2CTNA

Structure of calcium-saturated cardiac troponin c, nmr, 30 structures
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
88
structure length
88
Chain Sequence
ADIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSMKDDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TROPONIN C
publication title Structure of cardiac muscle troponin C unexpectedly reveals a closed regulatory domain.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Calcium-binding protein
total genus 19
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 1997-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2ctnA00
3D0YB 1OZSA 5FYXA 3O4YA 2LE9B 1J7QA 3FWBA 3NSLA 3RLZA 2LMUA 1F4QA 3VRRA 1AP4A 1KWOB 3BUWB 1CFFA 1NX2A 2KBMA 3BUMB 5K89A 1XA5A 2FOTA 5JJGA 1RROA 1NWDA 3BQ3A 4OV2A 2KAVA 1ALVA 1LVCD 2JU0A 2ZN9A 2JTZA 1CMGA 5CSJA 1KQMC 1SNLA 2OPOA 1DJIA 4MZLA 1JSAA 1SW8A 2K0JA 1PK0D 3CS1A 1TNPA 5I8NA 2K8MB 3JTDB 3HCMA 1EH2A 2Q91A 5AERA 3DVEA 1OMDA 1BR4B 3CLNA 4GNKB 1A29A 1S6IA 4DCKA 4CPVA 1JF2A 1L2OB 2KAYA 4QJ3B 3ZNIA 1YTZC 1MXEA 1XFVO 4P2YB 2GGMA 1DJHA 1K9KA 5AEQA 2KI6C 3CZTX 5DKQA 1S5GZ 2KBIA 5KTYA 1B7TY 1KSOA 2KOTA 1GJYA 1FI6A 1WLZA 1SBJA 1N65A 2LCPA 1B1GA 2TN4A 5GQQC 1GGZA 1DJWA 2Y1NA 4ORCB 1XO5A 1WRKA 2P6BB 5HKYA 1UURA 1LA0A 1MQ1A 1CM1A 4NQGA 4GUKA 1M45A 3CTNA 2JT0A 4FTGA 2AUCA 1FPWA 3SJSA 3KHEA 3JVTB 1G4YR 1S26D 3WHTB 1IWQA 4GPLB 1J7OA 3BXKA 1SRAA 1CDMA 1R6PA 2F2PA 1TNXA 3VGOA 3CR4X 3IQQA 1PVAA 2M7LA 1NX3A 2GV5A 1NX0A 1SYMA 3EVUA 1CFCA 2KQ6A 2MRDA 1CKKA 3OX6A 3E3RA 2WCFA 3KO0A 1FI5A 2O60A 5HLVA 2I94A 2WCEA 2H61C 2O5GA 1WY9A 2CXJA 1PRWA 1OOJA 1J7RA 1K9PA 1BMOA 1K95A 4OKHA 1CDLA 4MEWA 3BUXB 2M9GA 4GAOA 1B7TZ 2SCPA 3I5IC 2Q4UA 1F4OA 1B4CA 2LC5A 1A03A 1EG3A 1K9UA 3RM1A 1TTXA 1NUBA 1XFWO 2H61A 3DF0B 3IF7A 1AVSA 2E30A 1J1EA 4AQJA 1DF0B 2WOSA 5D7FA 1LINA 1MR8A 1FW4A 2M29A 4YBHB 1DJXA 5J3XA 5ER4X 2LAPA 4I5JA 2JULA 2LUCA 1CMFA 1WRLA 2LLUA 2LVVA 1MXLC 1QIWA 2JRFA 1CDNA 5HYDA 1UHHA 1TRFA 5KU1A 2RGIA 1MUXA 2JQ6A 1JFKA 1K90D 1M39A 4Q04A 4M2QA 1Q80A 2D8NA 2LLSA 3I5GB 4L9MA 1BLQA 5CSIA 2KQYA 3KPXA 1EG4A 2LMTA 1B8LA 2BCAA 2LP3A 2KYFA 1B9AA 2CNPA 2JXCA 2OS8B 3CWGA 3LLEA 1D1OA 2KI4B 4MBEA 1S3PA 2ZRTA 4N1FA 4PHMA 3EKHA 1IH0A 1ZOTB 3PATA 1BF5A 3NSKA 1WDCB 2LMVA 3I5HB 1SR6C 2HETA 2JXLA 4NDBA 3WHUB 1DJGA 3TUYC 1QASA 4YGAA 2BECA 1NYAA 4ETOA 1C7VA 2FCDA 4USLA 2JOJA 2EGDA 2M3WA 1BOCA 1CB1A 1JWDA 5CSFA 1Y0VH 3DVJA 1K8UA 4OVNF 1RTP1 1QTXA 2M1KB 1SCMB 1TNQA 1A2XA 3ICBA 3H4SE 4XJKA 1NSHA 2LLTA 3O6BA 2BCBA 2BKHB 4JQ0D 1M31A 1YRTB 1OMVA 2LP2A 3LL8B 2LVJA 1ZMZA 2L51A 4MN0A 3PSRA 3VRQA 2L4IA 2BL0C 3PN7B 2L50A 1SL7A 5DKNA 4E68A 4DIRA 1SPYA 1YUTA 1KK7Y 1F54A 1OZOA 1RECA 1VRKA 2BE6A 4YGBB 2EC6C 4JPZB 2I18A 1AJ4A 3CGAA 1K96A 2K2FA 3QRXA 5BPJA 1BU3A 3SIBA 3EK7A 1DVIA 1YVLA 4AOMA 1UUSA 1R2UA 1CLMA 1S36A 1W7JB 3SG3A 5HLOA 3OP0A 5B8IB 1NX1A 1ZUZA 2F8PA 4QJ5B 1NCZA 1QIVA 1ZACA 3A4UB 1QS7A 4R1EA 1KFXS 4WQ2A 2I7AA 3GK2A 1U5IA 1NPQA 2E6WA 1QX5B 2ZRSA 4OR9B 4MRXA 3GK1A 3TS5C 4DS7A 1A4PA 1KK8C 2G9BA 4NDDA 4YGDB 2Y1MA 1GQMA 3C1VA 1SMGA 1X02A 4PHNA 3EKJA 4A4BA 4YRUA 1HT9A 2BBMA 1QV0A 1TOPA 1IKUA 1Y1UA 2LHLA 2JT8A 4MZKA 4ZCUA 1F55A 1RFJA 4C0KA 1M63B 2LVKA 1ALWA 4YI9A 2KGRA 1J55A 2WNDA 1CM4A 3WNXB 4F0ZB 1QX7A 2KSPA 2KFGA 1PVBA 1AK8A 2F3YA 1QXPA 2MLEC 1KK7Z 3I5FC 1UHNA 3NXAA 3HX4A 1SCVA 1PULA 3M0WA 5AXIA 2OTGC 1AUIB 1N2DA 1CNPA 4D1EA 1BJFA 1CTRA 4C0JA 2NZ0A 3ZWHA 1KQMB 1UHIA 1QJTA 3EK8A 3F45A 3PALA 4PE7A 2H2KA 3GK4X 1F8HA 1JBAA 5I2QA 1LXFC 1KWOC 2BL0B 1IJ5A 1UP5A 1SKTA 1CFDA 2BE4A 4PHKA 3VRNA 2ZFDA 3BOWA 1Y1AA 4ORAB 2LNKA 1IJ6A 3OB2B 4ORBB 1ODBA 1U5IB 1YUUA 1JC2A 3D0YA 2K7DA 2PALA 1AJ5A 2MLFC 3GOFA 2F3ZA 5AANA 3K21A 5KSZA 3JTDC 2M0RA 2F33A 5I2LA 1KFXL 1YUSA 4DRWA 1YX7A 3AAKA 4WRIA 2JNXA 4N1GA 4CFQA 1L2OC 1SY9A 1L7ZA 3BYAA 5TNCA 2CT9A 3MSEB 5PALA 1LKJA 1YRUB 3NSIA 4GGNA 1B47A 1UWOA 3BUOB 4I5KA 2CCMA 2FCEA 1BODA 1XYDA 2PMYA 2QPTA 3SG7A 1XFYO 4A4CA 1XK4C 2KI6D 3AKAA 3PLFB 1XVJA 1B8CA 2HPSA 2L2EA 4PALA 2NXQA 3AKBA 1TIZA 2DOQA 1EL4A 3NSOA 2NLNA 3SG5A 1K93D 1H4BA 1JUOA 1SL8A 1KCYA 1Y1XA 2QACA 4BY5A 4CIDA 3JVTC 4HREE 5G08A 1DJYA 1QLSA 2PSRA 3DVKA 4U8DA 2ZN8A 2MBXA 1QV1A 1F71A 4AQIA 1M46A 2HQWA 1IQ3A 2SASA 5I2OA 2LV7A 3PFVA 2K7OA 2CBLA 2EHBA 1NP8A 4I5NB 2LM5A 1DJZA 5HKZA 1F70A 1S6JA 3O78A 2B1UA 2MHHA 2R2IA 2F2OA 4CLNA 4HSZA 1MWNA 4M2OA 1W7IB 1TNWA 1MHOA 4HRHA 3I5IB 1NIWA 2ZKMX 2LUXA 2MJWB 1QATA 1DTLA 4FQOA 4MLWA 4WQ3A 1K94A 1NCXA 1TCOB 2JZIA 2K61A 1XFXO 1IGVA 1SK6D 4XYNA 2KAXA 2BBNA 1IRJA 1KFUS 1V1FA 2KDHA 3SG2A 1DGUA 4CFRA 2JWWA 3OHMB 1Y6WA 4N5XA 1UHKA 1C07A 3DVMA 5JOLA 3EVRA 1CLLA 4TNCA 1C7WA 3SG4A 1TCFA 1TN4A 4QJ4B 1JF0A 3LK0A 2LANA 1IQ5A 2PRUA 2M1UA 1FBVA 3FIAA 1DGVA 3LK1A 4OCIA 4GBAA 1OMRA 3TZ1A 1IG5A 3OX5A 1OSAA 5ER5A 1J1DA 1XFZO 2BKIB 2CTNA 2M97A 1BR1B 3DF0A 3PM8A 3WXAA 3LCPC 1EXRA 4MZJA 2GGZA 4XJKB 4PE1A 1AHRA 1YR5A 1DT7B 2FJUB 1DF0A 1PALA 2Y5IA 1SR6B 3I5GC 1XFUO 2BCXA 1ZFSA 2WC8A 3KF9A 4IL1A 5F6TA 3TUYB 1QX2A 1G8IA 3A8RA 1BT6A 2JT3A 5D69A 1YURA 4GFTA 1A75A 2OS8C 2AMIA 4ICBA 3VRPA 2KI4C 2V53A 1CFPA 4YI8A 1GGWA 1YX8A 2M7NA 2JC2A 2ZNDA 1WDCC 3I5HC 4NDCA 3VROA 2HQ8A 2I2RE 2KGBC 2L0PA 2L5XB 2ZNEA 2K2AA 1S1EA 1BG1A 2L4HA 3BUNB 2EC6B 1G33A 3SG6A 2M49B 3OB1B 1QLKA 2JPTA 2WCBA 1QVIY 1SCMC 2KHNA 4JWQA 1PSRA 1KSMA 3D10A 3EK4A 2A4JA 4MRYA 4PE4A 2KNEA 2LHIA 2MA2A 3EVVA 4C0LA 2ISDA 2Y4QA 3PN7C 2AAOA 2VRGA 1KFUL 3DD4A 1PSBA 4M2PA 1RWYA 1WLMA 2NCPA 2G2BA 4YGCB 1E8AA 1CDPA 4P5OE 2KFHA 5CPVA 2JNFA 3O2PA 2MAZA 2JTTA 3CR5X 4PHJA 3AAJA 1N0YA 5HKWA 3SIAA 1JFJA 2WORA 4MVFA 1MF8B 3CR2A 2IS9A 3TDIA 3TS5B 1FF1A 4ZCVA 4DUQA 1KK8B 2L98A 3FS7A 1HQVA 1WRZA 1DMOA 2K7BA 4I5LB 2PASA 1A75B 1S6CA 2K7CA 4GGFC 1H8BA 2HF5A 3KEVA 1YVHA 1RK9A 2KFFA 3IQOA 5AFPA 1NCYA 4MSPA 4PDZA 4BY4A 1LA3A 1EJ3A 1V1GA 1KQVA 1OQPA 1S5GY 1B8RA 2NCOA 1UHJA 1XK4A 3FWCA 5IBWA 5CSNA 2COLB 4PE0A 2M8UA 1SL9A 1K2HA 4UPGA 3I5FB 5DKRA 4HRGA 1RJVA 4PCWA 1J7PA 4YGEB 1OE9B 4GGFA 2OTGB 3BOWB 2LVIA 1QVIZ 2KYCA 3TDUA 3TDZA 2PVBA 1CLBA
chains in the Genus database with same CATH superfamily
3NHIA 3D0YB 3D77A 1OZSA 5FYXA 3O4YA 2LE9B 1J7QA 3FWBA 3NSLA 3RLZA 2LMUA 1F4QA 3VRRA 2WCHA 1KWOB 3BUWB 1AP4A 1NX2A 1CFFA 2KBMA 3BUMB 5K89A 1XA5A 2FOTA 5JJGA 3PM2A 1RROA 1NWDA 1DC1A 3BQ3A 4OV2A 2KAVA 4PT1A 1ALVA 1LVCD 2JU0A 2ZN9A 2JTZA 1CMGA 5CSJA 1KQMC 1SNLA 2OPOA 1DJIA 3BFBA 4MZLA 1JSAA 1SW8A 3R72A 2K0JA 1PK0D 3CS1A 1TNPA 5I8NA 2K8MB 3JTDB 3HCMA 1EH2A 2FJYA 2Q91A 5AERA 3DVEA 3SS4A 1OMDA 1BR4B 3CLNA 4GNKB 1A29A 1S6IA 4DCKA 4CPVA 3B6XA 1JF2A 1L2OB 2KAYA 4QJ3B 3ZNIA 1YTZC 1MXEA 1XFVO 4P2YB 2GGMA 1DJHA 1K9KA 5AEQA 2KI6C 3CZTX 5DKQA 1S5GZ 2KBIA 5KTYA 1B7TY 1KSOA 1ORGA 2KOTA 1GJYA 3CABA 1FI6A 1WLZA 1SBJA 1N65A 2LCPA 3OBVA 1B1GA 4F7FA 2TN4A 5GQQC 1GGZA 3FE9A 1DJWA 2Y1NA 4ORCB 1XO5A 1WRKA 2P6BB 5HKYA 1UURA 1LA0A 2ERBA 1MQ1A 1CM1A 4NQGA 4GUKA 1M45A 3CTNA 2JT0A 4FTGA 2AUCA 1FPWA 3SJSA 3CZ2A 3JVTB 3KHEA 1G4YR 1S26D 1GM0A 3WHTB 1IWQA 3L4AA 3NGVA 4GPLB 1J7OA 3BXKA 1SRAA 1CDMA 1R6PA 2F2PA 2JPOA 1TNXA 3VGOA 3CR4X 3IQQA 1PVAA 2M7LA 1NX3A 2GV5A 1NX0A 1SYMA 3EVUA 1CFCA 2KQ6A 2MRDA 1CKKA 3OX6A 3E3RA 2WCFA 3KO0A 1FI5A 2O60A 1DELA 5HLVA 2I94A 2WCEA 2H61C 2O5GA 1WY9A 4INWA 2CXJA 1PRWA 1OOJA 1J7RA 1K9PA 5D3OA 1BMOA 3S0DA 3PJIA 1K95A 4OKHA 1CDLA 4MEWA 3BUXB 1Z2CB 2M9GA 3R1PA 4GAOA 3Q8IA 3SS5A 1B7TZ 2SCPA 3I5IC 2Q4UA 1F4OA 1B4CA 2LC5A 1A03A 1EG3A 1K9UA 3RM1A 1TTXA 1NUBA 1XFWO 2H61A 3DF0B 3IF7A 2YGUA 1P28A 1AVSA 2E30A 1J1EA 4AQJA 1DEKA 1DF0B 2WOSA 5D7FA 1LINA 1MR8A 1FW4A 2M29A 4YBHB 1DJXA 5J3XA 5ER4X 2LAPA 4I5JA 2JULA 2LUCA 1CMFA 1WRLA 2LLUA 2LVVA 1OOHA 1MXLC 1QIWA 2JRFA 1CDNA 5HYDA 1UHHA 1TRFA 5KU1A 2RGIA 1MUXA 2JQ6A 1JFKA 1K90D 1M39A 4Q04A 4M2QA 1Q80A 2D8NA 2LLSA 3I5GB 4L9MA 2P71A 3DZTA 1BLQA 5CSIA 2KQYA 3KPXA 1EG4A 2LMTA 2GTEA 1B8LA 2BCAA 2LP3A 2KYFA 1B9AA 2CNPA 2JXCA 2OS8B 3CWGA 2QEOA 3LLEA 1D1OA 2KI4B 4MBEA 1S3PA 2ZRTA 4N1FA 4PHMA 3EKHA 1IH0A 4OZDA 1ZOTB 3PATA 1BF5A 3NSKA 1WDCB 2LMVA 3I5HB 1SR6C 2HETA 2JXLA 4NDBA 3WHUB 1DJGA 3TUYC 1QASA 4YGAA 5DICA 2BECA 1NYAA 4ETOA 1C7VA 3S0FA 2FCDA 4USLA 2JOJA 2EGDA 2M3WA 1BOCA 1CB1A 1JWDA 5CSFA 1Y0VH 3DVJA 1K8UA 4OVNF 1RTP1 1QTXA 2M1KB 1SCMB 1TNQA 1A2XA 3ICBA 3H4SE 4XJKA 1NSHA 2LLTA 3O6BA 2BCBA 2BKHB 4JQ0D 1M31A 1YRTB 3BJHA 3S0EA 1OMVA 2LP2A 5FI6A 3LL8B 2LVJA 1ZMZA 2L51A 4MN0A 3PSRA 4IJ7A 3VRQA 2L4IA 2BL0C 3PN7B 2L50A 1SL7A 5DKNA 4E68A 3DYEA 1SPYA 1YUTA 4DIRA 1KK7Y 1F54A 1OZOA 3EG5B 1RECA 1VRKA 2BE6A 2K60A 2EC6C 4YGBB 4JPZB 2WCLA 2I18A 1AJ4A 3CGAA 1K96A 2K2FA 3QRXA 5BPJA 1BU3A 3S0GA 3SIBA 3EK7A 1DVIA 1YVLA 4AOMA 1UUSA 1R2UA 1CLMA 1S36A 1W7JB 3SG3A 5HLOA 1LS8A 1OOIX 3OP0A 5B8IB 3B7AA 1NX1A 1ZUZA 2F8PA 4QJ5B 2KPHA 1NCZA 1QIVA 1ZACA 3A4UB 1QS7A 4R1EA 1KFXS 4WQ2A 2I7AA 3B87A 3GK2A 1U5IA 1NPQA 2E6WA 1QX5B 2ZRSA 4OR9B 4MRXA 3GK1A 3K1EA 3TS5C 4DS7A 1A4PA 1KK8C 3BFHA 3D73A 2G9BA 4NDDA 4YGDB 1TWOA 2Y1MA 1GQMA 3C1VA 1SMGA 1TUJA 1X02A 4PHNA 3EKJA 4A4BA 4YRUA 1HT9A 2BBMA 1QV0A 1TOPA 1IKUA 1Y1UA 2LHLA 2JT8A 4MZKA 4ZCUA 1F55A 1RFJA 1OOFA 4C0KA 1M63B 2LVKA 1ALWA 4YI9A 2KGRA 1J55A 2WNDA 1CM4A 3WNXB 4F0ZB 1QX7A 2KSPA 2KFGA 1PVBA 1AK8A 2F3YA 1QXPA 2MLEC 1KK7Z 3I5FC 1UHNA 3NXAA 3HX4A 1SCVA 1PULA 3M0WA 3CDNA 5AXIA 2OTGC 1AUIB 1N2DA 1CNPA 4D1EA 1BJFA 1CTRA 4C0JA 2NZ0A 3ZWHA 1KQMB 1UHIA 1QJTA 1W9ZA 3EK8A 3F45A 3PALA 4PE7A 2H2KA 3GK4X 1F8HA 1JBAA 5I2QA 1LXFC 1KWOC 2BL0B 1IJ5A 3FE6A 1UP5A 1SKTA 1CFDA 2BE4A 4PHKA 3VRNA 1Z4HA 2ZFDA 3BOWA 1Y1AA 4ORAB 2LNKA 1OW4A 1IJ6A 2L5YA 3OB2B 1T14A 1ODBA 4ORBB 1U5IB 1YUUA 1JC2A 3D0YA 2K7DA 2PALA 1AJ5A 2MLFC 3GOFA 2F3ZA 5AANA 3K21A 5KSZA 3JTDC 2M0RA 2F33A 5I2LA 5FI7A 3B88A 1KFXL 1YUSA 4DRWA 1YX7A 3AAKA 4WRIA 2JNXA 2PQLA 3N7HA 4N1GA 4CFQA 1L2OC 1SY9A 1L7ZA 1OOGA 3BYAA 5TNCA 2CT9A 3MSEB 5PALA 1LKJA 1YRUB 3NSIA 4GGNA 1B47A 1UWOA 3BUOB 4I5KA 2CCMA 2FCEA 1BODA 1XYDA 2PMYA 2QPTA 3SG7A 1XFYO 4A4CA 3S0AA 1XK4C 4INXA 2KI6D 3AKAA 3PLFB 1XVJA 5EL2A 1B8CA 2HPSA 2L2EA 4PALA 3QMEA 2NXQA 3AKBA 1TIZA 2DOQA 1EL4A 3NSOA 2NLNA 3SG5A 1K93D 1H4BA 1JUOA 1SL8A 1KCYA 1Y1XA 2QACA 4FQTA 4BY5A 3DXLA 4CIDA 3JVTC 4HREE 5G08A 2QEHA 1DJYA 1QLSA 2PSRA 3DVKA 3IVTA 4U8DA 2ZN8A 2MBXA 1QV1A 1TUZA 1XFRA 4AQIA 1M46A 2HQWA 1F71A 1IQ3A 2SASA 5I2OA 2LV7A 3D74A 3PFVA 2K7OA 2CBLA 2EHBA 1NP8A 4I5NB 2LM5A 1DJZA 5HKZA 1F70A 1S6JA 3O78A 2B1UA 2MHHA 1C3YA 2R2IA 3CYZA 2F2OA 4CLNA 4HSZA 1MWNA 4M2OA 1W7IB 1TNWA 1MHOA 4HRHA 3I5IB 1NIWA 2ZKMX 2LUXA 2MJWB 3BFAA 1QATA 1DTLA 4FQOA 3O4XA 4MLWA 2BNXA 4WQ3A 1K94A 1NCXA 3UNWA 3SS3A 1IIOA 1TCOB 2JZIA 2K61A 3CZ1A 2L2CA 1XFXO 1IGVA 5I94A 1SK6D 4XYNA 2KAXA 2BBNA 3CZ0A 1IRJA 1KFUS 1V1FA 2KDHA 3SG2A 1DGUA 3UO9A 4CFRA 2JWWA 2P70A 3OHMB 1Y6WA 4N5XA 1SSEB 4JKTA 1UHKA 1C07A 3RZSA 3DVMA 5JOLA 3EVRA 1CLLA 2WCJA 4TNCA 1C7WA 3SG4A 1TCFA 1TN4A 4QJ4B 1JF0A 3LK0A 2LANA 3FE8A 1IQ5A 2PRUA 2M1UA 3R1VA 1FBVA 3FIAA 3B86A 1DGVA 3LK1A 4OCIA 4GBAA 1OMRA 3L4LA 3TZ1A 1IG5A 3OX5A 1OSAA 5ER5A 1J1DA 1XFZO 2BKIB 2CTNA 2M97A 1BR1B 3DF0A 3PM8A 3WXAA 3LCPC 1EXRA 1QWVA 2GGZA 4MZJA 4XJKB 3V2LA 4PE1A 1AHRA 1YR5A 1DT7B 3R1OA 2FJUB 1DF0A 3D75A 1PALA 2Y5IA 1SR6B 3I5GC 1XFUO 2BCXA 1ZFSA 2WC8A 3KF9A 4IL1A 5F6TA 3TUYB 1QX2A 1G8IA 3S0BA 3L47A 3A8RA 1BT6A 4KYNA 2JT3A 5D69A 2QEBA 1YURA 4GFTA 1A75A 2BAPA 2OS8C 2AMIA 4ICBA 1DQEA 3VRPA 2KI4C 2V53A 1CFPA 4YI8A 1GGWA 1YX8A 2M7NA 2JC2A 2ZNDA 1WDCC 3I5HC 2KLEA 2QDIA 2WCMA 4NDCA 3DY9A 3VROA 2HQ8A 2I2RE 2KGBC 2L0PA 2L5XB 2ZNEA 3D76A 2K2AA 1S1EA 1BG1A 2L4HA 3BUNB 2EC6B 1G33A 3SG6A 2M49B 3OB1B 1QLKA 2JPTA 2WCBA 1QVIY 1SCMC 2KHNA 4JWQA 1PSRA 1KSMA 3D10A 3EK4A 2A4JA 4MRYA 3OGNA 4PE4A 2KNEA 2LHIA 4JD9A 2MA2A 3EVVA 4C0LA 2ISDA 2Y4QA 3PN7C 2AAOA 3NHTA 2VRGA 1KFUL 3DD4A 1PSBA 4M2PA 1RWYA 1WLMA 2KLDA 2G2BA 2NCPA 4YGCB 1E8AA 1CDPA 4P5OE 2KFHA 5CPVA 2JNFA 3O2PA 2MAZA 2JTTA 3CR5X 4PHJA 3D78A 3AAJA 1N0YA 5HKWA 3SIAA 1JFJA 2WORA 4MVFA 1MF8B 3CR2A 2IS9A 3TDIA 3TS5B 1FF1A 4ZCVA 4DUQA 1KK8B 2L98A 3FS7A 1HQVA 1WRZA 1DMOA 2K7BA 4I5LB 2PASA 2H8VA 1A75B 1S6CA 2K7CA 4GGFC 1H8BA 2HF5A 3KEVA 1C3ZA 1YVHA 1RK9A 2KFFA 3IQOA 5AFPA 1NCYA 5FI2A 4MSPA 4PDZA 4BY4A 1LA3A 3VB1A 1EJ3A 1V1GA 1KQVA 1OQPA 1S5GY 2WC6A 2PYQA 1B8RA 2NCOA 1UHJA 1XK4A 3FWCA 5IBWA 5CSNA 2COLB 4PE0A 2M8UA 1SL9A 2WC5A 1K2HA 4UPGA 3I5FB 2QEVA 5DKRA 4HRGA 1RJVA 2WCKA 4PCWA 4YGEB 1J7PA 1OE9B 4GGFA 2OTGB 3BOWB 2LVIA 5HL1A 1QVIZ 2KYCA 3TDUA 3TDZA 2PVBA 1CLBA
chains in the Genus database with same CATH topology
3D0YB 1OZSA 5FYXA 3O4YA 2LE9B 1J7QA 3FWBA 3NSLA 3RLZA 2LMUA 1F4QA 3VRRA 1AP4A 1KWOB 3BUWB 1CFFA 1NX2A 2KBMA 3BUMB 5K89A 1XA5A 2FOTA 5JJGA 1RROA 1NWDA 3BQ3A 4OV2A 2KAVA 1ALVA 1LVCD 2JU0A 2ZN9A 2JTZA 1CMGA 5CSJA 1KQMC 1SNLA 2OPOA 1DJIA 4MZLA 1JSAA 1SW8A 2K0JA 1PK0D 3CS1A 1TNPA 5I8NA 2K8MB 3JTDB 3HCMA 1EH2A 2Q91A 5AERA 3DVEA 1OMDA 1BR4B 3CLNA 4GNKB 1A29A 1S6IA 4DCKA 4CPVA 1JF2A 1L2OB 2KAYA 4QJ3B 3ZNIA 1YTZC 1MXEA 1XFVO 4P2YB 2GGMA 1DJHA 1K9KA 5AEQA 2KI6C 3CZTX 5DKQA 1S5GZ 2KBIA 5KTYA 1B7TY 1KSOA 2KOTA 1GJYA 1FI6A 1WLZA 1SBJA 1N65A 2LCPA 1B1GA 2TN4A 5GQQC 1GGZA 1DJWA 2Y1NA 4ORCB 1XO5A 1WRKA 2P6BB 5HKYA 1UURA 1LA0A 1MQ1A 1CM1A 4NQGA 4GUKA 1M45A 3CTNA 2JT0A 4FTGA 2AUCA 1FPWA 3SJSA 3KHEA 3JVTB 1G4YR 1S26D 3WHTB 1IWQA 4GPLB 1J7OA 3BXKA 1SRAA 1CDMA 1R6PA 2F2PA 1TNXA 3VGOA 3CR4X 3IQQA 1PVAA 2M7LA 1NX3A 2GV5A 1NX0A 1SYMA 3EVUA 1CFCA 2KQ6A 2MRDA 1CKKA 3OX6A 3E3RA 2WCFA 3KO0A 1FI5A 2O60A 5HLVA 2I94A 2WCEA 2H61C 2O5GA 1WY9A 2CXJA 1PRWA 1OOJA 1J7RA 1K9PA 1BMOA 1K95A 4OKHA 1CDLA 4MEWA 3BUXB 2M9GA 4GAOA 1B7TZ 2SCPA 3I5IC 2Q4UA 1F4OA 1B4CA 2LC5A 1A03A 1EG3A 1K9UA 3RM1A 1TTXA 1NUBA 1XFWO 2H61A 3DF0B 3IF7A 1AVSA 2E30A 1J1EA 4AQJA 1DF0B 2WOSA 5D7FA 1LINA 1MR8A 1FW4A 2M29A 4YBHB 1DJXA 5J3XA 5ER4X 2LAPA 4I5JA 2JULA 2LUCA 1CMFA 1WRLA 2LLUA 2LVVA 1MXLC 1QIWA 2JRFA 1CDNA 5HYDA 1UHHA 1TRFA 5KU1A 2RGIA 1MUXA 2JQ6A 1JFKA 1K90D 1M39A 4Q04A 4M2QA 1Q80A 2D8NA 2LLSA 3I5GB 4L9MA 1BLQA 5CSIA 2KQYA 3KPXA 1EG4A 2LMTA 1B8LA 2BCAA 2LP3A 2KYFA 1B9AA 2CNPA 2JXCA 2OS8B 3CWGA 3LLEA 1D1OA 2KI4B 4MBEA 1S3PA 2ZRTA 4N1FA 4PHMA 3EKHA 1IH0A 1ZOTB 3PATA 1BF5A 3NSKA 1WDCB 2LMVA 3I5HB 1SR6C 2HETA 2JXLA 4NDBA 3WHUB 1DJGA 3TUYC 1QASA 4YGAA 2BECA 1NYAA 4ETOA 1C7VA 2FCDA 4USLA 2JOJA 2EGDA 2M3WA 1BOCA 1CB1A 1JWDA 5CSFA 1Y0VH 3DVJA 1K8UA 4OVNF 1RTP1 1QTXA 2M1KB 1SCMB 1TNQA 1A2XA 3ICBA 3H4SE 4XJKA 1NSHA 2LLTA 3O6BA 2BCBA 2BKHB 4JQ0D 1M31A 1YRTB 1OMVA 2LP2A 3LL8B 2LVJA 1ZMZA 2L51A 4MN0A 3PSRA 3VRQA 2L4IA 2BL0C 3PN7B 2L50A 1SL7A 5DKNA 4E68A 4DIRA 1SPYA 1YUTA 1KK7Y 1F54A 1OZOA 1RECA 1VRKA 2BE6A 4YGBB 2EC6C 4JPZB 2I18A 1AJ4A 3CGAA 1K96A 2K2FA 3QRXA 5BPJA 1BU3A 3SIBA 3EK7A 1DVIA 1YVLA 4AOMA 1UUSA 1R2UA 1CLMA 1S36A 1W7JB 3SG3A 5HLOA 3OP0A 5B8IB 1NX1A 1ZUZA 2F8PA 4QJ5B 1NCZA 1QIVA 1ZACA 3A4UB 1QS7A 4R1EA 1KFXS 4WQ2A 2I7AA 3GK2A 1U5IA 1NPQA 2E6WA 1QX5B 2ZRSA 4OR9B 4MRXA 3GK1A 3TS5C 4DS7A 1A4PA 1KK8C 2G9BA 4NDDA 4YGDB 2Y1MA 1GQMA 3C1VA 1SMGA 1X02A 4PHNA 3EKJA 4A4BA 4YRUA 1HT9A 2BBMA 1QV0A 1TOPA 1IKUA 1Y1UA 2LHLA 2JT8A 4MZKA 4ZCUA 1F55A 1RFJA 4C0KA 1M63B 2LVKA 1ALWA 4YI9A 2KGRA 1J55A 2WNDA 1CM4A 3WNXB 4F0ZB 1QX7A 2KSPA 2KFGA 1PVBA 1AK8A 2F3YA 1QXPA 2MLEC 1KK7Z 3I5FC 1UHNA 3NXAA 3HX4A 1SCVA 1PULA 3M0WA 5AXIA 2OTGC 1AUIB 1N2DA 1CNPA 4D1EA 1BJFA 1CTRA 4C0JA 2NZ0A 3ZWHA 1KQMB 1UHIA 1QJTA 3EK8A 3F45A 3PALA 4PE7A 2H2KA 3GK4X 1F8HA 1JBAA 5I2QA 1LXFC 1KWOC 2BL0B 1IJ5A 1UP5A 1SKTA 1CFDA 2BE4A 4PHKA 3VRNA 2ZFDA 3BOWA 1Y1AA 4ORAB 2LNKA 1IJ6A 3OB2B 4ORBB 1ODBA 1U5IB 1YUUA 1JC2A 3D0YA 2K7DA 2PALA 1AJ5A 2MLFC 3GOFA 2F3ZA 5AANA 3K21A 5KSZA 3JTDC 2M0RA 2F33A 5I2LA 1KFXL 1YUSA 4DRWA 1YX7A 3AAKA 4WRIA 2JNXA 4N1GA 4CFQA 1L2OC 1SY9A 1L7ZA 3BYAA 5TNCA 2CT9A 3MSEB 5PALA 1LKJA 1YRUB 3NSIA 4GGNA 1B47A 1UWOA 3BUOB 4I5KA 2CCMA 2FCEA 1BODA 1XYDA 2PMYA 2QPTA 3SG7A 1XFYO 4A4CA 1XK4C 2KI6D 3AKAA 3PLFB 1XVJA 1B8CA 2HPSA 2L2EA 4PALA 2NXQA 3AKBA 1TIZA 2DOQA 1EL4A 3NSOA 2NLNA 3SG5A 1K93D 1H4BA 1JUOA 1SL8A 1KCYA 1Y1XA 2QACA 4BY5A 4CIDA 3JVTC 4HREE 5G08A 1DJYA 1QLSA 2PSRA 3DVKA 4U8DA 2ZN8A 2MBXA 1QV1A 1F71A 4AQIA 1M46A 2HQWA 1IQ3A 2SASA 5I2OA 2LV7A 3PFVA 2K7OA 2CBLA 2EHBA 1NP8A 4I5NB 2LM5A 1DJZA 5HKZA 1F70A 1S6JA 3O78A 2B1UA 2MHHA 2R2IA 2F2OA 4CLNA 4HSZA 1MWNA 4M2OA 1W7IB 1TNWA 1MHOA 4HRHA 3I5IB 1NIWA 2ZKMX 2LUXA 2MJWB 1QATA 1DTLA 4FQOA 4MLWA 4WQ3A 1K94A 1NCXA 1TCOB 2JZIA 2K61A 1XFXO 1IGVA 1SK6D 4XYNA 2KAXA 2BBNA 1IRJA 1KFUS 1V1FA 2KDHA 3SG2A 1DGUA 4CFRA 2JWWA 3OHMB 1Y6WA 4N5XA 1UHKA 1C07A 3DVMA 5JOLA 3EVRA 1CLLA 4TNCA 1C7WA 3SG4A 1TCFA 1TN4A 4QJ4B 1JF0A 3LK0A 2LANA 1IQ5A 2PRUA 2M1UA 1FBVA 3FIAA 1DGVA 3LK1A 4OCIA 4GBAA 1OMRA 3TZ1A 1IG5A 3OX5A 1OSAA 5ER5A 1J1DA 1XFZO 2BKIB 2CTNA 2M97A 1BR1B 3DF0A 3PM8A 3WXAA 3LCPC 1EXRA 4MZJA 2GGZA 4XJKB 4PE1A 1AHRA 1YR5A 1DT7B 2FJUB 1DF0A 1PALA 2Y5IA 1SR6B 3I5GC 1XFUO 2BCXA 1ZFSA 2WC8A 3KF9A 4IL1A 5F6TA 3TUYB 1QX2A 1G8IA 3A8RA 1BT6A 2JT3A 5D69A 1YURA 4GFTA 1A75A 2OS8C 2AMIA 4ICBA 3VRPA 2KI4C 2V53A 1CFPA 4YI8A 1GGWA 1YX8A 2M7NA 2JC2A 2ZNDA 1WDCC 3I5HC 4NDCA 3VROA 2HQ8A 2I2RE 2KGBC 2L0PA 2L5XB 2ZNEA 2K2AA 1S1EA 1BG1A 2L4HA 3BUNB 2EC6B 1G33A 3SG6A 2M49B 3OB1B 1QLKA 2JPTA 2WCBA 1QVIY 1SCMC 2KHNA 4JWQA 1PSRA 1KSMA 3D10A 3EK4A 2A4JA 4MRYA 4PE4A 2KNEA 2LHIA 2MA2A 3EVVA 4C0LA 2ISDA 2Y4QA 3PN7C 2AAOA 2VRGA 1KFUL 3DD4A 1PSBA 4M2PA 1RWYA 1WLMA 2NCPA 2G2BA 4YGCB 1E8AA 1CDPA 4P5OE 2KFHA 5CPVA 2JNFA 3O2PA 2MAZA 2JTTA 3CR5X 4PHJA 3AAJA 1N0YA 5HKWA 3SIAA 1JFJA 2WORA 4MVFA 1MF8B 3CR2A 2IS9A 3TDIA 3TS5B 1FF1A 4ZCVA 4DUQA 1KK8B 2L98A 3FS7A 1HQVA 1WRZA 1DMOA 2K7BA 4I5LB 2PASA 1A75B 1S6CA 2K7CA 4GGFC 1H8BA 2HF5A 3KEVA 1YVHA 1RK9A 2KFFA 3IQOA 5AFPA 1NCYA 4MSPA 4PDZA 4BY4A 1LA3A 1EJ3A 1V1GA 1KQVA 1OQPA 1S5GY 1B8RA 2NCOA 1UHJA 1XK4A 3FWCA 5IBWA 5CSNA 2COLB 4PE0A 2M8UA 1SL9A 1K2HA 4UPGA 3I5FB 5DKRA 4HRGA 1RJVA 4PCWA 1J7PA 4YGEB 1OE9B 4GGFA 2OTGB 3BOWB 2LVIA 1QVIZ 2KYCA 3TDUA 3TDZA 2PVBA 1CLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D0Y B;  1OZS A;  5FYX A;  3O4Y A;  2LE9 B;  1J7Q A;  3FWB A;  3NSL A;  3RLZ A;  2LMU A;  1F4Q A;  3VRR A;  1AP4 A;  1KWO B;  3BUW B;  1CFF A;  1NX2 A;  2KBM A;  3BUM B;  5K89 A;  1XA5 A;  2FOT A;  5JJG A;  1RRO A;  1NWD A;  3BQ3 A;  4OV2 A;  2KAV A;  1ALV A;  1LVC D;  2JU0 A;  2ZN9 A;  2JTZ A;  1CMG A;  5CSJ A;  1KQM C;  1SNL A;  2OPO A;  1DJI A;  4MZL A;  1JSA A;  1SW8 A;  2K0J A;  1PK0 D;  3CS1 A;  1TNP A;  5I8N A;  2K8M B;  3JTD B;  3HCM A;  1EH2 A;  2Q91 A;  5AER A;  3DVE A;  1OMD A;  1BR4 B;  3CLN A;  4GNK B;  1A29 A;  1S6I A;  4DCK A;  4CPV A;  1JF2 A;  1L2O B;  2KAY A;  4QJ3 B;  3ZNI A;  1YTZ C;  1MXE A;  1XFV O;  4P2Y B;  2GGM A;  1DJH A;  1K9K A;  5AEQ A;  2KI6 C;  3CZT X;  5DKQ A;  1S5G Z;  2KBI A;  5KTY A;  1B7T Y;  1KSO A;  2KOT A;  1GJY A;  1FI6 A;  1WLZ A;  1SBJ A;  1N65 A;  2LCP A;  1B1G A;  2TN4 A;  5GQQ C;  1GGZ A;  1DJW A;  2Y1N A;  4ORC B;  1XO5 A;  1WRK A;  2P6B B;  5HKY A;  1UUR A;  1LA0 A;  1MQ1 A;  1CM1 A;  4NQG A;  4GUK A;  1M45 A;  3CTN A;  2JT0 A;  4FTG A;  2AUC A;  1FPW A;  3SJS A;  3KHE A;  3JVT B;  1G4Y R;  1S26 D;  3WHT B;  1IWQ A;  4GPL B;  1J7O A;  3BXK A;  1SRA A;  1CDM A;  1R6P A;  2F2P A;  1TNX A;  3VGO A;  3CR4 X;  3IQQ A;  1PVA A;  2M7L A;  1NX3 A;  2GV5 A;  1NX0 A;  1SYM A;  3EVU A;  1CFC A;  2KQ6 A;  2MRD A;  1CKK A;  3OX6 A;  3E3R A;  2WCF A;  3KO0 A;  1FI5 A;  2O60 A;  5HLV A;  2I94 A;  2WCE A;  2H61 C;  2O5G A;  1WY9 A;  2CXJ A;  1PRW A;  1OOJ A;  1J7R A;  1K9P A;  1BMO A;  1K95 A;  4OKH A;  1CDL A;  4MEW A;  3BUX B;  2M9G A;  4GAO A;  1B7T Z;  2SCP A;  3I5I C;  2Q4U A;  1F4O A;  1B4C A;  2LC5 A;  1A03 A;  1EG3 A;  1K9U A;  3RM1 A;  1TTX A;  1NUB A;  1XFW O;  2H61 A;  3DF0 B;  3IF7 A;  1AVS A;  2E30 A;  1J1E A;  4AQJ A;  1DF0 B;  2WOS A;  5D7F A;  1LIN A;  1MR8 A;  1FW4 A;  2M29 A;  4YBH B;  1DJX A;  5J3X A;  5ER4 X;  2LAP A;  4I5J A;  2JUL A;  2LUC A;  1CMF A;  1WRL A;  2LLU A;  2LVV A;  1MXL C;  1QIW A;  2JRF A;  1CDN A;  5HYD A;  1UHH A;  1TRF A;  5KU1 A;  2RGI A;  1MUX A;  2JQ6 A;  1JFK A;  1K90 D;  1M39 A;  4Q04 A;  4M2Q A;  1Q80 A;  2D8N A;  2LLS A;  3I5G B;  4L9M A;  1BLQ A;  5CSI A;  2KQY A;  3KPX A;  1EG4 A;  2LMT A;  1B8L A;  2BCA A;  2LP3 A;  2KYF A;  1B9A A;  2CNP A;  2JXC A;  2OS8 B;  3CWG A;  3LLE A;  1D1O A;  2KI4 B;  4MBE A;  1S3P A;  2ZRT A;  4N1F A;  4PHM A;  3EKH A;  1IH0 A;  1ZOT B;  3PAT A;  1BF5 A;  3NSK A;  1WDC B;  2LMV A;  3I5H B;  1SR6 C;  2HET A;  2JXL A;  4NDB A;  3WHU B;  1DJG A;  3TUY C;  1QAS A;  4YGA A;  2BEC A;  1NYA A;  4ETO A;  1C7V A;  2FCD A;  4USL A;  2JOJ A;  2EGD A;  2M3W A;  1BOC A;  1CB1 A;  1JWD A;  5CSF A;  1Y0V H;  3DVJ A;  1K8U A;  4OVN F;  1RTP 1;  1QTX A;  2M1K B;  1SCM B;  1TNQ A;  1A2X A;  3ICB A;  3H4S E;  4XJK A;  1NSH A;  2LLT A;  3O6B A;  2BCB A;  2BKH B;  4JQ0 D;  1M31 A;  1YRT B;  1OMV A;  2LP2 A;  3LL8 B;  2LVJ A;  1ZMZ A;  2L51 A;  4MN0 A;  3PSR A;  3VRQ A;  2L4I A;  2BL0 C;  3PN7 B;  2L50 A;  1SL7 A;  5DKN A;  4E68 A;  4DIR A;  1SPY A;  1YUT A;  1KK7 Y;  1F54 A;  1OZO A;  1REC A;  1VRK A;  2BE6 A;  4YGB B;  2EC6 C;  4JPZ B;  2I18 A;  1AJ4 A;  3CGA A;  1K96 A;  2K2F A;  3QRX A;  5BPJ A;  1BU3 A;  3SIB A;  3EK7 A;  1DVI A;  1YVL A;  4AOM A;  1UUS A;  1R2U A;  1CLM A;  1S36 A;  1W7J B;  3SG3 A;  5HLO A;  3OP0 A;  5B8I B;  1NX1 A;  1ZUZ A;  2F8P A;  4QJ5 B;  1NCZ A;  1QIV A;  1ZAC A;  3A4U B;  1QS7 A;  4R1E A;  1KFX S;  4WQ2 A;  2I7A A;  3GK2 A;  1U5I A;  1NPQ A;  2E6W A;  1QX5 B;  2ZRS A;  4OR9 B;  4MRX A;  3GK1 A;  3TS5 C;  4DS7 A;  1A4P A;  1KK8 C;  2G9B A;  4NDD A;  4YGD B;  2Y1M A;  1GQM A;  3C1V A;  1SMG A;  1X02 A;  4PHN A;  3EKJ A;  4A4B A;  4YRU A;  1HT9 A;  2BBM A;  1QV0 A;  1TOP A;  1IKU A;  1Y1U A;  2LHL A;  2JT8 A;  4MZK A;  4ZCU A;  1F55 A;  1RFJ A;  4C0K A;  1M63 B;  2LVK A;  1ALW A;  4YI9 A;  2KGR A;  1J55 A;  2WND A;  1CM4 A;  3WNX B;  4F0Z B;  1QX7 A;  2KSP A;  2KFG A;  1PVB A;  1AK8 A;  2F3Y A;  1QXP A;  2MLE C;  1KK7 Z;  3I5F C;  1UHN A;  3NXA A;  3HX4 A;  1SCV A;  1PUL A;  3M0W A;  5AXI A;  2OTG C;  1AUI B;  1N2D A;  1CNP A;  4D1E A;  1BJF A;  1CTR A;  4C0J A;  2NZ0 A;  3ZWH A;  1KQM B;  1UHI A;  1QJT A;  3EK8 A;  3F45 A;  3PAL A;  4PE7 A;  2H2K A;  3GK4 X;  1F8H A;  1JBA A;  5I2Q A;  1LXF C;  1KWO C;  2BL0 B;  1IJ5 A;  1UP5 A;  1SKT A;  1CFD A;  2BE4 A;  4PHK A;  3VRN A;  2ZFD A;  3BOW A;  1Y1A A;  4ORA B;  2LNK A;  1IJ6 A;  3OB2 B;  4ORB B;  1ODB A;  1U5I B;  1YUU A;  1JC2 A;  3D0Y A;  2K7D A;  2PAL A;  1AJ5 A;  2MLF C;  3GOF A;  2F3Z A;  5AAN A;  3K21 A;  5KSZ A;  3JTD C;  2M0R A;  2F33 A;  5I2L A;  1KFX L;  1YUS A;  4DRW A;  1YX7 A;  3AAK A;  4WRI A;  2JNX A;  4N1G A;  4CFQ A;  1L2O C;  1SY9 A;  1L7Z A;  3BYA A;  5TNC A;  2CT9 A;  3MSE B;  5PAL A;  1LKJ A;  1YRU B;  3NSI A;  4GGN A;  1B47 A;  1UWO A;  3BUO B;  4I5K A;  2CCM A;  2FCE A;  1BOD A;  1XYD A;  2PMY A;  2QPT A;  3SG7 A;  1XFY O;  4A4C A;  1XK4 C;  2KI6 D;  3AKA A;  3PLF B;  1XVJ A;  1B8C A;  2HPS A;  2L2E A;  4PAL A;  2NXQ A;  3AKB A;  1TIZ A;  2DOQ A;  1EL4 A;  3NSO A;  2NLN A;  3SG5 A;  1K93 D;  1H4B A;  1JUO A;  1SL8 A;  1KCY A;  1Y1X A;  2QAC A;  4BY5 A;  4CID A;  3JVT C;  4HRE E;  5G08 A;  1DJY A;  1QLS A;  2PSR A;  3DVK A;  4U8D A;  2ZN8 A;  2MBX A;  1QV1 A;  1F71 A;  4AQI A;  1M46 A;  2HQW A;  1IQ3 A;  2SAS A;  5I2O A;  2LV7 A;  3PFV A;  2K7O A;  2CBL A;  2EHB A;  1NP8 A;  4I5N B;  2LM5 A;  1DJZ A;  5HKZ A;  1F70 A;  1S6J A;  3O78 A;  2B1U A;  2MHH A;  2R2I A;  2F2O A;  4CLN A;  4HSZ A;  1MWN A;  4M2O A;  1W7I B;  1TNW A;  1MHO A;  4HRH A;  3I5I B;  1NIW A;  2ZKM X;  2LUX A;  2MJW B;  1QAT A;  1DTL A;  4FQO A;  4MLW A;  4WQ3 A;  1K94 A;  1NCX A;  1TCO B;  2JZI A;  2K61 A;  1XFX O;  1IGV A;  1SK6 D;  4XYN A;  2KAX A;  2BBN A;  1IRJ A;  1KFU S;  1V1F A;  2KDH A;  3SG2 A;  1DGU A;  4CFR A;  2JWW A;  3OHM B;  1Y6W A;  4N5X A;  1UHK A;  1C07 A;  3DVM A;  5JOL A;  3EVR A;  1CLL A;  4TNC A;  1C7W A;  3SG4 A;  1TCF A;  1TN4 A;  4QJ4 B;  1JF0 A;  3LK0 A;  2LAN A;  1IQ5 A;  2PRU A;  2M1U A;  1FBV A;  3FIA A;  1DGV A;  3LK1 A;  4OCI A;  4GBA A;  1OMR A;  3TZ1 A;  1IG5 A;  3OX5 A;  1OSA A;  5ER5 A;  1J1D A;  1XFZ O;  2BKI B;  2CTN A;  2M97 A;  1BR1 B;  3DF0 A;  3PM8 A;  3WXA A;  3LCP C;  1EXR A;  4MZJ A;  2GGZ A;  4XJK B;  4PE1 A;  1AHR A;  1YR5 A;  1DT7 B;  2FJU B;  1DF0 A;  1PAL A;  2Y5I A;  1SR6 B;  3I5G C;  1XFU O;  2BCX A;  1ZFS A;  2WC8 A;  3KF9 A;  4IL1 A;  5F6T A;  3TUY B;  1QX2 A;  1G8I A;  3A8R A;  1BT6 A;  2JT3 A;  5D69 A;  1YUR A;  4GFT A;  1A75 A;  2OS8 C;  2AMI A;  4ICB A;  3VRP A;  2KI4 C;  2V53 A;  1CFP A;  4YI8 A;  1GGW A;  1YX8 A;  2M7N A;  2JC2 A;  2ZND A;  1WDC C;  3I5H C;  4NDC A;  3VRO A;  2HQ8 A;  2I2R E;  2KGB C;  2L0P A;  2L5X B;  2ZNE A;  2K2A A;  1S1E A;  1BG1 A;  2L4H A;  3BUN B;  2EC6 B;  1G33 A;  3SG6 A;  2M49 B;  3OB1 B;  1QLK A;  2JPT A;  2WCB A;  1QVI Y;  1SCM C;  2KHN A;  4JWQ A;  1PSR A;  1KSM A;  3D10 A;  3EK4 A;  2A4J A;  4MRY A;  4PE4 A;  2KNE A;  2LHI A;  2MA2 A;  3EVV A;  4C0L A;  2ISD A;  2Y4Q A;  3PN7 C;  2AAO A;  2VRG A;  1KFU L;  3DD4 A;  1PSB A;  4M2P A;  1RWY A;  1WLM A;  2NCP A;  2G2B A;  4YGC B;  1E8A A;  1CDP A;  4P5O E;  2KFH A;  5CPV A;  2JNF A;  3O2P A;  2MAZ A;  2JTT A;  3CR5 X;  4PHJ A;  3AAJ A;  1N0Y A;  5HKW A;  3SIA A;  1JFJ A;  2WOR A;  4MVF A;  1MF8 B;  3CR2 A;  2IS9 A;  3TDI A;  3TS5 B;  1FF1 A;  4ZCV A;  4DUQ A;  1KK8 B;  2L98 A;  3FS7 A;  1HQV A;  1WRZ A;  1DMO A;  2K7B A;  4I5L B;  2PAS A;  1A75 B;  1S6C A;  2K7C A;  4GGF C;  1H8B A;  2HF5 A;  3KEV A;  1YVH A;  1RK9 A;  2KFF A;  3IQO A;  5AFP A;  1NCY A;  4MSP A;  4PDZ A;  4BY4 A;  1LA3 A;  1EJ3 A;  1V1G A;  1KQV A;  1OQP A;  1S5G Y;  1B8R A;  2NCO A;  1UHJ A;  1XK4 A;  3FWC A;  5IBW A;  5CSN A;  2COL B;  4PE0 A;  2M8U A;  1SL9 A;  1K2H A;  4UPG A;  3I5F B;  5DKR A;  4HRG A;  1RJV A;  4PCW A;  1J7P A;  4YGE B;  1OE9 B;  4GGF A;  2OTG B;  3BOW B;  2LVI A;  1QVI Z;  2KYC A;  3TDU A;  3TDZ A;  2PVB A;  1CLB A; 
#chains in the Genus database with same CATH topology
 3NHI A;  3D0Y B;  3D77 A;  1OZS A;  5FYX A;  3O4Y A;  2LE9 B;  1J7Q A;  3FWB A;  3NSL A;  3RLZ A;  2LMU A;  1F4Q A;  3VRR A;  2WCH A;  1KWO B;  3BUW B;  1AP4 A;  1NX2 A;  1CFF A;  2KBM A;  3BUM B;  5K89 A;  1XA5 A;  2FOT A;  5JJG A;  3PM2 A;  1RRO A;  1NWD A;  1DC1 A;  3BQ3 A;  4OV2 A;  2KAV A;  4PT1 A;  1ALV A;  1LVC D;  2JU0 A;  2ZN9 A;  2JTZ A;  1CMG A;  5CSJ A;  1KQM C;  1SNL A;  2OPO A;  1DJI A;  3BFB A;  4MZL A;  1JSA A;  1SW8 A;  3R72 A;  2K0J A;  1PK0 D;  3CS1 A;  1TNP A;  5I8N A;  2K8M B;  3JTD B;  3HCM A;  1EH2 A;  2FJY A;  2Q91 A;  5AER A;  3DVE A;  3SS4 A;  1OMD A;  1BR4 B;  3CLN A;  4GNK B;  1A29 A;  1S6I A;  4DCK A;  4CPV A;  3B6X A;  1JF2 A;  1L2O B;  2KAY A;  4QJ3 B;  3ZNI A;  1YTZ C;  1MXE A;  1XFV O;  4P2Y B;  2GGM A;  1DJH A;  1K9K A;  5AEQ A;  2KI6 C;  3CZT X;  5DKQ A;  1S5G Z;  2KBI A;  5KTY A;  1B7T Y;  1KSO A;  1ORG A;  2KOT A;  1GJY A;  3CAB A;  1FI6 A;  1WLZ A;  1SBJ A;  1N65 A;  2LCP A;  3OBV A;  1B1G A;  4F7F A;  2TN4 A;  5GQQ C;  1GGZ A;  3FE9 A;  1DJW A;  2Y1N A;  4ORC B;  1XO5 A;  1WRK A;  2P6B B;  5HKY A;  1UUR A;  1LA0 A;  2ERB A;  1MQ1 A;  1CM1 A;  4NQG A;  4GUK A;  1M45 A;  3CTN A;  2JT0 A;  4FTG A;  2AUC A;  1FPW A;  3SJS A;  3CZ2 A;  3JVT B;  3KHE A;  1G4Y R;  1S26 D;  1GM0 A;  3WHT B;  1IWQ A;  3L4A A;  3NGV A;  4GPL B;  1J7O A;  3BXK A;  1SRA A;  1CDM A;  1R6P A;  2F2P A;  2JPO A;  1TNX A;  3VGO A;  3CR4 X;  3IQQ A;  1PVA A;  2M7L A;  1NX3 A;  2GV5 A;  1NX0 A;  1SYM A;  3EVU A;  1CFC A;  2KQ6 A;  2MRD A;  1CKK A;  3OX6 A;  3E3R A;  2WCF A;  3KO0 A;  1FI5 A;  2O60 A;  1DEL A;  5HLV A;  2I94 A;  2WCE A;  2H61 C;  2O5G A;  1WY9 A;  4INW A;  2CXJ A;  1PRW A;  1OOJ A;  1J7R A;  1K9P A;  5D3O A;  1BMO A;  3S0D A;  3PJI A;  1K95 A;  4OKH A;  1CDL A;  4MEW A;  3BUX B;  1Z2C B;  2M9G A;  3R1P A;  4GAO A;  3Q8I A;  3SS5 A;  1B7T Z;  2SCP A;  3I5I C;  2Q4U A;  1F4O A;  1B4C A;  2LC5 A;  1A03 A;  1EG3 A;  1K9U A;  3RM1 A;  1TTX A;  1NUB A;  1XFW O;  2H61 A;  3DF0 B;  3IF7 A;  2YGU A;  1P28 A;  1AVS A;  2E30 A;  1J1E A;  4AQJ A;  1DEK A;  1DF0 B;  2WOS A;  5D7F A;  1LIN A;  1MR8 A;  1FW4 A;  2M29 A;  4YBH B;  1DJX A;  5J3X A;  5ER4 X;  2LAP A;  4I5J A;  2JUL A;  2LUC A;  1CMF A;  1WRL A;  2LLU A;  2LVV A;  1OOH A;  1MXL C;  1QIW A;  2JRF A;  1CDN A;  5HYD A;  1UHH A;  1TRF A;  5KU1 A;  2RGI A;  1MUX A;  2JQ6 A;  1JFK A;  1K90 D;  1M39 A;  4Q04 A;  4M2Q A;  1Q80 A;  2D8N A;  2LLS A;  3I5G B;  4L9M A;  2P71 A;  3DZT A;  1BLQ A;  5CSI A;  2KQY A;  3KPX A;  1EG4 A;  2LMT A;  2GTE A;  1B8L A;  2BCA A;  2LP3 A;  2KYF A;  1B9A A;  2CNP A;  2JXC A;  2OS8 B;  3CWG A;  2QEO A;  3LLE A;  1D1O A;  2KI4 B;  4MBE A;  1S3P A;  2ZRT A;  4N1F A;  4PHM A;  3EKH A;  1IH0 A;  4OZD A;  1ZOT B;  3PAT A;  1BF5 A;  3NSK A;  1WDC B;  2LMV A;  3I5H B;  1SR6 C;  2HET A;  2JXL A;  4NDB A;  3WHU B;  1DJG A;  3TUY C;  1QAS A;  4YGA A;  5DIC A;  2BEC A;  1NYA A;  4ETO A;  1C7V A;  3S0F A;  2FCD A;  4USL A;  2JOJ A;  2EGD A;  2M3W A;  1BOC A;  1CB1 A;  1JWD A;  5CSF A;  1Y0V H;  3DVJ A;  1K8U A;  4OVN F;  1RTP 1;  1QTX A;  2M1K B;  1SCM B;  1TNQ A;  1A2X A;  3ICB A;  3H4S E;  4XJK A;  1NSH A;  2LLT A;  3O6B A;  2BCB A;  2BKH B;  4JQ0 D;  1M31 A;  1YRT B;  3BJH A;  3S0E A;  1OMV A;  2LP2 A;  5FI6 A;  3LL8 B;  2LVJ A;  1ZMZ A;  2L51 A;  4MN0 A;  3PSR A;  4IJ7 A;  3VRQ A;  2L4I A;  2BL0 C;  3PN7 B;  2L50 A;  1SL7 A;  5DKN A;  4E68 A;  3DYE A;  1SPY A;  1YUT A;  4DIR A;  1KK7 Y;  1F54 A;  1OZO A;  3EG5 B;  1REC A;  1VRK A;  2BE6 A;  2K60 A;  2EC6 C;  4YGB B;  4JPZ B;  2WCL A;  2I18 A;  1AJ4 A;  3CGA A;  1K96 A;  2K2F A;  3QRX A;  5BPJ A;  1BU3 A;  3S0G A;  3SIB A;  3EK7 A;  1DVI A;  1YVL A;  4AOM A;  1UUS A;  1R2U A;  1CLM A;  1S36 A;  1W7J B;  3SG3 A;  5HLO A;  1LS8 A;  1OOI X;  3OP0 A;  5B8I B;  3B7A A;  1NX1 A;  1ZUZ A;  2F8P A;  4QJ5 B;  2KPH A;  1NCZ A;  1QIV A;  1ZAC A;  3A4U B;  1QS7 A;  4R1E A;  1KFX S;  4WQ2 A;  2I7A A;  3B87 A;  3GK2 A;  1U5I A;  1NPQ A;  2E6W A;  1QX5 B;  2ZRS A;  4OR9 B;  4MRX A;  3GK1 A;  3K1E A;  3TS5 C;  4DS7 A;  1A4P A;  1KK8 C;  3BFH A;  3D73 A;  2G9B A;  4NDD A;  4YGD B;  1TWO A;  2Y1M A;  1GQM A;  3C1V A;  1SMG A;  1TUJ A;  1X02 A;  4PHN A;  3EKJ A;  4A4B A;  4YRU A;  1HT9 A;  2BBM A;  1QV0 A;  1TOP A;  1IKU A;  1Y1U A;  2LHL A;  2JT8 A;  4MZK A;  4ZCU A;  1F55 A;  1RFJ A;  1OOF A;  4C0K A;  1M63 B;  2LVK A;  1ALW A;  4YI9 A;  2KGR A;  1J55 A;  2WND A;  1CM4 A;  3WNX B;  4F0Z B;  1QX7 A;  2KSP A;  2KFG A;  1PVB A;  1AK8 A;  2F3Y A;  1QXP A;  2MLE C;  1KK7 Z;  3I5F C;  1UHN A;  3NXA A;  3HX4 A;  1SCV A;  1PUL A;  3M0W A;  3CDN A;  5AXI A;  2OTG C;  1AUI B;  1N2D A;  1CNP A;  4D1E A;  1BJF A;  1CTR A;  4C0J A;  2NZ0 A;  3ZWH A;  1KQM B;  1UHI A;  1QJT A;  1W9Z A;  3EK8 A;  3F45 A;  3PAL A;  4PE7 A;  2H2K A;  3GK4 X;  1F8H A;  1JBA A;  5I2Q A;  1LXF C;  1KWO C;  2BL0 B;  1IJ5 A;  3FE6 A;  1UP5 A;  1SKT A;  1CFD A;  2BE4 A;  4PHK A;  3VRN A;  1Z4H A;  2ZFD A;  3BOW A;  1Y1A A;  4ORA B;  2LNK A;  1OW4 A;  1IJ6 A;  2L5Y A;  3OB2 B;  1T14 A;  1ODB A;  4ORB B;  1U5I B;  1YUU A;  1JC2 A;  3D0Y A;  2K7D A;  2PAL A;  1AJ5 A;  2MLF C;  3GOF A;  2F3Z A;  5AAN A;  3K21 A;  5KSZ A;  3JTD C;  2M0R A;  2F33 A;  5I2L A;  5FI7 A;  3B88 A;  1KFX L;  1YUS A;  4DRW A;  1YX7 A;  3AAK A;  4WRI A;  2JNX A;  2PQL A;  3N7H A;  4N1G A;  4CFQ A;  1L2O C;  1SY9 A;  1L7Z A;  1OOG A;  3BYA A;  5TNC A;  2CT9 A;  3MSE B;  5PAL A;  1LKJ A;  1YRU B;  3NSI A;  4GGN A;  1B47 A;  1UWO A;  3BUO B;  4I5K A;  2CCM A;  2FCE A;  1BOD A;  1XYD A;  2PMY A;  2QPT A;  3SG7 A;  1XFY O;  4A4C A;  3S0A A;  1XK4 C;  4INX A;  2KI6 D;  3AKA A;  3PLF B;  1XVJ A;  5EL2 A;  1B8C A;  2HPS A;  2L2E A;  4PAL A;  3QME A;  2NXQ A;  3AKB A;  1TIZ A;  2DOQ A;  1EL4 A;  3NSO A;  2NLN A;  3SG5 A;  1K93 D;  1H4B A;  1JUO A;  1SL8 A;  1KCY A;  1Y1X A;  2QAC A;  4FQT A;  4BY5 A;  3DXL A;  4CID A;  3JVT C;  4HRE E;  5G08 A;  2QEH A;  1DJY A;  1QLS A;  2PSR A;  3DVK A;  3IVT A;  4U8D A;  2ZN8 A;  2MBX A;  1QV1 A;  1TUZ A;  1XFR A;  4AQI A;  1M46 A;  2HQW A;  1F71 A;  1IQ3 A;  2SAS A;  5I2O A;  2LV7 A;  3D74 A;  3PFV A;  2K7O A;  2CBL A;  2EHB A;  1NP8 A;  4I5N B;  2LM5 A;  1DJZ A;  5HKZ A;  1F70 A;  1S6J A;  3O78 A;  2B1U A;  2MHH A;  1C3Y A;  2R2I A;  3CYZ A;  2F2O A;  4CLN A;  4HSZ A;  1MWN A;  4M2O A;  1W7I B;  1TNW A;  1MHO A;  4HRH A;  3I5I B;  1NIW A;  2ZKM X;  2LUX A;  2MJW B;  3BFA A;  1QAT A;  1DTL A;  4FQO A;  3O4X A;  4MLW A;  2BNX A;  4WQ3 A;  1K94 A;  1NCX A;  3UNW A;  3SS3 A;  1IIO A;  1TCO B;  2JZI A;  2K61 A;  3CZ1 A;  2L2C A;  1XFX O;  1IGV A;  5I94 A;  1SK6 D;  4XYN A;  2KAX A;  2BBN A;  3CZ0 A;  1IRJ A;  1KFU S;  1V1F A;  2KDH A;  3SG2 A;  1DGU A;  3UO9 A;  4CFR A;  2JWW A;  2P70 A;  3OHM B;  1Y6W A;  4N5X A;  1SSE B;  4JKT A;  1UHK A;  1C07 A;  3RZS A;  3DVM A;  5JOL A;  3EVR A;  1CLL A;  2WCJ A;  4TNC A;  1C7W A;  3SG4 A;  1TCF A;  1TN4 A;  4QJ4 B;  1JF0 A;  3LK0 A;  2LAN A;  3FE8 A;  1IQ5 A;  2PRU A;  2M1U A;  3R1V A;  1FBV A;  3FIA A;  3B86 A;  1DGV A;  3LK1 A;  4OCI A;  4GBA A;  1OMR A;  3L4L A;  3TZ1 A;  1IG5 A;  3OX5 A;  1OSA A;  5ER5 A;  1J1D A;  1XFZ O;  2BKI B;  2CTN A;  2M97 A;  1BR1 B;  3DF0 A;  3PM8 A;  3WXA A;  3LCP C;  1EXR A;  1QWV A;  2GGZ A;  4MZJ A;  4XJK B;  3V2L A;  4PE1 A;  1AHR A;  1YR5 A;  1DT7 B;  3R1O A;  2FJU B;  1DF0 A;  3D75 A;  1PAL A;  2Y5I A;  1SR6 B;  3I5G C;  1XFU O;  2BCX A;  1ZFS A;  2WC8 A;  3KF9 A;  4IL1 A;  5F6T A;  3TUY B;  1QX2 A;  1G8I A;  3S0B A;  3L47 A;  3A8R A;  1BT6 A;  4KYN A;  2JT3 A;  5D69 A;  2QEB A;  1YUR A;  4GFT A;  1A75 A;  2BAP A;  2OS8 C;  2AMI A;  4ICB A;  1DQE A;  3VRP A;  2KI4 C;  2V53 A;  1CFP A;  4YI8 A;  1GGW A;  1YX8 A;  2M7N A;  2JC2 A;  2ZND A;  1WDC C;  3I5H C;  2KLE A;  2QDI A;  2WCM A;  4NDC A;  3DY9 A;  3VRO A;  2HQ8 A;  2I2R E;  2KGB C;  2L0P A;  2L5X B;  2ZNE A;  3D76 A;  2K2A A;  1S1E A;  1BG1 A;  2L4H A;  3BUN B;  2EC6 B;  1G33 A;  3SG6 A;  2M49 B;  3OB1 B;  1QLK A;  2JPT A;  2WCB A;  1QVI Y;  1SCM C;  2KHN A;  4JWQ A;  1PSR A;  1KSM A;  3D10 A;  3EK4 A;  2A4J A;  4MRY A;  3OGN A;  4PE4 A;  2KNE A;  2LHI A;  4JD9 A;  2MA2 A;  3EVV A;  4C0L A;  2ISD A;  2Y4Q A;  3PN7 C;  2AAO A;  3NHT A;  2VRG A;  1KFU L;  3DD4 A;  1PSB A;  4M2P A;  1RWY A;  1WLM A;  2KLD A;  2G2B A;  2NCP A;  4YGC B;  1E8A A;  1CDP A;  4P5O E;  2KFH A;  5CPV A;  2JNF A;  3O2P A;  2MAZ A;  2JTT A;  3CR5 X;  4PHJ A;  3D78 A;  3AAJ A;  1N0Y A;  5HKW A;  3SIA A;  1JFJ A;  2WOR A;  4MVF A;  1MF8 B;  3CR2 A;  2IS9 A;  3TDI A;  3TS5 B;  1FF1 A;  4ZCV A;  4DUQ A;  1KK8 B;  2L98 A;  3FS7 A;  1HQV A;  1WRZ A;  1DMO A;  2K7B A;  4I5L B;  2PAS A;  2H8V A;  1A75 B;  1S6C A;  2K7C A;  4GGF C;  1H8B A;  2HF5 A;  3KEV A;  1C3Z A;  1YVH A;  1RK9 A;  2KFF A;  3IQO A;  5AFP A;  1NCY A;  5FI2 A;  4MSP A;  4PDZ A;  4BY4 A;  1LA3 A;  3VB1 A;  1EJ3 A;  1V1G A;  1KQV A;  1OQP A;  1S5G Y;  2WC6 A;  2PYQ A;  1B8R A;  2NCO A;  1UHJ A;  1XK4 A;  3FWC A;  5IBW A;  5CSN A;  2COL B;  4PE0 A;  2M8U A;  1SL9 A;  2WC5 A;  1K2H A;  4UPG A;  3I5F B;  2QEV A;  5DKR A;  4HRG A;  1RJV A;  2WCK A;  4PCW A;  4YGE B;  1J7P A;  1OE9 B;  4GGF A;  2OTG B;  3BOW B;  2LVI A;  5HL1 A;  1QVI Z;  2KYC A;  3TDU A;  3TDZ A;  2PVB A;  1CLB A; 
#chains in the Genus database with same CATH homology
 3D0Y B;  1OZS A;  5FYX A;  3O4Y A;  2LE9 B;  1J7Q A;  3FWB A;  3NSL A;  3RLZ A;  2LMU A;  1F4Q A;  3VRR A;  1AP4 A;  1KWO B;  3BUW B;  1CFF A;  1NX2 A;  2KBM A;  3BUM B;  5K89 A;  1XA5 A;  2FOT A;  5JJG A;  1RRO A;  1NWD A;  3BQ3 A;  4OV2 A;  2KAV A;  1ALV A;  1LVC D;  2JU0 A;  2ZN9 A;  2JTZ A;  1CMG A;  5CSJ A;  1KQM C;  1SNL A;  2OPO A;  1DJI A;  4MZL A;  1JSA A;  1SW8 A;  2K0J A;  1PK0 D;  3CS1 A;  1TNP A;  5I8N A;  2K8M B;  3JTD B;  3HCM A;  1EH2 A;  2Q91 A;  5AER A;  3DVE A;  1OMD A;  1BR4 B;  3CLN A;  4GNK B;  1A29 A;  1S6I A;  4DCK A;  4CPV A;  1JF2 A;  1L2O B;  2KAY A;  4QJ3 B;  3ZNI A;  1YTZ C;  1MXE A;  1XFV O;  4P2Y B;  2GGM A;  1DJH A;  1K9K A;  5AEQ A;  2KI6 C;  3CZT X;  5DKQ A;  1S5G Z;  2KBI A;  5KTY A;  1B7T Y;  1KSO A;  2KOT A;  1GJY A;  1FI6 A;  1WLZ A;  1SBJ A;  1N65 A;  2LCP A;  1B1G A;  2TN4 A;  5GQQ C;  1GGZ A;  1DJW A;  2Y1N A;  4ORC B;  1XO5 A;  1WRK A;  2P6B B;  5HKY A;  1UUR A;  1LA0 A;  1MQ1 A;  1CM1 A;  4NQG A;  4GUK A;  1M45 A;  3CTN A;  2JT0 A;  4FTG A;  2AUC A;  1FPW A;  3SJS A;  3KHE A;  3JVT B;  1G4Y R;  1S26 D;  3WHT B;  1IWQ A;  4GPL B;  1J7O A;  3BXK A;  1SRA A;  1CDM A;  1R6P A;  2F2P A;  1TNX A;  3VGO A;  3CR4 X;  3IQQ A;  1PVA A;  2M7L A;  1NX3 A;  2GV5 A;  1NX0 A;  1SYM A;  3EVU A;  1CFC A;  2KQ6 A;  2MRD A;  1CKK A;  3OX6 A;  3E3R A;  2WCF A;  3KO0 A;  1FI5 A;  2O60 A;  5HLV A;  2I94 A;  2WCE A;  2H61 C;  2O5G A;  1WY9 A;  2CXJ A;  1PRW A;  1OOJ A;  1J7R A;  1K9P A;  1BMO A;  1K95 A;  4OKH A;  1CDL A;  4MEW A;  3BUX B;  2M9G A;  4GAO A;  1B7T Z;  2SCP A;  3I5I C;  2Q4U A;  1F4O A;  1B4C A;  2LC5 A;  1A03 A;  1EG3 A;  1K9U A;  3RM1 A;  1TTX A;  1NUB A;  1XFW O;  2H61 A;  3DF0 B;  3IF7 A;  1AVS A;  2E30 A;  1J1E A;  4AQJ A;  1DF0 B;  2WOS A;  5D7F A;  1LIN A;  1MR8 A;  1FW4 A;  2M29 A;  4YBH B;  1DJX A;  5J3X A;  5ER4 X;  2LAP A;  4I5J A;  2JUL A;  2LUC A;  1CMF A;  1WRL A;  2LLU A;  2LVV A;  1MXL C;  1QIW A;  2JRF A;  1CDN A;  5HYD A;  1UHH A;  1TRF A;  5KU1 A;  2RGI A;  1MUX A;  2JQ6 A;  1JFK A;  1K90 D;  1M39 A;  4Q04 A;  4M2Q A;  1Q80 A;  2D8N A;  2LLS A;  3I5G B;  4L9M A;  1BLQ A;  5CSI A;  2KQY A;  3KPX A;  1EG4 A;  2LMT A;  1B8L A;  2BCA A;  2LP3 A;  2KYF A;  1B9A A;  2CNP A;  2JXC A;  2OS8 B;  3CWG A;  3LLE A;  1D1O A;  2KI4 B;  4MBE A;  1S3P A;  2ZRT A;  4N1F A;  4PHM A;  3EKH A;  1IH0 A;  1ZOT B;  3PAT A;  1BF5 A;  3NSK A;  1WDC B;  2LMV A;  3I5H B;  1SR6 C;  2HET A;  2JXL A;  4NDB A;  3WHU B;  1DJG A;  3TUY C;  1QAS A;  4YGA A;  2BEC A;  1NYA A;  4ETO A;  1C7V A;  2FCD A;  4USL A;  2JOJ A;  2EGD A;  2M3W A;  1BOC A;  1CB1 A;  1JWD A;  5CSF A;  1Y0V H;  3DVJ A;  1K8U A;  4OVN F;  1RTP 1;  1QTX A;  2M1K B;  1SCM B;  1TNQ A;  1A2X A;  3ICB A;  3H4S E;  4XJK A;  1NSH A;  2LLT A;  3O6B A;  2BCB A;  2BKH B;  4JQ0 D;  1M31 A;  1YRT B;  1OMV A;  2LP2 A;  3LL8 B;  2LVJ A;  1ZMZ A;  2L51 A;  4MN0 A;  3PSR A;  3VRQ A;  2L4I A;  2BL0 C;  3PN7 B;  2L50 A;  1SL7 A;  5DKN A;  4E68 A;  4DIR A;  1SPY A;  1YUT A;  1KK7 Y;  1F54 A;  1OZO A;  1REC A;  1VRK A;  2BE6 A;  4YGB B;  2EC6 C;  4JPZ B;  2I18 A;  1AJ4 A;  3CGA A;  1K96 A;  2K2F A;  3QRX A;  5BPJ A;  1BU3 A;  3SIB A;  3EK7 A;  1DVI A;  1YVL A;  4AOM A;  1UUS A;  1R2U A;  1CLM A;  1S36 A;  1W7J B;  3SG3 A;  5HLO A;  3OP0 A;  5B8I B;  1NX1 A;  1ZUZ A;  2F8P A;  4QJ5 B;  1NCZ A;  1QIV A;  1ZAC A;  3A4U B;  1QS7 A;  4R1E A;  1KFX S;  4WQ2 A;  2I7A A;  3GK2 A;  1U5I A;  1NPQ A;  2E6W A;  1QX5 B;  2ZRS A;  4OR9 B;  4MRX A;  3GK1 A;  3TS5 C;  4DS7 A;  1A4P A;  1KK8 C;  2G9B A;  4NDD A;  4YGD B;  2Y1M A;  1GQM A;  3C1V A;  1SMG A;  1X02 A;  4PHN A;  3EKJ A;  4A4B A;  4YRU A;  1HT9 A;  2BBM A;  1QV0 A;  1TOP A;  1IKU A;  1Y1U A;  2LHL A;  2JT8 A;  4MZK A;  4ZCU A;  1F55 A;  1RFJ A;  4C0K A;  1M63 B;  2LVK A;  1ALW A;  4YI9 A;  2KGR A;  1J55 A;  2WND A;  1CM4 A;  3WNX B;  4F0Z B;  1QX7 A;  2KSP A;  2KFG A;  1PVB A;  1AK8 A;  2F3Y A;  1QXP A;  2MLE C;  1KK7 Z;  3I5F C;  1UHN A;  3NXA A;  3HX4 A;  1SCV A;  1PUL A;  3M0W A;  5AXI A;  2OTG C;  1AUI B;  1N2D A;  1CNP A;  4D1E A;  1BJF A;  1CTR A;  4C0J A;  2NZ0 A;  3ZWH A;  1KQM B;  1UHI A;  1QJT A;  3EK8 A;  3F45 A;  3PAL A;  4PE7 A;  2H2K A;  3GK4 X;  1F8H A;  1JBA A;  5I2Q A;  1LXF C;  1KWO C;  2BL0 B;  1IJ5 A;  1UP5 A;  1SKT A;  1CFD A;  2BE4 A;  4PHK A;  3VRN A;  2ZFD A;  3BOW A;  1Y1A A;  4ORA B;  2LNK A;  1IJ6 A;  3OB2 B;  4ORB B;  1ODB A;  1U5I B;  1YUU A;  1JC2 A;  3D0Y A;  2K7D A;  2PAL A;  1AJ5 A;  2MLF C;  3GOF A;  2F3Z A;  5AAN A;  3K21 A;  5KSZ A;  3JTD C;  2M0R A;  2F33 A;  5I2L A;  1KFX L;  1YUS A;  4DRW A;  1YX7 A;  3AAK A;  4WRI A;  2JNX A;  4N1G A;  4CFQ A;  1L2O C;  1SY9 A;  1L7Z A;  3BYA A;  5TNC A;  2CT9 A;  3MSE B;  5PAL A;  1LKJ A;  1YRU B;  3NSI A;  4GGN A;  1B47 A;  1UWO A;  3BUO B;  4I5K A;  2CCM A;  2FCE A;  1BOD A;  1XYD A;  2PMY A;  2QPT A;  3SG7 A;  1XFY O;  4A4C A;  1XK4 C;  2KI6 D;  3AKA A;  3PLF B;  1XVJ A;  1B8C A;  2HPS A;  2L2E A;  4PAL A;  2NXQ A;  3AKB A;  1TIZ A;  2DOQ A;  1EL4 A;  3NSO A;  2NLN A;  3SG5 A;  1K93 D;  1H4B A;  1JUO A;  1SL8 A;  1KCY A;  1Y1X A;  2QAC A;  4BY5 A;  4CID A;  3JVT C;  4HRE E;  5G08 A;  1DJY A;  1QLS A;  2PSR A;  3DVK A;  4U8D A;  2ZN8 A;  2MBX A;  1QV1 A;  1F71 A;  4AQI A;  1M46 A;  2HQW A;  1IQ3 A;  2SAS A;  5I2O A;  2LV7 A;  3PFV A;  2K7O A;  2CBL A;  2EHB A;  1NP8 A;  4I5N B;  2LM5 A;  1DJZ A;  5HKZ A;  1F70 A;  1S6J A;  3O78 A;  2B1U A;  2MHH A;  2R2I A;  2F2O A;  4CLN A;  4HSZ A;  1MWN A;  4M2O A;  1W7I B;  1TNW A;  1MHO A;  4HRH A;  3I5I B;  1NIW A;  2ZKM X;  2LUX A;  2MJW B;  1QAT A;  1DTL A;  4FQO A;  4MLW A;  4WQ3 A;  1K94 A;  1NCX A;  1TCO B;  2JZI A;  2K61 A;  1XFX O;  1IGV A;  1SK6 D;  4XYN A;  2KAX A;  2BBN A;  1IRJ A;  1KFU S;  1V1F A;  2KDH A;  3SG2 A;  1DGU A;  4CFR A;  2JWW A;  3OHM B;  1Y6W A;  4N5X A;  1UHK A;  1C07 A;  3DVM A;  5JOL A;  3EVR A;  1CLL A;  4TNC A;  1C7W A;  3SG4 A;  1TCF A;  1TN4 A;  4QJ4 B;  1JF0 A;  3LK0 A;  2LAN A;  1IQ5 A;  2PRU A;  2M1U A;  1FBV A;  3FIA A;  1DGV A;  3LK1 A;  4OCI A;  4GBA A;  1OMR A;  3TZ1 A;  1IG5 A;  3OX5 A;  1OSA A;  5ER5 A;  1J1D A;  1XFZ O;  2BKI B;  2CTN A;  2M97 A;  1BR1 B;  3DF0 A;  3PM8 A;  3WXA A;  3LCP C;  1EXR A;  4MZJ A;  2GGZ A;  4XJK B;  4PE1 A;  1AHR A;  1YR5 A;  1DT7 B;  2FJU B;  1DF0 A;  1PAL A;  2Y5I A;  1SR6 B;  3I5G C;  1XFU O;  2BCX A;  1ZFS A;  2WC8 A;  3KF9 A;  4IL1 A;  5F6T A;  3TUY B;  1QX2 A;  1G8I A;  3A8R A;  1BT6 A;  2JT3 A;  5D69 A;  1YUR A;  4GFT A;  1A75 A;  2OS8 C;  2AMI A;  4ICB A;  3VRP A;  2KI4 C;  2V53 A;  1CFP A;  4YI8 A;  1GGW A;  1YX8 A;  2M7N A;  2JC2 A;  2ZND A;  1WDC C;  3I5H C;  4NDC A;  3VRO A;  2HQ8 A;  2I2R E;  2KGB C;  2L0P A;  2L5X B;  2ZNE A;  2K2A A;  1S1E A;  1BG1 A;  2L4H A;  3BUN B;  2EC6 B;  1G33 A;  3SG6 A;  2M49 B;  3OB1 B;  1QLK A;  2JPT A;  2WCB A;  1QVI Y;  1SCM C;  2KHN A;  4JWQ A;  1PSR A;  1KSM A;  3D10 A;  3EK4 A;  2A4J A;  4MRY A;  4PE4 A;  2KNE A;  2LHI A;  2MA2 A;  3EVV A;  4C0L A;  2ISD A;  2Y4Q A;  3PN7 C;  2AAO A;  2VRG A;  1KFU L;  3DD4 A;  1PSB A;  4M2P A;  1RWY A;  1WLM A;  2NCP A;  2G2B A;  4YGC B;  1E8A A;  1CDP A;  4P5O E;  2KFH A;  5CPV A;  2JNF A;  3O2P A;  2MAZ A;  2JTT A;  3CR5 X;  4PHJ A;  3AAJ A;  1N0Y A;  5HKW A;  3SIA A;  1JFJ A;  2WOR A;  4MVF A;  1MF8 B;  3CR2 A;  2IS9 A;  3TDI A;  3TS5 B;  1FF1 A;  4ZCV A;  4DUQ A;  1KK8 B;  2L98 A;  3FS7 A;  1HQV A;  1WRZ A;  1DMO A;  2K7B A;  4I5L B;  2PAS A;  1A75 B;  1S6C A;  2K7C A;  4GGF C;  1H8B A;  2HF5 A;  3KEV A;  1YVH A;  1RK9 A;  2KFF A;  3IQO A;  5AFP A;  1NCY A;  4MSP A;  4PDZ A;  4BY4 A;  1LA3 A;  1EJ3 A;  1V1G A;  1KQV A;  1OQP A;  1S5G Y;  1B8R A;  2NCO A;  1UHJ A;  1XK4 A;  3FWC A;  5IBW A;  5CSN A;  2COL B;  4PE0 A;  2M8U A;  1SL9 A;  1K2H A;  4UPG A;  3I5F B;  5DKR A;  4HRG A;  1RJV A;  4PCW A;  1J7P A;  4YGE B;  1OE9 B;  4GGF A;  2OTG B;  3BOW B;  2LVI A;  1QVI Z;  2KYC A;  3TDU A;  3TDZ A;  2PVB A;  1CLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...