3RM1A

1.24 angstrom x-ray structure of bovine trtk12-ca(2+)-s100b d63n
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
89
structure length
89
Chain Sequence
MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSNGDGECDFQEFMAFVAMITTACHEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title The effects of CapZ peptide (TRTK12) on the protein dynamics of S100B and S100B D63N
rcsb
source organism Bos taurus
molecule tags Metal binding protein/protein binding
total genus 32
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3rm1A00
4WRIA 1QV0A 3RLZA 2OPOA 1QS7A 2M1KB 5AERA 5HKWA 1L7ZA 4OKHA 5HKYA 3DVMA 2K2AA 2LVKA 2RGIA 4DUQA 4NQGA 2OTGB 1TOPA 1YR5A 1FI5A 2FJUB 1SK6D 4JWQA 4ICBA 3DVJA 2COLB 2PASA 4Q04A 1CFFA 3IQOA 1BG1A 1UHNA 1MF8B 4ZCUA 2LLSA 1J7RA 1SPYA 2BL0B 1JBAA 4HREE 1IKUA 2LHLA 3TS5B 3CGAA 4R1EA 1KFUS 4OR9B 1Y1XA 1SMGA 2Y4QA 2K7BA 1BODA 3A4UB 1JF2A 1JWDA 2KYCA 2LMUA 3CZTX 2JQ6A 2LANA 1S3PA 4I5JA 3WHUB 4MLWA 1DF0B 1D1OA 1S6IA 1A75A 1IH0A 4XYNA 1S6CA 2LUCA 1L2OB 4CIDA 1W7JB 2GGZA 2WNDA 3NSIA 2BBNA 3OHMB 4CFQA 3VROA 4FQOA 3RM1A 1NWDA 2FOTA 4ORBB 1TCFA 1EXRA 4PHNA 4GGFA 2K2FA 5ER4X 1MHOA 1JSAA 2LV7A 1ALVA 1XK4A 1PVAA 2KGRA 1Y1UA 4HSZA 4C0LA 1DVIA 2MJWB 1K95A 1LINA 1JFJA 5FYXA 1KFXS 1F4QA 3TUYC 3AKAA 4YGBB 1MXEA 2SASA 1KQVA 2ZNDA 2LC5A 3GK2A 3SG2A 3CLNA 4NDCA 5DKQA 5K89A 1QX7A 3DVKA 1TCOB 3ICBA 4M2QA 3SJSA 3IF7A 2LNKA 4AQJA 1X02A 3CTNA 1PALA 1DJXA 2HETA 2KGBC 1PK0D 3E3RA 1F54A 5DKNA 1F71A 1E8AA 1TRFA 1MWNA 2CBLA 3HCMA 1KSMA 1CKKA 3KHEA 1B8LA 2GV5A 3ZNIA 3O78A 1SCMB 2BKHB 2G2BA 2BCXA 1OZOA 3FWBA 2HF5A 2PALA 1SL8A 2O60A 2LP2A 3BXKA 1B7TZ 4PE1A 1CFDA 4GGNA 4MZJA 3DF0A 2NCPA 1ZUZA 2H61C 3I5IC 1CB1A 2O5GA 2LAPA 2LVIA 4WQ2A 3FS7A 1MUXA 4YGAA 1M45A 1B8RA 2JXLA 4PALA 2G9BA 1PRWA 2K7CA 1UP5A 4GGFC 2M49B 1J1EA 2NXQA 4PCWA 1SNLA 1J7OA 1XK4C 2BBMA 5CSFA 1V1GA 1NCXA 3FWCA 1RK9A 1XVJA 1XYDA 1GGZA 2F3ZA 4WQ3A 1U5IA 1DJZA 1TNXA 4MSPA 3CR2A 2BCBA 1SR6B 2JXCA 3AAJA 1WY9A 4CPVA 3WXAA 1YRTB 4D1EA 3BOWB 4BY4A 1QASA 1XFZO 1UHHA 3PLFB 1QIVA 1TN4A 2BL0C 1NCYA 1CFPA 1KCYA 4YRUA 3SG3A 1XA5A 2Q91A 2ZN9A 2P6BB 4M2OA 2Y5IA 1KK8B 2MHHA 3CS1A 2JWWA 4GUKA 2KFHA 3TDUA 5D69A 3LK1A 2ZRSA 4MBEA 1GQMA 1YUSA 3EVRA 3PN7C 2EGDA 1NX0A 1SL7A 2K7OA 1SY9A 1H4BA 2LP3A 1EL4A 4ZCVA 2KFGA 2PRUA 2KSPA 3TDIA 1BR1B 1G4YR 3VRQA 4XJKB 2Y1MA 3WNXB 2L98A 1XFUO 1FF1A 1UHJA 1K94A 3WHTB 1ZMZA 5AXIA 2FCEA 3I5FC 1BU3A 4P5OE 2ZN8A 4OCIA 1B47A 2F8PA 1S36A 2QPTA 4MRYA 5HLOA 1N2DA 2FCDA 1Y0VH 1VRKA 5CSNA 3CR4X 1PVBA 1YUTA 1NX1A 4JPZB 4TNCA 1QX5B 3BYAA 2QACA 2HQ8A 1NSHA 1QVIY 1KWOC 2JTZA 2M7LA 4YI9A 1EJ3A 2K8MB 3I5GC 3JTDC 3C1VA 2MA2A 1J7QA 3SIBA 2L2EA 1Y6WA 2H61A 2M8UA 3KEVA 1QIWA 3HX4A 1K96A 2JT3A 3K21A 3VGOA 1KK7Y 1DJYA 1IGVA 2KAXA 2I7AA 2KI4C 2OS8B 2JC2A 4C0JA 1V1FA 2TN4A 2F33A 1XFWO 4PE7A 4QJ4B 1IRJA 2LM5A 1S5GZ 1ALWA 1JUOA 3NXAA 1XO5A 4DCKA 3D0YB 2LMTA 1RROA 2KI6C 5J3XA 3SG6A 4F0ZB 1KQMB 1UWOA 2KOTA 1CLBA 1F4OA 1NP8A 3O2PA 1IWQA 2KQYA 3I5HB 5DKRA 3LK0A 1AUIB 1SL9A 2NLNA 5HYDA 1K9PA 2F2OA 2CTNA 1OOJA 2LE9B 5IBWA 2M7NA 3EKHA 4DS7A 1QLKA 4ETOA 1CFCA 1BOCA 3SG7A 1W7IB 5AFPA 1B9AA 3KF9A 3FIAA 1NX3A 1Y1AA 3BUMB 1S26D 1SR6C 2EHBA 4GNKB 1CLLA 2L4HA 2ZNEA 1YX8A 2L0PA 4YGCB 2LCPA 1CMGA 1YVHA 4YBHB 4ORCB 4N1FA 1AJ4A 2JOJA 4DIRA 2K7DA 2WOSA 4N1GA 1DF0A 2BE6A 2JULA 1DJGA 1YURA 1WDCC 3OB1B 4QJ3B 2K0JA 1S1EA 1J55A 1R6PA 2LLTA 5CPVA 1XFXO 4MEWA 1N0YA 4MZKA 3VRNA 1J7PA 1PSRA 3TZ1A 3JVTC 1EH2A 5JOLA 1SW8A 2EC6B 1J1DA 4N5XA 3SG4A 1NYAA 2KQ6A 1SKTA 2CNPA 1QXPA 1TIZA 3BUNB 3DD4A 3PFVA 1NCZA 1CM1A 2KAYA 2BCAA 2HPSA 2JT8A 2R2IA 4QJ5B 1BJFA 1SBJA 2BKIB 2NZ0A 1A2XA 1EG3A 2E6WA 2OTGC 2MLEC 1LKJA 2WORA 5KSZA 3F45A 3NSLA 1YUUA 1OZSA 4MN0A 4CLNA 1K9KA 2L50A 3GOFA 4U8DA 1PULA 2IS9A 2I18A 1KFUL 4AQIA 3GK1A 1RECA 1XFVO 1LXFC 3CWGA 4I5KA 3TS5C 1IJ5A 1GGWA 2M3WA 1ODBA 1M39A 2LVVA 2PMYA 3EK8A 4E68A 1BF5A 1DT7B 3EK7A 1OSAA 1SYMA 4C0KA 1B7TY 1JFKA 1IQ5A 2V53A 1L2OC 2ISDA 2Q4UA 2SCPA 2M1UA 1FBVA 5BPJA 2OS8C 1UUSA 1A75B 3BUXB 3EVUA 1CDLA 3QRXA 3LLEA 4GAOA 2VRGA 1H8BA 2D8NA 5KU1A 1F8HA 1DJWA 5PALA 2MBXA 3LCPC 1IQ3A 2KBMA 1KFXL 3M0WA 1KQMC 1YTZC 1YX7A 3PM8A 3SG5A 1NX2A 1OMRA 2DOQA 2I2RE 4PE0A 1WRKA 3I5HC 1B8CA 2PSRA 1XFYO 4YGDB 2ZRTA 2L4IA 2WCFA 4BY5A 1CMFA 2Y1NA 4JQ0D 4MZLA 3EVVA 3A8RA 3AAKA 2M97A 3NSOA 2JPTA 3BOWA 3NSKA 3OX6A 1CNPA 5F6TA 2CT9A 1CDNA 1K8UA 4GBAA 2L5XB 3IQQA 4ORAB 3CR5X 1Q80A 2H2KA 2LUXA 1ZFSA 3BUWB 2LVJA 1FW4A 1SCMC 1QJTA 5D7FA 3VRPA 1WRLA 1OMVA 3DVEA 1CDPA 1DMOA 1QATA 1JC2A 2BE4A 1FI6A 4DRWA 2KDHA 3DF0B 4HRHA 4OVNF 5JJGA 1A29A 2I94A 1F70A 3PN7B 1DGUA 4PHMA 2KI6D 3O6BA 4M2PA 1ZACA 1IJ6A 2AUCA 1DTLA 2B1UA 4XJKA 2A4JA 2KBIA 1CDMA 2CXJA 1TTXA 2WCEA 5KTYA 2JT0A 2ZKMX 2EC6C 4I5LB 1MQ1A 4OV2A 2MAZA 2KNEA 2LHIA 2KYFA 1HT9A 3I5FB 5GQQC 2JTTA 1KSOA 3AKBA 4FTGA 1B1GA 1U5IB 1LA0A 5HKZA 1UURA 1C7WA 2AMIA 5TNCA 1CTRA 1EG4A 2HQWA 2JZIA 1M46A 1N65A 1YVLA 1K9UA 1TNWA 2M29A 5I8NA 2BECA 1FPWA 3MSEB 4AOMA 5AEQA 1F55A 1KWOB 3O4YA 4HRGA 2AAOA 2F2PA 4PE4A 5I2LA 3JTDB 3I5GB 1WLZA 1NIWA 1OQPA 5ER5A 1WRZA 1NUBA 1AJ5A 1BR4B 2K61A 1KK8C 2LMVA 3PATA 5I2QA 1K90D 1UHIA 2KHNA 1AHRA 1LVCD 2LLUA 4A4CA 3PSRA 4I5NB 1AVSA 1RTP1 3D10A 1CLMA 1A03A 2KI4B 5HLVA 1BMOA 2GGMA 4CFRA 1SCVA 1TNPA 2E30A 2M9GA 1B4CA 5G08A 1QTXA 3D0YA 1S5GY 3OB2B 2WCBA 4USLA 4L9MA 4IL1A 4NDBA 2MLFC 2CCMA 2JNXA 4PHJA 1K93D 1SRAA 4GFTA 2JU0A 1PSBA 1OMDA 5AANA 1S6JA 2JNFA 1MR8A 3ZWHA 5B8IB 4NDDA 1QX2A 1C07A 3TUYB 3EKJA 1QV1A 2JRFA 3H4SE 1C7VA 1CM4A 1BT6A 1RWYA 4A4BA 1BLQA 1NPQA 3KPXA 1LA3A 5CSJA 3KO0A 1M63B 2PVBA 4MRXA 2F3YA 1AK8A 2WC8A 1DJHA 4MVFA 1DGVA 4P2YB 5I2OA 3EK4A 1G8IA 1QVIZ 1K2HA 2L51A 1RFJA 2ZFDA 3OX5A 1R2UA 1QLSA 3OP0A 1TNQA 1A4PA 2NCOA 1G33A 1DJIA 3I5IB 3VRRA 2KFFA 3BUOB 3SIAA 1KK7Z 2M0RA 4YGEB 1UHKA 1M31A 1MXLC 1RJVA 1WDCB 2KAVA 3GK4X 3TDZA 1WLMA 4YI8A 5CSIA 3BQ3A 1GJYA 1JF0A 1IG5A 2MRDA 1OE9B 1YRUB 3JVTB 4GPLB 4PDZA 3LL8B 1HQVA 4UPGA 1AP4A 4PHKA 1ZOTB 3PALA
chains in the Genus database with same CATH superfamily
4WRIA 1QV0A 3RLZA 2OPOA 1QS7A 2M1KB 2QDIA 5HKWA 1L7ZA 4OKHA 5AERA 5HKYA 3DVMA 2K2AA 2LVKA 2RGIA 3S0EA 4DUQA 4NQGA 2OTGB 3S0DA 1TOPA 1YR5A 1FI5A 2FJUB 1SK6D 4JWQA 4ICBA 3DVJA 2COLB 2PASA 4Q04A 3Q8IA 1CFFA 3IQOA 1BG1A 1UHNA 1MF8B 4ZCUA 2LLSA 1J7RA 1SPYA 2BL0B 1JBAA 4HREE 1IKUA 2LHLA 3TS5B 3CGAA 4R1EA 1P28A 2P70A 1KFUS 4OR9B 3UNWA 1Y1XA 1SMGA 2Y4QA 2K7BA 1BODA 3A4UB 1JF2A 4FQTA 1JWDA 2KYCA 2LMUA 3CZTX 2JQ6A 2LANA 1S3PA 4I5JA 3WHUB 4MLWA 3S0FA 1DF0B 1D1OA 1S6IA 1A75A 1IH0A 4XYNA 1S6CA 2LUCA 1L2OB 4CIDA 1W7JB 2GGZA 2WNDA 3NSIA 2BBNA 3OHMB 3R72A 3VROA 4CFQA 4FQOA 3RM1A 1NWDA 2FOTA 2L2CA 4ORBB 1TCFA 1EXRA 4PHNA 4GGFA 2K2FA 5ER4X 1MHOA 1JSAA 2LV7A 1ALVA 1XK4A 1PVAA 2KGRA 1Y1UA 4HSZA 4C0LA 1DVIA 2MJWB 1K95A 1LINA 1JFJA 5FYXA 1KFXS 5I94A 1F4QA 3CDNA 3CYZA 3AKAA 3DXLA 4JKTA 3TUYC 4YGBB 1MXEA 3BFBA 2SASA 1KQVA 2ZNDA 2LC5A 3GK2A 3SG2A 3CLNA 4NDCA 5DKQA 5K89A 1QX7A 3DVKA 1TCOB 3ICBA 4M2QA 3SJSA 3IF7A 2LNKA 4AQJA 1X02A 3CTNA 1PALA 1DJXA 2HETA 2KGBC 1PK0D 2WCLA 1QWVA 3E3RA 1F54A 5DKNA 1F71A 1E8AA 1TRFA 1MWNA 2CBLA 3HCMA 1KSMA 1CKKA 3KHEA 1B8LA 3EG5B 2GV5A 3ZNIA 3O78A 1SCMB 2BKHB 2G2BA 2BCXA 1OZOA 3FWBA 2HF5A 2PALA 1SL8A 2O60A 2LP2A 3BXKA 1B7TZ 4PE1A 1CFDA 1DQEA 4GGNA 4MZJA 3DF0A 2NCPA 1ZUZA 2H61C 3I5IC 1CB1A 2O5GA 2LAPA 2LVIA 4WQ2A 3FS7A 1MUXA 2K60A 4YGAA 1M45A 1B8RA 2JXLA 4PALA 2G9BA 4JD9A 1PRWA 3NHTA 2K7CA 1UP5A 4GGFC 1W9ZA 1J1EA 2M49B 2NXQA 4PCWA 1SNLA 2WC6A 1J7OA 1XK4C 2BBMA 5CSFA 5D3OA 1V1GA 1NCXA 3FWCA 3L4AA 1RK9A 1XVJA 1XYDA 1GGZA 3S0BA 2F3ZA 3R1PA 2FJYA 4WQ3A 1U5IA 1DJZA 1TNXA 4MSPA 3CR2A 2BCBA 3DY9A 1SR6B 2JXCA 3AAJA 1WY9A 4CPVA 3OBVA 3WXAA 3CZ1A 1SSEB 3DYEA 1YRTB 1OOHA 4D1EA 3BOWB 4BY4A 1QASA 1XFZO 1UHHA 3PLFB 1QIVA 1TN4A 3CZ0A 2BL0C 1NCYA 1CFPA 1KCYA 4YRUA 3SG3A 2QEHA 1XA5A 2Q91A 2ZN9A 2P6BB 4M2OA 2Y5IA 1KK8B 2MHHA 3CS1A 2JWWA 4GUKA 2KFHA 3TDUA 5D69A 3LK1A 2ZRSA 4MBEA 1GQMA 1YUSA 3EVRA 3PN7C 2EGDA 1NX0A 1SL7A 2K7OA 1SY9A 1H4BA 2LP3A 1EL4A 4ZCVA 2KFGA 2PRUA 2KSPA 3D75A 1BR1B 3TDIA 1G4YR 3VRQA 4XJKB 2Y1MA 3WNXB 2L98A 1XFUO 1FF1A 1UHJA 1K94A 3WHTB 1ZMZA 2BNXA 5AXIA 2FCEA 3OGNA 4PT1A 3I5FC 1BU3A 4P5OE 2ZN8A 4OCIA 1B47A 2F8PA 1S36A 2QPTA 4MRYA 5HLOA 1N2DA 2FCDA 1Y0VH 1VRKA 5CSNA 2YGUA 3CR4X 3NHIA 1PVBA 1YUTA 1NX1A 4JPZB 4TNCA 1QX5B 3L47A 3IVTA 3BYAA 2QACA 2HQ8A 1NSHA 1QVIY 1KWOC 2JTZA 2M7LA 3QMEA 2GTEA 4YI9A 1EJ3A 2K8MB 3I5GC 3JTDC 3C1VA 2MA2A 1J7QA 3SIBA 2L2EA 1Y6WA 2H61A 2M8UA 3PJIA 3KEVA 1QIWA 3HX4A 1K96A 2JT3A 3K21A 3VGOA 1KK7Y 1DJYA 1IGVA 2KAXA 2I7AA 2KI4C 2OS8B 2JC2A 4C0JA 1V1FA 2TN4A 2F33A 1XFWO 4PE7A 4QJ4B 1IRJA 1XFRA 2LM5A 1OOFA 1S5GZ 1ALWA 1JUOA 3NXAA 1XO5A 4DCKA 3D0YB 2LMTA 1RROA 2KI6C 5J3XA 3SG6A 4F0ZB 1KQMB 1UWOA 2KOTA 1CLBA 1F4OA 1NP8A 2ERBA 1DELA 3O2PA 1IWQA 1T14A 2KQYA 3I5HB 3V2LA 5DKRA 3LK0A 2KLEA 1AUIB 3B86A 1SL9A 2NLNA 5HYDA 1K9PA 2F2OA 2CTNA 1OOJA 2LE9B 2P71A 2M7NA 3EKHA 4DS7A 1QLKA 4ETOA 2L5YA 1CFCA 1BOCA 3SG7A 1W7IB 5AFPA 1B9AA 3KF9A 3FIAA 1NX3A 1Y1AA 3BUMB 1S26D 1SR6C 2EHBA 1Z2CB 4GNKB 1CLLA 2L4HA 2ZNEA 1YX8A 2L0PA 2KPHA 4YGCB 2LCPA 1LS8A 1CMGA 1GM0A 1YVHA 4YBHB 4ORCB 4N1FA 1AJ4A 2JOJA 4DIRA 2K7DA 2WOSA 4N1GA 1DF0A 2BE6A 2JULA 3N7HA 1DJGA 1YURA 1WDCC 3OB1B 4QJ3B 2K0JA 4F7FA 1S1EA 1J55A 1R6PA 2KLDA 2LLTA 5CPVA 1XFXO 4MEWA 1N0YA 4MZKA 3VRNA 1J7PA 1PSRA 3TZ1A 5IBWA 3FE6A 3JVTC 1EH2A 5JOLA 1SW8A 2EC6B 1J1DA 5DICA 4N5XA 3SG4A 1NYAA 2KQ6A 1SKTA 3B88A 2CNPA 1QXPA 1TIZA 3BUNB 1ORGA 3DD4A 3PFVA 2WCKA 1NCZA 1CM1A 2KAYA 2BCAA 2HPSA 2JT8A 2R2IA 4QJ5B 1BJFA 1SBJA 2BKIB 2NZ0A 1A2XA 1EG3A 2E6WA 2OTGC 2MLEC 1LKJA 2WORA 5KSZA 2BAPA 3FE9A 3F45A 3NSLA 1YUUA 1OZSA 4MN0A 4CLNA 1K9KA 2L50A 3GOFA 4U8DA 3NGVA 1DEKA 1PULA 2IS9A 2I18A 1KFUL 1OW4A 4AQIA 1C3ZA 3GK1A 1RECA 1XFVO 1LXFC 3CWGA 4I5KA 4KYNA 3TS5C 1IJ5A 1GGWA 2WC5A 2M3WA 1ODBA 1M39A 2LVVA 2PMYA 3EK8A 4E68A 1BF5A 1DT7B 3EK7A 1IIOA 1OSAA 1SYMA 4C0KA 1TWOA 1B7TY 1TUZA 1JFKA 1IQ5A 2V53A 1L2OC 2ISDA 2Q4UA 2SCPA 2M1UA 4OZDA 1FBVA 5BPJA 2OS8C 1UUSA 1A75B 3BFAA 3BUXB 3EVUA 1CDLA 3QRXA 3LLEA 1OOGA 2VRGA 4GAOA 1H8BA 2D8NA 5KU1A 3RZSA 1F8HA 1DJWA 5PALA 2QEBA 4INXA 2MBXA 3LCPC 1IQ3A 2KBMA 1KFXL 2PQLA 3M0WA 3DZTA 1KQMC 1YTZC 1YX7A 2QEOA 3PM8A 3SG5A 1NX2A 3FE8A 1OMRA 2DOQA 2I2RE 3K1EA 4PE0A 2WCHA 1WRKA 3I5HC 1B8CA 2PSRA 1XFYO 4YGDB 3SS5A 2ZRTA 2L4IA 2WCFA 4BY5A 1CMFA 2Y1NA 4JQ0D 1OOIX 3O4XA 4MZLA 3EVVA 3A8RA 3AAKA 2M97A 3NSOA 2JPTA 3BOWA 3NSKA 3OX6A 1CNPA 5F6TA 2CT9A 1CDNA 1K8UA 2QEVA 4GBAA 2L5XB 3IQQA 4ORAB 3CR5X 1Q80A 2H2KA 2LUXA 1ZFSA 3BUWB 5EL2A 2LVJA 1FW4A 1SCMC 1Z4HA 1QJTA 5D7FA 3VRPA 1WRLA 3S0AA 1OMVA 3DVEA 1CDPA 1DMOA 3R1VA 1QATA 1JC2A 2BE4A 3BJHA 1FI6A 4DRWA 2KDHA 3DF0B 4HRHA 4OVNF 5JJGA 1A29A 2I94A 1F70A 3PN7B 1DGUA 4PHMA 2KI6D 3O6BA 3D74A 1ZACA 4M2PA 1IJ6A 2AUCA 1DTLA 2B1UA 4XJKA 2A4JA 2KBIA 1CDMA 2CXJA 1TTXA 2WCEA 5KTYA 2JT0A 2ZKMX 2EC6C 4I5LB 1MQ1A 4OV2A 3CZ2A 2MAZA 3D77A 2KNEA 2LHIA 2KYFA 1HT9A 3I5FB 5GQQC 2JTTA 1KSOA 3AKBA 4FTGA 1B1GA 1U5IB 1LA0A 5HKZA 1UURA 1C7WA 2AMIA 5TNCA 1CTRA 1EG4A 2HQWA 2JZIA 1M46A 1N65A 1YVLA 1K9UA 1TNWA 3CABA 3PM2A 2M29A 3B87A 2BECA 5I8NA 1FPWA 3MSEB 4AOMA 5AEQA 1F55A 1KWOB 3O4YA 4HRGA 2AAOA 2F2PA 4PE4A 5I2LA 3JTDB 3I5GB 4IJ7A 1WLZA 1NIWA 1OQPA 5ER5A 1WRZA 1NUBA 1AJ5A 1BR4B 2K61A 1KK8C 2LMVA 3D78A 3PATA 5I2QA 1K90D 1UHIA 2KHNA 5FI6A 1AHRA 1LVCD 2LLUA 4A4CA 3PSRA 4I5NB 3UO9A 1AVSA 1RTP1 3D10A 5FI2A 1CLMA 1A03A 2KI4B 3D73A 5HLVA 1BMOA 2GGMA 4CFRA 1SCVA 1TNPA 2E30A 5FI7A 2WCJA 2M9GA 1B4CA 5G08A 1QTXA 3D0YA 1S5GY 3OB2B 2WCBA 4USLA 4L9MA 4IL1A 2PYQA 4NDBA 2MLFC 2CCMA 2JNXA 4PHJA 1K93D 1SRAA 4GFTA 2JPOA 2JU0A 1PSBA 1OMDA 5AANA 1S6JA 2JNFA 1MR8A 3ZWHA 3SS4A 4NDDA 1QX2A 5B8IB 3TUYB 1C07A 3EKJA 1QV1A 2JRFA 3H4SE 1C7VA 1CM4A 1BT6A 1RWYA 4A4BA 2WCMA 1NPQA 3L4LA 1BLQA 3KPXA 1LA3A 4INWA 5CSJA 3KO0A 1M63B 2PVBA 4MRXA 2F3YA 1AK8A 3B6XA 2WC8A 1DJHA 4MVFA 3D76A 1DGVA 4P2YB 2H8VA 5I2OA 3EK4A 1G8IA 3S0GA 1QVIZ 1K2HA 2L51A 1RFJA 1DC1A 2ZFDA 3OX5A 1R2UA 1QLSA 3OP0A 1TNQA 5HL1A 1A4PA 2NCOA 1G33A 1DJIA 3B7AA 3I5IB 2KFFA 1TUJA 3BUOB 3VRRA 3SIAA 1KK7Z 2M0RA 4YGEB 1UHKA 1M31A 1MXLC 1RJVA 1WDCB 2KAVA 3GK4X 3TDZA 1WLMA 4YI8A 5CSIA 3SS3A 3BQ3A 3R1OA 3BFHA 1GJYA 1JF0A 1IG5A 2MRDA 1OE9B 1YRUB 3JVTB 4GPLB 1C3YA 4PDZA 3LL8B 1HQVA 4UPGA 3VB1A 1AP4A 4PHKA 1ZOTB 3PALA
chains in the Genus database with same CATH topology
4WRIA 1QV0A 3RLZA 2OPOA 1QS7A 2M1KB 5AERA 5HKWA 1L7ZA 4OKHA 5HKYA 3DVMA 2K2AA 2LVKA 2RGIA 4DUQA 4NQGA 2OTGB 1TOPA 1YR5A 1FI5A 2FJUB 1SK6D 4JWQA 4ICBA 3DVJA 2COLB 2PASA 4Q04A 1CFFA 3IQOA 1BG1A 1UHNA 1MF8B 4ZCUA 2LLSA 1J7RA 1SPYA 2BL0B 1JBAA 4HREE 1IKUA 2LHLA 3TS5B 3CGAA 4R1EA 1KFUS 4OR9B 1Y1XA 1SMGA 2Y4QA 2K7BA 1BODA 3A4UB 1JF2A 1JWDA 2KYCA 2LMUA 3CZTX 2JQ6A 2LANA 1S3PA 4I5JA 3WHUB 4MLWA 1DF0B 1D1OA 1S6IA 1A75A 1IH0A 4XYNA 1S6CA 2LUCA 1L2OB 4CIDA 1W7JB 2GGZA 2WNDA 3NSIA 2BBNA 3OHMB 4CFQA 3VROA 4FQOA 3RM1A 1NWDA 2FOTA 4ORBB 1TCFA 1EXRA 4PHNA 4GGFA 2K2FA 5ER4X 1MHOA 1JSAA 2LV7A 1ALVA 1XK4A 1PVAA 2KGRA 1Y1UA 4HSZA 4C0LA 1DVIA 2MJWB 1K95A 1LINA 1JFJA 5FYXA 1KFXS 1F4QA 3TUYC 3AKAA 4YGBB 1MXEA 2SASA 1KQVA 2ZNDA 2LC5A 3GK2A 3SG2A 3CLNA 4NDCA 5DKQA 5K89A 1QX7A 3DVKA 1TCOB 3ICBA 4M2QA 3SJSA 3IF7A 2LNKA 4AQJA 1X02A 3CTNA 1PALA 1DJXA 2HETA 2KGBC 1PK0D 3E3RA 1F54A 5DKNA 1F71A 1E8AA 1TRFA 1MWNA 2CBLA 3HCMA 1KSMA 1CKKA 3KHEA 1B8LA 2GV5A 3ZNIA 3O78A 1SCMB 2BKHB 2G2BA 2BCXA 1OZOA 3FWBA 2HF5A 2PALA 1SL8A 2O60A 2LP2A 3BXKA 1B7TZ 4PE1A 1CFDA 4GGNA 4MZJA 3DF0A 2NCPA 1ZUZA 2H61C 3I5IC 1CB1A 2O5GA 2LAPA 2LVIA 4WQ2A 3FS7A 1MUXA 4YGAA 1M45A 1B8RA 2JXLA 4PALA 2G9BA 1PRWA 2K7CA 1UP5A 4GGFC 2M49B 1J1EA 2NXQA 4PCWA 1SNLA 1J7OA 1XK4C 2BBMA 5CSFA 1V1GA 1NCXA 3FWCA 1RK9A 1XVJA 1XYDA 1GGZA 2F3ZA 4WQ3A 1U5IA 1DJZA 1TNXA 4MSPA 3CR2A 2BCBA 1SR6B 2JXCA 3AAJA 1WY9A 4CPVA 3WXAA 1YRTB 4D1EA 3BOWB 4BY4A 1QASA 1XFZO 1UHHA 3PLFB 1QIVA 1TN4A 2BL0C 1NCYA 1CFPA 1KCYA 4YRUA 3SG3A 1XA5A 2Q91A 2ZN9A 2P6BB 4M2OA 2Y5IA 1KK8B 2MHHA 3CS1A 2JWWA 4GUKA 2KFHA 3TDUA 5D69A 3LK1A 2ZRSA 4MBEA 1GQMA 1YUSA 3EVRA 3PN7C 2EGDA 1NX0A 1SL7A 2K7OA 1SY9A 1H4BA 2LP3A 1EL4A 4ZCVA 2KFGA 2PRUA 2KSPA 3TDIA 1BR1B 1G4YR 3VRQA 4XJKB 2Y1MA 3WNXB 2L98A 1XFUO 1FF1A 1UHJA 1K94A 3WHTB 1ZMZA 5AXIA 2FCEA 3I5FC 1BU3A 4P5OE 2ZN8A 4OCIA 1B47A 2F8PA 1S36A 2QPTA 4MRYA 5HLOA 1N2DA 2FCDA 1Y0VH 1VRKA 5CSNA 3CR4X 1PVBA 1YUTA 1NX1A 4JPZB 4TNCA 1QX5B 3BYAA 2QACA 2HQ8A 1NSHA 1QVIY 1KWOC 2JTZA 2M7LA 4YI9A 1EJ3A 2K8MB 3I5GC 3JTDC 3C1VA 2MA2A 1J7QA 3SIBA 2L2EA 1Y6WA 2H61A 2M8UA 3KEVA 1QIWA 3HX4A 1K96A 2JT3A 3K21A 3VGOA 1KK7Y 1DJYA 1IGVA 2KAXA 2I7AA 2KI4C 2OS8B 2JC2A 4C0JA 1V1FA 2TN4A 2F33A 1XFWO 4PE7A 4QJ4B 1IRJA 2LM5A 1S5GZ 1ALWA 1JUOA 3NXAA 1XO5A 4DCKA 3D0YB 2LMTA 1RROA 2KI6C 5J3XA 3SG6A 4F0ZB 1KQMB 1UWOA 2KOTA 1CLBA 1F4OA 1NP8A 3O2PA 1IWQA 2KQYA 3I5HB 5DKRA 3LK0A 1AUIB 1SL9A 2NLNA 5HYDA 1K9PA 2F2OA 2CTNA 1OOJA 2LE9B 5IBWA 2M7NA 3EKHA 4DS7A 1QLKA 4ETOA 1CFCA 1BOCA 3SG7A 1W7IB 5AFPA 1B9AA 3KF9A 3FIAA 1NX3A 1Y1AA 3BUMB 1S26D 1SR6C 2EHBA 4GNKB 1CLLA 2L4HA 2ZNEA 1YX8A 2L0PA 4YGCB 2LCPA 1CMGA 1YVHA 4YBHB 4ORCB 4N1FA 1AJ4A 2JOJA 4DIRA 2K7DA 2WOSA 4N1GA 1DF0A 2BE6A 2JULA 1DJGA 1YURA 1WDCC 3OB1B 4QJ3B 2K0JA 1S1EA 1J55A 1R6PA 2LLTA 5CPVA 1XFXO 4MEWA 1N0YA 4MZKA 3VRNA 1J7PA 1PSRA 3TZ1A 3JVTC 1EH2A 5JOLA 1SW8A 2EC6B 1J1DA 4N5XA 3SG4A 1NYAA 2KQ6A 1SKTA 2CNPA 1QXPA 1TIZA 3BUNB 3DD4A 3PFVA 1NCZA 1CM1A 2KAYA 2BCAA 2HPSA 2JT8A 2R2IA 4QJ5B 1BJFA 1SBJA 2BKIB 2NZ0A 1A2XA 1EG3A 2E6WA 2OTGC 2MLEC 1LKJA 2WORA 5KSZA 3F45A 3NSLA 1YUUA 1OZSA 4MN0A 4CLNA 1K9KA 2L50A 3GOFA 4U8DA 1PULA 2IS9A 2I18A 1KFUL 4AQIA 3GK1A 1RECA 1XFVO 1LXFC 3CWGA 4I5KA 3TS5C 1IJ5A 1GGWA 2M3WA 1ODBA 1M39A 2LVVA 2PMYA 3EK8A 4E68A 1BF5A 1DT7B 3EK7A 1OSAA 1SYMA 4C0KA 1B7TY 1JFKA 1IQ5A 2V53A 1L2OC 2ISDA 2Q4UA 2SCPA 2M1UA 1FBVA 5BPJA 2OS8C 1UUSA 1A75B 3BUXB 3EVUA 1CDLA 3QRXA 3LLEA 4GAOA 2VRGA 1H8BA 2D8NA 5KU1A 1F8HA 1DJWA 5PALA 2MBXA 3LCPC 1IQ3A 2KBMA 1KFXL 3M0WA 1KQMC 1YTZC 1YX7A 3PM8A 3SG5A 1NX2A 1OMRA 2DOQA 2I2RE 4PE0A 1WRKA 3I5HC 1B8CA 2PSRA 1XFYO 4YGDB 2ZRTA 2L4IA 2WCFA 4BY5A 1CMFA 2Y1NA 4JQ0D 4MZLA 3EVVA 3A8RA 3AAKA 2M97A 3NSOA 2JPTA 3BOWA 3NSKA 3OX6A 1CNPA 5F6TA 2CT9A 1CDNA 1K8UA 4GBAA 2L5XB 3IQQA 4ORAB 3CR5X 1Q80A 2H2KA 2LUXA 1ZFSA 3BUWB 2LVJA 1FW4A 1SCMC 1QJTA 5D7FA 3VRPA 1WRLA 1OMVA 3DVEA 1CDPA 1DMOA 1QATA 1JC2A 2BE4A 1FI6A 4DRWA 2KDHA 3DF0B 4HRHA 4OVNF 5JJGA 1A29A 2I94A 1F70A 3PN7B 1DGUA 4PHMA 2KI6D 3O6BA 4M2PA 1ZACA 1IJ6A 2AUCA 1DTLA 2B1UA 4XJKA 2A4JA 2KBIA 1CDMA 2CXJA 1TTXA 2WCEA 5KTYA 2JT0A 2ZKMX 2EC6C 4I5LB 1MQ1A 4OV2A 2MAZA 2KNEA 2LHIA 2KYFA 1HT9A 3I5FB 5GQQC 2JTTA 1KSOA 3AKBA 4FTGA 1B1GA 1U5IB 1LA0A 5HKZA 1UURA 1C7WA 2AMIA 5TNCA 1CTRA 1EG4A 2HQWA 2JZIA 1M46A 1N65A 1YVLA 1K9UA 1TNWA 2M29A 5I8NA 2BECA 1FPWA 3MSEB 4AOMA 5AEQA 1F55A 1KWOB 3O4YA 4HRGA 2AAOA 2F2PA 4PE4A 5I2LA 3JTDB 3I5GB 1WLZA 1NIWA 1OQPA 5ER5A 1WRZA 1NUBA 1AJ5A 1BR4B 2K61A 1KK8C 2LMVA 3PATA 5I2QA 1K90D 1UHIA 2KHNA 1AHRA 1LVCD 2LLUA 4A4CA 3PSRA 4I5NB 1AVSA 1RTP1 3D10A 1CLMA 1A03A 2KI4B 5HLVA 1BMOA 2GGMA 4CFRA 1SCVA 1TNPA 2E30A 2M9GA 1B4CA 5G08A 1QTXA 3D0YA 1S5GY 3OB2B 2WCBA 4USLA 4L9MA 4IL1A 4NDBA 2MLFC 2CCMA 2JNXA 4PHJA 1K93D 1SRAA 4GFTA 2JU0A 1PSBA 1OMDA 5AANA 1S6JA 2JNFA 1MR8A 3ZWHA 5B8IB 4NDDA 1QX2A 1C07A 3TUYB 3EKJA 1QV1A 2JRFA 3H4SE 1C7VA 1CM4A 1BT6A 1RWYA 4A4BA 1BLQA 1NPQA 3KPXA 1LA3A 5CSJA 3KO0A 1M63B 2PVBA 4MRXA 2F3YA 1AK8A 2WC8A 1DJHA 4MVFA 1DGVA 4P2YB 5I2OA 3EK4A 1G8IA 1QVIZ 1K2HA 2L51A 1RFJA 2ZFDA 3OX5A 1R2UA 1QLSA 3OP0A 1TNQA 1A4PA 2NCOA 1G33A 1DJIA 3I5IB 3VRRA 2KFFA 3BUOB 3SIAA 1KK7Z 2M0RA 4YGEB 1UHKA 1M31A 1MXLC 1RJVA 1WDCB 2KAVA 3GK4X 3TDZA 1WLMA 4YI8A 5CSIA 3BQ3A 1GJYA 1JF0A 1IG5A 2MRDA 1OE9B 1YRUB 3JVTB 4GPLB 4PDZA 3LL8B 1HQVA 4UPGA 1AP4A 4PHKA 1ZOTB 3PALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WRI A;  1QV0 A;  3RLZ A;  2OPO A;  1QS7 A;  2M1K B;  5AER A;  5HKW A;  1L7Z A;  4OKH A;  5HKY A;  3DVM A;  2K2A A;  2LVK A;  2RGI A;  4DUQ A;  4NQG A;  2OTG B;  1TOP A;  1YR5 A;  1FI5 A;  2FJU B;  1SK6 D;  4JWQ A;  4ICB A;  3DVJ A;  2COL B;  2PAS A;  4Q04 A;  1CFF A;  3IQO A;  1BG1 A;  1UHN A;  1MF8 B;  4ZCU A;  2LLS A;  1J7R A;  1SPY A;  2BL0 B;  1JBA A;  4HRE E;  1IKU A;  2LHL A;  3TS5 B;  3CGA A;  4R1E A;  1KFU S;  4OR9 B;  1Y1X A;  1SMG A;  2Y4Q A;  2K7B A;  1BOD A;  3A4U B;  1JF2 A;  1JWD A;  2KYC A;  2LMU A;  3CZT X;  2JQ6 A;  2LAN A;  1S3P A;  4I5J A;  3WHU B;  4MLW A;  1DF0 B;  1D1O A;  1S6I A;  1A75 A;  1IH0 A;  4XYN A;  1S6C A;  2LUC A;  1L2O B;  4CID A;  1W7J B;  2GGZ A;  2WND A;  3NSI A;  2BBN A;  3OHM B;  4CFQ A;  3VRO A;  4FQO A;  3RM1 A;  1NWD A;  2FOT A;  4ORB B;  1TCF A;  1EXR A;  4PHN A;  4GGF A;  2K2F A;  5ER4 X;  1MHO A;  1JSA A;  2LV7 A;  1ALV A;  1XK4 A;  1PVA A;  2KGR A;  1Y1U A;  4HSZ A;  4C0L A;  1DVI A;  2MJW B;  1K95 A;  1LIN A;  1JFJ A;  5FYX A;  1KFX S;  1F4Q A;  3TUY C;  3AKA A;  4YGB B;  1MXE A;  2SAS A;  1KQV A;  2ZND A;  2LC5 A;  3GK2 A;  3SG2 A;  3CLN A;  4NDC A;  5DKQ A;  5K89 A;  1QX7 A;  3DVK A;  1TCO B;  3ICB A;  4M2Q A;  3SJS A;  3IF7 A;  2LNK A;  4AQJ A;  1X02 A;  3CTN A;  1PAL A;  1DJX A;  2HET A;  2KGB C;  1PK0 D;  3E3R A;  1F54 A;  5DKN A;  1F71 A;  1E8A A;  1TRF A;  1MWN A;  2CBL A;  3HCM A;  1KSM A;  1CKK A;  3KHE A;  1B8L A;  2GV5 A;  3ZNI A;  3O78 A;  1SCM B;  2BKH B;  2G2B A;  2BCX A;  1OZO A;  3FWB A;  2HF5 A;  2PAL A;  1SL8 A;  2O60 A;  2LP2 A;  3BXK A;  1B7T Z;  4PE1 A;  1CFD A;  4GGN A;  4MZJ A;  3DF0 A;  2NCP A;  1ZUZ A;  2H61 C;  3I5I C;  1CB1 A;  2O5G A;  2LAP A;  2LVI A;  4WQ2 A;  3FS7 A;  1MUX A;  4YGA A;  1M45 A;  1B8R A;  2JXL A;  4PAL A;  2G9B A;  1PRW A;  2K7C A;  1UP5 A;  4GGF C;  2M49 B;  1J1E A;  2NXQ A;  4PCW A;  1SNL A;  1J7O A;  1XK4 C;  2BBM A;  5CSF A;  1V1G A;  1NCX A;  3FWC A;  1RK9 A;  1XVJ A;  1XYD A;  1GGZ A;  2F3Z A;  4WQ3 A;  1U5I A;  1DJZ A;  1TNX A;  4MSP A;  3CR2 A;  2BCB A;  1SR6 B;  2JXC A;  3AAJ A;  1WY9 A;  4CPV A;  3WXA A;  1YRT B;  4D1E A;  3BOW B;  4BY4 A;  1QAS A;  1XFZ O;  1UHH A;  3PLF B;  1QIV A;  1TN4 A;  2BL0 C;  1NCY A;  1CFP A;  1KCY A;  4YRU A;  3SG3 A;  1XA5 A;  2Q91 A;  2ZN9 A;  2P6B B;  4M2O A;  2Y5I A;  1KK8 B;  2MHH A;  3CS1 A;  2JWW A;  4GUK A;  2KFH A;  3TDU A;  5D69 A;  3LK1 A;  2ZRS A;  4MBE A;  1GQM A;  1YUS A;  3EVR A;  3PN7 C;  2EGD A;  1NX0 A;  1SL7 A;  2K7O A;  1SY9 A;  1H4B A;  2LP3 A;  1EL4 A;  4ZCV A;  2KFG A;  2PRU A;  2KSP A;  3TDI A;  1BR1 B;  1G4Y R;  3VRQ A;  4XJK B;  2Y1M A;  3WNX B;  2L98 A;  1XFU O;  1FF1 A;  1UHJ A;  1K94 A;  3WHT B;  1ZMZ A;  5AXI A;  2FCE A;  3I5F C;  1BU3 A;  4P5O E;  2ZN8 A;  4OCI A;  1B47 A;  2F8P A;  1S36 A;  2QPT A;  4MRY A;  5HLO A;  1N2D A;  2FCD A;  1Y0V H;  1VRK A;  5CSN A;  3CR4 X;  1PVB A;  1YUT A;  1NX1 A;  4JPZ B;  4TNC A;  1QX5 B;  3BYA A;  2QAC A;  2HQ8 A;  1NSH A;  1QVI Y;  1KWO C;  2JTZ A;  2M7L A;  4YI9 A;  1EJ3 A;  2K8M B;  3I5G C;  3JTD C;  3C1V A;  2MA2 A;  1J7Q A;  3SIB A;  2L2E A;  1Y6W A;  2H61 A;  2M8U A;  3KEV A;  1QIW A;  3HX4 A;  1K96 A;  2JT3 A;  3K21 A;  3VGO A;  1KK7 Y;  1DJY A;  1IGV A;  2KAX A;  2I7A A;  2KI4 C;  2OS8 B;  2JC2 A;  4C0J A;  1V1F A;  2TN4 A;  2F33 A;  1XFW O;  4PE7 A;  4QJ4 B;  1IRJ A;  2LM5 A;  1S5G Z;  1ALW A;  1JUO A;  3NXA A;  1XO5 A;  4DCK A;  3D0Y B;  2LMT A;  1RRO A;  2KI6 C;  5J3X A;  3SG6 A;  4F0Z B;  1KQM B;  1UWO A;  2KOT A;  1CLB A;  1F4O A;  1NP8 A;  3O2P A;  1IWQ A;  2KQY A;  3I5H B;  5DKR A;  3LK0 A;  1AUI B;  1SL9 A;  2NLN A;  5HYD A;  1K9P A;  2F2O A;  2CTN A;  1OOJ A;  2LE9 B;  5IBW A;  2M7N A;  3EKH A;  4DS7 A;  1QLK A;  4ETO A;  1CFC A;  1BOC A;  3SG7 A;  1W7I B;  5AFP A;  1B9A A;  3KF9 A;  3FIA A;  1NX3 A;  1Y1A A;  3BUM B;  1S26 D;  1SR6 C;  2EHB A;  4GNK B;  1CLL A;  2L4H A;  2ZNE A;  1YX8 A;  2L0P A;  4YGC B;  2LCP A;  1CMG A;  1YVH A;  4YBH B;  4ORC B;  4N1F A;  1AJ4 A;  2JOJ A;  4DIR A;  2K7D A;  2WOS A;  4N1G A;  1DF0 A;  2BE6 A;  2JUL A;  1DJG A;  1YUR A;  1WDC C;  3OB1 B;  4QJ3 B;  2K0J A;  1S1E A;  1J55 A;  1R6P A;  2LLT A;  5CPV A;  1XFX O;  4MEW A;  1N0Y A;  4MZK A;  3VRN A;  1J7P A;  1PSR A;  3TZ1 A;  3JVT C;  1EH2 A;  5JOL A;  1SW8 A;  2EC6 B;  1J1D A;  4N5X A;  3SG4 A;  1NYA A;  2KQ6 A;  1SKT A;  2CNP A;  1QXP A;  1TIZ A;  3BUN B;  3DD4 A;  3PFV A;  1NCZ A;  1CM1 A;  2KAY A;  2BCA A;  2HPS A;  2JT8 A;  2R2I A;  4QJ5 B;  1BJF A;  1SBJ A;  2BKI B;  2NZ0 A;  1A2X A;  1EG3 A;  2E6W A;  2OTG C;  2MLE C;  1LKJ A;  2WOR A;  5KSZ A;  3F45 A;  3NSL A;  1YUU A;  1OZS A;  4MN0 A;  4CLN A;  1K9K A;  2L50 A;  3GOF A;  4U8D A;  1PUL A;  2IS9 A;  2I18 A;  1KFU L;  4AQI A;  3GK1 A;  1REC A;  1XFV O;  1LXF C;  3CWG A;  4I5K A;  3TS5 C;  1IJ5 A;  1GGW A;  2M3W A;  1ODB A;  1M39 A;  2LVV A;  2PMY A;  3EK8 A;  4E68 A;  1BF5 A;  1DT7 B;  3EK7 A;  1OSA A;  1SYM A;  4C0K A;  1B7T Y;  1JFK A;  1IQ5 A;  2V53 A;  1L2O C;  2ISD A;  2Q4U A;  2SCP A;  2M1U A;  1FBV A;  5BPJ A;  2OS8 C;  1UUS A;  1A75 B;  3BUX B;  3EVU A;  1CDL A;  3QRX A;  3LLE A;  4GAO A;  2VRG A;  1H8B A;  2D8N A;  5KU1 A;  1F8H A;  1DJW A;  5PAL A;  2MBX A;  3LCP C;  1IQ3 A;  2KBM A;  1KFX L;  3M0W A;  1KQM C;  1YTZ C;  1YX7 A;  3PM8 A;  3SG5 A;  1NX2 A;  1OMR A;  2DOQ A;  2I2R E;  4PE0 A;  1WRK A;  3I5H C;  1B8C A;  2PSR A;  1XFY O;  4YGD B;  2ZRT A;  2L4I A;  2WCF A;  4BY5 A;  1CMF A;  2Y1N A;  4JQ0 D;  4MZL A;  3EVV A;  3A8R A;  3AAK A;  2M97 A;  3NSO A;  2JPT A;  3BOW A;  3NSK A;  3OX6 A;  1CNP A;  5F6T A;  2CT9 A;  1CDN A;  1K8U A;  4GBA A;  2L5X B;  3IQQ A;  4ORA B;  3CR5 X;  1Q80 A;  2H2K A;  2LUX A;  1ZFS A;  3BUW B;  2LVJ A;  1FW4 A;  1SCM C;  1QJT A;  5D7F A;  3VRP A;  1WRL A;  1OMV A;  3DVE A;  1CDP A;  1DMO A;  1QAT A;  1JC2 A;  2BE4 A;  1FI6 A;  4DRW A;  2KDH A;  3DF0 B;  4HRH A;  4OVN F;  5JJG A;  1A29 A;  2I94 A;  1F70 A;  3PN7 B;  1DGU A;  4PHM A;  2KI6 D;  3O6B A;  4M2P A;  1ZAC A;  1IJ6 A;  2AUC A;  1DTL A;  2B1U A;  4XJK A;  2A4J A;  2KBI A;  1CDM A;  2CXJ A;  1TTX A;  2WCE A;  5KTY A;  2JT0 A;  2ZKM X;  2EC6 C;  4I5L B;  1MQ1 A;  4OV2 A;  2MAZ A;  2KNE A;  2LHI A;  2KYF A;  1HT9 A;  3I5F B;  5GQQ C;  2JTT A;  1KSO A;  3AKB A;  4FTG A;  1B1G A;  1U5I B;  1LA0 A;  5HKZ A;  1UUR A;  1C7W A;  2AMI A;  5TNC A;  1CTR A;  1EG4 A;  2HQW A;  2JZI A;  1M46 A;  1N65 A;  1YVL A;  1K9U A;  1TNW A;  2M29 A;  5I8N A;  2BEC A;  1FPW A;  3MSE B;  4AOM A;  5AEQ A;  1F55 A;  1KWO B;  3O4Y A;  4HRG A;  2AAO A;  2F2P A;  4PE4 A;  5I2L A;  3JTD B;  3I5G B;  1WLZ A;  1NIW A;  1OQP A;  5ER5 A;  1WRZ A;  1NUB A;  1AJ5 A;  1BR4 B;  2K61 A;  1KK8 C;  2LMV A;  3PAT A;  5I2Q A;  1K90 D;  1UHI A;  2KHN A;  1AHR A;  1LVC D;  2LLU A;  4A4C A;  3PSR A;  4I5N B;  1AVS A;  1RTP 1;  3D10 A;  1CLM A;  1A03 A;  2KI4 B;  5HLV A;  1BMO A;  2GGM A;  4CFR A;  1SCV A;  1TNP A;  2E30 A;  2M9G A;  1B4C A;  5G08 A;  1QTX A;  3D0Y A;  1S5G Y;  3OB2 B;  2WCB A;  4USL A;  4L9M A;  4IL1 A;  4NDB A;  2MLF C;  2CCM A;  2JNX A;  4PHJ A;  1K93 D;  1SRA A;  4GFT A;  2JU0 A;  1PSB A;  1OMD A;  5AAN A;  1S6J A;  2JNF A;  1MR8 A;  3ZWH A;  5B8I B;  4NDD A;  1QX2 A;  1C07 A;  3TUY B;  3EKJ A;  1QV1 A;  2JRF A;  3H4S E;  1C7V A;  1CM4 A;  1BT6 A;  1RWY A;  4A4B A;  1BLQ A;  1NPQ A;  3KPX A;  1LA3 A;  5CSJ A;  3KO0 A;  1M63 B;  2PVB A;  4MRX A;  2F3Y A;  1AK8 A;  2WC8 A;  1DJH A;  4MVF A;  1DGV A;  4P2Y B;  5I2O A;  3EK4 A;  1G8I A;  1QVI Z;  1K2H A;  2L51 A;  1RFJ A;  2ZFD A;  3OX5 A;  1R2U A;  1QLS A;  3OP0 A;  1TNQ A;  1A4P A;  2NCO A;  1G33 A;  1DJI A;  3I5I B;  3VRR A;  2KFF A;  3BUO B;  3SIA A;  1KK7 Z;  2M0R A;  4YGE B;  1UHK A;  1M31 A;  1MXL C;  1RJV A;  1WDC B;  2KAV A;  3GK4 X;  3TDZ A;  1WLM A;  4YI8 A;  5CSI A;  3BQ3 A;  1GJY A;  1JF0 A;  1IG5 A;  2MRD A;  1OE9 B;  1YRU B;  3JVT B;  4GPL B;  4PDZ A;  3LL8 B;  1HQV A;  4UPG A;  1AP4 A;  4PHK A;  1ZOT B;  3PAL A; 
#chains in the Genus database with same CATH topology
 4WRI A;  1QV0 A;  3RLZ A;  2OPO A;  1QS7 A;  2M1K B;  2QDI A;  5HKW A;  1L7Z A;  4OKH A;  5AER A;  5HKY A;  3DVM A;  2K2A A;  2LVK A;  2RGI A;  3S0E A;  4DUQ A;  4NQG A;  2OTG B;  3S0D A;  1TOP A;  1YR5 A;  1FI5 A;  2FJU B;  1SK6 D;  4JWQ A;  4ICB A;  3DVJ A;  2COL B;  2PAS A;  4Q04 A;  3Q8I A;  1CFF A;  3IQO A;  1BG1 A;  1UHN A;  1MF8 B;  4ZCU A;  2LLS A;  1J7R A;  1SPY A;  2BL0 B;  1JBA A;  4HRE E;  1IKU A;  2LHL A;  3TS5 B;  3CGA A;  4R1E A;  1P28 A;  2P70 A;  1KFU S;  4OR9 B;  3UNW A;  1Y1X A;  1SMG A;  2Y4Q A;  2K7B A;  1BOD A;  3A4U B;  1JF2 A;  4FQT A;  1JWD A;  2KYC A;  2LMU A;  3CZT X;  2JQ6 A;  2LAN A;  1S3P A;  4I5J A;  3WHU B;  4MLW A;  3S0F A;  1DF0 B;  1D1O A;  1S6I A;  1A75 A;  1IH0 A;  4XYN A;  1S6C A;  2LUC A;  1L2O B;  4CID A;  1W7J B;  2GGZ A;  2WND A;  3NSI A;  2BBN A;  3OHM B;  3R72 A;  3VRO A;  4CFQ A;  4FQO A;  3RM1 A;  1NWD A;  2FOT A;  2L2C A;  4ORB B;  1TCF A;  1EXR A;  4PHN A;  4GGF A;  2K2F A;  5ER4 X;  1MHO A;  1JSA A;  2LV7 A;  1ALV A;  1XK4 A;  1PVA A;  2KGR A;  1Y1U A;  4HSZ A;  4C0L A;  1DVI A;  2MJW B;  1K95 A;  1LIN A;  1JFJ A;  5FYX A;  1KFX S;  5I94 A;  1F4Q A;  3CDN A;  3CYZ A;  3AKA A;  3DXL A;  4JKT A;  3TUY C;  4YGB B;  1MXE A;  3BFB A;  2SAS A;  1KQV A;  2ZND A;  2LC5 A;  3GK2 A;  3SG2 A;  3CLN A;  4NDC A;  5DKQ A;  5K89 A;  1QX7 A;  3DVK A;  1TCO B;  3ICB A;  4M2Q A;  3SJS A;  3IF7 A;  2LNK A;  4AQJ A;  1X02 A;  3CTN A;  1PAL A;  1DJX A;  2HET A;  2KGB C;  1PK0 D;  2WCL A;  1QWV A;  3E3R A;  1F54 A;  5DKN A;  1F71 A;  1E8A A;  1TRF A;  1MWN A;  2CBL A;  3HCM A;  1KSM A;  1CKK A;  3KHE A;  1B8L A;  3EG5 B;  2GV5 A;  3ZNI A;  3O78 A;  1SCM B;  2BKH B;  2G2B A;  2BCX A;  1OZO A;  3FWB A;  2HF5 A;  2PAL A;  1SL8 A;  2O60 A;  2LP2 A;  3BXK A;  1B7T Z;  4PE1 A;  1CFD A;  1DQE A;  4GGN A;  4MZJ A;  3DF0 A;  2NCP A;  1ZUZ A;  2H61 C;  3I5I C;  1CB1 A;  2O5G A;  2LAP A;  2LVI A;  4WQ2 A;  3FS7 A;  1MUX A;  2K60 A;  4YGA A;  1M45 A;  1B8R A;  2JXL A;  4PAL A;  2G9B A;  4JD9 A;  1PRW A;  3NHT A;  2K7C A;  1UP5 A;  4GGF C;  1W9Z A;  1J1E A;  2M49 B;  2NXQ A;  4PCW A;  1SNL A;  2WC6 A;  1J7O A;  1XK4 C;  2BBM A;  5CSF A;  5D3O A;  1V1G A;  1NCX A;  3FWC A;  3L4A A;  1RK9 A;  1XVJ A;  1XYD A;  1GGZ A;  3S0B A;  2F3Z A;  3R1P A;  2FJY A;  4WQ3 A;  1U5I A;  1DJZ A;  1TNX A;  4MSP A;  3CR2 A;  2BCB A;  3DY9 A;  1SR6 B;  2JXC A;  3AAJ A;  1WY9 A;  4CPV A;  3OBV A;  3WXA A;  3CZ1 A;  1SSE B;  3DYE A;  1YRT B;  1OOH A;  4D1E A;  3BOW B;  4BY4 A;  1QAS A;  1XFZ O;  1UHH A;  3PLF B;  1QIV A;  1TN4 A;  3CZ0 A;  2BL0 C;  1NCY A;  1CFP A;  1KCY A;  4YRU A;  3SG3 A;  2QEH A;  1XA5 A;  2Q91 A;  2ZN9 A;  2P6B B;  4M2O A;  2Y5I A;  1KK8 B;  2MHH A;  3CS1 A;  2JWW A;  4GUK A;  2KFH A;  3TDU A;  5D69 A;  3LK1 A;  2ZRS A;  4MBE A;  1GQM A;  1YUS A;  3EVR A;  3PN7 C;  2EGD A;  1NX0 A;  1SL7 A;  2K7O A;  1SY9 A;  1H4B A;  2LP3 A;  1EL4 A;  4ZCV A;  2KFG A;  2PRU A;  2KSP A;  3D75 A;  1BR1 B;  3TDI A;  1G4Y R;  3VRQ A;  4XJK B;  2Y1M A;  3WNX B;  2L98 A;  1XFU O;  1FF1 A;  1UHJ A;  1K94 A;  3WHT B;  1ZMZ A;  2BNX A;  5AXI A;  2FCE A;  3OGN A;  4PT1 A;  3I5F C;  1BU3 A;  4P5O E;  2ZN8 A;  4OCI A;  1B47 A;  2F8P A;  1S36 A;  2QPT A;  4MRY A;  5HLO A;  1N2D A;  2FCD A;  1Y0V H;  1VRK A;  5CSN A;  2YGU A;  3CR4 X;  3NHI A;  1PVB A;  1YUT A;  1NX1 A;  4JPZ B;  4TNC A;  1QX5 B;  3L47 A;  3IVT A;  3BYA A;  2QAC A;  2HQ8 A;  1NSH A;  1QVI Y;  1KWO C;  2JTZ A;  2M7L A;  3QME A;  2GTE A;  4YI9 A;  1EJ3 A;  2K8M B;  3I5G C;  3JTD C;  3C1V A;  2MA2 A;  1J7Q A;  3SIB A;  2L2E A;  1Y6W A;  2H61 A;  2M8U A;  3PJI A;  3KEV A;  1QIW A;  3HX4 A;  1K96 A;  2JT3 A;  3K21 A;  3VGO A;  1KK7 Y;  1DJY A;  1IGV A;  2KAX A;  2I7A A;  2KI4 C;  2OS8 B;  2JC2 A;  4C0J A;  1V1F A;  2TN4 A;  2F33 A;  1XFW O;  4PE7 A;  4QJ4 B;  1IRJ A;  1XFR A;  2LM5 A;  1OOF A;  1S5G Z;  1ALW A;  1JUO A;  3NXA A;  1XO5 A;  4DCK A;  3D0Y B;  2LMT A;  1RRO A;  2KI6 C;  5J3X A;  3SG6 A;  4F0Z B;  1KQM B;  1UWO A;  2KOT A;  1CLB A;  1F4O A;  1NP8 A;  2ERB A;  1DEL A;  3O2P A;  1IWQ A;  1T14 A;  2KQY A;  3I5H B;  3V2L A;  5DKR A;  3LK0 A;  2KLE A;  1AUI B;  3B86 A;  1SL9 A;  2NLN A;  5HYD A;  1K9P A;  2F2O A;  2CTN A;  1OOJ A;  2LE9 B;  2P71 A;  2M7N A;  3EKH A;  4DS7 A;  1QLK A;  4ETO A;  2L5Y A;  1CFC A;  1BOC A;  3SG7 A;  1W7I B;  5AFP A;  1B9A A;  3KF9 A;  3FIA A;  1NX3 A;  1Y1A A;  3BUM B;  1S26 D;  1SR6 C;  2EHB A;  1Z2C B;  4GNK B;  1CLL A;  2L4H A;  2ZNE A;  1YX8 A;  2L0P A;  2KPH A;  4YGC B;  2LCP A;  1LS8 A;  1CMG A;  1GM0 A;  1YVH A;  4YBH B;  4ORC B;  4N1F A;  1AJ4 A;  2JOJ A;  4DIR A;  2K7D A;  2WOS A;  4N1G A;  1DF0 A;  2BE6 A;  2JUL A;  3N7H A;  1DJG A;  1YUR A;  1WDC C;  3OB1 B;  4QJ3 B;  2K0J A;  4F7F A;  1S1E A;  1J55 A;  1R6P A;  2KLD A;  2LLT A;  5CPV A;  1XFX O;  4MEW A;  1N0Y A;  4MZK A;  3VRN A;  1J7P A;  1PSR A;  3TZ1 A;  5IBW A;  3FE6 A;  3JVT C;  1EH2 A;  5JOL A;  1SW8 A;  2EC6 B;  1J1D A;  5DIC A;  4N5X A;  3SG4 A;  1NYA A;  2KQ6 A;  1SKT A;  3B88 A;  2CNP A;  1QXP A;  1TIZ A;  3BUN B;  1ORG A;  3DD4 A;  3PFV A;  2WCK A;  1NCZ A;  1CM1 A;  2KAY A;  2BCA A;  2HPS A;  2JT8 A;  2R2I A;  4QJ5 B;  1BJF A;  1SBJ A;  2BKI B;  2NZ0 A;  1A2X A;  1EG3 A;  2E6W A;  2OTG C;  2MLE C;  1LKJ A;  2WOR A;  5KSZ A;  2BAP A;  3FE9 A;  3F45 A;  3NSL A;  1YUU A;  1OZS A;  4MN0 A;  4CLN A;  1K9K A;  2L50 A;  3GOF A;  4U8D A;  3NGV A;  1DEK A;  1PUL A;  2IS9 A;  2I18 A;  1KFU L;  1OW4 A;  4AQI A;  1C3Z A;  3GK1 A;  1REC A;  1XFV O;  1LXF C;  3CWG A;  4I5K A;  4KYN A;  3TS5 C;  1IJ5 A;  1GGW A;  2WC5 A;  2M3W A;  1ODB A;  1M39 A;  2LVV A;  2PMY A;  3EK8 A;  4E68 A;  1BF5 A;  1DT7 B;  3EK7 A;  1IIO A;  1OSA A;  1SYM A;  4C0K A;  1TWO A;  1B7T Y;  1TUZ A;  1JFK A;  1IQ5 A;  2V53 A;  1L2O C;  2ISD A;  2Q4U A;  2SCP A;  2M1U A;  4OZD A;  1FBV A;  5BPJ A;  2OS8 C;  1UUS A;  1A75 B;  3BFA A;  3BUX B;  3EVU A;  1CDL A;  3QRX A;  3LLE A;  1OOG A;  2VRG A;  4GAO A;  1H8B A;  2D8N A;  5KU1 A;  3RZS A;  1F8H A;  1DJW A;  5PAL A;  2QEB A;  4INX A;  2MBX A;  3LCP C;  1IQ3 A;  2KBM A;  1KFX L;  2PQL A;  3M0W A;  3DZT A;  1KQM C;  1YTZ C;  1YX7 A;  2QEO A;  3PM8 A;  3SG5 A;  1NX2 A;  3FE8 A;  1OMR A;  2DOQ A;  2I2R E;  3K1E A;  4PE0 A;  2WCH A;  1WRK A;  3I5H C;  1B8C A;  2PSR A;  1XFY O;  4YGD B;  3SS5 A;  2ZRT A;  2L4I A;  2WCF A;  4BY5 A;  1CMF A;  2Y1N A;  4JQ0 D;  1OOI X;  3O4X A;  4MZL A;  3EVV A;  3A8R A;  3AAK A;  2M97 A;  3NSO A;  2JPT A;  3BOW A;  3NSK A;  3OX6 A;  1CNP A;  5F6T A;  2CT9 A;  1CDN A;  1K8U A;  2QEV A;  4GBA A;  2L5X B;  3IQQ A;  4ORA B;  3CR5 X;  1Q80 A;  2H2K A;  2LUX A;  1ZFS A;  3BUW B;  5EL2 A;  2LVJ A;  1FW4 A;  1SCM C;  1Z4H A;  1QJT A;  5D7F A;  3VRP A;  1WRL A;  3S0A A;  1OMV A;  3DVE A;  1CDP A;  1DMO A;  3R1V A;  1QAT A;  1JC2 A;  2BE4 A;  3BJH A;  1FI6 A;  4DRW A;  2KDH A;  3DF0 B;  4HRH A;  4OVN F;  5JJG A;  1A29 A;  2I94 A;  1F70 A;  3PN7 B;  1DGU A;  4PHM A;  2KI6 D;  3O6B A;  3D74 A;  1ZAC A;  4M2P A;  1IJ6 A;  2AUC A;  1DTL A;  2B1U A;  4XJK A;  2A4J A;  2KBI A;  1CDM A;  2CXJ A;  1TTX A;  2WCE A;  5KTY A;  2JT0 A;  2ZKM X;  2EC6 C;  4I5L B;  1MQ1 A;  4OV2 A;  3CZ2 A;  2MAZ A;  3D77 A;  2KNE A;  2LHI A;  2KYF A;  1HT9 A;  3I5F B;  5GQQ C;  2JTT A;  1KSO A;  3AKB A;  4FTG A;  1B1G A;  1U5I B;  1LA0 A;  5HKZ A;  1UUR A;  1C7W A;  2AMI A;  5TNC A;  1CTR A;  1EG4 A;  2HQW A;  2JZI A;  1M46 A;  1N65 A;  1YVL A;  1K9U A;  1TNW A;  3CAB A;  3PM2 A;  2M29 A;  3B87 A;  2BEC A;  5I8N A;  1FPW A;  3MSE B;  4AOM A;  5AEQ A;  1F55 A;  1KWO B;  3O4Y A;  4HRG A;  2AAO A;  2F2P A;  4PE4 A;  5I2L A;  3JTD B;  3I5G B;  4IJ7 A;  1WLZ A;  1NIW A;  1OQP A;  5ER5 A;  1WRZ A;  1NUB A;  1AJ5 A;  1BR4 B;  2K61 A;  1KK8 C;  2LMV A;  3D78 A;  3PAT A;  5I2Q A;  1K90 D;  1UHI A;  2KHN A;  5FI6 A;  1AHR A;  1LVC D;  2LLU A;  4A4C A;  3PSR A;  4I5N B;  3UO9 A;  1AVS A;  1RTP 1;  3D10 A;  5FI2 A;  1CLM A;  1A03 A;  2KI4 B;  3D73 A;  5HLV A;  1BMO A;  2GGM A;  4CFR A;  1SCV A;  1TNP A;  2E30 A;  5FI7 A;  2WCJ A;  2M9G A;  1B4C A;  5G08 A;  1QTX A;  3D0Y A;  1S5G Y;  3OB2 B;  2WCB A;  4USL A;  4L9M A;  4IL1 A;  2PYQ A;  4NDB A;  2MLF C;  2CCM A;  2JNX A;  4PHJ A;  1K93 D;  1SRA A;  4GFT A;  2JPO A;  2JU0 A;  1PSB A;  1OMD A;  5AAN A;  1S6J A;  2JNF A;  1MR8 A;  3ZWH A;  3SS4 A;  4NDD A;  1QX2 A;  5B8I B;  3TUY B;  1C07 A;  3EKJ A;  1QV1 A;  2JRF A;  3H4S E;  1C7V A;  1CM4 A;  1BT6 A;  1RWY A;  4A4B A;  2WCM A;  1NPQ A;  3L4L A;  1BLQ A;  3KPX A;  1LA3 A;  4INW A;  5CSJ A;  3KO0 A;  1M63 B;  2PVB A;  4MRX A;  2F3Y A;  1AK8 A;  3B6X A;  2WC8 A;  1DJH A;  4MVF A;  3D76 A;  1DGV A;  4P2Y B;  2H8V A;  5I2O A;  3EK4 A;  1G8I A;  3S0G A;  1QVI Z;  1K2H A;  2L51 A;  1RFJ A;  1DC1 A;  2ZFD A;  3OX5 A;  1R2U A;  1QLS A;  3OP0 A;  1TNQ A;  5HL1 A;  1A4P A;  2NCO A;  1G33 A;  1DJI A;  3B7A A;  3I5I B;  2KFF A;  1TUJ A;  3BUO B;  3VRR A;  3SIA A;  1KK7 Z;  2M0R A;  4YGE B;  1UHK A;  1M31 A;  1MXL C;  1RJV A;  1WDC B;  2KAV A;  3GK4 X;  3TDZ A;  1WLM A;  4YI8 A;  5CSI A;  3SS3 A;  3BQ3 A;  3R1O A;  3BFH A;  1GJY A;  1JF0 A;  1IG5 A;  2MRD A;  1OE9 B;  1YRU B;  3JVT B;  4GPL B;  1C3Y A;  4PDZ A;  3LL8 B;  1HQV A;  4UPG A;  3VB1 A;  1AP4 A;  4PHK A;  1ZOT B;  3PAL A; 
#chains in the Genus database with same CATH homology
 4WRI A;  1QV0 A;  3RLZ A;  2OPO A;  1QS7 A;  2M1K B;  5AER A;  5HKW A;  1L7Z A;  4OKH A;  5HKY A;  3DVM A;  2K2A A;  2LVK A;  2RGI A;  4DUQ A;  4NQG A;  2OTG B;  1TOP A;  1YR5 A;  1FI5 A;  2FJU B;  1SK6 D;  4JWQ A;  4ICB A;  3DVJ A;  2COL B;  2PAS A;  4Q04 A;  1CFF A;  3IQO A;  1BG1 A;  1UHN A;  1MF8 B;  4ZCU A;  2LLS A;  1J7R A;  1SPY A;  2BL0 B;  1JBA A;  4HRE E;  1IKU A;  2LHL A;  3TS5 B;  3CGA A;  4R1E A;  1KFU S;  4OR9 B;  1Y1X A;  1SMG A;  2Y4Q A;  2K7B A;  1BOD A;  3A4U B;  1JF2 A;  1JWD A;  2KYC A;  2LMU A;  3CZT X;  2JQ6 A;  2LAN A;  1S3P A;  4I5J A;  3WHU B;  4MLW A;  1DF0 B;  1D1O A;  1S6I A;  1A75 A;  1IH0 A;  4XYN A;  1S6C A;  2LUC A;  1L2O B;  4CID A;  1W7J B;  2GGZ A;  2WND A;  3NSI A;  2BBN A;  3OHM B;  4CFQ A;  3VRO A;  4FQO A;  3RM1 A;  1NWD A;  2FOT A;  4ORB B;  1TCF A;  1EXR A;  4PHN A;  4GGF A;  2K2F A;  5ER4 X;  1MHO A;  1JSA A;  2LV7 A;  1ALV A;  1XK4 A;  1PVA A;  2KGR A;  1Y1U A;  4HSZ A;  4C0L A;  1DVI A;  2MJW B;  1K95 A;  1LIN A;  1JFJ A;  5FYX A;  1KFX S;  1F4Q A;  3TUY C;  3AKA A;  4YGB B;  1MXE A;  2SAS A;  1KQV A;  2ZND A;  2LC5 A;  3GK2 A;  3SG2 A;  3CLN A;  4NDC A;  5DKQ A;  5K89 A;  1QX7 A;  3DVK A;  1TCO B;  3ICB A;  4M2Q A;  3SJS A;  3IF7 A;  2LNK A;  4AQJ A;  1X02 A;  3CTN A;  1PAL A;  1DJX A;  2HET A;  2KGB C;  1PK0 D;  3E3R A;  1F54 A;  5DKN A;  1F71 A;  1E8A A;  1TRF A;  1MWN A;  2CBL A;  3HCM A;  1KSM A;  1CKK A;  3KHE A;  1B8L A;  2GV5 A;  3ZNI A;  3O78 A;  1SCM B;  2BKH B;  2G2B A;  2BCX A;  1OZO A;  3FWB A;  2HF5 A;  2PAL A;  1SL8 A;  2O60 A;  2LP2 A;  3BXK A;  1B7T Z;  4PE1 A;  1CFD A;  4GGN A;  4MZJ A;  3DF0 A;  2NCP A;  1ZUZ A;  2H61 C;  3I5I C;  1CB1 A;  2O5G A;  2LAP A;  2LVI A;  4WQ2 A;  3FS7 A;  1MUX A;  4YGA A;  1M45 A;  1B8R A;  2JXL A;  4PAL A;  2G9B A;  1PRW A;  2K7C A;  1UP5 A;  4GGF C;  2M49 B;  1J1E A;  2NXQ A;  4PCW A;  1SNL A;  1J7O A;  1XK4 C;  2BBM A;  5CSF A;  1V1G A;  1NCX A;  3FWC A;  1RK9 A;  1XVJ A;  1XYD A;  1GGZ A;  2F3Z A;  4WQ3 A;  1U5I A;  1DJZ A;  1TNX A;  4MSP A;  3CR2 A;  2BCB A;  1SR6 B;  2JXC A;  3AAJ A;  1WY9 A;  4CPV A;  3WXA A;  1YRT B;  4D1E A;  3BOW B;  4BY4 A;  1QAS A;  1XFZ O;  1UHH A;  3PLF B;  1QIV A;  1TN4 A;  2BL0 C;  1NCY A;  1CFP A;  1KCY A;  4YRU A;  3SG3 A;  1XA5 A;  2Q91 A;  2ZN9 A;  2P6B B;  4M2O A;  2Y5I A;  1KK8 B;  2MHH A;  3CS1 A;  2JWW A;  4GUK A;  2KFH A;  3TDU A;  5D69 A;  3LK1 A;  2ZRS A;  4MBE A;  1GQM A;  1YUS A;  3EVR A;  3PN7 C;  2EGD A;  1NX0 A;  1SL7 A;  2K7O A;  1SY9 A;  1H4B A;  2LP3 A;  1EL4 A;  4ZCV A;  2KFG A;  2PRU A;  2KSP A;  3TDI A;  1BR1 B;  1G4Y R;  3VRQ A;  4XJK B;  2Y1M A;  3WNX B;  2L98 A;  1XFU O;  1FF1 A;  1UHJ A;  1K94 A;  3WHT B;  1ZMZ A;  5AXI A;  2FCE A;  3I5F C;  1BU3 A;  4P5O E;  2ZN8 A;  4OCI A;  1B47 A;  2F8P A;  1S36 A;  2QPT A;  4MRY A;  5HLO A;  1N2D A;  2FCD A;  1Y0V H;  1VRK A;  5CSN A;  3CR4 X;  1PVB A;  1YUT A;  1NX1 A;  4JPZ B;  4TNC A;  1QX5 B;  3BYA A;  2QAC A;  2HQ8 A;  1NSH A;  1QVI Y;  1KWO C;  2JTZ A;  2M7L A;  4YI9 A;  1EJ3 A;  2K8M B;  3I5G C;  3JTD C;  3C1V A;  2MA2 A;  1J7Q A;  3SIB A;  2L2E A;  1Y6W A;  2H61 A;  2M8U A;  3KEV A;  1QIW A;  3HX4 A;  1K96 A;  2JT3 A;  3K21 A;  3VGO A;  1KK7 Y;  1DJY A;  1IGV A;  2KAX A;  2I7A A;  2KI4 C;  2OS8 B;  2JC2 A;  4C0J A;  1V1F A;  2TN4 A;  2F33 A;  1XFW O;  4PE7 A;  4QJ4 B;  1IRJ A;  2LM5 A;  1S5G Z;  1ALW A;  1JUO A;  3NXA A;  1XO5 A;  4DCK A;  3D0Y B;  2LMT A;  1RRO A;  2KI6 C;  5J3X A;  3SG6 A;  4F0Z B;  1KQM B;  1UWO A;  2KOT A;  1CLB A;  1F4O A;  1NP8 A;  3O2P A;  1IWQ A;  2KQY A;  3I5H B;  5DKR A;  3LK0 A;  1AUI B;  1SL9 A;  2NLN A;  5HYD A;  1K9P A;  2F2O A;  2CTN A;  1OOJ A;  2LE9 B;  5IBW A;  2M7N A;  3EKH A;  4DS7 A;  1QLK A;  4ETO A;  1CFC A;  1BOC A;  3SG7 A;  1W7I B;  5AFP A;  1B9A A;  3KF9 A;  3FIA A;  1NX3 A;  1Y1A A;  3BUM B;  1S26 D;  1SR6 C;  2EHB A;  4GNK B;  1CLL A;  2L4H A;  2ZNE A;  1YX8 A;  2L0P A;  4YGC B;  2LCP A;  1CMG A;  1YVH A;  4YBH B;  4ORC B;  4N1F A;  1AJ4 A;  2JOJ A;  4DIR A;  2K7D A;  2WOS A;  4N1G A;  1DF0 A;  2BE6 A;  2JUL A;  1DJG A;  1YUR A;  1WDC C;  3OB1 B;  4QJ3 B;  2K0J A;  1S1E A;  1J55 A;  1R6P A;  2LLT A;  5CPV A;  1XFX O;  4MEW A;  1N0Y A;  4MZK A;  3VRN A;  1J7P A;  1PSR A;  3TZ1 A;  3JVT C;  1EH2 A;  5JOL A;  1SW8 A;  2EC6 B;  1J1D A;  4N5X A;  3SG4 A;  1NYA A;  2KQ6 A;  1SKT A;  2CNP A;  1QXP A;  1TIZ A;  3BUN B;  3DD4 A;  3PFV A;  1NCZ A;  1CM1 A;  2KAY A;  2BCA A;  2HPS A;  2JT8 A;  2R2I A;  4QJ5 B;  1BJF A;  1SBJ A;  2BKI B;  2NZ0 A;  1A2X A;  1EG3 A;  2E6W A;  2OTG C;  2MLE C;  1LKJ A;  2WOR A;  5KSZ A;  3F45 A;  3NSL A;  1YUU A;  1OZS A;  4MN0 A;  4CLN A;  1K9K A;  2L50 A;  3GOF A;  4U8D A;  1PUL A;  2IS9 A;  2I18 A;  1KFU L;  4AQI A;  3GK1 A;  1REC A;  1XFV O;  1LXF C;  3CWG A;  4I5K A;  3TS5 C;  1IJ5 A;  1GGW A;  2M3W A;  1ODB A;  1M39 A;  2LVV A;  2PMY A;  3EK8 A;  4E68 A;  1BF5 A;  1DT7 B;  3EK7 A;  1OSA A;  1SYM A;  4C0K A;  1B7T Y;  1JFK A;  1IQ5 A;  2V53 A;  1L2O C;  2ISD A;  2Q4U A;  2SCP A;  2M1U A;  1FBV A;  5BPJ A;  2OS8 C;  1UUS A;  1A75 B;  3BUX B;  3EVU A;  1CDL A;  3QRX A;  3LLE A;  4GAO A;  2VRG A;  1H8B A;  2D8N A;  5KU1 A;  1F8H A;  1DJW A;  5PAL A;  2MBX A;  3LCP C;  1IQ3 A;  2KBM A;  1KFX L;  3M0W A;  1KQM C;  1YTZ C;  1YX7 A;  3PM8 A;  3SG5 A;  1NX2 A;  1OMR A;  2DOQ A;  2I2R E;  4PE0 A;  1WRK A;  3I5H C;  1B8C A;  2PSR A;  1XFY O;  4YGD B;  2ZRT A;  2L4I A;  2WCF A;  4BY5 A;  1CMF A;  2Y1N A;  4JQ0 D;  4MZL A;  3EVV A;  3A8R A;  3AAK A;  2M97 A;  3NSO A;  2JPT A;  3BOW A;  3NSK A;  3OX6 A;  1CNP A;  5F6T A;  2CT9 A;  1CDN A;  1K8U A;  4GBA A;  2L5X B;  3IQQ A;  4ORA B;  3CR5 X;  1Q80 A;  2H2K A;  2LUX A;  1ZFS A;  3BUW B;  2LVJ A;  1FW4 A;  1SCM C;  1QJT A;  5D7F A;  3VRP A;  1WRL A;  1OMV A;  3DVE A;  1CDP A;  1DMO A;  1QAT A;  1JC2 A;  2BE4 A;  1FI6 A;  4DRW A;  2KDH A;  3DF0 B;  4HRH A;  4OVN F;  5JJG A;  1A29 A;  2I94 A;  1F70 A;  3PN7 B;  1DGU A;  4PHM A;  2KI6 D;  3O6B A;  4M2P A;  1ZAC A;  1IJ6 A;  2AUC A;  1DTL A;  2B1U A;  4XJK A;  2A4J A;  2KBI A;  1CDM A;  2CXJ A;  1TTX A;  2WCE A;  5KTY A;  2JT0 A;  2ZKM X;  2EC6 C;  4I5L B;  1MQ1 A;  4OV2 A;  2MAZ A;  2KNE A;  2LHI A;  2KYF A;  1HT9 A;  3I5F B;  5GQQ C;  2JTT A;  1KSO A;  3AKB A;  4FTG A;  1B1G A;  1U5I B;  1LA0 A;  5HKZ A;  1UUR A;  1C7W A;  2AMI A;  5TNC A;  1CTR A;  1EG4 A;  2HQW A;  2JZI A;  1M46 A;  1N65 A;  1YVL A;  1K9U A;  1TNW A;  2M29 A;  5I8N A;  2BEC A;  1FPW A;  3MSE B;  4AOM A;  5AEQ A;  1F55 A;  1KWO B;  3O4Y A;  4HRG A;  2AAO A;  2F2P A;  4PE4 A;  5I2L A;  3JTD B;  3I5G B;  1WLZ A;  1NIW A;  1OQP A;  5ER5 A;  1WRZ A;  1NUB A;  1AJ5 A;  1BR4 B;  2K61 A;  1KK8 C;  2LMV A;  3PAT A;  5I2Q A;  1K90 D;  1UHI A;  2KHN A;  1AHR A;  1LVC D;  2LLU A;  4A4C A;  3PSR A;  4I5N B;  1AVS A;  1RTP 1;  3D10 A;  1CLM A;  1A03 A;  2KI4 B;  5HLV A;  1BMO A;  2GGM A;  4CFR A;  1SCV A;  1TNP A;  2E30 A;  2M9G A;  1B4C A;  5G08 A;  1QTX A;  3D0Y A;  1S5G Y;  3OB2 B;  2WCB A;  4USL A;  4L9M A;  4IL1 A;  4NDB A;  2MLF C;  2CCM A;  2JNX A;  4PHJ A;  1K93 D;  1SRA A;  4GFT A;  2JU0 A;  1PSB A;  1OMD A;  5AAN A;  1S6J A;  2JNF A;  1MR8 A;  3ZWH A;  5B8I B;  4NDD A;  1QX2 A;  1C07 A;  3TUY B;  3EKJ A;  1QV1 A;  2JRF A;  3H4S E;  1C7V A;  1CM4 A;  1BT6 A;  1RWY A;  4A4B A;  1BLQ A;  1NPQ A;  3KPX A;  1LA3 A;  5CSJ A;  3KO0 A;  1M63 B;  2PVB A;  4MRX A;  2F3Y A;  1AK8 A;  2WC8 A;  1DJH A;  4MVF A;  1DGV A;  4P2Y B;  5I2O A;  3EK4 A;  1G8I A;  1QVI Z;  1K2H A;  2L51 A;  1RFJ A;  2ZFD A;  3OX5 A;  1R2U A;  1QLS A;  3OP0 A;  1TNQ A;  1A4P A;  2NCO A;  1G33 A;  1DJI A;  3I5I B;  3VRR A;  2KFF A;  3BUO B;  3SIA A;  1KK7 Z;  2M0R A;  4YGE B;  1UHK A;  1M31 A;  1MXL C;  1RJV A;  1WDC B;  2KAV A;  3GK4 X;  3TDZ A;  1WLM A;  4YI8 A;  5CSI A;  3BQ3 A;  1GJY A;  1JF0 A;  1IG5 A;  2MRD A;  1OE9 B;  1YRU B;  3JVT B;  4GPL B;  4PDZ A;  3LL8 B;  1HQV A;  4UPG A;  1AP4 A;  4PHK A;  1ZOT B;  3PAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...