3RM1A

1.24 angstrom x-ray structure of bovine trtk12-ca(2+)-s100b d63n
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
89
structure length
89
Chain Sequence
b'MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSNGDGECDFQEFMAFVAMITTACHEFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title The effects of CapZ peptide (TRTK12) on the protein dynamics of S100B and S100B D63N
rcsb
source organism Bos taurus
molecule tags Metal binding protein/protein binding
total genus 32
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2011-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3rm1A00
1K90D 2I94A 1CLMA 3RM1A 4OR9B 4P5OE 5DKQA 3HX4A 4YGDB 3BUMB 4AQJA 1SR6B 1B7TY 2WCEA 1NPQA 1MHOA 1TN4A 1G33A 3DF0B 1OZSA 2LM5A 3SG6A 1K8UA 4YI8A 3JTDB 4XJKA 1CM4A 2BBNA 3RLZA 1CDMA 3BOWB 1MWNA 2CXJA 3GK1A 2QPTA 1ZFSA 1H8BA 1CKKA 1FBVA 2M7LA 1CDNA 1B8RA 1EJ3A 2WORA 3EK8A 4CLNA 2LMVA 1YVHA 3SG2A 5I8NA 5HKYA 2OS8C 1WDCC 4DUQA 5GQQC 3VRQA 1BR1B 1DJYA 5PALA 1DJHA 1UP5A 1XK4C 5TNCA 2ZN9A 2JC2A 3CR5X 4F0ZB 1TRFA 3PALA 4PE0A 1B7TZ 1DTLA 1TNWA 2BKHB 1KCYA 2Y5IA 4YGCB 4R1EA 2LHIA 1CMFA 2KAVA 4NQGA 1F4OA 2HETA 3TUYC 3KHEA 4PDZA 3AAJA 3O4YA 1L7ZA 1TNQA 1RTP1 5HLVA 2F8PA 1MR8A 1V1FA 1NSHA 3NSKA 3SG3A 2F2OA 3PM8A 1UWOA 2JT3A 3EVUA 1KWOB 1RWYA 1YUSA 2Y1MA 3VRPA 2G2BA 2NCPA 3I5IB 1IH0A 1KSOA 3TDUA 2CTNA 4ORCB 1SL9A 2JZIA 4DRWA 1TOPA 2L4IA 4MEWA 5F6TA 5B8IB 5HYDA 5J3XA 3BQ3A 5CSJA 3O2PA 3TS5B 1DJZA 2L5XB 2CCMA 3VGOA 1LVCD 1YVLA 2BKIB 1NWDA 1NX1A 1C7WA 2JNXA 1DJGA 2I2RE 1YURA 2P6BB 1Q80A 1BODA 1SKTA 1DMOA 1R2UA 1GGWA 1KK8B 2NZ0A 3DVMA 4PCWA 1PALA 2KFFA 1MF8B 2LVJA 3SG7A 2KAYA 1UURA 2LHLA 1BU3A 1M39A 2MLEC 1AJ5A 4PHKA 3AAKA 4XJKB 1SMGA 1CM1A 1XA5A 2K2FA 3F45A 1CFCA 4N5XA 2JQ6A 2AUCA 4CPVA 1BMOA 2LP2A 3A4UB 2BL0B 2GGZA 1ODBA 3JVTC 2JTTA 1XVJA 1M46A 3ZNIA 4QJ4B 4ORAB 5I2QA 3PN7C 5AXIA 2G9BA 2L51A 2F3ZA 4YGBB 1XFZO 3PSRA 1SYMA 1CFDA 4U8DA 2PRUA 3NSLA 1QX2A 1RK9A 1OMDA 1B47A 1CFPA 1F71A 1TNPA 3DVEA 3LCPC 3VROA 3TDZA 1OOJA 2M97A 1YX7A 2KSPA 4M2OA 2SASA 1LKJA 1ZACA 3SG4A 1CDPA 1YTZC 1K94A 2L50A 1XK4A 1BR4B 1IRJA 2Y4QA 4ZCVA 4AOMA 4CIDA 5KSZA 3I5FC 4ORBB 5AFPA 3CR2A 2JU0A 1S36A 1C7VA 5DKRA 2OPOA 4I5JA 4CFRA 4IL1A 3CR4X 4WQ2A 1PSRA 2FCDA 1SW8A 3SG5A 3TZ1A 1JBAA 4CFQA 3CTNA 1JF2A 2FJUB 2K7OA 3I5GC 1IJ5A 4Q04A 2KBMA 3KPXA 1A03A 2I18A 1PSBA 2EC6B 3AKAA 5JOLA 1F54A 2B1UA 1AJ4A 1NX0A 1WRKA 3OP0A 5HLOA 2KFHA 1J1DA 3O78A 3H4SE 5AANA 1AHRA 3IQOA 2PMYA 4PALA 2KYCA 3GK2A 4M2PA 1C07A 3SIBA 5KTYA 2PVBA 3FWBA 2K7CA 2F33A 1QX5B 2LMTA 4HSZA 3I5HC 2HPSA 1NP8A 4MVFA 1K95A 2ZRSA 4WRIA 1JF0A 2HF5A 2H61A 1W7IB 2K7DA 2F3YA 2NCOA 1SK6D 4OV2A 2PALA 2JRFA 4MRXA 1IQ3A 1QS7A 1M45A 2WCFA 2KI6D 1NYAA 4MLWA 3NSIA 1QLSA 1BLQA 1Y1AA 2KYFA 5JJGA 1SY9A 2L4HA 2LVKA 1PRWA 1V1GA 2L98A 2LCPA 3M0WA 1RROA 1SBJA 4C0JA 1EL4A 2OS8B 1WDCB 3MSEB 2ZNDA 2IS9A 2LAPA 2COLB 3VRNA 2MAZA 2Q91A 2QACA 3D0YA 5I2OA 3FIAA 1A75A 2K8MB 2WNDA 2E6WA 5G08A 5I2LA 1U5IA 1F70A 5CSNA 1XO5A 4GUKA 3TUYB 1QIVA 2LVIA 2MLFC 1KQVA 1XFVO 2R2IA 4I5LB 4MZLA 1DVIA 1FPWA 1B1GA 1K2HA 3OHMB 3EK4A 2HQWA 1GJYA 3HCMA 2JOJA 4HREE 4TNCA 4C0LA 2BECA 3SJSA 1F55A 2LE9B 1QV1A 4NDDA 4PHNA 2KI4C 1Y1UA 4ZCUA 1EXRA 1K93D 1OE9B 4WQ3A 2H61C 1EG4A 2FOTA 3BUWB 5FYXA 2ISDA 3OX6A 4GGFC 1SCVA 2BE6A 3PFVA 1XYDA 1JC2A 1FI6A 1DF0A 1KSMA 1PK0D 1ZOTB 3ICBA 1QVIZ 2OTGC 2SCPA 1KFXL 2F2PA 2JTZA 2KDHA 1DJXA 1VRKA 4QJ5B 2CNPA 2E30A 1XFWO 2JNFA 1S1EA 3D10A 2LC5A 3O6BA 4GFTA 1QASA 2EHBA 4M2QA 1AUIB 1JFJA 3LL8B 3SIAA 1M31A 1KFUL 2LMUA 1BJFA 1IGVA 1KQMC 1SRAA 1XFYO 2MBXA 1QX7A 1S6JA 1UHNA 3DD4A 1X02A 3LK0A 1MXLC 2CBLA 1CFFA 4YGAA 2M8UA 3BXKA 4ETOA 1JSAA 3JVTB 1B9AA 3WXAA 1A29A 2KGRA 1JFKA 2I7AA 1SCMB 5KU1A 3CWGA 3FS7A 4DS7A 1N0YA 3OB2B 3PN7B 4N1GA 3D0YB 1B8LA 1FF1A 2NXQA 1A75B 2M3WA 2VRGA 5HKZA 1PVAA 2BCBA 5HKWA 1NX3A 1BF5A 3PLFB 1U5IB 1WLZA 3PATA 1M63B 1MXEA 5CSIA 5DKNA 2O5GA 1K96A 4PE4A 1TCOB 1CMGA 1YUTA 1S6CA 1TNXA 1Y1XA 2D8NA 2WC8A 4BY5A 2JXLA 4GGNA 1CNPA 3I5FB 1N65A 1B8CA 4GBAA 2CT9A 1S6IA 2K7BA 2TN4A 3WHUB 1L2OC 2AAOA 1QTXA 1WLMA 4QJ3B 1CDLA 1E8AA 4PE7A 5ER4X 2PASA 2NLNA 2EGDA 4I5KA 2KHNA 1SPYA 1J7QA 1H4BA 3I5GB 3WHTB 4PHJA 1WY9A 2BE4A 1DF0B 5IBWA 1K9PA 1QV0A 1KK7Y 1SR6C 1UUSA 3CLNA 1KFXS 1LINA 3GK4X 3LK1A 1TCFA 1Y6WA 1TTXA 2RGIA 1YX8A 3KF9A 1YR5A 2KQ6A 5BPJA 4FQOA 3JTDC 4P2YB 1OQPA 2JWWA 1UHHA 2M9GA 2MJWB 4USLA 1QLKA 2V53A 1KFUS 1OZOA 4GGFA 3LLEA 4PE1A 4C0KA 1BG1A 4YI9A 1MUXA 1JWDA 1TIZA 3QRXA 1DT7B 1HQVA 3FWCA 1RECA 1YRTB 1RFJA 3VRRA 2AMIA 2M1UA 1F8HA 1QATA 3EVVA 1IWQA 2GGMA 3I5HB 1IKUA 1YRUB 2WCBA 2KAXA 1KK7Z 1ALWA 1IJ6A 1A4PA 3NXAA 2ZRTA 2L2EA 3AKBA 5AERA 2A4JA 5D7FA 4YGEB 2JT0A 1F4QA 5AEQA 4I5NB 1J7PA 1IG5A 3A8RA 1B4CA 1BT6A 4JPZB 2LLTA 1G4YR 2M1KB 2ZFDA 4NDCA 1S3PA 3EKHA 3OX5A 4MZKA 3ZWHA 4MRYA 4OKHA 1WRLA 1KWOC 1BOCA 1QVIY 3I5IC 1NCXA 1XFXO 4FTGA 2KI6C 2JXCA 3EVRA 4AQIA 1LA0A 4UPGA 1SL8A 2LANA 2KBIA 4YBHB 4JWQA 4A4CA 1S5GY 1FW4A 3WNXB 1ZMZA 2GV5A 4HRHA 1NUBA 2LLSA 1J55A 1AVSA 4OVNF 3TS5C 3GOFA 4JQ0D 4GPLB 5CSFA 1DGVA 2ZKMX 3OB1B 1N2DA 4MN0A 1G8IA 1AP4A 1HT9A 1UHIA 2LUCA 4L9MA 1NIWA 1K9UA 2LUXA 1LA3A 4GAOA 1GGZA 1MQ1A 3E3RA 3K21A 4D1EA 1KK8C 2LLUA 3TDIA 2ZN8A 2M0RA 3CGAA 2M7NA 1SL7A 2FCEA 4MZJA 1GQMA 1JUOA 2M29A 1IQ5A 4MBEA 2KI4B 4GNKB 2BBMA 3KO0A 3DVJA 2MA2A 5ER5A 1R6PA 1QJTA 4DCKA 3NSOA 2L0PA 2MHHA 4OCIA 1S5GZ 2MRDA 1WRZA 3KEVA 1J7OA 1S26D 2BL0C 2H2KA 3IF7A 1LXFC 4YRUA 4BY4A 2LVVA 2OTGB 2WOSA 2LP3A 1OSAA 2K0JA 2KGBC 2K61A 3DF0A 5CPVA 1EH2A 1UHJA 1W7JB 2O60A 1CTRA 2ZNEA 3BUXB 1DJWA 5K89A 4A4BA 1YUUA 3BOWA 3EKJA 1KQMB 1ZUZA 2HQ8A 2KQYA 1NX2A 2KOTA 1J7RA 2LNKA 3BUOB 1NCYA 1SCMC 1EG3A 2KFGA 4ICBA 2BCAA 1DJIA 1XFUO 1QIWA 2DOQA 1CLBA 2K2AA 1Y0VH 2Y1NA 2KNEA 1K9KA 2M49B 4MSPA 1FI5A 2Q4UA 2LV7A 3EK7A 4N1FA 3CS1A 3DVKA 3CZTX 1D1OA 1ALVA 1UHKA 4E68A 1CB1A 1OMVA 4XYNA 5D69A 1NCZA 1SNLA 3IQQA 1CLLA 3BUNB 1OMRA 4HRGA 2EC6C 1QXPA 1RJVA 2JT8A 1PULA 3BYAA 1A2XA 4PHMA 2JULA 2JPTA 1J1EA 1AK8A 4DIRA 4NDBA 1L2OB 2BCXA 2PSRA 1DGUA 1PVBA 3C1VA
chains in the Genus database with same CATH superfamily
1K90D 2I94A 3DZTA 1CLMA 3RM1A 4OR9B 4P5OE 5DKQA 2PQLA 3HX4A 4YGDB 3BUMB 4AQJA 2QEVA 1SR6B 3DXLA 1B7TY 2WCEA 3D75A 1NPQA 1MHOA 3RZSA 1TN4A 1G33A 3DF0B 1OZSA 2LM5A 3IVTA 3SG6A 1K8UA 4YI8A 3JTDB 4XJKA 1CM4A 2BBNA 3RLZA 1CDMA 3BOWB 1MWNA 2CXJA 3GK1A 2QPTA 1ZFSA 3PJIA 1GM0A 1H8BA 1CKKA 1FBVA 2M7LA 1CDNA 1B8RA 1EJ3A 2WORA 3EK8A 4CLNA 2LMVA 1OOHA 1YVHA 2JPOA 3FE9A 3SG2A 3SS5A 3Q8IA 5I8NA 5HKYA 2OS8C 1WDCC 4DUQA 5GQQC 3VRQA 1BR1B 1DJYA 5PALA 1DJHA 1UP5A 1XK4C 3NHTA 5TNCA 2ZN9A 2JC2A 3CR5X 3DY9A 4F0ZB 1TRFA 3FE6A 3PALA 4PE0A 1B7TZ 1DTLA 3OBVA 1TNWA 2BKHB 1KCYA 2Y5IA 4YGCB 4R1EA 2LHIA 2QDIA 1CMFA 2KAVA 4NQGA 1F4OA 2HETA 3TUYC 3KHEA 4PDZA 3AAJA 3O4YA 1L7ZA 1TNQA 1RTP1 5HLVA 2F8PA 1MR8A 1V1FA 1NSHA 2WCJA 3NSKA 3SG3A 2F2OA 3PM8A 1UWOA 2JT3A 3EVUA 1KWOB 1RWYA 1YUSA 3BFBA 2Y1MA 3VRPA 2G2BA 2NCPA 3I5IB 1IH0A 3BJHA 1KSOA 3TDUA 2CTNA 4ORCB 1SL9A 2JZIA 4JD9A 1OOGA 1XFRA 4DRWA 1TOPA 2L4IA 4MEWA 5F6TA 5B8IB 5HYDA 5J3XA 1OOIX 3BQ3A 5CSJA 3O2PA 3TS5B 1DJZA 2L5XB 2CCMA 3VGOA 1LVCD 5HL1A 1YVLA 2BKIB 1NWDA 1NX1A 1C7WA 2JNXA 1DJGA 2I2RE 3V2LA 1YURA 2P6BB 1Q80A 2ERBA 2L2CA 1SKTA 1BODA 1DMOA 1R2UA 1GGWA 1KK8B 2NZ0A 3DVMA 4PCWA 3R1VA 1PALA 2KFFA 1MF8B 2LVJA 3SG7A 2KAYA 1UURA 2LHLA 1BU3A 1M39A 3L4LA 2MLEC 1AJ5A 4PHKA 3AAKA 4XJKB 1SMGA 1CM1A 1XA5A 2K2FA 3F45A 1CFCA 4N5XA 2JQ6A 2AUCA 3BFHA 4CPVA 4IJ7A 1BMOA 2LP2A 3A4UB 2BL0B 2GGZA 1ODBA 3JVTC 2JTTA 3B87A 1XVJA 1QWVA 1M46A 3ZNIA 4QJ4B 4ORAB 5I2QA 3PN7C 5AXIA 2G9BA 2L51A 2F3ZA 4YGBB 1XFZO 3PSRA 1SYMA 1CFDA 4U8DA 2PRUA 3NSLA 2WCHA 1QX2A 1RK9A 1OMDA 1B47A 1CFPA 1F71A 1TNPA 3DVEA 3LCPC 3VROA 3TDZA 3CZ1A 1OOJA 2M97A 1YX7A 2KSPA 4M2OA 2SASA 1LKJA 1IIOA 1ZACA 3SG4A 1CDPA 1YTZC 2WCKA 1DC1A 3D74A 1K94A 1TUZA 1XK4A 2L50A 1BR4B 1IRJA 2QEOA 2Y4QA 4ZCVA 4AOMA 4CIDA 5KSZA 3I5FC 2BAPA 4ORBB 5AFPA 3CABA 2L5YA 3CR2A 2JU0A 1S36A 1C7VA 5DKRA 2OPOA 4I5JA 4CFRA 1DQEA 4IL1A 3CR4X 4WQ2A 1PSRA 2FCDA 1SW8A 3SG5A 3TZ1A 1JBAA 4CFQA 3CTNA 1JF2A 2FJUB 2K7OA 3I5GC 1IJ5A 4KYNA 4Q04A 3UO9A 2KBMA 3D76A 3KPXA 4JKTA 1A03A 2I18A 1PSBA 2EC6B 3AKAA 5JOLA 1F54A 2B1UA 1AJ4A 1NX0A 1WRKA 3OP0A 5HLOA 2KFHA 1J1DA 3O78A 3H4SE 5AANA 1AHRA 3IQOA 2PMYA 4PALA 2KYCA 3GK2A 4M2PA 1C07A 3SIBA 5KTYA 2PVBA 3FWBA 2K7CA 2F33A 1QX5B 2LMTA 4HSZA 3I5HC 2HPSA 1NP8A 4MVFA 3VB1A 1K95A 2ZRSA 4WRIA 1JF0A 2HF5A 2H61A 1W7IB 2K7DA 2F3YA 2KPHA 3CYZA 2NCOA 1SK6D 4OV2A 2PALA 2JRFA 4MRXA 1IQ3A 1QS7A 1M45A 2WCFA 4PT1A 2KI6D 1NYAA 4MLWA 3NSIA 2H8VA 1DEKA 1QLSA 1BLQA 1Y1AA 3D78A 3D77A 2KYFA 5JJGA 1SY9A 2L4HA 2LVKA 1PRWA 1V1GA 2L98A 2LCPA 3M0WA 1RROA 1SBJA 4C0JA 1EL4A 1LS8A 2OS8B 1WDCB 3MSEB 2ZNDA 2IS9A 2LAPA 2COLB 3VRNA 2MAZA 2Q91A 2QACA 3D0YA 5I2OA 3FIAA 1A75A 2K8MB 2KLEA 2WNDA 3K1EA 2E6WA 5G08A 1TUJA 5I2LA 1U5IA 2P70A 1F70A 5CSNA 1XO5A 4GUKA 3TUYB 1QIVA 2LVIA 2MLFC 1KQVA 1XFVO 2R2IA 4I5LB 4MZLA 1DVIA 1FPWA 1B1GA 1C3YA 1K2HA 3OHMB 3EK4A 2HQWA 1DELA 1GJYA 2JOJA 3HCMA 4HREE 4TNCA 4INXA 1TWOA 4C0LA 2BECA 3SJSA 1F55A 2LE9B 1QV1A 4NDDA 2P71A 4PHNA 2KI4C 1Y1UA 4ZCUA 1EXRA 2PYQA 1K93D 1OE9B 4WQ3A 2H61C 2YGUA 1EG4A 2FOTA 3BUWB 5FYXA 2ISDA 3NHIA 3OX6A 4GGFC 1SCVA 2BE6A 3PFVA 1XYDA 1JC2A 1FI6A 1DF0A 1KSMA 1T14A 1PK0D 1ZOTB 3ICBA 3R72A 1QVIZ 2OTGC 2SCPA 1KFXL 2F2PA 2JTZA 2KDHA 1DJXA 1VRKA 3FE8A 4FQTA 4QJ5B 2CNPA 2E30A 1XFWO 2JNFA 1S1EA 3D10A 2LC5A 3O6BA 3B7AA 4GFTA 1QASA 2EHBA 4M2QA 1AUIB 1JFJA 3LL8B 3SIAA 1M31A 1KFUL 2LMUA 1BJFA 1IGVA 1KQMC 1SRAA 1XFYO 2MBXA 1QX7A 1S6JA 1UHNA 3DD4A 4OZDA 1X02A 3L47A 3LK0A 3SS3A 2WCLA 1MXLC 1P28A 2CBLA 1CFFA 4YGAA 2M8UA 3BXKA 4ETOA 3B6XA 2GTEA 1JSAA 3DYEA 3JVTB 1B9AA 5EL2A 3WXAA 1A29A 2KGRA 1JFKA 2I7AA 1SCMB 5KU1A 3CWGA 3FS7A 4DS7A 1N0YA 3NGVA 1SSEB 3OB2B 3PN7B 4N1GA 3D0YB 1B8LA 1FF1A 2NXQA 1A75B 2M3WA 2VRGA 5HKZA 1PVAA 2BCBA 5HKWA 1NX3A 1BF5A 3PLFB 1U5IB 1WLZA 3S0DA 3PATA 3S0BA 1M63B 1MXEA 5CSIA 5DKNA 2O5GA 1K96A 5I94A 4PE4A 1TCOB 1CMGA 1YUTA 1S6CA 1TNXA 1Y1XA 3R1OA 2D8NA 2WC8A 4BY5A 2JXLA 4GGNA 1CNPA 3I5FB 1N65A 1B8CA 4GBAA 2CT9A 1S6IA 2K7BA 2K60A 2TN4A 3CZ2A 3WHUB 1L2OC 2AAOA 3SS4A 1QTXA 1WLMA 4QJ3B 1CDLA 1E8AA 4PE7A 5ER4X 2PASA 2NLNA 2EGDA 4I5KA 2KHNA 1SPYA 1J7QA 1H4BA 3I5GB 3WHTB 4PHJA 3OGNA 1WY9A 2BE4A 1DF0B 5IBWA 1K9PA 1QV0A 1KK7Y 1SR6C 1UUSA 3CLNA 1KFXS 1LINA 3GK4X 3LK1A 3S0GA 3S0FA 1TCFA 1Y6WA 1TTXA 2RGIA 1YX8A 3KF9A 1YR5A 2KQ6A 5BPJA 4FQOA 3JTDC 4P2YB 1OQPA 2JWWA 1UHHA 5DICA 2M9GA 2MJWB 4USLA 1QLKA 2V53A 1KFUS 1OZOA 4GGFA 3LLEA 4PE1A 4C0KA 1BG1A 4YI9A 1MUXA 1JWDA 1TIZA 3QRXA 1DT7B 1HQVA 3FWCA 1RECA 1YRTB 1RFJA 3VRRA 2AMIA 2M1UA 2WC5A 1QATA 2KLDA 3EVVA 1IWQA 2GGMA 3I5HB 1IKUA 1F8HA 3EG5B 1YRUB 2WCBA 2KAXA 1KK7Z 1ALWA 1IJ6A 1A4PA 3NXAA 1C3ZA 2ZRTA 2L2EA 3AKBA 5FI2A 3PM2A 5AERA 2A4JA 5D7FA 4YGEB 2JT0A 1F4QA 3BFAA 4I5NB 5AEQA 1J7PA 1IG5A 3A8RA 1B4CA 1BT6A 3O4XA 4JPZB 2LLTA 1G4YR 2M1KB 2ZFDA 4NDCA 1S3PA 3EKHA 3OX5A 4MZKA 3ZWHA 4MRYA 4OKHA 1WRLA 1KWOC 1Z2CB 1BOCA 1QVIY 3I5IC 1NCXA 1XFXO 1OOFA 4FTGA 4INWA 2KI6C 2QEBA 5FI7A 2JXCA 3EVRA 4AQIA 1LA0A 4UPGA 1SL8A 2LANA 2KBIA 4YBHB 3S0EA 4JWQA 4A4CA 3UNWA 1S5GY 1FW4A 3WNXB 1ZMZA 2GV5A 4HRHA 1NUBA 2LLSA 1J55A 1AVSA 4OVNF 3CDNA 3TS5C 3GOFA 4JQ0D 4GPLB 5CSFA 1DGVA 2ZKMX 3OB1B 1N2DA 4MN0A 1G8IA 1AP4A 1HT9A 1UHIA 2LUCA 4L9MA 1NIWA 1K9UA 2LUXA 1LA3A 4GAOA 1GGZA 1MQ1A 3E3RA 3K21A 4D1EA 1KK8C 2LLUA 3L4AA 2ZN8A 3TDIA 2M0RA 3CGAA 2M7NA 1SL7A 2FCEA 4MZJA 1GQMA 1JUOA 2M29A 1IQ5A 4MBEA 2BNXA 2QEHA 2KI4B 4GNKB 2BBMA 5D3OA 3KO0A 3DVJA 2MA2A 5ER5A 1R6PA 1QJTA 4DCKA 3NSOA 2L0PA 2MHHA 4OCIA 1S5GZ 2MRDA 1WRZA 3KEVA 1J7OA 1S26D 2BL0C 2H2KA 3R1PA 3IF7A 1LXFC 4YRUA 4BY4A 2LVVA 2OTGB 2WC6A 3N7HA 2WOSA 4F7FA 2LP3A 1OSAA 2K0JA 2KGBC 2K61A 2WCMA 3DF0A 3QMEA 5CPVA 1EH2A 1UHJA 1W7JB 2O60A 1CTRA 2ZNEA 3BUXB 1DJWA 5K89A 4A4BA 1YUUA 1Z4HA 3BOWA 3EKJA 1W9ZA 3B86A 1KQMB 1ZUZA 2HQ8A 2KQYA 1NX2A 2KOTA 1J7RA 2LNKA 3BUOB 1NCYA 1SCMC 1EG3A 2KFGA 4ICBA 2BCAA 3S0AA 1DJIA 1XFUO 1QIWA 2DOQA 1CLBA 2K2AA 1Y0VH 2Y1NA 2KNEA 1K9KA 2M49B 4MSPA 3B88A 1FI5A 2Q4UA 2LV7A 3EK7A 4N1FA 3CS1A 3DVKA 3CZTX 3CZ0A 1D1OA 1ALVA 1UHKA 4E68A 1CB1A 1OMVA 4XYNA 5D69A 1NCZA 1SNLA 3IQQA 1CLLA 3BUNB 1OMRA 4HRGA 2EC6C 1QXPA 1RJVA 2JT8A 1PULA 3BYAA 1A2XA 1OW4A 4PHMA 2JULA 2JPTA 1J1EA 1AK8A 4DIRA 2FJYA 4NDBA 1L2OB 5FI6A 2BCXA 2PSRA 3D73A 1DGUA 1ORGA 1PVBA 3C1VA
chains in the Genus database with same CATH topology
1K90D 2I94A 1CLMA 3RM1A 4OR9B 4P5OE 5DKQA 3HX4A 4YGDB 3BUMB 4AQJA 1SR6B 1B7TY 2WCEA 1NPQA 1MHOA 1TN4A 1G33A 3DF0B 1OZSA 2LM5A 3SG6A 1K8UA 4YI8A 3JTDB 4XJKA 1CM4A 2BBNA 3RLZA 1CDMA 3BOWB 1MWNA 2CXJA 3GK1A 2QPTA 1ZFSA 1H8BA 1CKKA 1FBVA 2M7LA 1CDNA 1B8RA 1EJ3A 2WORA 3EK8A 4CLNA 2LMVA 1YVHA 3SG2A 5I8NA 5HKYA 2OS8C 1WDCC 4DUQA 5GQQC 3VRQA 1BR1B 1DJYA 5PALA 1DJHA 1UP5A 1XK4C 5TNCA 2ZN9A 2JC2A 3CR5X 4F0ZB 1TRFA 3PALA 4PE0A 1B7TZ 1DTLA 1TNWA 2BKHB 1KCYA 2Y5IA 4YGCB 4R1EA 2LHIA 1CMFA 2KAVA 4NQGA 1F4OA 2HETA 3TUYC 3KHEA 4PDZA 3AAJA 3O4YA 1L7ZA 1TNQA 1RTP1 5HLVA 2F8PA 1MR8A 1V1FA 1NSHA 3NSKA 3SG3A 2F2OA 3PM8A 1UWOA 2JT3A 3EVUA 1KWOB 1RWYA 1YUSA 2Y1MA 3VRPA 2G2BA 2NCPA 3I5IB 1IH0A 1KSOA 3TDUA 2CTNA 4ORCB 1SL9A 2JZIA 4DRWA 1TOPA 2L4IA 4MEWA 5F6TA 5B8IB 5HYDA 5J3XA 3BQ3A 5CSJA 3O2PA 3TS5B 1DJZA 2L5XB 2CCMA 3VGOA 1LVCD 1YVLA 2BKIB 1NWDA 1NX1A 1C7WA 2JNXA 1DJGA 2I2RE 1YURA 2P6BB 1Q80A 1BODA 1SKTA 1DMOA 1R2UA 1GGWA 1KK8B 2NZ0A 3DVMA 4PCWA 1PALA 2KFFA 1MF8B 2LVJA 3SG7A 2KAYA 1UURA 2LHLA 1BU3A 1M39A 2MLEC 1AJ5A 4PHKA 3AAKA 4XJKB 1SMGA 1CM1A 1XA5A 2K2FA 3F45A 1CFCA 4N5XA 2JQ6A 2AUCA 4CPVA 1BMOA 2LP2A 3A4UB 2BL0B 2GGZA 1ODBA 3JVTC 2JTTA 1XVJA 1M46A 3ZNIA 4QJ4B 4ORAB 5I2QA 3PN7C 5AXIA 2G9BA 2L51A 2F3ZA 4YGBB 1XFZO 3PSRA 1SYMA 1CFDA 4U8DA 2PRUA 3NSLA 1QX2A 1RK9A 1OMDA 1B47A 1CFPA 1F71A 1TNPA 3DVEA 3LCPC 3VROA 3TDZA 1OOJA 2M97A 1YX7A 2KSPA 4M2OA 2SASA 1LKJA 1ZACA 3SG4A 1CDPA 1YTZC 1K94A 2L50A 1XK4A 1BR4B 1IRJA 2Y4QA 4ZCVA 4AOMA 4CIDA 5KSZA 3I5FC 4ORBB 5AFPA 3CR2A 2JU0A 1S36A 1C7VA 5DKRA 2OPOA 4I5JA 4CFRA 4IL1A 3CR4X 4WQ2A 1PSRA 2FCDA 1SW8A 3SG5A 3TZ1A 1JBAA 4CFQA 3CTNA 1JF2A 2FJUB 2K7OA 3I5GC 1IJ5A 4Q04A 2KBMA 3KPXA 1A03A 2I18A 1PSBA 2EC6B 3AKAA 5JOLA 1F54A 2B1UA 1AJ4A 1NX0A 1WRKA 3OP0A 5HLOA 2KFHA 1J1DA 3O78A 3H4SE 5AANA 1AHRA 3IQOA 2PMYA 4PALA 2KYCA 3GK2A 4M2PA 1C07A 3SIBA 5KTYA 2PVBA 3FWBA 2K7CA 2F33A 1QX5B 2LMTA 4HSZA 3I5HC 2HPSA 1NP8A 4MVFA 1K95A 2ZRSA 4WRIA 1JF0A 2HF5A 2H61A 1W7IB 2K7DA 2F3YA 2NCOA 1SK6D 4OV2A 2PALA 2JRFA 4MRXA 1IQ3A 1QS7A 1M45A 2WCFA 2KI6D 1NYAA 4MLWA 3NSIA 1QLSA 1BLQA 1Y1AA 2KYFA 5JJGA 1SY9A 2L4HA 2LVKA 1PRWA 1V1GA 2L98A 2LCPA 3M0WA 1RROA 1SBJA 4C0JA 1EL4A 2OS8B 1WDCB 3MSEB 2ZNDA 2IS9A 2LAPA 2COLB 3VRNA 2MAZA 2Q91A 2QACA 3D0YA 5I2OA 3FIAA 1A75A 2K8MB 2WNDA 2E6WA 5G08A 5I2LA 1U5IA 1F70A 5CSNA 1XO5A 4GUKA 3TUYB 1QIVA 2LVIA 2MLFC 1KQVA 1XFVO 2R2IA 4I5LB 4MZLA 1DVIA 1FPWA 1B1GA 1K2HA 3OHMB 3EK4A 2HQWA 1GJYA 3HCMA 2JOJA 4HREE 4TNCA 4C0LA 2BECA 3SJSA 1F55A 2LE9B 1QV1A 4NDDA 4PHNA 2KI4C 1Y1UA 4ZCUA 1EXRA 1K93D 1OE9B 4WQ3A 2H61C 1EG4A 2FOTA 3BUWB 5FYXA 2ISDA 3OX6A 4GGFC 1SCVA 2BE6A 3PFVA 1XYDA 1JC2A 1FI6A 1DF0A 1KSMA 1PK0D 1ZOTB 3ICBA 1QVIZ 2OTGC 2SCPA 1KFXL 2F2PA 2JTZA 2KDHA 1DJXA 1VRKA 4QJ5B 2CNPA 2E30A 1XFWO 2JNFA 1S1EA 3D10A 2LC5A 3O6BA 4GFTA 1QASA 2EHBA 4M2QA 1AUIB 1JFJA 3LL8B 3SIAA 1M31A 1KFUL 2LMUA 1BJFA 1IGVA 1KQMC 1SRAA 1XFYO 2MBXA 1QX7A 1S6JA 1UHNA 3DD4A 1X02A 3LK0A 1MXLC 2CBLA 1CFFA 4YGAA 2M8UA 3BXKA 4ETOA 1JSAA 3JVTB 1B9AA 3WXAA 1A29A 2KGRA 1JFKA 2I7AA 1SCMB 5KU1A 3CWGA 3FS7A 4DS7A 1N0YA 3OB2B 3PN7B 4N1GA 3D0YB 1B8LA 1FF1A 2NXQA 1A75B 2M3WA 2VRGA 5HKZA 1PVAA 2BCBA 5HKWA 1NX3A 1BF5A 3PLFB 1U5IB 1WLZA 3PATA 1M63B 1MXEA 5CSIA 5DKNA 2O5GA 1K96A 4PE4A 1TCOB 1CMGA 1YUTA 1S6CA 1TNXA 1Y1XA 2D8NA 2WC8A 4BY5A 2JXLA 4GGNA 1CNPA 3I5FB 1N65A 1B8CA 4GBAA 2CT9A 1S6IA 2K7BA 2TN4A 3WHUB 1L2OC 2AAOA 1QTXA 1WLMA 4QJ3B 1CDLA 1E8AA 4PE7A 5ER4X 2PASA 2NLNA 2EGDA 4I5KA 2KHNA 1SPYA 1J7QA 1H4BA 3I5GB 3WHTB 4PHJA 1WY9A 2BE4A 1DF0B 5IBWA 1K9PA 1QV0A 1KK7Y 1SR6C 1UUSA 3CLNA 1KFXS 1LINA 3GK4X 3LK1A 1TCFA 1Y6WA 1TTXA 2RGIA 1YX8A 3KF9A 1YR5A 2KQ6A 5BPJA 4FQOA 3JTDC 4P2YB 1OQPA 2JWWA 1UHHA 2M9GA 2MJWB 4USLA 1QLKA 2V53A 1KFUS 1OZOA 4GGFA 3LLEA 4PE1A 4C0KA 1BG1A 4YI9A 1MUXA 1JWDA 1TIZA 3QRXA 1DT7B 1HQVA 3FWCA 1RECA 1YRTB 1RFJA 3VRRA 2AMIA 2M1UA 1F8HA 1QATA 3EVVA 1IWQA 2GGMA 3I5HB 1IKUA 1YRUB 2WCBA 2KAXA 1KK7Z 1ALWA 1IJ6A 1A4PA 3NXAA 2ZRTA 2L2EA 3AKBA 5AERA 2A4JA 5D7FA 4YGEB 2JT0A 1F4QA 5AEQA 4I5NB 1J7PA 1IG5A 3A8RA 1B4CA 1BT6A 4JPZB 2LLTA 1G4YR 2M1KB 2ZFDA 4NDCA 1S3PA 3EKHA 3OX5A 4MZKA 3ZWHA 4MRYA 4OKHA 1WRLA 1KWOC 1BOCA 1QVIY 3I5IC 1NCXA 1XFXO 4FTGA 2KI6C 2JXCA 3EVRA 4AQIA 1LA0A 4UPGA 1SL8A 2LANA 2KBIA 4YBHB 4JWQA 4A4CA 1S5GY 1FW4A 3WNXB 1ZMZA 2GV5A 4HRHA 1NUBA 2LLSA 1J55A 1AVSA 4OVNF 3TS5C 3GOFA 4JQ0D 4GPLB 5CSFA 1DGVA 2ZKMX 3OB1B 1N2DA 4MN0A 1G8IA 1AP4A 1HT9A 1UHIA 2LUCA 4L9MA 1NIWA 1K9UA 2LUXA 1LA3A 4GAOA 1GGZA 1MQ1A 3E3RA 3K21A 4D1EA 1KK8C 2LLUA 3TDIA 2ZN8A 2M0RA 3CGAA 2M7NA 1SL7A 2FCEA 4MZJA 1GQMA 1JUOA 2M29A 1IQ5A 4MBEA 2KI4B 4GNKB 2BBMA 3KO0A 3DVJA 2MA2A 5ER5A 1R6PA 1QJTA 4DCKA 3NSOA 2L0PA 2MHHA 4OCIA 1S5GZ 2MRDA 1WRZA 3KEVA 1J7OA 1S26D 2BL0C 2H2KA 3IF7A 1LXFC 4YRUA 4BY4A 2LVVA 2OTGB 2WOSA 2LP3A 1OSAA 2K0JA 2KGBC 2K61A 3DF0A 5CPVA 1EH2A 1UHJA 1W7JB 2O60A 1CTRA 2ZNEA 3BUXB 1DJWA 5K89A 4A4BA 1YUUA 3BOWA 3EKJA 1KQMB 1ZUZA 2HQ8A 2KQYA 1NX2A 2KOTA 1J7RA 2LNKA 3BUOB 1NCYA 1SCMC 1EG3A 2KFGA 4ICBA 2BCAA 1DJIA 1XFUO 1QIWA 2DOQA 1CLBA 2K2AA 1Y0VH 2Y1NA 2KNEA 1K9KA 2M49B 4MSPA 1FI5A 2Q4UA 2LV7A 3EK7A 4N1FA 3CS1A 3DVKA 3CZTX 1D1OA 1ALVA 1UHKA 4E68A 1CB1A 1OMVA 4XYNA 5D69A 1NCZA 1SNLA 3IQQA 1CLLA 3BUNB 1OMRA 4HRGA 2EC6C 1QXPA 1RJVA 2JT8A 1PULA 3BYAA 1A2XA 4PHMA 2JULA 2JPTA 1J1EA 1AK8A 4DIRA 4NDBA 1L2OB 2BCXA 2PSRA 1DGUA 1PVBA 3C1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K90 D;  2I94 A;  1CLM A;  3RM1 A;  4OR9 B;  4P5O E;  5DKQ A;  3HX4 A;  4YGD B;  3BUM B;  4AQJ A;  1SR6 B;  1B7T Y;  2WCE A;  1NPQ A;  1MHO A;  1TN4 A;  1G33 A;  3DF0 B;  1OZS A;  2LM5 A;  3SG6 A;  1K8U A;  4YI8 A;  3JTD B;  4XJK A;  1CM4 A;  2BBN A;  3RLZ A;  1CDM A;  3BOW B;  1MWN A;  2CXJ A;  3GK1 A;  2QPT A;  1ZFS A;  1H8B A;  1CKK A;  1FBV A;  2M7L A;  1CDN A;  1B8R A;  1EJ3 A;  2WOR A;  3EK8 A;  4CLN A;  2LMV A;  1YVH A;  3SG2 A;  5I8N A;  5HKY A;  2OS8 C;  1WDC C;  4DUQ A;  5GQQ C;  3VRQ A;  1BR1 B;  1DJY A;  5PAL A;  1DJH A;  1UP5 A;  1XK4 C;  5TNC A;  2ZN9 A;  2JC2 A;  3CR5 X;  4F0Z B;  1TRF A;  3PAL A;  4PE0 A;  1B7T Z;  1DTL A;  1TNW A;  2BKH B;  1KCY A;  2Y5I A;  4YGC B;  4R1E A;  2LHI A;  1CMF A;  2KAV A;  4NQG A;  1F4O A;  2HET A;  3TUY C;  3KHE A;  4PDZ A;  3AAJ A;  3O4Y A;  1L7Z A;  1TNQ A;  1RTP 1;  5HLV A;  2F8P A;  1MR8 A;  1V1F A;  1NSH A;  3NSK A;  3SG3 A;  2F2O A;  3PM8 A;  1UWO A;  2JT3 A;  3EVU A;  1KWO B;  1RWY A;  1YUS A;  2Y1M A;  3VRP A;  2G2B A;  2NCP A;  3I5I B;  1IH0 A;  1KSO A;  3TDU A;  2CTN A;  4ORC B;  1SL9 A;  2JZI A;  4DRW A;  1TOP A;  2L4I A;  4MEW A;  5F6T A;  5B8I B;  5HYD A;  5J3X A;  3BQ3 A;  5CSJ A;  3O2P A;  3TS5 B;  1DJZ A;  2L5X B;  2CCM A;  3VGO A;  1LVC D;  1YVL A;  2BKI B;  1NWD A;  1NX1 A;  1C7W A;  2JNX A;  1DJG A;  2I2R E;  1YUR A;  2P6B B;  1Q80 A;  1BOD A;  1SKT A;  1DMO A;  1R2U A;  1GGW A;  1KK8 B;  2NZ0 A;  3DVM A;  4PCW A;  1PAL A;  2KFF A;  1MF8 B;  2LVJ A;  3SG7 A;  2KAY A;  1UUR A;  2LHL A;  1BU3 A;  1M39 A;  2MLE C;  1AJ5 A;  4PHK A;  3AAK A;  4XJK B;  1SMG A;  1CM1 A;  1XA5 A;  2K2F A;  3F45 A;  1CFC A;  4N5X A;  2JQ6 A;  2AUC A;  4CPV A;  1BMO A;  2LP2 A;  3A4U B;  2BL0 B;  2GGZ A;  1ODB A;  3JVT C;  2JTT A;  1XVJ A;  1M46 A;  3ZNI A;  4QJ4 B;  4ORA B;  5I2Q A;  3PN7 C;  5AXI A;  2G9B A;  2L51 A;  2F3Z A;  4YGB B;  1XFZ O;  3PSR A;  1SYM A;  1CFD A;  4U8D A;  2PRU A;  3NSL A;  1QX2 A;  1RK9 A;  1OMD A;  1B47 A;  1CFP A;  1F71 A;  1TNP A;  3DVE A;  3LCP C;  3VRO A;  3TDZ A;  1OOJ A;  2M97 A;  1YX7 A;  2KSP A;  4M2O A;  2SAS A;  1LKJ A;  1ZAC A;  3SG4 A;  1CDP A;  1YTZ C;  1K94 A;  2L50 A;  1XK4 A;  1BR4 B;  1IRJ A;  2Y4Q A;  4ZCV A;  4AOM A;  4CID A;  5KSZ A;  3I5F C;  4ORB B;  5AFP A;  3CR2 A;  2JU0 A;  1S36 A;  1C7V A;  5DKR A;  2OPO A;  4I5J A;  4CFR A;  4IL1 A;  3CR4 X;  4WQ2 A;  1PSR A;  2FCD A;  1SW8 A;  3SG5 A;  3TZ1 A;  1JBA A;  4CFQ A;  3CTN A;  1JF2 A;  2FJU B;  2K7O A;  3I5G C;  1IJ5 A;  4Q04 A;  2KBM A;  3KPX A;  1A03 A;  2I18 A;  1PSB A;  2EC6 B;  3AKA A;  5JOL A;  1F54 A;  2B1U A;  1AJ4 A;  1NX0 A;  1WRK A;  3OP0 A;  5HLO A;  2KFH A;  1J1D A;  3O78 A;  3H4S E;  5AAN A;  1AHR A;  3IQO A;  2PMY A;  4PAL A;  2KYC A;  3GK2 A;  4M2P A;  1C07 A;  3SIB A;  5KTY A;  2PVB A;  3FWB A;  2K7C A;  2F33 A;  1QX5 B;  2LMT A;  4HSZ A;  3I5H C;  2HPS A;  1NP8 A;  4MVF A;  1K95 A;  2ZRS A;  4WRI A;  1JF0 A;  2HF5 A;  2H61 A;  1W7I B;  2K7D A;  2F3Y A;  2NCO A;  1SK6 D;  4OV2 A;  2PAL A;  2JRF A;  4MRX A;  1IQ3 A;  1QS7 A;  1M45 A;  2WCF A;  2KI6 D;  1NYA A;  4MLW A;  3NSI A;  1QLS A;  1BLQ A;  1Y1A A;  2KYF A;  5JJG A;  1SY9 A;  2L4H A;  2LVK A;  1PRW A;  1V1G A;  2L98 A;  2LCP A;  3M0W A;  1RRO A;  1SBJ A;  4C0J A;  1EL4 A;  2OS8 B;  1WDC B;  3MSE B;  2ZND A;  2IS9 A;  2LAP A;  2COL B;  3VRN A;  2MAZ A;  2Q91 A;  2QAC A;  3D0Y A;  5I2O A;  3FIA A;  1A75 A;  2K8M B;  2WND A;  2E6W A;  5G08 A;  5I2L A;  1U5I A;  1F70 A;  5CSN A;  1XO5 A;  4GUK A;  3TUY B;  1QIV A;  2LVI A;  2MLF C;  1KQV A;  1XFV O;  2R2I A;  4I5L B;  4MZL A;  1DVI A;  1FPW A;  1B1G A;  1K2H A;  3OHM B;  3EK4 A;  2HQW A;  1GJY A;  3HCM A;  2JOJ A;  4HRE E;  4TNC A;  4C0L A;  2BEC A;  3SJS A;  1F55 A;  2LE9 B;  1QV1 A;  4NDD A;  4PHN A;  2KI4 C;  1Y1U A;  4ZCU A;  1EXR A;  1K93 D;  1OE9 B;  4WQ3 A;  2H61 C;  1EG4 A;  2FOT A;  3BUW B;  5FYX A;  2ISD A;  3OX6 A;  4GGF C;  1SCV A;  2BE6 A;  3PFV A;  1XYD A;  1JC2 A;  1FI6 A;  1DF0 A;  1KSM A;  1PK0 D;  1ZOT B;  3ICB A;  1QVI Z;  2OTG C;  2SCP A;  1KFX L;  2F2P A;  2JTZ A;  2KDH A;  1DJX A;  1VRK A;  4QJ5 B;  2CNP A;  2E30 A;  1XFW O;  2JNF A;  1S1E A;  3D10 A;  2LC5 A;  3O6B A;  4GFT A;  1QAS A;  2EHB A;  4M2Q A;  1AUI B;  1JFJ A;  3LL8 B;  3SIA A;  1M31 A;  1KFU L;  2LMU A;  1BJF A;  1IGV A;  1KQM C;  1SRA A;  1XFY O;  2MBX A;  1QX7 A;  1S6J A;  1UHN A;  3DD4 A;  1X02 A;  3LK0 A;  1MXL C;  2CBL A;  1CFF A;  4YGA A;  2M8U A;  3BXK A;  4ETO A;  1JSA A;  3JVT B;  1B9A A;  3WXA A;  1A29 A;  2KGR A;  1JFK A;  2I7A A;  1SCM B;  5KU1 A;  3CWG A;  3FS7 A;  4DS7 A;  1N0Y A;  3OB2 B;  3PN7 B;  4N1G A;  3D0Y B;  1B8L A;  1FF1 A;  2NXQ A;  1A75 B;  2M3W A;  2VRG A;  5HKZ A;  1PVA A;  2BCB A;  5HKW A;  1NX3 A;  1BF5 A;  3PLF B;  1U5I B;  1WLZ A;  3PAT A;  1M63 B;  1MXE A;  5CSI A;  5DKN A;  2O5G A;  1K96 A;  4PE4 A;  1TCO B;  1CMG A;  1YUT A;  1S6C A;  1TNX A;  1Y1X A;  2D8N A;  2WC8 A;  4BY5 A;  2JXL A;  4GGN A;  1CNP A;  3I5F B;  1N65 A;  1B8C A;  4GBA A;  2CT9 A;  1S6I A;  2K7B A;  2TN4 A;  3WHU B;  1L2O C;  2AAO A;  1QTX A;  1WLM A;  4QJ3 B;  1CDL A;  1E8A A;  4PE7 A;  5ER4 X;  2PAS A;  2NLN A;  2EGD A;  4I5K A;  2KHN A;  1SPY A;  1J7Q A;  1H4B A;  3I5G B;  3WHT B;  4PHJ A;  1WY9 A;  2BE4 A;  1DF0 B;  5IBW A;  1K9P A;  1QV0 A;  1KK7 Y;  1SR6 C;  1UUS A;  3CLN A;  1KFX S;  1LIN A;  3GK4 X;  3LK1 A;  1TCF A;  1Y6W A;  1TTX A;  2RGI A;  1YX8 A;  3KF9 A;  1YR5 A;  2KQ6 A;  5BPJ A;  4FQO A;  3JTD C;  4P2Y B;  1OQP A;  2JWW A;  1UHH A;  2M9G A;  2MJW B;  4USL A;  1QLK A;  2V53 A;  1KFU S;  1OZO A;  4GGF A;  3LLE A;  4PE1 A;  4C0K A;  1BG1 A;  4YI9 A;  1MUX A;  1JWD A;  1TIZ A;  3QRX A;  1DT7 B;  1HQV A;  3FWC A;  1REC A;  1YRT B;  1RFJ A;  3VRR A;  2AMI A;  2M1U A;  1F8H A;  1QAT A;  3EVV A;  1IWQ A;  2GGM A;  3I5H B;  1IKU A;  1YRU B;  2WCB A;  2KAX A;  1KK7 Z;  1ALW A;  1IJ6 A;  1A4P A;  3NXA A;  2ZRT A;  2L2E A;  3AKB A;  5AER A;  2A4J A;  5D7F A;  4YGE B;  2JT0 A;  1F4Q A;  5AEQ A;  4I5N B;  1J7P A;  1IG5 A;  3A8R A;  1B4C A;  1BT6 A;  4JPZ B;  2LLT A;  1G4Y R;  2M1K B;  2ZFD A;  4NDC A;  1S3P A;  3EKH A;  3OX5 A;  4MZK A;  3ZWH A;  4MRY A;  4OKH A;  1WRL A;  1KWO C;  1BOC A;  1QVI Y;  3I5I C;  1NCX A;  1XFX O;  4FTG A;  2KI6 C;  2JXC A;  3EVR A;  4AQI A;  1LA0 A;  4UPG A;  1SL8 A;  2LAN A;  2KBI A;  4YBH B;  4JWQ A;  4A4C A;  1S5G Y;  1FW4 A;  3WNX B;  1ZMZ A;  2GV5 A;  4HRH A;  1NUB A;  2LLS A;  1J55 A;  1AVS A;  4OVN F;  3TS5 C;  3GOF A;  4JQ0 D;  4GPL B;  5CSF A;  1DGV A;  2ZKM X;  3OB1 B;  1N2D A;  4MN0 A;  1G8I A;  1AP4 A;  1HT9 A;  1UHI A;  2LUC A;  4L9M A;  1NIW A;  1K9U A;  2LUX A;  1LA3 A;  4GAO A;  1GGZ A;  1MQ1 A;  3E3R A;  3K21 A;  4D1E A;  1KK8 C;  2LLU A;  3TDI A;  2ZN8 A;  2M0R A;  3CGA A;  2M7N A;  1SL7 A;  2FCE A;  4MZJ A;  1GQM A;  1JUO A;  2M29 A;  1IQ5 A;  4MBE A;  2KI4 B;  4GNK B;  2BBM A;  3KO0 A;  3DVJ A;  2MA2 A;  5ER5 A;  1R6P A;  1QJT A;  4DCK A;  3NSO A;  2L0P A;  2MHH A;  4OCI A;  1S5G Z;  2MRD A;  1WRZ A;  3KEV A;  1J7O A;  1S26 D;  2BL0 C;  2H2K A;  3IF7 A;  1LXF C;  4YRU A;  4BY4 A;  2LVV A;  2OTG B;  2WOS A;  2LP3 A;  1OSA A;  2K0J A;  2KGB C;  2K61 A;  3DF0 A;  5CPV A;  1EH2 A;  1UHJ A;  1W7J B;  2O60 A;  1CTR A;  2ZNE A;  3BUX B;  1DJW A;  5K89 A;  4A4B A;  1YUU A;  3BOW A;  3EKJ A;  1KQM B;  1ZUZ A;  2HQ8 A;  2KQY A;  1NX2 A;  2KOT A;  1J7R A;  2LNK A;  3BUO B;  1NCY A;  1SCM C;  1EG3 A;  2KFG A;  4ICB A;  2BCA A;  1DJI A;  1XFU O;  1QIW A;  2DOQ A;  1CLB A;  2K2A A;  1Y0V H;  2Y1N A;  2KNE A;  1K9K A;  2M49 B;  4MSP A;  1FI5 A;  2Q4U A;  2LV7 A;  3EK7 A;  4N1F A;  3CS1 A;  3DVK A;  3CZT X;  1D1O A;  1ALV A;  1UHK A;  4E68 A;  1CB1 A;  1OMV A;  4XYN A;  5D69 A;  1NCZ A;  1SNL A;  3IQQ A;  1CLL A;  3BUN B;  1OMR A;  4HRG A;  2EC6 C;  1QXP A;  1RJV A;  2JT8 A;  1PUL A;  3BYA A;  1A2X A;  4PHM A;  2JUL A;  2JPT A;  1J1E A;  1AK8 A;  4DIR A;  4NDB A;  1L2O B;  2BCX A;  2PSR A;  1DGU A;  1PVB A;  3C1V A; 
#chains in the Genus database with same CATH topology
 1K90 D;  2I94 A;  3DZT A;  1CLM A;  3RM1 A;  4OR9 B;  4P5O E;  5DKQ A;  2PQL A;  3HX4 A;  4YGD B;  3BUM B;  4AQJ A;  2QEV A;  1SR6 B;  3DXL A;  1B7T Y;  2WCE A;  3D75 A;  1NPQ A;  1MHO A;  3RZS A;  1TN4 A;  1G33 A;  3DF0 B;  1OZS A;  2LM5 A;  3IVT A;  3SG6 A;  1K8U A;  4YI8 A;  3JTD B;  4XJK A;  1CM4 A;  2BBN A;  3RLZ A;  1CDM A;  3BOW B;  1MWN A;  2CXJ A;  3GK1 A;  2QPT A;  1ZFS A;  3PJI A;  1GM0 A;  1H8B A;  1CKK A;  1FBV A;  2M7L A;  1CDN A;  1B8R A;  1EJ3 A;  2WOR A;  3EK8 A;  4CLN A;  2LMV A;  1OOH A;  1YVH A;  2JPO A;  3FE9 A;  3SG2 A;  3SS5 A;  3Q8I A;  5I8N A;  5HKY A;  2OS8 C;  1WDC C;  4DUQ A;  5GQQ C;  3VRQ A;  1BR1 B;  1DJY A;  5PAL A;  1DJH A;  1UP5 A;  1XK4 C;  3NHT A;  5TNC A;  2ZN9 A;  2JC2 A;  3CR5 X;  3DY9 A;  4F0Z B;  1TRF A;  3FE6 A;  3PAL A;  4PE0 A;  1B7T Z;  1DTL A;  3OBV A;  1TNW A;  2BKH B;  1KCY A;  2Y5I A;  4YGC B;  4R1E A;  2LHI A;  2QDI A;  1CMF A;  2KAV A;  4NQG A;  1F4O A;  2HET A;  3TUY C;  3KHE A;  4PDZ A;  3AAJ A;  3O4Y A;  1L7Z A;  1TNQ A;  1RTP 1;  5HLV A;  2F8P A;  1MR8 A;  1V1F A;  1NSH A;  2WCJ A;  3NSK A;  3SG3 A;  2F2O A;  3PM8 A;  1UWO A;  2JT3 A;  3EVU A;  1KWO B;  1RWY A;  1YUS A;  3BFB A;  2Y1M A;  3VRP A;  2G2B A;  2NCP A;  3I5I B;  1IH0 A;  3BJH A;  1KSO A;  3TDU A;  2CTN A;  4ORC B;  1SL9 A;  2JZI A;  4JD9 A;  1OOG A;  1XFR A;  4DRW A;  1TOP A;  2L4I A;  4MEW A;  5F6T A;  5B8I B;  5HYD A;  5J3X A;  1OOI X;  3BQ3 A;  5CSJ A;  3O2P A;  3TS5 B;  1DJZ A;  2L5X B;  2CCM A;  3VGO A;  1LVC D;  5HL1 A;  1YVL A;  2BKI B;  1NWD A;  1NX1 A;  1C7W A;  2JNX A;  1DJG A;  2I2R E;  3V2L A;  1YUR A;  2P6B B;  1Q80 A;  2ERB A;  2L2C A;  1SKT A;  1BOD A;  1DMO A;  1R2U A;  1GGW A;  1KK8 B;  2NZ0 A;  3DVM A;  4PCW A;  3R1V A;  1PAL A;  2KFF A;  1MF8 B;  2LVJ A;  3SG7 A;  2KAY A;  1UUR A;  2LHL A;  1BU3 A;  1M39 A;  3L4L A;  2MLE C;  1AJ5 A;  4PHK A;  3AAK A;  4XJK B;  1SMG A;  1CM1 A;  1XA5 A;  2K2F A;  3F45 A;  1CFC A;  4N5X A;  2JQ6 A;  2AUC A;  3BFH A;  4CPV A;  4IJ7 A;  1BMO A;  2LP2 A;  3A4U B;  2BL0 B;  2GGZ A;  1ODB A;  3JVT C;  2JTT A;  3B87 A;  1XVJ A;  1QWV A;  1M46 A;  3ZNI A;  4QJ4 B;  4ORA B;  5I2Q A;  3PN7 C;  5AXI A;  2G9B A;  2L51 A;  2F3Z A;  4YGB B;  1XFZ O;  3PSR A;  1SYM A;  1CFD A;  4U8D A;  2PRU A;  3NSL A;  2WCH A;  1QX2 A;  1RK9 A;  1OMD A;  1B47 A;  1CFP A;  1F71 A;  1TNP A;  3DVE A;  3LCP C;  3VRO A;  3TDZ A;  3CZ1 A;  1OOJ A;  2M97 A;  1YX7 A;  2KSP A;  4M2O A;  2SAS A;  1LKJ A;  1IIO A;  1ZAC A;  3SG4 A;  1CDP A;  1YTZ C;  2WCK A;  1DC1 A;  3D74 A;  1K94 A;  1TUZ A;  1XK4 A;  2L50 A;  1BR4 B;  1IRJ A;  2QEO A;  2Y4Q A;  4ZCV A;  4AOM A;  4CID A;  5KSZ A;  3I5F C;  2BAP A;  4ORB B;  5AFP A;  3CAB A;  2L5Y A;  3CR2 A;  2JU0 A;  1S36 A;  1C7V A;  5DKR A;  2OPO A;  4I5J A;  4CFR A;  1DQE A;  4IL1 A;  3CR4 X;  4WQ2 A;  1PSR A;  2FCD A;  1SW8 A;  3SG5 A;  3TZ1 A;  1JBA A;  4CFQ A;  3CTN A;  1JF2 A;  2FJU B;  2K7O A;  3I5G C;  1IJ5 A;  4KYN A;  4Q04 A;  3UO9 A;  2KBM A;  3D76 A;  3KPX A;  4JKT A;  1A03 A;  2I18 A;  1PSB A;  2EC6 B;  3AKA A;  5JOL A;  1F54 A;  2B1U A;  1AJ4 A;  1NX0 A;  1WRK A;  3OP0 A;  5HLO A;  2KFH A;  1J1D A;  3O78 A;  3H4S E;  5AAN A;  1AHR A;  3IQO A;  2PMY A;  4PAL A;  2KYC A;  3GK2 A;  4M2P A;  1C07 A;  3SIB A;  5KTY A;  2PVB A;  3FWB A;  2K7C A;  2F33 A;  1QX5 B;  2LMT A;  4HSZ A;  3I5H C;  2HPS A;  1NP8 A;  4MVF A;  3VB1 A;  1K95 A;  2ZRS A;  4WRI A;  1JF0 A;  2HF5 A;  2H61 A;  1W7I B;  2K7D A;  2F3Y A;  2KPH A;  3CYZ A;  2NCO A;  1SK6 D;  4OV2 A;  2PAL A;  2JRF A;  4MRX A;  1IQ3 A;  1QS7 A;  1M45 A;  2WCF A;  4PT1 A;  2KI6 D;  1NYA A;  4MLW A;  3NSI A;  2H8V A;  1DEK A;  1QLS A;  1BLQ A;  1Y1A A;  3D78 A;  3D77 A;  2KYF A;  5JJG A;  1SY9 A;  2L4H A;  2LVK A;  1PRW A;  1V1G A;  2L98 A;  2LCP A;  3M0W A;  1RRO A;  1SBJ A;  4C0J A;  1EL4 A;  1LS8 A;  2OS8 B;  1WDC B;  3MSE B;  2ZND A;  2IS9 A;  2LAP A;  2COL B;  3VRN A;  2MAZ A;  2Q91 A;  2QAC A;  3D0Y A;  5I2O A;  3FIA A;  1A75 A;  2K8M B;  2KLE A;  2WND A;  3K1E A;  2E6W A;  5G08 A;  1TUJ A;  5I2L A;  1U5I A;  2P70 A;  1F70 A;  5CSN A;  1XO5 A;  4GUK A;  3TUY B;  1QIV A;  2LVI A;  2MLF C;  1KQV A;  1XFV O;  2R2I A;  4I5L B;  4MZL A;  1DVI A;  1FPW A;  1B1G A;  1C3Y A;  1K2H A;  3OHM B;  3EK4 A;  2HQW A;  1DEL A;  1GJY A;  2JOJ A;  3HCM A;  4HRE E;  4TNC A;  4INX A;  1TWO A;  4C0L A;  2BEC A;  3SJS A;  1F55 A;  2LE9 B;  1QV1 A;  4NDD A;  2P71 A;  4PHN A;  2KI4 C;  1Y1U A;  4ZCU A;  1EXR A;  2PYQ A;  1K93 D;  1OE9 B;  4WQ3 A;  2H61 C;  2YGU A;  1EG4 A;  2FOT A;  3BUW B;  5FYX A;  2ISD A;  3NHI A;  3OX6 A;  4GGF C;  1SCV A;  2BE6 A;  3PFV A;  1XYD A;  1JC2 A;  1FI6 A;  1DF0 A;  1KSM A;  1T14 A;  1PK0 D;  1ZOT B;  3ICB A;  3R72 A;  1QVI Z;  2OTG C;  2SCP A;  1KFX L;  2F2P A;  2JTZ A;  2KDH A;  1DJX A;  1VRK A;  3FE8 A;  4FQT A;  4QJ5 B;  2CNP A;  2E30 A;  1XFW O;  2JNF A;  1S1E A;  3D10 A;  2LC5 A;  3O6B A;  3B7A A;  4GFT A;  1QAS A;  2EHB A;  4M2Q A;  1AUI B;  1JFJ A;  3LL8 B;  3SIA A;  1M31 A;  1KFU L;  2LMU A;  1BJF A;  1IGV A;  1KQM C;  1SRA A;  1XFY O;  2MBX A;  1QX7 A;  1S6J A;  1UHN A;  3DD4 A;  4OZD A;  1X02 A;  3L47 A;  3LK0 A;  3SS3 A;  2WCL A;  1MXL C;  1P28 A;  2CBL A;  1CFF A;  4YGA A;  2M8U A;  3BXK A;  4ETO A;  3B6X A;  2GTE A;  1JSA A;  3DYE A;  3JVT B;  1B9A A;  5EL2 A;  3WXA A;  1A29 A;  2KGR A;  1JFK A;  2I7A A;  1SCM B;  5KU1 A;  3CWG A;  3FS7 A;  4DS7 A;  1N0Y A;  3NGV A;  1SSE B;  3OB2 B;  3PN7 B;  4N1G A;  3D0Y B;  1B8L A;  1FF1 A;  2NXQ A;  1A75 B;  2M3W A;  2VRG A;  5HKZ A;  1PVA A;  2BCB A;  5HKW A;  1NX3 A;  1BF5 A;  3PLF B;  1U5I B;  1WLZ A;  3S0D A;  3PAT A;  3S0B A;  1M63 B;  1MXE A;  5CSI A;  5DKN A;  2O5G A;  1K96 A;  5I94 A;  4PE4 A;  1TCO B;  1CMG A;  1YUT A;  1S6C A;  1TNX A;  1Y1X A;  3R1O A;  2D8N A;  2WC8 A;  4BY5 A;  2JXL A;  4GGN A;  1CNP A;  3I5F B;  1N65 A;  1B8C A;  4GBA A;  2CT9 A;  1S6I A;  2K7B A;  2K60 A;  2TN4 A;  3CZ2 A;  3WHU B;  1L2O C;  2AAO A;  3SS4 A;  1QTX A;  1WLM A;  4QJ3 B;  1CDL A;  1E8A A;  4PE7 A;  5ER4 X;  2PAS A;  2NLN A;  2EGD A;  4I5K A;  2KHN A;  1SPY A;  1J7Q A;  1H4B A;  3I5G B;  3WHT B;  4PHJ A;  3OGN A;  1WY9 A;  2BE4 A;  1DF0 B;  5IBW A;  1K9P A;  1QV0 A;  1KK7 Y;  1SR6 C;  1UUS A;  3CLN A;  1KFX S;  1LIN A;  3GK4 X;  3LK1 A;  3S0G A;  3S0F A;  1TCF A;  1Y6W A;  1TTX A;  2RGI A;  1YX8 A;  3KF9 A;  1YR5 A;  2KQ6 A;  5BPJ A;  4FQO A;  3JTD C;  4P2Y B;  1OQP A;  2JWW A;  1UHH A;  5DIC A;  2M9G A;  2MJW B;  4USL A;  1QLK A;  2V53 A;  1KFU S;  1OZO A;  4GGF A;  3LLE A;  4PE1 A;  4C0K A;  1BG1 A;  4YI9 A;  1MUX A;  1JWD A;  1TIZ A;  3QRX A;  1DT7 B;  1HQV A;  3FWC A;  1REC A;  1YRT B;  1RFJ A;  3VRR A;  2AMI A;  2M1U A;  2WC5 A;  1QAT A;  2KLD A;  3EVV A;  1IWQ A;  2GGM A;  3I5H B;  1IKU A;  1F8H A;  3EG5 B;  1YRU B;  2WCB A;  2KAX A;  1KK7 Z;  1ALW A;  1IJ6 A;  1A4P A;  3NXA A;  1C3Z A;  2ZRT A;  2L2E A;  3AKB A;  5FI2 A;  3PM2 A;  5AER A;  2A4J A;  5D7F A;  4YGE B;  2JT0 A;  1F4Q A;  3BFA A;  4I5N B;  5AEQ A;  1J7P A;  1IG5 A;  3A8R A;  1B4C A;  1BT6 A;  3O4X A;  4JPZ B;  2LLT A;  1G4Y R;  2M1K B;  2ZFD A;  4NDC A;  1S3P A;  3EKH A;  3OX5 A;  4MZK A;  3ZWH A;  4MRY A;  4OKH A;  1WRL A;  1KWO C;  1Z2C B;  1BOC A;  1QVI Y;  3I5I C;  1NCX A;  1XFX O;  1OOF A;  4FTG A;  4INW A;  2KI6 C;  2QEB A;  5FI7 A;  2JXC A;  3EVR A;  4AQI A;  1LA0 A;  4UPG A;  1SL8 A;  2LAN A;  2KBI A;  4YBH B;  3S0E A;  4JWQ A;  4A4C A;  3UNW A;  1S5G Y;  1FW4 A;  3WNX B;  1ZMZ A;  2GV5 A;  4HRH A;  1NUB A;  2LLS A;  1J55 A;  1AVS A;  4OVN F;  3CDN A;  3TS5 C;  3GOF A;  4JQ0 D;  4GPL B;  5CSF A;  1DGV A;  2ZKM X;  3OB1 B;  1N2D A;  4MN0 A;  1G8I A;  1AP4 A;  1HT9 A;  1UHI A;  2LUC A;  4L9M A;  1NIW A;  1K9U A;  2LUX A;  1LA3 A;  4GAO A;  1GGZ A;  1MQ1 A;  3E3R A;  3K21 A;  4D1E A;  1KK8 C;  2LLU A;  3L4A A;  2ZN8 A;  3TDI A;  2M0R A;  3CGA A;  2M7N A;  1SL7 A;  2FCE A;  4MZJ A;  1GQM A;  1JUO A;  2M29 A;  1IQ5 A;  4MBE A;  2BNX A;  2QEH A;  2KI4 B;  4GNK B;  2BBM A;  5D3O A;  3KO0 A;  3DVJ A;  2MA2 A;  5ER5 A;  1R6P A;  1QJT A;  4DCK A;  3NSO A;  2L0P A;  2MHH A;  4OCI A;  1S5G Z;  2MRD A;  1WRZ A;  3KEV A;  1J7O A;  1S26 D;  2BL0 C;  2H2K A;  3R1P A;  3IF7 A;  1LXF C;  4YRU A;  4BY4 A;  2LVV A;  2OTG B;  2WC6 A;  3N7H A;  2WOS A;  4F7F A;  2LP3 A;  1OSA A;  2K0J A;  2KGB C;  2K61 A;  2WCM A;  3DF0 A;  3QME A;  5CPV A;  1EH2 A;  1UHJ A;  1W7J B;  2O60 A;  1CTR A;  2ZNE A;  3BUX B;  1DJW A;  5K89 A;  4A4B A;  1YUU A;  1Z4H A;  3BOW A;  3EKJ A;  1W9Z A;  3B86 A;  1KQM B;  1ZUZ A;  2HQ8 A;  2KQY A;  1NX2 A;  2KOT A;  1J7R A;  2LNK A;  3BUO B;  1NCY A;  1SCM C;  1EG3 A;  2KFG A;  4ICB A;  2BCA A;  3S0A A;  1DJI A;  1XFU O;  1QIW A;  2DOQ A;  1CLB A;  2K2A A;  1Y0V H;  2Y1N A;  2KNE A;  1K9K A;  2M49 B;  4MSP A;  3B88 A;  1FI5 A;  2Q4U A;  2LV7 A;  3EK7 A;  4N1F A;  3CS1 A;  3DVK A;  3CZT X;  3CZ0 A;  1D1O A;  1ALV A;  1UHK A;  4E68 A;  1CB1 A;  1OMV A;  4XYN A;  5D69 A;  1NCZ A;  1SNL A;  3IQQ A;  1CLL A;  3BUN B;  1OMR A;  4HRG A;  2EC6 C;  1QXP A;  1RJV A;  2JT8 A;  1PUL A;  3BYA A;  1A2X A;  1OW4 A;  4PHM A;  2JUL A;  2JPT A;  1J1E A;  1AK8 A;  4DIR A;  2FJY A;  4NDB A;  1L2O B;  5FI6 A;  2BCX A;  2PSR A;  3D73 A;  1DGU A;  1ORG A;  1PVB A;  3C1V A; 
#chains in the Genus database with same CATH homology
 1K90 D;  2I94 A;  1CLM A;  3RM1 A;  4OR9 B;  4P5O E;  5DKQ A;  3HX4 A;  4YGD B;  3BUM B;  4AQJ A;  1SR6 B;  1B7T Y;  2WCE A;  1NPQ A;  1MHO A;  1TN4 A;  1G33 A;  3DF0 B;  1OZS A;  2LM5 A;  3SG6 A;  1K8U A;  4YI8 A;  3JTD B;  4XJK A;  1CM4 A;  2BBN A;  3RLZ A;  1CDM A;  3BOW B;  1MWN A;  2CXJ A;  3GK1 A;  2QPT A;  1ZFS A;  1H8B A;  1CKK A;  1FBV A;  2M7L A;  1CDN A;  1B8R A;  1EJ3 A;  2WOR A;  3EK8 A;  4CLN A;  2LMV A;  1YVH A;  3SG2 A;  5I8N A;  5HKY A;  2OS8 C;  1WDC C;  4DUQ A;  5GQQ C;  3VRQ A;  1BR1 B;  1DJY A;  5PAL A;  1DJH A;  1UP5 A;  1XK4 C;  5TNC A;  2ZN9 A;  2JC2 A;  3CR5 X;  4F0Z B;  1TRF A;  3PAL A;  4PE0 A;  1B7T Z;  1DTL A;  1TNW A;  2BKH B;  1KCY A;  2Y5I A;  4YGC B;  4R1E A;  2LHI A;  1CMF A;  2KAV A;  4NQG A;  1F4O A;  2HET A;  3TUY C;  3KHE A;  4PDZ A;  3AAJ A;  3O4Y A;  1L7Z A;  1TNQ A;  1RTP 1;  5HLV A;  2F8P A;  1MR8 A;  1V1F A;  1NSH A;  3NSK A;  3SG3 A;  2F2O A;  3PM8 A;  1UWO A;  2JT3 A;  3EVU A;  1KWO B;  1RWY A;  1YUS A;  2Y1M A;  3VRP A;  2G2B A;  2NCP A;  3I5I B;  1IH0 A;  1KSO A;  3TDU A;  2CTN A;  4ORC B;  1SL9 A;  2JZI A;  4DRW A;  1TOP A;  2L4I A;  4MEW A;  5F6T A;  5B8I B;  5HYD A;  5J3X A;  3BQ3 A;  5CSJ A;  3O2P A;  3TS5 B;  1DJZ A;  2L5X B;  2CCM A;  3VGO A;  1LVC D;  1YVL A;  2BKI B;  1NWD A;  1NX1 A;  1C7W A;  2JNX A;  1DJG A;  2I2R E;  1YUR A;  2P6B B;  1Q80 A;  1BOD A;  1SKT A;  1DMO A;  1R2U A;  1GGW A;  1KK8 B;  2NZ0 A;  3DVM A;  4PCW A;  1PAL A;  2KFF A;  1MF8 B;  2LVJ A;  3SG7 A;  2KAY A;  1UUR A;  2LHL A;  1BU3 A;  1M39 A;  2MLE C;  1AJ5 A;  4PHK A;  3AAK A;  4XJK B;  1SMG A;  1CM1 A;  1XA5 A;  2K2F A;  3F45 A;  1CFC A;  4N5X A;  2JQ6 A;  2AUC A;  4CPV A;  1BMO A;  2LP2 A;  3A4U B;  2BL0 B;  2GGZ A;  1ODB A;  3JVT C;  2JTT A;  1XVJ A;  1M46 A;  3ZNI A;  4QJ4 B;  4ORA B;  5I2Q A;  3PN7 C;  5AXI A;  2G9B A;  2L51 A;  2F3Z A;  4YGB B;  1XFZ O;  3PSR A;  1SYM A;  1CFD A;  4U8D A;  2PRU A;  3NSL A;  1QX2 A;  1RK9 A;  1OMD A;  1B47 A;  1CFP A;  1F71 A;  1TNP A;  3DVE A;  3LCP C;  3VRO A;  3TDZ A;  1OOJ A;  2M97 A;  1YX7 A;  2KSP A;  4M2O A;  2SAS A;  1LKJ A;  1ZAC A;  3SG4 A;  1CDP A;  1YTZ C;  1K94 A;  2L50 A;  1XK4 A;  1BR4 B;  1IRJ A;  2Y4Q A;  4ZCV A;  4AOM A;  4CID A;  5KSZ A;  3I5F C;  4ORB B;  5AFP A;  3CR2 A;  2JU0 A;  1S36 A;  1C7V A;  5DKR A;  2OPO A;  4I5J A;  4CFR A;  4IL1 A;  3CR4 X;  4WQ2 A;  1PSR A;  2FCD A;  1SW8 A;  3SG5 A;  3TZ1 A;  1JBA A;  4CFQ A;  3CTN A;  1JF2 A;  2FJU B;  2K7O A;  3I5G C;  1IJ5 A;  4Q04 A;  2KBM A;  3KPX A;  1A03 A;  2I18 A;  1PSB A;  2EC6 B;  3AKA A;  5JOL A;  1F54 A;  2B1U A;  1AJ4 A;  1NX0 A;  1WRK A;  3OP0 A;  5HLO A;  2KFH A;  1J1D A;  3O78 A;  3H4S E;  5AAN A;  1AHR A;  3IQO A;  2PMY A;  4PAL A;  2KYC A;  3GK2 A;  4M2P A;  1C07 A;  3SIB A;  5KTY A;  2PVB A;  3FWB A;  2K7C A;  2F33 A;  1QX5 B;  2LMT A;  4HSZ A;  3I5H C;  2HPS A;  1NP8 A;  4MVF A;  1K95 A;  2ZRS A;  4WRI A;  1JF0 A;  2HF5 A;  2H61 A;  1W7I B;  2K7D A;  2F3Y A;  2NCO A;  1SK6 D;  4OV2 A;  2PAL A;  2JRF A;  4MRX A;  1IQ3 A;  1QS7 A;  1M45 A;  2WCF A;  2KI6 D;  1NYA A;  4MLW A;  3NSI A;  1QLS A;  1BLQ A;  1Y1A A;  2KYF A;  5JJG A;  1SY9 A;  2L4H A;  2LVK A;  1PRW A;  1V1G A;  2L98 A;  2LCP A;  3M0W A;  1RRO A;  1SBJ A;  4C0J A;  1EL4 A;  2OS8 B;  1WDC B;  3MSE B;  2ZND A;  2IS9 A;  2LAP A;  2COL B;  3VRN A;  2MAZ A;  2Q91 A;  2QAC A;  3D0Y A;  5I2O A;  3FIA A;  1A75 A;  2K8M B;  2WND A;  2E6W A;  5G08 A;  5I2L A;  1U5I A;  1F70 A;  5CSN A;  1XO5 A;  4GUK A;  3TUY B;  1QIV A;  2LVI A;  2MLF C;  1KQV A;  1XFV O;  2R2I A;  4I5L B;  4MZL A;  1DVI A;  1FPW A;  1B1G A;  1K2H A;  3OHM B;  3EK4 A;  2HQW A;  1GJY A;  3HCM A;  2JOJ A;  4HRE E;  4TNC A;  4C0L A;  2BEC A;  3SJS A;  1F55 A;  2LE9 B;  1QV1 A;  4NDD A;  4PHN A;  2KI4 C;  1Y1U A;  4ZCU A;  1EXR A;  1K93 D;  1OE9 B;  4WQ3 A;  2H61 C;  1EG4 A;  2FOT A;  3BUW B;  5FYX A;  2ISD A;  3OX6 A;  4GGF C;  1SCV A;  2BE6 A;  3PFV A;  1XYD A;  1JC2 A;  1FI6 A;  1DF0 A;  1KSM A;  1PK0 D;  1ZOT B;  3ICB A;  1QVI Z;  2OTG C;  2SCP A;  1KFX L;  2F2P A;  2JTZ A;  2KDH A;  1DJX A;  1VRK A;  4QJ5 B;  2CNP A;  2E30 A;  1XFW O;  2JNF A;  1S1E A;  3D10 A;  2LC5 A;  3O6B A;  4GFT A;  1QAS A;  2EHB A;  4M2Q A;  1AUI B;  1JFJ A;  3LL8 B;  3SIA A;  1M31 A;  1KFU L;  2LMU A;  1BJF A;  1IGV A;  1KQM C;  1SRA A;  1XFY O;  2MBX A;  1QX7 A;  1S6J A;  1UHN A;  3DD4 A;  1X02 A;  3LK0 A;  1MXL C;  2CBL A;  1CFF A;  4YGA A;  2M8U A;  3BXK A;  4ETO A;  1JSA A;  3JVT B;  1B9A A;  3WXA A;  1A29 A;  2KGR A;  1JFK A;  2I7A A;  1SCM B;  5KU1 A;  3CWG A;  3FS7 A;  4DS7 A;  1N0Y A;  3OB2 B;  3PN7 B;  4N1G A;  3D0Y B;  1B8L A;  1FF1 A;  2NXQ A;  1A75 B;  2M3W A;  2VRG A;  5HKZ A;  1PVA A;  2BCB A;  5HKW A;  1NX3 A;  1BF5 A;  3PLF B;  1U5I B;  1WLZ A;  3PAT A;  1M63 B;  1MXE A;  5CSI A;  5DKN A;  2O5G A;  1K96 A;  4PE4 A;  1TCO B;  1CMG A;  1YUT A;  1S6C A;  1TNX A;  1Y1X A;  2D8N A;  2WC8 A;  4BY5 A;  2JXL A;  4GGN A;  1CNP A;  3I5F B;  1N65 A;  1B8C A;  4GBA A;  2CT9 A;  1S6I A;  2K7B A;  2TN4 A;  3WHU B;  1L2O C;  2AAO A;  1QTX A;  1WLM A;  4QJ3 B;  1CDL A;  1E8A A;  4PE7 A;  5ER4 X;  2PAS A;  2NLN A;  2EGD A;  4I5K A;  2KHN A;  1SPY A;  1J7Q A;  1H4B A;  3I5G B;  3WHT B;  4PHJ A;  1WY9 A;  2BE4 A;  1DF0 B;  5IBW A;  1K9P A;  1QV0 A;  1KK7 Y;  1SR6 C;  1UUS A;  3CLN A;  1KFX S;  1LIN A;  3GK4 X;  3LK1 A;  1TCF A;  1Y6W A;  1TTX A;  2RGI A;  1YX8 A;  3KF9 A;  1YR5 A;  2KQ6 A;  5BPJ A;  4FQO A;  3JTD C;  4P2Y B;  1OQP A;  2JWW A;  1UHH A;  2M9G A;  2MJW B;  4USL A;  1QLK A;  2V53 A;  1KFU S;  1OZO A;  4GGF A;  3LLE A;  4PE1 A;  4C0K A;  1BG1 A;  4YI9 A;  1MUX A;  1JWD A;  1TIZ A;  3QRX A;  1DT7 B;  1HQV A;  3FWC A;  1REC A;  1YRT B;  1RFJ A;  3VRR A;  2AMI A;  2M1U A;  1F8H A;  1QAT A;  3EVV A;  1IWQ A;  2GGM A;  3I5H B;  1IKU A;  1YRU B;  2WCB A;  2KAX A;  1KK7 Z;  1ALW A;  1IJ6 A;  1A4P A;  3NXA A;  2ZRT A;  2L2E A;  3AKB A;  5AER A;  2A4J A;  5D7F A;  4YGE B;  2JT0 A;  1F4Q A;  5AEQ A;  4I5N B;  1J7P A;  1IG5 A;  3A8R A;  1B4C A;  1BT6 A;  4JPZ B;  2LLT A;  1G4Y R;  2M1K B;  2ZFD A;  4NDC A;  1S3P A;  3EKH A;  3OX5 A;  4MZK A;  3ZWH A;  4MRY A;  4OKH A;  1WRL A;  1KWO C;  1BOC A;  1QVI Y;  3I5I C;  1NCX A;  1XFX O;  4FTG A;  2KI6 C;  2JXC A;  3EVR A;  4AQI A;  1LA0 A;  4UPG A;  1SL8 A;  2LAN A;  2KBI A;  4YBH B;  4JWQ A;  4A4C A;  1S5G Y;  1FW4 A;  3WNX B;  1ZMZ A;  2GV5 A;  4HRH A;  1NUB A;  2LLS A;  1J55 A;  1AVS A;  4OVN F;  3TS5 C;  3GOF A;  4JQ0 D;  4GPL B;  5CSF A;  1DGV A;  2ZKM X;  3OB1 B;  1N2D A;  4MN0 A;  1G8I A;  1AP4 A;  1HT9 A;  1UHI A;  2LUC A;  4L9M A;  1NIW A;  1K9U A;  2LUX A;  1LA3 A;  4GAO A;  1GGZ A;  1MQ1 A;  3E3R A;  3K21 A;  4D1E A;  1KK8 C;  2LLU A;  3TDI A;  2ZN8 A;  2M0R A;  3CGA A;  2M7N A;  1SL7 A;  2FCE A;  4MZJ A;  1GQM A;  1JUO A;  2M29 A;  1IQ5 A;  4MBE A;  2KI4 B;  4GNK B;  2BBM A;  3KO0 A;  3DVJ A;  2MA2 A;  5ER5 A;  1R6P A;  1QJT A;  4DCK A;  3NSO A;  2L0P A;  2MHH A;  4OCI A;  1S5G Z;  2MRD A;  1WRZ A;  3KEV A;  1J7O A;  1S26 D;  2BL0 C;  2H2K A;  3IF7 A;  1LXF C;  4YRU A;  4BY4 A;  2LVV A;  2OTG B;  2WOS A;  2LP3 A;  1OSA A;  2K0J A;  2KGB C;  2K61 A;  3DF0 A;  5CPV A;  1EH2 A;  1UHJ A;  1W7J B;  2O60 A;  1CTR A;  2ZNE A;  3BUX B;  1DJW A;  5K89 A;  4A4B A;  1YUU A;  3BOW A;  3EKJ A;  1KQM B;  1ZUZ A;  2HQ8 A;  2KQY A;  1NX2 A;  2KOT A;  1J7R A;  2LNK A;  3BUO B;  1NCY A;  1SCM C;  1EG3 A;  2KFG A;  4ICB A;  2BCA A;  1DJI A;  1XFU O;  1QIW A;  2DOQ A;  1CLB A;  2K2A A;  1Y0V H;  2Y1N A;  2KNE A;  1K9K A;  2M49 B;  4MSP A;  1FI5 A;  2Q4U A;  2LV7 A;  3EK7 A;  4N1F A;  3CS1 A;  3DVK A;  3CZT X;  1D1O A;  1ALV A;  1UHK A;  4E68 A;  1CB1 A;  1OMV A;  4XYN A;  5D69 A;  1NCZ A;  1SNL A;  3IQQ A;  1CLL A;  3BUN B;  1OMR A;  4HRG A;  2EC6 C;  1QXP A;  1RJV A;  2JT8 A;  1PUL A;  3BYA A;  1A2X A;  4PHM A;  2JUL A;  2JPT A;  1J1E A;  1AK8 A;  4DIR A;  4NDB A;  1L2O B;  2BCX A;  2PSR A;  1DGU A;  1PVB A;  3C1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...