  1LA0 A;  1OZS A;  1PK0 D;  1LIN A;  3NGV A;  3NHT A;  4OV2 A;  1UUS A;  3CWG A;  1KK7 Y;  2WCM A;  3ZNI A;  1ZUZ A;  4QJ5 B;  1MR8 A;  3DVM A;  1DF0 A;  2KFH A;  2QEO A;  1EG3 A;  3S0E A;  2AMI A;  2F8P A;  3DY9 A;  2JZI A;  3VRQ A;  3BUM B;  2BNX A;  1ORG A;  1M45 A;  2QEB A;  3N7H A;  1AP4 A;  2OS8 C;  1FI6 A;  5HKW A;  2JWW A;  4U8D A;  3TUY C;  2OPO A;  1EH2 A;  1KSM A;  1TNX A;  2FCE A;  5D69 A;  2K7O A;  4XJK B;  2KI4 B;  1YUU A;  3CR4 X;  4FQO A;  2KAY A;  5AEQ A;  1B1G A;  3B86 A;  1CFP A;  1M46 A;  1GM0 A;  2JXL A;  2VRG A;  3R72 A;  1KK8 C;  2BEC A;  2LM5 A;  3EVU A;  1C07 A;  3R1P A;  5FYX A;  1QXP A;  1BT6 A;  1S1E A;  2ZRT A;  2BCB A;  2QEH A;  3PSR A;  1IKU A;  1W7I B;  1B9A A;  2LUC A;  5KSZ A;  4NDB A;  3IF7 A;  2SCP A;  2LMU A;  3QME A;  4OKH A;  2O5G A;  2PAS A;  2KBM A;  3I5F B;  1YRU B;  1JUO A;  1F4O A;  2B1U A;  1F70 A;  2LVV A;  2A4J A;  3CZ1 A;  1A4P A;  1DGV A;  4JD9 A;  5AER A;  4JQ0 D;  4MLW A;  3AKA A;  1J1E A;  4MVF A;  5AXI A; 
#chains in the Genus database with same CATH homology
 1BR4 B;  1ALV A;  1FPW A;  1LXF C;  1S6J A;  1XFY O;  1TN4 A;  2JNX A;  3BUW B;  2Q4U A;  1CDL A;  2WC8 A;  1GJY A;  4MRY A;  3FWC A;  1NX2 A;  1A75 A;  1BMO A;  1QTX A;  3CZT X;  3EVV A;  1JF0 A;  3PN7 B;  1OOJ A;  4PDZ A;  1IG5 A;  5CSN A;  3SG4 A;  1BR1 B;  3BOW B;  5I8N A;  1NCY A;  4DCK A;  2R2I A;  1DJY A;  2K2F A;  4PHK A;  4YBH B;  1DJW A;  5HYD A;  1J7R A;  5CSI A;  1CFF A;  2KQY A;  1LVC D;  2CXJ A;  1C7V A;  2M8U A;  1CLM A;  2NZ0 A;  3BXK A;  4GPL B;  4HRG A;  1A2X A;  1WLZ A;  5D7F A;  3VRO A;  1WRZ A;  2GGM A;  3LK0 A;  1SR6 B;  2PRU A;  4PE0 A;  1FW4 A;  3I5H B;  1N2D A;  5KU1 A;  1CMG A;  1IWQ A;  4USL A;  2CBL A;  3A4U B;  2KSP A;  1J7Q A;  1B8R A;  1FBV A;  4DRW A;  1NCZ A;  1SNL A;  2H2K A;  1MQ1 A;  4N1F A;  2HQW A;  1QIW A;  3GK1 A;  3PFV A;  2K8M B;  1L2O C;  2BBM A;  1OE9 B;  5GQQ C;  4BY4 A;  1QX2 A;  2M9G A;  3VGO A;  1ZAC A;  2LAN A;  2MRD A;  1K95 A;  2MAZ A;  1CLL A;  1AHR A;  2MLF C;  3D0Y A;  4HRE E;  1Y1U A;  3GK4 X;  4OVN F;  1MF8 B;  1QJT A;  3H4S E;  1SCV A;  2K7C A;  2WCF A;  2M1K B;  3RM1 A;  3VRR A;  4I5L B;  2L0P A;  1XFV O;  3JVT B;  4TNC A;  3DVJ A;  4Q04 A;  3NSO A;  3NXA A;  1OZO A;  1XO5 A;  4MBE A;  4ORC B;  1CFD A;  2KOT A;  1QV1 A;  2K0J A;  1YUS A;  1CTR A;  1NSH A;  3SG2 A;  1GGZ A;  2IS9 A;  1TOP A;  1UHJ A;  2CT9 A;  2M97 A;  3VRP A;  1SRA A;  4MZK A;  2M3W A;  4DS7 A;  1H8B A;  2MJW B;  3PM8 A;  1A29 A;  2EC6 C;  1KCY A;  4YGA A;  2JUL A;  3PN7 C;  1CLB A;  3D10 A;  1F54 A;  1JC2 A;  2Y5I A;  2CNP A;  1G8I A;  3ICB A;  4ICB A;  1G4Y R;  2G2B A;  1PVA A;  5ER5 A;  3PAT A;  1IQ3 A;  4NQG A;  1QX7 A;  3VRN A;  2Y1M A;  3TDI A;  2KGB C;  4M2P A;  1CKK A;  2F2O A;  4I5K A;  1KQM B;  2GV5 A;  4CLN A;  1XK4 A;  5AFP A;  2JPT A;  1IGV A;  1NPQ A;  4NDC A;  4PE4 A;  5G08 A;  2JT0 A;  3DF0 B;  2FCD A;  2OTG B;  1S5G Z;  3BQ3 A;  2CTN A;  2GGZ A;  3I5G C;  3O4Y A;  1SCM B;  3TDZ A;  3O6B A;  1B7T Z;  2KBI A;  1PVB A;  2JQ6 A;  2JXC A;  1SL8 A;  3NSL A;  4MN0 A;  4IL1 A;  1A03 A;  1OMD A;  3OX5 A;  1DGU A;  1TNW A;  5KTY A;  1XFU O;  2K7B A;  3GK2 A;  4GUK A;  2DOQ A;  1JFJ A;  2QPT A;  1J55 A;  2ZKM X;  4QJ3 B;  2JC2 A;  2BL0 B;  1DJZ A;  1XFW O;  2PMY A;  2BCA A;  3I5I C;  2F3Y A;  4XYN A;  1F8H A;  2PAL A;  1UHH A;  2BE4 A;  5HKY A;  2JOJ A;  1RRO A;  2MLE C;  2BCX A;  2E6W A;  4MZL A;  2L2E A;  1XK4 C;  5DKR A;  4HSZ A;  2LC5 A;  4C0J A;  2WCE A;  1RJV A;  3LL8 B;  1IRJ A;  1TIZ A;  3WNX B;  3WXA A;  1SPY A;  2FJU B;  1X02 A;  4XJK A;  5I2L A;  3BUN B;  5JJG A;  4E68 A;  1CDM A;  1SKT A;  2HPS A;  1CDN A;  1UP5 A;  1C7W A;  1CM4 A;  3SG6 A;  3CS1 A;  1SK6 D;  1XYD A;  1EG4 A;  4WQ2 A;  1K9P A;  2JU0 A;  1CFC A;  1DMO A;  3TS5 B;  3O78 A;  1TNP A;  2ZN9 A;  4ZCU A;  2M29 A;  2CCM A;  4GAO A;  1FF1 A;  1DT7 B;  3BUX B;  1K96 A;  1PRW A;  1SL9 A;  2LNK A;  3SIB A;  3F45 A;  1DJH A;  1KQM C;  2ZNE A;  1UHI A;  3PLF B;  3RLZ A;  3K21 A;  5BPJ A;  4YGD B;  5B8I B;  1GQM A;  1QX5 B;  1Y6W A;  3JTD B;  5DKQ A;  2G9B A;  2L4I A;  4MRX A;  2EGD A;  2COL B;  1J1D A;  3EK4 A;  1TNQ A;  3AAJ A;  3BUO B;  1WRL A;  3C1V A;  2BKH B;  1WRK A;  1AJ4 A;  3HX4 A;  1MHO A;  4YGB B;  4OCI A;  2KI4 C;  1RWY A;  1WDC B;  3LK1 A;  3FWB A;  4PAL A;  1DJI A;  1BU3 A;  1BOD A;  4DIR A;  2JT8 A;  3BOW A;  2LHI A;  3DVE A;  2NCO A;  1LKJ A;  1S6I A;  3CLN A;  1YVL A;  1NX3 A;  2BL0 C;  2I94 A;  4YGC B;  1JF2 A;  2LP2 A;  2JT3 A;  3EK8 A;  1ALW A;  1U5I B;  1KSO A;  1CB1 A;  2NXQ A;  1IJ6 A;  3OB2 B;  1AJ5 A;  4GNK B;  2V53 A;  5CSJ A;  1UHN A;  1DVI A;  3I5F C;  4GFT A;  1KFX S;  2LLS A;  2OS8 B;  5HLV A;  1NUB A;  3TUY B;  1EXR A;  3GOF A;  4M2Q A;  2L4H A;  3IQQ A;  3EVR A;  3KF9 A;  1J7P A;  2JTZ A;  4C0K A;  3AKB A;  2F33 A;  3A8R A;  1NP8 A;  4WRI A;  2LLT A;  1MUX A;  1KK8 B;  1YRT B;  2LVI A;  2KDH A;  4WQ3 A;  4C0L A;  1SW8 A;  1OSA A;  2D8N A;  3M0W A;  4P5O E;  1HT9 A;  1YUR A;  2AAO A;  3IQO A;  1MXE A;  2LV7 A;  3TS5 C;  3DD4 A;  5HLO A;  3KPX A;  1DJX A;  3SIA A;  1KFX L;  1Y1X A;  2TN4 A;  5PAL A;  3DVK A;  1RFJ A;  5JOL A;  3SG7 A;  1ZOT B;  3E3R A;  3AAK A;  1IQ5 A;  1DF0 B;  1M31 A;  1NWD A;  1NYA A;  1YX8 A;  3LCP C;  1K90 D;  1QVI Z;  3TZ1 A;  1QVI Y;  4CID A;  2LP3 A;  1KFU S;  3O2P A;  1K2H A;  2L98 A;  1V1G A;  1M39 A;  1SL7 A;  5ER4 X;  1MXL C;  2PVB A;  2EHB A;  5TNC A;  1SR6 C;  2SAS A;  3I5H C;  1QAS A;  5DKN A;  1REC A;  2BE6 A;  4PCW A;  4DUQ A;  1S5G Y;  1UUR A;  2WOS A;  1QLK A;  3CTN A;  3WHU B;  1EJ3 A;  1B7T Y;  1K8U A;  1UWO A;  3OX6 A;  3QRX A;  4GGN A;  4PHJ A;  5F6T A;  1YX7 A;  5CSF A;  1PSR A;  1BOC A;  1WLM A;  4YRU A;  2KAX A;  4GBA A;  1WY9 A;  2K7D A;  2KYF A;  3OHM B;  4PHN A;  2ISD A;  1KFU L;  1KK7 Z;  1CNP A;  1FI5 A;  4P2Y B;  1CDP A;  1KWO B;  2RGI A;  3LLE A;  4MEW A;  4ZCV A;  1PUL A;  4JPZ B;  1N0Y A;  2I2R E;  2KFG A;  4JWQ A;  2FOT A;  1QIV A;  2F2P A;  1JWD A;  4N1G A;  1DTL A;  3EK7 A;  1SBJ A;  3JVT C;  2L5X B;  4D1E A;  2L50 A;  1BJF A;  2KNE A;  1XFX O;  1SY9 A;  3DF0 A;  1ODB A;  2KYC A;  4NDD A;  1YUT A;  4F0Z B;  1BF5 A;  1RK9 A;  4CFR A;  1XA5 A;  1BG1 A;  2WOR A;  1XFZ O;  1E8A A;  2Y4Q A;  4I5N B;  3SJS A;  1L2O B;  2MA2 A;  1A75 B;  1B8L A;  1JSA A;  2KI6 C;  3BYA A;  4ORA B;  1V1F A;  4AQJ A;  2JTT A;  5IBW A;  1SMG A;  4QJ4 B;  4R1E A;  2L51 A;  2P6B B;  5CPV A;  3KEV A;  1QV0 A;  3WHT B;  3EKH A;  4BY5 A;  1K9K A;  5AAN A;  1S26 D;  2I7A A;  1GGW A;  2LCP A;  1B8C A;  1W7J B;  4PE7 A;  3NSK A;  2KAV A;  4FTG A;  3KO0 A;  2WCB A;  1OMV A;  1Y1A A;  4OR9 B;  4AOM A;  1ZFS A;  2K2A A;  1HQV A;  4MSP A;  1CMF A;  1QS7 A;  1Q80 A;  1S36 A;  1B4C A;  2KHN A;  1CM1 A;  3OB1 B;  3HCM A;  3SG3 A;  3SG5 A;  2LMV A;  2OTG C;  3EKJ A;  4PE1 A;  1F71 A;  2K61 A;  2EC6 B;  5J3X A;  4CPV A;  1BLQ A;  1SCM C;  1F4Q A;  2ZN8 A;  4YI9 A;  1NX1 A;  2HF5 A;  1TRF A;  1TCO B;  2HET A;  1Y0V H;  2KFF A;  2M0R A;  3D0Y B;  1IJ5 A;  1XVJ A;  1J7O A;  2M7N A;  2NLN A;  1OQP A;  4GGF A;  3ZWH A;  1QLS A;  1KWO C;  2KQ6 A;  5I2Q A;  1IH0 A;  2E30 A;  1EL4 A;  5I2O A;  2PSR A;  4YGE B;  1RTP 1;  1D1O A;  2I18 A;  1QAT A;  2LUX A;  2BKI B;  1YR5 A;  2H61 A;  1NX0 A;  2QAC A;  4N5X A;  4A4B A;  1SYM A;  2NCP A;  1YVH A;  3I5G B;  1M63 B;  4AQI A;  4UPG A;  1LA3 A;  2LVK A;  2KGR A;  2M1U A;  2LVJ A;  4A4C A;  1S3P A;  2M49 B;  1K9U A;  2LMT A;  2ZRS A;  3CR2 A;  1B47 A;  2BBN A;  1NCX A;  3CR5 X;  1YTZ C;  4CFQ A;  4I5J A;  2LHL A;  3I5I B;  3PAL A;  2LLU A;  4MZJ A;  2HQ8 A;  1DJG A;  1N65 A;  1ZMZ A;  4HRH A;  1K94 A;  2LE9 B;  1VRK A;  1U5I A;  1KQV A;  1PSB A;  1UHK A;  3OP0 A;  4GGF C;  3CGA A;  4ETO A;  2M7L A;  1AK8 A;  2LAP A;  1JBA A;  3KHE A;  1R6P A;  2Q91 A;  1MWN A;  1R2U A;  3NSI A;  4PHM A;  4YI8 A;  2H61 C;  1AUI B;  1NIW A;  1L7Z A;  3TDU A;  1G33 A;  1TTX A;  3JTD C;  1PAL A;  2Y1N A;  2MBX A;  1JFK A;  2KI6 D;  3MSE B;  4M2O A;  1K93 D;  1S6C A;  2JNF A;  2F3Z A;  2MHH A;  2WND A;  2ZFD A;  2ZND A;  3FS7 A;  4L9M A;  4ORB B;  1AVS A;  2JRF A;  1H4B A;  1OMR A;  1WDC C;  2AUC A;  1TCF A;  3FIA A;  5HKZ A;  1F55 A;  2O60 A;  5K89 A;  1LA0 A;  1OZS A;  1PK0 D;  1LIN A;  4OV2 A;  1UUS A;  3CWG A;  1KK7 Y;  3ZNI A;  1ZUZ A;  4QJ5 B;  1MR8 A;  3DVM A;  1DF0 A;  2KFH A;  1EG3 A;  2AMI A;  2F8P A;  3VRQ A;  2JZI A;  3BUM B;  1M45 A;  1AP4 A;  2OS8 C;  1FI6 A;  5HKW A;  2JWW A;  4U8D A;  3TUY C;  2OPO A;  1EH2 A;  1KSM A;  1TNX A;  2FCE A;  5D69 A;  2K7O A;  4XJK B;  2KI4 B;  1YUU A;  3CR4 X;  4FQO A;  2KAY A;  5AEQ A;  1B1G A;  1CFP A;  1M46 A;  2JXL A;  2VRG A;  1KK8 C;  2BEC A;  2LM5 A;  3EVU A;  1C07 A;  5FYX A;  1QXP A;  1BT6 A;  1S1E A;  2ZRT A;  2BCB A;  1IKU A;  3PSR A;  1W7I B;  1B9A A;  2LUC A;  5KSZ A;  4NDB A;  3IF7 A;  2SCP A;  2LMU A;  4OKH A;  2O5G A;  2PAS A;  2KBM A;  3I5F B;  1YRU B;  1JUO A;  1F4O A;  2B1U A;  1F70 A;  2LVV A;  2A4J A;  1A4P A;  1DGV A;  5AER A;  4JQ0 D;  4MLW A;  3AKA A;  1J1E A;  4MVF A;  5AXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...