4MLWA

Crystal structure of non-myristoylated recoverin at 1.45 a resolution with calcium bound to ef-hand 3
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
192
structure length
192
Chain Sequence
GALSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A highly conserved cysteine of neuronal calcium-sensing proteins controls cooperative binding of Ca2+ to recoverin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
molecule keywords Recoverin
total genus 78
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2013-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4mlwA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4mlwA01
1DJIA 2G9BA 1TIZA 1PSRA 3JTDC 4OKHA 3LK1A 1J7RA 1OMVA 2JNFA 2Y1MA 4MVFA 5ER4X 3TS5B 2RGIA 2PRUA 2L51A 3K21A 4GPLB 4JPZB 4A4BA 1QV0A 1DJZA 1CDLA 4GGFC 2BKIB 5CSFA 1HT9A 2ZNDA 1B8CA 1WLZA 1M46A 1SR6B 2LV7A 4NDDA 3TDZA 1F54A 3D0YB 2SCPA 2EC6C 3LCPC 1KSMA 1TNPA 2LANA 1MXEA 4N1GA 1FI6A 1PALA 2K2AA 3BUMB 3DF0A 4FTGA 1J7PA 1NYAA 4MZLA 3JVTB 2KI6D 1XFWO 1K2HA 1CFCA 5ER5A 1G8IA 2KGRA 1CMGA 1N65A 1ZFSA 1A2XA 2CXJA 3TUYB 2V53A 2LLSA 2FOTA 2BCAA 3LL8B 1OOJA 2M29A 1BF5A 1YVHA 2HETA 4E68A 1MF8B 1WDCC 1SMGA 1IG5A 1W7JB 4JQ0D 2JT3A 5D7FA 5HKYA 4PHKA 2F33A 2GGMA 4PE1A 5DKRA 4CIDA 2JOJA 3FWBA 4PE0A 2O60A 3LLEA 4MN0A 1DF0A 1XFUO 3DVKA 4MLWA 1FBVA 3CZTX 3GOFA 3I5IB 5AERA 3I5GB 1S6JA 1B7TZ 1YRTB 4M2QA 2ZN9A 3D10A 1EG3A 3VRRA 1JFKA 4A4CA 3KPXA 2WCEA 1KWOC 1OMDA 4R1EA 3CR4X 1DJYA 2WCFA 1CKKA 1J1EA 1CFDA 4HRGA 1OZSA 1YX8A 2I94A 2KHNA 3PM8A 1QXPA 4AOMA 2MRDA 1MQ1A 1DGVA 1KSOA 3NSKA 3AKBA 4N5XA 3WHUB 1UWOA 2KFGA 2LVVA 1SPYA 4MZJA 1G4YR 1F55A 2L0PA 4YI9A 5HLOA 1QX7A 2KI6C 3WNXB 1XA5A 4YGCB 4AQJA 2LVIA 1WRLA 1L7ZA 4XJKA 4QJ3B 2KFFA 1Y0VH 1QS7A 3E3RA 2JNXA 1ZUZA 3F45A 1AUIB 1XVJA 3SG3A 1B47A 2LCPA 3BOWA 1ZMZA 3WXAA 1NWDA 3PLFB 4HREE 1CDNA 3NSIA 1XFXO 3RM1A 2A4JA 1B8LA 4GUKA 1DJWA 1SRAA 1NCYA 5JJGA 3PSRA 1ALWA 2L4HA 1PK0D 3OP0A 4XYNA 1QIVA 3VRPA 1KQMB 4M2OA 1QLSA 1RK9A 5IBWA 3I5HB 3I5HC 1IRJA 4ORAB 3NSOA 4GAOA 2K2FA 1NX3A 1SCMC 2JZIA 2FCEA 1K90D 2FCDA 4ORBB 1X02A 1Q80A 3JVTC 1BG1A 2M49B 2Q91A 2I18A 1SL8A 2EC6B 1MR8A 1WLMA 2KDHA 4PHJA 3EVUA 2K61A 1DF0B 1WRKA 2M0RA 1BLQA 2K7BA 1BR4B 5TNCA 3PALA 4BY4A 1JFJA 3KO0A 2WORA 1NP8A 2LMUA 4ZCVA 1YR5A 1YX7A 2MLFC 3FIAA 5J3XA 2LHIA 1SW8A 2OPOA 4YGAA 1IQ5A 1AVSA 2LAPA 2ZRSA 5BPJA 2KAXA 1TCOB 2KBMA 4PE7A 1MHOA 5CSNA 1BMOA 1VRKA 2L2EA 4Q04A 3BUXB 4I5JA 4GGNA 5AANA 1F71A 4GBAA 1F4OA 1U5IB 4C0KA 1SK6D 2JWWA 1TNWA 3AAKA 1IJ6A 2KYFA 3I5IC 3CR5X 3I5FB 4L9MA 2LHLA 1OZOA 2AAOA 2KBIA 2GGZA 4PE4A 2H61C 1DMOA 1KFXL 1B4CA 1NCXA 2JQ6A 1YTZC 1B7TY 1V1GA 2K7OA 2BBNA 3M0WA 4XJKB 2M1KB 3SG6A 1K96A 1CFPA 3TDUA 2LNKA 1IWQA 3OX5A 4WQ2A 3SG4A 1QVIZ 2WCBA 2B1UA 2MBXA 2E6WA 1SCMB 1RJVA 4DIRA 1IH0A 4PHNA 4MEWA 3VGOA 2R2IA 1C7VA 5CSJA 1LVCD 1QJTA 2BECA 2I7AA 3O4YA 5AXIA 3NSLA 4I5KA 1PSBA 1FW4A 3GK2A 3H4SE 3PATA 1KK8B 3O78A 1WY9A 1JUOA 2OS8C 1CFFA 1KWOB 4P5OE 3IQOA 2OTGC 2SASA 2JPTA 1DJHA 1NIWA 3DVMA 1B8RA 1EG4A 3VROA 2LP2A 4JWQA 2JULA 1M31A 1YUTA 1XFVO 1J55A 1B9AA 2MLEC 5CPVA 4MSPA 2BE6A 1BU3A 4YI8A 1OE9B 2NCOA 2KGBC 2LMTA 3AKAA 1CLMA 1DGUA 1YVLA 1UURA 1V1FA 2VRGA 2F2PA 2M97A 3PN7C 4HRHA 1G33A 3BUWB 2LLTA 1LKJA 1KFUL 3BOWB 5I2OA 2H61A 1LINA 1MWNA 1K94A 3HX4A 4NDBA 2PSRA 1Y1XA 3BUOB 1RFJA 4C0JA 2GV5A 4OV2A 2EGDA 2F8PA 3PN7B 4MZKA 1KCYA 2ZKMX 1ALVA 1XYDA 1DJXA 3BYAA 2O5GA 3BUNB 3BQ3A 5HLVA 5HKZA 5I2QA 3AAJA 3CWGA 1YRUB 1BJFA 1A75A 1BR1B 1EH2A 1FPWA 2F3ZA 1TTXA 3C1VA 4I5LB 1S5GZ 2EHBA 4U8DA 3LK0A 1ZACA 3D0YA 1NPQA 1NUBA 1S3PA 2CCMA 1SL9A 4YGDB 1CLBA 1EXRA 2K0JA 2JTTA 1DJGA 1A75B 1TNXA 1CB1A 5FYXA 1NSHA 1TOPA 3KHEA 1NCZA 2KNEA 4CPVA 5AFPA 1A03A 5K89A 1NX0A 2WNDA 2M1UA 5AEQA 2M9GA 3EKHA 1UHIA 1CDMA 1RECA 2LVKA 3SG7A 4ORCB 2KQYA 1LA3A 5JOLA 3I5FC 1AJ5A 4TNCA 4AQIA 4NDCA 4NQGA 1KFXS 4DUQA 1IQ3A 1B1GA 1PVBA 3CS1A 2M3WA 2NXQA 2KYCA 3SJSA 3TS5C 2M7NA 3HCMA 1NX1A 4WQ3A 1S5GY 3IF7A 1YURA 1M63B 2MJWB 3RLZA 1YUUA 2HPSA 1BODA 2CBLA 1D1OA 1PVAA 5I2LA 2PASA 2DOQA 2LLUA 1RWYA 3OB1B 1SY9A 1AJ4A 1XFZO 1CNPA 2L5XB 1H8BA 1TN4A 1K8UA 4CLNA 1CM4A 1N0YA 2PALA 4D1EA 1HQVA 1XK4C 1F70A 4MRXA 1JC2A 2TN4A 3CR2A 3I5GC 4CFQA 4YGBB 4MBEA 1KK8C 1RTP1 2KQ6A 1CTRA 5B8IB 2LC5A 1KQVA 1M45A 4GNKB 4PHMA 1DTLA 1S26D 1W7IB 1QX2A 2COLB 2JXCA 3OX6A 1H4BA 5F6TA 2KOTA 2JU0A 2QPTA 4OR9B 2F2OA 1JF2A 2OS8B 2H2KA 1JSAA 1CDPA 2L4IA 4FQOA 3ZWHA 1J7OA 3DF0B 3QRXA 3A4UB 2KI4C 1KFUS 2Y4QA 1MUXA 3TUYC 1E8AA 3TDIA 1KQMC 4BY5A 1L2OC 1QTXA 2F3YA 1JF0A 1IJ5A 1S1EA 1A4PA 2MHHA 1KK7Z 1OQPA 1Y6WA 4USLA 4M2PA 2BKHB 1UHKA 5CSIA 1SR6C 1FI5A 1Y1AA 3DVJA 4QJ4B 1UHNA 2NZ0A 3IQQA 1QLKA 3O2PA 2BCBA 1CLLA 3EK8A 1S6IA 3OHMB 4PALA 2LP3A 1A29A 3FWCA 2L50A 4F0ZB 1GGWA 2JRFA 2CTNA 2CT9A 1DT7B 4IL1A 3GK4X 2BBMA 1BT6A 2LM5A 1BOCA 3A8RA 4YGEB 2D8NA 1SNLA 3TZ1A 4HSZA 2KFHA 4ETOA 2ZNEA 1SCVA 3EKJA 3VRQA 1UP5A 1QIWA 3EVVA 2AUCA 1WRZA 3KEVA 3EVRA 1K95A 1N2DA 1IKUA 2M7LA 3O6BA 3CGAA 3GK1A 1MXLC 2Q4UA 1XK4A 1R2UA 3EK7A 4WRIA 2G2BA 4ZCUA 4OCIA 2KI4B 1M39A 1CMFA 3DD4A 1YUSA 1RROA 2JT0A 1PULA 1SYMA 4YBHB 1OMRA 1TCFA 1K93D 2HQWA 2AMIA 2BE4A 3SG5A 1R6PA 2HF5A 1S36A 1UHHA 4GFTA 5HKWA 5I8NA 2IS9A 2M8UA 1AP4A 1XFYO 2KAYA 2NCPA 3CTNA 2LE9B 2LUCA 2P6BB 2WC8A 5DKNA 2E30A 2BL0C 4I5NB 3ZNIA 1K9KA 1K9PA 1S6CA 1QATA 5KTYA 2CNPA 4DRWA 1QV1A 2LVJA 1K9UA 1EJ3A 1XO5A 5G08A 1QX5B 1Y1UA 3FS7A 1UUSA 4ICBA 2JXLA 2HQ8A 4DCKA 1GQMA 3JTDB 2BL0B 3PFVA 1J7QA 2K8MB 3CLNA 4CFRA 1GGZA 2FJUB 2I2RE 2LMVA 1GJYA 4UPGA 1IGVA 1LA0A 1C07A 2PVBA 4C0LA 2K7DA 2PMYA 3DVEA 1KK7Y 1JBAA 3EK4A 3VRNA 2JC2A 2KAVA 5DKQA 3NXAA 5PALA 3ICBA 3SIAA 2KSPA 4N1FA 2ZRTA 1JWDA 5GQQC 1OSAA 1U5IA 1AK8A 1CM1A 1TRFA 1SKTA 4QJ5B 2L98A 4DS7A 3BXKA 1SL7A 1PRWA 1QASA 2ISDA 1NX2A 4P2YB 4PCWA 1DVIA 1UHJA 1QVIY 2Y5IA 2OTGB 5KSZA 1F8HA 2JT8A 1J1DA 1LXFC 2ZFDA 3SIBA 2MA2A 2QACA 2K7CA 1SBJA 1AHRA 4GGFA 5D69A 4PDZA 5KU1A 2MAZA 3OB2B 2LUXA 1F4QA 1TNQA 4MRYA 2JTZA 1FF1A 4YRUA 5HYDA 1WDCB 2Y1NA 3KF9A 1ZOTB 3WHTB 2NLNA 4OVNF 3MSEB 1ODBA 1C7WA 2ZN8A 2WOSA 3SG2A 1L2OB 1EL4A 2BCXA
chains in the Genus database with same CATH superfamily
3PM2A 1DJIA 2G9BA 1TIZA 1PSRA 3JTDC 4OKHA 3LK1A 1J7RA 1OMVA 2JNFA 2Y1MA 4MVFA 1TWOA 5ER4X 3TS5B 2RGIA 2PRUA 5I94A 2L51A 3K21A 1T14A 3IVTA 4GPLB 4JPZB 4A4BA 1QV0A 1DJZA 1CDLA 4GGFC 2BKIB 5CSFA 1HT9A 2ZNDA 1B8CA 1WLZA 1M46A 1SR6B 2LV7A 4NDDA 3TDZA 2KLEA 1F54A 3O4XA 3D0YB 2SCPA 2EC6C 3LCPC 1KSMA 1TNPA 2LANA 1MXEA 1DC1A 4N1GA 1FI6A 1PALA 2K2AA 3BUMB 3DF0A 4FTGA 5DICA 2PQLA 1J7PA 1NYAA 4MZLA 3JVTB 2KI6D 1XFWO 1K2HA 1CFCA 5ER5A 1G8IA 2KGRA 1CMGA 1N65A 1QWVA 1ZFSA 1A2XA 2CXJA 3TUYB 2V53A 2LLSA 2FOTA 2BCAA 3LL8B 1OOJA 2M29A 3FE6A 1BF5A 1YVHA 2HETA 4E68A 2QEHA 1MF8B 1WDCC 1SMGA 1IG5A 1W7JB 4JQ0D 2JT3A 5D7FA 5HKYA 4PHKA 2L5YA 2F33A 2GGMA 4PE1A 5DKRA 4CIDA 2JOJA 3FWBA 4PE0A 2O60A 3LLEA 4MN0A 3OBVA 1DF0A 5FI6A 1XFUO 3Q8IA 4OZDA 3DVKA 4MLWA 1FBVA 3CZTX 3GOFA 3S0DA 3I5IB 5AERA 3I5GB 1S6JA 1B7TZ 1YRTB 4M2QA 2ZN9A 3D10A 1EG3A 3VRRA 1JFKA 4A4CA 3KPXA 2WCEA 1KWOC 1OMDA 4R1EA 1DELA 1DJYA 2WCFA 3CR4X 1J1EA 3UO9A 1CKKA 1CFDA 4HRGA 1OZSA 1YX8A 2GTEA 2I94A 2KHNA 3PM8A 1QXPA 4AOMA 2MRDA 1MQ1A 1DGVA 1KSOA 3NSKA 1Z4HA 3AKBA 4N5XA 3WHUB 1UWOA 2KFGA 2LVVA 1SPYA 4MZJA 1G4YR 1F55A 2L0PA 4YI9A 5HLOA 1QX7A 2KI6C 3WNXB 1XA5A 4YGCB 3D73A 4AQJA 2LVIA 1WRLA 1L7ZA 4XJKA 4QJ3B 2KFFA 2PYQA 1Y0VH 4JKTA 1QS7A 3E3RA 2JNXA 1ZUZA 3F45A 1AUIB 1IIOA 1XVJA 3CDNA 3SG3A 1B47A 2LCPA 3BOWA 2WCJA 1ZMZA 3BFAA 3WXAA 1TUZA 1NWDA 3PLFB 4HREE 1CDNA 3NSIA 1XFXO 3RM1A 2A4JA 2P71A 1B8LA 3B86A 4GUKA 2FJYA 1DJWA 1SRAA 1NCYA 5JJGA 3PSRA 1ALWA 2L4HA 3L47A 1PK0D 3OP0A 4XYNA 1QIVA 3CABA 3VRPA 3S0BA 1OOIX 1KQMB 4M2OA 2WCMA 3NHTA 1QLSA 1RK9A 5IBWA 3I5HB 4F7FA 3I5HC 4IJ7A 1IRJA 1XFRA 4ORAB 3NSOA 4GAOA 2K2FA 1NX3A 1SCMC 2JZIA 2FCEA 1K90D 2FCDA 4ORBB 1X02A 1Q80A 3JVTC 3D74A 2M49B 2Q91A 1BG1A 2I18A 1SL8A 2EC6B 1MR8A 1WLMA 2KDHA 4PHJA 3EVUA 2H8VA 1DF0B 2K61A 1WRKA 5HL1A 2M0RA 1BLQA 2K7BA 1BR4B 2JPOA 5TNCA 3PALA 4BY4A 1JFJA 3KO0A 2WORA 1NP8A 2LMUA 4FQTA 1YR5A 1YX7A 2MLFC 3FIAA 4ZCVA 2LHIA 1SW8A 3DZTA 5J3XA 2OPOA 4YGAA 1IQ5A 1AVSA 2LAPA 2ZRSA 5BPJA 2KAXA 1TCOB 2KBMA 4PE7A 1MHOA 5CSNA 1BMOA 1VRKA 2L2EA 4Q04A 3BUXB 3D77A 4GGNA 4I5JA 5AANA 1F71A 4GBAA 1F4OA 1U5IB 4C0KA 1SK6D 2JWWA 1TNWA 3AAKA 1IJ6A 2KYFA 3R1OA 3I5IC 3CR5X 3EG5B 3I5FB 3R72A 4L9MA 2LHLA 1OZOA 2AAOA 2KBIA 2GGZA 4PE4A 2H61C 1DMOA 1KFXL 1B4CA 1C3YA 1Z2CB 1NCXA 2JQ6A 1YTZC 1B7TY 1V1GA 2K7OA 2BBNA 3BFBA 1P28A 3M0WA 4XJKB 2M1KB 3SG6A 1K96A 1CFPA 3TDUA 2LNKA 1IWQA 1TUJA 3OX5A 4WQ2A 3SG4A 1QVIZ 2WCBA 2B1UA 2MBXA 2E6WA 1SCMB 1GM0A 1RJVA 4DIRA 1IH0A 4PHNA 4MEWA 3VGOA 2R2IA 1C7VA 5CSJA 1LVCD 1QJTA 2BECA 2I7AA 2KPHA 3O4YA 3VB1A 5AXIA 3NSLA 4I5KA 1PSBA 1FW4A 3GK2A 3H4SE 3PATA 1KK8B 3O78A 1WY9A 1JUOA 2OS8C 1CFFA 1KWOB 3DY9A 4P5OE 3RZSA 3IQOA 2OTGC 2SASA 2JPTA 1DJHA 1NIWA 3DVMA 1B8RA 1EG4A 3VROA 3SS3A 2L2CA 2LP2A 3FE9A 2WCLA 4JWQA 2JULA 1M31A 1YUTA 1XFVO 3B87A 1J55A 1B9AA 2MLEC 5CPVA 4MSPA 2BE6A 1BU3A 4YI8A 1OE9B 2NCOA 2KGBC 1DEKA 2LMTA 3AKAA 3DYEA 1CLMA 1DGUA 1YVLA 1UURA 1V1FA 2VRGA 2F2PA 2M97A 3PN7C 4HRHA 1G33A 3BUWB 2LLTA 1LKJA 1KFUL 3BOWB 5I2OA 4INWA 2H61A 1LINA 1MWNA 1K94A 3HX4A 4KYNA 4NDBA 2PSRA 1Y1XA 3BUOB 1RFJA 4C0JA 2GV5A 4OV2A 2EGDA 2F8PA 3PN7B 4MZKA 1KCYA 2ZKMX 1ALVA 1XYDA 1DJXA 3BYAA 1ORGA 2O5GA 3BUNB 3BQ3A 5HLVA 5HKZA 5I2QA 3AAJA 3CWGA 3NHIA 1YRUB 1BJFA 1A75A 1BR1B 2QEVA 1EH2A 1FPWA 2F3ZA 1TTXA 3C1VA 4I5LB 1S5GZ 2EHBA 4U8DA 3LK0A 1ZACA 3D0YA 1NPQA 1NUBA 1S3PA 2CCMA 1SL9A 4YGDB 1CLBA 1EXRA 2K0JA 2JTTA 1DJGA 1A75B 1TNXA 1CB1A 5FYXA 2WC6A 1NSHA 1TOPA 3KHEA 1NCZA 2KNEA 4CPVA 5AFPA 1A03A 5K89A 1NX0A 2WNDA 2M1UA 5AEQA 2M9GA 3EKHA 1UHIA 1CDMA 1RECA 2LVKA 3SG7A 4ORCB 2KQYA 3NGVA 1LA3A 5JOLA 3I5FC 5EL2A 1AJ5A 4TNCA 4AQIA 4JD9A 4NDCA 4NQGA 1DQEA 1KFXS 4DUQA 1IQ3A 1B1GA 1PVBA 3CS1A 2M3WA 2NXQA 2KYCA 5D3OA 3CZ2A 3SJSA 3TS5C 2BAPA 2M7NA 3HCMA 1NX1A 4WQ3A 1S5GY 3IF7A 1YURA 3L4AA 1M63B 2MJWB 3RLZA 1YUUA 2HPSA 1BODA 2CBLA 1D1OA 1PVAA 3B7AA 2PASA 5I2LA 2DOQA 2LLUA 1RWYA 3OB1B 1SY9A 1AJ4A 1XFZO 1CNPA 2BNXA 2L5XB 1H8BA 1TN4A 1K8UA 4CLNA 1CM4A 1N0YA 2PALA 4D1EA 1HQVA 1XK4C 1F70A 3D76A 4MRXA 3UNWA 1JC2A 2TN4A 3CR2A 3I5GC 4CFQA 4YGBB 4MBEA 1KK8C 1RTP1 3CYZA 2KQ6A 1CTRA 5B8IB 3B6XA 2LC5A 3S0GA 1KQVA 1M45A 4GNKB 4PHMA 1DTLA 1S26D 1W7IB 1QX2A 2COLB 2JXCA 3OX6A 1H4BA 5F6TA 3PJIA 2KOTA 2JU0A 1W9ZA 2QPTA 4OR9B 2QEOA 2F2OA 1JF2A 1OW4A 2OS8B 2H2KA 1JSAA 1CDPA 2L4IA 3L4LA 4FQOA 2QDIA 3ZWHA 1J7OA 3DF0B 3QRXA 5FI2A 3A4UB 2KI4C 1KFUS 2Y4QA 2YGUA 3V2LA 1MUXA 3TUYC 1E8AA 3D75A 1KQMC 3TDIA 3CZ0A 2P70A 4BY5A 3DXLA 1L2OC 1OOHA 1QTXA 2F3YA 1JF0A 1IJ5A 1S1EA 1A4PA 2MHHA 1KK7Z 1OQPA 1Y6WA 4USLA 4M2PA 2BKHB 1UHKA 5CSIA 1SR6C 1FI5A 1Y1AA 3DVJA 4QJ4B 1UHNA 2NZ0A 3IQQA 1QLKA 3O2PA 2BCBA 1CLLA 5FI7A 3EK8A 1S6IA 3OHMB 4PALA 2LP3A 1A29A 3FWCA 2L50A 4F0ZB 1GGWA 2JRFA 2CTNA 2CT9A 2WCHA 4IL1A 3GK4X 2BBMA 1BT6A 2LM5A 1DT7B 3A8RA 2WCKA 1BOCA 4YGEB 2D8NA 1OOFA 1SNLA 3R1VA 3TZ1A 4HSZA 2KFHA 4ETOA 2ZNEA 1SCVA 3EKJA 3VRQA 1UP5A 1QIWA 3B88A 2AUCA 3EVVA 1WRZA 3KEVA 3N7HA 4PT1A 3EVRA 1K95A 1N2DA 1IKUA 2M7LA 3O6BA 3CGAA 3GK1A 1MXLC 2Q4UA 1XK4A 3S0FA 1R2UA 3EK7A 4WRIA 2G2BA 4ZCUA 4OCIA 2KI4B 1M39A 1CMFA 3DD4A 1YUSA 1RROA 2JT0A 1PULA 1SYMA 4YBHB 1OMRA 1TCFA 1K93D 1SSEB 2AMIA 2BE4A 2HQWA 1R6PA 2HF5A 1S36A 3SG5A 1UHHA 4GFTA 5HKWA 5I8NA 2IS9A 2M8UA 2ERBA 3R1PA 1AP4A 1XFYO 2KAYA 2NCPA 3CTNA 2LE9B 3BFHA 2LUCA 2P6BB 2WC8A 5DKNA 2E30A 2BL0C 4I5NB 3ZNIA 1K9KA 1K9PA 1S6CA 1QATA 5KTYA 2CNPA 4DRWA 1QV1A 2LVJA 2K60A 1K9UA 1EJ3A 1XO5A 5G08A 1QX5B 1LS8A 1Y1UA 3FS7A 3S0EA 1UUSA 3D78A 4ICBA 1C3ZA 2JXLA 2HQ8A 4DCKA 1GQMA 3JTDB 2BL0B 3PFVA 1J7QA 2K8MB 3CLNA 4CFRA 1GGZA 2FJUB 2I2RE 2LMVA 1GJYA 4UPGA 1IGVA 1LA0A 3SS5A 1C07A 2PVBA 4C0LA 2K7DA 2PMYA 3DVEA 1KK7Y 1JBAA 3EK4A 3K1EA 3OGNA 3QMEA 3VRNA 2JC2A 2KAVA 5DKQA 3NXAA 5PALA 3ICBA 3SIAA 2KSPA 4N1FA 2ZRTA 1JWDA 5GQQC 1OSAA 3CZ1A 1U5IA 1AK8A 1CM1A 1TRFA 1SKTA 3SS4A 4QJ5B 2L98A 4DS7A 3BXKA 1SL7A 1PRWA 1QASA 2ISDA 1NX2A 4P2YB 4PCWA 1DVIA 1UHJA 3S0AA 1QVIY 2Y5IA 2OTGB 5KSZA 1F8HA 2JT8A 1J1DA 1LXFC 2ZFDA 3SIBA 3BJHA 2QEBA 2MA2A 2QACA 2K7CA 1SBJA 1AHRA 4GGFA 5D69A 4PDZA 5KU1A 2MAZA 3OB2B 3FE8A 2LUXA 2KLDA 1F4QA 1TNQA 4MRYA 2JTZA 1FF1A 4YRUA 5HYDA 1WDCB 2Y1NA 3KF9A 1ZOTB 3WHTB 2NLNA 4OVNF 3MSEB 1ODBA 1C7WA 4INXA 2ZN8A 2WOSA 2WC5A 3SG2A 1L2OB 1EL4A 1OOGA 2BCXA
chains in the Genus database with same CATH topology
1DJIA 2G9BA 1TIZA 1PSRA 3JTDC 4OKHA 3LK1A 1J7RA 1OMVA 2JNFA 2Y1MA 4MVFA 5ER4X 3TS5B 2RGIA 2PRUA 2L51A 3K21A 4GPLB 4JPZB 4A4BA 1QV0A 1DJZA 1CDLA 4GGFC 2BKIB 5CSFA 1HT9A 2ZNDA 1B8CA 1WLZA 1M46A 1SR6B 2LV7A 4NDDA 3TDZA 1F54A 3D0YB 2SCPA 2EC6C 3LCPC 1KSMA 1TNPA 2LANA 1MXEA 4N1GA 1FI6A 1PALA 2K2AA 3BUMB 3DF0A 4FTGA 1J7PA 1NYAA 4MZLA 3JVTB 2KI6D 1XFWO 1K2HA 1CFCA 5ER5A 1G8IA 2KGRA 1CMGA 1N65A 1ZFSA 1A2XA 2CXJA 3TUYB 2V53A 2LLSA 2FOTA 2BCAA 3LL8B 1OOJA 2M29A 1BF5A 1YVHA 2HETA 4E68A 1MF8B 1WDCC 1SMGA 1IG5A 1W7JB 4JQ0D 2JT3A 5D7FA 5HKYA 4PHKA 2F33A 2GGMA 4PE1A 5DKRA 4CIDA 2JOJA 3FWBA 4PE0A 2O60A 3LLEA 4MN0A 1DF0A 1XFUO 3DVKA 4MLWA 1FBVA 3CZTX 3GOFA 3I5IB 5AERA 3I5GB 1S6JA 1B7TZ 1YRTB 4M2QA 2ZN9A 3D10A 1EG3A 3VRRA 1JFKA 4A4CA 3KPXA 2WCEA 1KWOC 1OMDA 4R1EA 3CR4X 1DJYA 2WCFA 1CKKA 1J1EA 1CFDA 4HRGA 1OZSA 1YX8A 2I94A 2KHNA 3PM8A 1QXPA 4AOMA 2MRDA 1MQ1A 1DGVA 1KSOA 3NSKA 3AKBA 4N5XA 3WHUB 1UWOA 2KFGA 2LVVA 1SPYA 4MZJA 1G4YR 1F55A 2L0PA 4YI9A 5HLOA 1QX7A 2KI6C 3WNXB 1XA5A 4YGCB 4AQJA 2LVIA 1WRLA 1L7ZA 4XJKA 4QJ3B 2KFFA 1Y0VH 1QS7A 3E3RA 2JNXA 1ZUZA 3F45A 1AUIB 1XVJA 3SG3A 1B47A 2LCPA 3BOWA 1ZMZA 3WXAA 1NWDA 3PLFB 4HREE 1CDNA 3NSIA 1XFXO 3RM1A 2A4JA 1B8LA 4GUKA 1DJWA 1SRAA 1NCYA 5JJGA 3PSRA 1ALWA 2L4HA 1PK0D 3OP0A 4XYNA 1QIVA 3VRPA 1KQMB 4M2OA 1QLSA 1RK9A 5IBWA 3I5HB 3I5HC 1IRJA 4ORAB 3NSOA 4GAOA 2K2FA 1NX3A 1SCMC 2JZIA 2FCEA 1K90D 2FCDA 4ORBB 1X02A 1Q80A 3JVTC 1BG1A 2M49B 2Q91A 2I18A 1SL8A 2EC6B 1MR8A 1WLMA 2KDHA 4PHJA 3EVUA 2K61A 1DF0B 1WRKA 2M0RA 1BLQA 2K7BA 1BR4B 5TNCA 3PALA 4BY4A 1JFJA 3KO0A 2WORA 1NP8A 2LMUA 4ZCVA 1YR5A 1YX7A 2MLFC 3FIAA 5J3XA 2LHIA 1SW8A 2OPOA 4YGAA 1IQ5A 1AVSA 2LAPA 2ZRSA 5BPJA 2KAXA 1TCOB 2KBMA 4PE7A 1MHOA 5CSNA 1BMOA 1VRKA 2L2EA 4Q04A 3BUXB 4I5JA 4GGNA 5AANA 1F71A 4GBAA 1F4OA 1U5IB 4C0KA 1SK6D 2JWWA 1TNWA 3AAKA 1IJ6A 2KYFA 3I5IC 3CR5X 3I5FB 4L9MA 2LHLA 1OZOA 2AAOA 2KBIA 2GGZA 4PE4A 2H61C 1DMOA 1KFXL 1B4CA 1NCXA 2JQ6A 1YTZC 1B7TY 1V1GA 2K7OA 2BBNA 3M0WA 4XJKB 2M1KB 3SG6A 1K96A 1CFPA 3TDUA 2LNKA 1IWQA 3OX5A 4WQ2A 3SG4A 1QVIZ 2WCBA 2B1UA 2MBXA 2E6WA 1SCMB 1RJVA 4DIRA 1IH0A 4PHNA 4MEWA 3VGOA 2R2IA 1C7VA 5CSJA 1LVCD 1QJTA 2BECA 2I7AA 3O4YA 5AXIA 3NSLA 4I5KA 1PSBA 1FW4A 3GK2A 3H4SE 3PATA 1KK8B 3O78A 1WY9A 1JUOA 2OS8C 1CFFA 1KWOB 4P5OE 3IQOA 2OTGC 2SASA 2JPTA 1DJHA 1NIWA 3DVMA 1B8RA 1EG4A 3VROA 2LP2A 4JWQA 2JULA 1M31A 1YUTA 1XFVO 1J55A 1B9AA 2MLEC 5CPVA 4MSPA 2BE6A 1BU3A 4YI8A 1OE9B 2NCOA 2KGBC 2LMTA 3AKAA 1CLMA 1DGUA 1YVLA 1UURA 1V1FA 2VRGA 2F2PA 2M97A 3PN7C 4HRHA 1G33A 3BUWB 2LLTA 1LKJA 1KFUL 3BOWB 5I2OA 2H61A 1LINA 1MWNA 1K94A 3HX4A 4NDBA 2PSRA 1Y1XA 3BUOB 1RFJA 4C0JA 2GV5A 4OV2A 2EGDA 2F8PA 3PN7B 4MZKA 1KCYA 2ZKMX 1ALVA 1XYDA 1DJXA 3BYAA 2O5GA 3BUNB 3BQ3A 5HLVA 5HKZA 5I2QA 3AAJA 3CWGA 1YRUB 1BJFA 1A75A 1BR1B 1EH2A 1FPWA 2F3ZA 1TTXA 3C1VA 4I5LB 1S5GZ 2EHBA 4U8DA 3LK0A 1ZACA 3D0YA 1NPQA 1NUBA 1S3PA 2CCMA 1SL9A 4YGDB 1CLBA 1EXRA 2K0JA 2JTTA 1DJGA 1A75B 1TNXA 1CB1A 5FYXA 1NSHA 1TOPA 3KHEA 1NCZA 2KNEA 4CPVA 5AFPA 1A03A 5K89A 1NX0A 2WNDA 2M1UA 5AEQA 2M9GA 3EKHA 1UHIA 1CDMA 1RECA 2LVKA 3SG7A 4ORCB 2KQYA 1LA3A 5JOLA 3I5FC 1AJ5A 4TNCA 4AQIA 4NDCA 4NQGA 1KFXS 4DUQA 1IQ3A 1B1GA 1PVBA 3CS1A 2M3WA 2NXQA 2KYCA 3SJSA 3TS5C 2M7NA 3HCMA 1NX1A 4WQ3A 1S5GY 3IF7A 1YURA 1M63B 2MJWB 3RLZA 1YUUA 2HPSA 1BODA 2CBLA 1D1OA 1PVAA 5I2LA 2PASA 2DOQA 2LLUA 1RWYA 3OB1B 1SY9A 1AJ4A 1XFZO 1CNPA 2L5XB 1H8BA 1TN4A 1K8UA 4CLNA 1CM4A 1N0YA 2PALA 4D1EA 1HQVA 1XK4C 1F70A 4MRXA 1JC2A 2TN4A 3CR2A 3I5GC 4CFQA 4YGBB 4MBEA 1KK8C 1RTP1 2KQ6A 1CTRA 5B8IB 2LC5A 1KQVA 1M45A 4GNKB 4PHMA 1DTLA 1S26D 1W7IB 1QX2A 2COLB 2JXCA 3OX6A 1H4BA 5F6TA 2KOTA 2JU0A 2QPTA 4OR9B 2F2OA 1JF2A 2OS8B 2H2KA 1JSAA 1CDPA 2L4IA 4FQOA 3ZWHA 1J7OA 3DF0B 3QRXA 3A4UB 2KI4C 1KFUS 2Y4QA 1MUXA 3TUYC 1E8AA 3TDIA 1KQMC 4BY5A 1L2OC 1QTXA 2F3YA 1JF0A 1IJ5A 1S1EA 1A4PA 2MHHA 1KK7Z 1OQPA 1Y6WA 4USLA 4M2PA 2BKHB 1UHKA 5CSIA 1SR6C 1FI5A 1Y1AA 3DVJA 4QJ4B 1UHNA 2NZ0A 3IQQA 1QLKA 3O2PA 2BCBA 1CLLA 3EK8A 1S6IA 3OHMB 4PALA 2LP3A 1A29A 3FWCA 2L50A 4F0ZB 1GGWA 2JRFA 2CTNA 2CT9A 1DT7B 4IL1A 3GK4X 2BBMA 1BT6A 2LM5A 1BOCA 3A8RA 4YGEB 2D8NA 1SNLA 3TZ1A 4HSZA 2KFHA 4ETOA 2ZNEA 1SCVA 3EKJA 3VRQA 1UP5A 1QIWA 3EVVA 2AUCA 1WRZA 3KEVA 3EVRA 1K95A 1N2DA 1IKUA 2M7LA 3O6BA 3CGAA 3GK1A 1MXLC 2Q4UA 1XK4A 1R2UA 3EK7A 4WRIA 2G2BA 4ZCUA 4OCIA 2KI4B 1M39A 1CMFA 3DD4A 1YUSA 1RROA 2JT0A 1PULA 1SYMA 4YBHB 1OMRA 1TCFA 1K93D 2HQWA 2AMIA 2BE4A 3SG5A 1R6PA 2HF5A 1S36A 1UHHA 4GFTA 5HKWA 5I8NA 2IS9A 2M8UA 1AP4A 1XFYO 2KAYA 2NCPA 3CTNA 2LE9B 2LUCA 2P6BB 2WC8A 5DKNA 2E30A 2BL0C 4I5NB 3ZNIA 1K9KA 1K9PA 1S6CA 1QATA 5KTYA 2CNPA 4DRWA 1QV1A 2LVJA 1K9UA 1EJ3A 1XO5A 5G08A 1QX5B 1Y1UA 3FS7A 1UUSA 4ICBA 2JXLA 2HQ8A 4DCKA 1GQMA 3JTDB 2BL0B 3PFVA 1J7QA 2K8MB 3CLNA 4CFRA 1GGZA 2FJUB 2I2RE 2LMVA 1GJYA 4UPGA 1IGVA 1LA0A 1C07A 2PVBA 4C0LA 2K7DA 2PMYA 3DVEA 1KK7Y 1JBAA 3EK4A 3VRNA 2JC2A 2KAVA 5DKQA 3NXAA 5PALA 3ICBA 3SIAA 2KSPA 4N1FA 2ZRTA 1JWDA 5GQQC 1OSAA 1U5IA 1AK8A 1CM1A 1TRFA 1SKTA 4QJ5B 2L98A 4DS7A 3BXKA 1SL7A 1PRWA 1QASA 2ISDA 1NX2A 4P2YB 4PCWA 1DVIA 1UHJA 1QVIY 2Y5IA 2OTGB 5KSZA 1F8HA 2JT8A 1J1DA 1LXFC 2ZFDA 3SIBA 2MA2A 2QACA 2K7CA 1SBJA 1AHRA 4GGFA 5D69A 4PDZA 5KU1A 2MAZA 3OB2B 2LUXA 1F4QA 1TNQA 4MRYA 2JTZA 1FF1A 4YRUA 5HYDA 1WDCB 2Y1NA 3KF9A 1ZOTB 3WHTB 2NLNA 4OVNF 3MSEB 1ODBA 1C7WA 2ZN8A 2WOSA 3SG2A 1L2OB 1EL4A 2BCXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DJI A;  2G9B A;  1TIZ A;  1PSR A;  3JTD C;  4OKH A;  3LK1 A;  1J7R A;  1OMV A;  2JNF A;  2Y1M A;  4MVF A;  5ER4 X;  3TS5 B;  2RGI A;  2PRU A;  2L51 A;  3K21 A;  4GPL B;  4JPZ B;  4A4B A;  1QV0 A;  1DJZ A;  1CDL A;  4GGF C;  2BKI B;  5CSF A;  1HT9 A;  2ZND A;  1B8C A;  1WLZ A;  1M46 A;  1SR6 B;  2LV7 A;  4NDD A;  3TDZ A;  1F54 A;  3D0Y B;  2SCP A;  2EC6 C;  3LCP C;  1KSM A;  1TNP A;  2LAN A;  1MXE A;  4N1G A;  1FI6 A;  1PAL A;  2K2A A;  3BUM B;  3DF0 A;  4FTG A;  1J7P A;  1NYA A;  4MZL A;  3JVT B;  2KI6 D;  1XFW O;  1K2H A;  1CFC A;  5ER5 A;  1G8I A;  2KGR A;  1CMG A;  1N65 A;  1ZFS A;  1A2X A;  2CXJ A;  3TUY B;  2V53 A;  2LLS A;  2FOT A;  2BCA A;  3LL8 B;  1OOJ A;  2M29 A;  1BF5 A;  1YVH A;  2HET A;  4E68 A;  1MF8 B;  1WDC C;  1SMG A;  1IG5 A;  1W7J B;  4JQ0 D;  2JT3 A;  5D7F A;  5HKY A;  4PHK A;  2F33 A;  2GGM A;  4PE1 A;  5DKR A;  4CID A;  2JOJ A;  3FWB A;  4PE0 A;  2O60 A;  3LLE A;  4MN0 A;  1DF0 A;  1XFU O;  3DVK A;  4MLW A;  1FBV A;  3CZT X;  3GOF A;  3I5I B;  5AER A;  3I5G B;  1S6J A;  1B7T Z;  1YRT B;  4M2Q A;  2ZN9 A;  3D10 A;  1EG3 A;  3VRR A;  1JFK A;  4A4C A;  3KPX A;  2WCE A;  1KWO C;  1OMD A;  4R1E A;  3CR4 X;  1DJY A;  2WCF A;  1CKK A;  1J1E A;  1CFD A;  4HRG A;  1OZS A;  1YX8 A;  2I94 A;  2KHN A;  3PM8 A;  1QXP A;  4AOM A;  2MRD A;  1MQ1 A;  1DGV A;  1KSO A;  3NSK A;  3AKB A;  4N5X A;  3WHU B;  1UWO A;  2KFG A;  2LVV A;  1SPY A;  4MZJ A;  1G4Y R;  1F55 A;  2L0P A;  4YI9 A;  5HLO A;  1QX7 A;  2KI6 C;  3WNX B;  1XA5 A;  4YGC B;  4AQJ A;  2LVI A;  1WRL A;  1L7Z A;  4XJK A;  4QJ3 B;  2KFF A;  1Y0V H;  1QS7 A;  3E3R A;  2JNX A;  1ZUZ A;  3F45 A;  1AUI B;  1XVJ A;  3SG3 A;  1B47 A;  2LCP A;  3BOW A;  1ZMZ A;  3WXA A;  1NWD A;  3PLF B;  4HRE E;  1CDN A;  3NSI A;  1XFX O;  3RM1 A;  2A4J A;  1B8L A;  4GUK A;  1DJW A;  1SRA A;  1NCY A;  5JJG A;  3PSR A;  1ALW A;  2L4H A;  1PK0 D;  3OP0 A;  4XYN A;  1QIV A;  3VRP A;  1KQM B;  4M2O A;  1QLS A;  1RK9 A;  5IBW A;  3I5H B;  3I5H C;  1IRJ A;  4ORA B;  3NSO A;  4GAO A;  2K2F A;  1NX3 A;  1SCM C;  2JZI A;  2FCE A;  1K90 D;  2FCD A;  4ORB B;  1X02 A;  1Q80 A;  3JVT C;  1BG1 A;  2M49 B;  2Q91 A;  2I18 A;  1SL8 A;  2EC6 B;  1MR8 A;  1WLM A;  2KDH A;  4PHJ A;  3EVU A;  2K61 A;  1DF0 B;  1WRK A;  2M0R A;  1BLQ A;  2K7B A;  1BR4 B;  5TNC A;  3PAL A;  4BY4 A;  1JFJ A;  3KO0 A;  2WOR A;  1NP8 A;  2LMU A;  4ZCV A;  1YR5 A;  1YX7 A;  2MLF C;  3FIA A;  5J3X A;  2LHI A;  1SW8 A;  2OPO A;  4YGA A;  1IQ5 A;  1AVS A;  2LAP A;  2ZRS A;  5BPJ A;  2KAX A;  1TCO B;  2KBM A;  4PE7 A;  1MHO A;  5CSN A;  1BMO A;  1VRK A;  2L2E A;  4Q04 A;  3BUX B;  4I5J A;  4GGN A;  5AAN A;  1F71 A;  4GBA A;  1F4O A;  1U5I B;  4C0K A;  1SK6 D;  2JWW A;  1TNW A;  3AAK A;  1IJ6 A;  2KYF A;  3I5I C;  3CR5 X;  3I5F B;  4L9M A;  2LHL A;  1OZO A;  2AAO A;  2KBI A;  2GGZ A;  4PE4 A;  2H61 C;  1DMO A;  1KFX L;  1B4C A;  1NCX A;  2JQ6 A;  1YTZ C;  1B7T Y;  1V1G A;  2K7O A;  2BBN A;  3M0W A;  4XJK B;  2M1K B;  3SG6 A;  1K96 A;  1CFP A;  3TDU A;  2LNK A;  1IWQ A;  3OX5 A;  4WQ2 A;  3SG4 A;  1QVI Z;  2WCB A;  2B1U A;  2MBX A;  2E6W A;  1SCM B;  1RJV A;  4DIR A;  1IH0 A;  4PHN A;  4MEW A;  3VGO A;  2R2I A;  1C7V A;  5CSJ A;  1LVC D;  1QJT A;  2BEC A;  2I7A A;  3O4Y A;  5AXI A;  3NSL A;  4I5K A;  1PSB A;  1FW4 A;  3GK2 A;  3H4S E;  3PAT A;  1KK8 B;  3O78 A;  1WY9 A;  1JUO A;  2OS8 C;  1CFF A;  1KWO B;  4P5O E;  3IQO A;  2OTG C;  2SAS A;  2JPT A;  1DJH A;  1NIW A;  3DVM A;  1B8R A;  1EG4 A;  3VRO A;  2LP2 A;  4JWQ A;  2JUL A;  1M31 A;  1YUT A;  1XFV O;  1J55 A;  1B9A A;  2MLE C;  5CPV A;  4MSP A;  2BE6 A;  1BU3 A;  4YI8 A;  1OE9 B;  2NCO A;  2KGB C;  2LMT A;  3AKA A;  1CLM A;  1DGU A;  1YVL A;  1UUR A;  1V1F A;  2VRG A;  2F2P A;  2M97 A;  3PN7 C;  4HRH A;  1G33 A;  3BUW B;  2LLT A;  1LKJ A;  1KFU L;  3BOW B;  5I2O A;  2H61 A;  1LIN A;  1MWN A;  1K94 A;  3HX4 A;  4NDB A;  2PSR A;  1Y1X A;  3BUO B;  1RFJ A;  4C0J A;  2GV5 A;  4OV2 A;  2EGD A;  2F8P A;  3PN7 B;  4MZK A;  1KCY A;  2ZKM X;  1ALV A;  1XYD A;  1DJX A;  3BYA A;  2O5G A;  3BUN B;  3BQ3 A;  5HLV A;  5HKZ A;  5I2Q A;  3AAJ A;  3CWG A;  1YRU B;  1BJF A;  1A75 A;  1BR1 B;  1EH2 A;  1FPW A;  2F3Z A;  1TTX A;  3C1V A;  4I5L B;  1S5G Z;  2EHB A;  4U8D A;  3LK0 A;  1ZAC A;  3D0Y A;  1NPQ A;  1NUB A;  1S3P A;  2CCM A;  1SL9 A;  4YGD B;  1CLB A;  1EXR A;  2K0J A;  2JTT A;  1DJG A;  1A75 B;  1TNX A;  1CB1 A;  5FYX A;  1NSH A;  1TOP A;  3KHE A;  1NCZ A;  2KNE A;  4CPV A;  5AFP A;  1A03 A;  5K89 A;  1NX0 A;  2WND A;  2M1U A;  5AEQ A;  2M9G A;  3EKH A;  1UHI A;  1CDM A;  1REC A;  2LVK A;  3SG7 A;  4ORC B;  2KQY A;  1LA3 A;  5JOL A;  3I5F C;  1AJ5 A;  4TNC A;  4AQI A;  4NDC A;  4NQG A;  1KFX S;  4DUQ A;  1IQ3 A;  1B1G A;  1PVB A;  3CS1 A;  2M3W A;  2NXQ A;  2KYC A;  3SJS A;  3TS5 C;  2M7N A;  3HCM A;  1NX1 A;  4WQ3 A;  1S5G Y;  3IF7 A;  1YUR A;  1M63 B;  2MJW B;  3RLZ A;  1YUU A;  2HPS A;  1BOD A;  2CBL A;  1D1O A;  1PVA A;  5I2L A;  2PAS A;  2DOQ A;  2LLU A;  1RWY A;  3OB1 B;  1SY9 A;  1AJ4 A;  1XFZ O;  1CNP A;  2L5X B;  1H8B A;  1TN4 A;  1K8U A;  4CLN A;  1CM4 A;  1N0Y A;  2PAL A;  4D1E A;  1HQV A;  1XK4 C;  1F70 A;  4MRX A;  1JC2 A;  2TN4 A;  3CR2 A;  3I5G C;  4CFQ A;  4YGB B;  4MBE A;  1KK8 C;  1RTP 1;  2KQ6 A;  1CTR A;  5B8I B;  2LC5 A;  1KQV A;  1M45 A;  4GNK B;  4PHM A;  1DTL A;  1S26 D;  1W7I B;  1QX2 A;  2COL B;  2JXC A;  3OX6 A;  1H4B A;  5F6T A;  2KOT A;  2JU0 A;  2QPT A;  4OR9 B;  2F2O A;  1JF2 A;  2OS8 B;  2H2K A;  1JSA A;  1CDP A;  2L4I A;  4FQO A;  3ZWH A;  1J7O A;  3DF0 B;  3QRX A;  3A4U B;  2KI4 C;  1KFU S;  2Y4Q A;  1MUX A;  3TUY C;  1E8A A;  3TDI A;  1KQM C;  4BY5 A;  1L2O C;  1QTX A;  2F3Y A;  1JF0 A;  1IJ5 A;  1S1E A;  1A4P A;  2MHH A;  1KK7 Z;  1OQP A;  1Y6W A;  4USL A;  4M2P A;  2BKH B;  1UHK A;  5CSI A;  1SR6 C;  1FI5 A;  1Y1A A;  3DVJ A;  4QJ4 B;  1UHN A;  2NZ0 A;  3IQQ A;  1QLK A;  3O2P A;  2BCB A;  1CLL A;  3EK8 A;  1S6I A;  3OHM B;  4PAL A;  2LP3 A;  1A29 A;  3FWC A;  2L50 A;  4F0Z B;  1GGW A;  2JRF A;  2CTN A;  2CT9 A;  1DT7 B;  4IL1 A;  3GK4 X;  2BBM A;  1BT6 A;  2LM5 A;  1BOC A;  3A8R A;  4YGE B;  2D8N A;  1SNL A;  3TZ1 A;  4HSZ A;  2KFH A;  4ETO A;  2ZNE A;  1SCV A;  3EKJ A;  3VRQ A;  1UP5 A;  1QIW A;  3EVV A;  2AUC A;  1WRZ A;  3KEV A;  3EVR A;  1K95 A;  1N2D A;  1IKU A;  2M7L A;  3O6B A;  3CGA A;  3GK1 A;  1MXL C;  2Q4U A;  1XK4 A;  1R2U A;  3EK7 A;  4WRI A;  2G2B A;  4ZCU A;  4OCI A;  2KI4 B;  1M39 A;  1CMF A;  3DD4 A;  1YUS A;  1RRO A;  2JT0 A;  1PUL A;  1SYM A;  4YBH B;  1OMR A;  1TCF A;  1K93 D;  2HQW A;  2AMI A;  2BE4 A;  3SG5 A;  1R6P A;  2HF5 A;  1S36 A;  1UHH A;  4GFT A;  5HKW A;  5I8N A;  2IS9 A;  2M8U A;  1AP4 A;  1XFY O;  2KAY A;  2NCP A;  3CTN A;  2LE9 B;  2LUC A;  2P6B B;  2WC8 A;  5DKN A;  2E30 A;  2BL0 C;  4I5N B;  3ZNI A;  1K9K A;  1K9P A;  1S6C A;  1QAT A;  5KTY A;  2CNP A;  4DRW A;  1QV1 A;  2LVJ A;  1K9U A;  1EJ3 A;  1XO5 A;  5G08 A;  1QX5 B;  1Y1U A;  3FS7 A;  1UUS A;  4ICB A;  2JXL A;  2HQ8 A;  4DCK A;  1GQM A;  3JTD B;  2BL0 B;  3PFV A;  1J7Q A;  2K8M B;  3CLN A;  4CFR A;  1GGZ A;  2FJU B;  2I2R E;  2LMV A;  1GJY A;  4UPG A;  1IGV A;  1LA0 A;  1C07 A;  2PVB A;  4C0L A;  2K7D A;  2PMY A;  3DVE A;  1KK7 Y;  1JBA A;  3EK4 A;  3VRN A;  2JC2 A;  2KAV A;  5DKQ A;  3NXA A;  5PAL A;  3ICB A;  3SIA A;  2KSP A;  4N1F A;  2ZRT A;  1JWD A;  5GQQ C;  1OSA A;  1U5I A;  1AK8 A;  1CM1 A;  1TRF A;  1SKT A;  4QJ5 B;  2L98 A;  4DS7 A;  3BXK A;  1SL7 A;  1PRW A;  1QAS A;  2ISD A;  1NX2 A;  4P2Y B;  4PCW A;  1DVI A;  1UHJ A;  1QVI Y;  2Y5I A;  2OTG B;  5KSZ A;  1F8H A;  2JT8 A;  1J1D A;  1LXF C;  2ZFD A;  3SIB A;  2MA2 A;  2QAC A;  2K7C A;  1SBJ A;  1AHR A;  4GGF A;  5D69 A;  4PDZ A;  5KU1 A;  2MAZ A;  3OB2 B;  2LUX A;  1F4Q A;  1TNQ A;  4MRY A;  2JTZ A;  1FF1 A;  4YRU A;  5HYD A;  1WDC B;  2Y1N A;  3KF9 A;  1ZOT B;  3WHT B;  2NLN A;  4OVN F;  3MSE B;  1ODB A;  1C7W A;  2ZN8 A;  2WOS A;  3SG2 A;  1L2O B;  1EL4 A;  2BCX A; 
#chains in the Genus database with same CATH topology
 3PM2 A;  1DJI A;  2G9B A;  1TIZ A;  1PSR A;  3JTD C;  4OKH A;  3LK1 A;  1J7R A;  1OMV A;  2JNF A;  2Y1M A;  4MVF A;  1TWO A;  5ER4 X;  3TS5 B;  2RGI A;  2PRU A;  5I94 A;  2L51 A;  3K21 A;  1T14 A;  3IVT A;  4GPL B;  4JPZ B;  4A4B A;  1QV0 A;  1DJZ A;  1CDL A;  4GGF C;  2BKI B;  5CSF A;  1HT9 A;  2ZND A;  1B8C A;  1WLZ A;  1M46 A;  1SR6 B;  2LV7 A;  4NDD A;  3TDZ A;  2KLE A;  1F54 A;  3O4X A;  3D0Y B;  2SCP A;  2EC6 C;  3LCP C;  1KSM A;  1TNP A;  2LAN A;  1MXE A;  1DC1 A;  4N1G A;  1FI6 A;  1PAL A;  2K2A A;  3BUM B;  3DF0 A;  4FTG A;  5DIC A;  2PQL A;  1J7P A;  1NYA A;  4MZL A;  3JVT B;  2KI6 D;  1XFW O;  1K2H A;  1CFC A;  5ER5 A;  1G8I A;  2KGR A;  1CMG A;  1N65 A;  1QWV A;  1ZFS A;  1A2X A;  2CXJ A;  3TUY B;  2V53 A;  2LLS A;  2FOT A;  2BCA A;  3LL8 B;  1OOJ A;  2M29 A;  3FE6 A;  1BF5 A;  1YVH A;  2HET A;  4E68 A;  2QEH A;  1MF8 B;  1WDC C;  1SMG A;  1IG5 A;  1W7J B;  4JQ0 D;  2JT3 A;  5D7F A;  5HKY A;  4PHK A;  2L5Y A;  2F33 A;  2GGM A;  4PE1 A;  5DKR A;  4CID A;  2JOJ A;  3FWB A;  4PE0 A;  2O60 A;  3LLE A;  4MN0 A;  3OBV A;  1DF0 A;  5FI6 A;  1XFU O;  3Q8I A;  4OZD A;  3DVK A;  4MLW A;  1FBV A;  3CZT X;  3GOF A;  3S0D A;  3I5I B;  5AER A;  3I5G B;  1S6J A;  1B7T Z;  1YRT B;  4M2Q A;  2ZN9 A;  3D10 A;  1EG3 A;  3VRR A;  1JFK A;  4A4C A;  3KPX A;  2WCE A;  1KWO C;  1OMD A;  4R1E A;  1DEL A;  1DJY A;  2WCF A;  3CR4 X;  1J1E A;  3UO9 A;  1CKK A;  1CFD A;  4HRG A;  1OZS A;  1YX8 A;  2GTE A;  2I94 A;  2KHN A;  3PM8 A;  1QXP A;  4AOM A;  2MRD A;  1MQ1 A;  1DGV A;  1KSO A;  3NSK A;  1Z4H A;  3AKB A;  4N5X A;  3WHU B;  1UWO A;  2KFG A;  2LVV A;  1SPY A;  4MZJ A;  1G4Y R;  1F55 A;  2L0P A;  4YI9 A;  5HLO A;  1QX7 A;  2KI6 C;  3WNX B;  1XA5 A;  4YGC B;  3D73 A;  4AQJ A;  2LVI A;  1WRL A;  1L7Z A;  4XJK A;  4QJ3 B;  2KFF A;  2PYQ A;  1Y0V H;  4JKT A;  1QS7 A;  3E3R A;  2JNX A;  1ZUZ A;  3F45 A;  1AUI B;  1IIO A;  1XVJ A;  3CDN A;  3SG3 A;  1B47 A;  2LCP A;  3BOW A;  2WCJ A;  1ZMZ A;  3BFA A;  3WXA A;  1TUZ A;  1NWD A;  3PLF B;  4HRE E;  1CDN A;  3NSI A;  1XFX O;  3RM1 A;  2A4J A;  2P71 A;  1B8L A;  3B86 A;  4GUK A;  2FJY A;  1DJW A;  1SRA A;  1NCY A;  5JJG A;  3PSR A;  1ALW A;  2L4H A;  3L47 A;  1PK0 D;  3OP0 A;  4XYN A;  1QIV A;  3CAB A;  3VRP A;  3S0B A;  1OOI X;  1KQM B;  4M2O A;  2WCM A;  3NHT A;  1QLS A;  1RK9 A;  5IBW A;  3I5H B;  4F7F A;  3I5H C;  4IJ7 A;  1IRJ A;  1XFR A;  4ORA B;  3NSO A;  4GAO A;  2K2F A;  1NX3 A;  1SCM C;  2JZI A;  2FCE A;  1K90 D;  2FCD A;  4ORB B;  1X02 A;  1Q80 A;  3JVT C;  3D74 A;  2M49 B;  2Q91 A;  1BG1 A;  2I18 A;  1SL8 A;  2EC6 B;  1MR8 A;  1WLM A;  2KDH A;  4PHJ A;  3EVU A;  2H8V A;  1DF0 B;  2K61 A;  1WRK A;  5HL1 A;  2M0R A;  1BLQ A;  2K7B A;  1BR4 B;  2JPO A;  5TNC A;  3PAL A;  4BY4 A;  1JFJ A;  3KO0 A;  2WOR A;  1NP8 A;  2LMU A;  4FQT A;  1YR5 A;  1YX7 A;  2MLF C;  3FIA A;  4ZCV A;  2LHI A;  1SW8 A;  3DZT A;  5J3X A;  2OPO A;  4YGA A;  1IQ5 A;  1AVS A;  2LAP A;  2ZRS A;  5BPJ A;  2KAX A;  1TCO B;  2KBM A;  4PE7 A;  1MHO A;  5CSN A;  1BMO A;  1VRK A;  2L2E A;  4Q04 A;  3BUX B;  3D77 A;  4GGN A;  4I5J A;  5AAN A;  1F71 A;  4GBA A;  1F4O A;  1U5I B;  4C0K A;  1SK6 D;  2JWW A;  1TNW A;  3AAK A;  1IJ6 A;  2KYF A;  3R1O A;  3I5I C;  3CR5 X;  3EG5 B;  3I5F B;  3R72 A;  4L9M A;  2LHL A;  1OZO A;  2AAO A;  2KBI A;  2GGZ A;  4PE4 A;  2H61 C;  1DMO A;  1KFX L;  1B4C A;  1C3Y A;  1Z2C B;  1NCX A;  2JQ6 A;  1YTZ C;  1B7T Y;  1V1G A;  2K7O A;  2BBN A;  3BFB A;  1P28 A;  3M0W A;  4XJK B;  2M1K B;  3SG6 A;  1K96 A;  1CFP A;  3TDU A;  2LNK A;  1IWQ A;  1TUJ A;  3OX5 A;  4WQ2 A;  3SG4 A;  1QVI Z;  2WCB A;  2B1U A;  2MBX A;  2E6W A;  1SCM B;  1GM0 A;  1RJV A;  4DIR A;  1IH0 A;  4PHN A;  4MEW A;  3VGO A;  2R2I A;  1C7V A;  5CSJ A;  1LVC D;  1QJT A;  2BEC A;  2I7A A;  2KPH A;  3O4Y A;  3VB1 A;  5AXI A;  3NSL A;  4I5K A;  1PSB A;  1FW4 A;  3GK2 A;  3H4S E;  3PAT A;  1KK8 B;  3O78 A;  1WY9 A;  1JUO A;  2OS8 C;  1CFF A;  1KWO B;  3DY9 A;  4P5O E;  3RZS A;  3IQO A;  2OTG C;  2SAS A;  2JPT A;  1DJH A;  1NIW A;  3DVM A;  1B8R A;  1EG4 A;  3VRO A;  3SS3 A;  2L2C A;  2LP2 A;  3FE9 A;  2WCL A;  4JWQ A;  2JUL A;  1M31 A;  1YUT A;  1XFV O;  3B87 A;  1J55 A;  1B9A A;  2MLE C;  5CPV A;  4MSP A;  2BE6 A;  1BU3 A;  4YI8 A;  1OE9 B;  2NCO A;  2KGB C;  1DEK A;  2LMT A;  3AKA A;  3DYE A;  1CLM A;  1DGU A;  1YVL A;  1UUR A;  1V1F A;  2VRG A;  2F2P A;  2M97 A;  3PN7 C;  4HRH A;  1G33 A;  3BUW B;  2LLT A;  1LKJ A;  1KFU L;  3BOW B;  5I2O A;  4INW A;  2H61 A;  1LIN A;  1MWN A;  1K94 A;  3HX4 A;  4KYN A;  4NDB A;  2PSR A;  1Y1X A;  3BUO B;  1RFJ A;  4C0J A;  2GV5 A;  4OV2 A;  2EGD A;  2F8P A;  3PN7 B;  4MZK A;  1KCY A;  2ZKM X;  1ALV A;  1XYD A;  1DJX A;  3BYA A;  1ORG A;  2O5G A;  3BUN B;  3BQ3 A;  5HLV A;  5HKZ A;  5I2Q A;  3AAJ A;  3CWG A;  3NHI A;  1YRU B;  1BJF A;  1A75 A;  1BR1 B;  2QEV A;  1EH2 A;  1FPW A;  2F3Z A;  1TTX A;  3C1V A;  4I5L B;  1S5G Z;  2EHB A;  4U8D A;  3LK0 A;  1ZAC A;  3D0Y A;  1NPQ A;  1NUB A;  1S3P A;  2CCM A;  1SL9 A;  4YGD B;  1CLB A;  1EXR A;  2K0J A;  2JTT A;  1DJG A;  1A75 B;  1TNX A;  1CB1 A;  5FYX A;  2WC6 A;  1NSH A;  1TOP A;  3KHE A;  1NCZ A;  2KNE A;  4CPV A;  5AFP A;  1A03 A;  5K89 A;  1NX0 A;  2WND A;  2M1U A;  5AEQ A;  2M9G A;  3EKH A;  1UHI A;  1CDM A;  1REC A;  2LVK A;  3SG7 A;  4ORC B;  2KQY A;  3NGV A;  1LA3 A;  5JOL A;  3I5F C;  5EL2 A;  1AJ5 A;  4TNC A;  4AQI A;  4JD9 A;  4NDC A;  4NQG A;  1DQE A;  1KFX S;  4DUQ A;  1IQ3 A;  1B1G A;  1PVB A;  3CS1 A;  2M3W A;  2NXQ A;  2KYC A;  5D3O A;  3CZ2 A;  3SJS A;  3TS5 C;  2BAP A;  2M7N A;  3HCM A;  1NX1 A;  4WQ3 A;  1S5G Y;  3IF7 A;  1YUR A;  3L4A A;  1M63 B;  2MJW B;  3RLZ A;  1YUU A;  2HPS A;  1BOD A;  2CBL A;  1D1O A;  1PVA A;  3B7A A;  2PAS A;  5I2L A;  2DOQ A;  2LLU A;  1RWY A;  3OB1 B;  1SY9 A;  1AJ4 A;  1XFZ O;  1CNP A;  2BNX A;  2L5X B;  1H8B A;  1TN4 A;  1K8U A;  4CLN A;  1CM4 A;  1N0Y A;  2PAL A;  4D1E A;  1HQV A;  1XK4 C;  1F70 A;  3D76 A;  4MRX A;  3UNW A;  1JC2 A;  2TN4 A;  3CR2 A;  3I5G C;  4CFQ A;  4YGB B;  4MBE A;  1KK8 C;  1RTP 1;  3CYZ A;  2KQ6 A;  1CTR A;  5B8I B;  3B6X A;  2LC5 A;  3S0G A;  1KQV A;  1M45 A;  4GNK B;  4PHM A;  1DTL A;  1S26 D;  1W7I B;  1QX2 A;  2COL B;  2JXC A;  3OX6 A;  1H4B A;  5F6T A;  3PJI A;  2KOT A;  2JU0 A;  1W9Z A;  2QPT A;  4OR9 B;  2QEO A;  2F2O A;  1JF2 A;  1OW4 A;  2OS8 B;  2H2K A;  1JSA A;  1CDP A;  2L4I A;  3L4L A;  4FQO A;  2QDI A;  3ZWH A;  1J7O A;  3DF0 B;  3QRX A;  5FI2 A;  3A4U B;  2KI4 C;  1KFU S;  2Y4Q A;  2YGU A;  3V2L A;  1MUX A;  3TUY C;  1E8A A;  3D75 A;  1KQM C;  3TDI A;  3CZ0 A;  2P70 A;  4BY5 A;  3DXL A;  1L2O C;  1OOH A;  1QTX A;  2F3Y A;  1JF0 A;  1IJ5 A;  1S1E A;  1A4P A;  2MHH A;  1KK7 Z;  1OQP A;  1Y6W A;  4USL A;  4M2P A;  2BKH B;  1UHK A;  5CSI A;  1SR6 C;  1FI5 A;  1Y1A A;  3DVJ A;  4QJ4 B;  1UHN A;  2NZ0 A;  3IQQ A;  1QLK A;  3O2P A;  2BCB A;  1CLL A;  5FI7 A;  3EK8 A;  1S6I A;  3OHM B;  4PAL A;  2LP3 A;  1A29 A;  3FWC A;  2L50 A;  4F0Z B;  1GGW A;  2JRF A;  2CTN A;  2CT9 A;  2WCH A;  4IL1 A;  3GK4 X;  2BBM A;  1BT6 A;  2LM5 A;  1DT7 B;  3A8R A;  2WCK A;  1BOC A;  4YGE B;  2D8N A;  1OOF A;  1SNL A;  3R1V A;  3TZ1 A;  4HSZ A;  2KFH A;  4ETO A;  2ZNE A;  1SCV A;  3EKJ A;  3VRQ A;  1UP5 A;  1QIW A;  3B88 A;  2AUC A;  3EVV A;  1WRZ A;  3KEV A;  3N7H A;  4PT1 A;  3EVR A;  1K95 A;  1N2D A;  1IKU A;  2M7L A;  3O6B A;  3CGA A;  3GK1 A;  1MXL C;  2Q4U A;  1XK4 A;  3S0F A;  1R2U A;  3EK7 A;  4WRI A;  2G2B A;  4ZCU A;  4OCI A;  2KI4 B;  1M39 A;  1CMF A;  3DD4 A;  1YUS A;  1RRO A;  2JT0 A;  1PUL A;  1SYM A;  4YBH B;  1OMR A;  1TCF A;  1K93 D;  1SSE B;  2AMI A;  2BE4 A;  2HQW A;  1R6P A;  2HF5 A;  1S36 A;  3SG5 A;  1UHH A;  4GFT A;  5HKW A;  5I8N A;  2IS9 A;  2M8U A;  2ERB A;  3R1P A;  1AP4 A;  1XFY O;  2KAY A;  2NCP A;  3CTN A;  2LE9 B;  3BFH A;  2LUC A;  2P6B B;  2WC8 A;  5DKN A;  2E30 A;  2BL0 C;  4I5N B;  3ZNI A;  1K9K A;  1K9P A;  1S6C A;  1QAT A;  5KTY A;  2CNP A;  4DRW A;  1QV1 A;  2LVJ A;  2K60 A;  1K9U A;  1EJ3 A;  1XO5 A;  5G08 A;  1QX5 B;  1LS8 A;  1Y1U A;  3FS7 A;  3S0E A;  1UUS A;  3D78 A;  4ICB A;  1C3Z A;  2JXL A;  2HQ8 A;  4DCK A;  1GQM A;  3JTD B;  2BL0 B;  3PFV A;  1J7Q A;  2K8M B;  3CLN A;  4CFR A;  1GGZ A;  2FJU B;  2I2R E;  2LMV A;  1GJY A;  4UPG A;  1IGV A;  1LA0 A;  3SS5 A;  1C07 A;  2PVB A;  4C0L A;  2K7D A;  2PMY A;  3DVE A;  1KK7 Y;  1JBA A;  3EK4 A;  3K1E A;  3OGN A;  3QME A;  3VRN A;  2JC2 A;  2KAV A;  5DKQ A;  3NXA A;  5PAL A;  3ICB A;  3SIA A;  2KSP A;  4N1F A;  2ZRT A;  1JWD A;  5GQQ C;  1OSA A;  3CZ1 A;  1U5I A;  1AK8 A;  1CM1 A;  1TRF A;  1SKT A;  3SS4 A;  4QJ5 B;  2L98 A;  4DS7 A;  3BXK A;  1SL7 A;  1PRW A;  1QAS A;  2ISD A;  1NX2 A;  4P2Y B;  4PCW A;  1DVI A;  1UHJ A;  3S0A A;  1QVI Y;  2Y5I A;  2OTG B;  5KSZ A;  1F8H A;  2JT8 A;  1J1D A;  1LXF C;  2ZFD A;  3SIB A;  3BJH A;  2QEB A;  2MA2 A;  2QAC A;  2K7C A;  1SBJ A;  1AHR A;  4GGF A;  5D69 A;  4PDZ A;  5KU1 A;  2MAZ A;  3OB2 B;  3FE8 A;  2LUX A;  2KLD A;  1F4Q A;  1TNQ A;  4MRY A;  2JTZ A;  1FF1 A;  4YRU A;  5HYD A;  1WDC B;  2Y1N A;  3KF9 A;  1ZOT B;  3WHT B;  2NLN A;  4OVN F;  3MSE B;  1ODB A;  1C7W A;  4INX A;  2ZN8 A;  2WOS A;  2WC5 A;  3SG2 A;  1L2O B;  1EL4 A;  1OOG A;  2BCX A; 
#chains in the Genus database with same CATH homology
 1DJI A;  2G9B A;  1TIZ A;  1PSR A;  3JTD C;  4OKH A;  3LK1 A;  1J7R A;  1OMV A;  2JNF A;  2Y1M A;  4MVF A;  5ER4 X;  3TS5 B;  2RGI A;  2PRU A;  2L51 A;  3K21 A;  4GPL B;  4JPZ B;  4A4B A;  1QV0 A;  1DJZ A;  1CDL A;  4GGF C;  2BKI B;  5CSF A;  1HT9 A;  2ZND A;  1B8C A;  1WLZ A;  1M46 A;  1SR6 B;  2LV7 A;  4NDD A;  3TDZ A;  1F54 A;  3D0Y B;  2SCP A;  2EC6 C;  3LCP C;  1KSM A;  1TNP A;  2LAN A;  1MXE A;  4N1G A;  1FI6 A;  1PAL A;  2K2A A;  3BUM B;  3DF0 A;  4FTG A;  1J7P A;  1NYA A;  4MZL A;  3JVT B;  2KI6 D;  1XFW O;  1K2H A;  1CFC A;  5ER5 A;  1G8I A;  2KGR A;  1CMG A;  1N65 A;  1ZFS A;  1A2X A;  2CXJ A;  3TUY B;  2V53 A;  2LLS A;  2FOT A;  2BCA A;  3LL8 B;  1OOJ A;  2M29 A;  1BF5 A;  1YVH A;  2HET A;  4E68 A;  1MF8 B;  1WDC C;  1SMG A;  1IG5 A;  1W7J B;  4JQ0 D;  2JT3 A;  5D7F A;  5HKY A;  4PHK A;  2F33 A;  2GGM A;  4PE1 A;  5DKR A;  4CID A;  2JOJ A;  3FWB A;  4PE0 A;  2O60 A;  3LLE A;  4MN0 A;  1DF0 A;  1XFU O;  3DVK A;  4MLW A;  1FBV A;  3CZT X;  3GOF A;  3I5I B;  5AER A;  3I5G B;  1S6J A;  1B7T Z;  1YRT B;  4M2Q A;  2ZN9 A;  3D10 A;  1EG3 A;  3VRR A;  1JFK A;  4A4C A;  3KPX A;  2WCE A;  1KWO C;  1OMD A;  4R1E A;  3CR4 X;  1DJY A;  2WCF A;  1CKK A;  1J1E A;  1CFD A;  4HRG A;  1OZS A;  1YX8 A;  2I94 A;  2KHN A;  3PM8 A;  1QXP A;  4AOM A;  2MRD A;  1MQ1 A;  1DGV A;  1KSO A;  3NSK A;  3AKB A;  4N5X A;  3WHU B;  1UWO A;  2KFG A;  2LVV A;  1SPY A;  4MZJ A;  1G4Y R;  1F55 A;  2L0P A;  4YI9 A;  5HLO A;  1QX7 A;  2KI6 C;  3WNX B;  1XA5 A;  4YGC B;  4AQJ A;  2LVI A;  1WRL A;  1L7Z A;  4XJK A;  4QJ3 B;  2KFF A;  1Y0V H;  1QS7 A;  3E3R A;  2JNX A;  1ZUZ A;  3F45 A;  1AUI B;  1XVJ A;  3SG3 A;  1B47 A;  2LCP A;  3BOW A;  1ZMZ A;  3WXA A;  1NWD A;  3PLF B;  4HRE E;  1CDN A;  3NSI A;  1XFX O;  3RM1 A;  2A4J A;  1B8L A;  4GUK A;  1DJW A;  1SRA A;  1NCY A;  5JJG A;  3PSR A;  1ALW A;  2L4H A;  1PK0 D;  3OP0 A;  4XYN A;  1QIV A;  3VRP A;  1KQM B;  4M2O A;  1QLS A;  1RK9 A;  5IBW A;  3I5H B;  3I5H C;  1IRJ A;  4ORA B;  3NSO A;  4GAO A;  2K2F A;  1NX3 A;  1SCM C;  2JZI A;  2FCE A;  1K90 D;  2FCD A;  4ORB B;  1X02 A;  1Q80 A;  3JVT C;  1BG1 A;  2M49 B;  2Q91 A;  2I18 A;  1SL8 A;  2EC6 B;  1MR8 A;  1WLM A;  2KDH A;  4PHJ A;  3EVU A;  2K61 A;  1DF0 B;  1WRK A;  2M0R A;  1BLQ A;  2K7B A;  1BR4 B;  5TNC A;  3PAL A;  4BY4 A;  1JFJ A;  3KO0 A;  2WOR A;  1NP8 A;  2LMU A;  4ZCV A;  1YR5 A;  1YX7 A;  2MLF C;  3FIA A;  5J3X A;  2LHI A;  1SW8 A;  2OPO A;  4YGA A;  1IQ5 A;  1AVS A;  2LAP A;  2ZRS A;  5BPJ A;  2KAX A;  1TCO B;  2KBM A;  4PE7 A;  1MHO A;  5CSN A;  1BMO A;  1VRK A;  2L2E A;  4Q04 A;  3BUX B;  4I5J A;  4GGN A;  5AAN A;  1F71 A;  4GBA A;  1F4O A;  1U5I B;  4C0K A;  1SK6 D;  2JWW A;  1TNW A;  3AAK A;  1IJ6 A;  2KYF A;  3I5I C;  3CR5 X;  3I5F B;  4L9M A;  2LHL A;  1OZO A;  2AAO A;  2KBI A;  2GGZ A;  4PE4 A;  2H61 C;  1DMO A;  1KFX L;  1B4C A;  1NCX A;  2JQ6 A;  1YTZ C;  1B7T Y;  1V1G A;  2K7O A;  2BBN A;  3M0W A;  4XJK B;  2M1K B;  3SG6 A;  1K96 A;  1CFP A;  3TDU A;  2LNK A;  1IWQ A;  3OX5 A;  4WQ2 A;  3SG4 A;  1QVI Z;  2WCB A;  2B1U A;  2MBX A;  2E6W A;  1SCM B;  1RJV A;  4DIR A;  1IH0 A;  4PHN A;  4MEW A;  3VGO A;  2R2I A;  1C7V A;  5CSJ A;  1LVC D;  1QJT A;  2BEC A;  2I7A A;  3O4Y A;  5AXI A;  3NSL A;  4I5K A;  1PSB A;  1FW4 A;  3GK2 A;  3H4S E;  3PAT A;  1KK8 B;  3O78 A;  1WY9 A;  1JUO A;  2OS8 C;  1CFF A;  1KWO B;  4P5O E;  3IQO A;  2OTG C;  2SAS A;  2JPT A;  1DJH A;  1NIW A;  3DVM A;  1B8R A;  1EG4 A;  3VRO A;  2LP2 A;  4JWQ A;  2JUL A;  1M31 A;  1YUT A;  1XFV O;  1J55 A;  1B9A A;  2MLE C;  5CPV A;  4MSP A;  2BE6 A;  1BU3 A;  4YI8 A;  1OE9 B;  2NCO A;  2KGB C;  2LMT A;  3AKA A;  1CLM A;  1DGU A;  1YVL A;  1UUR A;  1V1F A;  2VRG A;  2F2P A;  2M97 A;  3PN7 C;  4HRH A;  1G33 A;  3BUW B;  2LLT A;  1LKJ A;  1KFU L;  3BOW B;  5I2O A;  2H61 A;  1LIN A;  1MWN A;  1K94 A;  3HX4 A;  4NDB A;  2PSR A;  1Y1X A;  3BUO B;  1RFJ A;  4C0J A;  2GV5 A;  4OV2 A;  2EGD A;  2F8P A;  3PN7 B;  4MZK A;  1KCY A;  2ZKM X;  1ALV A;  1XYD A;  1DJX A;  3BYA A;  2O5G A;  3BUN B;  3BQ3 A;  5HLV A;  5HKZ A;  5I2Q A;  3AAJ A;  3CWG A;  1YRU B;  1BJF A;  1A75 A;  1BR1 B;  1EH2 A;  1FPW A;  2F3Z A;  1TTX A;  3C1V A;  4I5L B;  1S5G Z;  2EHB A;  4U8D A;  3LK0 A;  1ZAC A;  3D0Y A;  1NPQ A;  1NUB A;  1S3P A;  2CCM A;  1SL9 A;  4YGD B;  1CLB A;  1EXR A;  2K0J A;  2JTT A;  1DJG A;  1A75 B;  1TNX A;  1CB1 A;  5FYX A;  1NSH A;  1TOP A;  3KHE A;  1NCZ A;  2KNE A;  4CPV A;  5AFP A;  1A03 A;  5K89 A;  1NX0 A;  2WND A;  2M1U A;  5AEQ A;  2M9G A;  3EKH A;  1UHI A;  1CDM A;  1REC A;  2LVK A;  3SG7 A;  4ORC B;  2KQY A;  1LA3 A;  5JOL A;  3I5F C;  1AJ5 A;  4TNC A;  4AQI A;  4NDC A;  4NQG A;  1KFX S;  4DUQ A;  1IQ3 A;  1B1G A;  1PVB A;  3CS1 A;  2M3W A;  2NXQ A;  2KYC A;  3SJS A;  3TS5 C;  2M7N A;  3HCM A;  1NX1 A;  4WQ3 A;  1S5G Y;  3IF7 A;  1YUR A;  1M63 B;  2MJW B;  3RLZ A;  1YUU A;  2HPS A;  1BOD A;  2CBL A;  1D1O A;  1PVA A;  5I2L A;  2PAS A;  2DOQ A;  2LLU A;  1RWY A;  3OB1 B;  1SY9 A;  1AJ4 A;  1XFZ O;  1CNP A;  2L5X B;  1H8B A;  1TN4 A;  1K8U A;  4CLN A;  1CM4 A;  1N0Y A;  2PAL A;  4D1E A;  1HQV A;  1XK4 C;  1F70 A;  4MRX A;  1JC2 A;  2TN4 A;  3CR2 A;  3I5G C;  4CFQ A;  4YGB B;  4MBE A;  1KK8 C;  1RTP 1;  2KQ6 A;  1CTR A;  5B8I B;  2LC5 A;  1KQV A;  1M45 A;  4GNK B;  4PHM A;  1DTL A;  1S26 D;  1W7I B;  1QX2 A;  2COL B;  2JXC A;  3OX6 A;  1H4B A;  5F6T A;  2KOT A;  2JU0 A;  2QPT A;  4OR9 B;  2F2O A;  1JF2 A;  2OS8 B;  2H2K A;  1JSA A;  1CDP A;  2L4I A;  4FQO A;  3ZWH A;  1J7O A;  3DF0 B;  3QRX A;  3A4U B;  2KI4 C;  1KFU S;  2Y4Q A;  1MUX A;  3TUY C;  1E8A A;  3TDI A;  1KQM C;  4BY5 A;  1L2O C;  1QTX A;  2F3Y A;  1JF0 A;  1IJ5 A;  1S1E A;  1A4P A;  2MHH A;  1KK7 Z;  1OQP A;  1Y6W A;  4USL A;  4M2P A;  2BKH B;  1UHK A;  5CSI A;  1SR6 C;  1FI5 A;  1Y1A A;  3DVJ A;  4QJ4 B;  1UHN A;  2NZ0 A;  3IQQ A;  1QLK A;  3O2P A;  2BCB A;  1CLL A;  3EK8 A;  1S6I A;  3OHM B;  4PAL A;  2LP3 A;  1A29 A;  3FWC A;  2L50 A;  4F0Z B;  1GGW A;  2JRF A;  2CTN A;  2CT9 A;  1DT7 B;  4IL1 A;  3GK4 X;  2BBM A;  1BT6 A;  2LM5 A;  1BOC A;  3A8R A;  4YGE B;  2D8N A;  1SNL A;  3TZ1 A;  4HSZ A;  2KFH A;  4ETO A;  2ZNE A;  1SCV A;  3EKJ A;  3VRQ A;  1UP5 A;  1QIW A;  3EVV A;  2AUC A;  1WRZ A;  3KEV A;  3EVR A;  1K95 A;  1N2D A;  1IKU A;  2M7L A;  3O6B A;  3CGA A;  3GK1 A;  1MXL C;  2Q4U A;  1XK4 A;  1R2U A;  3EK7 A;  4WRI A;  2G2B A;  4ZCU A;  4OCI A;  2KI4 B;  1M39 A;  1CMF A;  3DD4 A;  1YUS A;  1RRO A;  2JT0 A;  1PUL A;  1SYM A;  4YBH B;  1OMR A;  1TCF A;  1K93 D;  2HQW A;  2AMI A;  2BE4 A;  3SG5 A;  1R6P A;  2HF5 A;  1S36 A;  1UHH A;  4GFT A;  5HKW A;  5I8N A;  2IS9 A;  2M8U A;  1AP4 A;  1XFY O;  2KAY A;  2NCP A;  3CTN A;  2LE9 B;  2LUC A;  2P6B B;  2WC8 A;  5DKN A;  2E30 A;  2BL0 C;  4I5N B;  3ZNI A;  1K9K A;  1K9P A;  1S6C A;  1QAT A;  5KTY A;  2CNP A;  4DRW A;  1QV1 A;  2LVJ A;  1K9U A;  1EJ3 A;  1XO5 A;  5G08 A;  1QX5 B;  1Y1U A;  3FS7 A;  1UUS A;  4ICB A;  2JXL A;  2HQ8 A;  4DCK A;  1GQM A;  3JTD B;  2BL0 B;  3PFV A;  1J7Q A;  2K8M B;  3CLN A;  4CFR A;  1GGZ A;  2FJU B;  2I2R E;  2LMV A;  1GJY A;  4UPG A;  1IGV A;  1LA0 A;  1C07 A;  2PVB A;  4C0L A;  2K7D A;  2PMY A;  3DVE A;  1KK7 Y;  1JBA A;  3EK4 A;  3VRN A;  2JC2 A;  2KAV A;  5DKQ A;  3NXA A;  5PAL A;  3ICB A;  3SIA A;  2KSP A;  4N1F A;  2ZRT A;  1JWD A;  5GQQ C;  1OSA A;  1U5I A;  1AK8 A;  1CM1 A;  1TRF A;  1SKT A;  4QJ5 B;  2L98 A;  4DS7 A;  3BXK A;  1SL7 A;  1PRW A;  1QAS A;  2ISD A;  1NX2 A;  4P2Y B;  4PCW A;  1DVI A;  1UHJ A;  1QVI Y;  2Y5I A;  2OTG B;  5KSZ A;  1F8H A;  2JT8 A;  1J1D A;  1LXF C;  2ZFD A;  3SIB A;  2MA2 A;  2QAC A;  2K7C A;  1SBJ A;  1AHR A;  4GGF A;  5D69 A;  4PDZ A;  5KU1 A;  2MAZ A;  3OB2 B;  2LUX A;  1F4Q A;  1TNQ A;  4MRY A;  2JTZ A;  1FF1 A;  4YRU A;  5HYD A;  1WDC B;  2Y1N A;  3KF9 A;  1ZOT B;  3WHT B;  2NLN A;  4OVN F;  3MSE B;  1ODB A;  1C7W A;  2ZN8 A;  2WOS A;  3SG2 A;  1L2O B;  1EL4 A;  2BCX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...