4MLWA

Crystal structure of non-myristoylated recoverin at 1.45 a resolution with calcium bound to ef-hand 3
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
192
structure length
192
Chain Sequence
b'GALSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Recoverin
publication title A highly conserved cysteine of neuronal calcium-sensing proteins controls cooperative binding of Ca2+ to recoverin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 78
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2013-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4mlwA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4mlwA01
2EC6C 4PE1A 1EXRA 3KF9A 3TUYB 1K93D 4FTGA 3TS5C 4M2QA 1QIVA 2QPTA 5D69A 1YVLA 1TTXA 2KAXA 2O60A 4OR9B 3FWCA 1DT7B 2ZNEA 1E8AA 2CT9A 1NX3A 2I7AA 1XFZO 5BPJA 2ZN9A 2KYCA 3LK1A 1MUXA 1EG4A 5CSJA 2FOTA 1DGUA 2BL0B 1SYMA 1WLMA 5CSIA 2CNPA 1XFYO 1YTZC 2LLSA 3A8RA 4E68A 1NCZA 1EJ3A 1LA3A 1QVIZ 2E30A 2EC6B 4ZCVA 2NXQA 1N65A 2OTGC 1KCYA 1FBVA 1CMGA 1BOCA 4JQ0D 1J1EA 1KFXS 3TS5B 2COLB 3SIAA 4F0ZB 5JJGA 2DOQA 1G8IA 1QIWA 2LV7A 1WDCC 3FS7A 3TDIA 2RGIA 1NX0A 1M46A 1S6JA 4OKHA 1CLLA 4DS7A 1FPWA 4PALA 4GGNA 3PFVA 1LINA 5CSFA 2EHBA 1KFXL 1OMDA 4MN0A 1OMRA 1DJXA 1QVIY 2MHHA 2AUCA 3LCPC 2JULA 1SK6D 3VRNA 1FW4A 4AOMA 1X02A 2O5GA 1CFCA 1TNQA 2OTGB 2NCOA 4WRIA 3D0YA 2LVKA 3PALA 5DKRA 1J7QA 1LKJA 2L2EA 4YGAA 1AJ5A 1UUSA 2LCPA 4MEWA 1BLQA 2KDHA 1WDCB 5HKZA 3O78A 1QX7A 3O4YA 4I5LB 5HKWA 2M29A 3ICBA 2ZRSA 3VROA 1C07A 5K89A 4AQJA 1C7WA 2LAPA 3DVKA 3EK4A 1F55A 1U5IA 4C0KA 3LLEA 1QX5B 3BUOB 1GGWA 3I5IC 1B7TZ 3KPXA 1XVJA 1YX7A 1LA0A 3BQ3A 1G33A 2KFFA 2Q4UA 4USLA 1HQVA 2AMIA 5ER4X 2PALA 2PASA 2H61A 1JBAA 1JWDA 4PHMA 1SCMC 2BCXA 3AAJA 1SCVA 1A29A 3OHMB 2CTNA 4P2YB 2MRDA 1CFPA 2F3YA 1QATA 1NCYA 2NZ0A 1CKKA 3NSOA 5AFPA 4YBHB 2JC2A 2FCEA 5HKYA 4Q04A 2LHIA 3SG6A 1B7TY 1YR5A 1IQ5A 1SNLA 2JPTA 2L4HA 2CCMA 1K95A 1V1GA 3QRXA 1NWDA 2M0RA 3CR4X 2JRFA 3FWBA 4DIRA 3EK8A 3NSKA 2JNXA 3I5IB 1FF1A 2LM5A 4PHKA 5HYDA 4MZJA 1DF0A 2CBLA 3GK2A 1HT9A 2MJWB 4NDCA 2PVBA 1J7OA 1MQ1A 3A4UB 2ISDA 1KFUS 5AEQA 1B1GA 3CS1A 4HRHA 1S1EA 2Y4QA 1SCMB 2PRUA 3HCMA 3WXAA 1B47A 1IH0A 1SRAA 1IRJA 1R6PA 3NSIA 2KBIA 2LP2A 3DVEA 5I2OA 5KTYA 1TNPA 2KI6C 1CMFA 1J7RA 1SW8A 1KFUL 1KK7Y 2LVVA 5CSNA 1KK8C 2LVIA 3WNXB 2L5XB 2KFHA 1J1DA 1L2OC 3CTNA 3JVTC 1BT6A 4YGBB 1GQMA 4PDZA 1DJHA 1F4OA 1N2DA 2KQYA 1SKTA 4M2OA 3O2PA 1DJZA 3CZTX 4C0JA 1RTP1 2GV5A 2M1KB 3SIBA 1K9UA 4D1EA 4YGCB 1MR8A 2L98A 3DD4A 3MSEB 1EL4A 4NQGA 1MWNA 1DF0B 3IQOA 1IJ5A 1G4YR 2PSRA 1QX2A 3BOWA 3E3RA 2F8PA 2F2OA 1EG3A 1SR6C 1K96A 2KNEA 5DKQA 1Y6WA 4GGFA 1GJYA 1S5GZ 1KK8B 4ORBB 5GQQC 2M7LA 1NIWA 2K0JA 2QACA 3AAKA 2G2BA 4YRUA 1L2OB 4CIDA 1JC2A 1NX1A 1BR1B 2TN4A 1B9AA 1H8BA 3NXAA 5HLOA 1AVSA 1Y0VH 1S3PA 2KAYA 3LK0A 1GGZA 4TNCA 1OOJA 4CLNA 4CFQA 1PRWA 2E6WA 1VRKA 2AAOA 2A4JA 5FYXA 1BMOA 2JXLA 3AKAA 1PULA 1OZSA 2D8NA 3KHEA 1CDPA 1FI6A 3PN7C 1DTLA 1S5GY 4MBEA 4U8DA 2L4IA 2MBXA 3VRPA 2R2IA 1SL8A 3DF0A 1ZACA 4IL1A 1OMVA 2K2FA 2MA2A 1SR6B 1ODBA 2V53A 1MXLC 1ZFSA 3H4SE 4JWQA 1S26D 2WOSA 3BUWB 1JSAA 1B8CA 1A75A 2KAVA 2K8MB 1S6IA 1BF5A 3EVUA 4PHNA 2FJUB 2I94A 2VRGA 1F71A 1IWQA 1SL7A 3EK7A 2LHLA 2LMTA 3O6BA 1PSBA 1WY9A 2M7NA 3AKBA 5HLVA 1TCOB 3BXKA 3ZWHA 1CTRA 3PLFB 4HREE 4DRWA 2B1UA 1YUUA 3OX5A 4QJ3B 1BG1A 3PN7B 3I5GC 4GUKA 1ZOTB 5I2LA 1WLZA 4CFRA 2M49B 2JXCA 2WCFA 1A4PA 1UHIA 2JQ6A 2HQWA 5ER5A 2K7DA 2Y5IA 1PALA 4NDDA 4N5XA 1TOPA 1K9KA 2JT0A 4XJKA 4GNKB 2BE6A 1CB1A 2K7OA 2GGMA 1K90D 1RECA 1M31A 1SL9A 2H61C 3KO0A 1QASA 1DJGA 2LLUA 3IF7A 3D0YB 4QJ5B 3VRQA 1K8UA 4MRYA 1FI5A 3CLNA 2LLTA 4BY5A 1XO5A 1CFDA 1JUOA 1DJWA 1NYAA 3CR5X 3VRRA 1KQMC 1N0YA 2Y1MA 1KK7Z 1UURA 3I5GB 4YGEB 1V1FA 4UPGA 1OQPA 4OV2A 3VGOA 1U5IB 1NX2A 1PSRA 5CPVA 1B8LA 2ZN8A 1AP4A 4FQOA 4MLWA 2KQ6A 1L7ZA 4PCWA 2ZKMX 2L50A 4MVFA 3CR2A 2K2AA 1AK8A 1MF8B 3OB2B 5AANA 4A4CA 2H2KA 1DVIA 1OSAA 1QXPA 1EH2A 1LXFC 3WHUB 3GK4X 1TNWA 1KSMA 1WRZA 2F33A 2M9GA 4HSZA 2KFGA 1CM1A 1SY9A 1QV0A 1UHHA 1Y1XA 4XJKB 1KQMB 1OE9B 1PVBA 3SG2A 1A03A 1NUBA 3K21A 4GBAA 1XK4A 3LL8B 1Y1AA 1NPQA 3OB1B 1JF2A 1XA5A 1TRFA 4ORAB 2KGBC 1SMGA 1B4CA 3FIAA 2BBMA 1K9PA 4GPLB 4YI9A 5AXIA 1KWOC 2M1UA 1UHNA 2L0PA 4DUQA 3RM1A 1CDNA 1UP5A 1XFWO 1QLKA 1TIZA 2Q91A 3TDZA 2MLFC 4PE0A 5I2QA 1XK4C 5KU1A 1JFJA 4MZLA 3EKHA 1RJVA 2WORA 2WCBA 1XYDA 1YVHA 3EVRA 4ICBA 1IG5A 2WCEA 2KI4C 1F8HA 1PK0D 4GFTA 4PE4A 4JPZB 2BCBA 2EGDA 1ALWA 5D7FA 2I18A 3JVTB 4WQ3A 3SG7A 2BKHB 1CLMA 1TN4A 1R2UA 1W7IB 2K7BA 1DJIA 2SASA 4I5KA 3PSRA 1SBJA 1YUSA 5B8IB 1Q80A 2M3WA 1YRTB 5F6TA 2M8UA 1UHKA 1WRLA 1BODA 3TZ1A 1UHJA 1OZOA 3I5FC 2BCAA 4GGFC 4A4BA 2JTZA 2OS8C 4XYNA 1BJFA 2I2RE 2KOTA 4ZCUA 1XFVO 2F2PA 4PE7A 1KWOB 1BR4B 2JOJA 2LMVA 1DJYA 4N1GA 5TNCA 2JT3A 4M2PA 4I5NB 2LC5A 2HF5A 1J55A 1IKUA 3BUNB 1LVCD 1F70A 4YI8A 5PALA 3SJSA 1S6CA 1XFXO 1A2XA 4YGDB 2NLNA 2KI4B 2ZNDA 1M39A 1JF0A 2K61A 1BU3A 2ZRTA 2ZFDA 2GGZA 1KSOA 1QTXA 4C0LA 2SCPA 2KYFA 4QJ4B 3BOWB 2JNFA 2Y1NA 1AUIB 2LUXA 1RWYA 1AHRA 2JT8A 1CNPA 4I5JA 1DMOA 1RROA 3I5FB 4MSPA 1S36A 2JTTA 4R1EA 3RLZA 2OS8B 4OCIA 3M0WA 5G08A 4N1FA 3SG5A 1CDLA 2KGRA 3PATA 4WQ2A 3EVVA 1MXEA 2LNKA 5IBWA 4ORCB 3D10A 1W7JB 3NSLA 3CWGA 2LMUA 1ALVA 3EKJA 1CFFA 1NSHA 1F54A 2BECA 1RFJA 1SPYA 2JU0A 3WHTB 4DCKA 1D1OA 4MRXA 1TNXA 2MLEC 4NDBA 1JFKA 3PM8A 1ZUZA 1K94A 1IQ3A 5J3XA 1CM4A 3I5HC 4PHJA 3OX6A 2WNDA 3CGAA 1QS7A 1J7PA 2KBMA 2NCPA 3DF0B 2BBNA 1RK9A 5DKNA 5JOLA 2G9BA 2P6BB 4P5OE 1KQVA 1Y1UA 1A75B 2WC8A 3JTDC 2HETA 2HQ8A 3SG3A 1CDMA 3OP0A 1C7VA 2KSPA 3BUMB 5KSZA 2LANA 3F45A 4OVNF 1IGVA 1TCFA 2LE9B 4L9MA 2MAZA 3GOFA 3BUXB 1QLSA 2CXJA 1YRUB 2KHNA 3KEVA 3BYAA 1CLBA 1WRKA 4AQIA 3TUYC 1YURA 2M97A 1QJTA 1B8RA 2LVJA 4MZKA 2IS9A 2PMYA 2L51A 3I5HB 1M63B 4HRGA 1K2HA 2K7CA 1UWOA 4ETOA 3IQQA 1IJ6A 3GK1A 4BY4A 1F4QA 1YUTA 1XFUO 4GAOA 2F3ZA 1PVAA 3TDUA 3ZNIA 3C1VA 1H4BA 2LP3A 2FCDA 1MHOA 2BE4A 3JTDB 1AJ4A 4CPVA 1NCXA 5AERA 5I8NA 1NP8A 2BL0C 3DVMA 3SG4A 1QV1A 3HX4A 2JZIA 2KI6D 2HPSA 1ZMZA 2LUCA 1M45A 2OPOA 2BKIB 2JWWA 1DGVA 1YX8A 3DVJA
chains in the Genus database with same CATH superfamily
2EC6C 4PE1A 1EXRA 3R1OA 3KF9A 3TUYB 1K93D 4FTGA 3TS5C 4M2QA 1QIVA 5HL1A 2QPTA 5D69A 1YVLA 2BNXA 1TTXA 2KAXA 4KYNA 2O60A 4OR9B 3FWCA 1DT7B 2ZNEA 1E8AA 2CT9A 1NX3A 2I7AA 1XFZO 1SSEB 5BPJA 2ZN9A 2KYCA 3LK1A 1MUXA 1EG4A 3UNWA 5CSJA 2FOTA 1DGUA 2BL0B 1SYMA 1WLMA 5CSIA 2CNPA 1XFYO 1YTZC 3FE9A 2LLSA 3A8RA 4E68A 1NCZA 1EJ3A 1LA3A 1QVIZ 2E30A 2EC6B 3Q8IA 2NXQA 4ZCVA 1N65A 2OTGC 1KCYA 1FBVA 2WCHA 2K60A 3CZ0A 1CMGA 4JQ0D 1J1EA 1BOCA 1KFXS 3TS5B 1ORGA 2COLB 3SIAA 4F0ZB 5JJGA 1P28A 2DOQA 1G8IA 1QIWA 3SS3A 2LV7A 1WDCC 3FS7A 3TDIA 2RGIA 1NX0A 1M46A 1S6JA 4OKHA 1CLLA 4DS7A 1FPWA 4PALA 4GGNA 3PFVA 1LINA 5CSFA 2EHBA 1KFXL 1OMDA 4MN0A 1OMRA 1IIOA 1DJXA 1QVIY 2MHHA 3S0FA 2AUCA 3LCPC 3O4XA 2JULA 1SK6D 3VRNA 1FW4A 4AOMA 1X02A 1C3ZA 2O5GA 2QEBA 1CFCA 1TNQA 2OTGB 1OOFA 2WCKA 1DELA 2NCOA 4WRIA 3D0YA 2LVKA 3PALA 5DKRA 1J7QA 1LKJA 2L2EA 4YGAA 1AJ5A 1UUSA 2LCPA 3NGVA 4MEWA 2M7LA 3L4AA 1BLQA 2KDHA 1WDCB 3EG5B 5HKZA 3O78A 1QX7A 3O4YA 4I5LB 5HKWA 2M29A 3ICBA 2ZRSA 3S0DA 3VROA 1C07A 5K89A 4AQJA 1C7WA 2LAPA 3DVKA 3EK4A 1F55A 1U5IA 4C0KA 3LLEA 1QX5B 3BUOB 1GGWA 3D78A 1GM0A 3I5IC 3S0EA 1B7TZ 2QEVA 3KPXA 1XVJA 1YX7A 1LA0A 3BQ3A 1G33A 2KFFA 2Q4UA 4USLA 1HQVA 2AMIA 5ER4X 2PALA 3PM2A 2PASA 2H61A 1JBAA 1JWDA 4PHMA 5FI7A 1SCMC 2BCXA 2P71A 1SCVA 1A29A 3AAJA 2CTNA 3OHMB 4P2YB 2MRDA 1CFPA 2F3YA 1QATA 1NCYA 2NZ0A 1CKKA 3NSOA 5AFPA 4YBHB 2JC2A 2FCEA 5HKYA 3RZSA 4INXA 5DICA 4Q04A 2LHIA 3SG6A 1B7TY 1YR5A 1IQ5A 1SNLA 2JPTA 2L4HA 2CCMA 3D75A 1K95A 5EL2A 1V1GA 3QRXA 1NWDA 2M0RA 3CR4X 2YGUA 2JRFA 3FWBA 4DIRA 3EK8A 3NSKA 2JNXA 3I5IB 1FF1A 2LM5A 4PHKA 5HYDA 4MZJA 1DF0A 2CBLA 3GK2A 1HT9A 3OBVA 2MJWB 4NDCA 3IVTA 2GTEA 2PVBA 1J7OA 1MQ1A 3A4UB 2ISDA 1KFUS 5AEQA 1B1GA 2PQLA 3CS1A 1S1EA 2Y4QA 4HRHA 1SCMB 2PRUA 3HCMA 3WXAA 1B47A 1IH0A 1SRAA 1IRJA 1R6PA 3NSIA 2KBIA 2LP2A 3DXLA 1OW4A 3DVEA 5I2OA 5KTYA 1TNPA 2KI6C 1CMFA 1J7RA 1SW8A 1KFUL 1KK7Y 2LVVA 3DY9A 2KLDA 5CSNA 1KK8C 2LVIA 3WNXB 2L5XB 2KFHA 1J1DA 1L2OC 3CTNA 3JVTC 1BT6A 3L4LA 4YGBB 1GQMA 4INWA 4PDZA 1DJHA 1F4OA 1N2DA 2KQYA 1SKTA 4M2OA 3O2PA 1DJZA 3CZTX 4C0JA 1RTP1 2GV5A 2M1KB 3SIBA 1K9UA 4D1EA 4YGCB 1MR8A 1DC1A 2L98A 3NHTA 3SS4A 2PYQA 3CZ2A 3DD4A 3MSEB 1EL4A 4NQGA 2QEHA 1MWNA 1DF0B 3IQOA 1IJ5A 1G4YR 2PSRA 1QX2A 3BOWA 3E3RA 3BJHA 2F8PA 2F2OA 1EG3A 1SR6C 1K96A 2KNEA 5DKQA 1Y6WA 4GGFA 1GJYA 1S5GZ 1KK8B 2WCJA 4ORBB 5GQQC 1NIWA 2K0JA 2QACA 3AAKA 2G2BA 4YRUA 1L2OB 4CIDA 1JC2A 1NX1A 3BFAA 1BR1B 2TN4A 1B9AA 1H8BA 3NXAA 5HLOA 1AVSA 1Y0VH 1S3PA 2KAYA 3LK0A 1GGZA 4TNCA 1OOJA 4CLNA 4CFQA 5I94A 1DQEA 1PRWA 2E6WA 1VRKA 2AAOA 2A4JA 5FYXA 1BMOA 2JXLA 3AKAA 1PULA 1OZSA 2D8NA 3KHEA 1CDPA 1FI6A 2WCLA 3PN7C 1DTLA 1S5GY 1T14A 4MBEA 4U8DA 2L4IA 2MBXA 3D74A 3VRPA 2KLEA 2R2IA 1SL8A 3DF0A 1ZACA 4IL1A 1OMVA 1DEKA 2K2FA 2MA2A 1SR6B 1ODBA 2V53A 1MXLC 1ZFSA 3H4SE 3QMEA 1S26D 2WOSA 3BUWB 4JWQA 1JSAA 1B8CA 1A75A 3FE6A 2KAVA 2K8MB 1S6IA 1BF5A 3EVUA 4PHNA 2FJUB 2I94A 2VRGA 1F71A 1IWQA 1SL7A 1OOHA 3EK7A 2LHLA 2LMTA 3O6BA 3V2LA 1PSBA 1WY9A 2M7NA 3AKBA 3OGNA 5HLVA 1TCOB 3BXKA 3ZWHA 1CTRA 3PLFB 3CDNA 4HREE 4DRWA 3K1EA 2B1UA 1YUUA 3OX5A 4QJ3B 1BG1A 3PN7B 3I5GC 4GUKA 1ZOTB 5I2LA 1WLZA 4CFRA 2M49B 2JXCA 2WCFA 1A4PA 1UHIA 2JQ6A 2HQWA 5ER5A 2K7DA 2Y5IA 3PJIA 3BFBA 1PALA 4NDDA 4N5XA 3FE8A 1TOPA 1K9KA 2JT0A 2WCMA 4XJKA 2QEOA 4GNKB 2BE6A 1CB1A 2K7OA 2GGMA 1K90D 1RECA 1M31A 1SL9A 2H61C 3KO0A 1QASA 1DJGA 2LLUA 3IF7A 3D0YB 4QJ5B 3VRQA 3DZTA 1K8UA 4IJ7A 4MRYA 3CLNA 4JKTA 1FI5A 2LLTA 4BY5A 1XO5A 1CFDA 1JUOA 1DJWA 1NYAA 3CR5X 3VRRA 1KQMC 1W9ZA 1N0YA 3B86A 2Y1MA 3VB1A 1KK7Z 1UURA 3I5GB 4YGEB 2QDIA 1V1FA 4UPGA 1OQPA 4OV2A 3VGOA 1U5IB 1NX2A 1PSRA 5CPVA 5FI2A 1B8LA 2ZN8A 1AP4A 4FQOA 4MLWA 2KQ6A 1L7ZA 4PCWA 2ZKMX 2L50A 1OOIX 4MVFA 3CR2A 2K2AA 1AK8A 1MF8B 3OB2B 5AANA 4A4CA 2H2KA 1DVIA 1OSAA 1QXPA 1EH2A 1LXFC 1OOGA 3WHUB 3GK4X 1TNWA 1KSMA 1WRZA 2F33A 2M9GA 4HSZA 3S0AA 2KFGA 1CM1A 1SY9A 1QV0A 1UHHA 1Y1XA 4XJKB 1KQMB 1OE9B 1PVBA 3SG2A 1A03A 1NUBA 3K21A 4GBAA 1XK4A 3LL8B 1Y1AA 1NPQA 1LS8A 3OB1B 1JF2A 1XA5A 1TRFA 3B88A 4ORAB 2KGBC 1SMGA 1XFRA 3FIAA 1B4CA 2BBMA 1K9PA 4GPLB 4YI9A 5AXIA 1KWOC 2M1UA 1UHNA 3N7HA 2L0PA 4DUQA 3RM1A 1CDNA 1UP5A 1XFWO 3D77A 1QLKA 1TIZA 2KPHA 2Q91A 3TDZA 2MLFC 4PE0A 3BFHA 2H8VA 5I2QA 1XK4C 5KU1A 1JFJA 3DYEA 3EKHA 4MZLA 1RJVA 2WORA 2WCBA 1XYDA 2FJYA 1YVHA 3EVRA 4ICBA 1IG5A 2WCEA 2KI4C 2WC5A 1F8HA 1PK0D 4GFTA 4PE4A 4JPZB 2BCBA 2EGDA 1ALWA 5D7FA 2I18A 3JVTB 4WQ3A 4PT1A 3SG7A 1CLMA 2BKHB 1TN4A 1R2UA 1W7IB 4FQTA 2K7BA 1DJIA 2SASA 3L47A 4I5KA 3PSRA 1SBJA 1YUSA 5B8IB 2BAPA 1Q80A 2M3WA 1YRTB 5F6TA 2M8UA 1UHKA 1WRLA 1BODA 3TZ1A 1UHJA 1OZOA 4JD9A 3I5FC 2BCAA 4GGFC 4A4BA 2JTZA 2OS8C 4XYNA 1BJFA 2I2RE 2KOTA 2WC6A 3CZ1A 1XFVO 2F2PA 4PE7A 4ZCUA 1KWOB 1BR4B 2JOJA 2LMVA 1DJYA 4N1GA 5TNCA 2JT3A 4M2PA 4I5NB 2LC5A 5D3OA 2HF5A 1J55A 1IKUA 3BUNB 1LVCD 1F70A 4YI8A 5PALA 3SJSA 1S6CA 1XFXO 2ERBA 5FI6A 1A2XA 4YGDB 2NLNA 2KI4B 2L5YA 2ZNDA 1M39A 1JF0A 1Z2CB 3CYZA 2K61A 1BU3A 1TUJA 2ZRTA 1C3YA 2ZFDA 2GGZA 1KSOA 1QTXA 4C0LA 3B7AA 2SCPA 2KYFA 4QJ4B 3BOWB 2JNFA 2Y1NA 1AUIB 2LUXA 1RWYA 1AHRA 2JT8A 1CNPA 4I5JA 1DMOA 1RROA 3I5FB 4MSPA 1S36A 2JTTA 4R1EA 3RLZA 2OS8B 4OCIA 1QWVA 3M0WA 5G08A 4N1FA 3SG5A 1CDLA 3D76A 2KGRA 3PATA 4WQ2A 3EVVA 1MXEA 2LNKA 5IBWA 4ORCB 3D10A 1W7JB 3NSLA 3CWGA 2LMUA 1ALVA 3EKJA 1CFFA 1NSHA 3R1VA 1F54A 2BECA 1RFJA 1SPYA 2JU0A 3S0BA 3B6XA 3WHTB 4DCKA 1D1OA 4MRXA 1TNXA 4F7FA 2MLEC 4NDBA 1JFKA 3PM8A 1ZUZA 1K94A 1IQ3A 5J3XA 1CM4A 3I5HC 4PHJA 3R72A 3OX6A 2WNDA 3CGAA 1QS7A 1J7PA 2KBMA 2NCPA 3DF0B 3UO9A 2BBNA 1RK9A 5DKNA 5JOLA 2G9BA 2P6BB 4P5OE 4OZDA 1KQVA 3NHIA 1Y1UA 1A75B 2WC8A 3JTDC 2HETA 2HQ8A 3SG3A 1CDMA 3OP0A 1C7VA 2KSPA 3BUMB 5KSZA 2LANA 3F45A 3R1PA 4OVNF 1IGVA 1TCFA 2LE9B 4L9MA 2MAZA 3GOFA 3BUXB 1QLSA 2CXJA 1YRUB 2KHNA 3KEVA 3BYAA 1CLBA 1WRKA 2P70A 4AQIA 3TUYC 1YURA 2M97A 3B87A 1QJTA 1B8RA 2LVJA 2JPOA 2IS9A 4MZKA 3CABA 1Z4HA 2PMYA 2L51A 3I5HB 3S0GA 1M63B 4HRGA 1K2HA 1TUZA 2K7CA 1TWOA 1UWOA 4ETOA 3IQQA 1IJ6A 3GK1A 4BY4A 1F4QA 1YUTA 1XFUO 4GAOA 3SS5A 2F3ZA 1PVAA 3TDUA 3D73A 3C1VA 2L2CA 3ZNIA 1H4BA 2LP3A 2FCDA 1MHOA 2BE4A 3JTDB 1AJ4A 4CPVA 1NCXA 5AERA 5I8NA 1NP8A 2BL0C 3DVMA 3SG4A 1QV1A 3HX4A 2JZIA 2KI6D 2HPSA 1ZMZA 2LUCA 1M45A 2OPOA 2BKIB 2JWWA 1DGVA 1YX8A 3DVJA
chains in the Genus database with same CATH topology
2EC6C 4PE1A 1EXRA 3KF9A 3TUYB 1K93D 4FTGA 3TS5C 4M2QA 1QIVA 2QPTA 5D69A 1YVLA 1TTXA 2KAXA 2O60A 4OR9B 3FWCA 1DT7B 2ZNEA 1E8AA 2CT9A 1NX3A 2I7AA 1XFZO 5BPJA 2ZN9A 2KYCA 3LK1A 1MUXA 1EG4A 5CSJA 2FOTA 1DGUA 2BL0B 1SYMA 1WLMA 5CSIA 2CNPA 1XFYO 1YTZC 2LLSA 3A8RA 4E68A 1NCZA 1EJ3A 1LA3A 1QVIZ 2E30A 2EC6B 4ZCVA 2NXQA 1N65A 2OTGC 1KCYA 1FBVA 1CMGA 1BOCA 4JQ0D 1J1EA 1KFXS 3TS5B 2COLB 3SIAA 4F0ZB 5JJGA 2DOQA 1G8IA 1QIWA 2LV7A 1WDCC 3FS7A 3TDIA 2RGIA 1NX0A 1M46A 1S6JA 4OKHA 1CLLA 4DS7A 1FPWA 4PALA 4GGNA 3PFVA 1LINA 5CSFA 2EHBA 1KFXL 1OMDA 4MN0A 1OMRA 1DJXA 1QVIY 2MHHA 2AUCA 3LCPC 2JULA 1SK6D 3VRNA 1FW4A 4AOMA 1X02A 2O5GA 1CFCA 1TNQA 2OTGB 2NCOA 4WRIA 3D0YA 2LVKA 3PALA 5DKRA 1J7QA 1LKJA 2L2EA 4YGAA 1AJ5A 1UUSA 2LCPA 4MEWA 1BLQA 2KDHA 1WDCB 5HKZA 3O78A 1QX7A 3O4YA 4I5LB 5HKWA 2M29A 3ICBA 2ZRSA 3VROA 1C07A 5K89A 4AQJA 1C7WA 2LAPA 3DVKA 3EK4A 1F55A 1U5IA 4C0KA 3LLEA 1QX5B 3BUOB 1GGWA 3I5IC 1B7TZ 3KPXA 1XVJA 1YX7A 1LA0A 3BQ3A 1G33A 2KFFA 2Q4UA 4USLA 1HQVA 2AMIA 5ER4X 2PALA 2PASA 2H61A 1JBAA 1JWDA 4PHMA 1SCMC 2BCXA 3AAJA 1SCVA 1A29A 3OHMB 2CTNA 4P2YB 2MRDA 1CFPA 2F3YA 1QATA 1NCYA 2NZ0A 1CKKA 3NSOA 5AFPA 4YBHB 2JC2A 2FCEA 5HKYA 4Q04A 2LHIA 3SG6A 1B7TY 1YR5A 1IQ5A 1SNLA 2JPTA 2L4HA 2CCMA 1K95A 1V1GA 3QRXA 1NWDA 2M0RA 3CR4X 2JRFA 3FWBA 4DIRA 3EK8A 3NSKA 2JNXA 3I5IB 1FF1A 2LM5A 4PHKA 5HYDA 4MZJA 1DF0A 2CBLA 3GK2A 1HT9A 2MJWB 4NDCA 2PVBA 1J7OA 1MQ1A 3A4UB 2ISDA 1KFUS 5AEQA 1B1GA 3CS1A 4HRHA 1S1EA 2Y4QA 1SCMB 2PRUA 3HCMA 3WXAA 1B47A 1IH0A 1SRAA 1IRJA 1R6PA 3NSIA 2KBIA 2LP2A 3DVEA 5I2OA 5KTYA 1TNPA 2KI6C 1CMFA 1J7RA 1SW8A 1KFUL 1KK7Y 2LVVA 5CSNA 1KK8C 2LVIA 3WNXB 2L5XB 2KFHA 1J1DA 1L2OC 3CTNA 3JVTC 1BT6A 4YGBB 1GQMA 4PDZA 1DJHA 1F4OA 1N2DA 2KQYA 1SKTA 4M2OA 3O2PA 1DJZA 3CZTX 4C0JA 1RTP1 2GV5A 2M1KB 3SIBA 1K9UA 4D1EA 4YGCB 1MR8A 2L98A 3DD4A 3MSEB 1EL4A 4NQGA 1MWNA 1DF0B 3IQOA 1IJ5A 1G4YR 2PSRA 1QX2A 3BOWA 3E3RA 2F8PA 2F2OA 1EG3A 1SR6C 1K96A 2KNEA 5DKQA 1Y6WA 4GGFA 1GJYA 1S5GZ 1KK8B 4ORBB 5GQQC 2M7LA 1NIWA 2K0JA 2QACA 3AAKA 2G2BA 4YRUA 1L2OB 4CIDA 1JC2A 1NX1A 1BR1B 2TN4A 1B9AA 1H8BA 3NXAA 5HLOA 1AVSA 1Y0VH 1S3PA 2KAYA 3LK0A 1GGZA 4TNCA 1OOJA 4CLNA 4CFQA 1PRWA 2E6WA 1VRKA 2AAOA 2A4JA 5FYXA 1BMOA 2JXLA 3AKAA 1PULA 1OZSA 2D8NA 3KHEA 1CDPA 1FI6A 3PN7C 1DTLA 1S5GY 4MBEA 4U8DA 2L4IA 2MBXA 3VRPA 2R2IA 1SL8A 3DF0A 1ZACA 4IL1A 1OMVA 2K2FA 2MA2A 1SR6B 1ODBA 2V53A 1MXLC 1ZFSA 3H4SE 4JWQA 1S26D 2WOSA 3BUWB 1JSAA 1B8CA 1A75A 2KAVA 2K8MB 1S6IA 1BF5A 3EVUA 4PHNA 2FJUB 2I94A 2VRGA 1F71A 1IWQA 1SL7A 3EK7A 2LHLA 2LMTA 3O6BA 1PSBA 1WY9A 2M7NA 3AKBA 5HLVA 1TCOB 3BXKA 3ZWHA 1CTRA 3PLFB 4HREE 4DRWA 2B1UA 1YUUA 3OX5A 4QJ3B 1BG1A 3PN7B 3I5GC 4GUKA 1ZOTB 5I2LA 1WLZA 4CFRA 2M49B 2JXCA 2WCFA 1A4PA 1UHIA 2JQ6A 2HQWA 5ER5A 2K7DA 2Y5IA 1PALA 4NDDA 4N5XA 1TOPA 1K9KA 2JT0A 4XJKA 4GNKB 2BE6A 1CB1A 2K7OA 2GGMA 1K90D 1RECA 1M31A 1SL9A 2H61C 3KO0A 1QASA 1DJGA 2LLUA 3IF7A 3D0YB 4QJ5B 3VRQA 1K8UA 4MRYA 1FI5A 3CLNA 2LLTA 4BY5A 1XO5A 1CFDA 1JUOA 1DJWA 1NYAA 3CR5X 3VRRA 1KQMC 1N0YA 2Y1MA 1KK7Z 1UURA 3I5GB 4YGEB 1V1FA 4UPGA 1OQPA 4OV2A 3VGOA 1U5IB 1NX2A 1PSRA 5CPVA 1B8LA 2ZN8A 1AP4A 4FQOA 4MLWA 2KQ6A 1L7ZA 4PCWA 2ZKMX 2L50A 4MVFA 3CR2A 2K2AA 1AK8A 1MF8B 3OB2B 5AANA 4A4CA 2H2KA 1DVIA 1OSAA 1QXPA 1EH2A 1LXFC 3WHUB 3GK4X 1TNWA 1KSMA 1WRZA 2F33A 2M9GA 4HSZA 2KFGA 1CM1A 1SY9A 1QV0A 1UHHA 1Y1XA 4XJKB 1KQMB 1OE9B 1PVBA 3SG2A 1A03A 1NUBA 3K21A 4GBAA 1XK4A 3LL8B 1Y1AA 1NPQA 3OB1B 1JF2A 1XA5A 1TRFA 4ORAB 2KGBC 1SMGA 1B4CA 3FIAA 2BBMA 1K9PA 4GPLB 4YI9A 5AXIA 1KWOC 2M1UA 1UHNA 2L0PA 4DUQA 3RM1A 1CDNA 1UP5A 1XFWO 1QLKA 1TIZA 2Q91A 3TDZA 2MLFC 4PE0A 5I2QA 1XK4C 5KU1A 1JFJA 4MZLA 3EKHA 1RJVA 2WORA 2WCBA 1XYDA 1YVHA 3EVRA 4ICBA 1IG5A 2WCEA 2KI4C 1F8HA 1PK0D 4GFTA 4PE4A 4JPZB 2BCBA 2EGDA 1ALWA 5D7FA 2I18A 3JVTB 4WQ3A 3SG7A 2BKHB 1CLMA 1TN4A 1R2UA 1W7IB 2K7BA 1DJIA 2SASA 4I5KA 3PSRA 1SBJA 1YUSA 5B8IB 1Q80A 2M3WA 1YRTB 5F6TA 2M8UA 1UHKA 1WRLA 1BODA 3TZ1A 1UHJA 1OZOA 3I5FC 2BCAA 4GGFC 4A4BA 2JTZA 2OS8C 4XYNA 1BJFA 2I2RE 2KOTA 4ZCUA 1XFVO 2F2PA 4PE7A 1KWOB 1BR4B 2JOJA 2LMVA 1DJYA 4N1GA 5TNCA 2JT3A 4M2PA 4I5NB 2LC5A 2HF5A 1J55A 1IKUA 3BUNB 1LVCD 1F70A 4YI8A 5PALA 3SJSA 1S6CA 1XFXO 1A2XA 4YGDB 2NLNA 2KI4B 2ZNDA 1M39A 1JF0A 2K61A 1BU3A 2ZRTA 2ZFDA 2GGZA 1KSOA 1QTXA 4C0LA 2SCPA 2KYFA 4QJ4B 3BOWB 2JNFA 2Y1NA 1AUIB 2LUXA 1RWYA 1AHRA 2JT8A 1CNPA 4I5JA 1DMOA 1RROA 3I5FB 4MSPA 1S36A 2JTTA 4R1EA 3RLZA 2OS8B 4OCIA 3M0WA 5G08A 4N1FA 3SG5A 1CDLA 2KGRA 3PATA 4WQ2A 3EVVA 1MXEA 2LNKA 5IBWA 4ORCB 3D10A 1W7JB 3NSLA 3CWGA 2LMUA 1ALVA 3EKJA 1CFFA 1NSHA 1F54A 2BECA 1RFJA 1SPYA 2JU0A 3WHTB 4DCKA 1D1OA 4MRXA 1TNXA 2MLEC 4NDBA 1JFKA 3PM8A 1ZUZA 1K94A 1IQ3A 5J3XA 1CM4A 3I5HC 4PHJA 3OX6A 2WNDA 3CGAA 1QS7A 1J7PA 2KBMA 2NCPA 3DF0B 2BBNA 1RK9A 5DKNA 5JOLA 2G9BA 2P6BB 4P5OE 1KQVA 1Y1UA 1A75B 2WC8A 3JTDC 2HETA 2HQ8A 3SG3A 1CDMA 3OP0A 1C7VA 2KSPA 3BUMB 5KSZA 2LANA 3F45A 4OVNF 1IGVA 1TCFA 2LE9B 4L9MA 2MAZA 3GOFA 3BUXB 1QLSA 2CXJA 1YRUB 2KHNA 3KEVA 3BYAA 1CLBA 1WRKA 4AQIA 3TUYC 1YURA 2M97A 1QJTA 1B8RA 2LVJA 4MZKA 2IS9A 2PMYA 2L51A 3I5HB 1M63B 4HRGA 1K2HA 2K7CA 1UWOA 4ETOA 3IQQA 1IJ6A 3GK1A 4BY4A 1F4QA 1YUTA 1XFUO 4GAOA 2F3ZA 1PVAA 3TDUA 3ZNIA 3C1VA 1H4BA 2LP3A 2FCDA 1MHOA 2BE4A 3JTDB 1AJ4A 4CPVA 1NCXA 5AERA 5I8NA 1NP8A 2BL0C 3DVMA 3SG4A 1QV1A 3HX4A 2JZIA 2KI6D 2HPSA 1ZMZA 2LUCA 1M45A 2OPOA 2BKIB 2JWWA 1DGVA 1YX8A 3DVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EC6 C;  4PE1 A;  1EXR A;  3KF9 A;  3TUY B;  1K93 D;  4FTG A;  3TS5 C;  4M2Q A;  1QIV A;  2QPT A;  5D69 A;  1YVL A;  1TTX A;  2KAX A;  2O60 A;  4OR9 B;  3FWC A;  1DT7 B;  2ZNE A;  1E8A A;  2CT9 A;  1NX3 A;  2I7A A;  1XFZ O;  5BPJ A;  2ZN9 A;  2KYC A;  3LK1 A;  1MUX A;  1EG4 A;  5CSJ A;  2FOT A;  1DGU A;  2BL0 B;  1SYM A;  1WLM A;  5CSI A;  2CNP A;  1XFY O;  1YTZ C;  2LLS A;  3A8R A;  4E68 A;  1NCZ A;  1EJ3 A;  1LA3 A;  1QVI Z;  2E30 A;  2EC6 B;  4ZCV A;  2NXQ A;  1N65 A;  2OTG C;  1KCY A;  1FBV A;  1CMG A;  1BOC A;  4JQ0 D;  1J1E A;  1KFX S;  3TS5 B;  2COL B;  3SIA A;  4F0Z B;  5JJG A;  2DOQ A;  1G8I A;  1QIW A;  2LV7 A;  1WDC C;  3FS7 A;  3TDI A;  2RGI A;  1NX0 A;  1M46 A;  1S6J A;  4OKH A;  1CLL A;  4DS7 A;  1FPW A;  4PAL A;  4GGN A;  3PFV A;  1LIN A;  5CSF A;  2EHB A;  1KFX L;  1OMD A;  4MN0 A;  1OMR A;  1DJX A;  1QVI Y;  2MHH A;  2AUC A;  3LCP C;  2JUL A;  1SK6 D;  3VRN A;  1FW4 A;  4AOM A;  1X02 A;  2O5G A;  1CFC A;  1TNQ A;  2OTG B;  2NCO A;  4WRI A;  3D0Y A;  2LVK A;  3PAL A;  5DKR A;  1J7Q A;  1LKJ A;  2L2E A;  4YGA A;  1AJ5 A;  1UUS A;  2LCP A;  4MEW A;  1BLQ A;  2KDH A;  1WDC B;  5HKZ A;  3O78 A;  1QX7 A;  3O4Y A;  4I5L B;  5HKW A;  2M29 A;  3ICB A;  2ZRS A;  3VRO A;  1C07 A;  5K89 A;  4AQJ A;  1C7W A;  2LAP A;  3DVK A;  3EK4 A;  1F55 A;  1U5I A;  4C0K A;  3LLE A;  1QX5 B;  3BUO B;  1GGW A;  3I5I C;  1B7T Z;  3KPX A;  1XVJ A;  1YX7 A;  1LA0 A;  3BQ3 A;  1G33 A;  2KFF A;  2Q4U A;  4USL A;  1HQV A;  2AMI A;  5ER4 X;  2PAL A;  2PAS A;  2H61 A;  1JBA A;  1JWD A;  4PHM A;  1SCM C;  2BCX A;  3AAJ A;  1SCV A;  1A29 A;  3OHM B;  2CTN A;  4P2Y B;  2MRD A;  1CFP A;  2F3Y A;  1QAT A;  1NCY A;  2NZ0 A;  1CKK A;  3NSO A;  5AFP A;  4YBH B;  2JC2 A;  2FCE A;  5HKY A;  4Q04 A;  2LHI A;  3SG6 A;  1B7T Y;  1YR5 A;  1IQ5 A;  1SNL A;  2JPT A;  2L4H A;  2CCM A;  1K95 A;  1V1G A;  3QRX A;  1NWD A;  2M0R A;  3CR4 X;  2JRF A;  3FWB A;  4DIR A;  3EK8 A;  3NSK A;  2JNX A;  3I5I B;  1FF1 A;  2LM5 A;  4PHK A;  5HYD A;  4MZJ A;  1DF0 A;  2CBL A;  3GK2 A;  1HT9 A;  2MJW B;  4NDC A;  2PVB A;  1J7O A;  1MQ1 A;  3A4U B;  2ISD A;  1KFU S;  5AEQ A;  1B1G A;  3CS1 A;  4HRH A;  1S1E A;  2Y4Q A;  1SCM B;  2PRU A;  3HCM A;  3WXA A;  1B47 A;  1IH0 A;  1SRA A;  1IRJ A;  1R6P A;  3NSI A;  2KBI A;  2LP2 A;  3DVE A;  5I2O A;  5KTY A;  1TNP A;  2KI6 C;  1CMF A;  1J7R A;  1SW8 A;  1KFU L;  1KK7 Y;  2LVV A;  5CSN A;  1KK8 C;  2LVI A;  3WNX B;  2L5X B;  2KFH A;  1J1D A;  1L2O C;  3CTN A;  3JVT C;  1BT6 A;  4YGB B;  1GQM A;  4PDZ A;  1DJH A;  1F4O A;  1N2D A;  2KQY A;  1SKT A;  4M2O A;  3O2P A;  1DJZ A;  3CZT X;  4C0J A;  1RTP 1;  2GV5 A;  2M1K B;  3SIB A;  1K9U A;  4D1E A;  4YGC B;  1MR8 A;  2L98 A;  3DD4 A;  3MSE B;  1EL4 A;  4NQG A;  1MWN A;  1DF0 B;  3IQO A;  1IJ5 A;  1G4Y R;  2PSR A;  1QX2 A;  3BOW A;  3E3R A;  2F8P A;  2F2O A;  1EG3 A;  1SR6 C;  1K96 A;  2KNE A;  5DKQ A;  1Y6W A;  4GGF A;  1GJY A;  1S5G Z;  1KK8 B;  4ORB B;  5GQQ C;  2M7L A;  1NIW A;  2K0J A;  2QAC A;  3AAK A;  2G2B A;  4YRU A;  1L2O B;  4CID A;  1JC2 A;  1NX1 A;  1BR1 B;  2TN4 A;  1B9A A;  1H8B A;  3NXA A;  5HLO A;  1AVS A;  1Y0V H;  1S3P A;  2KAY A;  3LK0 A;  1GGZ A;  4TNC A;  1OOJ A;  4CLN A;  4CFQ A;  1PRW A;  2E6W A;  1VRK A;  2AAO A;  2A4J A;  5FYX A;  1BMO A;  2JXL A;  3AKA A;  1PUL A;  1OZS A;  2D8N A;  3KHE A;  1CDP A;  1FI6 A;  3PN7 C;  1DTL A;  1S5G Y;  4MBE A;  4U8D A;  2L4I A;  2MBX A;  3VRP A;  2R2I A;  1SL8 A;  3DF0 A;  1ZAC A;  4IL1 A;  1OMV A;  2K2F A;  2MA2 A;  1SR6 B;  1ODB A;  2V53 A;  1MXL C;  1ZFS A;  3H4S E;  4JWQ A;  1S26 D;  2WOS A;  3BUW B;  1JSA A;  1B8C A;  1A75 A;  2KAV A;  2K8M B;  1S6I A;  1BF5 A;  3EVU A;  4PHN A;  2FJU B;  2I94 A;  2VRG A;  1F71 A;  1IWQ A;  1SL7 A;  3EK7 A;  2LHL A;  2LMT A;  3O6B A;  1PSB A;  1WY9 A;  2M7N A;  3AKB A;  5HLV A;  1TCO B;  3BXK A;  3ZWH A;  1CTR A;  3PLF B;  4HRE E;  4DRW A;  2B1U A;  1YUU A;  3OX5 A;  4QJ3 B;  1BG1 A;  3PN7 B;  3I5G C;  4GUK A;  1ZOT B;  5I2L A;  1WLZ A;  4CFR A;  2M49 B;  2JXC A;  2WCF A;  1A4P A;  1UHI A;  2JQ6 A;  2HQW A;  5ER5 A;  2K7D A;  2Y5I A;  1PAL A;  4NDD A;  4N5X A;  1TOP A;  1K9K A;  2JT0 A;  4XJK A;  4GNK B;  2BE6 A;  1CB1 A;  2K7O A;  2GGM A;  1K90 D;  1REC A;  1M31 A;  1SL9 A;  2H61 C;  3KO0 A;  1QAS A;  1DJG A;  2LLU A;  3IF7 A;  3D0Y B;  4QJ5 B;  3VRQ A;  1K8U A;  4MRY A;  1FI5 A;  3CLN A;  2LLT A;  4BY5 A;  1XO5 A;  1CFD A;  1JUO A;  1DJW A;  1NYA A;  3CR5 X;  3VRR A;  1KQM C;  1N0Y A;  2Y1M A;  1KK7 Z;  1UUR A;  3I5G B;  4YGE B;  1V1F A;  4UPG A;  1OQP A;  4OV2 A;  3VGO A;  1U5I B;  1NX2 A;  1PSR A;  5CPV A;  1B8L A;  2ZN8 A;  1AP4 A;  4FQO A;  4MLW A;  2KQ6 A;  1L7Z A;  4PCW A;  2ZKM X;  2L50 A;  4MVF A;  3CR2 A;  2K2A A;  1AK8 A;  1MF8 B;  3OB2 B;  5AAN A;  4A4C A;  2H2K A;  1DVI A;  1OSA A;  1QXP A;  1EH2 A;  1LXF C;  3WHU B;  3GK4 X;  1TNW A;  1KSM A;  1WRZ A;  2F33 A;  2M9G A;  4HSZ A;  2KFG A;  1CM1 A;  1SY9 A;  1QV0 A;  1UHH A;  1Y1X A;  4XJK B;  1KQM B;  1OE9 B;  1PVB A;  3SG2 A;  1A03 A;  1NUB A;  3K21 A;  4GBA A;  1XK4 A;  3LL8 B;  1Y1A A;  1NPQ A;  3OB1 B;  1JF2 A;  1XA5 A;  1TRF A;  4ORA B;  2KGB C;  1SMG A;  1B4C A;  3FIA A;  2BBM A;  1K9P A;  4GPL B;  4YI9 A;  5AXI A;  1KWO C;  2M1U A;  1UHN A;  2L0P A;  4DUQ A;  3RM1 A;  1CDN A;  1UP5 A;  1XFW O;  1QLK A;  1TIZ A;  2Q91 A;  3TDZ A;  2MLF C;  4PE0 A;  5I2Q A;  1XK4 C;  5KU1 A;  1JFJ A;  4MZL A;  3EKH A;  1RJV A;  2WOR A;  2WCB A;  1XYD A;  1YVH A;  3EVR A;  4ICB A;  1IG5 A;  2WCE A;  2KI4 C;  1F8H A;  1PK0 D;  4GFT A;  4PE4 A;  4JPZ B;  2BCB A;  2EGD A;  1ALW A;  5D7F A;  2I18 A;  3JVT B;  4WQ3 A;  3SG7 A;  2BKH B;  1CLM A;  1TN4 A;  1R2U A;  1W7I B;  2K7B A;  1DJI A;  2SAS A;  4I5K A;  3PSR A;  1SBJ A;  1YUS A;  5B8I B;  1Q80 A;  2M3W A;  1YRT B;  5F6T A;  2M8U A;  1UHK A;  1WRL A;  1BOD A;  3TZ1 A;  1UHJ A;  1OZO A;  3I5F C;  2BCA A;  4GGF C;  4A4B A;  2JTZ A;  2OS8 C;  4XYN A;  1BJF A;  2I2R E;  2KOT A;  4ZCU A;  1XFV O;  2F2P A;  4PE7 A;  1KWO B;  1BR4 B;  2JOJ A;  2LMV A;  1DJY A;  4N1G A;  5TNC A;  2JT3 A;  4M2P A;  4I5N B;  2LC5 A;  2HF5 A;  1J55 A;  1IKU A;  3BUN B;  1LVC D;  1F70 A;  4YI8 A;  5PAL A;  3SJS A;  1S6C A;  1XFX O;  1A2X A;  4YGD B;  2NLN A;  2KI4 B;  2ZND A;  1M39 A;  1JF0 A;  2K61 A;  1BU3 A;  2ZRT A;  2ZFD A;  2GGZ A;  1KSO A;  1QTX A;  4C0L A;  2SCP A;  2KYF A;  4QJ4 B;  3BOW B;  2JNF A;  2Y1N A;  1AUI B;  2LUX A;  1RWY A;  1AHR A;  2JT8 A;  1CNP A;  4I5J A;  1DMO A;  1RRO A;  3I5F B;  4MSP A;  1S36 A;  2JTT A;  4R1E A;  3RLZ A;  2OS8 B;  4OCI A;  3M0W A;  5G08 A;  4N1F A;  3SG5 A;  1CDL A;  2KGR A;  3PAT A;  4WQ2 A;  3EVV A;  1MXE A;  2LNK A;  5IBW A;  4ORC B;  3D10 A;  1W7J B;  3NSL A;  3CWG A;  2LMU A;  1ALV A;  3EKJ A;  1CFF A;  1NSH A;  1F54 A;  2BEC A;  1RFJ A;  1SPY A;  2JU0 A;  3WHT B;  4DCK A;  1D1O A;  4MRX A;  1TNX A;  2MLE C;  4NDB A;  1JFK A;  3PM8 A;  1ZUZ A;  1K94 A;  1IQ3 A;  5J3X A;  1CM4 A;  3I5H C;  4PHJ A;  3OX6 A;  2WND A;  3CGA A;  1QS7 A;  1J7P A;  2KBM A;  2NCP A;  3DF0 B;  2BBN A;  1RK9 A;  5DKN A;  5JOL A;  2G9B A;  2P6B B;  4P5O E;  1KQV A;  1Y1U A;  1A75 B;  2WC8 A;  3JTD C;  2HET A;  2HQ8 A;  3SG3 A;  1CDM A;  3OP0 A;  1C7V A;  2KSP A;  3BUM B;  5KSZ A;  2LAN A;  3F45 A;  4OVN F;  1IGV A;  1TCF A;  2LE9 B;  4L9M A;  2MAZ A;  3GOF A;  3BUX B;  1QLS A;  2CXJ A;  1YRU B;  2KHN A;  3KEV A;  3BYA A;  1CLB A;  1WRK A;  4AQI A;  3TUY C;  1YUR A;  2M97 A;  1QJT A;  1B8R A;  2LVJ A;  4MZK A;  2IS9 A;  2PMY A;  2L51 A;  3I5H B;  1M63 B;  4HRG A;  1K2H A;  2K7C A;  1UWO A;  4ETO A;  3IQQ A;  1IJ6 A;  3GK1 A;  4BY4 A;  1F4Q A;  1YUT A;  1XFU O;  4GAO A;  2F3Z A;  1PVA A;  3TDU A;  3ZNI A;  3C1V A;  1H4B A;  2LP3 A;  2FCD A;  1MHO A;  2BE4 A;  3JTD B;  1AJ4 A;  4CPV A;  1NCX A;  5AER A;  5I8N A;  1NP8 A;  2BL0 C;  3DVM A;  3SG4 A;  1QV1 A;  3HX4 A;  2JZI A;  2KI6 D;  2HPS A;  1ZMZ A;  2LUC A;  1M45 A;  2OPO A;  2BKI B;  2JWW A;  1DGV A;  1YX8 A;  3DVJ A; 
#chains in the Genus database with same CATH topology
 2EC6 C;  4PE1 A;  1EXR A;  3R1O A;  3KF9 A;  3TUY B;  1K93 D;  4FTG A;  3TS5 C;  4M2Q A;  1QIV A;  5HL1 A;  2QPT A;  5D69 A;  1YVL A;  2BNX A;  1TTX A;  2KAX A;  4KYN A;  2O60 A;  4OR9 B;  3FWC A;  1DT7 B;  2ZNE A;  1E8A A;  2CT9 A;  1NX3 A;  2I7A A;  1XFZ O;  1SSE B;  5BPJ A;  2ZN9 A;  2KYC A;  3LK1 A;  1MUX A;  1EG4 A;  3UNW A;  5CSJ A;  2FOT A;  1DGU A;  2BL0 B;  1SYM A;  1WLM A;  5CSI A;  2CNP A;  1XFY O;  1YTZ C;  3FE9 A;  2LLS A;  3A8R A;  4E68 A;  1NCZ A;  1EJ3 A;  1LA3 A;  1QVI Z;  2E30 A;  2EC6 B;  3Q8I A;  2NXQ A;  4ZCV A;  1N65 A;  2OTG C;  1KCY A;  1FBV A;  2WCH A;  2K60 A;  3CZ0 A;  1CMG A;  4JQ0 D;  1J1E A;  1BOC A;  1KFX S;  3TS5 B;  1ORG A;  2COL B;  3SIA A;  4F0Z B;  5JJG A;  1P28 A;  2DOQ A;  1G8I A;  1QIW A;  3SS3 A;  2LV7 A;  1WDC C;  3FS7 A;  3TDI A;  2RGI A;  1NX0 A;  1M46 A;  1S6J A;  4OKH A;  1CLL A;  4DS7 A;  1FPW A;  4PAL A;  4GGN A;  3PFV A;  1LIN A;  5CSF A;  2EHB A;  1KFX L;  1OMD A;  4MN0 A;  1OMR A;  1IIO A;  1DJX A;  1QVI Y;  2MHH A;  3S0F A;  2AUC A;  3LCP C;  3O4X A;  2JUL A;  1SK6 D;  3VRN A;  1FW4 A;  4AOM A;  1X02 A;  1C3Z A;  2O5G A;  2QEB A;  1CFC A;  1TNQ A;  2OTG B;  1OOF A;  2WCK A;  1DEL A;  2NCO A;  4WRI A;  3D0Y A;  2LVK A;  3PAL A;  5DKR A;  1J7Q A;  1LKJ A;  2L2E A;  4YGA A;  1AJ5 A;  1UUS A;  2LCP A;  3NGV A;  4MEW A;  2M7L A;  3L4A A;  1BLQ A;  2KDH A;  1WDC B;  3EG5 B;  5HKZ A;  3O78 A;  1QX7 A;  3O4Y A;  4I5L B;  5HKW A;  2M29 A;  3ICB A;  2ZRS A;  3S0D A;  3VRO A;  1C07 A;  5K89 A;  4AQJ A;  1C7W A;  2LAP A;  3DVK A;  3EK4 A;  1F55 A;  1U5I A;  4C0K A;  3LLE A;  1QX5 B;  3BUO B;  1GGW A;  3D78 A;  1GM0 A;  3I5I C;  3S0E A;  1B7T Z;  2QEV A;  3KPX A;  1XVJ A;  1YX7 A;  1LA0 A;  3BQ3 A;  1G33 A;  2KFF A;  2Q4U A;  4USL A;  1HQV A;  2AMI A;  5ER4 X;  2PAL A;  3PM2 A;  2PAS A;  2H61 A;  1JBA A;  1JWD A;  4PHM A;  5FI7 A;  1SCM C;  2BCX A;  2P71 A;  1SCV A;  1A29 A;  3AAJ A;  2CTN A;  3OHM B;  4P2Y B;  2MRD A;  1CFP A;  2F3Y A;  1QAT A;  1NCY A;  2NZ0 A;  1CKK A;  3NSO A;  5AFP A;  4YBH B;  2JC2 A;  2FCE A;  5HKY A;  3RZS A;  4INX A;  5DIC A;  4Q04 A;  2LHI A;  3SG6 A;  1B7T Y;  1YR5 A;  1IQ5 A;  1SNL A;  2JPT A;  2L4H A;  2CCM A;  3D75 A;  1K95 A;  5EL2 A;  1V1G A;  3QRX A;  1NWD A;  2M0R A;  3CR4 X;  2YGU A;  2JRF A;  3FWB A;  4DIR A;  3EK8 A;  3NSK A;  2JNX A;  3I5I B;  1FF1 A;  2LM5 A;  4PHK A;  5HYD A;  4MZJ A;  1DF0 A;  2CBL A;  3GK2 A;  1HT9 A;  3OBV A;  2MJW B;  4NDC A;  3IVT A;  2GTE A;  2PVB A;  1J7O A;  1MQ1 A;  3A4U B;  2ISD A;  1KFU S;  5AEQ A;  1B1G A;  2PQL A;  3CS1 A;  1S1E A;  2Y4Q A;  4HRH A;  1SCM B;  2PRU A;  3HCM A;  3WXA A;  1B47 A;  1IH0 A;  1SRA A;  1IRJ A;  1R6P A;  3NSI A;  2KBI A;  2LP2 A;  3DXL A;  1OW4 A;  3DVE A;  5I2O A;  5KTY A;  1TNP A;  2KI6 C;  1CMF A;  1J7R A;  1SW8 A;  1KFU L;  1KK7 Y;  2LVV A;  3DY9 A;  2KLD A;  5CSN A;  1KK8 C;  2LVI A;  3WNX B;  2L5X B;  2KFH A;  1J1D A;  1L2O C;  3CTN A;  3JVT C;  1BT6 A;  3L4L A;  4YGB B;  1GQM A;  4INW A;  4PDZ A;  1DJH A;  1F4O A;  1N2D A;  2KQY A;  1SKT A;  4M2O A;  3O2P A;  1DJZ A;  3CZT X;  4C0J A;  1RTP 1;  2GV5 A;  2M1K B;  3SIB A;  1K9U A;  4D1E A;  4YGC B;  1MR8 A;  1DC1 A;  2L98 A;  3NHT A;  3SS4 A;  2PYQ A;  3CZ2 A;  3DD4 A;  3MSE B;  1EL4 A;  4NQG A;  2QEH A;  1MWN A;  1DF0 B;  3IQO A;  1IJ5 A;  1G4Y R;  2PSR A;  1QX2 A;  3BOW A;  3E3R A;  3BJH A;  2F8P A;  2F2O A;  1EG3 A;  1SR6 C;  1K96 A;  2KNE A;  5DKQ A;  1Y6W A;  4GGF A;  1GJY A;  1S5G Z;  1KK8 B;  2WCJ A;  4ORB B;  5GQQ C;  1NIW A;  2K0J A;  2QAC A;  3AAK A;  2G2B A;  4YRU A;  1L2O B;  4CID A;  1JC2 A;  1NX1 A;  3BFA A;  1BR1 B;  2TN4 A;  1B9A A;  1H8B A;  3NXA A;  5HLO A;  1AVS A;  1Y0V H;  1S3P A;  2KAY A;  3LK0 A;  1GGZ A;  4TNC A;  1OOJ A;  4CLN A;  4CFQ A;  5I94 A;  1DQE A;  1PRW A;  2E6W A;  1VRK A;  2AAO A;  2A4J A;  5FYX A;  1BMO A;  2JXL A;  3AKA A;  1PUL A;  1OZS A;  2D8N A;  3KHE A;  1CDP A;  1FI6 A;  2WCL A;  3PN7 C;  1DTL A;  1S5G Y;  1T14 A;  4MBE A;  4U8D A;  2L4I A;  2MBX A;  3D74 A;  3VRP A;  2KLE A;  2R2I A;  1SL8 A;  3DF0 A;  1ZAC A;  4IL1 A;  1OMV A;  1DEK A;  2K2F A;  2MA2 A;  1SR6 B;  1ODB A;  2V53 A;  1MXL C;  1ZFS A;  3H4S E;  3QME A;  1S26 D;  2WOS A;  3BUW B;  4JWQ A;  1JSA A;  1B8C A;  1A75 A;  3FE6 A;  2KAV A;  2K8M B;  1S6I A;  1BF5 A;  3EVU A;  4PHN A;  2FJU B;  2I94 A;  2VRG A;  1F71 A;  1IWQ A;  1SL7 A;  1OOH A;  3EK7 A;  2LHL A;  2LMT A;  3O6B A;  3V2L A;  1PSB A;  1WY9 A;  2M7N A;  3AKB A;  3OGN A;  5HLV A;  1TCO B;  3BXK A;  3ZWH A;  1CTR A;  3PLF B;  3CDN A;  4HRE E;  4DRW A;  3K1E A;  2B1U A;  1YUU A;  3OX5 A;  4QJ3 B;  1BG1 A;  3PN7 B;  3I5G C;  4GUK A;  1ZOT B;  5I2L A;  1WLZ A;  4CFR A;  2M49 B;  2JXC A;  2WCF A;  1A4P A;  1UHI A;  2JQ6 A;  2HQW A;  5ER5 A;  2K7D A;  2Y5I A;  3PJI A;  3BFB A;  1PAL A;  4NDD A;  4N5X A;  3FE8 A;  1TOP A;  1K9K A;  2JT0 A;  2WCM A;  4XJK A;  2QEO A;  4GNK B;  2BE6 A;  1CB1 A;  2K7O A;  2GGM A;  1K90 D;  1REC A;  1M31 A;  1SL9 A;  2H61 C;  3KO0 A;  1QAS A;  1DJG A;  2LLU A;  3IF7 A;  3D0Y B;  4QJ5 B;  3VRQ A;  3DZT A;  1K8U A;  4IJ7 A;  4MRY A;  3CLN A;  4JKT A;  1FI5 A;  2LLT A;  4BY5 A;  1XO5 A;  1CFD A;  1JUO A;  1DJW A;  1NYA A;  3CR5 X;  3VRR A;  1KQM C;  1W9Z A;  1N0Y A;  3B86 A;  2Y1M A;  3VB1 A;  1KK7 Z;  1UUR A;  3I5G B;  4YGE B;  2QDI A;  1V1F A;  4UPG A;  1OQP A;  4OV2 A;  3VGO A;  1U5I B;  1NX2 A;  1PSR A;  5CPV A;  5FI2 A;  1B8L A;  2ZN8 A;  1AP4 A;  4FQO A;  4MLW A;  2KQ6 A;  1L7Z A;  4PCW A;  2ZKM X;  2L50 A;  1OOI X;  4MVF A;  3CR2 A;  2K2A A;  1AK8 A;  1MF8 B;  3OB2 B;  5AAN A;  4A4C A;  2H2K A;  1DVI A;  1OSA A;  1QXP A;  1EH2 A;  1LXF C;  1OOG A;  3WHU B;  3GK4 X;  1TNW A;  1KSM A;  1WRZ A;  2F33 A;  2M9G A;  4HSZ A;  3S0A A;  2KFG A;  1CM1 A;  1SY9 A;  1QV0 A;  1UHH A;  1Y1X A;  4XJK B;  1KQM B;  1OE9 B;  1PVB A;  3SG2 A;  1A03 A;  1NUB A;  3K21 A;  4GBA A;  1XK4 A;  3LL8 B;  1Y1A A;  1NPQ A;  1LS8 A;  3OB1 B;  1JF2 A;  1XA5 A;  1TRF A;  3B88 A;  4ORA B;  2KGB C;  1SMG A;  1XFR A;  3FIA A;  1B4C A;  2BBM A;  1K9P A;  4GPL B;  4YI9 A;  5AXI A;  1KWO C;  2M1U A;  1UHN A;  3N7H A;  2L0P A;  4DUQ A;  3RM1 A;  1CDN A;  1UP5 A;  1XFW O;  3D77 A;  1QLK A;  1TIZ A;  2KPH A;  2Q91 A;  3TDZ A;  2MLF C;  4PE0 A;  3BFH A;  2H8V A;  5I2Q A;  1XK4 C;  5KU1 A;  1JFJ A;  3DYE A;  3EKH A;  4MZL A;  1RJV A;  2WOR A;  2WCB A;  1XYD A;  2FJY A;  1YVH A;  3EVR A;  4ICB A;  1IG5 A;  2WCE A;  2KI4 C;  2WC5 A;  1F8H A;  1PK0 D;  4GFT A;  4PE4 A;  4JPZ B;  2BCB A;  2EGD A;  1ALW A;  5D7F A;  2I18 A;  3JVT B;  4WQ3 A;  4PT1 A;  3SG7 A;  1CLM A;  2BKH B;  1TN4 A;  1R2U A;  1W7I B;  4FQT A;  2K7B A;  1DJI A;  2SAS A;  3L47 A;  4I5K A;  3PSR A;  1SBJ A;  1YUS A;  5B8I B;  2BAP A;  1Q80 A;  2M3W A;  1YRT B;  5F6T A;  2M8U A;  1UHK A;  1WRL A;  1BOD A;  3TZ1 A;  1UHJ A;  1OZO A;  4JD9 A;  3I5F C;  2BCA A;  4GGF C;  4A4B A;  2JTZ A;  2OS8 C;  4XYN A;  1BJF A;  2I2R E;  2KOT A;  2WC6 A;  3CZ1 A;  1XFV O;  2F2P A;  4PE7 A;  4ZCU A;  1KWO B;  1BR4 B;  2JOJ A;  2LMV A;  1DJY A;  4N1G A;  5TNC A;  2JT3 A;  4M2P A;  4I5N B;  2LC5 A;  5D3O A;  2HF5 A;  1J55 A;  1IKU A;  3BUN B;  1LVC D;  1F70 A;  4YI8 A;  5PAL A;  3SJS A;  1S6C A;  1XFX O;  2ERB A;  5FI6 A;  1A2X A;  4YGD B;  2NLN A;  2KI4 B;  2L5Y A;  2ZND A;  1M39 A;  1JF0 A;  1Z2C B;  3CYZ A;  2K61 A;  1BU3 A;  1TUJ A;  2ZRT A;  1C3Y A;  2ZFD A;  2GGZ A;  1KSO A;  1QTX A;  4C0L A;  3B7A A;  2SCP A;  2KYF A;  4QJ4 B;  3BOW B;  2JNF A;  2Y1N A;  1AUI B;  2LUX A;  1RWY A;  1AHR A;  2JT8 A;  1CNP A;  4I5J A;  1DMO A;  1RRO A;  3I5F B;  4MSP A;  1S36 A;  2JTT A;  4R1E A;  3RLZ A;  2OS8 B;  4OCI A;  1QWV A;  3M0W A;  5G08 A;  4N1F A;  3SG5 A;  1CDL A;  3D76 A;  2KGR A;  3PAT A;  4WQ2 A;  3EVV A;  1MXE A;  2LNK A;  5IBW A;  4ORC B;  3D10 A;  1W7J B;  3NSL A;  3CWG A;  2LMU A;  1ALV A;  3EKJ A;  1CFF A;  1NSH A;  3R1V A;  1F54 A;  2BEC A;  1RFJ A;  1SPY A;  2JU0 A;  3S0B A;  3B6X A;  3WHT B;  4DCK A;  1D1O A;  4MRX A;  1TNX A;  4F7F A;  2MLE C;  4NDB A;  1JFK A;  3PM8 A;  1ZUZ A;  1K94 A;  1IQ3 A;  5J3X A;  1CM4 A;  3I5H C;  4PHJ A;  3R72 A;  3OX6 A;  2WND A;  3CGA A;  1QS7 A;  1J7P A;  2KBM A;  2NCP A;  3DF0 B;  3UO9 A;  2BBN A;  1RK9 A;  5DKN A;  5JOL A;  2G9B A;  2P6B B;  4P5O E;  4OZD A;  1KQV A;  3NHI A;  1Y1U A;  1A75 B;  2WC8 A;  3JTD C;  2HET A;  2HQ8 A;  3SG3 A;  1CDM A;  3OP0 A;  1C7V A;  2KSP A;  3BUM B;  5KSZ A;  2LAN A;  3F45 A;  3R1P A;  4OVN F;  1IGV A;  1TCF A;  2LE9 B;  4L9M A;  2MAZ A;  3GOF A;  3BUX B;  1QLS A;  2CXJ A;  1YRU B;  2KHN A;  3KEV A;  3BYA A;  1CLB A;  1WRK A;  2P70 A;  4AQI A;  3TUY C;  1YUR A;  2M97 A;  3B87 A;  1QJT A;  1B8R A;  2LVJ A;  2JPO A;  2IS9 A;  4MZK A;  3CAB A;  1Z4H A;  2PMY A;  2L51 A;  3I5H B;  3S0G A;  1M63 B;  4HRG A;  1K2H A;  1TUZ A;  2K7C A;  1TWO A;  1UWO A;  4ETO A;  3IQQ A;  1IJ6 A;  3GK1 A;  4BY4 A;  1F4Q A;  1YUT A;  1XFU O;  4GAO A;  3SS5 A;  2F3Z A;  1PVA A;  3TDU A;  3D73 A;  3C1V A;  2L2C A;  3ZNI A;  1H4B A;  2LP3 A;  2FCD A;  1MHO A;  2BE4 A;  3JTD B;  1AJ4 A;  4CPV A;  1NCX A;  5AER A;  5I8N A;  1NP8 A;  2BL0 C;  3DVM A;  3SG4 A;  1QV1 A;  3HX4 A;  2JZI A;  2KI6 D;  2HPS A;  1ZMZ A;  2LUC A;  1M45 A;  2OPO A;  2BKI B;  2JWW A;  1DGV A;  1YX8 A;  3DVJ A; 
#chains in the Genus database with same CATH homology
 2EC6 C;  4PE1 A;  1EXR A;  3KF9 A;  3TUY B;  1K93 D;  4FTG A;  3TS5 C;  4M2Q A;  1QIV A;  2QPT A;  5D69 A;  1YVL A;  1TTX A;  2KAX A;  2O60 A;  4OR9 B;  3FWC A;  1DT7 B;  2ZNE A;  1E8A A;  2CT9 A;  1NX3 A;  2I7A A;  1XFZ O;  5BPJ A;  2ZN9 A;  2KYC A;  3LK1 A;  1MUX A;  1EG4 A;  5CSJ A;  2FOT A;  1DGU A;  2BL0 B;  1SYM A;  1WLM A;  5CSI A;  2CNP A;  1XFY O;  1YTZ C;  2LLS A;  3A8R A;  4E68 A;  1NCZ A;  1EJ3 A;  1LA3 A;  1QVI Z;  2E30 A;  2EC6 B;  4ZCV A;  2NXQ A;  1N65 A;  2OTG C;  1KCY A;  1FBV A;  1CMG A;  1BOC A;  4JQ0 D;  1J1E A;  1KFX S;  3TS5 B;  2COL B;  3SIA A;  4F0Z B;  5JJG A;  2DOQ A;  1G8I A;  1QIW A;  2LV7 A;  1WDC C;  3FS7 A;  3TDI A;  2RGI A;  1NX0 A;  1M46 A;  1S6J A;  4OKH A;  1CLL A;  4DS7 A;  1FPW A;  4PAL A;  4GGN A;  3PFV A;  1LIN A;  5CSF A;  2EHB A;  1KFX L;  1OMD A;  4MN0 A;  1OMR A;  1DJX A;  1QVI Y;  2MHH A;  2AUC A;  3LCP C;  2JUL A;  1SK6 D;  3VRN A;  1FW4 A;  4AOM A;  1X02 A;  2O5G A;  1CFC A;  1TNQ A;  2OTG B;  2NCO A;  4WRI A;  3D0Y A;  2LVK A;  3PAL A;  5DKR A;  1J7Q A;  1LKJ A;  2L2E A;  4YGA A;  1AJ5 A;  1UUS A;  2LCP A;  4MEW A;  1BLQ A;  2KDH A;  1WDC B;  5HKZ A;  3O78 A;  1QX7 A;  3O4Y A;  4I5L B;  5HKW A;  2M29 A;  3ICB A;  2ZRS A;  3VRO A;  1C07 A;  5K89 A;  4AQJ A;  1C7W A;  2LAP A;  3DVK A;  3EK4 A;  1F55 A;  1U5I A;  4C0K A;  3LLE A;  1QX5 B;  3BUO B;  1GGW A;  3I5I C;  1B7T Z;  3KPX A;  1XVJ A;  1YX7 A;  1LA0 A;  3BQ3 A;  1G33 A;  2KFF A;  2Q4U A;  4USL A;  1HQV A;  2AMI A;  5ER4 X;  2PAL A;  2PAS A;  2H61 A;  1JBA A;  1JWD A;  4PHM A;  1SCM C;  2BCX A;  3AAJ A;  1SCV A;  1A29 A;  3OHM B;  2CTN A;  4P2Y B;  2MRD A;  1CFP A;  2F3Y A;  1QAT A;  1NCY A;  2NZ0 A;  1CKK A;  3NSO A;  5AFP A;  4YBH B;  2JC2 A;  2FCE A;  5HKY A;  4Q04 A;  2LHI A;  3SG6 A;  1B7T Y;  1YR5 A;  1IQ5 A;  1SNL A;  2JPT A;  2L4H A;  2CCM A;  1K95 A;  1V1G A;  3QRX A;  1NWD A;  2M0R A;  3CR4 X;  2JRF A;  3FWB A;  4DIR A;  3EK8 A;  3NSK A;  2JNX A;  3I5I B;  1FF1 A;  2LM5 A;  4PHK A;  5HYD A;  4MZJ A;  1DF0 A;  2CBL A;  3GK2 A;  1HT9 A;  2MJW B;  4NDC A;  2PVB A;  1J7O A;  1MQ1 A;  3A4U B;  2ISD A;  1KFU S;  5AEQ A;  1B1G A;  3CS1 A;  4HRH A;  1S1E A;  2Y4Q A;  1SCM B;  2PRU A;  3HCM A;  3WXA A;  1B47 A;  1IH0 A;  1SRA A;  1IRJ A;  1R6P A;  3NSI A;  2KBI A;  2LP2 A;  3DVE A;  5I2O A;  5KTY A;  1TNP A;  2KI6 C;  1CMF A;  1J7R A;  1SW8 A;  1KFU L;  1KK7 Y;  2LVV A;  5CSN A;  1KK8 C;  2LVI A;  3WNX B;  2L5X B;  2KFH A;  1J1D A;  1L2O C;  3CTN A;  3JVT C;  1BT6 A;  4YGB B;  1GQM A;  4PDZ A;  1DJH A;  1F4O A;  1N2D A;  2KQY A;  1SKT A;  4M2O A;  3O2P A;  1DJZ A;  3CZT X;  4C0J A;  1RTP 1;  2GV5 A;  2M1K B;  3SIB A;  1K9U A;  4D1E A;  4YGC B;  1MR8 A;  2L98 A;  3DD4 A;  3MSE B;  1EL4 A;  4NQG A;  1MWN A;  1DF0 B;  3IQO A;  1IJ5 A;  1G4Y R;  2PSR A;  1QX2 A;  3BOW A;  3E3R A;  2F8P A;  2F2O A;  1EG3 A;  1SR6 C;  1K96 A;  2KNE A;  5DKQ A;  1Y6W A;  4GGF A;  1GJY A;  1S5G Z;  1KK8 B;  4ORB B;  5GQQ C;  2M7L A;  1NIW A;  2K0J A;  2QAC A;  3AAK A;  2G2B A;  4YRU A;  1L2O B;  4CID A;  1JC2 A;  1NX1 A;  1BR1 B;  2TN4 A;  1B9A A;  1H8B A;  3NXA A;  5HLO A;  1AVS A;  1Y0V H;  1S3P A;  2KAY A;  3LK0 A;  1GGZ A;  4TNC A;  1OOJ A;  4CLN A;  4CFQ A;  1PRW A;  2E6W A;  1VRK A;  2AAO A;  2A4J A;  5FYX A;  1BMO A;  2JXL A;  3AKA A;  1PUL A;  1OZS A;  2D8N A;  3KHE A;  1CDP A;  1FI6 A;  3PN7 C;  1DTL A;  1S5G Y;  4MBE A;  4U8D A;  2L4I A;  2MBX A;  3VRP A;  2R2I A;  1SL8 A;  3DF0 A;  1ZAC A;  4IL1 A;  1OMV A;  2K2F A;  2MA2 A;  1SR6 B;  1ODB A;  2V53 A;  1MXL C;  1ZFS A;  3H4S E;  4JWQ A;  1S26 D;  2WOS A;  3BUW B;  1JSA A;  1B8C A;  1A75 A;  2KAV A;  2K8M B;  1S6I A;  1BF5 A;  3EVU A;  4PHN A;  2FJU B;  2I94 A;  2VRG A;  1F71 A;  1IWQ A;  1SL7 A;  3EK7 A;  2LHL A;  2LMT A;  3O6B A;  1PSB A;  1WY9 A;  2M7N A;  3AKB A;  5HLV A;  1TCO B;  3BXK A;  3ZWH A;  1CTR A;  3PLF B;  4HRE E;  4DRW A;  2B1U A;  1YUU A;  3OX5 A;  4QJ3 B;  1BG1 A;  3PN7 B;  3I5G C;  4GUK A;  1ZOT B;  5I2L A;  1WLZ A;  4CFR A;  2M49 B;  2JXC A;  2WCF A;  1A4P A;  1UHI A;  2JQ6 A;  2HQW A;  5ER5 A;  2K7D A;  2Y5I A;  1PAL A;  4NDD A;  4N5X A;  1TOP A;  1K9K A;  2JT0 A;  4XJK A;  4GNK B;  2BE6 A;  1CB1 A;  2K7O A;  2GGM A;  1K90 D;  1REC A;  1M31 A;  1SL9 A;  2H61 C;  3KO0 A;  1QAS A;  1DJG A;  2LLU A;  3IF7 A;  3D0Y B;  4QJ5 B;  3VRQ A;  1K8U A;  4MRY A;  1FI5 A;  3CLN A;  2LLT A;  4BY5 A;  1XO5 A;  1CFD A;  1JUO A;  1DJW A;  1NYA A;  3CR5 X;  3VRR A;  1KQM C;  1N0Y A;  2Y1M A;  1KK7 Z;  1UUR A;  3I5G B;  4YGE B;  1V1F A;  4UPG A;  1OQP A;  4OV2 A;  3VGO A;  1U5I B;  1NX2 A;  1PSR A;  5CPV A;  1B8L A;  2ZN8 A;  1AP4 A;  4FQO A;  4MLW A;  2KQ6 A;  1L7Z A;  4PCW A;  2ZKM X;  2L50 A;  4MVF A;  3CR2 A;  2K2A A;  1AK8 A;  1MF8 B;  3OB2 B;  5AAN A;  4A4C A;  2H2K A;  1DVI A;  1OSA A;  1QXP A;  1EH2 A;  1LXF C;  3WHU B;  3GK4 X;  1TNW A;  1KSM A;  1WRZ A;  2F33 A;  2M9G A;  4HSZ A;  2KFG A;  1CM1 A;  1SY9 A;  1QV0 A;  1UHH A;  1Y1X A;  4XJK B;  1KQM B;  1OE9 B;  1PVB A;  3SG2 A;  1A03 A;  1NUB A;  3K21 A;  4GBA A;  1XK4 A;  3LL8 B;  1Y1A A;  1NPQ A;  3OB1 B;  1JF2 A;  1XA5 A;  1TRF A;  4ORA B;  2KGB C;  1SMG A;  1B4C A;  3FIA A;  2BBM A;  1K9P A;  4GPL B;  4YI9 A;  5AXI A;  1KWO C;  2M1U A;  1UHN A;  2L0P A;  4DUQ A;  3RM1 A;  1CDN A;  1UP5 A;  1XFW O;  1QLK A;  1TIZ A;  2Q91 A;  3TDZ A;  2MLF C;  4PE0 A;  5I2Q A;  1XK4 C;  5KU1 A;  1JFJ A;  4MZL A;  3EKH A;  1RJV A;  2WOR A;  2WCB A;  1XYD A;  1YVH A;  3EVR A;  4ICB A;  1IG5 A;  2WCE A;  2KI4 C;  1F8H A;  1PK0 D;  4GFT A;  4PE4 A;  4JPZ B;  2BCB A;  2EGD A;  1ALW A;  5D7F A;  2I18 A;  3JVT B;  4WQ3 A;  3SG7 A;  2BKH B;  1CLM A;  1TN4 A;  1R2U A;  1W7I B;  2K7B A;  1DJI A;  2SAS A;  4I5K A;  3PSR A;  1SBJ A;  1YUS A;  5B8I B;  1Q80 A;  2M3W A;  1YRT B;  5F6T A;  2M8U A;  1UHK A;  1WRL A;  1BOD A;  3TZ1 A;  1UHJ A;  1OZO A;  3I5F C;  2BCA A;  4GGF C;  4A4B A;  2JTZ A;  2OS8 C;  4XYN A;  1BJF A;  2I2R E;  2KOT A;  4ZCU A;  1XFV O;  2F2P A;  4PE7 A;  1KWO B;  1BR4 B;  2JOJ A;  2LMV A;  1DJY A;  4N1G A;  5TNC A;  2JT3 A;  4M2P A;  4I5N B;  2LC5 A;  2HF5 A;  1J55 A;  1IKU A;  3BUN B;  1LVC D;  1F70 A;  4YI8 A;  5PAL A;  3SJS A;  1S6C A;  1XFX O;  1A2X A;  4YGD B;  2NLN A;  2KI4 B;  2ZND A;  1M39 A;  1JF0 A;  2K61 A;  1BU3 A;  2ZRT A;  2ZFD A;  2GGZ A;  1KSO A;  1QTX A;  4C0L A;  2SCP A;  2KYF A;  4QJ4 B;  3BOW B;  2JNF A;  2Y1N A;  1AUI B;  2LUX A;  1RWY A;  1AHR A;  2JT8 A;  1CNP A;  4I5J A;  1DMO A;  1RRO A;  3I5F B;  4MSP A;  1S36 A;  2JTT A;  4R1E A;  3RLZ A;  2OS8 B;  4OCI A;  3M0W A;  5G08 A;  4N1F A;  3SG5 A;  1CDL A;  2KGR A;  3PAT A;  4WQ2 A;  3EVV A;  1MXE A;  2LNK A;  5IBW A;  4ORC B;  3D10 A;  1W7J B;  3NSL A;  3CWG A;  2LMU A;  1ALV A;  3EKJ A;  1CFF A;  1NSH A;  1F54 A;  2BEC A;  1RFJ A;  1SPY A;  2JU0 A;  3WHT B;  4DCK A;  1D1O A;  4MRX A;  1TNX A;  2MLE C;  4NDB A;  1JFK A;  3PM8 A;  1ZUZ A;  1K94 A;  1IQ3 A;  5J3X A;  1CM4 A;  3I5H C;  4PHJ A;  3OX6 A;  2WND A;  3CGA A;  1QS7 A;  1J7P A;  2KBM A;  2NCP A;  3DF0 B;  2BBN A;  1RK9 A;  5DKN A;  5JOL A;  2G9B A;  2P6B B;  4P5O E;  1KQV A;  1Y1U A;  1A75 B;  2WC8 A;  3JTD C;  2HET A;  2HQ8 A;  3SG3 A;  1CDM A;  3OP0 A;  1C7V A;  2KSP A;  3BUM B;  5KSZ A;  2LAN A;  3F45 A;  4OVN F;  1IGV A;  1TCF A;  2LE9 B;  4L9M A;  2MAZ A;  3GOF A;  3BUX B;  1QLS A;  2CXJ A;  1YRU B;  2KHN A;  3KEV A;  3BYA A;  1CLB A;  1WRK A;  4AQI A;  3TUY C;  1YUR A;  2M97 A;  1QJT A;  1B8R A;  2LVJ A;  4MZK A;  2IS9 A;  2PMY A;  2L51 A;  3I5H B;  1M63 B;  4HRG A;  1K2H A;  2K7C A;  1UWO A;  4ETO A;  3IQQ A;  1IJ6 A;  3GK1 A;  4BY4 A;  1F4Q A;  1YUT A;  1XFU O;  4GAO A;  2F3Z A;  1PVA A;  3TDU A;  3ZNI A;  3C1V A;  1H4B A;  2LP3 A;  2FCD A;  1MHO A;  2BE4 A;  3JTD B;  1AJ4 A;  4CPV A;  1NCX A;  5AER A;  5I8N A;  1NP8 A;  2BL0 C;  3DVM A;  3SG4 A;  1QV1 A;  3HX4 A;  2JZI A;  2KI6 D;  2HPS A;  1ZMZ A;  2LUC A;  1M45 A;  2OPO A;  2BKI B;  2JWW A;  1DGV A;  1YX8 A;  3DVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...