4MLWA

Crystal structure of non-myristoylated recoverin at 1.45 a resolution with calcium bound to ef-hand 3
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
192
structure length
192
Chain Sequence
GALSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Recoverin
publication title A highly conserved cysteine of neuronal calcium-sensing proteins controls cooperative binding of Ca2+ to recoverin.
pubmed doi rcsb
source organism Bos taurus
total genus 78
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2013-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4mlwA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4mlwA01
1HQVA 2KOTA 3FWBA 1BT6A 1KQVA 4E68A 1SPYA 1YUTA 2L4IA 3TZ1A 4YRUA 1S26D 2BE4A 2L98A 3EKHA 1K96A 1SBJA 1QS7A 3EK8A 1KSMA 1JFKA 1NUBA 1OMDA 4MLWA 1MHOA 1N2DA 1WY9A 1Y6WA 2GV5A 3HCMA 1OZOA 4C0LA 4PE7A 3TUYB 2F33A 2FJUB 5AEQA 2E6WA 1PSRA 1NCYA 4AOMA 2G2BA 1PVBA 1CDNA 1AP4A 1BF5A 2AAOA 2HQWA 5KU1A 5FYXA 1A2XA 1SKTA 4R1EA 1JF2A 2F3YA 1BLQA 1LA0A 2JWWA 3LK1A 1B4CA 1R6PA 3VGOA 1S6IA 4BY4A 1KK7Z 1OSAA 3IF7A 2KSPA 4DUQA 2CCMA 2KFGA 2AUCA 1YURA 4PCWA 4XJKB 2F8PA 2LMTA 1IQ5A 4GFTA 1MQ1A 2OTGB 3VROA 2JOJA 4HRHA 1CTRA 1QV1A 5HLOA 1CB1A 1IKUA 1X02A 1S36A 1UHKA 1PRWA 4XYNA 4YGCB 1Y1UA 4YI9A 2G9BA 2ZKMX 1NX2A 1RWYA 3OX5A 1SW8A 1CFCA 3PFVA 1SCVA 1F70A 4MRXA 4MN0A 2BKHB 5HKZA 1KFXL 1TN4A 4MVFA 1DJIA 4FTGA 3I5GB 5JJGA 2WCFA 4L9MA 2RGIA 1XFZO 4PHKA 1QLSA 1B8CA 3DD4A 4ZCVA 3EVVA 4OR9B 1SR6C 2ZNEA 2B1UA 2KBMA 1JF0A 1B8RA 1WRLA 1RROA 3DF0B 1CDMA 3DVEA 2JTZA 4CPVA 1KK8B 1BR4B 2LMVA 2JULA 3M0WA 3SG6A 1YR5A 3EVRA 3OB1B 4GNKB 2M9GA 1BMOA 2PASA 1KK7Y 2TN4A 2BCXA 2KI4C 3EKJA 1QJTA 1KWOB 2LLSA 3BOWB 5F6TA 1ZFSA 1A29A 2HQ8A 2L5XB 5D69A 5HLVA 2K8MB 2JNFA 1SY9A 2K7CA 2MHHA 3KHEA 4GGFA 4M2PA 4PE1A 1FBVA 1F55A 2JXLA 1SCMB 4N5XA 1S1EA 1WDCC 3KF9A 3CR5X 1XK4C 4ORBB 5DKRA 1W7IB 2MA2A 4NQGA 2OS8C 4MRYA 2ZFDA 2LANA 3CGAA 1VRKA 1Y1XA 2KYFA 4M2OA 1AK8A 1QASA 4WRIA 2Q91A 1B47A 1FPWA 1XFXO 2ISDA 2WOSA 1CFPA 4JQ0D 4PHJA 3OHMB 2M7NA 1J55A 1IWQA 2GGZA 2WNDA 3TDUA 4U8DA 1CMFA 2MRDA 4JPZB 4MZJA 2PALA 4MZKA 3CLNA 1QXPA 1F71A 5I2QA 2JXCA 3WHUB 1B8LA 1GJYA 2KHNA 4I5LB 4AQJA 1DTLA 4NDDA 2I2RE 2LVKA 4PE0A 2GGMA 2P6BB 1ODBA 3BUOB 2CNPA 2MAZA 1L2OC 5KSZA 2JPTA 3I5GC 1S6JA 2M29A 2KAVA 4QJ4B 1UUSA 2FOTA 1FI6A 5IBWA 4PALA 3CWGA 3JVTC 4GAOA 5HYDA 2MJWB 3GK1A 4QJ5B 1KFXS 1PSBA 2L2EA 3K21A 2K7BA 2JT8A 2SCPA 3PN7C 1AJ5A 1K95A 3PM8A 1QIVA 2QPTA 3AKBA 1XFWO 2NXQA 3TDIA 2PRUA 3DF0A 1R2UA 1SL9A 3D10A 4ICBA 1TNPA 3SIAA 1NSHA 1KSOA 1UHJA 2LV7A 3O78A 1ALWA 2H61A 1H8BA 1QX2A 2KQYA 2H61C 2NZ0A 1UURA 3CZTX 3JTDB 1G8IA 1GGZA 2ZRTA 1NCZA 1OOJA 1Y0VH 4YI8A 1MR8A 2LCPA 1FI5A 1BOCA 1RTP1 1UHHA 3I5IC 2BKIB 2LHLA 3BOWA 4I5JA 4N1FA 2Q4UA 1KFUL 4PHMA 4YGBB 2I18A 1DMOA 1K93D 4A4BA 2HF5A 1K90D 3SG3A 3I5HC 3E3RA 3TS5C 1RFJA 1TOPA 1IGVA 1JBAA 1C7VA 1B7TZ 1K2HA 2KNEA 1DJYA 1IQ3A 1IG5A 3D0YB 4WQ3A 3AAJA 5CSIA 4D1EA 1BU3A 4DRWA 2M7LA 2MLEC 2NLNA 2FCEA 5GQQC 3MSEB 5ER5A 1ZACA 2SASA 1DT7B 1LKJA 3H4SE 2BCBA 2JNXA 1TNQA 1CDPA 2O5GA 1TIZA 4P5OE 2M1UA 1SNLA 2OPOA 1Q80A 3GOFA 1J7QA 1CFDA 1OZSA 1EG3A 2AMIA 5CSNA 1XFYO 1OMVA 2CBLA 1IJ6A 2L50A 2LNKA 4DS7A 3RLZA 3C1VA 2LVJA 3BUMB 3KO0A 1DJZA 1ZUZA 3I5FC 2LHIA 5CSFA 1A75B 1BJFA 1CLMA 2BL0B 2A4JA 4DIRA 2JQ6A 2JT0A 3PALA 1BODA 1KQMB 1UHIA 4PE4A 1UHNA 2DOQA 1JUOA 1NX1A 5G08A 4GGNA 4ZCUA 5B8IB 4PDZA 1RJVA 1CFFA 4N1GA 1NPQA 1YVLA 2PVBA 2K61A 2Y1NA 2FCDA 2JZIA 5HKWA 3TUYC 1PULA 1XVJA 2NCOA 5JOLA 1TNWA 1N0YA 2JU0A 2JRFA 1B7TY 3A4UB 2PSRA 3FS7A 3SG7A 1NX0A 1PALA 1LA3A 2COLB 2KQ6A 5D7FA 4GGFC 5BPJA 2BBNA 4MZLA 3LK0A 1IRJA 4GBAA 5I8NA 3KEVA 1C07A 1IH0A 4IL1A 3DVJA 4QJ3B 4XJKA 2KGBC 2LUCA 2L0PA 4OVNF 1KFUS 1D1OA 1NIWA 2D8NA 4UPGA 2OTGC 1QVIZ 5DKNA 2JC2A 1YUUA 2BE6A 1W7JB 2JT3A 2ZRSA 3A8RA 2LM5A 1KCYA 2KAYA 1XO5A 2KDHA 2LUXA 1JFJA 1NCXA 1WRZA 1WLZA 4CIDA 1TCOB 2LLTA 2M1KB 4GPLB 1U5IB 1J7PA 1G4YR 2EC6B 3CTNA 1SL7A 1FW4A 1QIWA 1DJWA 3TDZA 4I5KA 1MUXA 3QRXA 3GK4X 5DKQA 2V53A 3BXKA 2KI6D 3ZWHA 3VRRA 1CDLA 1UWOA 1A75A 4MBEA 5I2OA 3O2PA 3O4YA 3EK4A 3EK7A 4HSZA 5HKYA 1SRAA 4OCIA 5CSJA 2CT9A 1TCFA 1DVIA 2NCPA 5ER4X 1J1EA 1LINA 1B1GA 4YBHB 1RK9A 4FQOA 2L51A 3SG4A 1MXEA 4OV2A 1K9PA 1KK8C 1SR6B 2M8UA 1J7OA 4I5NB 2JTTA 2WCBA 1M45A 4JWQA 1WRKA 5AXIA 1PVAA 1ZMZA 3CR4X 4MSPA 1BG1A 2O60A 2ZN8A 2I7AA 1YX8A 2BCAA 2QACA 2WORA 1CKKA 1EJ3A 2PMYA 4OKHA 4CFRA 1A03A 1KWOC 2CTNA 1NWDA 1F4QA 3WXAA 3NSOA 1DF0B 4Q04A 1QVIY 5PALA 1BR1B 1S3PA 1SCMC 2M97A 5KTYA 3F45A 3VRQA 3WHTB 3KPXA 1UP5A 5I2LA 3SJSA 1K9UA 1SYMA 2KI4B 2F2OA 3ZNIA 1DJHA 1B9AA 1K8UA 2F2PA 3NSLA 1TRFA 1MXLC 1HT9A 2K0JA 3LLEA 4ORAB 1S6CA 1M63B 2F3ZA 4YGAA 2R2IA 3BYAA 2KFHA 4C0KA 2LMUA 1TTXA 1WDCB 2LC5A 2WCEA 2Y1MA 2LP3A 3PATA 3BQ3A 2OS8B 1JWDA 1F4OA 1K9KA 2M3WA 3IQQA 4F0ZB 1K94A 4BY5A 1H4BA 3IQOA 2LP2A 2K7DA 1YTZC 3EVUA 1F54A 3CS1A 4NDBA 5TNCA 1U5IA 2Y5IA 4CLNA 1NX3A 3OX6A 4WQ2A 4YGDB 2EC6C 1YRUB 3GK2A 1S5GZ 1JC2A 1AUIB 1CM1A 1YVHA 3BUXB 2LAPA 3HX4A 4TNCA 1V1FA 1NYAA 1C7WA 2KGRA 2E30A 4YGEB 4C0JA 1M46A 1SMGA 1EL4A 2LVVA 1DGUA 1DJGA 4A4CA 1J1DA 2H2KA 1G33A 3FIAA 1OQPA 1V1GA 1L2OB 3FWCA 2KAXA 2M0RA 3LL8B 4NDCA 3CR2A 3JVTB 1LXFC 2IS9A 1QLKA 3VRNA 1ALVA 1DJXA 2KBIA 1N65A 3AAKA 3VRPA 5AANA 2BBMA 4ORCB 2KI6C 2Y4QA 3JTDC 5CPVA 1ZOTB 3ICBA 3PN7B 1XA5A 2ZN9A 3OB2B 4HREE 1A4PA 1CLLA 2K2AA 1YX7A 1QV0A 1E8AA 2KFFA 4ETOA 2LVIA 1CNPA 1M39A 5AERA 1DF0A 1AJ4A 2HPSA 5AFPA 1OMRA 2LLUA 2HETA 2KYCA 1XYDA 3NSIA 3D0YA 3RM1A 4AQIA 3I5IB 2M49B 1QX5B 1MF8B 2WC8A 2CXJA 1NP8A 1OE9B 3SG2A 1Y1AA 2I94A 4USLA 4PHNA 1QATA 3WNXB 3I5HB 5J3XA 3TS5B 1EXRA 1RECA 3PLFB 2LE9B 1SK6D 1XK4A 3DVMA 2MLFC 3NSKA 4M2QA 4CFQA 1S5GY 3LCPC 3BUNB 1PK0D 1FF1A 1DGVA 1GQMA 1F8HA 1GGWA 3OP0A 1CLBA 4MEWA 2VRGA 1CMGA 1QTXA 4HRGA 1IJ5A 1LVCD 3AKAA 2MBXA 1XFVO 1WLMA 1J7RA 3SG5A 3O6BA 4DCKA 1AVSA 1AHRA 2ZNDA 1SL8A 1JSAA 2EHBA 3BUWB 2BL0C 3SIBA 1MWNA 1XFUO 2K7OA 3DVKA 4GUKA 1KQMC 1EG4A 1M31A 1YRTB 3NXAA 5K89A 1CM4A 2BECA 3PSRA 1QX7A 1YUSA 2K2FA 4P2YB 1EH2A 3I5FB 1L7ZA 2L4HA 2EGDA 1TNXA
chains in the Genus database with same CATH superfamily
1HQVA 2KOTA 1LS8A 3FWBA 1BT6A 1KQVA 3OBVA 4E68A 1DC1A 1SPYA 1YUTA 2L4IA 3D73A 3TZ1A 4YRUA 1S26D 2BE4A 2L98A 3EKHA 1K96A 1SBJA 1QS7A 3EK8A 1KSMA 1JFKA 1NUBA 1OMDA 2L2CA 1MHOA 1N2DA 2WCMA 4MLWA 1WY9A 1Y6WA 2GV5A 3HCMA 1OZOA 4C0LA 4PE7A 3TUYB 1GM0A 3L4AA 2F33A 2FJUB 5AEQA 2E6WA 1PSRA 3SS5A 1NCYA 4AOMA 2G2BA 1PVBA 2H8VA 1CDNA 1AP4A 1BF5A 2AAOA 2HQWA 5KU1A 5FYXA 1A2XA 1OOIX 1SKTA 1JF2A 2F3YA 4R1EA 1BLQA 1LA0A 2JWWA 3LK1A 1B4CA 1R6PA 3VGOA 1S6IA 4BY4A 1KK7Z 1OSAA 3IF7A 2KSPA 4DUQA 2CCMA 2KFGA 2AUCA 1YURA 4PCWA 4XJKB 2F8PA 2LMTA 1IQ5A 4GFTA 1MQ1A 2KPHA 2OTGB 2YGUA 3VROA 1P28A 2JOJA 4HRHA 1CTRA 1QV1A 5HLOA 1CB1A 1IKUA 3SS4A 1X02A 1S36A 1UHKA 1PRWA 3B6XA 4XYNA 1Y1UA 4YGCB 4YI9A 2G9BA 2ZKMX 1NX2A 1RWYA 3OX5A 1SW8A 1CFCA 3PFVA 1SCVA 1F70A 4MRXA 4MN0A 2BKHB 5HKZA 1KFXL 1TN4A 2QEBA 4MVFA 1DJIA 4FTGA 3I5GB 3DZTA 5JJGA 2WCFA 4L9MA 2RGIA 1XFZO 4PHKA 1QLSA 3B86A 5EL2A 1B8CA 3DD4A 4ZCVA 3EVVA 3NHIA 4OR9B 1SR6C 4IJ7A 1TUZA 2ZNEA 2B1UA 2KBMA 1JF0A 1FI6A 3R1OA 1B8RA 1WRLA 3D76A 1RROA 3FE9A 3DF0B 3K1EA 1CDMA 3DVEA 2JTZA 4CPVA 1KK8B 3QMEA 1BR4B 2LMVA 2JULA 3M0WA 3SG6A 3BJHA 1IIOA 1YR5A 2FJYA 3EVRA 3OB1B 4GNKB 2M9GA 1BMOA 2PASA 1KK7Y 2TN4A 2BCXA 2WC6A 2KI4C 5FI2A 3EKJA 1QJTA 1KWOB 2LLSA 3DXLA 3BOWB 5F6TA 1TUJA 1A29A 1ZFSA 2HQ8A 2L5XB 3L4LA 5D69A 5HLVA 3RZSA 2K8MB 2JNFA 1SY9A 2K7CA 2MHHA 3KHEA 4GGFA 4M2PA 3B87A 4PE1A 1FBVA 1F55A 2JXLA 1SCMB 4N5XA 1S1EA 1WDCC 3KF9A 3CR5X 1XK4C 4ORBB 5DKRA 1W7IB 2MA2A 3D75A 2OS8C 4NQGA 4MRYA 2ZFDA 2LANA 3CGAA 1VRKA 1Y1XA 2KYFA 4M2OA 1AK8A 1QASA 4WRIA 2Q91A 1B47A 1FPWA 1XFXO 2ISDA 2WOSA 1CFPA 3Q8IA 4JQ0D 4PHJA 3OHMB 2M7NA 1J55A 1IWQA 2GGZA 2WNDA 3TDUA 4U8DA 1CMFA 2MRDA 4JPZB 4MZJA 2PALA 4MZKA 3CLNA 3CZ1A 1QXPA 1F71A 5I2QA 2JXCA 3WHUB 1B8LA 1GJYA 2KHNA 4I5LB 4AQJA 1Z4HA 1DTLA 2QDIA 2I2RE 2LVKA 4NDDA 4PE0A 3V2LA 2GGMA 2P6BB 1ODBA 3BUOB 2CNPA 2MAZA 1L2OC 5KSZA 2JPTA 3I5GC 1S6JA 2M29A 2KAVA 4QJ4B 1UUSA 2FOTA 3R1PA 5IBWA 4PALA 3CWGA 3JVTC 4GAOA 5HYDA 3N7HA 2KLDA 2WCHA 2MJWB 3GK1A 4QJ5B 1KFXS 1PSBA 2L2EA 3K21A 1W9ZA 2K7BA 2JT8A 2SCPA 3PN7C 1AJ5A 1K95A 3FE6A 1QIVA 3PM8A 2QPTA 3AKBA 1XFWO 2NXQA 3TDIA 2PRUA 3DF0A 1R2UA 1SL9A 3D10A 4ICBA 1TNPA 3SIAA 1NSHA 1KSOA 1UHJA 2LV7A 3O78A 1ALWA 2H61A 1H8BA 1QX2A 2KQYA 2H61C 2NZ0A 1UURA 3CZTX 3JTDB 1G8IA 1GGZA 2ZRTA 1NCZA 1OOJA 1Y0VH 4YI8A 1MR8A 2LCPA 1FI5A 1BOCA 1RTP1 1UHHA 3I5IC 2BKIB 2LHLA 3BOWA 4I5JA 4N1FA 2Q4UA 2QEHA 1KFUL 4PHMA 4YGBB 2I18A 3IVTA 1DMOA 1K93D 4A4BA 2HF5A 1K90D 3SG3A 3I5HC 3E3RA 5D3OA 3TS5C 3R1VA 2L5YA 1RFJA 1TOPA 1IGVA 1JBAA 1C7VA 1B7TZ 1K2HA 2KNEA 1DJYA 1IQ3A 1IG5A 3D0YB 4WQ3A 3AAJA 4JKTA 5CSIA 4D1EA 1BU3A 4DRWA 2M7LA 2MLEC 2NLNA 2FCEA 5GQQC 3MSEB 5ER5A 1ZACA 2SASA 3EG5B 2WCJA 1DT7B 1LKJA 3H4SE 2BCBA 2JNXA 1TNQA 1CDPA 2O5GA 2WC5A 1TIZA 4P5OE 2M1UA 1SNLA 3S0DA 2OPOA 1Q80A 3GOFA 1J7QA 1CFDA 1OZSA 3VB1A 1EG3A 2AMIA 5CSNA 1XFYO 1OMVA 2CBLA 3S0AA 1IJ6A 2L50A 2LNKA 4DS7A 3R72A 3RLZA 3C1VA 2LVJA 3BUMB 3KO0A 1DJZA 1ZUZA 3I5FC 1OOHA 2LHIA 1A75B 1BJFA 3CZ2A 5CSFA 1CLMA 2BL0B 2A4JA 4DIRA 2JQ6A 2JT0A 1DEKA 3PALA 1BODA 1KQMB 1UHIA 4PE4A 1UHNA 2DOQA 1JUOA 1NX1A 5G08A 4GGNA 4ZCUA 5B8IB 4PDZA 1RJVA 1XFRA 3CZ0A 3S0EA 2QEOA 4N1GA 1CFFA 1NPQA 1YVLA 2PVBA 2K61A 2Y1NA 5DICA 2FCDA 2JZIA 5FI7A 5HKWA 2K60A 3TUYC 1PULA 1XVJA 2NCOA 3PJIA 5JOLA 1TNWA 1N0YA 2JU0A 2JPOA 3NGVA 2JRFA 1B7TY 3A4UB 2PSRA 3CABA 3FS7A 3SG7A 1NX0A 1PALA 1LA3A 2COLB 2KQ6A 4INXA 5D7FA 4GGFC 5BPJA 2KLEA 2BBNA 4MZLA 3LK0A 1IRJA 3NHTA 4GBAA 5I8NA 3KEVA 1C07A 1IH0A 1OW4A 4IL1A 4KYNA 3DVJA 4QJ3B 4XJKA 2KGBC 2LUCA 2L0PA 4OVNF 1KFUS 1D1OA 3D77A 1NIWA 3S0BA 2D8NA 4UPGA 2OTGC 1QVIZ 5DKNA 3UNWA 2JC2A 1YUUA 2BE6A 1W7JB 2JT3A 2ZRSA 3A8RA 2LM5A 1KCYA 2KAYA 1XO5A 2KDHA 1T14A 2LUXA 2ERBA 1JFJA 1NCXA 1WRZA 1WLZA 3L47A 4CIDA 1TCOB 2LLTA 2M1KB 3B7AA 4GPLB 4INWA 1U5IB 1J7PA 1G4YR 2EC6B 3CTNA 1SL7A 1FW4A 1QIWA 1DJWA 3TDZA 4I5KA 1MUXA 2QEVA 3GK4X 3QRXA 5DKQA 2V53A 3BXKA 2KI6D 3ZWHA 3VRRA 1CDLA 1UWOA 1A75A 3DY9A 3O4XA 4MBEA 5I2OA 3O2PA 3O4YA 3EK4A 3EK7A 4HSZA 5HKYA 1SRAA 4OCIA 3PM2A 3D78A 5CSJA 2CT9A 1TCFA 1DVIA 2NCPA 5ER4X 1J1EA 1LINA 1B1GA 4YBHB 1RK9A 4FQOA 2L51A 3SG4A 1MXEA 4OV2A 1K9PA 1KK8C 1SR6B 2M8UA 4FQTA 1QWVA 1J7OA 4I5NB 2JTTA 2WCBA 1M45A 4JWQA 1WRKA 5AXIA 2P70A 1PVAA 1ZMZA 3CR4X 4MSPA 1BG1A 2O60A 2ZN8A 2I7AA 1YX8A 2BCAA 2QACA 2WORA 3S0GA 1CKKA 1EJ3A 2PMYA 4OKHA 4CFRA 1A03A 1KWOC 2CTNA 2WCLA 1NWDA 1F4QA 3WXAA 3FE8A 1Z2CB 3NSOA 3BFAA 1DF0B 2WCKA 2BAPA 4Q04A 3B88A 1QVIY 5PALA 1BR1B 1S3PA 1SCMC 2M97A 5KTYA 3F45A 3VRQA 3WHTB 3KPXA 1UP5A 1TWOA 5I2LA 1K9UA 1SYMA 2KI4B 2F2OA 3SJSA 3ZNIA 1DJHA 1B9AA 1K8UA 2F2PA 3NSLA 1TRFA 1MXLC 1HT9A 2K0JA 3LLEA 4ORAB 1S6CA 1M63B 2F3ZA 4YGAA 2R2IA 3BYAA 2KFHA 1OOFA 2LMUA 3BFBA 3BFHA 4C0KA 1TTXA 1WDCB 2LC5A 2WCEA 2Y1MA 1OOGA 2LP3A 3PATA 3BQ3A 2OS8B 1JWDA 1F4OA 1K9KA 2M3WA 3IQQA 4F0ZB 1K94A 4BY5A 1H4BA 3IQOA 2LP2A 2K7DA 1YTZC 3EVUA 1F54A 3CS1A 4NDBA 5TNCA 1U5IA 2Y5IA 4CLNA 1NX3A 3OX6A 4WQ2A 4YGDB 2EC6C 1YRUB 3GK2A 1S5GZ 1JC2A 2GTEA 1AUIB 1CM1A 1YVHA 3BUXB 2LAPA 3HX4A 4TNCA 1V1FA 2P71A 1NYAA 1C7WA 2KGRA 2E30A 4JD9A 4YGEB 4C0JA 1M46A 1SMGA 1EL4A 2LVVA 5I94A 1DGUA 1DJGA 3DYEA 1J1DA 2H2KA 1G33A 3FIAA 4A4CA 3S0FA 1OQPA 1V1GA 1L2OB 3FWCA 2KAXA 2M0RA 3LL8B 4NDCA 3CR2A 3JVTB 1LXFC 2IS9A 1QLKA 3VRNA 1ALVA 1DJXA 5FI6A 2KBIA 1N65A 3AAKA 3VRPA 3OGNA 5AANA 2BBMA 4ORCB 2KI6C 2Y4QA 2BNXA 3JTDC 5CPVA 1ZOTB 3ICBA 3PN7B 2PYQA 1XA5A 2ZN9A 3OB2B 4HREE 1A4PA 1CLLA 2K2AA 1YX7A 1QV0A 1E8AA 2KFFA 4ETOA 2LVIA 1CNPA 1M39A 5AERA 1C3YA 3CYZA 1DF0A 1AJ4A 2HPSA 5AFPA 1OMRA 2LLUA 1ORGA 2HETA 3SS3A 2KYCA 1XYDA 3NSIA 1DELA 3D0YA 3RM1A 4AQIA 4F7FA 3I5IB 2M49B 1QX5B 1MF8B 1SSEB 2CXJA 1NP8A 1OE9B 2WC8A 3CDNA 4OZDA 2PQLA 3SG2A 1Y1AA 2I94A 4USLA 4PHNA 1QATA 3WNXB 1DQEA 3I5HB 5J3XA 3TS5B 1EXRA 1RECA 3PLFB 5HL1A 2LE9B 1SK6D 1XK4A 3DVMA 2MLFC 3NSKA 4M2QA 4CFQA 1S5GY 3LCPC 3BUNB 1PK0D 1FF1A 1DGVA 1GQMA 1F8HA 1GGWA 3OP0A 3D74A 1CLBA 4MEWA 2VRGA 1CMGA 1QTXA 4HRGA 1IJ5A 1LVCD 3AKAA 2MBXA 1XFVO 1WLMA 1J7RA 3SG5A 3O6BA 4DCKA 1AVSA 1AHRA 2ZNDA 1SL8A 1JSAA 2EHBA 4PT1A 3BUWB 2BL0C 3SIBA 1MWNA 1XFUO 2K7OA 3DVKA 4GUKA 1KQMC 1C3ZA 1EG4A 1YRTB 1M31A 3NXAA 5K89A 1CM4A 2BECA 3PSRA 1QX7A 3UO9A 1YUSA 2K2FA 4P2YB 1EH2A 3I5FB 1L7ZA 2L4HA 2EGDA 1TNXA
chains in the Genus database with same CATH topology
1HQVA 2KOTA 3FWBA 1BT6A 1KQVA 4E68A 1SPYA 1YUTA 2L4IA 3TZ1A 4YRUA 1S26D 2BE4A 2L98A 3EKHA 1K96A 1SBJA 1QS7A 3EK8A 1KSMA 1JFKA 1NUBA 1OMDA 4MLWA 1MHOA 1N2DA 1WY9A 1Y6WA 2GV5A 3HCMA 1OZOA 4C0LA 4PE7A 3TUYB 2F33A 2FJUB 5AEQA 2E6WA 1PSRA 1NCYA 4AOMA 2G2BA 1PVBA 1CDNA 1AP4A 1BF5A 2AAOA 2HQWA 5KU1A 5FYXA 1A2XA 1SKTA 4R1EA 1JF2A 2F3YA 1BLQA 1LA0A 2JWWA 3LK1A 1B4CA 1R6PA 3VGOA 1S6IA 4BY4A 1KK7Z 1OSAA 3IF7A 2KSPA 4DUQA 2CCMA 2KFGA 2AUCA 1YURA 4PCWA 4XJKB 2F8PA 2LMTA 1IQ5A 4GFTA 1MQ1A 2OTGB 3VROA 2JOJA 4HRHA 1CTRA 1QV1A 5HLOA 1CB1A 1IKUA 1X02A 1S36A 1UHKA 1PRWA 4XYNA 4YGCB 1Y1UA 4YI9A 2G9BA 2ZKMX 1NX2A 1RWYA 3OX5A 1SW8A 1CFCA 3PFVA 1SCVA 1F70A 4MRXA 4MN0A 2BKHB 5HKZA 1KFXL 1TN4A 4MVFA 1DJIA 4FTGA 3I5GB 5JJGA 2WCFA 4L9MA 2RGIA 1XFZO 4PHKA 1QLSA 1B8CA 3DD4A 4ZCVA 3EVVA 4OR9B 1SR6C 2ZNEA 2B1UA 2KBMA 1JF0A 1B8RA 1WRLA 1RROA 3DF0B 1CDMA 3DVEA 2JTZA 4CPVA 1KK8B 1BR4B 2LMVA 2JULA 3M0WA 3SG6A 1YR5A 3EVRA 3OB1B 4GNKB 2M9GA 1BMOA 2PASA 1KK7Y 2TN4A 2BCXA 2KI4C 3EKJA 1QJTA 1KWOB 2LLSA 3BOWB 5F6TA 1ZFSA 1A29A 2HQ8A 2L5XB 5D69A 5HLVA 2K8MB 2JNFA 1SY9A 2K7CA 2MHHA 3KHEA 4GGFA 4M2PA 4PE1A 1FBVA 1F55A 2JXLA 1SCMB 4N5XA 1S1EA 1WDCC 3KF9A 3CR5X 1XK4C 4ORBB 5DKRA 1W7IB 2MA2A 4NQGA 2OS8C 4MRYA 2ZFDA 2LANA 3CGAA 1VRKA 1Y1XA 2KYFA 4M2OA 1AK8A 1QASA 4WRIA 2Q91A 1B47A 1FPWA 1XFXO 2ISDA 2WOSA 1CFPA 4JQ0D 4PHJA 3OHMB 2M7NA 1J55A 1IWQA 2GGZA 2WNDA 3TDUA 4U8DA 1CMFA 2MRDA 4JPZB 4MZJA 2PALA 4MZKA 3CLNA 1QXPA 1F71A 5I2QA 2JXCA 3WHUB 1B8LA 1GJYA 2KHNA 4I5LB 4AQJA 1DTLA 4NDDA 2I2RE 2LVKA 4PE0A 2GGMA 2P6BB 1ODBA 3BUOB 2CNPA 2MAZA 1L2OC 5KSZA 2JPTA 3I5GC 1S6JA 2M29A 2KAVA 4QJ4B 1UUSA 2FOTA 1FI6A 5IBWA 4PALA 3CWGA 3JVTC 4GAOA 5HYDA 2MJWB 3GK1A 4QJ5B 1KFXS 1PSBA 2L2EA 3K21A 2K7BA 2JT8A 2SCPA 3PN7C 1AJ5A 1K95A 3PM8A 1QIVA 2QPTA 3AKBA 1XFWO 2NXQA 3TDIA 2PRUA 3DF0A 1R2UA 1SL9A 3D10A 4ICBA 1TNPA 3SIAA 1NSHA 1KSOA 1UHJA 2LV7A 3O78A 1ALWA 2H61A 1H8BA 1QX2A 2KQYA 2H61C 2NZ0A 1UURA 3CZTX 3JTDB 1G8IA 1GGZA 2ZRTA 1NCZA 1OOJA 1Y0VH 4YI8A 1MR8A 2LCPA 1FI5A 1BOCA 1RTP1 1UHHA 3I5IC 2BKIB 2LHLA 3BOWA 4I5JA 4N1FA 2Q4UA 1KFUL 4PHMA 4YGBB 2I18A 1DMOA 1K93D 4A4BA 2HF5A 1K90D 3SG3A 3I5HC 3E3RA 3TS5C 1RFJA 1TOPA 1IGVA 1JBAA 1C7VA 1B7TZ 1K2HA 2KNEA 1DJYA 1IQ3A 1IG5A 3D0YB 4WQ3A 3AAJA 5CSIA 4D1EA 1BU3A 4DRWA 2M7LA 2MLEC 2NLNA 2FCEA 5GQQC 3MSEB 5ER5A 1ZACA 2SASA 1DT7B 1LKJA 3H4SE 2BCBA 2JNXA 1TNQA 1CDPA 2O5GA 1TIZA 4P5OE 2M1UA 1SNLA 2OPOA 1Q80A 3GOFA 1J7QA 1CFDA 1OZSA 1EG3A 2AMIA 5CSNA 1XFYO 1OMVA 2CBLA 1IJ6A 2L50A 2LNKA 4DS7A 3RLZA 3C1VA 2LVJA 3BUMB 3KO0A 1DJZA 1ZUZA 3I5FC 2LHIA 5CSFA 1A75B 1BJFA 1CLMA 2BL0B 2A4JA 4DIRA 2JQ6A 2JT0A 3PALA 1BODA 1KQMB 1UHIA 4PE4A 1UHNA 2DOQA 1JUOA 1NX1A 5G08A 4GGNA 4ZCUA 5B8IB 4PDZA 1RJVA 1CFFA 4N1GA 1NPQA 1YVLA 2PVBA 2K61A 2Y1NA 2FCDA 2JZIA 5HKWA 3TUYC 1PULA 1XVJA 2NCOA 5JOLA 1TNWA 1N0YA 2JU0A 2JRFA 1B7TY 3A4UB 2PSRA 3FS7A 3SG7A 1NX0A 1PALA 1LA3A 2COLB 2KQ6A 5D7FA 4GGFC 5BPJA 2BBNA 4MZLA 3LK0A 1IRJA 4GBAA 5I8NA 3KEVA 1C07A 1IH0A 4IL1A 3DVJA 4QJ3B 4XJKA 2KGBC 2LUCA 2L0PA 4OVNF 1KFUS 1D1OA 1NIWA 2D8NA 4UPGA 2OTGC 1QVIZ 5DKNA 2JC2A 1YUUA 2BE6A 1W7JB 2JT3A 2ZRSA 3A8RA 2LM5A 1KCYA 2KAYA 1XO5A 2KDHA 2LUXA 1JFJA 1NCXA 1WRZA 1WLZA 4CIDA 1TCOB 2LLTA 2M1KB 4GPLB 1U5IB 1J7PA 1G4YR 2EC6B 3CTNA 1SL7A 1FW4A 1QIWA 1DJWA 3TDZA 4I5KA 1MUXA 3QRXA 3GK4X 5DKQA 2V53A 3BXKA 2KI6D 3ZWHA 3VRRA 1CDLA 1UWOA 1A75A 4MBEA 5I2OA 3O2PA 3O4YA 3EK4A 3EK7A 4HSZA 5HKYA 1SRAA 4OCIA 5CSJA 2CT9A 1TCFA 1DVIA 2NCPA 5ER4X 1J1EA 1LINA 1B1GA 4YBHB 1RK9A 4FQOA 2L51A 3SG4A 1MXEA 4OV2A 1K9PA 1KK8C 1SR6B 2M8UA 1J7OA 4I5NB 2JTTA 2WCBA 1M45A 4JWQA 1WRKA 5AXIA 1PVAA 1ZMZA 3CR4X 4MSPA 1BG1A 2O60A 2ZN8A 2I7AA 1YX8A 2BCAA 2QACA 2WORA 1CKKA 1EJ3A 2PMYA 4OKHA 4CFRA 1A03A 1KWOC 2CTNA 1NWDA 1F4QA 3WXAA 3NSOA 1DF0B 4Q04A 1QVIY 5PALA 1BR1B 1S3PA 1SCMC 2M97A 5KTYA 3F45A 3VRQA 3WHTB 3KPXA 1UP5A 5I2LA 3SJSA 1K9UA 1SYMA 2KI4B 2F2OA 3ZNIA 1DJHA 1B9AA 1K8UA 2F2PA 3NSLA 1TRFA 1MXLC 1HT9A 2K0JA 3LLEA 4ORAB 1S6CA 1M63B 2F3ZA 4YGAA 2R2IA 3BYAA 2KFHA 4C0KA 2LMUA 1TTXA 1WDCB 2LC5A 2WCEA 2Y1MA 2LP3A 3PATA 3BQ3A 2OS8B 1JWDA 1F4OA 1K9KA 2M3WA 3IQQA 4F0ZB 1K94A 4BY5A 1H4BA 3IQOA 2LP2A 2K7DA 1YTZC 3EVUA 1F54A 3CS1A 4NDBA 5TNCA 1U5IA 2Y5IA 4CLNA 1NX3A 3OX6A 4WQ2A 4YGDB 2EC6C 1YRUB 3GK2A 1S5GZ 1JC2A 1AUIB 1CM1A 1YVHA 3BUXB 2LAPA 3HX4A 4TNCA 1V1FA 1NYAA 1C7WA 2KGRA 2E30A 4YGEB 4C0JA 1M46A 1SMGA 1EL4A 2LVVA 1DGUA 1DJGA 4A4CA 1J1DA 2H2KA 1G33A 3FIAA 1OQPA 1V1GA 1L2OB 3FWCA 2KAXA 2M0RA 3LL8B 4NDCA 3CR2A 3JVTB 1LXFC 2IS9A 1QLKA 3VRNA 1ALVA 1DJXA 2KBIA 1N65A 3AAKA 3VRPA 5AANA 2BBMA 4ORCB 2KI6C 2Y4QA 3JTDC 5CPVA 1ZOTB 3ICBA 3PN7B 1XA5A 2ZN9A 3OB2B 4HREE 1A4PA 1CLLA 2K2AA 1YX7A 1QV0A 1E8AA 2KFFA 4ETOA 2LVIA 1CNPA 1M39A 5AERA 1DF0A 1AJ4A 2HPSA 5AFPA 1OMRA 2LLUA 2HETA 2KYCA 1XYDA 3NSIA 3D0YA 3RM1A 4AQIA 3I5IB 2M49B 1QX5B 1MF8B 2WC8A 2CXJA 1NP8A 1OE9B 3SG2A 1Y1AA 2I94A 4USLA 4PHNA 1QATA 3WNXB 3I5HB 5J3XA 3TS5B 1EXRA 1RECA 3PLFB 2LE9B 1SK6D 1XK4A 3DVMA 2MLFC 3NSKA 4M2QA 4CFQA 1S5GY 3LCPC 3BUNB 1PK0D 1FF1A 1DGVA 1GQMA 1F8HA 1GGWA 3OP0A 1CLBA 4MEWA 2VRGA 1CMGA 1QTXA 4HRGA 1IJ5A 1LVCD 3AKAA 2MBXA 1XFVO 1WLMA 1J7RA 3SG5A 3O6BA 4DCKA 1AVSA 1AHRA 2ZNDA 1SL8A 1JSAA 2EHBA 3BUWB 2BL0C 3SIBA 1MWNA 1XFUO 2K7OA 3DVKA 4GUKA 1KQMC 1EG4A 1M31A 1YRTB 3NXAA 5K89A 1CM4A 2BECA 3PSRA 1QX7A 1YUSA 2K2FA 4P2YB 1EH2A 3I5FB 1L7ZA 2L4HA 2EGDA 1TNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQV A;  2KOT A;  3FWB A;  1BT6 A;  1KQV A;  4E68 A;  1SPY A;  1YUT A;  2L4I A;  3TZ1 A;  4YRU A;  1S26 D;  2BE4 A;  2L98 A;  3EKH A;  1K96 A;  1SBJ A;  1QS7 A;  3EK8 A;  1KSM A;  1JFK A;  1NUB A;  1OMD A;  4MLW A;  1MHO A;  1N2D A;  1WY9 A;  1Y6W A;  2GV5 A;  3HCM A;  1OZO A;  4C0L A;  4PE7 A;  3TUY B;  2F33 A;  2FJU B;  5AEQ A;  2E6W A;  1PSR A;  1NCY A;  4AOM A;  2G2B A;  1PVB A;  1CDN A;  1AP4 A;  1BF5 A;  2AAO A;  2HQW A;  5KU1 A;  5FYX A;  1A2X A;  1SKT A;  4R1E A;  1JF2 A;  2F3Y A;  1BLQ A;  1LA0 A;  2JWW A;  3LK1 A;  1B4C A;  1R6P A;  3VGO A;  1S6I A;  4BY4 A;  1KK7 Z;  1OSA A;  3IF7 A;  2KSP A;  4DUQ A;  2CCM A;  2KFG A;  2AUC A;  1YUR A;  4PCW A;  4XJK B;  2F8P A;  2LMT A;  1IQ5 A;  4GFT A;  1MQ1 A;  2OTG B;  3VRO A;  2JOJ A;  4HRH A;  1CTR A;  1QV1 A;  5HLO A;  1CB1 A;  1IKU A;  1X02 A;  1S36 A;  1UHK A;  1PRW A;  4XYN A;  4YGC B;  1Y1U A;  4YI9 A;  2G9B A;  2ZKM X;  1NX2 A;  1RWY A;  3OX5 A;  1SW8 A;  1CFC A;  3PFV A;  1SCV A;  1F70 A;  4MRX A;  4MN0 A;  2BKH B;  5HKZ A;  1KFX L;  1TN4 A;  4MVF A;  1DJI A;  4FTG A;  3I5G B;  5JJG A;  2WCF A;  4L9M A;  2RGI A;  1XFZ O;  4PHK A;  1QLS A;  1B8C A;  3DD4 A;  4ZCV A;  3EVV A;  4OR9 B;  1SR6 C;  2ZNE A;  2B1U A;  2KBM A;  1JF0 A;  1B8R A;  1WRL A;  1RRO A;  3DF0 B;  1CDM A;  3DVE A;  2JTZ A;  4CPV A;  1KK8 B;  1BR4 B;  2LMV A;  2JUL A;  3M0W A;  3SG6 A;  1YR5 A;  3EVR A;  3OB1 B;  4GNK B;  2M9G A;  1BMO A;  2PAS A;  1KK7 Y;  2TN4 A;  2BCX A;  2KI4 C;  3EKJ A;  1QJT A;  1KWO B;  2LLS A;  3BOW B;  5F6T A;  1ZFS A;  1A29 A;  2HQ8 A;  2L5X B;  5D69 A;  5HLV A;  2K8M B;  2JNF A;  1SY9 A;  2K7C A;  2MHH A;  3KHE A;  4GGF A;  4M2P A;  4PE1 A;  1FBV A;  1F55 A;  2JXL A;  1SCM B;  4N5X A;  1S1E A;  1WDC C;  3KF9 A;  3CR5 X;  1XK4 C;  4ORB B;  5DKR A;  1W7I B;  2MA2 A;  4NQG A;  2OS8 C;  4MRY A;  2ZFD A;  2LAN A;  3CGA A;  1VRK A;  1Y1X A;  2KYF A;  4M2O A;  1AK8 A;  1QAS A;  4WRI A;  2Q91 A;  1B47 A;  1FPW A;  1XFX O;  2ISD A;  2WOS A;  1CFP A;  4JQ0 D;  4PHJ A;  3OHM B;  2M7N A;  1J55 A;  1IWQ A;  2GGZ A;  2WND A;  3TDU A;  4U8D A;  1CMF A;  2MRD A;  4JPZ B;  4MZJ A;  2PAL A;  4MZK A;  3CLN A;  1QXP A;  1F71 A;  5I2Q A;  2JXC A;  3WHU B;  1B8L A;  1GJY A;  2KHN A;  4I5L B;  4AQJ A;  1DTL A;  4NDD A;  2I2R E;  2LVK A;  4PE0 A;  2GGM A;  2P6B B;  1ODB A;  3BUO B;  2CNP A;  2MAZ A;  1L2O C;  5KSZ A;  2JPT A;  3I5G C;  1S6J A;  2M29 A;  2KAV A;  4QJ4 B;  1UUS A;  2FOT A;  1FI6 A;  5IBW A;  4PAL A;  3CWG A;  3JVT C;  4GAO A;  5HYD A;  2MJW B;  3GK1 A;  4QJ5 B;  1KFX S;  1PSB A;  2L2E A;  3K21 A;  2K7B A;  2JT8 A;  2SCP A;  3PN7 C;  1AJ5 A;  1K95 A;  3PM8 A;  1QIV A;  2QPT A;  3AKB A;  1XFW O;  2NXQ A;  3TDI A;  2PRU A;  3DF0 A;  1R2U A;  1SL9 A;  3D10 A;  4ICB A;  1TNP A;  3SIA A;  1NSH A;  1KSO A;  1UHJ A;  2LV7 A;  3O78 A;  1ALW A;  2H61 A;  1H8B A;  1QX2 A;  2KQY A;  2H61 C;  2NZ0 A;  1UUR A;  3CZT X;  3JTD B;  1G8I A;  1GGZ A;  2ZRT A;  1NCZ A;  1OOJ A;  1Y0V H;  4YI8 A;  1MR8 A;  2LCP A;  1FI5 A;  1BOC A;  1RTP 1;  1UHH A;  3I5I C;  2BKI B;  2LHL A;  3BOW A;  4I5J A;  4N1F A;  2Q4U A;  1KFU L;  4PHM A;  4YGB B;  2I18 A;  1DMO A;  1K93 D;  4A4B A;  2HF5 A;  1K90 D;  3SG3 A;  3I5H C;  3E3R A;  3TS5 C;  1RFJ A;  1TOP A;  1IGV A;  1JBA A;  1C7V A;  1B7T Z;  1K2H A;  2KNE A;  1DJY A;  1IQ3 A;  1IG5 A;  3D0Y B;  4WQ3 A;  3AAJ A;  5CSI A;  4D1E A;  1BU3 A;  4DRW A;  2M7L A;  2MLE C;  2NLN A;  2FCE A;  5GQQ C;  3MSE B;  5ER5 A;  1ZAC A;  2SAS A;  1DT7 B;  1LKJ A;  3H4S E;  2BCB A;  2JNX A;  1TNQ A;  1CDP A;  2O5G A;  1TIZ A;  4P5O E;  2M1U A;  1SNL A;  2OPO A;  1Q80 A;  3GOF A;  1J7Q A;  1CFD A;  1OZS A;  1EG3 A;  2AMI A;  5CSN A;  1XFY O;  1OMV A;  2CBL A;  1IJ6 A;  2L50 A;  2LNK A;  4DS7 A;  3RLZ A;  3C1V A;  2LVJ A;  3BUM B;  3KO0 A;  1DJZ A;  1ZUZ A;  3I5F C;  2LHI A;  5CSF A;  1A75 B;  1BJF A;  1CLM A;  2BL0 B;  2A4J A;  4DIR A;  2JQ6 A;  2JT0 A;  3PAL A;  1BOD A;  1KQM B;  1UHI A;  4PE4 A;  1UHN A;  2DOQ A;  1JUO A;  1NX1 A;  5G08 A;  4GGN A;  4ZCU A;  5B8I B;  4PDZ A;  1RJV A;  1CFF A;  4N1G A;  1NPQ A;  1YVL A;  2PVB A;  2K61 A;  2Y1N A;  2FCD A;  2JZI A;  5HKW A;  3TUY C;  1PUL A;  1XVJ A;  2NCO A;  5JOL A;  1TNW A;  1N0Y A;  2JU0 A;  2JRF A;  1B7T Y;  3A4U B;  2PSR A;  3FS7 A;  3SG7 A;  1NX0 A;  1PAL A;  1LA3 A;  2COL B;  2KQ6 A;  5D7F A;  4GGF C;  5BPJ A;  2BBN A;  4MZL A;  3LK0 A;  1IRJ A;  4GBA A;  5I8N A;  3KEV A;  1C07 A;  1IH0 A;  4IL1 A;  3DVJ A;  4QJ3 B;  4XJK A;  2KGB C;  2LUC A;  2L0P A;  4OVN F;  1KFU S;  1D1O A;  1NIW A;  2D8N A;  4UPG A;  2OTG C;  1QVI Z;  5DKN A;  2JC2 A;  1YUU A;  2BE6 A;  1W7J B;  2JT3 A;  2ZRS A;  3A8R A;  2LM5 A;  1KCY A;  2KAY A;  1XO5 A;  2KDH A;  2LUX A;  1JFJ A;  1NCX A;  1WRZ A;  1WLZ A;  4CID A;  1TCO B;  2LLT A;  2M1K B;  4GPL B;  1U5I B;  1J7P A;  1G4Y R;  2EC6 B;  3CTN A;  1SL7 A;  1FW4 A;  1QIW A;  1DJW A;  3TDZ A;  4I5K A;  1MUX A;  3QRX A;  3GK4 X;  5DKQ A;  2V53 A;  3BXK A;  2KI6 D;  3ZWH A;  3VRR A;  1CDL A;  1UWO A;  1A75 A;  4MBE A;  5I2O A;  3O2P A;  3O4Y A;  3EK4 A;  3EK7 A;  4HSZ A;  5HKY A;  1SRA A;  4OCI A;  5CSJ A;  2CT9 A;  1TCF A;  1DVI A;  2NCP A;  5ER4 X;  1J1E A;  1LIN A;  1B1G A;  4YBH B;  1RK9 A;  4FQO A;  2L51 A;  3SG4 A;  1MXE A;  4OV2 A;  1K9P A;  1KK8 C;  1SR6 B;  2M8U A;  1J7O A;  4I5N B;  2JTT A;  2WCB A;  1M45 A;  4JWQ A;  1WRK A;  5AXI A;  1PVA A;  1ZMZ A;  3CR4 X;  4MSP A;  1BG1 A;  2O60 A;  2ZN8 A;  2I7A A;  1YX8 A;  2BCA A;  2QAC A;  2WOR A;  1CKK A;  1EJ3 A;  2PMY A;  4OKH A;  4CFR A;  1A03 A;  1KWO C;  2CTN A;  1NWD A;  1F4Q A;  3WXA A;  3NSO A;  1DF0 B;  4Q04 A;  1QVI Y;  5PAL A;  1BR1 B;  1S3P A;  1SCM C;  2M97 A;  5KTY A;  3F45 A;  3VRQ A;  3WHT B;  3KPX A;  1UP5 A;  5I2L A;  3SJS A;  1K9U A;  1SYM A;  2KI4 B;  2F2O A;  3ZNI A;  1DJH A;  1B9A A;  1K8U A;  2F2P A;  3NSL A;  1TRF A;  1MXL C;  1HT9 A;  2K0J A;  3LLE A;  4ORA B;  1S6C A;  1M63 B;  2F3Z A;  4YGA A;  2R2I A;  3BYA A;  2KFH A;  4C0K A;  2LMU A;  1TTX A;  1WDC B;  2LC5 A;  2WCE A;  2Y1M A;  2LP3 A;  3PAT A;  3BQ3 A;  2OS8 B;  1JWD A;  1F4O A;  1K9K A;  2M3W A;  3IQQ A;  4F0Z B;  1K94 A;  4BY5 A;  1H4B A;  3IQO A;  2LP2 A;  2K7D A;  1YTZ C;  3EVU A;  1F54 A;  3CS1 A;  4NDB A;  5TNC A;  1U5I A;  2Y5I A;  4CLN A;  1NX3 A;  3OX6 A;  4WQ2 A;  4YGD B;  2EC6 C;  1YRU B;  3GK2 A;  1S5G Z;  1JC2 A;  1AUI B;  1CM1 A;  1YVH A;  3BUX B;  2LAP A;  3HX4 A;  4TNC A;  1V1F A;  1NYA A;  1C7W A;  2KGR A;  2E30 A;  4YGE B;  4C0J A;  1M46 A;  1SMG A;  1EL4 A;  2LVV A;  1DGU A;  1DJG A;  4A4C A;  1J1D A;  2H2K A;  1G33 A;  3FIA A;  1OQP A;  1V1G A;  1L2O B;  3FWC A;  2KAX A;  2M0R A;  3LL8 B;  4NDC A;  3CR2 A;  3JVT B;  1LXF C;  2IS9 A;  1QLK A;  3VRN A;  1ALV A;  1DJX A;  2KBI A;  1N65 A;  3AAK A;  3VRP A;  5AAN A;  2BBM A;  4ORC B;  2KI6 C;  2Y4Q A;  3JTD C;  5CPV A;  1ZOT B;  3ICB A;  3PN7 B;  1XA5 A;  2ZN9 A;  3OB2 B;  4HRE E;  1A4P A;  1CLL A;  2K2A A;  1YX7 A;  1QV0 A;  1E8A A;  2KFF A;  4ETO A;  2LVI A;  1CNP A;  1M39 A;  5AER A;  1DF0 A;  1AJ4 A;  2HPS A;  5AFP A;  1OMR A;  2LLU A;  2HET A;  2KYC A;  1XYD A;  3NSI A;  3D0Y A;  3RM1 A;  4AQI A;  3I5I B;  2M49 B;  1QX5 B;  1MF8 B;  2WC8 A;  2CXJ A;  1NP8 A;  1OE9 B;  3SG2 A;  1Y1A A;  2I94 A;  4USL A;  4PHN A;  1QAT A;  3WNX B;  3I5H B;  5J3X A;  3TS5 B;  1EXR A;  1REC A;  3PLF B;  2LE9 B;  1SK6 D;  1XK4 A;  3DVM A;  2MLF C;  3NSK A;  4M2Q A;  4CFQ A;  1S5G Y;  3LCP C;  3BUN B;  1PK0 D;  1FF1 A;  1DGV A;  1GQM A;  1F8H A;  1GGW A;  3OP0 A;  1CLB A;  4MEW A;  2VRG A;  1CMG A;  1QTX A;  4HRG A;  1IJ5 A;  1LVC D;  3AKA A;  2MBX A;  1XFV O;  1WLM A;  1J7R A;  3SG5 A;  3O6B A;  4DCK A;  1AVS A;  1AHR A;  2ZND A;  1SL8 A;  1JSA A;  2EHB A;  3BUW B;  2BL0 C;  3SIB A;  1MWN A;  1XFU O;  2K7O A;  3DVK A;  4GUK A;  1KQM C;  1EG4 A;  1M31 A;  1YRT B;  3NXA A;  5K89 A;  1CM4 A;  2BEC A;  3PSR A;  1QX7 A;  1YUS A;  2K2F A;  4P2Y B;  1EH2 A;  3I5F B;  1L7Z A;  2L4H A;  2EGD A;  1TNX A; 
#chains in the Genus database with same CATH topology
 1HQV A;  2KOT A;  1LS8 A;  3FWB A;  1BT6 A;  1KQV A;  3OBV A;  4E68 A;  1DC1 A;  1SPY A;  1YUT A;  2L4I A;  3D73 A;  3TZ1 A;  4YRU A;  1S26 D;  2BE4 A;  2L98 A;  3EKH A;  1K96 A;  1SBJ A;  1QS7 A;  3EK8 A;  1KSM A;  1JFK A;  1NUB A;  1OMD A;  2L2C A;  1MHO A;  1N2D A;  2WCM A;  4MLW A;  1WY9 A;  1Y6W A;  2GV5 A;  3HCM A;  1OZO A;  4C0L A;  4PE7 A;  3TUY B;  1GM0 A;  3L4A A;  2F33 A;  2FJU B;  5AEQ A;  2E6W A;  1PSR A;  3SS5 A;  1NCY A;  4AOM A;  2G2B A;  1PVB A;  2H8V A;  1CDN A;  1AP4 A;  1BF5 A;  2AAO A;  2HQW A;  5KU1 A;  5FYX A;  1A2X A;  1OOI X;  1SKT A;  1JF2 A;  2F3Y A;  4R1E A;  1BLQ A;  1LA0 A;  2JWW A;  3LK1 A;  1B4C A;  1R6P A;  3VGO A;  1S6I A;  4BY4 A;  1KK7 Z;  1OSA A;  3IF7 A;  2KSP A;  4DUQ A;  2CCM A;  2KFG A;  2AUC A;  1YUR A;  4PCW A;  4XJK B;  2F8P A;  2LMT A;  1IQ5 A;  4GFT A;  1MQ1 A;  2KPH A;  2OTG B;  2YGU A;  3VRO A;  1P28 A;  2JOJ A;  4HRH A;  1CTR A;  1QV1 A;  5HLO A;  1CB1 A;  1IKU A;  3SS4 A;  1X02 A;  1S36 A;  1UHK A;  1PRW A;  3B6X A;  4XYN A;  1Y1U A;  4YGC B;  4YI9 A;  2G9B A;  2ZKM X;  1NX2 A;  1RWY A;  3OX5 A;  1SW8 A;  1CFC A;  3PFV A;  1SCV A;  1F70 A;  4MRX A;  4MN0 A;  2BKH B;  5HKZ A;  1KFX L;  1TN4 A;  2QEB A;  4MVF A;  1DJI A;  4FTG A;  3I5G B;  3DZT A;  5JJG A;  2WCF A;  4L9M A;  2RGI A;  1XFZ O;  4PHK A;  1QLS A;  3B86 A;  5EL2 A;  1B8C A;  3DD4 A;  4ZCV A;  3EVV A;  3NHI A;  4OR9 B;  1SR6 C;  4IJ7 A;  1TUZ A;  2ZNE A;  2B1U A;  2KBM A;  1JF0 A;  1FI6 A;  3R1O A;  1B8R A;  1WRL A;  3D76 A;  1RRO A;  3FE9 A;  3DF0 B;  3K1E A;  1CDM A;  3DVE A;  2JTZ A;  4CPV A;  1KK8 B;  3QME A;  1BR4 B;  2LMV A;  2JUL A;  3M0W A;  3SG6 A;  3BJH A;  1IIO A;  1YR5 A;  2FJY A;  3EVR A;  3OB1 B;  4GNK B;  2M9G A;  1BMO A;  2PAS A;  1KK7 Y;  2TN4 A;  2BCX A;  2WC6 A;  2KI4 C;  5FI2 A;  3EKJ A;  1QJT A;  1KWO B;  2LLS A;  3DXL A;  3BOW B;  5F6T A;  1TUJ A;  1A29 A;  1ZFS A;  2HQ8 A;  2L5X B;  3L4L A;  5D69 A;  5HLV A;  3RZS A;  2K8M B;  2JNF A;  1SY9 A;  2K7C A;  2MHH A;  3KHE A;  4GGF A;  4M2P A;  3B87 A;  4PE1 A;  1FBV A;  1F55 A;  2JXL A;  1SCM B;  4N5X A;  1S1E A;  1WDC C;  3KF9 A;  3CR5 X;  1XK4 C;  4ORB B;  5DKR A;  1W7I B;  2MA2 A;  3D75 A;  2OS8 C;  4NQG A;  4MRY A;  2ZFD A;  2LAN A;  3CGA A;  1VRK A;  1Y1X A;  2KYF A;  4M2O A;  1AK8 A;  1QAS A;  4WRI A;  2Q91 A;  1B47 A;  1FPW A;  1XFX O;  2ISD A;  2WOS A;  1CFP A;  3Q8I A;  4JQ0 D;  4PHJ A;  3OHM B;  2M7N A;  1J55 A;  1IWQ A;  2GGZ A;  2WND A;  3TDU A;  4U8D A;  1CMF A;  2MRD A;  4JPZ B;  4MZJ A;  2PAL A;  4MZK A;  3CLN A;  3CZ1 A;  1QXP A;  1F71 A;  5I2Q A;  2JXC A;  3WHU B;  1B8L A;  1GJY A;  2KHN A;  4I5L B;  4AQJ A;  1Z4H A;  1DTL A;  2QDI A;  2I2R E;  2LVK A;  4NDD A;  4PE0 A;  3V2L A;  2GGM A;  2P6B B;  1ODB A;  3BUO B;  2CNP A;  2MAZ A;  1L2O C;  5KSZ A;  2JPT A;  3I5G C;  1S6J A;  2M29 A;  2KAV A;  4QJ4 B;  1UUS A;  2FOT A;  3R1P A;  5IBW A;  4PAL A;  3CWG A;  3JVT C;  4GAO A;  5HYD A;  3N7H A;  2KLD A;  2WCH A;  2MJW B;  3GK1 A;  4QJ5 B;  1KFX S;  1PSB A;  2L2E A;  3K21 A;  1W9Z A;  2K7B A;  2JT8 A;  2SCP A;  3PN7 C;  1AJ5 A;  1K95 A;  3FE6 A;  1QIV A;  3PM8 A;  2QPT A;  3AKB A;  1XFW O;  2NXQ A;  3TDI A;  2PRU A;  3DF0 A;  1R2U A;  1SL9 A;  3D10 A;  4ICB A;  1TNP A;  3SIA A;  1NSH A;  1KSO A;  1UHJ A;  2LV7 A;  3O78 A;  1ALW A;  2H61 A;  1H8B A;  1QX2 A;  2KQY A;  2H61 C;  2NZ0 A;  1UUR A;  3CZT X;  3JTD B;  1G8I A;  1GGZ A;  2ZRT A;  1NCZ A;  1OOJ A;  1Y0V H;  4YI8 A;  1MR8 A;  2LCP A;  1FI5 A;  1BOC A;  1RTP 1;  1UHH A;  3I5I C;  2BKI B;  2LHL A;  3BOW A;  4I5J A;  4N1F A;  2Q4U A;  2QEH A;  1KFU L;  4PHM A;  4YGB B;  2I18 A;  3IVT A;  1DMO A;  1K93 D;  4A4B A;  2HF5 A;  1K90 D;  3SG3 A;  3I5H C;  3E3R A;  5D3O A;  3TS5 C;  3R1V A;  2L5Y A;  1RFJ A;  1TOP A;  1IGV A;  1JBA A;  1C7V A;  1B7T Z;  1K2H A;  2KNE A;  1DJY A;  1IQ3 A;  1IG5 A;  3D0Y B;  4WQ3 A;  3AAJ A;  4JKT A;  5CSI A;  4D1E A;  1BU3 A;  4DRW A;  2M7L A;  2MLE C;  2NLN A;  2FCE A;  5GQQ C;  3MSE B;  5ER5 A;  1ZAC A;  2SAS A;  3EG5 B;  2WCJ A;  1DT7 B;  1LKJ A;  3H4S E;  2BCB A;  2JNX A;  1TNQ A;  1CDP A;  2O5G A;  2WC5 A;  1TIZ A;  4P5O E;  2M1U A;  1SNL A;  3S0D A;  2OPO A;  1Q80 A;  3GOF A;  1J7Q A;  1CFD A;  1OZS A;  3VB1 A;  1EG3 A;  2AMI A;  5CSN A;  1XFY O;  1OMV A;  2CBL A;  3S0A A;  1IJ6 A;  2L50 A;  2LNK A;  4DS7 A;  3R72 A;  3RLZ A;  3C1V A;  2LVJ A;  3BUM B;  3KO0 A;  1DJZ A;  1ZUZ A;  3I5F C;  1OOH A;  2LHI A;  1A75 B;  1BJF A;  3CZ2 A;  5CSF A;  1CLM A;  2BL0 B;  2A4J A;  4DIR A;  2JQ6 A;  2JT0 A;  1DEK A;  3PAL A;  1BOD A;  1KQM B;  1UHI A;  4PE4 A;  1UHN A;  2DOQ A;  1JUO A;  1NX1 A;  5G08 A;  4GGN A;  4ZCU A;  5B8I B;  4PDZ A;  1RJV A;  1XFR A;  3CZ0 A;  3S0E A;  2QEO A;  4N1G A;  1CFF A;  1NPQ A;  1YVL A;  2PVB A;  2K61 A;  2Y1N A;  5DIC A;  2FCD A;  2JZI A;  5FI7 A;  5HKW A;  2K60 A;  3TUY C;  1PUL A;  1XVJ A;  2NCO A;  3PJI A;  5JOL A;  1TNW A;  1N0Y A;  2JU0 A;  2JPO A;  3NGV A;  2JRF A;  1B7T Y;  3A4U B;  2PSR A;  3CAB A;  3FS7 A;  3SG7 A;  1NX0 A;  1PAL A;  1LA3 A;  2COL B;  2KQ6 A;  4INX A;  5D7F A;  4GGF C;  5BPJ A;  2KLE A;  2BBN A;  4MZL A;  3LK0 A;  1IRJ A;  3NHT A;  4GBA A;  5I8N A;  3KEV A;  1C07 A;  1IH0 A;  1OW4 A;  4IL1 A;  4KYN A;  3DVJ A;  4QJ3 B;  4XJK A;  2KGB C;  2LUC A;  2L0P A;  4OVN F;  1KFU S;  1D1O A;  3D77 A;  1NIW A;  3S0B A;  2D8N A;  4UPG A;  2OTG C;  1QVI Z;  5DKN A;  3UNW A;  2JC2 A;  1YUU A;  2BE6 A;  1W7J B;  2JT3 A;  2ZRS A;  3A8R A;  2LM5 A;  1KCY A;  2KAY A;  1XO5 A;  2KDH A;  1T14 A;  2LUX A;  2ERB A;  1JFJ A;  1NCX A;  1WRZ A;  1WLZ A;  3L47 A;  4CID A;  1TCO B;  2LLT A;  2M1K B;  3B7A A;  4GPL B;  4INW A;  1U5I B;  1J7P A;  1G4Y R;  2EC6 B;  3CTN A;  1SL7 A;  1FW4 A;  1QIW A;  1DJW A;  3TDZ A;  4I5K A;  1MUX A;  2QEV A;  3GK4 X;  3QRX A;  5DKQ A;  2V53 A;  3BXK A;  2KI6 D;  3ZWH A;  3VRR A;  1CDL A;  1UWO A;  1A75 A;  3DY9 A;  3O4X A;  4MBE A;  5I2O A;  3O2P A;  3O4Y A;  3EK4 A;  3EK7 A;  4HSZ A;  5HKY A;  1SRA A;  4OCI A;  3PM2 A;  3D78 A;  5CSJ A;  2CT9 A;  1TCF A;  1DVI A;  2NCP A;  5ER4 X;  1J1E A;  1LIN A;  1B1G A;  4YBH B;  1RK9 A;  4FQO A;  2L51 A;  3SG4 A;  1MXE A;  4OV2 A;  1K9P A;  1KK8 C;  1SR6 B;  2M8U A;  4FQT A;  1QWV A;  1J7O A;  4I5N B;  2JTT A;  2WCB A;  1M45 A;  4JWQ A;  1WRK A;  5AXI A;  2P70 A;  1PVA A;  1ZMZ A;  3CR4 X;  4MSP A;  1BG1 A;  2O60 A;  2ZN8 A;  2I7A A;  1YX8 A;  2BCA A;  2QAC A;  2WOR A;  3S0G A;  1CKK A;  1EJ3 A;  2PMY A;  4OKH A;  4CFR A;  1A03 A;  1KWO C;  2CTN A;  2WCL A;  1NWD A;  1F4Q A;  3WXA A;  3FE8 A;  1Z2C B;  3NSO A;  3BFA A;  1DF0 B;  2WCK A;  2BAP A;  4Q04 A;  3B88 A;  1QVI Y;  5PAL A;  1BR1 B;  1S3P A;  1SCM C;  2M97 A;  5KTY A;  3F45 A;  3VRQ A;  3WHT B;  3KPX A;  1UP5 A;  1TWO A;  5I2L A;  1K9U A;  1SYM A;  2KI4 B;  2F2O A;  3SJS A;  3ZNI A;  1DJH A;  1B9A A;  1K8U A;  2F2P A;  3NSL A;  1TRF A;  1MXL C;  1HT9 A;  2K0J A;  3LLE A;  4ORA B;  1S6C A;  1M63 B;  2F3Z A;  4YGA A;  2R2I A;  3BYA A;  2KFH A;  1OOF A;  2LMU A;  3BFB A;  3BFH A;  4C0K A;  1TTX A;  1WDC B;  2LC5 A;  2WCE A;  2Y1M A;  1OOG A;  2LP3 A;  3PAT A;  3BQ3 A;  2OS8 B;  1JWD A;  1F4O A;  1K9K A;  2M3W A;  3IQQ A;  4F0Z B;  1K94 A;  4BY5 A;  1H4B A;  3IQO A;  2LP2 A;  2K7D A;  1YTZ C;  3EVU A;  1F54 A;  3CS1 A;  4NDB A;  5TNC A;  1U5I A;  2Y5I A;  4CLN A;  1NX3 A;  3OX6 A;  4WQ2 A;  4YGD B;  2EC6 C;  1YRU B;  3GK2 A;  1S5G Z;  1JC2 A;  2GTE A;  1AUI B;  1CM1 A;  1YVH A;  3BUX B;  2LAP A;  3HX4 A;  4TNC A;  1V1F A;  2P71 A;  1NYA A;  1C7W A;  2KGR A;  2E30 A;  4JD9 A;  4YGE B;  4C0J A;  1M46 A;  1SMG A;  1EL4 A;  2LVV A;  5I94 A;  1DGU A;  1DJG A;  3DYE A;  1J1D A;  2H2K A;  1G33 A;  3FIA A;  4A4C A;  3S0F A;  1OQP A;  1V1G A;  1L2O B;  3FWC A;  2KAX A;  2M0R A;  3LL8 B;  4NDC A;  3CR2 A;  3JVT B;  1LXF C;  2IS9 A;  1QLK A;  3VRN A;  1ALV A;  1DJX A;  5FI6 A;  2KBI A;  1N65 A;  3AAK A;  3VRP A;  3OGN A;  5AAN A;  2BBM A;  4ORC B;  2KI6 C;  2Y4Q A;  2BNX A;  3JTD C;  5CPV A;  1ZOT B;  3ICB A;  3PN7 B;  2PYQ A;  1XA5 A;  2ZN9 A;  3OB2 B;  4HRE E;  1A4P A;  1CLL A;  2K2A A;  1YX7 A;  1QV0 A;  1E8A A;  2KFF A;  4ETO A;  2LVI A;  1CNP A;  1M39 A;  5AER A;  1C3Y A;  3CYZ A;  1DF0 A;  1AJ4 A;  2HPS A;  5AFP A;  1OMR A;  2LLU A;  1ORG A;  2HET A;  3SS3 A;  2KYC A;  1XYD A;  3NSI A;  1DEL A;  3D0Y A;  3RM1 A;  4AQI A;  4F7F A;  3I5I B;  2M49 B;  1QX5 B;  1MF8 B;  1SSE B;  2CXJ A;  1NP8 A;  1OE9 B;  2WC8 A;  3CDN A;  4OZD A;  2PQL A;  3SG2 A;  1Y1A A;  2I94 A;  4USL A;  4PHN A;  1QAT A;  3WNX B;  1DQE A;  3I5H B;  5J3X A;  3TS5 B;  1EXR A;  1REC A;  3PLF B;  5HL1 A;  2LE9 B;  1SK6 D;  1XK4 A;  3DVM A;  2MLF C;  3NSK A;  4M2Q A;  4CFQ A;  1S5G Y;  3LCP C;  3BUN B;  1PK0 D;  1FF1 A;  1DGV A;  1GQM A;  1F8H A;  1GGW A;  3OP0 A;  3D74 A;  1CLB A;  4MEW A;  2VRG A;  1CMG A;  1QTX A;  4HRG A;  1IJ5 A;  1LVC D;  3AKA A;  2MBX A;  1XFV O;  1WLM A;  1J7R A;  3SG5 A;  3O6B A;  4DCK A;  1AVS A;  1AHR A;  2ZND A;  1SL8 A;  1JSA A;  2EHB A;  4PT1 A;  3BUW B;  2BL0 C;  3SIB A;  1MWN A;  1XFU O;  2K7O A;  3DVK A;  4GUK A;  1KQM C;  1C3Z A;  1EG4 A;  1YRT B;  1M31 A;  3NXA A;  5K89 A;  1CM4 A;  2BEC A;  3PSR A;  1QX7 A;  3UO9 A;  1YUS A;  2K2F A;  4P2Y B;  1EH2 A;  3I5F B;  1L7Z A;  2L4H A;  2EGD A;  1TNX A; 
#chains in the Genus database with same CATH homology
 1HQV A;  2KOT A;  3FWB A;  1BT6 A;  1KQV A;  4E68 A;  1SPY A;  1YUT A;  2L4I A;  3TZ1 A;  4YRU A;  1S26 D;  2BE4 A;  2L98 A;  3EKH A;  1K96 A;  1SBJ A;  1QS7 A;  3EK8 A;  1KSM A;  1JFK A;  1NUB A;  1OMD A;  4MLW A;  1MHO A;  1N2D A;  1WY9 A;  1Y6W A;  2GV5 A;  3HCM A;  1OZO A;  4C0L A;  4PE7 A;  3TUY B;  2F33 A;  2FJU B;  5AEQ A;  2E6W A;  1PSR A;  1NCY A;  4AOM A;  2G2B A;  1PVB A;  1CDN A;  1AP4 A;  1BF5 A;  2AAO A;  2HQW A;  5KU1 A;  5FYX A;  1A2X A;  1SKT A;  4R1E A;  1JF2 A;  2F3Y A;  1BLQ A;  1LA0 A;  2JWW A;  3LK1 A;  1B4C A;  1R6P A;  3VGO A;  1S6I A;  4BY4 A;  1KK7 Z;  1OSA A;  3IF7 A;  2KSP A;  4DUQ A;  2CCM A;  2KFG A;  2AUC A;  1YUR A;  4PCW A;  4XJK B;  2F8P A;  2LMT A;  1IQ5 A;  4GFT A;  1MQ1 A;  2OTG B;  3VRO A;  2JOJ A;  4HRH A;  1CTR A;  1QV1 A;  5HLO A;  1CB1 A;  1IKU A;  1X02 A;  1S36 A;  1UHK A;  1PRW A;  4XYN A;  4YGC B;  1Y1U A;  4YI9 A;  2G9B A;  2ZKM X;  1NX2 A;  1RWY A;  3OX5 A;  1SW8 A;  1CFC A;  3PFV A;  1SCV A;  1F70 A;  4MRX A;  4MN0 A;  2BKH B;  5HKZ A;  1KFX L;  1TN4 A;  4MVF A;  1DJI A;  4FTG A;  3I5G B;  5JJG A;  2WCF A;  4L9M A;  2RGI A;  1XFZ O;  4PHK A;  1QLS A;  1B8C A;  3DD4 A;  4ZCV A;  3EVV A;  4OR9 B;  1SR6 C;  2ZNE A;  2B1U A;  2KBM A;  1JF0 A;  1B8R A;  1WRL A;  1RRO A;  3DF0 B;  1CDM A;  3DVE A;  2JTZ A;  4CPV A;  1KK8 B;  1BR4 B;  2LMV A;  2JUL A;  3M0W A;  3SG6 A;  1YR5 A;  3EVR A;  3OB1 B;  4GNK B;  2M9G A;  1BMO A;  2PAS A;  1KK7 Y;  2TN4 A;  2BCX A;  2KI4 C;  3EKJ A;  1QJT A;  1KWO B;  2LLS A;  3BOW B;  5F6T A;  1ZFS A;  1A29 A;  2HQ8 A;  2L5X B;  5D69 A;  5HLV A;  2K8M B;  2JNF A;  1SY9 A;  2K7C A;  2MHH A;  3KHE A;  4GGF A;  4M2P A;  4PE1 A;  1FBV A;  1F55 A;  2JXL A;  1SCM B;  4N5X A;  1S1E A;  1WDC C;  3KF9 A;  3CR5 X;  1XK4 C;  4ORB B;  5DKR A;  1W7I B;  2MA2 A;  4NQG A;  2OS8 C;  4MRY A;  2ZFD A;  2LAN A;  3CGA A;  1VRK A;  1Y1X A;  2KYF A;  4M2O A;  1AK8 A;  1QAS A;  4WRI A;  2Q91 A;  1B47 A;  1FPW A;  1XFX O;  2ISD A;  2WOS A;  1CFP A;  4JQ0 D;  4PHJ A;  3OHM B;  2M7N A;  1J55 A;  1IWQ A;  2GGZ A;  2WND A;  3TDU A;  4U8D A;  1CMF A;  2MRD A;  4JPZ B;  4MZJ A;  2PAL A;  4MZK A;  3CLN A;  1QXP A;  1F71 A;  5I2Q A;  2JXC A;  3WHU B;  1B8L A;  1GJY A;  2KHN A;  4I5L B;  4AQJ A;  1DTL A;  4NDD A;  2I2R E;  2LVK A;  4PE0 A;  2GGM A;  2P6B B;  1ODB A;  3BUO B;  2CNP A;  2MAZ A;  1L2O C;  5KSZ A;  2JPT A;  3I5G C;  1S6J A;  2M29 A;  2KAV A;  4QJ4 B;  1UUS A;  2FOT A;  1FI6 A;  5IBW A;  4PAL A;  3CWG A;  3JVT C;  4GAO A;  5HYD A;  2MJW B;  3GK1 A;  4QJ5 B;  1KFX S;  1PSB A;  2L2E A;  3K21 A;  2K7B A;  2JT8 A;  2SCP A;  3PN7 C;  1AJ5 A;  1K95 A;  3PM8 A;  1QIV A;  2QPT A;  3AKB A;  1XFW O;  2NXQ A;  3TDI A;  2PRU A;  3DF0 A;  1R2U A;  1SL9 A;  3D10 A;  4ICB A;  1TNP A;  3SIA A;  1NSH A;  1KSO A;  1UHJ A;  2LV7 A;  3O78 A;  1ALW A;  2H61 A;  1H8B A;  1QX2 A;  2KQY A;  2H61 C;  2NZ0 A;  1UUR A;  3CZT X;  3JTD B;  1G8I A;  1GGZ A;  2ZRT A;  1NCZ A;  1OOJ A;  1Y0V H;  4YI8 A;  1MR8 A;  2LCP A;  1FI5 A;  1BOC A;  1RTP 1;  1UHH A;  3I5I C;  2BKI B;  2LHL A;  3BOW A;  4I5J A;  4N1F A;  2Q4U A;  1KFU L;  4PHM A;  4YGB B;  2I18 A;  1DMO A;  1K93 D;  4A4B A;  2HF5 A;  1K90 D;  3SG3 A;  3I5H C;  3E3R A;  3TS5 C;  1RFJ A;  1TOP A;  1IGV A;  1JBA A;  1C7V A;  1B7T Z;  1K2H A;  2KNE A;  1DJY A;  1IQ3 A;  1IG5 A;  3D0Y B;  4WQ3 A;  3AAJ A;  5CSI A;  4D1E A;  1BU3 A;  4DRW A;  2M7L A;  2MLE C;  2NLN A;  2FCE A;  5GQQ C;  3MSE B;  5ER5 A;  1ZAC A;  2SAS A;  1DT7 B;  1LKJ A;  3H4S E;  2BCB A;  2JNX A;  1TNQ A;  1CDP A;  2O5G A;  1TIZ A;  4P5O E;  2M1U A;  1SNL A;  2OPO A;  1Q80 A;  3GOF A;  1J7Q A;  1CFD A;  1OZS A;  1EG3 A;  2AMI A;  5CSN A;  1XFY O;  1OMV A;  2CBL A;  1IJ6 A;  2L50 A;  2LNK A;  4DS7 A;  3RLZ A;  3C1V A;  2LVJ A;  3BUM B;  3KO0 A;  1DJZ A;  1ZUZ A;  3I5F C;  2LHI A;  5CSF A;  1A75 B;  1BJF A;  1CLM A;  2BL0 B;  2A4J A;  4DIR A;  2JQ6 A;  2JT0 A;  3PAL A;  1BOD A;  1KQM B;  1UHI A;  4PE4 A;  1UHN A;  2DOQ A;  1JUO A;  1NX1 A;  5G08 A;  4GGN A;  4ZCU A;  5B8I B;  4PDZ A;  1RJV A;  1CFF A;  4N1G A;  1NPQ A;  1YVL A;  2PVB A;  2K61 A;  2Y1N A;  2FCD A;  2JZI A;  5HKW A;  3TUY C;  1PUL A;  1XVJ A;  2NCO A;  5JOL A;  1TNW A;  1N0Y A;  2JU0 A;  2JRF A;  1B7T Y;  3A4U B;  2PSR A;  3FS7 A;  3SG7 A;  1NX0 A;  1PAL A;  1LA3 A;  2COL B;  2KQ6 A;  5D7F A;  4GGF C;  5BPJ A;  2BBN A;  4MZL A;  3LK0 A;  1IRJ A;  4GBA A;  5I8N A;  3KEV A;  1C07 A;  1IH0 A;  4IL1 A;  3DVJ A;  4QJ3 B;  4XJK A;  2KGB C;  2LUC A;  2L0P A;  4OVN F;  1KFU S;  1D1O A;  1NIW A;  2D8N A;  4UPG A;  2OTG C;  1QVI Z;  5DKN A;  2JC2 A;  1YUU A;  2BE6 A;  1W7J B;  2JT3 A;  2ZRS A;  3A8R A;  2LM5 A;  1KCY A;  2KAY A;  1XO5 A;  2KDH A;  2LUX A;  1JFJ A;  1NCX A;  1WRZ A;  1WLZ A;  4CID A;  1TCO B;  2LLT A;  2M1K B;  4GPL B;  1U5I B;  1J7P A;  1G4Y R;  2EC6 B;  3CTN A;  1SL7 A;  1FW4 A;  1QIW A;  1DJW A;  3TDZ A;  4I5K A;  1MUX A;  3QRX A;  3GK4 X;  5DKQ A;  2V53 A;  3BXK A;  2KI6 D;  3ZWH A;  3VRR A;  1CDL A;  1UWO A;  1A75 A;  4MBE A;  5I2O A;  3O2P A;  3O4Y A;  3EK4 A;  3EK7 A;  4HSZ A;  5HKY A;  1SRA A;  4OCI A;  5CSJ A;  2CT9 A;  1TCF A;  1DVI A;  2NCP A;  5ER4 X;  1J1E A;  1LIN A;  1B1G A;  4YBH B;  1RK9 A;  4FQO A;  2L51 A;  3SG4 A;  1MXE A;  4OV2 A;  1K9P A;  1KK8 C;  1SR6 B;  2M8U A;  1J7O A;  4I5N B;  2JTT A;  2WCB A;  1M45 A;  4JWQ A;  1WRK A;  5AXI A;  1PVA A;  1ZMZ A;  3CR4 X;  4MSP A;  1BG1 A;  2O60 A;  2ZN8 A;  2I7A A;  1YX8 A;  2BCA A;  2QAC A;  2WOR A;  1CKK A;  1EJ3 A;  2PMY A;  4OKH A;  4CFR A;  1A03 A;  1KWO C;  2CTN A;  1NWD A;  1F4Q A;  3WXA A;  3NSO A;  1DF0 B;  4Q04 A;  1QVI Y;  5PAL A;  1BR1 B;  1S3P A;  1SCM C;  2M97 A;  5KTY A;  3F45 A;  3VRQ A;  3WHT B;  3KPX A;  1UP5 A;  5I2L A;  3SJS A;  1K9U A;  1SYM A;  2KI4 B;  2F2O A;  3ZNI A;  1DJH A;  1B9A A;  1K8U A;  2F2P A;  3NSL A;  1TRF A;  1MXL C;  1HT9 A;  2K0J A;  3LLE A;  4ORA B;  1S6C A;  1M63 B;  2F3Z A;  4YGA A;  2R2I A;  3BYA A;  2KFH A;  4C0K A;  2LMU A;  1TTX A;  1WDC B;  2LC5 A;  2WCE A;  2Y1M A;  2LP3 A;  3PAT A;  3BQ3 A;  2OS8 B;  1JWD A;  1F4O A;  1K9K A;  2M3W A;  3IQQ A;  4F0Z B;  1K94 A;  4BY5 A;  1H4B A;  3IQO A;  2LP2 A;  2K7D A;  1YTZ C;  3EVU A;  1F54 A;  3CS1 A;  4NDB A;  5TNC A;  1U5I A;  2Y5I A;  4CLN A;  1NX3 A;  3OX6 A;  4WQ2 A;  4YGD B;  2EC6 C;  1YRU B;  3GK2 A;  1S5G Z;  1JC2 A;  1AUI B;  1CM1 A;  1YVH A;  3BUX B;  2LAP A;  3HX4 A;  4TNC A;  1V1F A;  1NYA A;  1C7W A;  2KGR A;  2E30 A;  4YGE B;  4C0J A;  1M46 A;  1SMG A;  1EL4 A;  2LVV A;  1DGU A;  1DJG A;  4A4C A;  1J1D A;  2H2K A;  1G33 A;  3FIA A;  1OQP A;  1V1G A;  1L2O B;  3FWC A;  2KAX A;  2M0R A;  3LL8 B;  4NDC A;  3CR2 A;  3JVT B;  1LXF C;  2IS9 A;  1QLK A;  3VRN A;  1ALV A;  1DJX A;  2KBI A;  1N65 A;  3AAK A;  3VRP A;  5AAN A;  2BBM A;  4ORC B;  2KI6 C;  2Y4Q A;  3JTD C;  5CPV A;  1ZOT B;  3ICB A;  3PN7 B;  1XA5 A;  2ZN9 A;  3OB2 B;  4HRE E;  1A4P A;  1CLL A;  2K2A A;  1YX7 A;  1QV0 A;  1E8A A;  2KFF A;  4ETO A;  2LVI A;  1CNP A;  1M39 A;  5AER A;  1DF0 A;  1AJ4 A;  2HPS A;  5AFP A;  1OMR A;  2LLU A;  2HET A;  2KYC A;  1XYD A;  3NSI A;  3D0Y A;  3RM1 A;  4AQI A;  3I5I B;  2M49 B;  1QX5 B;  1MF8 B;  2WC8 A;  2CXJ A;  1NP8 A;  1OE9 B;  3SG2 A;  1Y1A A;  2I94 A;  4USL A;  4PHN A;  1QAT A;  3WNX B;  3I5H B;  5J3X A;  3TS5 B;  1EXR A;  1REC A;  3PLF B;  2LE9 B;  1SK6 D;  1XK4 A;  3DVM A;  2MLF C;  3NSK A;  4M2Q A;  4CFQ A;  1S5G Y;  3LCP C;  3BUN B;  1PK0 D;  1FF1 A;  1DGV A;  1GQM A;  1F8H A;  1GGW A;  3OP0 A;  1CLB A;  4MEW A;  2VRG A;  1CMG A;  1QTX A;  4HRG A;  1IJ5 A;  1LVC D;  3AKA A;  2MBX A;  1XFV O;  1WLM A;  1J7R A;  3SG5 A;  3O6B A;  4DCK A;  1AVS A;  1AHR A;  2ZND A;  1SL8 A;  1JSA A;  2EHB A;  3BUW B;  2BL0 C;  3SIB A;  1MWN A;  1XFU O;  2K7O A;  3DVK A;  4GUK A;  1KQM C;  1EG4 A;  1M31 A;  1YRT B;  3NXA A;  5K89 A;  1CM4 A;  2BEC A;  3PSR A;  1QX7 A;  1YUS A;  2K2F A;  4P2Y B;  1EH2 A;  3I5F B;  1L7Z A;  2L4H A;  2EGD A;  1TNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...