4MLWA

Crystal structure of non-myristoylated recoverin at 1.45 a resolution with calcium bound to ef-hand 3
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
192
structure length
192
Chain Sequence
GALSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A highly conserved cysteine of neuronal calcium-sensing proteins controls cooperative binding of Ca2+ to recoverin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
molecule keywords Recoverin
total genus 78
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2013-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4mlwA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4mlwA01
1TNWA 2OPOA 5D7FA 3DVJA 2JQ6A 1QX5B 2L4HA 2LV7A 5CSNA 3IQOA 1WY9A 4A4BA 3WHUB 4PE4A 1F8HA 3OB2B 4JPZB 3EVRA 3NSIA 4CLNA 4N1FA 1N0YA 5AERA 5HKWA 1WRZA 4OCIA 5AEQA 4DRWA 1S5GZ 4YGCB 4CIDA 2EC6B 2BE6A 4WQ2A 2PVBA 4GNKB 1B9AA 2H61A 1AVSA 1EL4A 2LE9B 3KF9A 1GGZA 1ZMZA 2JXLA 3I5IB 1QJTA 1NYAA 3BOWA 2NCOA 3DVMA 2JWWA 3LK0A 3DD4A 2LC5A 4MZJA 2KI4B 1Y1XA 1H8BA 1W7IB 1S6JA 4GUKA 1BJFA 1MUXA 2LCPA 1KSOA 3F45A 5GQQC 2BKIB 4MBEA 1F71A 2BCXA 1QATA 2JU0A 2M1UA 1J1EA 4YGEB 1JC2A 4FQOA 2FOTA 3AAJA 2PSRA 2LNKA 2M3WA 2JPTA 2KDHA 2LVVA 1NP8A 2MJWB 2WCFA 2PMYA 1QASA 1RECA 2M1KB 1JFJA 3D0YA 1IKUA 4JWQA 2JOJA 1SR6B 3OB1B 1Y6WA 1BR4B 4M2QA 2BKHB 2EGDA 1B1GA 2OTGC 1QS7A 1SYMA 2MHHA 2JT0A 2JXCA 5HKYA 1FI6A 1U5IB 1N65A 1NCZA 1S36A 2M49B 4GBAA 1J7OA 3NXAA 1MWNA 2LHIA 2LP2A 4I5KA 3OHMB 1KFUL 1SCMC 2BCAA 4N5XA 3FS7A 4XYNA 2HQWA 1BODA 3AKAA 1RWYA 2K8MB 1XFXO 2I7AA 1G4YR 1G8IA 1K96A 2MLEC 5HLOA 2D8NA 4YBHB 1XK4A 1OZOA 5B8IB 2F8PA 1EG4A 2KGBC 1DJWA 4QJ3B 2O60A 4ZCUA 1PSRA 1NPQA 1SY9A 3FWBA 2ZN9A 1B7TY 4CPVA 2NLNA 2BL0C 1IG5A 2WORA 3SIAA 1FBVA 2L98A 1YUUA 2KBIA 1SW8A 3H4SE 1KSMA 2JZIA 1RFJA 5ER5A 1JWDA 5TNCA 2LANA 3OX5A 1EG3A 1NIWA 1Y0VH 1Y1AA 2HF5A 2FJUB 4MZKA 2KYCA 1CLLA 2P6BB 4MZLA 2ZKMX 3BUOB 1ZOTB 2KGRA 1J7PA 2LHLA 1M31A 4C0KA 1CDPA 1QV0A 5BPJA 1YUTA 4IL1A 1CDLA 1WRKA 2E30A 4PDZA 2KYFA 1KK8B 1OE9B 3GOFA 1BOCA 1DJIA 2BE4A 1CFFA 4L9MA 3WXAA 1TNQA 1ZACA 4GGFC 2ZN8A 3FWCA 1X02A 4GAOA 1YVLA 1CFCA 1UWOA 3I5HC 1B47A 1IRJA 1S5GY 2K2FA 2M7NA 1TCFA 4M2OA 2CTNA 1BU3A 1EXRA 2KBMA 2F3ZA 3IF7A 3KHEA 3LK1A 1LA0A 1QLSA 1DTLA 5K89A 1J55A 2KI6C 1CDNA 1J7QA 1C7WA 1KFXL 2LVKA 1AUIB 2EHBA 4MRXA 4WRIA 1OMVA 1XFZO 1A2XA 2LVIA 3VRNA 1QIWA 1J1DA 1XFUO 2WCEA 3CR5X 1WLZA 2M7LA 1BLQA 3BUNB 1YURA 2R2IA 3O2PA 1SCVA 1FW4A 1PVAA 2AAOA 4USLA 3VGOA 1AJ5A 1ZFSA 2L51A 2NCPA 1LINA 2PRUA 1RJVA 1S26D 2F2OA 1VRKA 2JT8A 2VRGA 1DJZA 1QXPA 2CCMA 1R2UA 1LA3A 3LCPC 4DIRA 1GQMA 4ORBB 1TRFA 1B7TZ 1B4CA 1KCYA 3TDUA 3GK2A 3I5FB 4HREE 1IJ6A 3BUWB 1FPWA 1LVCD 2ZRSA 1KWOC 4PE0A 3ZWHA 2K7DA 1OMDA 1W7JB 2B1UA 3C1VA 1A75A 1M45A 1QX2A 1SL7A 3D10A 3WNXB 1UHNA 1CDMA 3DVKA 2GGMA 2AMIA 1IWQA 5DKQA 4OVNF 1OSAA 1Q80A 5ER4X 3TDIA 2L4IA 1JFKA 1PSBA 3HX4A 4DUQA 5I2OA 4YGDB 2G2BA 2KSPA 1M46A 5DKNA 1YRUB 1IQ3A 2AUCA 1SK6D 2CNPA 2GV5A 4AQJA 2WCBA 1H4BA 1BT6A 1K95A 1GGWA 2KQ6A 3O6BA 1TNXA 1ALWA 3EKJA 4DS7A 1XFWO 1ODBA 3O4YA 3NSKA 4QJ4B 1JUOA 2K2AA 3BUMB 1K9PA 2JC2A 4PHJA 1CNPA 1MHOA 4MEWA 3KPXA 2PASA 1SMGA 3SG2A 2HPSA 5CPVA 4UPGA 1ZUZA 2FCDA 2SASA 4GGFA 3OX6A 4Q04A 1KWOB 3PN7C 2ZNDA 1XA5A 2Y1MA 4HRHA 4ICBA 1B8RA 2Q91A 3PSRA 4MLWA 1A03A 5KTYA 2LAPA 2K0JA 2MRDA 4PE7A 2PALA 5AXIA 1L7ZA 2JTTA 5AANA 1JF0A 1S6CA 1YVHA 1F55A 4I5LB 2F33A 1MXEA 2I2RE 1IJ5A 2JRFA 1PULA 3CLNA 4M2PA 3EVVA 3E3RA 5AFPA 2MAZA 1EJ3A 1OMRA 1A4PA 1SR6C 3SJSA 3BUXB 3CR4X 4WQ3A 4FTGA 3TS5C 4MVFA 3KEVA 2NXQA 4PHNA 3ZNIA 4YGBB 1CTRA 4P5OE 4P2YB 1C7VA 1K2HA 2M8UA 4PHKA 1TTXA 3MSEB 2LUXA 1AK8A 3SG4A 2I94A 4AOMA 2ZNEA 1WLMA 2CT9A 4OKHA 3VRPA 1CFDA 3TUYB 4R1EA 2LVJA 4C0JA 4XJKB 1YRTB 2LM5A 4HRGA 4JQ0D 1S6IA 1YTZC 1NCXA 1QVIY 3IQQA 4ZCVA 1DJYA 1SKTA 1FI5A 1M63B 1PALA 1DJGA 2QACA 5I2LA 4BY5A 2L5XB 1QIVA 2LLTA 1KK7Z 1NX3A 1F54A 2M9GA 3I5HB 1KQVA 2TN4A 1UURA 4F0ZB 2BBMA 2RGIA 5CSFA 4MSPA 2KOTA 2WOSA 1DVIA 1YR5A 1KK8C 3CS1A 1HQVA 2H61C 1QLKA 2F2PA 3TDZA 5JJGA 1K8UA 1NSHA 2JNXA 4N1GA 3SG5A 1XYDA 2KQYA 3RM1A 2JNFA 1IGVA 3NSOA 2DOQA 1K94A 2L2EA 4PCWA 1CLMA 3CWGA 2WNDA 4GGNA 4PHMA 3VRQA 4GFTA 2O5GA 2LLUA 1UUSA 5FYXA 2KAYA 3BQ3A 5D69A 1UHKA 1BG1A 1A75B 1UHHA 1XFYO 5PALA 2Q4UA 1K9UA 1XK4C 3TZ1A 1NX1A 1PRWA 3DF0B 2Y5IA 4GPLB 1GJYA 5JOLA 1QTXA 1QV1A 2BL0B 4NDCA 2JT3A 1DF0B 2ZRTA 1CB1A 1SCMB 1F4OA 4QJ5B 2ZFDA 2CBLA 1SRAA 1YX7A 3KO0A 4OR9B 1F70A 1B8CA 1RROA 5J3XA 1TCOB 2FCEA 4U8DA 3GK4X 1YX8A 1KK7Y 3JTDC 2V53A 4AQIA 1MF8B 4OV2A 1OQPA 3EK4A 4ORCB 1SBJA 4MRYA 4PE1A 3WHTB 1QX7A 3EVUA 1S3PA 4YGAA 1CM4A 1QVIZ 1WDCC 3TUYC 1CM1A 1JSAA 2F3YA 2LMVA 3JTDB 3PALA 4DCKA 1CKKA 2OS8B 1XVJA 2NZ0A 4A4CA 4C0LA 3PATA 1JF2A 4YI8A 1CLBA 1ALVA 3EK7A 1FF1A 4TNCA 3SG7A 2K61A 4YRUA 5CSIA 2I18A 1AHRA 2KFGA 2E6WA 3BOWB 3VROA 1TIZA 3CTNA 4E68A 1BF5A 1V1GA 1C07A 1B8LA 1SPYA 5KU1A 1NUBA 3M0WA 1TN4A 3PFVA 1MXLC 1K93D 1PVBA 1UHIA 2M29A 2KNEA 3K21A 1UP5A 2LMTA 1KQMB 1TNPA 1K90D 3OP0A 2KI4C 3CR2A 5F6TA 2Y1NA 1WRLA 1N2DA 3D0YB 3RLZA 5I2QA 1MQ1A 5I8NA 3I5IC 2KFFA 1S1EA 3PN7B 2MA2A 2A4JA 2L0PA 2GGZA 2COLB 5IBWA 3A4UB 4CFQA 3GK1A 3I5GB 2M0RA 1YUSA 5HYDA 1V1FA 1U5IA 1Y1UA 4YI9A 1SNLA 5CSJA 1IQ5A 2SCPA 3O78A 1L2OC 1AJ4A 1L2OB 1KQMC 3PM8A 4I5JA 1KFXS 2G9BA 5KSZA 2Y4QA 3I5GC 4I5NB 1XO5A 3ICBA 2JTZA 4NQGA 5G08A 4ORAB 1LKJA 3SG3A 3SIBA 2LUCA 1DJHA 4XJKA 4D1EA 2LMUA 1DMOA 4PALA 2KI6D 2JULA 1RK9A 1DJXA 2LLSA 3DF0A 1R6PA 3SG6A 1JBAA 2BCBA 4NDDA 1DGVA 1SL8A 3BYAA 2HETA 1K9KA 3QRXA 3JVTB 2BECA 3AAKA 4HSZA 3BXKA 3EK8A 1SL9A 1MR8A 2IS9A 2BBNA 3VRRA 2OTGB 1CMFA 2KAXA 4BY4A 1WDCB 1OOJA 2WC8A 1NCYA 1NWDA 2LP3A 3AKBA 2QPTA 1DT7B 1AP4A 1CMGA 1BMOA 1G33A 1BR1B 1OZSA 3LLEA 3TS5B 1E8AA 1HT9A 4ETOA 3CGAA 1KFUS 1PK0D 2KAVA 3CZTX 3HCMA 2CXJA 3NSLA 1RTP1 2OS8C 1J7RA 3I5FC 1CFPA 3JVTC 1EH2A 2K7OA 5HKZA 2MLFC 4CFRA 1DGUA 1D1OA 3DVEA 5HLVA 1NX0A 1LXFC 4MN0A 2KHNA 1UHJA 1XFVO 2HQ8A 3PLFB 2K7CA 1M39A 3EKHA 4NDBA 5DKRA 1F4QA 2M97A 2H2KA 3LL8B 2KFHA 3FIAA 1A29A 1DF0A 2EC6C 2MBXA 1TOPA 3A8RA 1NX2A 2L50A 1IH0A 2K7BA 2ISDA
chains in the Genus database with same CATH superfamily
1TNWA 4OZDA 2OPOA 5D7FA 3DVJA 2JQ6A 1QX5B 2L4HA 2LV7A 5CSNA 3IQOA 1WY9A 4A4BA 3L4AA 3CZ1A 3WHUB 4PE4A 1F8HA 2WCKA 3OB2B 3EVRA 3NSIA 4JPZB 4CLNA 3R72A 4N1FA 1N0YA 5AERA 5HKWA 1WRZA 4OCIA 2QEVA 5AEQA 1DC1A 4DRWA 1S5GZ 4YGCB 4CIDA 2EC6B 2BE6A 4WQ2A 2PVBA 3DY9A 4GNKB 1B9AA 1T14A 2H61A 1AVSA 1EL4A 2LE9B 3KF9A 1GGZA 3N7HA 1ZMZA 2JXLA 3B88A 3I5IB 1QJTA 1NYAA 3BOWA 2NCOA 3CZ0A 3DVMA 2JWWA 3LK0A 3DD4A 2LC5A 4MZJA 2KI4B 1Y1XA 1H8BA 1W7IB 1S6JA 3B7AA 4GUKA 1SSEB 1BJFA 1MUXA 2LCPA 1KSOA 3F45A 5GQQC 2BKIB 4MBEA 2KLDA 3K1EA 2BCXA 1QATA 2JU0A 2M1UA 1J1EA 2WC5A 1DQEA 4YGEB 1JC2A 4FQOA 2FOTA 3AAJA 2PSRA 2LNKA 2BAPA 3S0BA 2M3WA 2JPTA 2KDHA 2LVVA 1NP8A 2MJWB 2WCFA 2PMYA 1QASA 1RECA 2M1KB 1JFJA 3D0YA 1IKUA 4JWQA 2JOJA 1SR6B 3OB1B 1Y6WA 1BR4B 4M2QA 2BKHB 2EGDA 1B1GA 2OTGC 1QS7A 1SYMA 2MHHA 2KLEA 2JT0A 2JXCA 3SS4A 5HKYA 1FI6A 1U5IB 1N65A 1NCZA 3RZSA 1S36A 2M49B 4GBAA 1J7OA 3NXAA 1MWNA 2LHIA 2LP2A 2WCHA 4I5KA 3OHMB 1KFUL 1SCMC 3PJIA 2BCAA 4N5XA 3FS7A 4XYNA 2HQWA 1BODA 3AKAA 1C3YA 1RWYA 2K8MB 1XFXO 2I7AA 1G4YR 1G8IA 1K96A 2MLEC 5HLOA 1OOHA 2D8NA 4YBHB 1XK4A 1OZOA 5B8IB 1EG4A 2F8PA 2KGBC 1DJWA 4QJ3B 2O60A 4ZCUA 3CABA 3VB1A 1PSRA 5DICA 1NPQA 1SY9A 3FWBA 2ZN9A 1B7TY 4CPVA 2NLNA 2BL0C 1IG5A 2WORA 3SIAA 1FBVA 2L98A 3S0DA 1YUUA 2KBIA 1SW8A 3H4SE 1KSMA 2JZIA 1RFJA 5ER5A 1JWDA 5TNCA 2LANA 3OX5A 1EG3A 1NIWA 1Y0VH 1Y1AA 3OBVA 2HF5A 2FJUB 4MZKA 2KYCA 1CLLA 2P6BB 4MZLA 5FI2A 2ZKMX 3BUOB 1ZOTB 2KGRA 3D76A 1J7PA 2LHLA 1M31A 4C0KA 1CDPA 1QV0A 5BPJA 3NHIA 1YUTA 1QWVA 1CDLA 1WRKA 4IL1A 2E30A 2FJYA 2QEOA 4PDZA 2KYFA 1KK8B 1OE9B 2GTEA 3GOFA 1BOCA 1DJIA 2BE4A 1CFFA 4L9MA 3WXAA 1TNQA 1ZACA 4GGFC 2ZN8A 3FWCA 1X02A 4GAOA 1YVLA 1CFCA 1UWOA 3I5HC 1B47A 1IRJA 1S5GY 2K2FA 2M7NA 1TCFA 4M2OA 2CTNA 1BU3A 1EXRA 2KBMA 2F3ZA 3DXLA 3IF7A 3KHEA 3LK1A 1LA0A 1QLSA 1DTLA 5K89A 1J55A 2KI6C 1CDNA 1J7QA 1C7WA 1KFXL 2LVKA 1AUIB 2EHBA 4MRXA 4WRIA 1OMVA 1XFZO 4JD9A 1A2XA 2LVIA 3Q8IA 1QIWA 1J1DA 3VRNA 1XFUO 2WCEA 3CR5X 1WLZA 2M7LA 1BLQA 3BUNB 1YURA 2R2IA 3O2PA 1SCVA 1FW4A 1PVAA 2AAOA 4USLA 3VGOA 1AJ5A 1ZFSA 2L51A 2NCPA 1LINA 2PRUA 1RJVA 1S26D 2F2OA 1VRKA 2JT8A 2VRGA 1DJZA 1QXPA 1TWOA 2CCMA 1R2UA 1LA3A 3LCPC 4DIRA 1GQMA 4ORBB 1TRFA 1B7TZ 1B4CA 1KCYA 3TDUA 3GK2A 3I5FB 4HREE 1IJ6A 3BUWB 1FPWA 1LVCD 2ZRSA 1KWOC 4PE0A 3ZWHA 2K7DA 1OMDA 1W7JB 2B1UA 3C1VA 1A75A 1M45A 1QX2A 1SL7A 3D10A 3WNXB 1UHNA 3BJHA 1CDMA 3UO9A 1Z4HA 3DVKA 2GGMA 2AMIA 1IWQA 5DKQA 4OVNF 1OSAA 1Q80A 5ER4X 3TDIA 2L4IA 1JFKA 1PSBA 3HX4A 4DUQA 5I2OA 4YGDB 3D77A 2G2BA 2WC6A 2KSPA 1M46A 5DKNA 1YRUB 3S0GA 1IQ3A 2AUCA 1OOGA 1SK6D 2CNPA 2GV5A 2P71A 4AQJA 2WCBA 3CDNA 4PT1A 1H4BA 1BT6A 1K95A 1GGWA 2KQ6A 3O6BA 1TNXA 1ALWA 3EKJA 1XFRA 4DS7A 1XFWO 1ODBA 3O4YA 3NSKA 4QJ4B 1JUOA 2K2AA 3BUMB 1K9PA 2JC2A 4PHJA 1CNPA 1MHOA 4MEWA 2ERBA 3KPXA 2WCMA 2QEBA 2PASA 1SMGA 2PYQA 2HPSA 5CPVA 3SG2A 4UPGA 1ZUZA 2FCDA 2SASA 4GGFA 3OX6A 3QMEA 4Q04A 1KWOB 3PN7C 2ZNDA 3S0AA 1XA5A 2Y1MA 3B6XA 4HRHA 1B8RA 2Q91A 3PSRA 4ICBA 4MLWA 1A03A 3PM2A 5KTYA 2LAPA 2K0JA 2MRDA 4PE7A 2PALA 5AXIA 5I94A 1L7ZA 2JTTA 5AANA 1JF0A 1C3ZA 1S6CA 3BFAA 1YVHA 1F55A 4I5LB 2F33A 1MXEA 2I2RE 1IJ5A 2JRFA 1PULA 3CLNA 4M2PA 3EVVA 3E3RA 1DEKA 5AFPA 2MAZA 1EJ3A 1OMRA 1A4PA 1SR6C 3SJSA 3BUXB 3CR4X 4WQ3A 4FTGA 3TS5C 4MVFA 3KEVA 2NXQA 4PHNA 3ZNIA 4YGBB 1CTRA 4P5OE 4P2YB 1C7VA 1K2HA 5D3OA 2M8UA 4PHKA 1TTXA 3MSEB 2LUXA 3S0EA 1AK8A 3SG4A 2I94A 4AOMA 2ZNEA 1WLMA 3BFBA 2CT9A 4OKHA 3VRPA 1CFDA 3R1OA 3TUYB 4R1EA 2LVJA 4C0JA 4XJKB 1YRTB 2LM5A 4HRGA 4JQ0D 1S6IA 3L4LA 1YTZC 3NHTA 1NCXA 1QVIY 3IQQA 4ZCVA 1DJYA 1SKTA 1FI5A 1M63B 1PALA 1DJGA 2QACA 5I2LA 4BY5A 2L5XB 1QIVA 2LLTA 1KK7Z 1TUJA 1NX3A 1F54A 1IIOA 2M9GA 3I5HB 1KQVA 2TN4A 1UURA 4F0ZB 3D73A 2BBMA 2RGIA 5CSFA 4MSPA 2KOTA 2WOSA 4F7FA 1DVIA 1YR5A 2KPHA 1KK8C 3CS1A 1HQVA 2H61C 1QLKA 2F2PA 3TDZA 5JJGA 1K8UA 1NSHA 2JNXA 4N1GA 3SG5A 1XYDA 2JPOA 2KQYA 2K60A 3RM1A 2JNFA 1IGVA 3NSOA 2DOQA 1K94A 2L2EA 4PCWA 1GM0A 1CLMA 3CWGA 2WNDA 4GGNA 4PHMA 3VRQA 4GFTA 2O5GA 2LLUA 2PQLA 1UUSA 5FYXA 2KAYA 3BQ3A 5D69A 1UHKA 3D78A 1BG1A 1A75B 4FQTA 1UHHA 1OOFA 1XFYO 2Q4UA 5PALA 1K9UA 1XK4C 3TZ1A 1NX1A 1PRWA 2L2CA 2QDIA 3DF0B 2Y5IA 4GPLB 1GJYA 5JOLA 1QTXA 1QV1A 2BL0B 4NDCA 2JT3A 1DF0B 2ZRTA 1CB1A 1SCMB 1F4OA 4QJ5B 2ZFDA 2CBLA 1SRAA 1YX7A 3KO0A 4OR9B 1F70A 1B8CA 1RROA 5J3XA 1TCOB 2FCEA 4U8DA 3GK4X 1YX8A 4INWA 1KK7Y 3JTDC 2V53A 4AQIA 1MF8B 4OV2A 1OQPA 3EK4A 4ORCB 1SBJA 4MRYA 4PE1A 1OOIX 3WHTB 1QX7A 3EVUA 1S3PA 4YGAA 3DZTA 1CM4A 1QVIZ 2BNXA 1WDCC 3TUYC 1CM1A 1JSAA 2F3YA 2LMVA 3JTDB 3PALA 4DCKA 1CKKA 2OS8B 1XVJA 2NZ0A 4A4CA 4C0LA 3PATA 1JF2A 4YI8A 1ORGA 1CLBA 1ALVA 2QEHA 3EK7A 4JKTA 4TNCA 1FF1A 3SG7A 2K61A 4YRUA 5CSIA 5EL2A 3SS3A 2I18A 1AHRA 2KFGA 2E6WA 3BOWB 3R1PA 1TIZA 3CTNA 3VROA 4E68A 1BF5A 2L5YA 1V1GA 1C07A 3CZ2A 1B8LA 1SPYA 5KU1A 1NUBA 3M0WA 1TN4A 3PFVA 1MXLC 3FE8A 1K93D 1PVBA 1UHIA 3SS5A 2M29A 2KNEA 3K21A 1UP5A 2LMTA 1KQMB 3CYZA 1TNPA 1K90D 3OP0A 2KI4C 3CR2A 5F6TA 2Y1NA 1WRLA 3R1VA 1N2DA 3O4XA 3D0YB 3RLZA 5I2QA 1MQ1A 5I8NA 3I5IC 2KFFA 1S1EA 4INXA 1F71A 3PN7B 2MA2A 3D74A 2A4JA 2L0PA 2GGZA 2COLB 5IBWA 3A4UB 4CFQA 3GK1A 3I5GB 2M0RA 1YUSA 5HYDA 1V1FA 1DELA 1Y1UA 1U5IA 4YI9A 1SNLA 5CSJA 1IQ5A 2YGUA 2SCPA 3O78A 1L2OC 1AJ4A 1L2OB 1KQMC 3B87A 3PM8A 4I5JA 4IJ7A 1KFXS 2G9BA 3B86A 5KSZA 2Y4QA 3I5GC 4I5NB 1XO5A 3ICBA 2JTZA 3IVTA 4NQGA 4ORAB 1LKJA 5G08A 1P28A 2LUCA 3SIBA 3SG3A 1DJHA 4XJKA 4D1EA 2LMUA 1DMOA 4PALA 2KI6D 2JULA 1RK9A 3NGVA 1DJXA 2LLSA 3L47A 3DF0A 1R6PA 3SG6A 1JBAA 2BCBA 4NDDA 1DGVA 1SL8A 3BYAA 2HETA 1K9KA 3EG5B 3QRXA 3JVTB 2BECA 3AAKA 4HSZA 3BXKA 3EK8A 1SL9A 1MR8A 2IS9A 2BBNA 3DYEA 3VRRA 2OTGB 3D75A 1CMFA 5FI7A 1W9ZA 3V2LA 2KAXA 4BY4A 1WDCB 1OOJA 2WC8A 1NCYA 2P70A 1NWDA 2LP3A 3AKBA 2QPTA 1DT7B 1AP4A 3S0FA 1Z2CB 1CMGA 1BMOA 1G33A 1OW4A 1BR1B 1OZSA 3LLEA 3TS5B 1E8AA 1HT9A 4ETOA 3CGAA 1KFUS 1PK0D 2KAVA 3CZTX 3HCMA 3FE9A 1LS8A 2CXJA 3NSLA 1RTP1 5HL1A 3OGNA 2OS8C 1J7RA 3I5FC 1CFPA 3JVTC 1EH2A 2K7OA 3FE6A 5HKZA 2MLFC 4CFRA 1DGUA 1D1OA 3DVEA 5HLVA 2WCJA 1NX0A 1LXFC 4MN0A 2KHNA 3BFHA 1UHJA 1XFVO 2H8VA 2HQ8A 3PLFB 2K7CA 1M39A 3EKHA 4NDBA 5DKRA 1F4QA 2M97A 2H2KA 3LL8B 2KFHA 5FI6A 4KYNA 3FIAA 1A29A 1DF0A 2EC6C 2WCLA 1TOPA 3A8RA 2MBXA 1NX2A 1TUZA 2L50A 3UNWA 1IH0A 2K7BA 2ISDA
chains in the Genus database with same CATH topology
1TNWA 2OPOA 5D7FA 3DVJA 2JQ6A 1QX5B 2L4HA 2LV7A 5CSNA 3IQOA 1WY9A 4A4BA 3WHUB 4PE4A 1F8HA 3OB2B 4JPZB 3EVRA 3NSIA 4CLNA 4N1FA 1N0YA 5AERA 5HKWA 1WRZA 4OCIA 5AEQA 4DRWA 1S5GZ 4YGCB 4CIDA 2EC6B 2BE6A 4WQ2A 2PVBA 4GNKB 1B9AA 2H61A 1AVSA 1EL4A 2LE9B 3KF9A 1GGZA 1ZMZA 2JXLA 3I5IB 1QJTA 1NYAA 3BOWA 2NCOA 3DVMA 2JWWA 3LK0A 3DD4A 2LC5A 4MZJA 2KI4B 1Y1XA 1H8BA 1W7IB 1S6JA 4GUKA 1BJFA 1MUXA 2LCPA 1KSOA 3F45A 5GQQC 2BKIB 4MBEA 1F71A 2BCXA 1QATA 2JU0A 2M1UA 1J1EA 4YGEB 1JC2A 4FQOA 2FOTA 3AAJA 2PSRA 2LNKA 2M3WA 2JPTA 2KDHA 2LVVA 1NP8A 2MJWB 2WCFA 2PMYA 1QASA 1RECA 2M1KB 1JFJA 3D0YA 1IKUA 4JWQA 2JOJA 1SR6B 3OB1B 1Y6WA 1BR4B 4M2QA 2BKHB 2EGDA 1B1GA 2OTGC 1QS7A 1SYMA 2MHHA 2JT0A 2JXCA 5HKYA 1FI6A 1U5IB 1N65A 1NCZA 1S36A 2M49B 4GBAA 1J7OA 3NXAA 1MWNA 2LHIA 2LP2A 4I5KA 3OHMB 1KFUL 1SCMC 2BCAA 4N5XA 3FS7A 4XYNA 2HQWA 1BODA 3AKAA 1RWYA 2K8MB 1XFXO 2I7AA 1G4YR 1G8IA 1K96A 2MLEC 5HLOA 2D8NA 4YBHB 1XK4A 1OZOA 5B8IB 2F8PA 1EG4A 2KGBC 1DJWA 4QJ3B 2O60A 4ZCUA 1PSRA 1NPQA 1SY9A 3FWBA 2ZN9A 1B7TY 4CPVA 2NLNA 2BL0C 1IG5A 2WORA 3SIAA 1FBVA 2L98A 1YUUA 2KBIA 1SW8A 3H4SE 1KSMA 2JZIA 1RFJA 5ER5A 1JWDA 5TNCA 2LANA 3OX5A 1EG3A 1NIWA 1Y0VH 1Y1AA 2HF5A 2FJUB 4MZKA 2KYCA 1CLLA 2P6BB 4MZLA 2ZKMX 3BUOB 1ZOTB 2KGRA 1J7PA 2LHLA 1M31A 4C0KA 1CDPA 1QV0A 5BPJA 1YUTA 4IL1A 1CDLA 1WRKA 2E30A 4PDZA 2KYFA 1KK8B 1OE9B 3GOFA 1BOCA 1DJIA 2BE4A 1CFFA 4L9MA 3WXAA 1TNQA 1ZACA 4GGFC 2ZN8A 3FWCA 1X02A 4GAOA 1YVLA 1CFCA 1UWOA 3I5HC 1B47A 1IRJA 1S5GY 2K2FA 2M7NA 1TCFA 4M2OA 2CTNA 1BU3A 1EXRA 2KBMA 2F3ZA 3IF7A 3KHEA 3LK1A 1LA0A 1QLSA 1DTLA 5K89A 1J55A 2KI6C 1CDNA 1J7QA 1C7WA 1KFXL 2LVKA 1AUIB 2EHBA 4MRXA 4WRIA 1OMVA 1XFZO 1A2XA 2LVIA 3VRNA 1QIWA 1J1DA 1XFUO 2WCEA 3CR5X 1WLZA 2M7LA 1BLQA 3BUNB 1YURA 2R2IA 3O2PA 1SCVA 1FW4A 1PVAA 2AAOA 4USLA 3VGOA 1AJ5A 1ZFSA 2L51A 2NCPA 1LINA 2PRUA 1RJVA 1S26D 2F2OA 1VRKA 2JT8A 2VRGA 1DJZA 1QXPA 2CCMA 1R2UA 1LA3A 3LCPC 4DIRA 1GQMA 4ORBB 1TRFA 1B7TZ 1B4CA 1KCYA 3TDUA 3GK2A 3I5FB 4HREE 1IJ6A 3BUWB 1FPWA 1LVCD 2ZRSA 1KWOC 4PE0A 3ZWHA 2K7DA 1OMDA 1W7JB 2B1UA 3C1VA 1A75A 1M45A 1QX2A 1SL7A 3D10A 3WNXB 1UHNA 1CDMA 3DVKA 2GGMA 2AMIA 1IWQA 5DKQA 4OVNF 1OSAA 1Q80A 5ER4X 3TDIA 2L4IA 1JFKA 1PSBA 3HX4A 4DUQA 5I2OA 4YGDB 2G2BA 2KSPA 1M46A 5DKNA 1YRUB 1IQ3A 2AUCA 1SK6D 2CNPA 2GV5A 4AQJA 2WCBA 1H4BA 1BT6A 1K95A 1GGWA 2KQ6A 3O6BA 1TNXA 1ALWA 3EKJA 4DS7A 1XFWO 1ODBA 3O4YA 3NSKA 4QJ4B 1JUOA 2K2AA 3BUMB 1K9PA 2JC2A 4PHJA 1CNPA 1MHOA 4MEWA 3KPXA 2PASA 1SMGA 3SG2A 2HPSA 5CPVA 4UPGA 1ZUZA 2FCDA 2SASA 4GGFA 3OX6A 4Q04A 1KWOB 3PN7C 2ZNDA 1XA5A 2Y1MA 4HRHA 4ICBA 1B8RA 2Q91A 3PSRA 4MLWA 1A03A 5KTYA 2LAPA 2K0JA 2MRDA 4PE7A 2PALA 5AXIA 1L7ZA 2JTTA 5AANA 1JF0A 1S6CA 1YVHA 1F55A 4I5LB 2F33A 1MXEA 2I2RE 1IJ5A 2JRFA 1PULA 3CLNA 4M2PA 3EVVA 3E3RA 5AFPA 2MAZA 1EJ3A 1OMRA 1A4PA 1SR6C 3SJSA 3BUXB 3CR4X 4WQ3A 4FTGA 3TS5C 4MVFA 3KEVA 2NXQA 4PHNA 3ZNIA 4YGBB 1CTRA 4P5OE 4P2YB 1C7VA 1K2HA 2M8UA 4PHKA 1TTXA 3MSEB 2LUXA 1AK8A 3SG4A 2I94A 4AOMA 2ZNEA 1WLMA 2CT9A 4OKHA 3VRPA 1CFDA 3TUYB 4R1EA 2LVJA 4C0JA 4XJKB 1YRTB 2LM5A 4HRGA 4JQ0D 1S6IA 1YTZC 1NCXA 1QVIY 3IQQA 4ZCVA 1DJYA 1SKTA 1FI5A 1M63B 1PALA 1DJGA 2QACA 5I2LA 4BY5A 2L5XB 1QIVA 2LLTA 1KK7Z 1NX3A 1F54A 2M9GA 3I5HB 1KQVA 2TN4A 1UURA 4F0ZB 2BBMA 2RGIA 5CSFA 4MSPA 2KOTA 2WOSA 1DVIA 1YR5A 1KK8C 3CS1A 1HQVA 2H61C 1QLKA 2F2PA 3TDZA 5JJGA 1K8UA 1NSHA 2JNXA 4N1GA 3SG5A 1XYDA 2KQYA 3RM1A 2JNFA 1IGVA 3NSOA 2DOQA 1K94A 2L2EA 4PCWA 1CLMA 3CWGA 2WNDA 4GGNA 4PHMA 3VRQA 4GFTA 2O5GA 2LLUA 1UUSA 5FYXA 2KAYA 3BQ3A 5D69A 1UHKA 1BG1A 1A75B 1UHHA 1XFYO 5PALA 2Q4UA 1K9UA 1XK4C 3TZ1A 1NX1A 1PRWA 3DF0B 2Y5IA 4GPLB 1GJYA 5JOLA 1QTXA 1QV1A 2BL0B 4NDCA 2JT3A 1DF0B 2ZRTA 1CB1A 1SCMB 1F4OA 4QJ5B 2ZFDA 2CBLA 1SRAA 1YX7A 3KO0A 4OR9B 1F70A 1B8CA 1RROA 5J3XA 1TCOB 2FCEA 4U8DA 3GK4X 1YX8A 1KK7Y 3JTDC 2V53A 4AQIA 1MF8B 4OV2A 1OQPA 3EK4A 4ORCB 1SBJA 4MRYA 4PE1A 3WHTB 1QX7A 3EVUA 1S3PA 4YGAA 1CM4A 1QVIZ 1WDCC 3TUYC 1CM1A 1JSAA 2F3YA 2LMVA 3JTDB 3PALA 4DCKA 1CKKA 2OS8B 1XVJA 2NZ0A 4A4CA 4C0LA 3PATA 1JF2A 4YI8A 1CLBA 1ALVA 3EK7A 1FF1A 4TNCA 3SG7A 2K61A 4YRUA 5CSIA 2I18A 1AHRA 2KFGA 2E6WA 3BOWB 3VROA 1TIZA 3CTNA 4E68A 1BF5A 1V1GA 1C07A 1B8LA 1SPYA 5KU1A 1NUBA 3M0WA 1TN4A 3PFVA 1MXLC 1K93D 1PVBA 1UHIA 2M29A 2KNEA 3K21A 1UP5A 2LMTA 1KQMB 1TNPA 1K90D 3OP0A 2KI4C 3CR2A 5F6TA 2Y1NA 1WRLA 1N2DA 3D0YB 3RLZA 5I2QA 1MQ1A 5I8NA 3I5IC 2KFFA 1S1EA 3PN7B 2MA2A 2A4JA 2L0PA 2GGZA 2COLB 5IBWA 3A4UB 4CFQA 3GK1A 3I5GB 2M0RA 1YUSA 5HYDA 1V1FA 1U5IA 1Y1UA 4YI9A 1SNLA 5CSJA 1IQ5A 2SCPA 3O78A 1L2OC 1AJ4A 1L2OB 1KQMC 3PM8A 4I5JA 1KFXS 2G9BA 5KSZA 2Y4QA 3I5GC 4I5NB 1XO5A 3ICBA 2JTZA 4NQGA 5G08A 4ORAB 1LKJA 3SG3A 3SIBA 2LUCA 1DJHA 4XJKA 4D1EA 2LMUA 1DMOA 4PALA 2KI6D 2JULA 1RK9A 1DJXA 2LLSA 3DF0A 1R6PA 3SG6A 1JBAA 2BCBA 4NDDA 1DGVA 1SL8A 3BYAA 2HETA 1K9KA 3QRXA 3JVTB 2BECA 3AAKA 4HSZA 3BXKA 3EK8A 1SL9A 1MR8A 2IS9A 2BBNA 3VRRA 2OTGB 1CMFA 2KAXA 4BY4A 1WDCB 1OOJA 2WC8A 1NCYA 1NWDA 2LP3A 3AKBA 2QPTA 1DT7B 1AP4A 1CMGA 1BMOA 1G33A 1BR1B 1OZSA 3LLEA 3TS5B 1E8AA 1HT9A 4ETOA 3CGAA 1KFUS 1PK0D 2KAVA 3CZTX 3HCMA 2CXJA 3NSLA 1RTP1 2OS8C 1J7RA 3I5FC 1CFPA 3JVTC 1EH2A 2K7OA 5HKZA 2MLFC 4CFRA 1DGUA 1D1OA 3DVEA 5HLVA 1NX0A 1LXFC 4MN0A 2KHNA 1UHJA 1XFVO 2HQ8A 3PLFB 2K7CA 1M39A 3EKHA 4NDBA 5DKRA 1F4QA 2M97A 2H2KA 3LL8B 2KFHA 3FIAA 1A29A 1DF0A 2EC6C 2MBXA 1TOPA 3A8RA 1NX2A 2L50A 1IH0A 2K7BA 2ISDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TNW A;  2OPO A;  5D7F A;  3DVJ A;  2JQ6 A;  1QX5 B;  2L4H A;  2LV7 A;  5CSN A;  3IQO A;  1WY9 A;  4A4B A;  3WHU B;  4PE4 A;  1F8H A;  3OB2 B;  4JPZ B;  3EVR A;  3NSI A;  4CLN A;  4N1F A;  1N0Y A;  5AER A;  5HKW A;  1WRZ A;  4OCI A;  5AEQ A;  4DRW A;  1S5G Z;  4YGC B;  4CID A;  2EC6 B;  2BE6 A;  4WQ2 A;  2PVB A;  4GNK B;  1B9A A;  2H61 A;  1AVS A;  1EL4 A;  2LE9 B;  3KF9 A;  1GGZ A;  1ZMZ A;  2JXL A;  3I5I B;  1QJT A;  1NYA A;  3BOW A;  2NCO A;  3DVM A;  2JWW A;  3LK0 A;  3DD4 A;  2LC5 A;  4MZJ A;  2KI4 B;  1Y1X A;  1H8B A;  1W7I B;  1S6J A;  4GUK A;  1BJF A;  1MUX A;  2LCP A;  1KSO A;  3F45 A;  5GQQ C;  2BKI B;  4MBE A;  1F71 A;  2BCX A;  1QAT A;  2JU0 A;  2M1U A;  1J1E A;  4YGE B;  1JC2 A;  4FQO A;  2FOT A;  3AAJ A;  2PSR A;  2LNK A;  2M3W A;  2JPT A;  2KDH A;  2LVV A;  1NP8 A;  2MJW B;  2WCF A;  2PMY A;  1QAS A;  1REC A;  2M1K B;  1JFJ A;  3D0Y A;  1IKU A;  4JWQ A;  2JOJ A;  1SR6 B;  3OB1 B;  1Y6W A;  1BR4 B;  4M2Q A;  2BKH B;  2EGD A;  1B1G A;  2OTG C;  1QS7 A;  1SYM A;  2MHH A;  2JT0 A;  2JXC A;  5HKY A;  1FI6 A;  1U5I B;  1N65 A;  1NCZ A;  1S36 A;  2M49 B;  4GBA A;  1J7O A;  3NXA A;  1MWN A;  2LHI A;  2LP2 A;  4I5K A;  3OHM B;  1KFU L;  1SCM C;  2BCA A;  4N5X A;  3FS7 A;  4XYN A;  2HQW A;  1BOD A;  3AKA A;  1RWY A;  2K8M B;  1XFX O;  2I7A A;  1G4Y R;  1G8I A;  1K96 A;  2MLE C;  5HLO A;  2D8N A;  4YBH B;  1XK4 A;  1OZO A;  5B8I B;  2F8P A;  1EG4 A;  2KGB C;  1DJW A;  4QJ3 B;  2O60 A;  4ZCU A;  1PSR A;  1NPQ A;  1SY9 A;  3FWB A;  2ZN9 A;  1B7T Y;  4CPV A;  2NLN A;  2BL0 C;  1IG5 A;  2WOR A;  3SIA A;  1FBV A;  2L98 A;  1YUU A;  2KBI A;  1SW8 A;  3H4S E;  1KSM A;  2JZI A;  1RFJ A;  5ER5 A;  1JWD A;  5TNC A;  2LAN A;  3OX5 A;  1EG3 A;  1NIW A;  1Y0V H;  1Y1A A;  2HF5 A;  2FJU B;  4MZK A;  2KYC A;  1CLL A;  2P6B B;  4MZL A;  2ZKM X;  3BUO B;  1ZOT B;  2KGR A;  1J7P A;  2LHL A;  1M31 A;  4C0K A;  1CDP A;  1QV0 A;  5BPJ A;  1YUT A;  4IL1 A;  1CDL A;  1WRK A;  2E30 A;  4PDZ A;  2KYF A;  1KK8 B;  1OE9 B;  3GOF A;  1BOC A;  1DJI A;  2BE4 A;  1CFF A;  4L9M A;  3WXA A;  1TNQ A;  1ZAC A;  4GGF C;  2ZN8 A;  3FWC A;  1X02 A;  4GAO A;  1YVL A;  1CFC A;  1UWO A;  3I5H C;  1B47 A;  1IRJ A;  1S5G Y;  2K2F A;  2M7N A;  1TCF A;  4M2O A;  2CTN A;  1BU3 A;  1EXR A;  2KBM A;  2F3Z A;  3IF7 A;  3KHE A;  3LK1 A;  1LA0 A;  1QLS A;  1DTL A;  5K89 A;  1J55 A;  2KI6 C;  1CDN A;  1J7Q A;  1C7W A;  1KFX L;  2LVK A;  1AUI B;  2EHB A;  4MRX A;  4WRI A;  1OMV A;  1XFZ O;  1A2X A;  2LVI A;  3VRN A;  1QIW A;  1J1D A;  1XFU O;  2WCE A;  3CR5 X;  1WLZ A;  2M7L A;  1BLQ A;  3BUN B;  1YUR A;  2R2I A;  3O2P A;  1SCV A;  1FW4 A;  1PVA A;  2AAO A;  4USL A;  3VGO A;  1AJ5 A;  1ZFS A;  2L51 A;  2NCP A;  1LIN A;  2PRU A;  1RJV A;  1S26 D;  2F2O A;  1VRK A;  2JT8 A;  2VRG A;  1DJZ A;  1QXP A;  2CCM A;  1R2U A;  1LA3 A;  3LCP C;  4DIR A;  1GQM A;  4ORB B;  1TRF A;  1B7T Z;  1B4C A;  1KCY A;  3TDU A;  3GK2 A;  3I5F B;  4HRE E;  1IJ6 A;  3BUW B;  1FPW A;  1LVC D;  2ZRS A;  1KWO C;  4PE0 A;  3ZWH A;  2K7D A;  1OMD A;  1W7J B;  2B1U A;  3C1V A;  1A75 A;  1M45 A;  1QX2 A;  1SL7 A;  3D10 A;  3WNX B;  1UHN A;  1CDM A;  3DVK A;  2GGM A;  2AMI A;  1IWQ A;  5DKQ A;  4OVN F;  1OSA A;  1Q80 A;  5ER4 X;  3TDI A;  2L4I A;  1JFK A;  1PSB A;  3HX4 A;  4DUQ A;  5I2O A;  4YGD B;  2G2B A;  2KSP A;  1M46 A;  5DKN A;  1YRU B;  1IQ3 A;  2AUC A;  1SK6 D;  2CNP A;  2GV5 A;  4AQJ A;  2WCB A;  1H4B A;  1BT6 A;  1K95 A;  1GGW A;  2KQ6 A;  3O6B A;  1TNX A;  1ALW A;  3EKJ A;  4DS7 A;  1XFW O;  1ODB A;  3O4Y A;  3NSK A;  4QJ4 B;  1JUO A;  2K2A A;  3BUM B;  1K9P A;  2JC2 A;  4PHJ A;  1CNP A;  1MHO A;  4MEW A;  3KPX A;  2PAS A;  1SMG A;  3SG2 A;  2HPS A;  5CPV A;  4UPG A;  1ZUZ A;  2FCD A;  2SAS A;  4GGF A;  3OX6 A;  4Q04 A;  1KWO B;  3PN7 C;  2ZND A;  1XA5 A;  2Y1M A;  4HRH A;  4ICB A;  1B8R A;  2Q91 A;  3PSR A;  4MLW A;  1A03 A;  5KTY A;  2LAP A;  2K0J A;  2MRD A;  4PE7 A;  2PAL A;  5AXI A;  1L7Z A;  2JTT A;  5AAN A;  1JF0 A;  1S6C A;  1YVH A;  1F55 A;  4I5L B;  2F33 A;  1MXE A;  2I2R E;  1IJ5 A;  2JRF A;  1PUL A;  3CLN A;  4M2P A;  3EVV A;  3E3R A;  5AFP A;  2MAZ A;  1EJ3 A;  1OMR A;  1A4P A;  1SR6 C;  3SJS A;  3BUX B;  3CR4 X;  4WQ3 A;  4FTG A;  3TS5 C;  4MVF A;  3KEV A;  2NXQ A;  4PHN A;  3ZNI A;  4YGB B;  1CTR A;  4P5O E;  4P2Y B;  1C7V A;  1K2H A;  2M8U A;  4PHK A;  1TTX A;  3MSE B;  2LUX A;  1AK8 A;  3SG4 A;  2I94 A;  4AOM A;  2ZNE A;  1WLM A;  2CT9 A;  4OKH A;  3VRP A;  1CFD A;  3TUY B;  4R1E A;  2LVJ A;  4C0J A;  4XJK B;  1YRT B;  2LM5 A;  4HRG A;  4JQ0 D;  1S6I A;  1YTZ C;  1NCX A;  1QVI Y;  3IQQ A;  4ZCV A;  1DJY A;  1SKT A;  1FI5 A;  1M63 B;  1PAL A;  1DJG A;  2QAC A;  5I2L A;  4BY5 A;  2L5X B;  1QIV A;  2LLT A;  1KK7 Z;  1NX3 A;  1F54 A;  2M9G A;  3I5H B;  1KQV A;  2TN4 A;  1UUR A;  4F0Z B;  2BBM A;  2RGI A;  5CSF A;  4MSP A;  2KOT A;  2WOS A;  1DVI A;  1YR5 A;  1KK8 C;  3CS1 A;  1HQV A;  2H61 C;  1QLK A;  2F2P A;  3TDZ A;  5JJG A;  1K8U A;  1NSH A;  2JNX A;  4N1G A;  3SG5 A;  1XYD A;  2KQY A;  3RM1 A;  2JNF A;  1IGV A;  3NSO A;  2DOQ A;  1K94 A;  2L2E A;  4PCW A;  1CLM A;  3CWG A;  2WND A;  4GGN A;  4PHM A;  3VRQ A;  4GFT A;  2O5G A;  2LLU A;  1UUS A;  5FYX A;  2KAY A;  3BQ3 A;  5D69 A;  1UHK A;  1BG1 A;  1A75 B;  1UHH A;  1XFY O;  5PAL A;  2Q4U A;  1K9U A;  1XK4 C;  3TZ1 A;  1NX1 A;  1PRW A;  3DF0 B;  2Y5I A;  4GPL B;  1GJY A;  5JOL A;  1QTX A;  1QV1 A;  2BL0 B;  4NDC A;  2JT3 A;  1DF0 B;  2ZRT A;  1CB1 A;  1SCM B;  1F4O A;  4QJ5 B;  2ZFD A;  2CBL A;  1SRA A;  1YX7 A;  3KO0 A;  4OR9 B;  1F70 A;  1B8C A;  1RRO A;  5J3X A;  1TCO B;  2FCE A;  4U8D A;  3GK4 X;  1YX8 A;  1KK7 Y;  3JTD C;  2V53 A;  4AQI A;  1MF8 B;  4OV2 A;  1OQP A;  3EK4 A;  4ORC B;  1SBJ A;  4MRY A;  4PE1 A;  3WHT B;  1QX7 A;  3EVU A;  1S3P A;  4YGA A;  1CM4 A;  1QVI Z;  1WDC C;  3TUY C;  1CM1 A;  1JSA A;  2F3Y A;  2LMV A;  3JTD B;  3PAL A;  4DCK A;  1CKK A;  2OS8 B;  1XVJ A;  2NZ0 A;  4A4C A;  4C0L A;  3PAT A;  1JF2 A;  4YI8 A;  1CLB A;  1ALV A;  3EK7 A;  1FF1 A;  4TNC A;  3SG7 A;  2K61 A;  4YRU A;  5CSI A;  2I18 A;  1AHR A;  2KFG A;  2E6W A;  3BOW B;  3VRO A;  1TIZ A;  3CTN A;  4E68 A;  1BF5 A;  1V1G A;  1C07 A;  1B8L A;  1SPY A;  5KU1 A;  1NUB A;  3M0W A;  1TN4 A;  3PFV A;  1MXL C;  1K93 D;  1PVB A;  1UHI A;  2M29 A;  2KNE A;  3K21 A;  1UP5 A;  2LMT A;  1KQM B;  1TNP A;  1K90 D;  3OP0 A;  2KI4 C;  3CR2 A;  5F6T A;  2Y1N A;  1WRL A;  1N2D A;  3D0Y B;  3RLZ A;  5I2Q A;  1MQ1 A;  5I8N A;  3I5I C;  2KFF A;  1S1E A;  3PN7 B;  2MA2 A;  2A4J A;  2L0P A;  2GGZ A;  2COL B;  5IBW A;  3A4U B;  4CFQ A;  3GK1 A;  3I5G B;  2M0R A;  1YUS A;  5HYD A;  1V1F A;  1U5I A;  1Y1U A;  4YI9 A;  1SNL A;  5CSJ A;  1IQ5 A;  2SCP A;  3O78 A;  1L2O C;  1AJ4 A;  1L2O B;  1KQM C;  3PM8 A;  4I5J A;  1KFX S;  2G9B A;  5KSZ A;  2Y4Q A;  3I5G C;  4I5N B;  1XO5 A;  3ICB A;  2JTZ A;  4NQG A;  5G08 A;  4ORA B;  1LKJ A;  3SG3 A;  3SIB A;  2LUC A;  1DJH A;  4XJK A;  4D1E A;  2LMU A;  1DMO A;  4PAL A;  2KI6 D;  2JUL A;  1RK9 A;  1DJX A;  2LLS A;  3DF0 A;  1R6P A;  3SG6 A;  1JBA A;  2BCB A;  4NDD A;  1DGV A;  1SL8 A;  3BYA A;  2HET A;  1K9K A;  3QRX A;  3JVT B;  2BEC A;  3AAK A;  4HSZ A;  3BXK A;  3EK8 A;  1SL9 A;  1MR8 A;  2IS9 A;  2BBN A;  3VRR A;  2OTG B;  1CMF A;  2KAX A;  4BY4 A;  1WDC B;  1OOJ A;  2WC8 A;  1NCY A;  1NWD A;  2LP3 A;  3AKB A;  2QPT A;  1DT7 B;  1AP4 A;  1CMG A;  1BMO A;  1G33 A;  1BR1 B;  1OZS A;  3LLE A;  3TS5 B;  1E8A A;  1HT9 A;  4ETO A;  3CGA A;  1KFU S;  1PK0 D;  2KAV A;  3CZT X;  3HCM A;  2CXJ A;  3NSL A;  1RTP 1;  2OS8 C;  1J7R A;  3I5F C;  1CFP A;  3JVT C;  1EH2 A;  2K7O A;  5HKZ A;  2MLF C;  4CFR A;  1DGU A;  1D1O A;  3DVE A;  5HLV A;  1NX0 A;  1LXF C;  4MN0 A;  2KHN A;  1UHJ A;  1XFV O;  2HQ8 A;  3PLF B;  2K7C A;  1M39 A;  3EKH A;  4NDB A;  5DKR A;  1F4Q A;  2M97 A;  2H2K A;  3LL8 B;  2KFH A;  3FIA A;  1A29 A;  1DF0 A;  2EC6 C;  2MBX A;  1TOP A;  3A8R A;  1NX2 A;  2L50 A;  1IH0 A;  2K7B A;  2ISD A; 
#chains in the Genus database with same CATH topology
 1TNW A;  4OZD A;  2OPO A;  5D7F A;  3DVJ A;  2JQ6 A;  1QX5 B;  2L4H A;  2LV7 A;  5CSN A;  3IQO A;  1WY9 A;  4A4B A;  3L4A A;  3CZ1 A;  3WHU B;  4PE4 A;  1F8H A;  2WCK A;  3OB2 B;  3EVR A;  3NSI A;  4JPZ B;  4CLN A;  3R72 A;  4N1F A;  1N0Y A;  5AER A;  5HKW A;  1WRZ A;  4OCI A;  2QEV A;  5AEQ A;  1DC1 A;  4DRW A;  1S5G Z;  4YGC B;  4CID A;  2EC6 B;  2BE6 A;  4WQ2 A;  2PVB A;  3DY9 A;  4GNK B;  1B9A A;  1T14 A;  2H61 A;  1AVS A;  1EL4 A;  2LE9 B;  3KF9 A;  1GGZ A;  3N7H A;  1ZMZ A;  2JXL A;  3B88 A;  3I5I B;  1QJT A;  1NYA A;  3BOW A;  2NCO A;  3CZ0 A;  3DVM A;  2JWW A;  3LK0 A;  3DD4 A;  2LC5 A;  4MZJ A;  2KI4 B;  1Y1X A;  1H8B A;  1W7I B;  1S6J A;  3B7A A;  4GUK A;  1SSE B;  1BJF A;  1MUX A;  2LCP A;  1KSO A;  3F45 A;  5GQQ C;  2BKI B;  4MBE A;  2KLD A;  3K1E A;  2BCX A;  1QAT A;  2JU0 A;  2M1U A;  1J1E A;  2WC5 A;  1DQE A;  4YGE B;  1JC2 A;  4FQO A;  2FOT A;  3AAJ A;  2PSR A;  2LNK A;  2BAP A;  3S0B A;  2M3W A;  2JPT A;  2KDH A;  2LVV A;  1NP8 A;  2MJW B;  2WCF A;  2PMY A;  1QAS A;  1REC A;  2M1K B;  1JFJ A;  3D0Y A;  1IKU A;  4JWQ A;  2JOJ A;  1SR6 B;  3OB1 B;  1Y6W A;  1BR4 B;  4M2Q A;  2BKH B;  2EGD A;  1B1G A;  2OTG C;  1QS7 A;  1SYM A;  2MHH A;  2KLE A;  2JT0 A;  2JXC A;  3SS4 A;  5HKY A;  1FI6 A;  1U5I B;  1N65 A;  1NCZ A;  3RZS A;  1S36 A;  2M49 B;  4GBA A;  1J7O A;  3NXA A;  1MWN A;  2LHI A;  2LP2 A;  2WCH A;  4I5K A;  3OHM B;  1KFU L;  1SCM C;  3PJI A;  2BCA A;  4N5X A;  3FS7 A;  4XYN A;  2HQW A;  1BOD A;  3AKA A;  1C3Y A;  1RWY A;  2K8M B;  1XFX O;  2I7A A;  1G4Y R;  1G8I A;  1K96 A;  2MLE C;  5HLO A;  1OOH A;  2D8N A;  4YBH B;  1XK4 A;  1OZO A;  5B8I B;  1EG4 A;  2F8P A;  2KGB C;  1DJW A;  4QJ3 B;  2O60 A;  4ZCU A;  3CAB A;  3VB1 A;  1PSR A;  5DIC A;  1NPQ A;  1SY9 A;  3FWB A;  2ZN9 A;  1B7T Y;  4CPV A;  2NLN A;  2BL0 C;  1IG5 A;  2WOR A;  3SIA A;  1FBV A;  2L98 A;  3S0D A;  1YUU A;  2KBI A;  1SW8 A;  3H4S E;  1KSM A;  2JZI A;  1RFJ A;  5ER5 A;  1JWD A;  5TNC A;  2LAN A;  3OX5 A;  1EG3 A;  1NIW A;  1Y0V H;  1Y1A A;  3OBV A;  2HF5 A;  2FJU B;  4MZK A;  2KYC A;  1CLL A;  2P6B B;  4MZL A;  5FI2 A;  2ZKM X;  3BUO B;  1ZOT B;  2KGR A;  3D76 A;  1J7P A;  2LHL A;  1M31 A;  4C0K A;  1CDP A;  1QV0 A;  5BPJ A;  3NHI A;  1YUT A;  1QWV A;  1CDL A;  1WRK A;  4IL1 A;  2E30 A;  2FJY A;  2QEO A;  4PDZ A;  2KYF A;  1KK8 B;  1OE9 B;  2GTE A;  3GOF A;  1BOC A;  1DJI A;  2BE4 A;  1CFF A;  4L9M A;  3WXA A;  1TNQ A;  1ZAC A;  4GGF C;  2ZN8 A;  3FWC A;  1X02 A;  4GAO A;  1YVL A;  1CFC A;  1UWO A;  3I5H C;  1B47 A;  1IRJ A;  1S5G Y;  2K2F A;  2M7N A;  1TCF A;  4M2O A;  2CTN A;  1BU3 A;  1EXR A;  2KBM A;  2F3Z A;  3DXL A;  3IF7 A;  3KHE A;  3LK1 A;  1LA0 A;  1QLS A;  1DTL A;  5K89 A;  1J55 A;  2KI6 C;  1CDN A;  1J7Q A;  1C7W A;  1KFX L;  2LVK A;  1AUI B;  2EHB A;  4MRX A;  4WRI A;  1OMV A;  1XFZ O;  4JD9 A;  1A2X A;  2LVI A;  3Q8I A;  1QIW A;  1J1D A;  3VRN A;  1XFU O;  2WCE A;  3CR5 X;  1WLZ A;  2M7L A;  1BLQ A;  3BUN B;  1YUR A;  2R2I A;  3O2P A;  1SCV A;  1FW4 A;  1PVA A;  2AAO A;  4USL A;  3VGO A;  1AJ5 A;  1ZFS A;  2L51 A;  2NCP A;  1LIN A;  2PRU A;  1RJV A;  1S26 D;  2F2O A;  1VRK A;  2JT8 A;  2VRG A;  1DJZ A;  1QXP A;  1TWO A;  2CCM A;  1R2U A;  1LA3 A;  3LCP C;  4DIR A;  1GQM A;  4ORB B;  1TRF A;  1B7T Z;  1B4C A;  1KCY A;  3TDU A;  3GK2 A;  3I5F B;  4HRE E;  1IJ6 A;  3BUW B;  1FPW A;  1LVC D;  2ZRS A;  1KWO C;  4PE0 A;  3ZWH A;  2K7D A;  1OMD A;  1W7J B;  2B1U A;  3C1V A;  1A75 A;  1M45 A;  1QX2 A;  1SL7 A;  3D10 A;  3WNX B;  1UHN A;  3BJH A;  1CDM A;  3UO9 A;  1Z4H A;  3DVK A;  2GGM A;  2AMI A;  1IWQ A;  5DKQ A;  4OVN F;  1OSA A;  1Q80 A;  5ER4 X;  3TDI A;  2L4I A;  1JFK A;  1PSB A;  3HX4 A;  4DUQ A;  5I2O A;  4YGD B;  3D77 A;  2G2B A;  2WC6 A;  2KSP A;  1M46 A;  5DKN A;  1YRU B;  3S0G A;  1IQ3 A;  2AUC A;  1OOG A;  1SK6 D;  2CNP A;  2GV5 A;  2P71 A;  4AQJ A;  2WCB A;  3CDN A;  4PT1 A;  1H4B A;  1BT6 A;  1K95 A;  1GGW A;  2KQ6 A;  3O6B A;  1TNX A;  1ALW A;  3EKJ A;  1XFR A;  4DS7 A;  1XFW O;  1ODB A;  3O4Y A;  3NSK A;  4QJ4 B;  1JUO A;  2K2A A;  3BUM B;  1K9P A;  2JC2 A;  4PHJ A;  1CNP A;  1MHO A;  4MEW A;  2ERB A;  3KPX A;  2WCM A;  2QEB A;  2PAS A;  1SMG A;  2PYQ A;  2HPS A;  5CPV A;  3SG2 A;  4UPG A;  1ZUZ A;  2FCD A;  2SAS A;  4GGF A;  3OX6 A;  3QME A;  4Q04 A;  1KWO B;  3PN7 C;  2ZND A;  3S0A A;  1XA5 A;  2Y1M A;  3B6X A;  4HRH A;  1B8R A;  2Q91 A;  3PSR A;  4ICB A;  4MLW A;  1A03 A;  3PM2 A;  5KTY A;  2LAP A;  2K0J A;  2MRD A;  4PE7 A;  2PAL A;  5AXI A;  5I94 A;  1L7Z A;  2JTT A;  5AAN A;  1JF0 A;  1C3Z A;  1S6C A;  3BFA A;  1YVH A;  1F55 A;  4I5L B;  2F33 A;  1MXE A;  2I2R E;  1IJ5 A;  2JRF A;  1PUL A;  3CLN A;  4M2P A;  3EVV A;  3E3R A;  1DEK A;  5AFP A;  2MAZ A;  1EJ3 A;  1OMR A;  1A4P A;  1SR6 C;  3SJS A;  3BUX B;  3CR4 X;  4WQ3 A;  4FTG A;  3TS5 C;  4MVF A;  3KEV A;  2NXQ A;  4PHN A;  3ZNI A;  4YGB B;  1CTR A;  4P5O E;  4P2Y B;  1C7V A;  1K2H A;  5D3O A;  2M8U A;  4PHK A;  1TTX A;  3MSE B;  2LUX A;  3S0E A;  1AK8 A;  3SG4 A;  2I94 A;  4AOM A;  2ZNE A;  1WLM A;  3BFB A;  2CT9 A;  4OKH A;  3VRP A;  1CFD A;  3R1O A;  3TUY B;  4R1E A;  2LVJ A;  4C0J A;  4XJK B;  1YRT B;  2LM5 A;  4HRG A;  4JQ0 D;  1S6I A;  3L4L A;  1YTZ C;  3NHT A;  1NCX A;  1QVI Y;  3IQQ A;  4ZCV A;  1DJY A;  1SKT A;  1FI5 A;  1M63 B;  1PAL A;  1DJG A;  2QAC A;  5I2L A;  4BY5 A;  2L5X B;  1QIV A;  2LLT A;  1KK7 Z;  1TUJ A;  1NX3 A;  1F54 A;  1IIO A;  2M9G A;  3I5H B;  1KQV A;  2TN4 A;  1UUR A;  4F0Z B;  3D73 A;  2BBM A;  2RGI A;  5CSF A;  4MSP A;  2KOT A;  2WOS A;  4F7F A;  1DVI A;  1YR5 A;  2KPH A;  1KK8 C;  3CS1 A;  1HQV A;  2H61 C;  1QLK A;  2F2P A;  3TDZ A;  5JJG A;  1K8U A;  1NSH A;  2JNX A;  4N1G A;  3SG5 A;  1XYD A;  2JPO A;  2KQY A;  2K60 A;  3RM1 A;  2JNF A;  1IGV A;  3NSO A;  2DOQ A;  1K94 A;  2L2E A;  4PCW A;  1GM0 A;  1CLM A;  3CWG A;  2WND A;  4GGN A;  4PHM A;  3VRQ A;  4GFT A;  2O5G A;  2LLU A;  2PQL A;  1UUS A;  5FYX A;  2KAY A;  3BQ3 A;  5D69 A;  1UHK A;  3D78 A;  1BG1 A;  1A75 B;  4FQT A;  1UHH A;  1OOF A;  1XFY O;  2Q4U A;  5PAL A;  1K9U A;  1XK4 C;  3TZ1 A;  1NX1 A;  1PRW A;  2L2C A;  2QDI A;  3DF0 B;  2Y5I A;  4GPL B;  1GJY A;  5JOL A;  1QTX A;  1QV1 A;  2BL0 B;  4NDC A;  2JT3 A;  1DF0 B;  2ZRT A;  1CB1 A;  1SCM B;  1F4O A;  4QJ5 B;  2ZFD A;  2CBL A;  1SRA A;  1YX7 A;  3KO0 A;  4OR9 B;  1F70 A;  1B8C A;  1RRO A;  5J3X A;  1TCO B;  2FCE A;  4U8D A;  3GK4 X;  1YX8 A;  4INW A;  1KK7 Y;  3JTD C;  2V53 A;  4AQI A;  1MF8 B;  4OV2 A;  1OQP A;  3EK4 A;  4ORC B;  1SBJ A;  4MRY A;  4PE1 A;  1OOI X;  3WHT B;  1QX7 A;  3EVU A;  1S3P A;  4YGA A;  3DZT A;  1CM4 A;  1QVI Z;  2BNX A;  1WDC C;  3TUY C;  1CM1 A;  1JSA A;  2F3Y A;  2LMV A;  3JTD B;  3PAL A;  4DCK A;  1CKK A;  2OS8 B;  1XVJ A;  2NZ0 A;  4A4C A;  4C0L A;  3PAT A;  1JF2 A;  4YI8 A;  1ORG A;  1CLB A;  1ALV A;  2QEH A;  3EK7 A;  4JKT A;  4TNC A;  1FF1 A;  3SG7 A;  2K61 A;  4YRU A;  5CSI A;  5EL2 A;  3SS3 A;  2I18 A;  1AHR A;  2KFG A;  2E6W A;  3BOW B;  3R1P A;  1TIZ A;  3CTN A;  3VRO A;  4E68 A;  1BF5 A;  2L5Y A;  1V1G A;  1C07 A;  3CZ2 A;  1B8L A;  1SPY A;  5KU1 A;  1NUB A;  3M0W A;  1TN4 A;  3PFV A;  1MXL C;  3FE8 A;  1K93 D;  1PVB A;  1UHI A;  3SS5 A;  2M29 A;  2KNE A;  3K21 A;  1UP5 A;  2LMT A;  1KQM B;  3CYZ A;  1TNP A;  1K90 D;  3OP0 A;  2KI4 C;  3CR2 A;  5F6T A;  2Y1N A;  1WRL A;  3R1V A;  1N2D A;  3O4X A;  3D0Y B;  3RLZ A;  5I2Q A;  1MQ1 A;  5I8N A;  3I5I C;  2KFF A;  1S1E A;  4INX A;  1F71 A;  3PN7 B;  2MA2 A;  3D74 A;  2A4J A;  2L0P A;  2GGZ A;  2COL B;  5IBW A;  3A4U B;  4CFQ A;  3GK1 A;  3I5G B;  2M0R A;  1YUS A;  5HYD A;  1V1F A;  1DEL A;  1Y1U A;  1U5I A;  4YI9 A;  1SNL A;  5CSJ A;  1IQ5 A;  2YGU A;  2SCP A;  3O78 A;  1L2O C;  1AJ4 A;  1L2O B;  1KQM C;  3B87 A;  3PM8 A;  4I5J A;  4IJ7 A;  1KFX S;  2G9B A;  3B86 A;  5KSZ A;  2Y4Q A;  3I5G C;  4I5N B;  1XO5 A;  3ICB A;  2JTZ A;  3IVT A;  4NQG A;  4ORA B;  1LKJ A;  5G08 A;  1P28 A;  2LUC A;  3SIB A;  3SG3 A;  1DJH A;  4XJK A;  4D1E A;  2LMU A;  1DMO A;  4PAL A;  2KI6 D;  2JUL A;  1RK9 A;  3NGV A;  1DJX A;  2LLS A;  3L47 A;  3DF0 A;  1R6P A;  3SG6 A;  1JBA A;  2BCB A;  4NDD A;  1DGV A;  1SL8 A;  3BYA A;  2HET A;  1K9K A;  3EG5 B;  3QRX A;  3JVT B;  2BEC A;  3AAK A;  4HSZ A;  3BXK A;  3EK8 A;  1SL9 A;  1MR8 A;  2IS9 A;  2BBN A;  3DYE A;  3VRR A;  2OTG B;  3D75 A;  1CMF A;  5FI7 A;  1W9Z A;  3V2L A;  2KAX A;  4BY4 A;  1WDC B;  1OOJ A;  2WC8 A;  1NCY A;  2P70 A;  1NWD A;  2LP3 A;  3AKB A;  2QPT A;  1DT7 B;  1AP4 A;  3S0F A;  1Z2C B;  1CMG A;  1BMO A;  1G33 A;  1OW4 A;  1BR1 B;  1OZS A;  3LLE A;  3TS5 B;  1E8A A;  1HT9 A;  4ETO A;  3CGA A;  1KFU S;  1PK0 D;  2KAV A;  3CZT X;  3HCM A;  3FE9 A;  1LS8 A;  2CXJ A;  3NSL A;  1RTP 1;  5HL1 A;  3OGN A;  2OS8 C;  1J7R A;  3I5F C;  1CFP A;  3JVT C;  1EH2 A;  2K7O A;  3FE6 A;  5HKZ A;  2MLF C;  4CFR A;  1DGU A;  1D1O A;  3DVE A;  5HLV A;  2WCJ A;  1NX0 A;  1LXF C;  4MN0 A;  2KHN A;  3BFH A;  1UHJ A;  1XFV O;  2H8V A;  2HQ8 A;  3PLF B;  2K7C A;  1M39 A;  3EKH A;  4NDB A;  5DKR A;  1F4Q A;  2M97 A;  2H2K A;  3LL8 B;  2KFH A;  5FI6 A;  4KYN A;  3FIA A;  1A29 A;  1DF0 A;  2EC6 C;  2WCL A;  1TOP A;  3A8R A;  2MBX A;  1NX2 A;  1TUZ A;  2L50 A;  3UNW A;  1IH0 A;  2K7B A;  2ISD A; 
#chains in the Genus database with same CATH homology
 1TNW A;  2OPO A;  5D7F A;  3DVJ A;  2JQ6 A;  1QX5 B;  2L4H A;  2LV7 A;  5CSN A;  3IQO A;  1WY9 A;  4A4B A;  3WHU B;  4PE4 A;  1F8H A;  3OB2 B;  4JPZ B;  3EVR A;  3NSI A;  4CLN A;  4N1F A;  1N0Y A;  5AER A;  5HKW A;  1WRZ A;  4OCI A;  5AEQ A;  4DRW A;  1S5G Z;  4YGC B;  4CID A;  2EC6 B;  2BE6 A;  4WQ2 A;  2PVB A;  4GNK B;  1B9A A;  2H61 A;  1AVS A;  1EL4 A;  2LE9 B;  3KF9 A;  1GGZ A;  1ZMZ A;  2JXL A;  3I5I B;  1QJT A;  1NYA A;  3BOW A;  2NCO A;  3DVM A;  2JWW A;  3LK0 A;  3DD4 A;  2LC5 A;  4MZJ A;  2KI4 B;  1Y1X A;  1H8B A;  1W7I B;  1S6J A;  4GUK A;  1BJF A;  1MUX A;  2LCP A;  1KSO A;  3F45 A;  5GQQ C;  2BKI B;  4MBE A;  1F71 A;  2BCX A;  1QAT A;  2JU0 A;  2M1U A;  1J1E A;  4YGE B;  1JC2 A;  4FQO A;  2FOT A;  3AAJ A;  2PSR A;  2LNK A;  2M3W A;  2JPT A;  2KDH A;  2LVV A;  1NP8 A;  2MJW B;  2WCF A;  2PMY A;  1QAS A;  1REC A;  2M1K B;  1JFJ A;  3D0Y A;  1IKU A;  4JWQ A;  2JOJ A;  1SR6 B;  3OB1 B;  1Y6W A;  1BR4 B;  4M2Q A;  2BKH B;  2EGD A;  1B1G A;  2OTG C;  1QS7 A;  1SYM A;  2MHH A;  2JT0 A;  2JXC A;  5HKY A;  1FI6 A;  1U5I B;  1N65 A;  1NCZ A;  1S36 A;  2M49 B;  4GBA A;  1J7O A;  3NXA A;  1MWN A;  2LHI A;  2LP2 A;  4I5K A;  3OHM B;  1KFU L;  1SCM C;  2BCA A;  4N5X A;  3FS7 A;  4XYN A;  2HQW A;  1BOD A;  3AKA A;  1RWY A;  2K8M B;  1XFX O;  2I7A A;  1G4Y R;  1G8I A;  1K96 A;  2MLE C;  5HLO A;  2D8N A;  4YBH B;  1XK4 A;  1OZO A;  5B8I B;  2F8P A;  1EG4 A;  2KGB C;  1DJW A;  4QJ3 B;  2O60 A;  4ZCU A;  1PSR A;  1NPQ A;  1SY9 A;  3FWB A;  2ZN9 A;  1B7T Y;  4CPV A;  2NLN A;  2BL0 C;  1IG5 A;  2WOR A;  3SIA A;  1FBV A;  2L98 A;  1YUU A;  2KBI A;  1SW8 A;  3H4S E;  1KSM A;  2JZI A;  1RFJ A;  5ER5 A;  1JWD A;  5TNC A;  2LAN A;  3OX5 A;  1EG3 A;  1NIW A;  1Y0V H;  1Y1A A;  2HF5 A;  2FJU B;  4MZK A;  2KYC A;  1CLL A;  2P6B B;  4MZL A;  2ZKM X;  3BUO B;  1ZOT B;  2KGR A;  1J7P A;  2LHL A;  1M31 A;  4C0K A;  1CDP A;  1QV0 A;  5BPJ A;  1YUT A;  4IL1 A;  1CDL A;  1WRK A;  2E30 A;  4PDZ A;  2KYF A;  1KK8 B;  1OE9 B;  3GOF A;  1BOC A;  1DJI A;  2BE4 A;  1CFF A;  4L9M A;  3WXA A;  1TNQ A;  1ZAC A;  4GGF C;  2ZN8 A;  3FWC A;  1X02 A;  4GAO A;  1YVL A;  1CFC A;  1UWO A;  3I5H C;  1B47 A;  1IRJ A;  1S5G Y;  2K2F A;  2M7N A;  1TCF A;  4M2O A;  2CTN A;  1BU3 A;  1EXR A;  2KBM A;  2F3Z A;  3IF7 A;  3KHE A;  3LK1 A;  1LA0 A;  1QLS A;  1DTL A;  5K89 A;  1J55 A;  2KI6 C;  1CDN A;  1J7Q A;  1C7W A;  1KFX L;  2LVK A;  1AUI B;  2EHB A;  4MRX A;  4WRI A;  1OMV A;  1XFZ O;  1A2X A;  2LVI A;  3VRN A;  1QIW A;  1J1D A;  1XFU O;  2WCE A;  3CR5 X;  1WLZ A;  2M7L A;  1BLQ A;  3BUN B;  1YUR A;  2R2I A;  3O2P A;  1SCV A;  1FW4 A;  1PVA A;  2AAO A;  4USL A;  3VGO A;  1AJ5 A;  1ZFS A;  2L51 A;  2NCP A;  1LIN A;  2PRU A;  1RJV A;  1S26 D;  2F2O A;  1VRK A;  2JT8 A;  2VRG A;  1DJZ A;  1QXP A;  2CCM A;  1R2U A;  1LA3 A;  3LCP C;  4DIR A;  1GQM A;  4ORB B;  1TRF A;  1B7T Z;  1B4C A;  1KCY A;  3TDU A;  3GK2 A;  3I5F B;  4HRE E;  1IJ6 A;  3BUW B;  1FPW A;  1LVC D;  2ZRS A;  1KWO C;  4PE0 A;  3ZWH A;  2K7D A;  1OMD A;  1W7J B;  2B1U A;  3C1V A;  1A75 A;  1M45 A;  1QX2 A;  1SL7 A;  3D10 A;  3WNX B;  1UHN A;  1CDM A;  3DVK A;  2GGM A;  2AMI A;  1IWQ A;  5DKQ A;  4OVN F;  1OSA A;  1Q80 A;  5ER4 X;  3TDI A;  2L4I A;  1JFK A;  1PSB A;  3HX4 A;  4DUQ A;  5I2O A;  4YGD B;  2G2B A;  2KSP A;  1M46 A;  5DKN A;  1YRU B;  1IQ3 A;  2AUC A;  1SK6 D;  2CNP A;  2GV5 A;  4AQJ A;  2WCB A;  1H4B A;  1BT6 A;  1K95 A;  1GGW A;  2KQ6 A;  3O6B A;  1TNX A;  1ALW A;  3EKJ A;  4DS7 A;  1XFW O;  1ODB A;  3O4Y A;  3NSK A;  4QJ4 B;  1JUO A;  2K2A A;  3BUM B;  1K9P A;  2JC2 A;  4PHJ A;  1CNP A;  1MHO A;  4MEW A;  3KPX A;  2PAS A;  1SMG A;  3SG2 A;  2HPS A;  5CPV A;  4UPG A;  1ZUZ A;  2FCD A;  2SAS A;  4GGF A;  3OX6 A;  4Q04 A;  1KWO B;  3PN7 C;  2ZND A;  1XA5 A;  2Y1M A;  4HRH A;  4ICB A;  1B8R A;  2Q91 A;  3PSR A;  4MLW A;  1A03 A;  5KTY A;  2LAP A;  2K0J A;  2MRD A;  4PE7 A;  2PAL A;  5AXI A;  1L7Z A;  2JTT A;  5AAN A;  1JF0 A;  1S6C A;  1YVH A;  1F55 A;  4I5L B;  2F33 A;  1MXE A;  2I2R E;  1IJ5 A;  2JRF A;  1PUL A;  3CLN A;  4M2P A;  3EVV A;  3E3R A;  5AFP A;  2MAZ A;  1EJ3 A;  1OMR A;  1A4P A;  1SR6 C;  3SJS A;  3BUX B;  3CR4 X;  4WQ3 A;  4FTG A;  3TS5 C;  4MVF A;  3KEV A;  2NXQ A;  4PHN A;  3ZNI A;  4YGB B;  1CTR A;  4P5O E;  4P2Y B;  1C7V A;  1K2H A;  2M8U A;  4PHK A;  1TTX A;  3MSE B;  2LUX A;  1AK8 A;  3SG4 A;  2I94 A;  4AOM A;  2ZNE A;  1WLM A;  2CT9 A;  4OKH A;  3VRP A;  1CFD A;  3TUY B;  4R1E A;  2LVJ A;  4C0J A;  4XJK B;  1YRT B;  2LM5 A;  4HRG A;  4JQ0 D;  1S6I A;  1YTZ C;  1NCX A;  1QVI Y;  3IQQ A;  4ZCV A;  1DJY A;  1SKT A;  1FI5 A;  1M63 B;  1PAL A;  1DJG A;  2QAC A;  5I2L A;  4BY5 A;  2L5X B;  1QIV A;  2LLT A;  1KK7 Z;  1NX3 A;  1F54 A;  2M9G A;  3I5H B;  1KQV A;  2TN4 A;  1UUR A;  4F0Z B;  2BBM A;  2RGI A;  5CSF A;  4MSP A;  2KOT A;  2WOS A;  1DVI A;  1YR5 A;  1KK8 C;  3CS1 A;  1HQV A;  2H61 C;  1QLK A;  2F2P A;  3TDZ A;  5JJG A;  1K8U A;  1NSH A;  2JNX A;  4N1G A;  3SG5 A;  1XYD A;  2KQY A;  3RM1 A;  2JNF A;  1IGV A;  3NSO A;  2DOQ A;  1K94 A;  2L2E A;  4PCW A;  1CLM A;  3CWG A;  2WND A;  4GGN A;  4PHM A;  3VRQ A;  4GFT A;  2O5G A;  2LLU A;  1UUS A;  5FYX A;  2KAY A;  3BQ3 A;  5D69 A;  1UHK A;  1BG1 A;  1A75 B;  1UHH A;  1XFY O;  5PAL A;  2Q4U A;  1K9U A;  1XK4 C;  3TZ1 A;  1NX1 A;  1PRW A;  3DF0 B;  2Y5I A;  4GPL B;  1GJY A;  5JOL A;  1QTX A;  1QV1 A;  2BL0 B;  4NDC A;  2JT3 A;  1DF0 B;  2ZRT A;  1CB1 A;  1SCM B;  1F4O A;  4QJ5 B;  2ZFD A;  2CBL A;  1SRA A;  1YX7 A;  3KO0 A;  4OR9 B;  1F70 A;  1B8C A;  1RRO A;  5J3X A;  1TCO B;  2FCE A;  4U8D A;  3GK4 X;  1YX8 A;  1KK7 Y;  3JTD C;  2V53 A;  4AQI A;  1MF8 B;  4OV2 A;  1OQP A;  3EK4 A;  4ORC B;  1SBJ A;  4MRY A;  4PE1 A;  3WHT B;  1QX7 A;  3EVU A;  1S3P A;  4YGA A;  1CM4 A;  1QVI Z;  1WDC C;  3TUY C;  1CM1 A;  1JSA A;  2F3Y A;  2LMV A;  3JTD B;  3PAL A;  4DCK A;  1CKK A;  2OS8 B;  1XVJ A;  2NZ0 A;  4A4C A;  4C0L A;  3PAT A;  1JF2 A;  4YI8 A;  1CLB A;  1ALV A;  3EK7 A;  1FF1 A;  4TNC A;  3SG7 A;  2K61 A;  4YRU A;  5CSI A;  2I18 A;  1AHR A;  2KFG A;  2E6W A;  3BOW B;  3VRO A;  1TIZ A;  3CTN A;  4E68 A;  1BF5 A;  1V1G A;  1C07 A;  1B8L A;  1SPY A;  5KU1 A;  1NUB A;  3M0W A;  1TN4 A;  3PFV A;  1MXL C;  1K93 D;  1PVB A;  1UHI A;  2M29 A;  2KNE A;  3K21 A;  1UP5 A;  2LMT A;  1KQM B;  1TNP A;  1K90 D;  3OP0 A;  2KI4 C;  3CR2 A;  5F6T A;  2Y1N A;  1WRL A;  1N2D A;  3D0Y B;  3RLZ A;  5I2Q A;  1MQ1 A;  5I8N A;  3I5I C;  2KFF A;  1S1E A;  3PN7 B;  2MA2 A;  2A4J A;  2L0P A;  2GGZ A;  2COL B;  5IBW A;  3A4U B;  4CFQ A;  3GK1 A;  3I5G B;  2M0R A;  1YUS A;  5HYD A;  1V1F A;  1U5I A;  1Y1U A;  4YI9 A;  1SNL A;  5CSJ A;  1IQ5 A;  2SCP A;  3O78 A;  1L2O C;  1AJ4 A;  1L2O B;  1KQM C;  3PM8 A;  4I5J A;  1KFX S;  2G9B A;  5KSZ A;  2Y4Q A;  3I5G C;  4I5N B;  1XO5 A;  3ICB A;  2JTZ A;  4NQG A;  5G08 A;  4ORA B;  1LKJ A;  3SG3 A;  3SIB A;  2LUC A;  1DJH A;  4XJK A;  4D1E A;  2LMU A;  1DMO A;  4PAL A;  2KI6 D;  2JUL A;  1RK9 A;  1DJX A;  2LLS A;  3DF0 A;  1R6P A;  3SG6 A;  1JBA A;  2BCB A;  4NDD A;  1DGV A;  1SL8 A;  3BYA A;  2HET A;  1K9K A;  3QRX A;  3JVT B;  2BEC A;  3AAK A;  4HSZ A;  3BXK A;  3EK8 A;  1SL9 A;  1MR8 A;  2IS9 A;  2BBN A;  3VRR A;  2OTG B;  1CMF A;  2KAX A;  4BY4 A;  1WDC B;  1OOJ A;  2WC8 A;  1NCY A;  1NWD A;  2LP3 A;  3AKB A;  2QPT A;  1DT7 B;  1AP4 A;  1CMG A;  1BMO A;  1G33 A;  1BR1 B;  1OZS A;  3LLE A;  3TS5 B;  1E8A A;  1HT9 A;  4ETO A;  3CGA A;  1KFU S;  1PK0 D;  2KAV A;  3CZT X;  3HCM A;  2CXJ A;  3NSL A;  1RTP 1;  2OS8 C;  1J7R A;  3I5F C;  1CFP A;  3JVT C;  1EH2 A;  2K7O A;  5HKZ A;  2MLF C;  4CFR A;  1DGU A;  1D1O A;  3DVE A;  5HLV A;  1NX0 A;  1LXF C;  4MN0 A;  2KHN A;  1UHJ A;  1XFV O;  2HQ8 A;  3PLF B;  2K7C A;  1M39 A;  3EKH A;  4NDB A;  5DKR A;  1F4Q A;  2M97 A;  2H2K A;  3LL8 B;  2KFH A;  3FIA A;  1A29 A;  1DF0 A;  2EC6 C;  2MBX A;  1TOP A;  3A8R A;  1NX2 A;  2L50 A;  1IH0 A;  2K7B A;  2ISD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...