3RM1A

1.24 angstrom x-ray structure of bovine trtk12-ca(2+)-s100b d63n
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
89
structure length
89
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSNGDGECDFQEFMAFVAMITTACHEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title The effects of CapZ peptide (TRTK12) on the protein dynamics of S100B and S100B D63N
rcsb
source organism Bos taurus
molecule tags Metal binding protein/protein binding
total genus 32
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3rm1A00
1KFXL 4TNCA 2M49B 4NDBA 1KWOC 4JWQA 5I2LA 2JXCA 1ZACA 3CLNA 5KSZA 4CPVA 1LINA 1IJ5A 5I2OA 1L2OB 4GUKA 1EG3A 1KFUS 2KI6D 1S26D 5PALA 3I5FB 4N5XA 4PHMA 2I18A 2F3YA 3WHUB 1XO5A 1SBJA 1WDCB 2L98A 1V1GA 2JC2A 3I5GB 3O6BA 1IG5A 1QATA 4FQOA 2EC6C 5CSJA 2BE6A 4MZKA 2M7NA 3QRXA 2JPTA 1XA5A 1XFVO 1K90D 4NDDA 4YGEB 2F2OA 3NXAA 5B8IB 1B1GA 1G4YR 3IQQA 4PALA 2WC8A 2ZN8A 1E8AA 3HCMA 3LK1A 1D1OA 2MLEC 1TCFA 1DJXA 1YVHA 3TDZA 1L7ZA 2BECA 1W7JB 1TOPA 2KSPA 1LA3A 3DF0A 4YI8A 1NSHA 2M29A 3SIBA 2L51A 2CTNA 2K7CA 1WRKA 1NX1A 1QV0A 1SPYA 1FPWA 4BY4A 2JQ6A 1A2XA 1YVLA 1KWOB 2K7DA 2SASA 1DJYA 1B7TZ 3TDIA 1IWQA 5AFPA 1CFDA 3PLFB 3NSKA 3DVEA 3EK7A 2M1UA 4WQ3A 1BR1B 1ZMZA 2KFGA 2ZNDA 2LVIA 3O78A 1CLLA 1SK6D 2KBIA 3CR2A 3CS1A 1IH0A 4USLA 2M8UA 4PE0A 2LANA 1V1FA 1H4BA 2TN4A 1JF2A 1RWYA 3CTNA 1SCVA 5CSFA 2BCBA 2LLTA 2EC6B 4IL1A 1F70A 3LK0A 4GGFC 1F54A 1M63B 2BBMA 2CT9A 4HRGA 1NP8A 2KAVA 2O60A 1JC2A 2LM5A 1KCYA 2K2AA 2ZKMX 1XK4C 2LE9B 2ZRTA 2LC5A 3CR4X 1SW8A 2F3ZA 4N1GA 1QX7A 2CBLA 1F55A 4MVFA 3KEVA 3LL8B 4YGCB 2FJUB 1BG1A 1JSAA 1DGVA 2JT8A 3GK2A 2QPTA 1Y0VH 1S6IA 1WY9A 1BF5A 3SG2A 3SG6A 1A75B 4FTGA 1M39A 1AK8A 1MUXA 3WXAA 1DMOA 1RROA 3GK1A 3SJSA 3RM1A 2KFFA 1IRJA 1S6CA 1SL9A 1U5IB 2D8NA 1XYDA 3D0YB 1TIZA 1EJ3A 2WCFA 1WLMA 1RK9A 2PSRA 1PVAA 1SL8A 3LLEA 4YBHB 4I5NB 4C0JA 2LMTA 2JULA 1RTP1 3I5IC 1K9PA 1S6JA 2HPSA 4GAOA 2COLB 5I8NA 1C7WA 1PK0D 1QIWA 2NLNA 1B9AA 4ORCB 2NXQA 2R2IA 4MLWA 1TNXA 1NCZA 1QVIY 1TNPA 2KYCA 2WCBA 1JFJA 4P2YB 1MHOA 4GPLB 2HQWA 4QJ4B 2KAXA 2HQ8A 2I94A 3A4UB 2PASA 2KI6C 4CFQA 3EKHA 2PRUA 1N0YA 3TS5C 1DGUA 1N2DA 1SYMA 1KK7Y 2Q91A 2WOSA 2OTGC 5HLOA 2LNKA 2QACA 1J7OA 1IQ3A 1DVIA 1CDNA 4PE4A 2MBXA 1QLKA 1BOCA 2FCEA 1GGWA 2JRFA 4L9MA 2KHNA 1F4QA 3EVRA 3BOWA 1A75A 2LHIA 4Q04A 3VRPA 1PULA 2JU0A 3OB2B 3OP0A 2KBMA 1U5IA 3M0WA 1A03A 4ORBB 1BLQA 2V53A 1K9UA 1S5GZ 2CCMA 2JOJA 1CDLA 2OS8C 1OMRA 3NSLA 5HKZA 1K2HA 1DF0B 1QTXA 3I5IB 3PN7C 3CGAA 2EGDA 3GOFA 2ISDA 2K0JA 1EH2A 2F2PA 1YX7A 1DJIA 1G8IA 1EG4A 4DIRA 2LVKA 3VROA 1JF0A 5K89A 1IGVA 1C07A 1YURA 4PE1A 3RLZA 2E30A 1C7VA 1BJFA 4MZJA 5JJGA 1Y1UA 2E6WA 2ZNEA 3TS5B 3SIAA 4OVNF 1WLZA 2K7BA 2OTGB 3ZNIA 2G2BA 1XK4A 1F8HA 4YGDB 4PDZA 1DJHA 2RGIA 1F4OA 3MSEB 1B4CA 5BPJA 4AQJA 2AUCA 3E3RA 3C1VA 1Q80A 1QLSA 1TCOB 1HT9A 1SRAA 1UHJA 3BQ3A 3WHTB 2AAOA 2LLUA 1UHIA 1B7TY 2JNXA 5JOLA 2MHHA 4GFTA 1XFUO 3PSRA 1PALA 2H61A 3PFVA 2GGMA 3DVJA 4ICBA 3WNXB 3I5HC 4D1EA 5ER5A 1KFXS 1NUBA 3DVKA 1SL7A 2OS8B 3IQOA 5D7FA 1AJ4A 3PN7B 1TN4A 1DJGA 3VGOA 3GK4X 1GJYA 1AHRA 4QJ3B 3SG5A 2BL0C 1A4PA 1GQMA 1WRLA 1YUUA 1OMVA 4YGAA 4OCIA 1QX5B 5ER4X 2P6BB 5GQQC 5FYXA 4YI9A 1PSRA 2A4JA 1FI6A 2JWWA 3FWBA 3LCPC 2Q4UA 3FIAA 1ZOTB 3BUOB 1JFKA 4OV2A 2M97A 2HF5A 2ZN9A 1WRZA 1AVSA 2KFHA 2LV7A 4BY5A 3SG7A 3TUYC 2LVVA 1RECA 2M1KB 1Y1XA 1JUOA 2OPOA 4MBEA 3F45A 4U8DA 1NPQA 1YUTA 2M0RA 1CM1A 1SKTA 2VRGA 1OZSA 5F6TA 1CB1A 4HREE 4UPGA 1J55A 1IQ5A 3I5HB 2ZRSA 2B1UA 4MRXA 5D69A 3JVTC 1ZUZA 1CDPA 1FW4A 1KFUL 4OR9B 4MN0A 4YGBB 2FCDA 1QS7A 2KOTA 1EL4A 2BL0B 2O5GA 3EVVA 2I2RE 3OB1B 3PALA 4ORAB 1JWDA 5AEQA 1BU3A 1PRWA 2K7OA 3OX6A 1X02A 3BUXB 2KQ6A 5HKWA 1OZOA 4DUQA 1NIWA 3AKBA 3CR5X 1TNWA 4CFRA 5KTYA 3HX4A 4DRWA 2JTZA 2NCOA 3FS7A 4NQGA 1NX0A 1YUSA 2GV5A 1QIVA 4M2OA 2LCPA 2LP2A 5AERA 2KGBC 2LUCA 1W7IB 2LP3A 3OX5A 2CNPA 1J1DA 1K9KA 3KHEA 5AXIA 1MR8A 3SG3A 1OMDA 3OHMB 1BR4B 1UURA 5AANA 5DKQA 4DS7A 1JBAA 1PVBA 3D0YA 1K95A 2KNEA 2KGRA 3A8RA 3IF7A 3KO0A 4GBAA 4P5OE 3FWCA 3JVTB 2IS9A 5DKNA 3KF9A 1BODA 1CFPA 4YRUA 1MWNA 2PALA 1K94A 1LVCD 3D10A 1CKKA 4GNKB 4ZCVA 3SG4A 4AQIA 4PHNA 2BE4A 2KYFA 1XFZO 1CFFA 1M31A 1M46A 4GGFA 1RJVA 4XJKB 4ETOA 5I2QA 1SCMC 2I7AA 1G33A 1KK8C 4GGNA 1SY9A 4PE7A 3NSIA 3ICBA 4ZCUA 4XYNA 1UHHA 2L4IA 2L50A 1SMGA 2WNDA 3AKAA 1B47A 4HRHA 4PHKA 4CLNA 2LMVA 3EK4A 1ALVA 2PVBA 1ODBA 2KI4C 1B8LA 3DVMA 2MA2A 2L2EA 1AJ5A 2K61A 2MRDA 2L4HA 1TTXA 1BT6A 1CTRA 4PHJA 1J1EA 1FI5A 1R6PA 2CXJA 1AUIB 2F8PA 3JTDC 4I5LB 3AAKA 1QXPA 2F33A 3EVUA 5HYDA 3PM8A 2LVJA 2AMIA 2M9GA 1RFJA 2LLSA 4WRIA 1Y1AA 1DF0A 1NWDA 3EKJA 1CLMA 1MXEA 1LKJA 1ZFSA 1DTLA 1R2UA 3VRQA 1CMFA 1M45A 4I5JA 5G08A 1MF8B 3BUMB 3ZWHA 4F0ZB 1S36A 1DJWA 2Y5IA 5DKRA 4A4BA 1GGZA 1B8RA 3CWGA 1K96A 1QX2A 1YR5A 4AOMA 1J7RA 1SCMB 1KK8B 2KQYA 4XJKA 3VRRA 1YTZC 1QJTA 3K21A 1SR6C 1LXFC 1UP5A 2WCEA 5TNCA 4MSPA 1Y6WA 2KAYA 4C0KA 2NZ0A 1EXRA 2LMUA 1QASA 2K8MB 1B8CA 1NCYA 1KSOA 3KPXA 1CFCA 1J7QA 2LHLA 1QV1A 2WORA 1KQMC 2MJWB 4NDCA 1MQ1A 2KI4B 2DOQA 2L5XB 2Y1MA 1IJ6A 2JZIA 1KQVA 2G9BA 4WQ2A 1XVJA 1XFYO 4JPZB 3VRNA 1IKUA 4M2QA 1K93D 3JTDB 2GGZA 1UUSA 2BBNA 1MXLC 2KDHA 1DJZA 2Y1NA 4MRYA 4DCKA 1UHKA 1UWOA 3BYAA 4MEWA 2HETA 2BCAA 2NCPA 1OOJA 4OKHA 1FF1A 4C0LA 1BMOA 1DT7B 1OQPA 2JT0A 1CMGA 4I5KA 3O4YA 1PSBA 1LA0A 3DD4A 4R1EA 1CM4A 1FBVA 3BOWB 1S3PA 2BKIB 1CLBA 4M2PA 5CSNA 2H2KA 2BKHB 2H61C 2ZFDA 3AAJA 3CZTX 4HSZA 5KU1A 1YRUB 1L2OC 1NX2A 4A4CA 4E68A 1N65A 1TNQA 1XFWO 3I5FC 3BUNB 2MAZA 1NX3A 3PATA 4N1FA 4JQ0D 2LAPA 1NCXA 1CNPA 4MZLA 1SR6B 1OSAA 1WDCC 5HLVA 2JNFA 5J3XA 1YRTB 3I5GC 4QJ5B 1NYAA 1A29A 1F71A 2M7LA 5IBWA 1SNLA 1OE9B 3TZ1A 4PCWA 1KQMB 3TUYB 1K8UA 1QVIZ 2JTTA 5CPVA 5HKYA 1ALWA 2SCPA 3NSOA 1J7PA 3TDUA 1H8BA 3O2PA 1S1EA 2M3WA 1VRKA 1HQVA 1YX8A 1XFXO 2Y4QA 3H4SE 2PMYA 2JT3A 2L0PA 3BXKA 5CSIA 2EHBA 2LUXA 1AP4A 1UHNA 1S5GY 3BUWB 2JXLA 1KSMA 3DF0B 2K2FA 1KK7Z 3EK8A 2BCXA 2FOTA 1CDMA 4CIDA 1TRFA 2MLFC
chains in the Genus database with same CATH superfamily
1KFXL 4TNCA 2M49B 4NDBA 1KWOC 4JWQA 5I2LA 2JXCA 1ZACA 3CLNA 5KSZA 4CPVA 1LINA 1IJ5A 4IJ7A 5I2OA 1L2OB 4GUKA 1EG3A 1KFUS 2KI6D 1S26D 4F7FA 5PALA 3I5FB 4N5XA 4PHMA 2I18A 2F3YA 3WHUB 1XO5A 1SBJA 1WDCB 2L98A 1V1GA 2JC2A 3I5GB 3O6BA 1IG5A 1QATA 3IVTA 2EC6C 4FQOA 5CSJA 2BE6A 4MZKA 2M7NA 3QRXA 2JPTA 1XA5A 1XFVO 1K90D 4NDDA 4YGEB 2F2OA 1LS8A 3NXAA 5B8IB 1B1GA 1G4YR 3IQQA 4PALA 2WC8A 2ZN8A 3S0AA 1E8AA 1XFRA 3HCMA 3LK1A 1D1OA 2MLEC 1TCFA 1DJXA 1YVHA 2H8VA 4INXA 3TDZA 1L7ZA 2BECA 1W7JB 2PQLA 1TOPA 2KSPA 1LA3A 3DF0A 1C3YA 1TWOA 2L5YA 4YI8A 1NSHA 2M29A 3CDNA 3SIBA 3NHTA 2L51A 2CTNA 2K7CA 1WRKA 1NX1A 2WCKA 1QV0A 1SPYA 1FPWA 4BY4A 2JQ6A 1A2XA 1YVLA 1KWOB 2K7DA 2SASA 2QEVA 1DJYA 1B7TZ 3TDIA 1IWQA 5AFPA 1CFDA 3PLFB 3NSKA 3DVEA 3EK7A 3FE6A 2M1UA 4WQ3A 1BR1B 1ZMZA 2KFGA 2ZNDA 2LVIA 3O78A 1CLLA 1SK6D 2KBIA 3CR2A 3CS1A 1IH0A 4USLA 2L2CA 2M8UA 4PE0A 2LANA 1V1FA 1H4BA 2TN4A 1JF2A 1RWYA 3CTNA 1SCVA 5CSFA 2BCBA 2LLTA 2EC6B 2KLDA 4IL1A 1F70A 3PM2A 3LK0A 4GGFC 1F54A 1M63B 2BBMA 2CT9A 4HRGA 1NP8A 2KAVA 2O60A 1JC2A 2LM5A 1KCYA 2K2AA 2ZKMX 3FE8A 1XK4C 2LE9B 2ZRTA 2LC5A 3CR4X 1SW8A 2F3ZA 4N1GA 1QX7A 2CBLA 1F55A 4MVFA 3KEVA 3LL8B 4YGCB 2FJUB 1BG1A 3B86A 1JSAA 1DGVA 2JT8A 3GK2A 3O4XA 2QPTA 1Y0VH 1S6IA 1WY9A 1BF5A 3SG2A 3SG6A 1A75B 4FTGA 1M39A 1AK8A 1MUXA 3WXAA 1DMOA 1RROA 3GK1A 3SJSA 3RM1A 2KFFA 1IRJA 1S6CA 1SL9A 1U5IB 2D8NA 1XYDA 3D0YB 1TIZA 1EJ3A 2WCFA 1WLMA 1RK9A 2PSRA 1PVAA 1SL8A 3LLEA 4YBHB 4I5NB 4C0JA 2LMTA 2JULA 1RTP1 1C3ZA 1K9PA 2P70A 1S6JA 2HPSA 3I5IC 2COLB 4GAOA 1C7WA 5I8NA 1PK0D 4FQTA 1QIWA 3N7HA 2NLNA 1B9AA 4ORCB 2NXQA 3S0BA 2R2IA 4MLWA 1TNXA 1NCZA 1QVIY 1TNPA 2KYCA 2WCBA 1JFJA 2P71A 4P2YB 1MHOA 3OBVA 4GPLB 2HQWA 4QJ4B 2KAXA 2HQ8A 3UNWA 2I94A 3A4UB 2PASA 2KI6C 4CFQA 3EKHA 2PRUA 4JKTA 1N0YA 3TS5C 1DGUA 1N2DA 1SYMA 1KK7Y 2Q91A 2WOSA 2OTGC 5HLOA 2LNKA 2QACA 3CZ2A 1J7OA 1IQ3A 1DVIA 1CDNA 4PE4A 2MBXA 1QLKA 1TUJA 1BOCA 2FCEA 1GGWA 2JRFA 4L9MA 2KHNA 1F4QA 3EVRA 3BOWA 1A75A 3L4AA 2LHIA 4Q04A 3VRPA 1PULA 2JU0A 3RZSA 3OB2B 3OP0A 2KBMA 2FJYA 1U5IA 3M0WA 1A03A 4ORBB 1BLQA 2V53A 1TUZA 1K9UA 1S5GZ 2CCMA 2JOJA 1CDLA 2OS8C 1OMRA 3CYZA 3NSLA 5HKZA 1DF0B 1QTXA 3I5IB 3PN7C 2GTEA 2EGDA 3CGAA 4JD9A 1Z2CB 3GOFA 2K0JA 2ISDA 3BFBA 1EH2A 3NGVA 2F2PA 1YX7A 1DJIA 1G8IA 5EL2A 3NHIA 1EG4A 4DIRA 2LVKA 3VROA 1JF0A 5K89A 1IGVA 3DXLA 1C07A 1YURA 4PE1A 3RLZA 2E30A 1C7VA 2YGUA 3Q8IA 4INWA 1BJFA 4MZJA 5JJGA 1Y1UA 2E6WA 2ZNEA 3TS5B 3SIAA 4OVNF 1ORGA 1WLZA 2K7BA 2OTGB 3ZNIA 2G2BA 1XK4A 1F8HA 4YGDB 4PDZA 1DJHA 2RGIA 1F4OA 1OOIX 3MSEB 1B4CA 5BPJA 3QMEA 4AQJA 2AUCA 3E3RA 3C1VA 2QDIA 1Q80A 1QLSA 1TCOB 1HT9A 1SRAA 1UHJA 3BQ3A 3PJIA 3WHTB 2AAOA 2LLUA 1UHIA 3DZTA 1B7TY 2JNXA 3UO9A 5JOLA 2MHHA 3K1EA 1XFUO 4GFTA 3PSRA 1PALA 2H61A 3PFVA 2GGMA 3DVJA 4ICBA 2WCLA 3I5HC 3WNXB 4D1EA 5ER5A 1KFXS 1NUBA 3DVKA 1SL7A 2OS8B 3IQOA 3CZ1A 5D7FA 5FI6A 1AJ4A 3PN7B 3R1PA 2WC6A 1TN4A 1DJGA 3VGOA 3GK4X 1GJYA 1AHRA 2WCHA 1DELA 4QJ3B 1K2HA 3SG5A 2BL0C 1A4PA 1GQMA 1WRLA 4PT1A 1YUUA 3BFHA 1OMVA 4YGAA 4OCIA 1QX5B 5ER4X 2P6BB 3R72A 5GQQC 5I94A 5FYXA 4YI9A 1PSRA 2A4JA 1FI6A 2JWWA 3FWBA 3LCPC 2Q4UA 3FIAA 1ZOTB 3BUOB 1JFKA 1DC1A 4OV2A 2M97A 2HF5A 2ZN9A 1WRZA 3B87A 3R1VA 1AVSA 2KFHA 5I2QA 2LV7A 4BY5A 3SG7A 3TUYC 2LVVA 1RECA 2M1KB 1Y1XA 1JUOA 2QEBA 2OPOA 4MBEA 3F45A 4U8DA 1NPQA 1YUTA 2M0RA 1CM1A 2BNXA 1SKTA 1OOHA 1OZSA 2VRGA 5F6TA 1CB1A 4HREE 4UPGA 1J55A 1IQ5A 3I5HB 2ZRSA 2B1UA 4MRXA 5D69A 3JVTC 1ZUZA 1CDPA 1FW4A 1KFUL 2WCMA 4OR9B 4MN0A 1QWVA 4YGBB 2FCDA 1QS7A 2KOTA 4KYNA 1EL4A 2BL0B 3OGNA 2O5GA 3EVVA 2I2RE 3OB1B 3PALA 4ORAB 1JWDA 5AEQA 3D78A 1BU3A 1PRWA 3SS4A 2K7OA 3OX6A 1X02A 3BUXB 2KQ6A 5HKWA 1OZOA 4DUQA 1NIWA 3AKBA 3CR5X 1TNWA 4CFRA 5KTYA 3HX4A 4DRWA 2JTZA 3L4LA 1SSEB 2NCOA 1Z4HA 3FS7A 4NQGA 1NX0A 1YUSA 2GV5A 1QIVA 4M2OA 2LCPA 3B6XA 2LP2A 5AERA 2KGBC 2LUCA 1W7IB 2LP3A 3OX5A 2CNPA 1J1DA 1K9KA 3KHEA 5AXIA 1MR8A 3B88A 3SG3A 1OMDA 3OHMB 1BR4B 1UURA 5AANA 5DKQA 4DS7A 1JBAA 1PVBA 3D0YA 1K95A 2KNEA 2KGRA 3A8RA 3IF7A 3KO0A 4GBAA 4P5OE 3FWCA 3JVTB 2IS9A 2KLEA 3KF9A 5DKNA 1BODA 2WCJA 1CFPA 3BJHA 3S0GA 4YRUA 1MWNA 2PALA 1K94A 1LVCD 3D10A 3D75A 1CKKA 4GNKB 4ZCVA 3SG4A 4AQIA 4PHNA 2BE4A 2KYFA 1XFZO 1CFFA 1M31A 1M46A 3DYEA 1RJVA 4GGFA 4XJKB 4ETOA 1SCMC 2I7AA 1G33A 1KK8C 4GGNA 1SY9A 4PE7A 3NSIA 3ICBA 4ZCUA 2WC5A 1UHHA 4XYNA 2L4IA 2L50A 1SMGA 2WNDA 3AKAA 1B47A 4HRHA 4PHKA 4CLNA 2LMVA 3EK4A 1ALVA 2PVBA 2K60A 1ODBA 2KI4C 1B8LA 3DVMA 2MA2A 2L2EA 1AJ5A 2K61A 2MRDA 2L4HA 2BAPA 3CZ0A 1TTXA 1BT6A 1CTRA 4PHJA 1J1EA 3D76A 1FI5A 1R6PA 2CXJA 1AUIB 2F8PA 3JTDC 4I5LB 1OOFA 3S0EA 3D77A 3AAKA 1IIOA 1DQEA 1QXPA 2F33A 3EVUA 5HYDA 3PM8A 2JPOA 2LVJA 2AMIA 2M9GA 1RFJA 2LLSA 4WRIA 1Y1AA 3L47A 1DF0A 1NWDA 3EKJA 1CLMA 1MXEA 1LKJA 1ZFSA 3SS5A 1DTLA 1R2UA 3VRQA 1CMFA 1M45A 4I5JA 5G08A 1MF8B 3BUMB 3ZWHA 4F0ZB 1S36A 1DJWA 2Y5IA 3BFAA 3DY9A 5DKRA 4A4BA 1GGZA 1B8RA 3CWGA 1K96A 1QX2A 1YR5A 4AOMA 1J7RA 1SCMB 1KK8B 2KQYA 4XJKA 3S0DA 1YTZC 1QJTA 3VB1A 3K21A 2QEHA 5DICA 3VRRA 3B7AA 1SR6C 1LXFC 1UP5A 2WCEA 5TNCA 4MSPA 1Y6WA 1W9ZA 2KAYA 2NZ0A 1EXRA 4C0KA 2LMUA 1QASA 1DEKA 1B8CA 1NCYA 1KSOA 2K8MB 3KPXA 1CFCA 1J7QA 2LHLA 1QV1A 2WORA 1KQMC 2MJWB 3D74A 1MQ1A 2KI4B 4NDCA 2DOQA 2L5XB 2Y1MA 1IJ6A 2JZIA 2QEOA 2G9BA 1KQVA 4WQ2A 1XVJA 1XFYO 4JPZB 3VRNA 1IKUA 4M2QA 1K93D 3JTDB 2GGZA 2KPHA 1UUSA 1OOGA 2BBNA 1MXLC 2KDHA 1DJZA 2Y1NA 4MRYA 4DCKA 1UHKA 1UWOA 3BYAA 4MEWA 2HETA 2BCAA 2NCPA 1OOJA 4OKHA 1FF1A 4C0LA 1BMOA 1DT7B 1OQPA 2JT0A 1CMGA 4I5KA 3O4YA 1PSBA 1LA0A 3DD4A 4R1EA 1CM4A 1FBVA 3BOWB 4OZDA 5FI2A 1S3PA 2BKIB 1CLBA 4M2PA 5CSNA 2H2KA 2BKHB 2H61C 2ZFDA 3AAJA 3CZTX 4HSZA 3S0FA 5KU1A 1YRUB 1L2OC 1NX2A 4A4CA 4E68A 5FI7A 1N65A 1TNQA 1XFWO 3I5FC 3BUNB 2MAZA 1NX3A 3PATA 4N1FA 4JQ0D 3SS3A 2LAPA 1GM0A 1NCXA 1CNPA 4MZLA 5HL1A 1SR6B 3R1OA 1OSAA 1WDCC 5HLVA 2JNFA 5J3XA 1YRTB 3EG5B 3I5GC 4QJ5B 1NYAA 1A29A 1F71A 2M7LA 1T14A 5IBWA 1SNLA 3D73A 1OE9B 3TZ1A 4PCWA 1KQMB 3TUYB 2PYQA 3V2LA 1K8UA 1QVIZ 2JTTA 5CPVA 5HKYA 1ALWA 2SCPA 3NSOA 1J7PA 3TDUA 1H8BA 3O2PA 1S1EA 2M3WA 1VRKA 1HQVA 1YX8A 2ERBA 1XFXO 1P28A 2Y4QA 3H4SE 2PMYA 2JT3A 2L0PA 3BXKA 5CSIA 2EHBA 2LUXA 1AP4A 1UHNA 1S5GY 3BUWB 2JXLA 1KSMA 3DF0B 2K2FA 1KK7Z 1OW4A 3EK8A 3CABA 5D3OA 2BCXA 2FOTA 1CDMA 4CIDA 1TRFA 3FE9A 2MLFC
chains in the Genus database with same CATH topology
1KFXL 4TNCA 2M49B 4NDBA 1KWOC 4JWQA 5I2LA 2JXCA 1ZACA 3CLNA 5KSZA 4CPVA 1LINA 1IJ5A 5I2OA 1L2OB 4GUKA 1EG3A 1KFUS 2KI6D 1S26D 5PALA 3I5FB 4N5XA 4PHMA 2I18A 2F3YA 3WHUB 1XO5A 1SBJA 1WDCB 2L98A 1V1GA 2JC2A 3I5GB 3O6BA 1IG5A 1QATA 4FQOA 2EC6C 5CSJA 2BE6A 4MZKA 2M7NA 3QRXA 2JPTA 1XA5A 1XFVO 1K90D 4NDDA 4YGEB 2F2OA 3NXAA 5B8IB 1B1GA 1G4YR 3IQQA 4PALA 2WC8A 2ZN8A 1E8AA 3HCMA 3LK1A 1D1OA 2MLEC 1TCFA 1DJXA 1YVHA 3TDZA 1L7ZA 2BECA 1W7JB 1TOPA 2KSPA 1LA3A 3DF0A 4YI8A 1NSHA 2M29A 3SIBA 2L51A 2CTNA 2K7CA 1WRKA 1NX1A 1QV0A 1SPYA 1FPWA 4BY4A 2JQ6A 1A2XA 1YVLA 1KWOB 2K7DA 2SASA 1DJYA 1B7TZ 3TDIA 1IWQA 5AFPA 1CFDA 3PLFB 3NSKA 3DVEA 3EK7A 2M1UA 4WQ3A 1BR1B 1ZMZA 2KFGA 2ZNDA 2LVIA 3O78A 1CLLA 1SK6D 2KBIA 3CR2A 3CS1A 1IH0A 4USLA 2M8UA 4PE0A 2LANA 1V1FA 1H4BA 2TN4A 1JF2A 1RWYA 3CTNA 1SCVA 5CSFA 2BCBA 2LLTA 2EC6B 4IL1A 1F70A 3LK0A 4GGFC 1F54A 1M63B 2BBMA 2CT9A 4HRGA 1NP8A 2KAVA 2O60A 1JC2A 2LM5A 1KCYA 2K2AA 2ZKMX 1XK4C 2LE9B 2ZRTA 2LC5A 3CR4X 1SW8A 2F3ZA 4N1GA 1QX7A 2CBLA 1F55A 4MVFA 3KEVA 3LL8B 4YGCB 2FJUB 1BG1A 1JSAA 1DGVA 2JT8A 3GK2A 2QPTA 1Y0VH 1S6IA 1WY9A 1BF5A 3SG2A 3SG6A 1A75B 4FTGA 1M39A 1AK8A 1MUXA 3WXAA 1DMOA 1RROA 3GK1A 3SJSA 3RM1A 2KFFA 1IRJA 1S6CA 1SL9A 1U5IB 2D8NA 1XYDA 3D0YB 1TIZA 1EJ3A 2WCFA 1WLMA 1RK9A 2PSRA 1PVAA 1SL8A 3LLEA 4YBHB 4I5NB 4C0JA 2LMTA 2JULA 1RTP1 3I5IC 1K9PA 1S6JA 2HPSA 4GAOA 2COLB 5I8NA 1C7WA 1PK0D 1QIWA 2NLNA 1B9AA 4ORCB 2NXQA 2R2IA 4MLWA 1TNXA 1NCZA 1QVIY 1TNPA 2KYCA 2WCBA 1JFJA 4P2YB 1MHOA 4GPLB 2HQWA 4QJ4B 2KAXA 2HQ8A 2I94A 3A4UB 2PASA 2KI6C 4CFQA 3EKHA 2PRUA 1N0YA 3TS5C 1DGUA 1N2DA 1SYMA 1KK7Y 2Q91A 2WOSA 2OTGC 5HLOA 2LNKA 2QACA 1J7OA 1IQ3A 1DVIA 1CDNA 4PE4A 2MBXA 1QLKA 1BOCA 2FCEA 1GGWA 2JRFA 4L9MA 2KHNA 1F4QA 3EVRA 3BOWA 1A75A 2LHIA 4Q04A 3VRPA 1PULA 2JU0A 3OB2B 3OP0A 2KBMA 1U5IA 3M0WA 1A03A 4ORBB 1BLQA 2V53A 1K9UA 1S5GZ 2CCMA 2JOJA 1CDLA 2OS8C 1OMRA 3NSLA 5HKZA 1K2HA 1DF0B 1QTXA 3I5IB 3PN7C 3CGAA 2EGDA 3GOFA 2ISDA 2K0JA 1EH2A 2F2PA 1YX7A 1DJIA 1G8IA 1EG4A 4DIRA 2LVKA 3VROA 1JF0A 5K89A 1IGVA 1C07A 1YURA 4PE1A 3RLZA 2E30A 1C7VA 1BJFA 4MZJA 5JJGA 1Y1UA 2E6WA 2ZNEA 3TS5B 3SIAA 4OVNF 1WLZA 2K7BA 2OTGB 3ZNIA 2G2BA 1XK4A 1F8HA 4YGDB 4PDZA 1DJHA 2RGIA 1F4OA 3MSEB 1B4CA 5BPJA 4AQJA 2AUCA 3E3RA 3C1VA 1Q80A 1QLSA 1TCOB 1HT9A 1SRAA 1UHJA 3BQ3A 3WHTB 2AAOA 2LLUA 1UHIA 1B7TY 2JNXA 5JOLA 2MHHA 4GFTA 1XFUO 3PSRA 1PALA 2H61A 3PFVA 2GGMA 3DVJA 4ICBA 3WNXB 3I5HC 4D1EA 5ER5A 1KFXS 1NUBA 3DVKA 1SL7A 2OS8B 3IQOA 5D7FA 1AJ4A 3PN7B 1TN4A 1DJGA 3VGOA 3GK4X 1GJYA 1AHRA 4QJ3B 3SG5A 2BL0C 1A4PA 1GQMA 1WRLA 1YUUA 1OMVA 4YGAA 4OCIA 1QX5B 5ER4X 2P6BB 5GQQC 5FYXA 4YI9A 1PSRA 2A4JA 1FI6A 2JWWA 3FWBA 3LCPC 2Q4UA 3FIAA 1ZOTB 3BUOB 1JFKA 4OV2A 2M97A 2HF5A 2ZN9A 1WRZA 1AVSA 2KFHA 2LV7A 4BY5A 3SG7A 3TUYC 2LVVA 1RECA 2M1KB 1Y1XA 1JUOA 2OPOA 4MBEA 3F45A 4U8DA 1NPQA 1YUTA 2M0RA 1CM1A 1SKTA 2VRGA 1OZSA 5F6TA 1CB1A 4HREE 4UPGA 1J55A 1IQ5A 3I5HB 2ZRSA 2B1UA 4MRXA 5D69A 3JVTC 1ZUZA 1CDPA 1FW4A 1KFUL 4OR9B 4MN0A 4YGBB 2FCDA 1QS7A 2KOTA 1EL4A 2BL0B 2O5GA 3EVVA 2I2RE 3OB1B 3PALA 4ORAB 1JWDA 5AEQA 1BU3A 1PRWA 2K7OA 3OX6A 1X02A 3BUXB 2KQ6A 5HKWA 1OZOA 4DUQA 1NIWA 3AKBA 3CR5X 1TNWA 4CFRA 5KTYA 3HX4A 4DRWA 2JTZA 2NCOA 3FS7A 4NQGA 1NX0A 1YUSA 2GV5A 1QIVA 4M2OA 2LCPA 2LP2A 5AERA 2KGBC 2LUCA 1W7IB 2LP3A 3OX5A 2CNPA 1J1DA 1K9KA 3KHEA 5AXIA 1MR8A 3SG3A 1OMDA 3OHMB 1BR4B 1UURA 5AANA 5DKQA 4DS7A 1JBAA 1PVBA 3D0YA 1K95A 2KNEA 2KGRA 3A8RA 3IF7A 3KO0A 4GBAA 4P5OE 3FWCA 3JVTB 2IS9A 5DKNA 3KF9A 1BODA 1CFPA 4YRUA 1MWNA 2PALA 1K94A 1LVCD 3D10A 1CKKA 4GNKB 4ZCVA 3SG4A 4AQIA 4PHNA 2BE4A 2KYFA 1XFZO 1CFFA 1M31A 1M46A 4GGFA 1RJVA 4XJKB 4ETOA 5I2QA 1SCMC 2I7AA 1G33A 1KK8C 4GGNA 1SY9A 4PE7A 3NSIA 3ICBA 4ZCUA 4XYNA 1UHHA 2L4IA 2L50A 1SMGA 2WNDA 3AKAA 1B47A 4HRHA 4PHKA 4CLNA 2LMVA 3EK4A 1ALVA 2PVBA 1ODBA 2KI4C 1B8LA 3DVMA 2MA2A 2L2EA 1AJ5A 2K61A 2MRDA 2L4HA 1TTXA 1BT6A 1CTRA 4PHJA 1J1EA 1FI5A 1R6PA 2CXJA 1AUIB 2F8PA 3JTDC 4I5LB 3AAKA 1QXPA 2F33A 3EVUA 5HYDA 3PM8A 2LVJA 2AMIA 2M9GA 1RFJA 2LLSA 4WRIA 1Y1AA 1DF0A 1NWDA 3EKJA 1CLMA 1MXEA 1LKJA 1ZFSA 1DTLA 1R2UA 3VRQA 1CMFA 1M45A 4I5JA 5G08A 1MF8B 3BUMB 3ZWHA 4F0ZB 1S36A 1DJWA 2Y5IA 5DKRA 4A4BA 1GGZA 1B8RA 3CWGA 1K96A 1QX2A 1YR5A 4AOMA 1J7RA 1SCMB 1KK8B 2KQYA 4XJKA 3VRRA 1YTZC 1QJTA 3K21A 1SR6C 1LXFC 1UP5A 2WCEA 5TNCA 4MSPA 1Y6WA 2KAYA 4C0KA 2NZ0A 1EXRA 2LMUA 1QASA 2K8MB 1B8CA 1NCYA 1KSOA 3KPXA 1CFCA 1J7QA 2LHLA 1QV1A 2WORA 1KQMC 2MJWB 4NDCA 1MQ1A 2KI4B 2DOQA 2L5XB 2Y1MA 1IJ6A 2JZIA 1KQVA 2G9BA 4WQ2A 1XVJA 1XFYO 4JPZB 3VRNA 1IKUA 4M2QA 1K93D 3JTDB 2GGZA 1UUSA 2BBNA 1MXLC 2KDHA 1DJZA 2Y1NA 4MRYA 4DCKA 1UHKA 1UWOA 3BYAA 4MEWA 2HETA 2BCAA 2NCPA 1OOJA 4OKHA 1FF1A 4C0LA 1BMOA 1DT7B 1OQPA 2JT0A 1CMGA 4I5KA 3O4YA 1PSBA 1LA0A 3DD4A 4R1EA 1CM4A 1FBVA 3BOWB 1S3PA 2BKIB 1CLBA 4M2PA 5CSNA 2H2KA 2BKHB 2H61C 2ZFDA 3AAJA 3CZTX 4HSZA 5KU1A 1YRUB 1L2OC 1NX2A 4A4CA 4E68A 1N65A 1TNQA 1XFWO 3I5FC 3BUNB 2MAZA 1NX3A 3PATA 4N1FA 4JQ0D 2LAPA 1NCXA 1CNPA 4MZLA 1SR6B 1OSAA 1WDCC 5HLVA 2JNFA 5J3XA 1YRTB 3I5GC 4QJ5B 1NYAA 1A29A 1F71A 2M7LA 5IBWA 1SNLA 1OE9B 3TZ1A 4PCWA 1KQMB 3TUYB 1K8UA 1QVIZ 2JTTA 5CPVA 5HKYA 1ALWA 2SCPA 3NSOA 1J7PA 3TDUA 1H8BA 3O2PA 1S1EA 2M3WA 1VRKA 1HQVA 1YX8A 1XFXO 2Y4QA 3H4SE 2PMYA 2JT3A 2L0PA 3BXKA 5CSIA 2EHBA 2LUXA 1AP4A 1UHNA 1S5GY 3BUWB 2JXLA 1KSMA 3DF0B 2K2FA 1KK7Z 3EK8A 2BCXA 2FOTA 1CDMA 4CIDA 1TRFA 2MLFC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KFX L;  4TNC A;  2M49 B;  4NDB A;  1KWO C;  4JWQ A;  5I2L A;  2JXC A;  1ZAC A;  3CLN A;  5KSZ A;  4CPV A;  1LIN A;  1IJ5 A;  5I2O A;  1L2O B;  4GUK A;  1EG3 A;  1KFU S;  2KI6 D;  1S26 D;  5PAL A;  3I5F B;  4N5X A;  4PHM A;  2I18 A;  2F3Y A;  3WHU B;  1XO5 A;  1SBJ A;  1WDC B;  2L98 A;  1V1G A;  2JC2 A;  3I5G B;  3O6B A;  1IG5 A;  1QAT A;  4FQO A;  2EC6 C;  5CSJ A;  2BE6 A;  4MZK A;  2M7N A;  3QRX A;  2JPT A;  1XA5 A;  1XFV O;  1K90 D;  4NDD A;  4YGE B;  2F2O A;  3NXA A;  5B8I B;  1B1G A;  1G4Y R;  3IQQ A;  4PAL A;  2WC8 A;  2ZN8 A;  1E8A A;  3HCM A;  3LK1 A;  1D1O A;  2MLE C;  1TCF A;  1DJX A;  1YVH A;  3TDZ A;  1L7Z A;  2BEC A;  1W7J B;  1TOP A;  2KSP A;  1LA3 A;  3DF0 A;  4YI8 A;  1NSH A;  2M29 A;  3SIB A;  2L51 A;  2CTN A;  2K7C A;  1WRK A;  1NX1 A;  1QV0 A;  1SPY A;  1FPW A;  4BY4 A;  2JQ6 A;  1A2X A;  1YVL A;  1KWO B;  2K7D A;  2SAS A;  1DJY A;  1B7T Z;  3TDI A;  1IWQ A;  5AFP A;  1CFD A;  3PLF B;  3NSK A;  3DVE A;  3EK7 A;  2M1U A;  4WQ3 A;  1BR1 B;  1ZMZ A;  2KFG A;  2ZND A;  2LVI A;  3O78 A;  1CLL A;  1SK6 D;  2KBI A;  3CR2 A;  3CS1 A;  1IH0 A;  4USL A;  2M8U A;  4PE0 A;  2LAN A;  1V1F A;  1H4B A;  2TN4 A;  1JF2 A;  1RWY A;  3CTN A;  1SCV A;  5CSF A;  2BCB A;  2LLT A;  2EC6 B;  4IL1 A;  1F70 A;  3LK0 A;  4GGF C;  1F54 A;  1M63 B;  2BBM A;  2CT9 A;  4HRG A;  1NP8 A;  2KAV A;  2O60 A;  1JC2 A;  2LM5 A;  1KCY A;  2K2A A;  2ZKM X;  1XK4 C;  2LE9 B;  2ZRT A;  2LC5 A;  3CR4 X;  1SW8 A;  2F3Z A;  4N1G A;  1QX7 A;  2CBL A;  1F55 A;  4MVF A;  3KEV A;  3LL8 B;  4YGC B;  2FJU B;  1BG1 A;  1JSA A;  1DGV A;  2JT8 A;  3GK2 A;  2QPT A;  1Y0V H;  1S6I A;  1WY9 A;  1BF5 A;  3SG2 A;  3SG6 A;  1A75 B;  4FTG A;  1M39 A;  1AK8 A;  1MUX A;  3WXA A;  1DMO A;  1RRO A;  3GK1 A;  3SJS A;  3RM1 A;  2KFF A;  1IRJ A;  1S6C A;  1SL9 A;  1U5I B;  2D8N A;  1XYD A;  3D0Y B;  1TIZ A;  1EJ3 A;  2WCF A;  1WLM A;  1RK9 A;  2PSR A;  1PVA A;  1SL8 A;  3LLE A;  4YBH B;  4I5N B;  4C0J A;  2LMT A;  2JUL A;  1RTP 1;  3I5I C;  1K9P A;  1S6J A;  2HPS A;  4GAO A;  2COL B;  5I8N A;  1C7W A;  1PK0 D;  1QIW A;  2NLN A;  1B9A A;  4ORC B;  2NXQ A;  2R2I A;  4MLW A;  1TNX A;  1NCZ A;  1QVI Y;  1TNP A;  2KYC A;  2WCB A;  1JFJ A;  4P2Y B;  1MHO A;  4GPL B;  2HQW A;  4QJ4 B;  2KAX A;  2HQ8 A;  2I94 A;  3A4U B;  2PAS A;  2KI6 C;  4CFQ A;  3EKH A;  2PRU A;  1N0Y A;  3TS5 C;  1DGU A;  1N2D A;  1SYM A;  1KK7 Y;  2Q91 A;  2WOS A;  2OTG C;  5HLO A;  2LNK A;  2QAC A;  1J7O A;  1IQ3 A;  1DVI A;  1CDN A;  4PE4 A;  2MBX A;  1QLK A;  1BOC A;  2FCE A;  1GGW A;  2JRF A;  4L9M A;  2KHN A;  1F4Q A;  3EVR A;  3BOW A;  1A75 A;  2LHI A;  4Q04 A;  3VRP A;  1PUL A;  2JU0 A;  3OB2 B;  3OP0 A;  2KBM A;  1U5I A;  3M0W A;  1A03 A;  4ORB B;  1BLQ A;  2V53 A;  1K9U A;  1S5G Z;  2CCM A;  2JOJ A;  1CDL A;  2OS8 C;  1OMR A;  3NSL A;  5HKZ A;  1K2H A;  1DF0 B;  1QTX A;  3I5I B;  3PN7 C;  3CGA A;  2EGD A;  3GOF A;  2ISD A;  2K0J A;  1EH2 A;  2F2P A;  1YX7 A;  1DJI A;  1G8I A;  1EG4 A;  4DIR A;  2LVK A;  3VRO A;  1JF0 A;  5K89 A;  1IGV A;  1C07 A;  1YUR A;  4PE1 A;  3RLZ A;  2E30 A;  1C7V A;  1BJF A;  4MZJ A;  5JJG A;  1Y1U A;  2E6W A;  2ZNE A;  3TS5 B;  3SIA A;  4OVN F;  1WLZ A;  2K7B A;  2OTG B;  3ZNI A;  2G2B A;  1XK4 A;  1F8H A;  4YGD B;  4PDZ A;  1DJH A;  2RGI A;  1F4O A;  3MSE B;  1B4C A;  5BPJ A;  4AQJ A;  2AUC A;  3E3R A;  3C1V A;  1Q80 A;  1QLS A;  1TCO B;  1HT9 A;  1SRA A;  1UHJ A;  3BQ3 A;  3WHT B;  2AAO A;  2LLU A;  1UHI A;  1B7T Y;  2JNX A;  5JOL A;  2MHH A;  4GFT A;  1XFU O;  3PSR A;  1PAL A;  2H61 A;  3PFV A;  2GGM A;  3DVJ A;  4ICB A;  3WNX B;  3I5H C;  4D1E A;  5ER5 A;  1KFX S;  1NUB A;  3DVK A;  1SL7 A;  2OS8 B;  3IQO A;  5D7F A;  1AJ4 A;  3PN7 B;  1TN4 A;  1DJG A;  3VGO A;  3GK4 X;  1GJY A;  1AHR A;  4QJ3 B;  3SG5 A;  2BL0 C;  1A4P A;  1GQM A;  1WRL A;  1YUU A;  1OMV A;  4YGA A;  4OCI A;  1QX5 B;  5ER4 X;  2P6B B;  5GQQ C;  5FYX A;  4YI9 A;  1PSR A;  2A4J A;  1FI6 A;  2JWW A;  3FWB A;  3LCP C;  2Q4U A;  3FIA A;  1ZOT B;  3BUO B;  1JFK A;  4OV2 A;  2M97 A;  2HF5 A;  2ZN9 A;  1WRZ A;  1AVS A;  2KFH A;  2LV7 A;  4BY5 A;  3SG7 A;  3TUY C;  2LVV A;  1REC A;  2M1K B;  1Y1X A;  1JUO A;  2OPO A;  4MBE A;  3F45 A;  4U8D A;  1NPQ A;  1YUT A;  2M0R A;  1CM1 A;  1SKT A;  2VRG A;  1OZS A;  5F6T A;  1CB1 A;  4HRE E;  4UPG A;  1J55 A;  1IQ5 A;  3I5H B;  2ZRS A;  2B1U A;  4MRX A;  5D69 A;  3JVT C;  1ZUZ A;  1CDP A;  1FW4 A;  1KFU L;  4OR9 B;  4MN0 A;  4YGB B;  2FCD A;  1QS7 A;  2KOT A;  1EL4 A;  2BL0 B;  2O5G A;  3EVV A;  2I2R E;  3OB1 B;  3PAL A;  4ORA B;  1JWD A;  5AEQ A;  1BU3 A;  1PRW A;  2K7O A;  3OX6 A;  1X02 A;  3BUX B;  2KQ6 A;  5HKW A;  1OZO A;  4DUQ A;  1NIW A;  3AKB A;  3CR5 X;  1TNW A;  4CFR A;  5KTY A;  3HX4 A;  4DRW A;  2JTZ A;  2NCO A;  3FS7 A;  4NQG A;  1NX0 A;  1YUS A;  2GV5 A;  1QIV A;  4M2O A;  2LCP A;  2LP2 A;  5AER A;  2KGB C;  2LUC A;  1W7I B;  2LP3 A;  3OX5 A;  2CNP A;  1J1D A;  1K9K A;  3KHE A;  5AXI A;  1MR8 A;  3SG3 A;  1OMD A;  3OHM B;  1BR4 B;  1UUR A;  5AAN A;  5DKQ A;  4DS7 A;  1JBA A;  1PVB A;  3D0Y A;  1K95 A;  2KNE A;  2KGR A;  3A8R A;  3IF7 A;  3KO0 A;  4GBA A;  4P5O E;  3FWC A;  3JVT B;  2IS9 A;  5DKN A;  3KF9 A;  1BOD A;  1CFP A;  4YRU A;  1MWN A;  2PAL A;  1K94 A;  1LVC D;  3D10 A;  1CKK A;  4GNK B;  4ZCV A;  3SG4 A;  4AQI A;  4PHN A;  2BE4 A;  2KYF A;  1XFZ O;  1CFF A;  1M31 A;  1M46 A;  4GGF A;  1RJV A;  4XJK B;  4ETO A;  5I2Q A;  1SCM C;  2I7A A;  1G33 A;  1KK8 C;  4GGN A;  1SY9 A;  4PE7 A;  3NSI A;  3ICB A;  4ZCU A;  4XYN A;  1UHH A;  2L4I A;  2L50 A;  1SMG A;  2WND A;  3AKA A;  1B47 A;  4HRH A;  4PHK A;  4CLN A;  2LMV A;  3EK4 A;  1ALV A;  2PVB A;  1ODB A;  2KI4 C;  1B8L A;  3DVM A;  2MA2 A;  2L2E A;  1AJ5 A;  2K61 A;  2MRD A;  2L4H A;  1TTX A;  1BT6 A;  1CTR A;  4PHJ A;  1J1E A;  1FI5 A;  1R6P A;  2CXJ A;  1AUI B;  2F8P A;  3JTD C;  4I5L B;  3AAK A;  1QXP A;  2F33 A;  3EVU A;  5HYD A;  3PM8 A;  2LVJ A;  2AMI A;  2M9G A;  1RFJ A;  2LLS A;  4WRI A;  1Y1A A;  1DF0 A;  1NWD A;  3EKJ A;  1CLM A;  1MXE A;  1LKJ A;  1ZFS A;  1DTL A;  1R2U A;  3VRQ A;  1CMF A;  1M45 A;  4I5J A;  5G08 A;  1MF8 B;  3BUM B;  3ZWH A;  4F0Z B;  1S36 A;  1DJW A;  2Y5I A;  5DKR A;  4A4B A;  1GGZ A;  1B8R A;  3CWG A;  1K96 A;  1QX2 A;  1YR5 A;  4AOM A;  1J7R A;  1SCM B;  1KK8 B;  2KQY A;  4XJK A;  3VRR A;  1YTZ C;  1QJT A;  3K21 A;  1SR6 C;  1LXF C;  1UP5 A;  2WCE A;  5TNC A;  4MSP A;  1Y6W A;  2KAY A;  4C0K A;  2NZ0 A;  1EXR A;  2LMU A;  1QAS A;  2K8M B;  1B8C A;  1NCY A;  1KSO A;  3KPX A;  1CFC A;  1J7Q A;  2LHL A;  1QV1 A;  2WOR A;  1KQM C;  2MJW B;  4NDC A;  1MQ1 A;  2KI4 B;  2DOQ A;  2L5X B;  2Y1M A;  1IJ6 A;  2JZI A;  1KQV A;  2G9B A;  4WQ2 A;  1XVJ A;  1XFY O;  4JPZ B;  3VRN A;  1IKU A;  4M2Q A;  1K93 D;  3JTD B;  2GGZ A;  1UUS A;  2BBN A;  1MXL C;  2KDH A;  1DJZ A;  2Y1N A;  4MRY A;  4DCK A;  1UHK A;  1UWO A;  3BYA A;  4MEW A;  2HET A;  2BCA A;  2NCP A;  1OOJ A;  4OKH A;  1FF1 A;  4C0L A;  1BMO A;  1DT7 B;  1OQP A;  2JT0 A;  1CMG A;  4I5K A;  3O4Y A;  1PSB A;  1LA0 A;  3DD4 A;  4R1E A;  1CM4 A;  1FBV A;  3BOW B;  1S3P A;  2BKI B;  1CLB A;  4M2P A;  5CSN A;  2H2K A;  2BKH B;  2H61 C;  2ZFD A;  3AAJ A;  3CZT X;  4HSZ A;  5KU1 A;  1YRU B;  1L2O C;  1NX2 A;  4A4C A;  4E68 A;  1N65 A;  1TNQ A;  1XFW O;  3I5F C;  3BUN B;  2MAZ A;  1NX3 A;  3PAT A;  4N1F A;  4JQ0 D;  2LAP A;  1NCX A;  1CNP A;  4MZL A;  1SR6 B;  1OSA A;  1WDC C;  5HLV A;  2JNF A;  5J3X A;  1YRT B;  3I5G C;  4QJ5 B;  1NYA A;  1A29 A;  1F71 A;  2M7L A;  5IBW A;  1SNL A;  1OE9 B;  3TZ1 A;  4PCW A;  1KQM B;  3TUY B;  1K8U A;  1QVI Z;  2JTT A;  5CPV A;  5HKY A;  1ALW A;  2SCP A;  3NSO A;  1J7P A;  3TDU A;  1H8B A;  3O2P A;  1S1E A;  2M3W A;  1VRK A;  1HQV A;  1YX8 A;  1XFX O;  2Y4Q A;  3H4S E;  2PMY A;  2JT3 A;  2L0P A;  3BXK A;  5CSI A;  2EHB A;  2LUX A;  1AP4 A;  1UHN A;  1S5G Y;  3BUW B;  2JXL A;  1KSM A;  3DF0 B;  2K2F A;  1KK7 Z;  3EK8 A;  2BCX A;  2FOT A;  1CDM A;  4CID A;  1TRF A;  2MLF C; 
#chains in the Genus database with same CATH topology
 1KFX L;  4TNC A;  2M49 B;  4NDB A;  1KWO C;  4JWQ A;  5I2L A;  2JXC A;  1ZAC A;  3CLN A;  5KSZ A;  4CPV A;  1LIN A;  1IJ5 A;  4IJ7 A;  5I2O A;  1L2O B;  4GUK A;  1EG3 A;  1KFU S;  2KI6 D;  1S26 D;  4F7F A;  5PAL A;  3I5F B;  4N5X A;  4PHM A;  2I18 A;  2F3Y A;  3WHU B;  1XO5 A;  1SBJ A;  1WDC B;  2L98 A;  1V1G A;  2JC2 A;  3I5G B;  3O6B A;  1IG5 A;  1QAT A;  3IVT A;  2EC6 C;  4FQO A;  5CSJ A;  2BE6 A;  4MZK A;  2M7N A;  3QRX A;  2JPT A;  1XA5 A;  1XFV O;  1K90 D;  4NDD A;  4YGE B;  2F2O A;  1LS8 A;  3NXA A;  5B8I B;  1B1G A;  1G4Y R;  3IQQ A;  4PAL A;  2WC8 A;  2ZN8 A;  3S0A A;  1E8A A;  1XFR A;  3HCM A;  3LK1 A;  1D1O A;  2MLE C;  1TCF A;  1DJX A;  1YVH A;  2H8V A;  4INX A;  3TDZ A;  1L7Z A;  2BEC A;  1W7J B;  2PQL A;  1TOP A;  2KSP A;  1LA3 A;  3DF0 A;  1C3Y A;  1TWO A;  2L5Y A;  4YI8 A;  1NSH A;  2M29 A;  3CDN A;  3SIB A;  3NHT A;  2L51 A;  2CTN A;  2K7C A;  1WRK A;  1NX1 A;  2WCK A;  1QV0 A;  1SPY A;  1FPW A;  4BY4 A;  2JQ6 A;  1A2X A;  1YVL A;  1KWO B;  2K7D A;  2SAS A;  2QEV A;  1DJY A;  1B7T Z;  3TDI A;  1IWQ A;  5AFP A;  1CFD A;  3PLF B;  3NSK A;  3DVE A;  3EK7 A;  3FE6 A;  2M1U A;  4WQ3 A;  1BR1 B;  1ZMZ A;  2KFG A;  2ZND A;  2LVI A;  3O78 A;  1CLL A;  1SK6 D;  2KBI A;  3CR2 A;  3CS1 A;  1IH0 A;  4USL A;  2L2C A;  2M8U A;  4PE0 A;  2LAN A;  1V1F A;  1H4B A;  2TN4 A;  1JF2 A;  1RWY A;  3CTN A;  1SCV A;  5CSF A;  2BCB A;  2LLT A;  2EC6 B;  2KLD A;  4IL1 A;  1F70 A;  3PM2 A;  3LK0 A;  4GGF C;  1F54 A;  1M63 B;  2BBM A;  2CT9 A;  4HRG A;  1NP8 A;  2KAV A;  2O60 A;  1JC2 A;  2LM5 A;  1KCY A;  2K2A A;  2ZKM X;  3FE8 A;  1XK4 C;  2LE9 B;  2ZRT A;  2LC5 A;  3CR4 X;  1SW8 A;  2F3Z A;  4N1G A;  1QX7 A;  2CBL A;  1F55 A;  4MVF A;  3KEV A;  3LL8 B;  4YGC B;  2FJU B;  1BG1 A;  3B86 A;  1JSA A;  1DGV A;  2JT8 A;  3GK2 A;  3O4X A;  2QPT A;  1Y0V H;  1S6I A;  1WY9 A;  1BF5 A;  3SG2 A;  3SG6 A;  1A75 B;  4FTG A;  1M39 A;  1AK8 A;  1MUX A;  3WXA A;  1DMO A;  1RRO A;  3GK1 A;  3SJS A;  3RM1 A;  2KFF A;  1IRJ A;  1S6C A;  1SL9 A;  1U5I B;  2D8N A;  1XYD A;  3D0Y B;  1TIZ A;  1EJ3 A;  2WCF A;  1WLM A;  1RK9 A;  2PSR A;  1PVA A;  1SL8 A;  3LLE A;  4YBH B;  4I5N B;  4C0J A;  2LMT A;  2JUL A;  1RTP 1;  1C3Z A;  1K9P A;  2P70 A;  1S6J A;  2HPS A;  3I5I C;  2COL B;  4GAO A;  1C7W A;  5I8N A;  1PK0 D;  4FQT A;  1QIW A;  3N7H A;  2NLN A;  1B9A A;  4ORC B;  2NXQ A;  3S0B A;  2R2I A;  4MLW A;  1TNX A;  1NCZ A;  1QVI Y;  1TNP A;  2KYC A;  2WCB A;  1JFJ A;  2P71 A;  4P2Y B;  1MHO A;  3OBV A;  4GPL B;  2HQW A;  4QJ4 B;  2KAX A;  2HQ8 A;  3UNW A;  2I94 A;  3A4U B;  2PAS A;  2KI6 C;  4CFQ A;  3EKH A;  2PRU A;  4JKT A;  1N0Y A;  3TS5 C;  1DGU A;  1N2D A;  1SYM A;  1KK7 Y;  2Q91 A;  2WOS A;  2OTG C;  5HLO A;  2LNK A;  2QAC A;  3CZ2 A;  1J7O A;  1IQ3 A;  1DVI A;  1CDN A;  4PE4 A;  2MBX A;  1QLK A;  1TUJ A;  1BOC A;  2FCE A;  1GGW A;  2JRF A;  4L9M A;  2KHN A;  1F4Q A;  3EVR A;  3BOW A;  1A75 A;  3L4A A;  2LHI A;  4Q04 A;  3VRP A;  1PUL A;  2JU0 A;  3RZS A;  3OB2 B;  3OP0 A;  2KBM A;  2FJY A;  1U5I A;  3M0W A;  1A03 A;  4ORB B;  1BLQ A;  2V53 A;  1TUZ A;  1K9U A;  1S5G Z;  2CCM A;  2JOJ A;  1CDL A;  2OS8 C;  1OMR A;  3CYZ A;  3NSL A;  5HKZ A;  1DF0 B;  1QTX A;  3I5I B;  3PN7 C;  2GTE A;  2EGD A;  3CGA A;  4JD9 A;  1Z2C B;  3GOF A;  2K0J A;  2ISD A;  3BFB A;  1EH2 A;  3NGV A;  2F2P A;  1YX7 A;  1DJI A;  1G8I A;  5EL2 A;  3NHI A;  1EG4 A;  4DIR A;  2LVK A;  3VRO A;  1JF0 A;  5K89 A;  1IGV A;  3DXL A;  1C07 A;  1YUR A;  4PE1 A;  3RLZ A;  2E30 A;  1C7V A;  2YGU A;  3Q8I A;  4INW A;  1BJF A;  4MZJ A;  5JJG A;  1Y1U A;  2E6W A;  2ZNE A;  3TS5 B;  3SIA A;  4OVN F;  1ORG A;  1WLZ A;  2K7B A;  2OTG B;  3ZNI A;  2G2B A;  1XK4 A;  1F8H A;  4YGD B;  4PDZ A;  1DJH A;  2RGI A;  1F4O A;  1OOI X;  3MSE B;  1B4C A;  5BPJ A;  3QME A;  4AQJ A;  2AUC A;  3E3R A;  3C1V A;  2QDI A;  1Q80 A;  1QLS A;  1TCO B;  1HT9 A;  1SRA A;  1UHJ A;  3BQ3 A;  3PJI A;  3WHT B;  2AAO A;  2LLU A;  1UHI A;  3DZT A;  1B7T Y;  2JNX A;  3UO9 A;  5JOL A;  2MHH A;  3K1E A;  1XFU O;  4GFT A;  3PSR A;  1PAL A;  2H61 A;  3PFV A;  2GGM A;  3DVJ A;  4ICB A;  2WCL A;  3I5H C;  3WNX B;  4D1E A;  5ER5 A;  1KFX S;  1NUB A;  3DVK A;  1SL7 A;  2OS8 B;  3IQO A;  3CZ1 A;  5D7F A;  5FI6 A;  1AJ4 A;  3PN7 B;  3R1P A;  2WC6 A;  1TN4 A;  1DJG A;  3VGO A;  3GK4 X;  1GJY A;  1AHR A;  2WCH A;  1DEL A;  4QJ3 B;  1K2H A;  3SG5 A;  2BL0 C;  1A4P A;  1GQM A;  1WRL A;  4PT1 A;  1YUU A;  3BFH A;  1OMV A;  4YGA A;  4OCI A;  1QX5 B;  5ER4 X;  2P6B B;  3R72 A;  5GQQ C;  5I94 A;  5FYX A;  4YI9 A;  1PSR A;  2A4J A;  1FI6 A;  2JWW A;  3FWB A;  3LCP C;  2Q4U A;  3FIA A;  1ZOT B;  3BUO B;  1JFK A;  1DC1 A;  4OV2 A;  2M97 A;  2HF5 A;  2ZN9 A;  1WRZ A;  3B87 A;  3R1V A;  1AVS A;  2KFH A;  5I2Q A;  2LV7 A;  4BY5 A;  3SG7 A;  3TUY C;  2LVV A;  1REC A;  2M1K B;  1Y1X A;  1JUO A;  2QEB A;  2OPO A;  4MBE A;  3F45 A;  4U8D A;  1NPQ A;  1YUT A;  2M0R A;  1CM1 A;  2BNX A;  1SKT A;  1OOH A;  1OZS A;  2VRG A;  5F6T A;  1CB1 A;  4HRE E;  4UPG A;  1J55 A;  1IQ5 A;  3I5H B;  2ZRS A;  2B1U A;  4MRX A;  5D69 A;  3JVT C;  1ZUZ A;  1CDP A;  1FW4 A;  1KFU L;  2WCM A;  4OR9 B;  4MN0 A;  1QWV A;  4YGB B;  2FCD A;  1QS7 A;  2KOT A;  4KYN A;  1EL4 A;  2BL0 B;  3OGN A;  2O5G A;  3EVV A;  2I2R E;  3OB1 B;  3PAL A;  4ORA B;  1JWD A;  5AEQ A;  3D78 A;  1BU3 A;  1PRW A;  3SS4 A;  2K7O A;  3OX6 A;  1X02 A;  3BUX B;  2KQ6 A;  5HKW A;  1OZO A;  4DUQ A;  1NIW A;  3AKB A;  3CR5 X;  1TNW A;  4CFR A;  5KTY A;  3HX4 A;  4DRW A;  2JTZ A;  3L4L A;  1SSE B;  2NCO A;  1Z4H A;  3FS7 A;  4NQG A;  1NX0 A;  1YUS A;  2GV5 A;  1QIV A;  4M2O A;  2LCP A;  3B6X A;  2LP2 A;  5AER A;  2KGB C;  2LUC A;  1W7I B;  2LP3 A;  3OX5 A;  2CNP A;  1J1D A;  1K9K A;  3KHE A;  5AXI A;  1MR8 A;  3B88 A;  3SG3 A;  1OMD A;  3OHM B;  1BR4 B;  1UUR A;  5AAN A;  5DKQ A;  4DS7 A;  1JBA A;  1PVB A;  3D0Y A;  1K95 A;  2KNE A;  2KGR A;  3A8R A;  3IF7 A;  3KO0 A;  4GBA A;  4P5O E;  3FWC A;  3JVT B;  2IS9 A;  2KLE A;  3KF9 A;  5DKN A;  1BOD A;  2WCJ A;  1CFP A;  3BJH A;  3S0G A;  4YRU A;  1MWN A;  2PAL A;  1K94 A;  1LVC D;  3D10 A;  3D75 A;  1CKK A;  4GNK B;  4ZCV A;  3SG4 A;  4AQI A;  4PHN A;  2BE4 A;  2KYF A;  1XFZ O;  1CFF A;  1M31 A;  1M46 A;  3DYE A;  1RJV A;  4GGF A;  4XJK B;  4ETO A;  1SCM C;  2I7A A;  1G33 A;  1KK8 C;  4GGN A;  1SY9 A;  4PE7 A;  3NSI A;  3ICB A;  4ZCU A;  2WC5 A;  1UHH A;  4XYN A;  2L4I A;  2L50 A;  1SMG A;  2WND A;  3AKA A;  1B47 A;  4HRH A;  4PHK A;  4CLN A;  2LMV A;  3EK4 A;  1ALV A;  2PVB A;  2K60 A;  1ODB A;  2KI4 C;  1B8L A;  3DVM A;  2MA2 A;  2L2E A;  1AJ5 A;  2K61 A;  2MRD A;  2L4H A;  2BAP A;  3CZ0 A;  1TTX A;  1BT6 A;  1CTR A;  4PHJ A;  1J1E A;  3D76 A;  1FI5 A;  1R6P A;  2CXJ A;  1AUI B;  2F8P A;  3JTD C;  4I5L B;  1OOF A;  3S0E A;  3D77 A;  3AAK A;  1IIO A;  1DQE A;  1QXP A;  2F33 A;  3EVU A;  5HYD A;  3PM8 A;  2JPO A;  2LVJ A;  2AMI A;  2M9G A;  1RFJ A;  2LLS A;  4WRI A;  1Y1A A;  3L47 A;  1DF0 A;  1NWD A;  3EKJ A;  1CLM A;  1MXE A;  1LKJ A;  1ZFS A;  3SS5 A;  1DTL A;  1R2U A;  3VRQ A;  1CMF A;  1M45 A;  4I5J A;  5G08 A;  1MF8 B;  3BUM B;  3ZWH A;  4F0Z B;  1S36 A;  1DJW A;  2Y5I A;  3BFA A;  3DY9 A;  5DKR A;  4A4B A;  1GGZ A;  1B8R A;  3CWG A;  1K96 A;  1QX2 A;  1YR5 A;  4AOM A;  1J7R A;  1SCM B;  1KK8 B;  2KQY A;  4XJK A;  3S0D A;  1YTZ C;  1QJT A;  3VB1 A;  3K21 A;  2QEH A;  5DIC A;  3VRR A;  3B7A A;  1SR6 C;  1LXF C;  1UP5 A;  2WCE A;  5TNC A;  4MSP A;  1Y6W A;  1W9Z A;  2KAY A;  2NZ0 A;  1EXR A;  4C0K A;  2LMU A;  1QAS A;  1DEK A;  1B8C A;  1NCY A;  1KSO A;  2K8M B;  3KPX A;  1CFC A;  1J7Q A;  2LHL A;  1QV1 A;  2WOR A;  1KQM C;  2MJW B;  3D74 A;  1MQ1 A;  2KI4 B;  4NDC A;  2DOQ A;  2L5X B;  2Y1M A;  1IJ6 A;  2JZI A;  2QEO A;  2G9B A;  1KQV A;  4WQ2 A;  1XVJ A;  1XFY O;  4JPZ B;  3VRN A;  1IKU A;  4M2Q A;  1K93 D;  3JTD B;  2GGZ A;  2KPH A;  1UUS A;  1OOG A;  2BBN A;  1MXL C;  2KDH A;  1DJZ A;  2Y1N A;  4MRY A;  4DCK A;  1UHK A;  1UWO A;  3BYA A;  4MEW A;  2HET A;  2BCA A;  2NCP A;  1OOJ A;  4OKH A;  1FF1 A;  4C0L A;  1BMO A;  1DT7 B;  1OQP A;  2JT0 A;  1CMG A;  4I5K A;  3O4Y A;  1PSB A;  1LA0 A;  3DD4 A;  4R1E A;  1CM4 A;  1FBV A;  3BOW B;  4OZD A;  5FI2 A;  1S3P A;  2BKI B;  1CLB A;  4M2P A;  5CSN A;  2H2K A;  2BKH B;  2H61 C;  2ZFD A;  3AAJ A;  3CZT X;  4HSZ A;  3S0F A;  5KU1 A;  1YRU B;  1L2O C;  1NX2 A;  4A4C A;  4E68 A;  5FI7 A;  1N65 A;  1TNQ A;  1XFW O;  3I5F C;  3BUN B;  2MAZ A;  1NX3 A;  3PAT A;  4N1F A;  4JQ0 D;  3SS3 A;  2LAP A;  1GM0 A;  1NCX A;  1CNP A;  4MZL A;  5HL1 A;  1SR6 B;  3R1O A;  1OSA A;  1WDC C;  5HLV A;  2JNF A;  5J3X A;  1YRT B;  3EG5 B;  3I5G C;  4QJ5 B;  1NYA A;  1A29 A;  1F71 A;  2M7L A;  1T14 A;  5IBW A;  1SNL A;  3D73 A;  1OE9 B;  3TZ1 A;  4PCW A;  1KQM B;  3TUY B;  2PYQ A;  3V2L A;  1K8U A;  1QVI Z;  2JTT A;  5CPV A;  5HKY A;  1ALW A;  2SCP A;  3NSO A;  1J7P A;  3TDU A;  1H8B A;  3O2P A;  1S1E A;  2M3W A;  1VRK A;  1HQV A;  1YX8 A;  2ERB A;  1XFX O;  1P28 A;  2Y4Q A;  3H4S E;  2PMY A;  2JT3 A;  2L0P A;  3BXK A;  5CSI A;  2EHB A;  2LUX A;  1AP4 A;  1UHN A;  1S5G Y;  3BUW B;  2JXL A;  1KSM A;  3DF0 B;  2K2F A;  1KK7 Z;  1OW4 A;  3EK8 A;  3CAB A;  5D3O A;  2BCX A;  2FOT A;  1CDM A;  4CID A;  1TRF A;  3FE9 A;  2MLF C; 
#chains in the Genus database with same CATH homology
 1KFX L;  4TNC A;  2M49 B;  4NDB A;  1KWO C;  4JWQ A;  5I2L A;  2JXC A;  1ZAC A;  3CLN A;  5KSZ A;  4CPV A;  1LIN A;  1IJ5 A;  5I2O A;  1L2O B;  4GUK A;  1EG3 A;  1KFU S;  2KI6 D;  1S26 D;  5PAL A;  3I5F B;  4N5X A;  4PHM A;  2I18 A;  2F3Y A;  3WHU B;  1XO5 A;  1SBJ A;  1WDC B;  2L98 A;  1V1G A;  2JC2 A;  3I5G B;  3O6B A;  1IG5 A;  1QAT A;  4FQO A;  2EC6 C;  5CSJ A;  2BE6 A;  4MZK A;  2M7N A;  3QRX A;  2JPT A;  1XA5 A;  1XFV O;  1K90 D;  4NDD A;  4YGE B;  2F2O A;  3NXA A;  5B8I B;  1B1G A;  1G4Y R;  3IQQ A;  4PAL A;  2WC8 A;  2ZN8 A;  1E8A A;  3HCM A;  3LK1 A;  1D1O A;  2MLE C;  1TCF A;  1DJX A;  1YVH A;  3TDZ A;  1L7Z A;  2BEC A;  1W7J B;  1TOP A;  2KSP A;  1LA3 A;  3DF0 A;  4YI8 A;  1NSH A;  2M29 A;  3SIB A;  2L51 A;  2CTN A;  2K7C A;  1WRK A;  1NX1 A;  1QV0 A;  1SPY A;  1FPW A;  4BY4 A;  2JQ6 A;  1A2X A;  1YVL A;  1KWO B;  2K7D A;  2SAS A;  1DJY A;  1B7T Z;  3TDI A;  1IWQ A;  5AFP A;  1CFD A;  3PLF B;  3NSK A;  3DVE A;  3EK7 A;  2M1U A;  4WQ3 A;  1BR1 B;  1ZMZ A;  2KFG A;  2ZND A;  2LVI A;  3O78 A;  1CLL A;  1SK6 D;  2KBI A;  3CR2 A;  3CS1 A;  1IH0 A;  4USL A;  2M8U A;  4PE0 A;  2LAN A;  1V1F A;  1H4B A;  2TN4 A;  1JF2 A;  1RWY A;  3CTN A;  1SCV A;  5CSF A;  2BCB A;  2LLT A;  2EC6 B;  4IL1 A;  1F70 A;  3LK0 A;  4GGF C;  1F54 A;  1M63 B;  2BBM A;  2CT9 A;  4HRG A;  1NP8 A;  2KAV A;  2O60 A;  1JC2 A;  2LM5 A;  1KCY A;  2K2A A;  2ZKM X;  1XK4 C;  2LE9 B;  2ZRT A;  2LC5 A;  3CR4 X;  1SW8 A;  2F3Z A;  4N1G A;  1QX7 A;  2CBL A;  1F55 A;  4MVF A;  3KEV A;  3LL8 B;  4YGC B;  2FJU B;  1BG1 A;  1JSA A;  1DGV A;  2JT8 A;  3GK2 A;  2QPT A;  1Y0V H;  1S6I A;  1WY9 A;  1BF5 A;  3SG2 A;  3SG6 A;  1A75 B;  4FTG A;  1M39 A;  1AK8 A;  1MUX A;  3WXA A;  1DMO A;  1RRO A;  3GK1 A;  3SJS A;  3RM1 A;  2KFF A;  1IRJ A;  1S6C A;  1SL9 A;  1U5I B;  2D8N A;  1XYD A;  3D0Y B;  1TIZ A;  1EJ3 A;  2WCF A;  1WLM A;  1RK9 A;  2PSR A;  1PVA A;  1SL8 A;  3LLE A;  4YBH B;  4I5N B;  4C0J A;  2LMT A;  2JUL A;  1RTP 1;  3I5I C;  1K9P A;  1S6J A;  2HPS A;  4GAO A;  2COL B;  5I8N A;  1C7W A;  1PK0 D;  1QIW A;  2NLN A;  1B9A A;  4ORC B;  2NXQ A;  2R2I A;  4MLW A;  1TNX A;  1NCZ A;  1QVI Y;  1TNP A;  2KYC A;  2WCB A;  1JFJ A;  4P2Y B;  1MHO A;  4GPL B;  2HQW A;  4QJ4 B;  2KAX A;  2HQ8 A;  2I94 A;  3A4U B;  2PAS A;  2KI6 C;  4CFQ A;  3EKH A;  2PRU A;  1N0Y A;  3TS5 C;  1DGU A;  1N2D A;  1SYM A;  1KK7 Y;  2Q91 A;  2WOS A;  2OTG C;  5HLO A;  2LNK A;  2QAC A;  1J7O A;  1IQ3 A;  1DVI A;  1CDN A;  4PE4 A;  2MBX A;  1QLK A;  1BOC A;  2FCE A;  1GGW A;  2JRF A;  4L9M A;  2KHN A;  1F4Q A;  3EVR A;  3BOW A;  1A75 A;  2LHI A;  4Q04 A;  3VRP A;  1PUL A;  2JU0 A;  3OB2 B;  3OP0 A;  2KBM A;  1U5I A;  3M0W A;  1A03 A;  4ORB B;  1BLQ A;  2V53 A;  1K9U A;  1S5G Z;  2CCM A;  2JOJ A;  1CDL A;  2OS8 C;  1OMR A;  3NSL A;  5HKZ A;  1K2H A;  1DF0 B;  1QTX A;  3I5I B;  3PN7 C;  3CGA A;  2EGD A;  3GOF A;  2ISD A;  2K0J A;  1EH2 A;  2F2P A;  1YX7 A;  1DJI A;  1G8I A;  1EG4 A;  4DIR A;  2LVK A;  3VRO A;  1JF0 A;  5K89 A;  1IGV A;  1C07 A;  1YUR A;  4PE1 A;  3RLZ A;  2E30 A;  1C7V A;  1BJF A;  4MZJ A;  5JJG A;  1Y1U A;  2E6W A;  2ZNE A;  3TS5 B;  3SIA A;  4OVN F;  1WLZ A;  2K7B A;  2OTG B;  3ZNI A;  2G2B A;  1XK4 A;  1F8H A;  4YGD B;  4PDZ A;  1DJH A;  2RGI A;  1F4O A;  3MSE B;  1B4C A;  5BPJ A;  4AQJ A;  2AUC A;  3E3R A;  3C1V A;  1Q80 A;  1QLS A;  1TCO B;  1HT9 A;  1SRA A;  1UHJ A;  3BQ3 A;  3WHT B;  2AAO A;  2LLU A;  1UHI A;  1B7T Y;  2JNX A;  5JOL A;  2MHH A;  4GFT A;  1XFU O;  3PSR A;  1PAL A;  2H61 A;  3PFV A;  2GGM A;  3DVJ A;  4ICB A;  3WNX B;  3I5H C;  4D1E A;  5ER5 A;  1KFX S;  1NUB A;  3DVK A;  1SL7 A;  2OS8 B;  3IQO A;  5D7F A;  1AJ4 A;  3PN7 B;  1TN4 A;  1DJG A;  3VGO A;  3GK4 X;  1GJY A;  1AHR A;  4QJ3 B;  3SG5 A;  2BL0 C;  1A4P A;  1GQM A;  1WRL A;  1YUU A;  1OMV A;  4YGA A;  4OCI A;  1QX5 B;  5ER4 X;  2P6B B;  5GQQ C;  5FYX A;  4YI9 A;  1PSR A;  2A4J A;  1FI6 A;  2JWW A;  3FWB A;  3LCP C;  2Q4U A;  3FIA A;  1ZOT B;  3BUO B;  1JFK A;  4OV2 A;  2M97 A;  2HF5 A;  2ZN9 A;  1WRZ A;  1AVS A;  2KFH A;  2LV7 A;  4BY5 A;  3SG7 A;  3TUY C;  2LVV A;  1REC A;  2M1K B;  1Y1X A;  1JUO A;  2OPO A;  4MBE A;  3F45 A;  4U8D A;  1NPQ A;  1YUT A;  2M0R A;  1CM1 A;  1SKT A;  2VRG A;  1OZS A;  5F6T A;  1CB1 A;  4HRE E;  4UPG A;  1J55 A;  1IQ5 A;  3I5H B;  2ZRS A;  2B1U A;  4MRX A;  5D69 A;  3JVT C;  1ZUZ A;  1CDP A;  1FW4 A;  1KFU L;  4OR9 B;  4MN0 A;  4YGB B;  2FCD A;  1QS7 A;  2KOT A;  1EL4 A;  2BL0 B;  2O5G A;  3EVV A;  2I2R E;  3OB1 B;  3PAL A;  4ORA B;  1JWD A;  5AEQ A;  1BU3 A;  1PRW A;  2K7O A;  3OX6 A;  1X02 A;  3BUX B;  2KQ6 A;  5HKW A;  1OZO A;  4DUQ A;  1NIW A;  3AKB A;  3CR5 X;  1TNW A;  4CFR A;  5KTY A;  3HX4 A;  4DRW A;  2JTZ A;  2NCO A;  3FS7 A;  4NQG A;  1NX0 A;  1YUS A;  2GV5 A;  1QIV A;  4M2O A;  2LCP A;  2LP2 A;  5AER A;  2KGB C;  2LUC A;  1W7I B;  2LP3 A;  3OX5 A;  2CNP A;  1J1D A;  1K9K A;  3KHE A;  5AXI A;  1MR8 A;  3SG3 A;  1OMD A;  3OHM B;  1BR4 B;  1UUR A;  5AAN A;  5DKQ A;  4DS7 A;  1JBA A;  1PVB A;  3D0Y A;  1K95 A;  2KNE A;  2KGR A;  3A8R A;  3IF7 A;  3KO0 A;  4GBA A;  4P5O E;  3FWC A;  3JVT B;  2IS9 A;  5DKN A;  3KF9 A;  1BOD A;  1CFP A;  4YRU A;  1MWN A;  2PAL A;  1K94 A;  1LVC D;  3D10 A;  1CKK A;  4GNK B;  4ZCV A;  3SG4 A;  4AQI A;  4PHN A;  2BE4 A;  2KYF A;  1XFZ O;  1CFF A;  1M31 A;  1M46 A;  4GGF A;  1RJV A;  4XJK B;  4ETO A;  5I2Q A;  1SCM C;  2I7A A;  1G33 A;  1KK8 C;  4GGN A;  1SY9 A;  4PE7 A;  3NSI A;  3ICB A;  4ZCU A;  4XYN A;  1UHH A;  2L4I A;  2L50 A;  1SMG A;  2WND A;  3AKA A;  1B47 A;  4HRH A;  4PHK A;  4CLN A;  2LMV A;  3EK4 A;  1ALV A;  2PVB A;  1ODB A;  2KI4 C;  1B8L A;  3DVM A;  2MA2 A;  2L2E A;  1AJ5 A;  2K61 A;  2MRD A;  2L4H A;  1TTX A;  1BT6 A;  1CTR A;  4PHJ A;  1J1E A;  1FI5 A;  1R6P A;  2CXJ A;  1AUI B;  2F8P A;  3JTD C;  4I5L B;  3AAK A;  1QXP A;  2F33 A;  3EVU A;  5HYD A;  3PM8 A;  2LVJ A;  2AMI A;  2M9G A;  1RFJ A;  2LLS A;  4WRI A;  1Y1A A;  1DF0 A;  1NWD A;  3EKJ A;  1CLM A;  1MXE A;  1LKJ A;  1ZFS A;  1DTL A;  1R2U A;  3VRQ A;  1CMF A;  1M45 A;  4I5J A;  5G08 A;  1MF8 B;  3BUM B;  3ZWH A;  4F0Z B;  1S36 A;  1DJW A;  2Y5I A;  5DKR A;  4A4B A;  1GGZ A;  1B8R A;  3CWG A;  1K96 A;  1QX2 A;  1YR5 A;  4AOM A;  1J7R A;  1SCM B;  1KK8 B;  2KQY A;  4XJK A;  3VRR A;  1YTZ C;  1QJT A;  3K21 A;  1SR6 C;  1LXF C;  1UP5 A;  2WCE A;  5TNC A;  4MSP A;  1Y6W A;  2KAY A;  4C0K A;  2NZ0 A;  1EXR A;  2LMU A;  1QAS A;  2K8M B;  1B8C A;  1NCY A;  1KSO A;  3KPX A;  1CFC A;  1J7Q A;  2LHL A;  1QV1 A;  2WOR A;  1KQM C;  2MJW B;  4NDC A;  1MQ1 A;  2KI4 B;  2DOQ A;  2L5X B;  2Y1M A;  1IJ6 A;  2JZI A;  1KQV A;  2G9B A;  4WQ2 A;  1XVJ A;  1XFY O;  4JPZ B;  3VRN A;  1IKU A;  4M2Q A;  1K93 D;  3JTD B;  2GGZ A;  1UUS A;  2BBN A;  1MXL C;  2KDH A;  1DJZ A;  2Y1N A;  4MRY A;  4DCK A;  1UHK A;  1UWO A;  3BYA A;  4MEW A;  2HET A;  2BCA A;  2NCP A;  1OOJ A;  4OKH A;  1FF1 A;  4C0L A;  1BMO A;  1DT7 B;  1OQP A;  2JT0 A;  1CMG A;  4I5K A;  3O4Y A;  1PSB A;  1LA0 A;  3DD4 A;  4R1E A;  1CM4 A;  1FBV A;  3BOW B;  1S3P A;  2BKI B;  1CLB A;  4M2P A;  5CSN A;  2H2K A;  2BKH B;  2H61 C;  2ZFD A;  3AAJ A;  3CZT X;  4HSZ A;  5KU1 A;  1YRU B;  1L2O C;  1NX2 A;  4A4C A;  4E68 A;  1N65 A;  1TNQ A;  1XFW O;  3I5F C;  3BUN B;  2MAZ A;  1NX3 A;  3PAT A;  4N1F A;  4JQ0 D;  2LAP A;  1NCX A;  1CNP A;  4MZL A;  1SR6 B;  1OSA A;  1WDC C;  5HLV A;  2JNF A;  5J3X A;  1YRT B;  3I5G C;  4QJ5 B;  1NYA A;  1A29 A;  1F71 A;  2M7L A;  5IBW A;  1SNL A;  1OE9 B;  3TZ1 A;  4PCW A;  1KQM B;  3TUY B;  1K8U A;  1QVI Z;  2JTT A;  5CPV A;  5HKY A;  1ALW A;  2SCP A;  3NSO A;  1J7P A;  3TDU A;  1H8B A;  3O2P A;  1S1E A;  2M3W A;  1VRK A;  1HQV A;  1YX8 A;  1XFX O;  2Y4Q A;  3H4S E;  2PMY A;  2JT3 A;  2L0P A;  3BXK A;  5CSI A;  2EHB A;  2LUX A;  1AP4 A;  1UHN A;  1S5G Y;  3BUW B;  2JXL A;  1KSM A;  3DF0 B;  2K2F A;  1KK7 Z;  3EK8 A;  2BCX A;  2FOT A;  1CDM A;  4CID A;  1TRF A;  2MLF C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...