4MLWA

Crystal structure of non-myristoylated recoverin at 1.45 a resolution with calcium bound to ef-hand 3
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
192
structure length
192
Chain Sequence
GALSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Recoverin
publication title A highly conserved cysteine of neuronal calcium-sensing proteins controls cooperative binding of Ca2+ to recoverin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 78
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2013-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4mlwA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4mlwA01
3LCPC 1S26D 3DVJA 1A75B 1YUUA 4A4CA 3I5GC 2H2KA 1XYDA 2Q4UA 3LL8B 5HLOA 1XFVO 3VRPA 4U8DA 4QJ4B 4YI9A 2LC5A 1F4QA 4GUKA 3ICBA 1W7JB 1EL4A 2G9BA 1LVCD 2B1UA 3CR4X 3TS5C 3O6BA 2HQ8A 2KYFA 3O78A 4PE1A 3EKJA 1FBVA 2KFHA 2COLB 3EK8A 3VRNA 1XFYO 2EC6B 1M46A 1V1FA 1R2UA 1CMGA 1NWDA 1JF2A 1IWQA 2JPTA 1PULA 1SL7A 1V1GA 1XVJA 2OTGC 3OX5A 2Q91A 1IKUA 2KGRA 1L2OB 2KBMA 3D0YB 4MZKA 3AKBA 1B8LA 2OS8C 3E3RA 2BL0B 1Q80A 4R1EA 5HYDA 1H4BA 2CBLA 2P6BB 1Y1AA 2K2AA 5BPJA 1NPQA 1KCYA 2M3WA 2JWWA 1K8UA 5KSZA 2LVIA 1G4YR 2LLTA 1JUOA 5AERA 4AOMA 1LA0A 1RROA 1SMGA 4OVNF 5B8IB 1YR5A 4PHMA 1F8HA 1YX7A 5I2LA 2M7LA 2LMUA 3A8RA 1ALVA 2MRDA 1S6CA 1QXPA 4OKHA 2E30A 5ER5A 1EJ3A 2O60A 4PHNA 3FWCA 1BMOA 1UHKA 1TNWA 2Y1MA 1S6IA 2V53A 1DJHA 1KFXL 4N1FA 2IS9A 2KFGA 1J7OA 1A75A 2DOQA 1NSHA 2LE9B 3SJSA 1F54A 2MBXA 1KFXS 1EG3A 2K0JA 1YVHA 3KO0A 1NUBA 3TDZA 5AANA 2PSRA 2ZN8A 1IG5A 2LVJA 3BUOB 2H61C 2M97A 1YUSA 4JQ0D 5CSFA 2ISDA 4CIDA 1C07A 3LLEA 1OOJA 1QTXA 4N5XA 1RTP1 2L50A 3M0WA 2KQ6A 3I5FB 3GK1A 1KK7Y 4NDCA 4OCIA 4WRIA 3HX4A 1BF5A 1TNXA 1CDPA 1TCFA 2BBNA 4L9MA 2JNFA 1SY9A 1OQPA 3PN7C 1GJYA 1SBJA 4GGFC 1RECA 2JNXA 2I2RE 3BUWB 3OX6A 3EK7A 4GGNA 3DD4A 5CPVA 3FWBA 1S3PA 2NLNA 1S1EA 2CTNA 1CM4A 2I7AA 3QRXA 3ZWHA 4MLWA 3DVEA 2LMTA 5D69A 4HREE 4M2QA 5KU1A 2PALA 2JQ6A 1SCMC 1QS7A 2AUCA 2M49B 5HKZA 5CSIA 3BUXB 2JT8A 3EVRA 1BR4B 2HF5A 2BL0C 1PK0D 1DJWA 2A4JA 2JTZA 1YVLA 1KQMC 2WC8A 2Y1NA 1SYMA 2AAOA 1RJVA 3SG7A 2LP3A 1NCYA 3SG6A 1GGZA 2KDHA 2F2PA 2BBMA 2M8UA 1MWNA 1UHJA 1KK8C 2K7BA 2KYCA 3CWGA 1CMFA 3BYAA 1QLKA 4FTGA 3WXAA 3KEVA 1SR6C 4HRHA 4QJ3B 1IH0A 2KBIA 3MSEB 1K9KA 1X02A 4P2YB 1SK6D 1DJYA 1NX3A 2MJWB 3CZTX 5K89A 1YTZC 1UURA 3OHMB 4FQOA 3NSKA 3OB1B 1RWYA 2KFFA 4E68A 2KI4B 3PLFB 1QASA 4P5OE 1K96A 2HQWA 4GPLB 2WNDA 1XK4A 3I5HB 1CFPA 1JSAA 3TDUA 3WHUB 2JTTA 1YURA 4HRGA 2F33A 1ZFSA 3O2PA 3IQQA 5DKQA 3JVTB 1UWOA 1BT6A 2F2OA 3FS7A 4OR9B 1CFDA 2ZKMX 2LHIA 2KOTA 3VRQA 4PDZA 3RM1A 2AMIA 5AEQA 4PHJA 2F8PA 2KHNA 5J3XA 4JPZB 2LANA 3SG3A 1U5IA 1B8CA 4NQGA 1KK7Z 4OV2A 2L2EA 4ETOA 3SG4A 3BOWA 2ZN9A 4QJ5B 1K95A 4MN0A 1NX1A 2K8MB 1D1OA 4I5KA 1S5GY 2L4HA 2M29A 3HCMA 3LK1A 2JULA 4C0LA 2PASA 1TIZA 2LLSA 1WDCC 2ZRSA 3BQ3A 4BY4A 4GFTA 1LKJA 2LUXA 4AQIA 4XJKB 3KPXA 5I2OA 3PALA 1CNPA 2K61A 3CS1A 3OB2B 2BCBA 5DKNA 1FF1A 3BUNB 1Y0VH 2E6WA 1LA3A 1QJTA 2G2BA 1AUIB 1DTLA 3TUYB 1QX7A 2JU0A 1QIWA 1NIWA 2I18A 1R6PA 1F55A 4C0JA 4YGEB 1DT7B 2EGDA 1F70A 1CDLA 1OZSA 1K9PA 1WRZA 1A03A 1AHRA 4ORBB 4TNCA 2ZNEA 4CFRA 2WOSA 3GK2A 1DF0B 1G8IA 2F3ZA 5DKRA 1KWOB 1EH2A 3DF0B 2MHHA 3I5IB 1N65A 2CNPA 3SIAA 1WY9A 1E8AA 4DCKA 3SG2A 1G33A 2LUCA 1HT9A 4IL1A 3D0YA 1J55A 1J7QA 3VRRA 1CKKA 1BG1A 1SKTA 1MXEA 4MRYA 1PALA 4M2PA 1J7PA 3AKAA 2F3YA 3I5GB 3DVKA 2FCDA 1B4CA 4YGBB 3IQOA 5F6TA 1J1DA 1B47A 3CTNA 4PE7A 1QX5B 1NYAA 2EC6C 3TS5B 2K7CA 5FYXA 1TN4A 1XFUO 4WQ2A 4DRWA 1L2OC 1TCOB 2K2FA 5D7FA 1MXLC 3LK0A 3PATA 1GQMA 2HPSA 2OTGB 4DUQA 2BECA 5I2QA 2JRFA 2JZIA 2WCBA 1CLLA 5AFPA 2SASA 2CXJA 1WRLA 2OS8B 1TNPA 3VGOA 1J1EA 2MLFC 1TTXA 1S5GZ 2GGMA 4ZCVA 1L7ZA 2OPOA 3WNXB 1CM1A 1H8BA 3EK4A 2L5XB 1SL9A 2CCMA 1CDMA 1M45A 1JFKA 1DGUA 2JOJA 2JXLA 3DVMA 2KAVA 4HSZA 4F0ZB 1MF8B 3TZ1A 3IF7A 5IBWA 3BUMB 3D10A 1UUSA 4YBHB 3DF0A 4YGCB 1NX2A 4C0KA 1FW4A 4NDDA 4MRXA 4PE0A 4CFQA 5PALA 1UP5A 1DJXA 1BLQA 4MSPA 2KNEA 2Y4QA 1JFJA 3SG5A 1PSRA 5I8NA 1MQ1A 2ZFDA 1DJIA 2FJUB 2I94A 3PFVA 1KWOC 2ZRTA 3K21A 2SCPA 2WCEA 4I5JA 3AAKA 4ZCUA 1YUTA 3EVVA 1ALWA 1AK8A 1KSOA 4GAOA 5CSJA 3I5FC 5GQQC 1YX8A 3OP0A 1QIVA 2M1KB 2L51A 1SNLA 1B9AA 1EXRA 1OMDA 1XK4C 1B8RA 2MA2A 4MBEA 4JWQA 1CDNA 1JWDA 2PMYA 4CPVA 4NDBA 4MVFA 2O5GA 2MAZA 1S36A 1TRFA 2R2IA 2LNKA 3JTDB 2GGZA 3PN7B 4N1GA 5JOLA 1FPWA 2LVVA 1B7TY 3ZNIA 1F4OA 1J7RA 1KFUL 1Y1XA 1UHHA 2FOTA 1JC2A 1FI5A 1SCVA 2MLEC 2CT9A 3CLNA 1JBAA 1KFUS 1BOCA 3CGAA 1SCMB 4YGDB 4UPGA 4CLNA 2WCFA 1XO5A 3O4YA 1S6JA 1HQVA 5KTYA 1W7IB 1RFJA 2LHLA 3EVUA 1KQMB 1M31A 2KAYA 1RK9A 2Y5IA 3KHEA 4MZLA 1QVIY 4ORCB 2LVKA 1KSMA 1BODA 1IJ6A 1WLMA 4YI8A 3GK4X 3CR2A 1KK8B 1K2HA 1MUXA 1MHOA 1PVAA 1M39A 1A2XA 4BY5A 1CLMA 1WRKA 1SR6B 1XFXO 2BCXA 3F45A 4PCWA 1CFFA 3C1VA 4USLA 2H61A 1OSAA 2M9GA 5AXIA 2KI4C 1UHNA 2BKHB 3BXKA 3SIBA 1BR1B 2KSPA 1PVBA 1K90D 4I5LB 4MZJA 2JT3A 1K94A 2L98A 1CLBA 1XA5A 1QX2A 1OMRA 1ZMZA 3KF9A 1IQ3A 3I5HC 2BKIB 1IJ5A 4PHKA 1LXFC 2LV7A 1IQ5A 1LINA 2BE6A 2TN4A 4Q04A 1CB1A 4MEWA 2FCEA 4ORAB 4DS7A 3A4UB 1BJFA 3JVTC 1A29A 1MR8A 1AJ5A 4GGFA 4GBAA 1Y1UA 2JC2A 1DJGA 1M63B 1WLZA 2PRUA 4XJKA 5JJGA 1N0YA 2JXCA 1IGVA 1CFCA 3PM8A 2LCPA 2PVBA 3GOFA 1UHIA 1N2DA 4ICBA 1YRTB 4YGAA 2VRGA 1B1GA 2K7OA 4DIRA 5ER4X 3NSIA 1IRJA 2JT0A 2KI6D 1SL8A 2LM5A 1C7VA 1AJ4A 3JTDC 2LP2A 1JF0A 2GV5A 2M7NA 1AP4A 3NXAA 1ZOTB 3PSRA 1NCXA 2D8NA 1SPYA 2M1UA 1F71A 2K7DA 2NXQA 1B7TZ 3CR5X 4D1EA 4XYNA 1AVSA 5CSNA 2WORA 2L0PA 1WDCB 5TNCA 2KQYA 1DF0A 2NCOA 1DGVA 3EKHA 1EG4A 5G08A 3VROA 3NSOA 1DMOA 1ZUZA 2QACA 2RGIA 2M0RA 3TUYC 1U5IB 3AAJA 1GGWA 1QATA 1SRAA 1XFZO 3BOWB 4PALA 1NX0A 1XFWO 2NZ0A 1PRWA 1OZOA 1VRKA 4YRUA 1YRUB 1TOPA 2QPTA 4M2OA 1NP8A 1OMVA 2LLUA 3WHTB 2NCPA 1BU3A 1CTRA 1QVIZ 2EHBA 2LAPA 3FIAA 5HKWA 3RLZA 1DVIA 1SW8A 4PE4A 2KGBC 2KAXA 1PSBA 1ZACA 1K93D 4GNKB 5HLVA 5HKYA 1K9UA 2L4IA 1KQVA 1Y6WA 4I5NB 1QV1A 1QLSA 3NSLA 3I5IC 2HETA 4WQ3A 2LMVA 1OE9B 1C7WA 3H4SE 1FI6A 2ZNDA 3TDIA 1DJZA 4AQJA 1TNQA 1QV0A 2BE4A 2KI6C 1A4PA 2BCAA 1NCZA 4A4BA 1ODBA
chains in the Genus database with same CATH superfamily
3LCPC 1S26D 3DVJA 1A75B 1YUUA 4A4CA 3OGNA 3I5GC 2H2KA 2PQLA 4PT1A 1XYDA 2Q4UA 3LL8B 5HLOA 1XFVO 3VRPA 4U8DA 4QJ4B 4YI9A 2LC5A 1F4QA 4GUKA 3UNWA 3ICBA 1W7JB 1EL4A 2G9BA 1LVCD 2B1UA 3CR4X 3TS5C 3O6BA 3B87A 3BFAA 2HQ8A 2KYFA 3O78A 4PE1A 3EKJA 1FBVA 2KFHA 2COLB 3EK8A 3VRNA 1C3YA 1XFYO 1DEKA 1M46A 1V1FA 1R2UA 2EC6B 1NWDA 1JF2A 1CMGA 1IWQA 3PM2A 2JPTA 1PULA 1SL7A 1V1GA 1XVJA 2OTGC 3OX5A 2Q91A 3S0EA 1IKUA 2KGRA 1L2OB 2KBMA 3D0YB 4MZKA 3AKBA 3CYZA 3S0AA 1B8LA 2OS8C 3E3RA 4IJ7A 2BL0B 1Q80A 4R1EA 5HYDA 1H4BA 2CBLA 2P6BB 3NGVA 1Y1AA 2K2AA 5BPJA 1NPQA 1KCYA 2M3WA 2JWWA 1K8UA 5KSZA 2LVIA 3DXLA 1G4YR 2LLTA 1JUOA 5AERA 4AOMA 1LA0A 3UO9A 1RROA 1SMGA 4OVNF 3FE9A 1YR5A 4PHMA 5B8IB 1F8HA 1YX7A 5I2LA 2M7LA 2LMUA 3A8RA 1ALVA 2MRDA 1S6CA 1QXPA 4OKHA 2E30A 5ER5A 1EJ3A 2O60A 4PHNA 3FWCA 1OOHA 1BMOA 3D75A 1UHKA 1TNWA 2Y1MA 1S6IA 2V53A 1DJHA 1KFXL 4INXA 2IS9A 2KFGA 4N1FA 1A75A 2DOQA 1J7OA 1NSHA 2LE9B 3SJSA 1F54A 2MBXA 3FE8A 1KFXS 1EG3A 2K0JA 1YVHA 3RZSA 3KO0A 1NUBA 3S0GA 5AANA 3TDZA 2PSRA 2ZN8A 1IG5A 1LS8A 2LVJA 2H61C 2M97A 1YUSA 3BUOB 4JQ0D 5CSFA 2ISDA 4CIDA 1C07A 3LLEA 2GTEA 4JKTA 1OOJA 1QTXA 2KLDA 4N5XA 1RTP1 2L50A 3D78A 3M0WA 2KQ6A 3I5FB 3GK1A 1KK7Y 2BNXA 4NDCA 4OCIA 3S0BA 4WRIA 3HX4A 3Q8IA 1TNXA 1BF5A 1CDPA 1TCFA 1OOFA 2BBNA 4L9MA 2JNFA 1SY9A 1OQPA 3BFBA 3PN7C 1C3ZA 1GJYA 1SBJA 4GGFC 1RECA 2JNXA 2I2RE 3BUWB 3OX6A 3EK7A 4GGNA 3DD4A 5CPVA 3BJHA 3FWBA 3S0DA 1S3PA 2NLNA 1S1EA 2CTNA 1CM4A 2I7AA 2JPOA 2QEBA 3QRXA 2QEOA 3ZWHA 4MLWA 3DVEA 2LMTA 5D69A 4HREE 4M2QA 5KU1A 2PALA 1T14A 2JQ6A 1SCMC 1QS7A 2AUCA 2M49B 5HKZA 5CSIA 5I94A 3BUXB 2JT8A 3EVRA 3DZTA 1BR4B 2HF5A 2BL0C 1PK0D 1DJWA 2A4JA 2JTZA 1YVLA 1KQMC 2WC8A 2Y1NA 1SYMA 2AAOA 1RJVA 3BFHA 1OOIX 3B88A 2LP3A 3SG7A 1NCYA 3SG6A 4FQTA 1GGZA 2KDHA 2F2PA 2BBMA 2M8UA 1MWNA 1UHJA 1KK8C 2K7BA 2KYCA 3CWGA 1CMFA 3BYAA 1QLKA 4FTGA 3CZ0A 3KEVA 1SR6C 3D77A 4HRHA 4QJ3B 2KBIA 3MSEB 1K9KA 1X02A 1IH0A 4P2YB 3DY9A 1SK6D 1DJYA 1NX3A 2MJWB 2P71A 3CZTX 5K89A 3WHTB 1YTZC 1UURA 3OHMB 4FQOA 3NSKA 3OB1B 1RWYA 2KFFA 4E68A 2KI4B 3PLFB 1QASA 4P5OE 1K96A 2HQWA 4GPLB 2WNDA 1XK4A 3I5HB 1CFPA 1JSAA 3TDUA 3WHUB 2JTTA 1YURA 4HRGA 2F33A 1ZFSA 2H8VA 3O2PA 3IQQA 5DKQA 3JVTB 1UWOA 1BT6A 2F2OA 3FS7A 4OR9B 1CFDA 2ZKMX 2LHIA 2KOTA 3VRQA 2KLEA 4PDZA 2AMIA 5AEQA 4PHJA 2F8PA 2KHNA 5J3XA 3CZ2A 4JPZB 2LANA 3SG3A 1U5IA 1B8CA 4NQGA 1KK7Z 4OV2A 2L2EA 4ETOA 3SG4A 3BOWA 2ZN9A 4QJ5B 1K95A 4MN0A 3V2LA 1NX1A 2K8MB 1D1OA 4I5KA 1S5GY 3PJIA 2L4HA 2M29A 3HCMA 3LK1A 2WCLA 2JULA 4C0LA 2WCMA 2PASA 1TIZA 2LLSA 1WDCC 2ZRSA 3BQ3A 4BY4A 4GFTA 1LKJA 2LUXA 4AQIA 4XJKB 3KPXA 5I2OA 3PALA 1CNPA 2K61A 3CS1A 3OB2B 2BCBA 5DKNA 1FF1A 3BUNB 1Y0VH 2E6WA 1LA3A 1QJTA 2G2BA 2QEHA 1AUIB 1DTLA 3S0FA 3TUYB 1QX7A 2JU0A 1QIWA 1NIWA 2I18A 1R6PA 1F55A 4C0JA 4YGEB 1DT7B 2EGDA 1F70A 1CDLA 1OZSA 2FJYA 4INWA 1K9PA 1WRZA 1A03A 1AHRA 2P70A 4ORBB 4TNCA 2ZNEA 4CFRA 3B86A 2WOSA 2WCHA 3GK2A 1DF0B 1G8IA 2F3ZA 5DKRA 1KWOB 1OW4A 1EH2A 3DF0B 2MHHA 3R1PA 3I5IB 1N65A 3WXAA 2CNPA 3SIAA 1WY9A 1E8AA 3CABA 4DCKA 3SG2A 1G33A 2LUCA 1HT9A 4IL1A 3D0YA 1J55A 3EG5B 3SS3A 1J7QA 3VRRA 1CKKA 1BG1A 1SKTA 1MXEA 4MRYA 1PALA 4M2PA 1J7PA 3AKAA 2F3YA 3I5GB 3DVKA 2FCDA 1B4CA 4YGBB 3IQOA 5F6TA 1J1DA 1Z2CB 1B47A 3CTNA 4PE7A 1QX5B 1NYAA 5FI7A 3SS4A 1SSEB 2EC6C 3TS5B 2K7CA 5FYXA 5D3OA 1XFRA 1TN4A 1XFUO 4WQ2A 4DRWA 1L2OC 1TCOB 2K2FA 2WC6A 5D7FA 1MXLC 3LK0A 3PATA 1GQMA 2HPSA 2OTGB 4DUQA 2BECA 5I2QA 2JRFA 2JZIA 2WCBA 1CLLA 5AFPA 2SASA 2CXJA 1WRLA 2OS8B 1TNPA 3VGOA 1J1EA 2MLFC 1TTXA 2WCKA 1S5GZ 2GGMA 4ZCVA 1L7ZA 2OPOA 2KPHA 3WNXB 1CM1A 1H8BA 3EK4A 2L5XB 1SL9A 2CCMA 1CDMA 1M45A 1JFKA 1DGUA 2JOJA 4KYNA 2JXLA 3DVMA 3NHIA 3O4XA 2KAVA 4HSZA 4F0ZB 1MF8B 3TZ1A 3IF7A 5IBWA 3BUMB 3D10A 1UUSA 4YBHB 3DF0A 1OOGA 1NX2A 4YGCB 4C0KA 1FW4A 4NDDA 4MRXA 4PE0A 4CFQA 2QDIA 5PALA 1UP5A 1DJXA 1BLQA 4MSPA 2QEVA 2KNEA 2Y4QA 1JFJA 3SG5A 1PSRA 5I8NA 1MQ1A 2ZFDA 2WCJA 3FE6A 1DJIA 2FJUB 2I94A 3PFVA 1KWOC 2ZRTA 3OBVA 3K21A 2SCPA 2WCEA 4I5JA 3AAKA 4ZCUA 1YUTA 2L2CA 3EVVA 3QMEA 1ALWA 4JD9A 1AK8A 1KSOA 3R72A 4GAOA 5CSJA 3I5FC 5GQQC 1YX8A 3OP0A 5HL1A 3N7HA 1QIVA 2M1KB 2L51A 2YGUA 1SNLA 3CDNA 1B9AA 3D74A 1EXRA 1OMDA 1XK4C 1B8RA 2MA2A 4MBEA 4JWQA 1CDNA 5FI2A 2PMYA 1JWDA 4CPVA 4NDBA 4MVFA 2O5GA 2MAZA 1S36A 1TRFA 2R2IA 2LNKA 1P28A 2GGZA 3JTDB 3L4LA 3PN7B 4N1GA 5JOLA 1FPWA 2LVVA 1B7TY 3ZNIA 1F4OA 1J7RA 2ERBA 1W9ZA 1KFUL 1Y1XA 1UHHA 2FOTA 3K1EA 1JC2A 1FI5A 1SCVA 2MLEC 2CT9A 3CLNA 1JBAA 2BAPA 1KFUS 1BOCA 3CGAA 3L47A 3CZ1A 1SCMB 4YGDB 4UPGA 4CLNA 3VB1A 2WCFA 1XO5A 3D73A 3O4YA 1S6JA 3SS5A 1HQVA 5KTYA 1W7IB 1RFJA 2LHLA 3EVUA 1KQMB 1M31A 2KAYA 1RK9A 2Y5IA 3KHEA 4MZLA 1QVIY 4ORCB 2LVKA 1KSMA 1BODA 1IJ6A 1WLMA 4YI8A 5FI6A 3GK4X 3CR2A 1KK8B 1K2HA 1MUXA 1MHOA 1PVAA 1M39A 4F7FA 1A2XA 4BY5A 1CLMA 1WRKA 1SR6B 1XFXO 2BCXA 3F45A 4PCWA 1CFFA 3C1VA 1DC1A 3R1OA 4USLA 2H61A 1OSAA 2M9GA 5AXIA 2KI4C 1UHNA 2BKHB 3BXKA 3SIBA 1BR1B 2WC5A 2KSPA 1PVBA 1K90D 4I5LB 4MZJA 2JT3A 1K94A 2L98A 1CLBA 1XA5A 5EL2A 1QX2A 1OMRA 1ZMZA 3KF9A 1IQ3A 3I5HC 2BKIB 1IJ5A 4PHKA 1LXFC 2LV7A 1IQ5A 1LINA 2BE6A 2TN4A 4Q04A 1CB1A 4MEWA 2FCEA 4ORAB 4OZDA 4DS7A 3A4UB 1BJFA 3JVTC 1A29A 1MR8A 1AJ5A 4GGFA 4GBAA 5DICA 2L5YA 1Y1UA 2JC2A 1DJGA 1M63B 1ORGA 3D76A 1WLZA 1GM0A 2PRUA 2PYQA 4XJKA 3RM1A 1N0YA 2JXCA 1IGVA 5JJGA 1CFCA 3PM8A 2LCPA 2PVBA 3GOFA 1UHIA 1N2DA 4ICBA 1YRTB 4YGAA 2VRGA 1B1GA 2K7OA 4DIRA 5ER4X 3NSIA 1IRJA 2JT0A 2KI6D 1SL8A 2LM5A 1C7VA 1AJ4A 3JTDC 2LP2A 1JF0A 2GV5A 2M7NA 1QWVA 1AP4A 3NXAA 1ZOTB 3PSRA 1DQEA 1NCXA 2D8NA 1SPYA 2M1UA 1F71A 2K7DA 3NHTA 2NXQA 1B7TZ 3CR5X 4D1EA 4XYNA 1AVSA 5CSNA 2WORA 2L0PA 1WDCB 5TNCA 2KQYA 1DF0A 2NCOA 1DGVA 3EKHA 1EG4A 5G08A 3VROA 3NSOA 1DMOA 1ZUZA 2QACA 2RGIA 3B6XA 2M0RA 3TUYC 1TUZA 1TWOA 1U5IB 3AAJA 1GGWA 1QATA 1SRAA 1XFZO 3BOWB 4PALA 1IIOA 1NX0A 1XFWO 2NZ0A 1PRWA 1OZOA 1VRKA 4YRUA 1YRUB 1TOPA 2QPTA 3B7AA 1NP8A 1OMVA 2LLUA 3DYEA 4M2OA 1TUJA 1Z4HA 3R1VA 2NCPA 1BU3A 1CTRA 1QVIZ 2EHBA 2LAPA 3FIAA 5HKWA 3RLZA 1DVIA 1SW8A 4PE4A 2KGBC 1DELA 2KAXA 1PSBA 1ZACA 1K93D 4GNKB 5HLVA 5HKYA 1K9UA 2L4IA 1KQVA 1Y6WA 4I5NB 1QV1A 1QLSA 3NSLA 3I5IC 2K60A 2HETA 4WQ3A 2LMVA 1OE9B 1C7WA 3H4SE 1FI6A 2ZNDA 3IVTA 3TDIA 1DJZA 4AQJA 3L4AA 1TNQA 1QV0A 2BE4A 2KI6C 1A4PA 2BCAA 1NCZA 4A4BA 1ODBA
chains in the Genus database with same CATH topology
3LCPC 1S26D 3DVJA 1A75B 1YUUA 4A4CA 3I5GC 2H2KA 1XYDA 2Q4UA 3LL8B 5HLOA 1XFVO 3VRPA 4U8DA 4QJ4B 4YI9A 2LC5A 1F4QA 4GUKA 3ICBA 1W7JB 1EL4A 2G9BA 1LVCD 2B1UA 3CR4X 3TS5C 3O6BA 2HQ8A 2KYFA 3O78A 4PE1A 3EKJA 1FBVA 2KFHA 2COLB 3EK8A 3VRNA 1XFYO 2EC6B 1M46A 1V1FA 1R2UA 1CMGA 1NWDA 1JF2A 1IWQA 2JPTA 1PULA 1SL7A 1V1GA 1XVJA 2OTGC 3OX5A 2Q91A 1IKUA 2KGRA 1L2OB 2KBMA 3D0YB 4MZKA 3AKBA 1B8LA 2OS8C 3E3RA 2BL0B 1Q80A 4R1EA 5HYDA 1H4BA 2CBLA 2P6BB 1Y1AA 2K2AA 5BPJA 1NPQA 1KCYA 2M3WA 2JWWA 1K8UA 5KSZA 2LVIA 1G4YR 2LLTA 1JUOA 5AERA 4AOMA 1LA0A 1RROA 1SMGA 4OVNF 5B8IB 1YR5A 4PHMA 1F8HA 1YX7A 5I2LA 2M7LA 2LMUA 3A8RA 1ALVA 2MRDA 1S6CA 1QXPA 4OKHA 2E30A 5ER5A 1EJ3A 2O60A 4PHNA 3FWCA 1BMOA 1UHKA 1TNWA 2Y1MA 1S6IA 2V53A 1DJHA 1KFXL 4N1FA 2IS9A 2KFGA 1J7OA 1A75A 2DOQA 1NSHA 2LE9B 3SJSA 1F54A 2MBXA 1KFXS 1EG3A 2K0JA 1YVHA 3KO0A 1NUBA 3TDZA 5AANA 2PSRA 2ZN8A 1IG5A 2LVJA 3BUOB 2H61C 2M97A 1YUSA 4JQ0D 5CSFA 2ISDA 4CIDA 1C07A 3LLEA 1OOJA 1QTXA 4N5XA 1RTP1 2L50A 3M0WA 2KQ6A 3I5FB 3GK1A 1KK7Y 4NDCA 4OCIA 4WRIA 3HX4A 1BF5A 1TNXA 1CDPA 1TCFA 2BBNA 4L9MA 2JNFA 1SY9A 1OQPA 3PN7C 1GJYA 1SBJA 4GGFC 1RECA 2JNXA 2I2RE 3BUWB 3OX6A 3EK7A 4GGNA 3DD4A 5CPVA 3FWBA 1S3PA 2NLNA 1S1EA 2CTNA 1CM4A 2I7AA 3QRXA 3ZWHA 4MLWA 3DVEA 2LMTA 5D69A 4HREE 4M2QA 5KU1A 2PALA 2JQ6A 1SCMC 1QS7A 2AUCA 2M49B 5HKZA 5CSIA 3BUXB 2JT8A 3EVRA 1BR4B 2HF5A 2BL0C 1PK0D 1DJWA 2A4JA 2JTZA 1YVLA 1KQMC 2WC8A 2Y1NA 1SYMA 2AAOA 1RJVA 3SG7A 2LP3A 1NCYA 3SG6A 1GGZA 2KDHA 2F2PA 2BBMA 2M8UA 1MWNA 1UHJA 1KK8C 2K7BA 2KYCA 3CWGA 1CMFA 3BYAA 1QLKA 4FTGA 3WXAA 3KEVA 1SR6C 4HRHA 4QJ3B 1IH0A 2KBIA 3MSEB 1K9KA 1X02A 4P2YB 1SK6D 1DJYA 1NX3A 2MJWB 3CZTX 5K89A 1YTZC 1UURA 3OHMB 4FQOA 3NSKA 3OB1B 1RWYA 2KFFA 4E68A 2KI4B 3PLFB 1QASA 4P5OE 1K96A 2HQWA 4GPLB 2WNDA 1XK4A 3I5HB 1CFPA 1JSAA 3TDUA 3WHUB 2JTTA 1YURA 4HRGA 2F33A 1ZFSA 3O2PA 3IQQA 5DKQA 3JVTB 1UWOA 1BT6A 2F2OA 3FS7A 4OR9B 1CFDA 2ZKMX 2LHIA 2KOTA 3VRQA 4PDZA 3RM1A 2AMIA 5AEQA 4PHJA 2F8PA 2KHNA 5J3XA 4JPZB 2LANA 3SG3A 1U5IA 1B8CA 4NQGA 1KK7Z 4OV2A 2L2EA 4ETOA 3SG4A 3BOWA 2ZN9A 4QJ5B 1K95A 4MN0A 1NX1A 2K8MB 1D1OA 4I5KA 1S5GY 2L4HA 2M29A 3HCMA 3LK1A 2JULA 4C0LA 2PASA 1TIZA 2LLSA 1WDCC 2ZRSA 3BQ3A 4BY4A 4GFTA 1LKJA 2LUXA 4AQIA 4XJKB 3KPXA 5I2OA 3PALA 1CNPA 2K61A 3CS1A 3OB2B 2BCBA 5DKNA 1FF1A 3BUNB 1Y0VH 2E6WA 1LA3A 1QJTA 2G2BA 1AUIB 1DTLA 3TUYB 1QX7A 2JU0A 1QIWA 1NIWA 2I18A 1R6PA 1F55A 4C0JA 4YGEB 1DT7B 2EGDA 1F70A 1CDLA 1OZSA 1K9PA 1WRZA 1A03A 1AHRA 4ORBB 4TNCA 2ZNEA 4CFRA 2WOSA 3GK2A 1DF0B 1G8IA 2F3ZA 5DKRA 1KWOB 1EH2A 3DF0B 2MHHA 3I5IB 1N65A 2CNPA 3SIAA 1WY9A 1E8AA 4DCKA 3SG2A 1G33A 2LUCA 1HT9A 4IL1A 3D0YA 1J55A 1J7QA 3VRRA 1CKKA 1BG1A 1SKTA 1MXEA 4MRYA 1PALA 4M2PA 1J7PA 3AKAA 2F3YA 3I5GB 3DVKA 2FCDA 1B4CA 4YGBB 3IQOA 5F6TA 1J1DA 1B47A 3CTNA 4PE7A 1QX5B 1NYAA 2EC6C 3TS5B 2K7CA 5FYXA 1TN4A 1XFUO 4WQ2A 4DRWA 1L2OC 1TCOB 2K2FA 5D7FA 1MXLC 3LK0A 3PATA 1GQMA 2HPSA 2OTGB 4DUQA 2BECA 5I2QA 2JRFA 2JZIA 2WCBA 1CLLA 5AFPA 2SASA 2CXJA 1WRLA 2OS8B 1TNPA 3VGOA 1J1EA 2MLFC 1TTXA 1S5GZ 2GGMA 4ZCVA 1L7ZA 2OPOA 3WNXB 1CM1A 1H8BA 3EK4A 2L5XB 1SL9A 2CCMA 1CDMA 1M45A 1JFKA 1DGUA 2JOJA 2JXLA 3DVMA 2KAVA 4HSZA 4F0ZB 1MF8B 3TZ1A 3IF7A 5IBWA 3BUMB 3D10A 1UUSA 4YBHB 3DF0A 4YGCB 1NX2A 4C0KA 1FW4A 4NDDA 4MRXA 4PE0A 4CFQA 5PALA 1UP5A 1DJXA 1BLQA 4MSPA 2KNEA 2Y4QA 1JFJA 3SG5A 1PSRA 5I8NA 1MQ1A 2ZFDA 1DJIA 2FJUB 2I94A 3PFVA 1KWOC 2ZRTA 3K21A 2SCPA 2WCEA 4I5JA 3AAKA 4ZCUA 1YUTA 3EVVA 1ALWA 1AK8A 1KSOA 4GAOA 5CSJA 3I5FC 5GQQC 1YX8A 3OP0A 1QIVA 2M1KB 2L51A 1SNLA 1B9AA 1EXRA 1OMDA 1XK4C 1B8RA 2MA2A 4MBEA 4JWQA 1CDNA 1JWDA 2PMYA 4CPVA 4NDBA 4MVFA 2O5GA 2MAZA 1S36A 1TRFA 2R2IA 2LNKA 3JTDB 2GGZA 3PN7B 4N1GA 5JOLA 1FPWA 2LVVA 1B7TY 3ZNIA 1F4OA 1J7RA 1KFUL 1Y1XA 1UHHA 2FOTA 1JC2A 1FI5A 1SCVA 2MLEC 2CT9A 3CLNA 1JBAA 1KFUS 1BOCA 3CGAA 1SCMB 4YGDB 4UPGA 4CLNA 2WCFA 1XO5A 3O4YA 1S6JA 1HQVA 5KTYA 1W7IB 1RFJA 2LHLA 3EVUA 1KQMB 1M31A 2KAYA 1RK9A 2Y5IA 3KHEA 4MZLA 1QVIY 4ORCB 2LVKA 1KSMA 1BODA 1IJ6A 1WLMA 4YI8A 3GK4X 3CR2A 1KK8B 1K2HA 1MUXA 1MHOA 1PVAA 1M39A 1A2XA 4BY5A 1CLMA 1WRKA 1SR6B 1XFXO 2BCXA 3F45A 4PCWA 1CFFA 3C1VA 4USLA 2H61A 1OSAA 2M9GA 5AXIA 2KI4C 1UHNA 2BKHB 3BXKA 3SIBA 1BR1B 2KSPA 1PVBA 1K90D 4I5LB 4MZJA 2JT3A 1K94A 2L98A 1CLBA 1XA5A 1QX2A 1OMRA 1ZMZA 3KF9A 1IQ3A 3I5HC 2BKIB 1IJ5A 4PHKA 1LXFC 2LV7A 1IQ5A 1LINA 2BE6A 2TN4A 4Q04A 1CB1A 4MEWA 2FCEA 4ORAB 4DS7A 3A4UB 1BJFA 3JVTC 1A29A 1MR8A 1AJ5A 4GGFA 4GBAA 1Y1UA 2JC2A 1DJGA 1M63B 1WLZA 2PRUA 4XJKA 5JJGA 1N0YA 2JXCA 1IGVA 1CFCA 3PM8A 2LCPA 2PVBA 3GOFA 1UHIA 1N2DA 4ICBA 1YRTB 4YGAA 2VRGA 1B1GA 2K7OA 4DIRA 5ER4X 3NSIA 1IRJA 2JT0A 2KI6D 1SL8A 2LM5A 1C7VA 1AJ4A 3JTDC 2LP2A 1JF0A 2GV5A 2M7NA 1AP4A 3NXAA 1ZOTB 3PSRA 1NCXA 2D8NA 1SPYA 2M1UA 1F71A 2K7DA 2NXQA 1B7TZ 3CR5X 4D1EA 4XYNA 1AVSA 5CSNA 2WORA 2L0PA 1WDCB 5TNCA 2KQYA 1DF0A 2NCOA 1DGVA 3EKHA 1EG4A 5G08A 3VROA 3NSOA 1DMOA 1ZUZA 2QACA 2RGIA 2M0RA 3TUYC 1U5IB 3AAJA 1GGWA 1QATA 1SRAA 1XFZO 3BOWB 4PALA 1NX0A 1XFWO 2NZ0A 1PRWA 1OZOA 1VRKA 4YRUA 1YRUB 1TOPA 2QPTA 4M2OA 1NP8A 1OMVA 2LLUA 3WHTB 2NCPA 1BU3A 1CTRA 1QVIZ 2EHBA 2LAPA 3FIAA 5HKWA 3RLZA 1DVIA 1SW8A 4PE4A 2KGBC 2KAXA 1PSBA 1ZACA 1K93D 4GNKB 5HLVA 5HKYA 1K9UA 2L4IA 1KQVA 1Y6WA 4I5NB 1QV1A 1QLSA 3NSLA 3I5IC 2HETA 4WQ3A 2LMVA 1OE9B 1C7WA 3H4SE 1FI6A 2ZNDA 3TDIA 1DJZA 4AQJA 1TNQA 1QV0A 2BE4A 2KI6C 1A4PA 2BCAA 1NCZA 4A4BA 1ODBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LCP C;  1S26 D;  3DVJ A;  1A75 B;  1YUU A;  4A4C A;  3I5G C;  2H2K A;  1XYD A;  2Q4U A;  3LL8 B;  5HLO A;  1XFV O;  3VRP A;  4U8D A;  4QJ4 B;  4YI9 A;  2LC5 A;  1F4Q A;  4GUK A;  3ICB A;  1W7J B;  1EL4 A;  2G9B A;  1LVC D;  2B1U A;  3CR4 X;  3TS5 C;  3O6B A;  2HQ8 A;  2KYF A;  3O78 A;  4PE1 A;  3EKJ A;  1FBV A;  2KFH A;  2COL B;  3EK8 A;  3VRN A;  1XFY O;  2EC6 B;  1M46 A;  1V1F A;  1R2U A;  1CMG A;  1NWD A;  1JF2 A;  1IWQ A;  2JPT A;  1PUL A;  1SL7 A;  1V1G A;  1XVJ A;  2OTG C;  3OX5 A;  2Q91 A;  1IKU A;  2KGR A;  1L2O B;  2KBM A;  3D0Y B;  4MZK A;  3AKB A;  1B8L A;  2OS8 C;  3E3R A;  2BL0 B;  1Q80 A;  4R1E A;  5HYD A;  1H4B A;  2CBL A;  2P6B B;  1Y1A A;  2K2A A;  5BPJ A;  1NPQ A;  1KCY A;  2M3W A;  2JWW A;  1K8U A;  5KSZ A;  2LVI A;  1G4Y R;  2LLT A;  1JUO A;  5AER A;  4AOM A;  1LA0 A;  1RRO A;  1SMG A;  4OVN F;  5B8I B;  1YR5 A;  4PHM A;  1F8H A;  1YX7 A;  5I2L A;  2M7L A;  2LMU A;  3A8R A;  1ALV A;  2MRD A;  1S6C A;  1QXP A;  4OKH A;  2E30 A;  5ER5 A;  1EJ3 A;  2O60 A;  4PHN A;  3FWC A;  1BMO A;  1UHK A;  1TNW A;  2Y1M A;  1S6I A;  2V53 A;  1DJH A;  1KFX L;  4N1F A;  2IS9 A;  2KFG A;  1J7O A;  1A75 A;  2DOQ A;  1NSH A;  2LE9 B;  3SJS A;  1F54 A;  2MBX A;  1KFX S;  1EG3 A;  2K0J A;  1YVH A;  3KO0 A;  1NUB A;  3TDZ A;  5AAN A;  2PSR A;  2ZN8 A;  1IG5 A;  2LVJ A;  3BUO B;  2H61 C;  2M97 A;  1YUS A;  4JQ0 D;  5CSF A;  2ISD A;  4CID A;  1C07 A;  3LLE A;  1OOJ A;  1QTX A;  4N5X A;  1RTP 1;  2L50 A;  3M0W A;  2KQ6 A;  3I5F B;  3GK1 A;  1KK7 Y;  4NDC A;  4OCI A;  4WRI A;  3HX4 A;  1BF5 A;  1TNX A;  1CDP A;  1TCF A;  2BBN A;  4L9M A;  2JNF A;  1SY9 A;  1OQP A;  3PN7 C;  1GJY A;  1SBJ A;  4GGF C;  1REC A;  2JNX A;  2I2R E;  3BUW B;  3OX6 A;  3EK7 A;  4GGN A;  3DD4 A;  5CPV A;  3FWB A;  1S3P A;  2NLN A;  1S1E A;  2CTN A;  1CM4 A;  2I7A A;  3QRX A;  3ZWH A;  4MLW A;  3DVE A;  2LMT A;  5D69 A;  4HRE E;  4M2Q A;  5KU1 A;  2PAL A;  2JQ6 A;  1SCM C;  1QS7 A;  2AUC A;  2M49 B;  5HKZ A;  5CSI A;  3BUX B;  2JT8 A;  3EVR A;  1BR4 B;  2HF5 A;  2BL0 C;  1PK0 D;  1DJW A;  2A4J A;  2JTZ A;  1YVL A;  1KQM C;  2WC8 A;  2Y1N A;  1SYM A;  2AAO A;  1RJV A;  3SG7 A;  2LP3 A;  1NCY A;  3SG6 A;  1GGZ A;  2KDH A;  2F2P A;  2BBM A;  2M8U A;  1MWN A;  1UHJ A;  1KK8 C;  2K7B A;  2KYC A;  3CWG A;  1CMF A;  3BYA A;  1QLK A;  4FTG A;  3WXA A;  3KEV A;  1SR6 C;  4HRH A;  4QJ3 B;  1IH0 A;  2KBI A;  3MSE B;  1K9K A;  1X02 A;  4P2Y B;  1SK6 D;  1DJY A;  1NX3 A;  2MJW B;  3CZT X;  5K89 A;  1YTZ C;  1UUR A;  3OHM B;  4FQO A;  3NSK A;  3OB1 B;  1RWY A;  2KFF A;  4E68 A;  2KI4 B;  3PLF B;  1QAS A;  4P5O E;  1K96 A;  2HQW A;  4GPL B;  2WND A;  1XK4 A;  3I5H B;  1CFP A;  1JSA A;  3TDU A;  3WHU B;  2JTT A;  1YUR A;  4HRG A;  2F33 A;  1ZFS A;  3O2P A;  3IQQ A;  5DKQ A;  3JVT B;  1UWO A;  1BT6 A;  2F2O A;  3FS7 A;  4OR9 B;  1CFD A;  2ZKM X;  2LHI A;  2KOT A;  3VRQ A;  4PDZ A;  3RM1 A;  2AMI A;  5AEQ A;  4PHJ A;  2F8P A;  2KHN A;  5J3X A;  4JPZ B;  2LAN A;  3SG3 A;  1U5I A;  1B8C A;  4NQG A;  1KK7 Z;  4OV2 A;  2L2E A;  4ETO A;  3SG4 A;  3BOW A;  2ZN9 A;  4QJ5 B;  1K95 A;  4MN0 A;  1NX1 A;  2K8M B;  1D1O A;  4I5K A;  1S5G Y;  2L4H A;  2M29 A;  3HCM A;  3LK1 A;  2JUL A;  4C0L A;  2PAS A;  1TIZ A;  2LLS A;  1WDC C;  2ZRS A;  3BQ3 A;  4BY4 A;  4GFT A;  1LKJ A;  2LUX A;  4AQI A;  4XJK B;  3KPX A;  5I2O A;  3PAL A;  1CNP A;  2K61 A;  3CS1 A;  3OB2 B;  2BCB A;  5DKN A;  1FF1 A;  3BUN B;  1Y0V H;  2E6W A;  1LA3 A;  1QJT A;  2G2B A;  1AUI B;  1DTL A;  3TUY B;  1QX7 A;  2JU0 A;  1QIW A;  1NIW A;  2I18 A;  1R6P A;  1F55 A;  4C0J A;  4YGE B;  1DT7 B;  2EGD A;  1F70 A;  1CDL A;  1OZS A;  1K9P A;  1WRZ A;  1A03 A;  1AHR A;  4ORB B;  4TNC A;  2ZNE A;  4CFR A;  2WOS A;  3GK2 A;  1DF0 B;  1G8I A;  2F3Z A;  5DKR A;  1KWO B;  1EH2 A;  3DF0 B;  2MHH A;  3I5I B;  1N65 A;  2CNP A;  3SIA A;  1WY9 A;  1E8A A;  4DCK A;  3SG2 A;  1G33 A;  2LUC A;  1HT9 A;  4IL1 A;  3D0Y A;  1J55 A;  1J7Q A;  3VRR A;  1CKK A;  1BG1 A;  1SKT A;  1MXE A;  4MRY A;  1PAL A;  4M2P A;  1J7P A;  3AKA A;  2F3Y A;  3I5G B;  3DVK A;  2FCD A;  1B4C A;  4YGB B;  3IQO A;  5F6T A;  1J1D A;  1B47 A;  3CTN A;  4PE7 A;  1QX5 B;  1NYA A;  2EC6 C;  3TS5 B;  2K7C A;  5FYX A;  1TN4 A;  1XFU O;  4WQ2 A;  4DRW A;  1L2O C;  1TCO B;  2K2F A;  5D7F A;  1MXL C;  3LK0 A;  3PAT A;  1GQM A;  2HPS A;  2OTG B;  4DUQ A;  2BEC A;  5I2Q A;  2JRF A;  2JZI A;  2WCB A;  1CLL A;  5AFP A;  2SAS A;  2CXJ A;  1WRL A;  2OS8 B;  1TNP A;  3VGO A;  1J1E A;  2MLF C;  1TTX A;  1S5G Z;  2GGM A;  4ZCV A;  1L7Z A;  2OPO A;  3WNX B;  1CM1 A;  1H8B A;  3EK4 A;  2L5X B;  1SL9 A;  2CCM A;  1CDM A;  1M45 A;  1JFK A;  1DGU A;  2JOJ A;  2JXL A;  3DVM A;  2KAV A;  4HSZ A;  4F0Z B;  1MF8 B;  3TZ1 A;  3IF7 A;  5IBW A;  3BUM B;  3D10 A;  1UUS A;  4YBH B;  3DF0 A;  4YGC B;  1NX2 A;  4C0K A;  1FW4 A;  4NDD A;  4MRX A;  4PE0 A;  4CFQ A;  5PAL A;  1UP5 A;  1DJX A;  1BLQ A;  4MSP A;  2KNE A;  2Y4Q A;  1JFJ A;  3SG5 A;  1PSR A;  5I8N A;  1MQ1 A;  2ZFD A;  1DJI A;  2FJU B;  2I94 A;  3PFV A;  1KWO C;  2ZRT A;  3K21 A;  2SCP A;  2WCE A;  4I5J A;  3AAK A;  4ZCU A;  1YUT A;  3EVV A;  1ALW A;  1AK8 A;  1KSO A;  4GAO A;  5CSJ A;  3I5F C;  5GQQ C;  1YX8 A;  3OP0 A;  1QIV A;  2M1K B;  2L51 A;  1SNL A;  1B9A A;  1EXR A;  1OMD A;  1XK4 C;  1B8R A;  2MA2 A;  4MBE A;  4JWQ A;  1CDN A;  1JWD A;  2PMY A;  4CPV A;  4NDB A;  4MVF A;  2O5G A;  2MAZ A;  1S36 A;  1TRF A;  2R2I A;  2LNK A;  3JTD B;  2GGZ A;  3PN7 B;  4N1G A;  5JOL A;  1FPW A;  2LVV A;  1B7T Y;  3ZNI A;  1F4O A;  1J7R A;  1KFU L;  1Y1X A;  1UHH A;  2FOT A;  1JC2 A;  1FI5 A;  1SCV A;  2MLE C;  2CT9 A;  3CLN A;  1JBA A;  1KFU S;  1BOC A;  3CGA A;  1SCM B;  4YGD B;  4UPG A;  4CLN A;  2WCF A;  1XO5 A;  3O4Y A;  1S6J A;  1HQV A;  5KTY A;  1W7I B;  1RFJ A;  2LHL A;  3EVU A;  1KQM B;  1M31 A;  2KAY A;  1RK9 A;  2Y5I A;  3KHE A;  4MZL A;  1QVI Y;  4ORC B;  2LVK A;  1KSM A;  1BOD A;  1IJ6 A;  1WLM A;  4YI8 A;  3GK4 X;  3CR2 A;  1KK8 B;  1K2H A;  1MUX A;  1MHO A;  1PVA A;  1M39 A;  1A2X A;  4BY5 A;  1CLM A;  1WRK A;  1SR6 B;  1XFX O;  2BCX A;  3F45 A;  4PCW A;  1CFF A;  3C1V A;  4USL A;  2H61 A;  1OSA A;  2M9G A;  5AXI A;  2KI4 C;  1UHN A;  2BKH B;  3BXK A;  3SIB A;  1BR1 B;  2KSP A;  1PVB A;  1K90 D;  4I5L B;  4MZJ A;  2JT3 A;  1K94 A;  2L98 A;  1CLB A;  1XA5 A;  1QX2 A;  1OMR A;  1ZMZ A;  3KF9 A;  1IQ3 A;  3I5H C;  2BKI B;  1IJ5 A;  4PHK A;  1LXF C;  2LV7 A;  1IQ5 A;  1LIN A;  2BE6 A;  2TN4 A;  4Q04 A;  1CB1 A;  4MEW A;  2FCE A;  4ORA B;  4DS7 A;  3A4U B;  1BJF A;  3JVT C;  1A29 A;  1MR8 A;  1AJ5 A;  4GGF A;  4GBA A;  1Y1U A;  2JC2 A;  1DJG A;  1M63 B;  1WLZ A;  2PRU A;  4XJK A;  5JJG A;  1N0Y A;  2JXC A;  1IGV A;  1CFC A;  3PM8 A;  2LCP A;  2PVB A;  3GOF A;  1UHI A;  1N2D A;  4ICB A;  1YRT B;  4YGA A;  2VRG A;  1B1G A;  2K7O A;  4DIR A;  5ER4 X;  3NSI A;  1IRJ A;  2JT0 A;  2KI6 D;  1SL8 A;  2LM5 A;  1C7V A;  1AJ4 A;  3JTD C;  2LP2 A;  1JF0 A;  2GV5 A;  2M7N A;  1AP4 A;  3NXA A;  1ZOT B;  3PSR A;  1NCX A;  2D8N A;  1SPY A;  2M1U A;  1F71 A;  2K7D A;  2NXQ A;  1B7T Z;  3CR5 X;  4D1E A;  4XYN A;  1AVS A;  5CSN A;  2WOR A;  2L0P A;  1WDC B;  5TNC A;  2KQY A;  1DF0 A;  2NCO A;  1DGV A;  3EKH A;  1EG4 A;  5G08 A;  3VRO A;  3NSO A;  1DMO A;  1ZUZ A;  2QAC A;  2RGI A;  2M0R A;  3TUY C;  1U5I B;  3AAJ A;  1GGW A;  1QAT A;  1SRA A;  1XFZ O;  3BOW B;  4PAL A;  1NX0 A;  1XFW O;  2NZ0 A;  1PRW A;  1OZO A;  1VRK A;  4YRU A;  1YRU B;  1TOP A;  2QPT A;  4M2O A;  1NP8 A;  1OMV A;  2LLU A;  3WHT B;  2NCP A;  1BU3 A;  1CTR A;  1QVI Z;  2EHB A;  2LAP A;  3FIA A;  5HKW A;  3RLZ A;  1DVI A;  1SW8 A;  4PE4 A;  2KGB C;  2KAX A;  1PSB A;  1ZAC A;  1K93 D;  4GNK B;  5HLV A;  5HKY A;  1K9U A;  2L4I A;  1KQV A;  1Y6W A;  4I5N B;  1QV1 A;  1QLS A;  3NSL A;  3I5I C;  2HET A;  4WQ3 A;  2LMV A;  1OE9 B;  1C7W A;  3H4S E;  1FI6 A;  2ZND A;  3TDI A;  1DJZ A;  4AQJ A;  1TNQ A;  1QV0 A;  2BE4 A;  2KI6 C;  1A4P A;  2BCA A;  1NCZ A;  4A4B A;  1ODB A; 
#chains in the Genus database with same CATH topology
 3LCP C;  1S26 D;  3DVJ A;  1A75 B;  1YUU A;  4A4C A;  3OGN A;  3I5G C;  2H2K A;  2PQL A;  4PT1 A;  1XYD A;  2Q4U A;  3LL8 B;  5HLO A;  1XFV O;  3VRP A;  4U8D A;  4QJ4 B;  4YI9 A;  2LC5 A;  1F4Q A;  4GUK A;  3UNW A;  3ICB A;  1W7J B;  1EL4 A;  2G9B A;  1LVC D;  2B1U A;  3CR4 X;  3TS5 C;  3O6B A;  3B87 A;  3BFA A;  2HQ8 A;  2KYF A;  3O78 A;  4PE1 A;  3EKJ A;  1FBV A;  2KFH A;  2COL B;  3EK8 A;  3VRN A;  1C3Y A;  1XFY O;  1DEK A;  1M46 A;  1V1F A;  1R2U A;  2EC6 B;  1NWD A;  1JF2 A;  1CMG A;  1IWQ A;  3PM2 A;  2JPT A;  1PUL A;  1SL7 A;  1V1G A;  1XVJ A;  2OTG C;  3OX5 A;  2Q91 A;  3S0E A;  1IKU A;  2KGR A;  1L2O B;  2KBM A;  3D0Y B;  4MZK A;  3AKB A;  3CYZ A;  3S0A A;  1B8L A;  2OS8 C;  3E3R A;  4IJ7 A;  2BL0 B;  1Q80 A;  4R1E A;  5HYD A;  1H4B A;  2CBL A;  2P6B B;  3NGV A;  1Y1A A;  2K2A A;  5BPJ A;  1NPQ A;  1KCY A;  2M3W A;  2JWW A;  1K8U A;  5KSZ A;  2LVI A;  3DXL A;  1G4Y R;  2LLT A;  1JUO A;  5AER A;  4AOM A;  1LA0 A;  3UO9 A;  1RRO A;  1SMG A;  4OVN F;  3FE9 A;  1YR5 A;  4PHM A;  5B8I B;  1F8H A;  1YX7 A;  5I2L A;  2M7L A;  2LMU A;  3A8R A;  1ALV A;  2MRD A;  1S6C A;  1QXP A;  4OKH A;  2E30 A;  5ER5 A;  1EJ3 A;  2O60 A;  4PHN A;  3FWC A;  1OOH A;  1BMO A;  3D75 A;  1UHK A;  1TNW A;  2Y1M A;  1S6I A;  2V53 A;  1DJH A;  1KFX L;  4INX A;  2IS9 A;  2KFG A;  4N1F A;  1A75 A;  2DOQ A;  1J7O A;  1NSH A;  2LE9 B;  3SJS A;  1F54 A;  2MBX A;  3FE8 A;  1KFX S;  1EG3 A;  2K0J A;  1YVH A;  3RZS A;  3KO0 A;  1NUB A;  3S0G A;  5AAN A;  3TDZ A;  2PSR A;  2ZN8 A;  1IG5 A;  1LS8 A;  2LVJ A;  2H61 C;  2M97 A;  1YUS A;  3BUO B;  4JQ0 D;  5CSF A;  2ISD A;  4CID A;  1C07 A;  3LLE A;  2GTE A;  4JKT A;  1OOJ A;  1QTX A;  2KLD A;  4N5X A;  1RTP 1;  2L50 A;  3D78 A;  3M0W A;  2KQ6 A;  3I5F B;  3GK1 A;  1KK7 Y;  2BNX A;  4NDC A;  4OCI A;  3S0B A;  4WRI A;  3HX4 A;  3Q8I A;  1TNX A;  1BF5 A;  1CDP A;  1TCF A;  1OOF A;  2BBN A;  4L9M A;  2JNF A;  1SY9 A;  1OQP A;  3BFB A;  3PN7 C;  1C3Z A;  1GJY A;  1SBJ A;  4GGF C;  1REC A;  2JNX A;  2I2R E;  3BUW B;  3OX6 A;  3EK7 A;  4GGN A;  3DD4 A;  5CPV A;  3BJH A;  3FWB A;  3S0D A;  1S3P A;  2NLN A;  1S1E A;  2CTN A;  1CM4 A;  2I7A A;  2JPO A;  2QEB A;  3QRX A;  2QEO A;  3ZWH A;  4MLW A;  3DVE A;  2LMT A;  5D69 A;  4HRE E;  4M2Q A;  5KU1 A;  2PAL A;  1T14 A;  2JQ6 A;  1SCM C;  1QS7 A;  2AUC A;  2M49 B;  5HKZ A;  5CSI A;  5I94 A;  3BUX B;  2JT8 A;  3EVR A;  3DZT A;  1BR4 B;  2HF5 A;  2BL0 C;  1PK0 D;  1DJW A;  2A4J A;  2JTZ A;  1YVL A;  1KQM C;  2WC8 A;  2Y1N A;  1SYM A;  2AAO A;  1RJV A;  3BFH A;  1OOI X;  3B88 A;  2LP3 A;  3SG7 A;  1NCY A;  3SG6 A;  4FQT A;  1GGZ A;  2KDH A;  2F2P A;  2BBM A;  2M8U A;  1MWN A;  1UHJ A;  1KK8 C;  2K7B A;  2KYC A;  3CWG A;  1CMF A;  3BYA A;  1QLK A;  4FTG A;  3CZ0 A;  3KEV A;  1SR6 C;  3D77 A;  4HRH A;  4QJ3 B;  2KBI A;  3MSE B;  1K9K A;  1X02 A;  1IH0 A;  4P2Y B;  3DY9 A;  1SK6 D;  1DJY A;  1NX3 A;  2MJW B;  2P71 A;  3CZT X;  5K89 A;  3WHT B;  1YTZ C;  1UUR A;  3OHM B;  4FQO A;  3NSK A;  3OB1 B;  1RWY A;  2KFF A;  4E68 A;  2KI4 B;  3PLF B;  1QAS A;  4P5O E;  1K96 A;  2HQW A;  4GPL B;  2WND A;  1XK4 A;  3I5H B;  1CFP A;  1JSA A;  3TDU A;  3WHU B;  2JTT A;  1YUR A;  4HRG A;  2F33 A;  1ZFS A;  2H8V A;  3O2P A;  3IQQ A;  5DKQ A;  3JVT B;  1UWO A;  1BT6 A;  2F2O A;  3FS7 A;  4OR9 B;  1CFD A;  2ZKM X;  2LHI A;  2KOT A;  3VRQ A;  2KLE A;  4PDZ A;  2AMI A;  5AEQ A;  4PHJ A;  2F8P A;  2KHN A;  5J3X A;  3CZ2 A;  4JPZ B;  2LAN A;  3SG3 A;  1U5I A;  1B8C A;  4NQG A;  1KK7 Z;  4OV2 A;  2L2E A;  4ETO A;  3SG4 A;  3BOW A;  2ZN9 A;  4QJ5 B;  1K95 A;  4MN0 A;  3V2L A;  1NX1 A;  2K8M B;  1D1O A;  4I5K A;  1S5G Y;  3PJI A;  2L4H A;  2M29 A;  3HCM A;  3LK1 A;  2WCL A;  2JUL A;  4C0L A;  2WCM A;  2PAS A;  1TIZ A;  2LLS A;  1WDC C;  2ZRS A;  3BQ3 A;  4BY4 A;  4GFT A;  1LKJ A;  2LUX A;  4AQI A;  4XJK B;  3KPX A;  5I2O A;  3PAL A;  1CNP A;  2K61 A;  3CS1 A;  3OB2 B;  2BCB A;  5DKN A;  1FF1 A;  3BUN B;  1Y0V H;  2E6W A;  1LA3 A;  1QJT A;  2G2B A;  2QEH A;  1AUI B;  1DTL A;  3S0F A;  3TUY B;  1QX7 A;  2JU0 A;  1QIW A;  1NIW A;  2I18 A;  1R6P A;  1F55 A;  4C0J A;  4YGE B;  1DT7 B;  2EGD A;  1F70 A;  1CDL A;  1OZS A;  2FJY A;  4INW A;  1K9P A;  1WRZ A;  1A03 A;  1AHR A;  2P70 A;  4ORB B;  4TNC A;  2ZNE A;  4CFR A;  3B86 A;  2WOS A;  2WCH A;  3GK2 A;  1DF0 B;  1G8I A;  2F3Z A;  5DKR A;  1KWO B;  1OW4 A;  1EH2 A;  3DF0 B;  2MHH A;  3R1P A;  3I5I B;  1N65 A;  3WXA A;  2CNP A;  3SIA A;  1WY9 A;  1E8A A;  3CAB A;  4DCK A;  3SG2 A;  1G33 A;  2LUC A;  1HT9 A;  4IL1 A;  3D0Y A;  1J55 A;  3EG5 B;  3SS3 A;  1J7Q A;  3VRR A;  1CKK A;  1BG1 A;  1SKT A;  1MXE A;  4MRY A;  1PAL A;  4M2P A;  1J7P A;  3AKA A;  2F3Y A;  3I5G B;  3DVK A;  2FCD A;  1B4C A;  4YGB B;  3IQO A;  5F6T A;  1J1D A;  1Z2C B;  1B47 A;  3CTN A;  4PE7 A;  1QX5 B;  1NYA A;  5FI7 A;  3SS4 A;  1SSE B;  2EC6 C;  3TS5 B;  2K7C A;  5FYX A;  5D3O A;  1XFR A;  1TN4 A;  1XFU O;  4WQ2 A;  4DRW A;  1L2O C;  1TCO B;  2K2F A;  2WC6 A;  5D7F A;  1MXL C;  3LK0 A;  3PAT A;  1GQM A;  2HPS A;  2OTG B;  4DUQ A;  2BEC A;  5I2Q A;  2JRF A;  2JZI A;  2WCB A;  1CLL A;  5AFP A;  2SAS A;  2CXJ A;  1WRL A;  2OS8 B;  1TNP A;  3VGO A;  1J1E A;  2MLF C;  1TTX A;  2WCK A;  1S5G Z;  2GGM A;  4ZCV A;  1L7Z A;  2OPO A;  2KPH A;  3WNX B;  1CM1 A;  1H8B A;  3EK4 A;  2L5X B;  1SL9 A;  2CCM A;  1CDM A;  1M45 A;  1JFK A;  1DGU A;  2JOJ A;  4KYN A;  2JXL A;  3DVM A;  3NHI A;  3O4X A;  2KAV A;  4HSZ A;  4F0Z B;  1MF8 B;  3TZ1 A;  3IF7 A;  5IBW A;  3BUM B;  3D10 A;  1UUS A;  4YBH B;  3DF0 A;  1OOG A;  1NX2 A;  4YGC B;  4C0K A;  1FW4 A;  4NDD A;  4MRX A;  4PE0 A;  4CFQ A;  2QDI A;  5PAL A;  1UP5 A;  1DJX A;  1BLQ A;  4MSP A;  2QEV A;  2KNE A;  2Y4Q A;  1JFJ A;  3SG5 A;  1PSR A;  5I8N A;  1MQ1 A;  2ZFD A;  2WCJ A;  3FE6 A;  1DJI A;  2FJU B;  2I94 A;  3PFV A;  1KWO C;  2ZRT A;  3OBV A;  3K21 A;  2SCP A;  2WCE A;  4I5J A;  3AAK A;  4ZCU A;  1YUT A;  2L2C A;  3EVV A;  3QME A;  1ALW A;  4JD9 A;  1AK8 A;  1KSO A;  3R72 A;  4GAO A;  5CSJ A;  3I5F C;  5GQQ C;  1YX8 A;  3OP0 A;  5HL1 A;  3N7H A;  1QIV A;  2M1K B;  2L51 A;  2YGU A;  1SNL A;  3CDN A;  1B9A A;  3D74 A;  1EXR A;  1OMD A;  1XK4 C;  1B8R A;  2MA2 A;  4MBE A;  4JWQ A;  1CDN A;  5FI2 A;  2PMY A;  1JWD A;  4CPV A;  4NDB A;  4MVF A;  2O5G A;  2MAZ A;  1S36 A;  1TRF A;  2R2I A;  2LNK A;  1P28 A;  2GGZ A;  3JTD B;  3L4L A;  3PN7 B;  4N1G A;  5JOL A;  1FPW A;  2LVV A;  1B7T Y;  3ZNI A;  1F4O A;  1J7R A;  2ERB A;  1W9Z A;  1KFU L;  1Y1X A;  1UHH A;  2FOT A;  3K1E A;  1JC2 A;  1FI5 A;  1SCV A;  2MLE C;  2CT9 A;  3CLN A;  1JBA A;  2BAP A;  1KFU S;  1BOC A;  3CGA A;  3L47 A;  3CZ1 A;  1SCM B;  4YGD B;  4UPG A;  4CLN A;  3VB1 A;  2WCF A;  1XO5 A;  3D73 A;  3O4Y A;  1S6J A;  3SS5 A;  1HQV A;  5KTY A;  1W7I B;  1RFJ A;  2LHL A;  3EVU A;  1KQM B;  1M31 A;  2KAY A;  1RK9 A;  2Y5I A;  3KHE A;  4MZL A;  1QVI Y;  4ORC B;  2LVK A;  1KSM A;  1BOD A;  1IJ6 A;  1WLM A;  4YI8 A;  5FI6 A;  3GK4 X;  3CR2 A;  1KK8 B;  1K2H A;  1MUX A;  1MHO A;  1PVA A;  1M39 A;  4F7F A;  1A2X A;  4BY5 A;  1CLM A;  1WRK A;  1SR6 B;  1XFX O;  2BCX A;  3F45 A;  4PCW A;  1CFF A;  3C1V A;  1DC1 A;  3R1O A;  4USL A;  2H61 A;  1OSA A;  2M9G A;  5AXI A;  2KI4 C;  1UHN A;  2BKH B;  3BXK A;  3SIB A;  1BR1 B;  2WC5 A;  2KSP A;  1PVB A;  1K90 D;  4I5L B;  4MZJ A;  2JT3 A;  1K94 A;  2L98 A;  1CLB A;  1XA5 A;  5EL2 A;  1QX2 A;  1OMR A;  1ZMZ A;  3KF9 A;  1IQ3 A;  3I5H C;  2BKI B;  1IJ5 A;  4PHK A;  1LXF C;  2LV7 A;  1IQ5 A;  1LIN A;  2BE6 A;  2TN4 A;  4Q04 A;  1CB1 A;  4MEW A;  2FCE A;  4ORA B;  4OZD A;  4DS7 A;  3A4U B;  1BJF A;  3JVT C;  1A29 A;  1MR8 A;  1AJ5 A;  4GGF A;  4GBA A;  5DIC A;  2L5Y A;  1Y1U A;  2JC2 A;  1DJG A;  1M63 B;  1ORG A;  3D76 A;  1WLZ A;  1GM0 A;  2PRU A;  2PYQ A;  4XJK A;  3RM1 A;  1N0Y A;  2JXC A;  1IGV A;  5JJG A;  1CFC A;  3PM8 A;  2LCP A;  2PVB A;  3GOF A;  1UHI A;  1N2D A;  4ICB A;  1YRT B;  4YGA A;  2VRG A;  1B1G A;  2K7O A;  4DIR A;  5ER4 X;  3NSI A;  1IRJ A;  2JT0 A;  2KI6 D;  1SL8 A;  2LM5 A;  1C7V A;  1AJ4 A;  3JTD C;  2LP2 A;  1JF0 A;  2GV5 A;  2M7N A;  1QWV A;  1AP4 A;  3NXA A;  1ZOT B;  3PSR A;  1DQE A;  1NCX A;  2D8N A;  1SPY A;  2M1U A;  1F71 A;  2K7D A;  3NHT A;  2NXQ A;  1B7T Z;  3CR5 X;  4D1E A;  4XYN A;  1AVS A;  5CSN A;  2WOR A;  2L0P A;  1WDC B;  5TNC A;  2KQY A;  1DF0 A;  2NCO A;  1DGV A;  3EKH A;  1EG4 A;  5G08 A;  3VRO A;  3NSO A;  1DMO A;  1ZUZ A;  2QAC A;  2RGI A;  3B6X A;  2M0R A;  3TUY C;  1TUZ A;  1TWO A;  1U5I B;  3AAJ A;  1GGW A;  1QAT A;  1SRA A;  1XFZ O;  3BOW B;  4PAL A;  1IIO A;  1NX0 A;  1XFW O;  2NZ0 A;  1PRW A;  1OZO A;  1VRK A;  4YRU A;  1YRU B;  1TOP A;  2QPT A;  3B7A A;  1NP8 A;  1OMV A;  2LLU A;  3DYE A;  4M2O A;  1TUJ A;  1Z4H A;  3R1V A;  2NCP A;  1BU3 A;  1CTR A;  1QVI Z;  2EHB A;  2LAP A;  3FIA A;  5HKW A;  3RLZ A;  1DVI A;  1SW8 A;  4PE4 A;  2KGB C;  1DEL A;  2KAX A;  1PSB A;  1ZAC A;  1K93 D;  4GNK B;  5HLV A;  5HKY A;  1K9U A;  2L4I A;  1KQV A;  1Y6W A;  4I5N B;  1QV1 A;  1QLS A;  3NSL A;  3I5I C;  2K60 A;  2HET A;  4WQ3 A;  2LMV A;  1OE9 B;  1C7W A;  3H4S E;  1FI6 A;  2ZND A;  3IVT A;  3TDI A;  1DJZ A;  4AQJ A;  3L4A A;  1TNQ A;  1QV0 A;  2BE4 A;  2KI6 C;  1A4P A;  2BCA A;  1NCZ A;  4A4B A;  1ODB A; 
#chains in the Genus database with same CATH homology
 3LCP C;  1S26 D;  3DVJ A;  1A75 B;  1YUU A;  4A4C A;  3I5G C;  2H2K A;  1XYD A;  2Q4U A;  3LL8 B;  5HLO A;  1XFV O;  3VRP A;  4U8D A;  4QJ4 B;  4YI9 A;  2LC5 A;  1F4Q A;  4GUK A;  3ICB A;  1W7J B;  1EL4 A;  2G9B A;  1LVC D;  2B1U A;  3CR4 X;  3TS5 C;  3O6B A;  2HQ8 A;  2KYF A;  3O78 A;  4PE1 A;  3EKJ A;  1FBV A;  2KFH A;  2COL B;  3EK8 A;  3VRN A;  1XFY O;  2EC6 B;  1M46 A;  1V1F A;  1R2U A;  1CMG A;  1NWD A;  1JF2 A;  1IWQ A;  2JPT A;  1PUL A;  1SL7 A;  1V1G A;  1XVJ A;  2OTG C;  3OX5 A;  2Q91 A;  1IKU A;  2KGR A;  1L2O B;  2KBM A;  3D0Y B;  4MZK A;  3AKB A;  1B8L A;  2OS8 C;  3E3R A;  2BL0 B;  1Q80 A;  4R1E A;  5HYD A;  1H4B A;  2CBL A;  2P6B B;  1Y1A A;  2K2A A;  5BPJ A;  1NPQ A;  1KCY A;  2M3W A;  2JWW A;  1K8U A;  5KSZ A;  2LVI A;  1G4Y R;  2LLT A;  1JUO A;  5AER A;  4AOM A;  1LA0 A;  1RRO A;  1SMG A;  4OVN F;  5B8I B;  1YR5 A;  4PHM A;  1F8H A;  1YX7 A;  5I2L A;  2M7L A;  2LMU A;  3A8R A;  1ALV A;  2MRD A;  1S6C A;  1QXP A;  4OKH A;  2E30 A;  5ER5 A;  1EJ3 A;  2O60 A;  4PHN A;  3FWC A;  1BMO A;  1UHK A;  1TNW A;  2Y1M A;  1S6I A;  2V53 A;  1DJH A;  1KFX L;  4N1F A;  2IS9 A;  2KFG A;  1J7O A;  1A75 A;  2DOQ A;  1NSH A;  2LE9 B;  3SJS A;  1F54 A;  2MBX A;  1KFX S;  1EG3 A;  2K0J A;  1YVH A;  3KO0 A;  1NUB A;  3TDZ A;  5AAN A;  2PSR A;  2ZN8 A;  1IG5 A;  2LVJ A;  3BUO B;  2H61 C;  2M97 A;  1YUS A;  4JQ0 D;  5CSF A;  2ISD A;  4CID A;  1C07 A;  3LLE A;  1OOJ A;  1QTX A;  4N5X A;  1RTP 1;  2L50 A;  3M0W A;  2KQ6 A;  3I5F B;  3GK1 A;  1KK7 Y;  4NDC A;  4OCI A;  4WRI A;  3HX4 A;  1BF5 A;  1TNX A;  1CDP A;  1TCF A;  2BBN A;  4L9M A;  2JNF A;  1SY9 A;  1OQP A;  3PN7 C;  1GJY A;  1SBJ A;  4GGF C;  1REC A;  2JNX A;  2I2R E;  3BUW B;  3OX6 A;  3EK7 A;  4GGN A;  3DD4 A;  5CPV A;  3FWB A;  1S3P A;  2NLN A;  1S1E A;  2CTN A;  1CM4 A;  2I7A A;  3QRX A;  3ZWH A;  4MLW A;  3DVE A;  2LMT A;  5D69 A;  4HRE E;  4M2Q A;  5KU1 A;  2PAL A;  2JQ6 A;  1SCM C;  1QS7 A;  2AUC A;  2M49 B;  5HKZ A;  5CSI A;  3BUX B;  2JT8 A;  3EVR A;  1BR4 B;  2HF5 A;  2BL0 C;  1PK0 D;  1DJW A;  2A4J A;  2JTZ A;  1YVL A;  1KQM C;  2WC8 A;  2Y1N A;  1SYM A;  2AAO A;  1RJV A;  3SG7 A;  2LP3 A;  1NCY A;  3SG6 A;  1GGZ A;  2KDH A;  2F2P A;  2BBM A;  2M8U A;  1MWN A;  1UHJ A;  1KK8 C;  2K7B A;  2KYC A;  3CWG A;  1CMF A;  3BYA A;  1QLK A;  4FTG A;  3WXA A;  3KEV A;  1SR6 C;  4HRH A;  4QJ3 B;  1IH0 A;  2KBI A;  3MSE B;  1K9K A;  1X02 A;  4P2Y B;  1SK6 D;  1DJY A;  1NX3 A;  2MJW B;  3CZT X;  5K89 A;  1YTZ C;  1UUR A;  3OHM B;  4FQO A;  3NSK A;  3OB1 B;  1RWY A;  2KFF A;  4E68 A;  2KI4 B;  3PLF B;  1QAS A;  4P5O E;  1K96 A;  2HQW A;  4GPL B;  2WND A;  1XK4 A;  3I5H B;  1CFP A;  1JSA A;  3TDU A;  3WHU B;  2JTT A;  1YUR A;  4HRG A;  2F33 A;  1ZFS A;  3O2P A;  3IQQ A;  5DKQ A;  3JVT B;  1UWO A;  1BT6 A;  2F2O A;  3FS7 A;  4OR9 B;  1CFD A;  2ZKM X;  2LHI A;  2KOT A;  3VRQ A;  4PDZ A;  3RM1 A;  2AMI A;  5AEQ A;  4PHJ A;  2F8P A;  2KHN A;  5J3X A;  4JPZ B;  2LAN A;  3SG3 A;  1U5I A;  1B8C A;  4NQG A;  1KK7 Z;  4OV2 A;  2L2E A;  4ETO A;  3SG4 A;  3BOW A;  2ZN9 A;  4QJ5 B;  1K95 A;  4MN0 A;  1NX1 A;  2K8M B;  1D1O A;  4I5K A;  1S5G Y;  2L4H A;  2M29 A;  3HCM A;  3LK1 A;  2JUL A;  4C0L A;  2PAS A;  1TIZ A;  2LLS A;  1WDC C;  2ZRS A;  3BQ3 A;  4BY4 A;  4GFT A;  1LKJ A;  2LUX A;  4AQI A;  4XJK B;  3KPX A;  5I2O A;  3PAL A;  1CNP A;  2K61 A;  3CS1 A;  3OB2 B;  2BCB A;  5DKN A;  1FF1 A;  3BUN B;  1Y0V H;  2E6W A;  1LA3 A;  1QJT A;  2G2B A;  1AUI B;  1DTL A;  3TUY B;  1QX7 A;  2JU0 A;  1QIW A;  1NIW A;  2I18 A;  1R6P A;  1F55 A;  4C0J A;  4YGE B;  1DT7 B;  2EGD A;  1F70 A;  1CDL A;  1OZS A;  1K9P A;  1WRZ A;  1A03 A;  1AHR A;  4ORB B;  4TNC A;  2ZNE A;  4CFR A;  2WOS A;  3GK2 A;  1DF0 B;  1G8I A;  2F3Z A;  5DKR A;  1KWO B;  1EH2 A;  3DF0 B;  2MHH A;  3I5I B;  1N65 A;  2CNP A;  3SIA A;  1WY9 A;  1E8A A;  4DCK A;  3SG2 A;  1G33 A;  2LUC A;  1HT9 A;  4IL1 A;  3D0Y A;  1J55 A;  1J7Q A;  3VRR A;  1CKK A;  1BG1 A;  1SKT A;  1MXE A;  4MRY A;  1PAL A;  4M2P A;  1J7P A;  3AKA A;  2F3Y A;  3I5G B;  3DVK A;  2FCD A;  1B4C A;  4YGB B;  3IQO A;  5F6T A;  1J1D A;  1B47 A;  3CTN A;  4PE7 A;  1QX5 B;  1NYA A;  2EC6 C;  3TS5 B;  2K7C A;  5FYX A;  1TN4 A;  1XFU O;  4WQ2 A;  4DRW A;  1L2O C;  1TCO B;  2K2F A;  5D7F A;  1MXL C;  3LK0 A;  3PAT A;  1GQM A;  2HPS A;  2OTG B;  4DUQ A;  2BEC A;  5I2Q A;  2JRF A;  2JZI A;  2WCB A;  1CLL A;  5AFP A;  2SAS A;  2CXJ A;  1WRL A;  2OS8 B;  1TNP A;  3VGO A;  1J1E A;  2MLF C;  1TTX A;  1S5G Z;  2GGM A;  4ZCV A;  1L7Z A;  2OPO A;  3WNX B;  1CM1 A;  1H8B A;  3EK4 A;  2L5X B;  1SL9 A;  2CCM A;  1CDM A;  1M45 A;  1JFK A;  1DGU A;  2JOJ A;  2JXL A;  3DVM A;  2KAV A;  4HSZ A;  4F0Z B;  1MF8 B;  3TZ1 A;  3IF7 A;  5IBW A;  3BUM B;  3D10 A;  1UUS A;  4YBH B;  3DF0 A;  4YGC B;  1NX2 A;  4C0K A;  1FW4 A;  4NDD A;  4MRX A;  4PE0 A;  4CFQ A;  5PAL A;  1UP5 A;  1DJX A;  1BLQ A;  4MSP A;  2KNE A;  2Y4Q A;  1JFJ A;  3SG5 A;  1PSR A;  5I8N A;  1MQ1 A;  2ZFD A;  1DJI A;  2FJU B;  2I94 A;  3PFV A;  1KWO C;  2ZRT A;  3K21 A;  2SCP A;  2WCE A;  4I5J A;  3AAK A;  4ZCU A;  1YUT A;  3EVV A;  1ALW A;  1AK8 A;  1KSO A;  4GAO A;  5CSJ A;  3I5F C;  5GQQ C;  1YX8 A;  3OP0 A;  1QIV A;  2M1K B;  2L51 A;  1SNL A;  1B9A A;  1EXR A;  1OMD A;  1XK4 C;  1B8R A;  2MA2 A;  4MBE A;  4JWQ A;  1CDN A;  1JWD A;  2PMY A;  4CPV A;  4NDB A;  4MVF A;  2O5G A;  2MAZ A;  1S36 A;  1TRF A;  2R2I A;  2LNK A;  3JTD B;  2GGZ A;  3PN7 B;  4N1G A;  5JOL A;  1FPW A;  2LVV A;  1B7T Y;  3ZNI A;  1F4O A;  1J7R A;  1KFU L;  1Y1X A;  1UHH A;  2FOT A;  1JC2 A;  1FI5 A;  1SCV A;  2MLE C;  2CT9 A;  3CLN A;  1JBA A;  1KFU S;  1BOC A;  3CGA A;  1SCM B;  4YGD B;  4UPG A;  4CLN A;  2WCF A;  1XO5 A;  3O4Y A;  1S6J A;  1HQV A;  5KTY A;  1W7I B;  1RFJ A;  2LHL A;  3EVU A;  1KQM B;  1M31 A;  2KAY A;  1RK9 A;  2Y5I A;  3KHE A;  4MZL A;  1QVI Y;  4ORC B;  2LVK A;  1KSM A;  1BOD A;  1IJ6 A;  1WLM A;  4YI8 A;  3GK4 X;  3CR2 A;  1KK8 B;  1K2H A;  1MUX A;  1MHO A;  1PVA A;  1M39 A;  1A2X A;  4BY5 A;  1CLM A;  1WRK A;  1SR6 B;  1XFX O;  2BCX A;  3F45 A;  4PCW A;  1CFF A;  3C1V A;  4USL A;  2H61 A;  1OSA A;  2M9G A;  5AXI A;  2KI4 C;  1UHN A;  2BKH B;  3BXK A;  3SIB A;  1BR1 B;  2KSP A;  1PVB A;  1K90 D;  4I5L B;  4MZJ A;  2JT3 A;  1K94 A;  2L98 A;  1CLB A;  1XA5 A;  1QX2 A;  1OMR A;  1ZMZ A;  3KF9 A;  1IQ3 A;  3I5H C;  2BKI B;  1IJ5 A;  4PHK A;  1LXF C;  2LV7 A;  1IQ5 A;  1LIN A;  2BE6 A;  2TN4 A;  4Q04 A;  1CB1 A;  4MEW A;  2FCE A;  4ORA B;  4DS7 A;  3A4U B;  1BJF A;  3JVT C;  1A29 A;  1MR8 A;  1AJ5 A;  4GGF A;  4GBA A;  1Y1U A;  2JC2 A;  1DJG A;  1M63 B;  1WLZ A;  2PRU A;  4XJK A;  5JJG A;  1N0Y A;  2JXC A;  1IGV A;  1CFC A;  3PM8 A;  2LCP A;  2PVB A;  3GOF A;  1UHI A;  1N2D A;  4ICB A;  1YRT B;  4YGA A;  2VRG A;  1B1G A;  2K7O A;  4DIR A;  5ER4 X;  3NSI A;  1IRJ A;  2JT0 A;  2KI6 D;  1SL8 A;  2LM5 A;  1C7V A;  1AJ4 A;  3JTD C;  2LP2 A;  1JF0 A;  2GV5 A;  2M7N A;  1AP4 A;  3NXA A;  1ZOT B;  3PSR A;  1NCX A;  2D8N A;  1SPY A;  2M1U A;  1F71 A;  2K7D A;  2NXQ A;  1B7T Z;  3CR5 X;  4D1E A;  4XYN A;  1AVS A;  5CSN A;  2WOR A;  2L0P A;  1WDC B;  5TNC A;  2KQY A;  1DF0 A;  2NCO A;  1DGV A;  3EKH A;  1EG4 A;  5G08 A;  3VRO A;  3NSO A;  1DMO A;  1ZUZ A;  2QAC A;  2RGI A;  2M0R A;  3TUY C;  1U5I B;  3AAJ A;  1GGW A;  1QAT A;  1SRA A;  1XFZ O;  3BOW B;  4PAL A;  1NX0 A;  1XFW O;  2NZ0 A;  1PRW A;  1OZO A;  1VRK A;  4YRU A;  1YRU B;  1TOP A;  2QPT A;  4M2O A;  1NP8 A;  1OMV A;  2LLU A;  3WHT B;  2NCP A;  1BU3 A;  1CTR A;  1QVI Z;  2EHB A;  2LAP A;  3FIA A;  5HKW A;  3RLZ A;  1DVI A;  1SW8 A;  4PE4 A;  2KGB C;  2KAX A;  1PSB A;  1ZAC A;  1K93 D;  4GNK B;  5HLV A;  5HKY A;  1K9U A;  2L4I A;  1KQV A;  1Y6W A;  4I5N B;  1QV1 A;  1QLS A;  3NSL A;  3I5I C;  2HET A;  4WQ3 A;  2LMV A;  1OE9 B;  1C7W A;  3H4S E;  1FI6 A;  2ZND A;  3TDI A;  1DJZ A;  4AQJ A;  1TNQ A;  1QV0 A;  2BE4 A;  2KI6 C;  1A4P A;  2BCA A;  1NCZ A;  4A4B A;  1ODB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...