1F4OA

Crystal structure of grancalcin with bound calcium
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
165
structure length
165
Chain Sequence
b'SVYTYFSAVAGQDGEVDAEELQRCLTQSGINGTYSPFSLETCRIMIAMLDRDHTGKMGFNAFKELWAALNAWKENFMTVDQDGSGTVEHHELRQAIGLMGYRLSPQTLTTIVKRYSKNGRIFFDDYVACCVKLRALTDFFKKRDHLQQGSADFIYDDFLQGTMAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GRANCALCIN
publication title Crystal structure of human grancalcin, a member of the penta-EF-hand protein family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 59
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1f4oA00
3IQOA 2QACA 2OTGC 5AANA 1K8UA 2KAVA 2FCDA 1CM1A 1V1GA 2LCPA 3BOWB 5AEQA 2KSPA 2ZFDA 1CLLA 1MF8B 2ZRTA 1S6IA 2L51A 3SG4A 4DRWA 2ZNEA 4F0ZB 1QV0A 1TCOB 4PHKA 3WNXB 5HKWA 2BKIB 4PHNA 1WY9A 1IWQA 2LMVA 5DKQA 1B4CA 2BBMA 4YGAA 4A4CA 4GFTA 1UHHA 1XFWO 1Y1AA 5I2QA 3WHUB 2JZIA 1A75A 1S5GY 2K61A 1LINA 2OS8B 3D0YB 1CFCA 1TNXA 3DVEA 5AFPA 2JWWA 2EC6B 1FF1A 4ETOA 1ZOTB 2PALA 1TNWA 3PSRA 1M31A 1DJZA 4M2OA 4GNKB 2KGBC 3VROA 1BF5A 1J55A 1YRUB 1B7TY 5FYXA 4XJKB 4L9MA 1R2UA 3BUWB 1CLMA 1X02A 4MZLA 4NDDA 1CB1A 1WDCC 1NUBA 1Q80A 4GPLB 2L4IA 1G33A 4XYNA 4HREE 1DF0A 4DUQA 1CNPA 1IJ6A 2A4JA 4ORCB 1CMGA 2DOQA 5AERA 1UHJA 2P6BB 1JFJA 3F45A 4DCKA 4WQ2A 4YBHB 2F2PA 5J3XA 3AKAA 3DVMA 1B8LA 1DVIA 2Q4UA 4MZKA 1Y1UA 3TUYB 3DF0A 3EVUA 5CSJA 1F71A 2KOTA 2WCFA 3WXAA 1KK7Z 1AUIB 2TN4A 1HT9A 1EG3A 2JNXA 3CR5X 1A75B 1KFXL 1RTP1 1NCYA 4MZJA 3NSKA 1KCYA 1NCZA 1S6JA 3E3RA 4ZCUA 2PRUA 1AP4A 3PATA 4JQ0D 4WRIA 1FPWA 2JRFA 3DVKA 3NSOA 2PASA 2JT8A 1JUOA 1A03A 4AQJA 2K7OA 5CPVA 2I7AA 4MN0A 3PLFB 1SR6C 3VRQA 3AKBA 2LVKA 3RLZA 1QX5B 5KTYA 1OOJA 1NX3A 2KBIA 3A4UB 2KYCA 1TRFA 3I5HC 1B8RA 2MHHA 3HX4A 1BR4B 1W7JB 2JC2A 1XA5A 3JVTB 1JF0A 1AHRA 1K94A 5HLOA 1QATA 1F4QA 4OKHA 3I5GC 2BKHB 1G4YR 4MRXA 2LE9B 2KQ6A 1A4PA 1JWDA 4GGFA 1QJTA 5HKYA 1CDLA 1YVLA 1QLKA 1CM4A 1Y0VH 2AUCA 3KO0A 1SKTA 3PM8A 2FCEA 2LMTA 2M49B 1KWOC 3FIAA 1SMGA 3DF0B 2K7BA 3SG5A 1F54A 1S36A 2M0RA 1IQ3A 1CMFA 1L2OC 1TIZA 1M46A 1PVAA 1SY9A 4MEWA 1DTLA 2LNKA 2BL0C 3BQ3A 1XK4A 1S6CA 1NWDA 2M97A 1EH2A 2K7CA 2LV7A 1NSHA 2M29A 2KGRA 1NIWA 1C07A 2CNPA 2F2OA 4PE1A 1YUUA 2CBLA 2K2AA 3EK7A 2WORA 1NX2A 1LXFC 2M7LA 4OV2A 3RM1A 1MHOA 4BY5A 1F55A 1C7VA 3A8RA 2NXQA 5G08A 1IG5A 1XK4C 1RJVA 1KK8C 1YVHA 3GK4X 2E6WA 3LK1A 2LHLA 3LL8B 2MA2A 4ORAB 4JPZB 2LMUA 1E8AA 2JPTA 2H61C 1J7PA 4AOMA 1KWOB 2WC8A 4GAOA 2JXCA 4D1EA 1N2DA 3M0WA 2LVJA 2RGIA 4N1FA 3ZNIA 2KHNA 1OMDA 1AJ4A 2F33A 3SG2A 1OZSA 1SW8A 1SCMC 3BUXB 5DKNA 2AAOA 1K90D 1IKUA 2KBMA 2NCOA 4MBEA 2FJUB 1IQ5A 2FOTA 2L2EA 3EKJA 1ZMZA 5CSIA 1RECA 2M9GA 3CGAA 3GOFA 4GUKA 1L7ZA 4PALA 2MLEC 2LAPA 2LVIA 2KI6C 2M7NA 4CIDA 2L5XB 1TNQA 1YX7A 2O5GA 3PFVA 2KAXA 1JSAA 1M63B 2K2FA 2LANA 1GQMA 3AAJA 3NSLA 1PULA 1KQMB 2JOJA 2MRDA 2OPOA 1HQVA 2OTGB 5AXIA 1B9AA 2O60A 3BYAA 3VRRA 5CSNA 5KSZA 1ALVA 1BMOA 2SASA 3LK0A 3I5FC 3OX6A 3CWGA 1V1FA 1BT6A 1QLSA 4YRUA 1XFUO 4BY4A 1KFXS 2CXJA 2CT9A 1N65A 1MXEA 1QIWA 4C0LA 1K95A 4OVNF 3SIBA 1WLZA 3PN7C 3CTNA 2KFFA 3O6BA 3O78A 3JTDC 3D10A 3IQQA 5IBWA 1A2XA 3WHTB 1FI6A 3CLNA 4QJ3B 2F8PA 4GGNA 2CCMA 1XFXO 1WRZA 2K8MB 2KFHA 1TNPA 1AVSA 1NP8A 1K93D 2Y1NA 4R1EA 1TCFA 1A29A 4PDZA 2HETA 1S26D 4PCWA 1F70A 1RWYA 1ZFSA 1KQMC 4JWQA 2BE4A 4CLNA 1WDCB 5PALA 1OE9B 1WRKA 1NCXA 2HQ8A 3PN7B 2LVVA 4CFQA 3I5IC 1UHIA 3MSEB 2ZN9A 4YGEB 2MLFC 2PVBA 1MR8A 2LLUA 4YI8A 4MVFA 1B8CA 1UHKA 3C1VA 2JU0A 2M3WA 1UWOA 4N1GA 1MUXA 4YGDB 2I2RE 1SL9A 4YGCB 2I18A 1QV1A 1DF0B 2VRGA 1QXPA 1DGUA 1ODBA 2JNFA 1QVIZ 2JTTA 1CDPA 1XFZO 3AAKA 1SYMA 1F8HA 4AQIA 2K0JA 2R2IA 1U5IA 4FQOA 5GQQC 2JULA 2L0PA 2JT0A 3CR2A 1YUTA 1GGZA 4C0JA 1PVBA 1SL7A 3LLEA 2BCBA 2COLB 2LUCA 1KFUS 1RK9A 1SNLA 3NXAA 5JJGA 5K89A 3SG6A 1ZUZA 2IS9A 4ORBB 1KK7Y 1SPYA 3I5IB 1YR5A 3K21A 2G9BA 4WQ3A 4DS7A 1SR6B 3KEVA 1FI5A 4PE4A 4ZCVA 2V53A 1DJGA 1K9KA 1OSAA 3I5HB 1UURA 2KNEA 1UUSA 2Y5IA 4PE0A 1NX1A 2H61A 4HSZA 3SG3A 5CSFA 4I5NB 4FTGA 3I5GB 2EHBA 1K96A 2BE6A 5DKRA 4MRYA 1OQPA 1QIVA 1Y6WA 3DVJA 1MQ1A 3GK2A 1RROA 1S5GZ 1KFUL 1PSBA 3KHEA 3VGOA 1WRLA 1YTZC 2LHIA 4ICBA 1M45A 1JC2A 1J1EA 1NYAA 4QJ4B 1LVCD 3TDIA 2EGDA 4C0KA 5JOLA 1IH0A 3FWBA 1G8IA 2HPSA 5ER5A 1L2OB 2LLTA 3FWCA 1LKJA 5I8NA 1MXLC 3QRXA 1SCVA 5F6TA 2BL0B 1EXRA 1B7TZ 1SRAA 1H8BA 2JQ6A 4TNCA 4CFRA 4CPVA 1J7OA 4Q04A 1C7WA 2G2BA 2M1KB 1DGVA 1TTXA 4PE7A 1SBJA 1BJFA 1FBVA 1JF2A 3CZTX 2LP3A 1SK6D 2NCPA 4P2YB 1KK8B 1UHNA 3OB2B 1CDNA 2BCXA 1CKKA 3HCMA 3O4YA 1CLBA 2AMIA 2BECA 3TDZA 2WNDA 2L98A 1MWNA 2LM5A 1TN4A 1XO5A 2KI6D 2SCPA 2F3YA 5HYDA 3BUMB 1SCMB 3BXKA 5D7FA 3SG7A 1RFJA 1DJWA 1XFVO 3KF9A 3DD4A 2JXLA 3EK8A 2WOSA 1M39A 1DMOA 2PSRA 3TS5C 2F3ZA 3TUYC 1GGWA 2ZKMX 1LA0A 1QX7A 1PRWA 1ALWA 4P5OE 1AJ5A 5TNCA 4NQGA 1TOPA 2KAYA 3O2PA 5I2OA 1OMVA 2MBXA 4MLWA 1UP5A 2HF5A 3SJSA 3LCPC 1F4OA 4I5KA 3OX5A 1DJHA 2KQYA 4DIRA 1NPQA 1VRKA 2KI4C 2MJWB 1H4BA 1IJ5A 3ZWHA 1LA3A 1BR1B 1YURA 2BCAA 1S1EA 1BG1A 1Y1XA 4M2QA 3I5FB 1XYDA 1CTRA 5HLVA 5ER4X 1S3PA 2NZ0A 2KDHA 5HKZA 5I2LA 4UPGA 1W7IB 4I5LB 2B1UA 4A4BA 2GGMA 2ZRSA 1D1OA 1J7RA 1CDMA 1J1DA 1QASA 3IF7A 3JVTC 3TS5B 3TZ1A 3JTDB 1PALA 3EK4A 1XFYO 1DJXA 3OP0A 4PHJA 1KSMA 3OB1B 3SIAA 3NSIA 2M8UA 1AK8A 1OMRA 1EG4A 1NX0A 4MSPA 2Y1MA 4N5XA 2ISDA 1JBAA 2KI4B 1YUSA 1DJIA 4NDCA 1BLQA 2JT3A 1YRTB 2Y4QA 2GGZA 2LUXA 1BU3A 1K9PA 1CFDA 1R6PA 4OCIA 2GV5A 3CS1A 4OR9B 2CTNA 2PMYA 1B1GA 1K2HA 1CFPA 1B47A 3TDUA 2LP2A 3PALA 1PSRA 1EL4A 4YI9A 1FW4A 2WCBA 2KYFA 1YX8A 4U8DA 2NLNA 2WCEA 3VRNA 2I94A 2LC5A 1K9UA 3FS7A 1SL8A 2KFGA 2ZNDA 3BOWA 4HRGA 2ZN8A 5B8IB 5KU1A 1QX2A 4GBAA 4I5JA 1PK0D 4E68A 4HRHA 3EKHA 1IRJA 1EJ3A 1DJYA 1N0YA 1QS7A 2H2KA 3CR4X 1OZOA 3EVVA 1WLMA 2HQWA 1KSOA 1KQVA 3D0YA 3KPXA 2LLSA 3BUOB 2L50A 2Q91A 4GGFC 2QPTA 1DT7B 1BODA 5BPJA 1J7QA 3EVRA 4IL1A 1QTXA 1QVIY 2L4HA 4NDBA 2BBNA 1GJYA 1IGVA 3H4SE 3VRPA 2MAZA 1CFFA 1BOCA 1U5IB 2M1UA 1XVJA 4PHMA 3BUNB 4M2PA 4USLA 5D69A 1JFKA 4QJ5B 2OS8C 2E30A 4XJKA 2JTZA 3ICBA 3GK1A 2K7DA 2EC6C 2D8NA 4YGBB 1ZACA 3OHMB
chains in the Genus database with same CATH superfamily
3IQOA 2QACA 3SS3A 2OTGC 5AANA 1K8UA 2KAVA 2FCDA 1CM1A 1V1GA 2LCPA 3BOWB 5AEQA 2KSPA 2ZFDA 1CLLA 1MF8B 2ZRTA 1S6IA 2L51A 3SG4A 4DRWA 2ZNEA 4F0ZB 1QV0A 1TCOB 4PHKA 3WNXB 5HKWA 2BKIB 4PHNA 2H8VA 1WY9A 1IWQA 3UO9A 2LMVA 5DKQA 2P71A 2BBMA 1B4CA 4YGAA 4A4CA 4GFTA 1UHHA 1XFWO 1Y1AA 3O4XA 5I2QA 1TUZA 2JZIA 1A75A 1S5GY 2K61A 1LINA 2OS8B 3D0YB 3WHUB 1CFCA 1TNXA 3DVEA 5AFPA 2JWWA 2EC6B 1FF1A 4ETOA 3B87A 1ZOTB 2PALA 1TNWA 3PSRA 1M31A 1DJZA 4M2OA 4GNKB 2KGBC 3VROA 1BF5A 1J55A 1YRUB 1B7TY 3DYEA 5FYXA 5FI7A 4XJKB 4L9MA 1R2UA 3BUWB 1CLMA 1X02A 3BJHA 4MZLA 4NDDA 1CB1A 1WDCC 1NUBA 1Q80A 4GPLB 2L4IA 1DELA 1G33A 4XYNA 4KYNA 4HREE 1DF0A 5FI6A 4DUQA 1CNPA 1IJ6A 3L4LA 2A4JA 4ORCB 3S0FA 4JD9A 1CMGA 2DOQA 5AERA 1UHJA 2P6BB 1JFJA 3F45A 4DCKA 4IJ7A 4WQ2A 4YBHB 2F2PA 5J3XA 1OOIX 3AKAA 3DVMA 1B8LA 1DVIA 2Q4UA 4MZKA 1Y1UA 3S0DA 3TUYB 3DF0A 1P28A 3EVUA 3IVTA 5CSJA 2KOTA 2WCFA 1F71A 3WXAA 1KK7Z 1AUIB 2TN4A 1HT9A 1EG3A 2JNXA 3CR5X 1A75B 1KFXL 1RTP1 1NCYA 4MZJA 3NSKA 1KCYA 1NCZA 1S6JA 3E3RA 4ZCUA 2PRUA 1AP4A 3PATA 4JQ0D 4WRIA 1FPWA 2JRFA 3DVKA 3NSOA 3QMEA 2PASA 1Z4HA 2JT8A 1JUOA 1A03A 4AQJA 2K7OA 5CPVA 2I7AA 4MN0A 3PLFB 1SR6C 3VRQA 3AKBA 2LVKA 3RLZA 1QX5B 5KTYA 1OOJA 1NX3A 2KBIA 3A4UB 2KYCA 1TRFA 3I5HC 1B8RA 2MHHA 3HX4A 1BR4B 1W7JB 2JC2A 1XA5A 3R1VA 4F7FA 3JVTB 1JF0A 1AHRA 4INXA 1K94A 1QWVA 1QATA 3B86A 5HLOA 1F4QA 4OKHA 3I5GC 2BKHB 1G4YR 4MRXA 2LE9B 2KQ6A 1A4PA 1JWDA 4GGFA 1QJTA 5HKYA 1CDLA 1YVLA 1QLKA 1CM4A 1Y0VH 2AUCA 3KO0A 1SKTA 3PM8A 2FCEA 2LMTA 2M49B 1XFRA 1KWOC 1SMGA 3DF0B 3FIAA 1DQEA 2K7BA 3SG5A 1F54A 2QEHA 1S36A 2M0RA 1IQ3A 1CMFA 1L2OC 1TIZA 1M46A 1PVAA 1SY9A 4MEWA 1DTLA 2LNKA 2BL0C 3B6XA 3BQ3A 1XK4A 1S6CA 1NWDA 2M97A 2WCHA 2K7CA 2LV7A 1EH2A 1NSHA 2M29A 2KGRA 5HL1A 1NIWA 1C07A 2CNPA 3S0GA 2F2OA 4PE1A 1YUUA 2CBLA 2K2AA 3EK7A 2WORA 1NX2A 1LXFC 3K1EA 4OV2A 2M7LA 3RM1A 1MHOA 4BY5A 3S0AA 3Q8IA 1C7VA 3A8RA 1F55A 2NXQA 5G08A 1IG5A 1XK4C 1RJVA 1KK8C 1YVHA 3GK4X 2E6WA 3LK1A 2LHLA 3LL8B 2MA2A 3B7AA 4ORAB 4JPZB 2LMUA 1E8AA 2JPTA 2H61C 1J7PA 2QEVA 4AOMA 1KWOB 2WC8A 4GAOA 2JXCA 4D1EA 3DXLA 1N2DA 3M0WA 2LVJA 2RGIA 4N1FA 3ZNIA 4FQTA 2KHNA 1OMDA 1AJ4A 2F33A 3SG2A 1OZSA 1SW8A 1SCMC 3BUXB 5DKNA 2AAOA 3SS5A 1K90D 1IKUA 2KBMA 3D75A 2NCOA 4MBEA 3NGVA 2FJUB 1IQ5A 1Z2CB 2FOTA 2L2EA 1ZMZA 3EKJA 5CSIA 1RECA 2M9GA 3CGAA 3GOFA 4GUKA 5FI2A 3CZ0A 3NHIA 1L7ZA 4PALA 2MLEC 2LAPA 2WC6A 2LVIA 2KI6C 2M7NA 3OBVA 4CIDA 2L5XB 3UNWA 2WCMA 1TNQA 1YX7A 2O5GA 3PFVA 2KAXA 1JSAA 1M63B 2K2FA 2LANA 1GQMA 3AAJA 3NSLA 3D77A 1PULA 1KQMB 2JOJA 2KLDA 2MRDA 2OPOA 1HQVA 2OTGB 5AXIA 1B9AA 2O60A 3BYAA 3VRRA 5DICA 5CSNA 1OW4A 5KSZA 1ALVA 1BMOA 1TUJA 2SASA 3LK0A 3I5FC 3OX6A 3CWGA 1V1FA 1BT6A 1QLSA 2WCLA 4YRUA 1XFUO 4BY4A 1KFXS 2CXJA 1N65A 1MXEA 2CT9A 1QIWA 4C0LA 1K95A 4OVNF 3SIBA 1WLZA 3PN7C 3CTNA 2KFFA 3O6BA 3O78A 3JTDC 2ERBA 3D10A 3IQQA 5IBWA 1A2XA 3WHTB 1FI6A 3CLNA 4QJ3B 2F8PA 4GGNA 3RZSA 2CCMA 1XFXO 1WRZA 3EG5B 2K8MB 2KFHA 1TNPA 1AVSA 1NP8A 1K93D 2Y1NA 4R1EA 1TCFA 1A29A 4PDZA 2HETA 1S26D 4PCWA 1F70A 1RWYA 1ZFSA 1KQMC 2BNXA 4JWQA 3OGNA 3N7HA 2BE4A 2P70A 4CLNA 1WDCB 5PALA 1T14A 1OE9B 1WRKA 1NCXA 2HQ8A 3PN7B 2LVVA 4CFQA 3I5IC 1UHIA 1OOGA 3MSEB 2ZN9A 4YGEB 1OOFA 2MLFC 3V2LA 2PVBA 1MR8A 2LLUA 4YI8A 4MVFA 1B8CA 1UHKA 3C1VA 2JU0A 2M3WA 1UWOA 4N1GA 1MUXA 4YGDB 2I2RE 3CDNA 1SL9A 4YGCB 2I18A 1QV1A 3CYZA 1DF0B 2VRGA 2YGUA 3PM2A 1GM0A 1QXPA 1DGUA 1ODBA 2JNFA 1QVIZ 2JTTA 1CDPA 1XFZO 3AAKA 1SYMA 1F8HA 4AQIA 2K0JA 2R2IA 1U5IA 2QEOA 4FQOA 5GQQC 2JULA 2L0PA 2JT0A 3CR2A 1YUTA 3D78A 1GGZA 4C0JA 1PVBA 1SL7A 3LLEA 2BCBA 2COLB 2LUCA 1IIOA 1KFUS 1RK9A 1SNLA 3NXAA 5JJGA 5K89A 4PT1A 3SG6A 1ZUZA 2IS9A 4ORBB 1KK7Y 1OOHA 1SPYA 3I5IB 1YR5A 3K21A 2G9BA 2WCKA 4WQ3A 3BFBA 1SR6B 3KEVA 4DS7A 1FI5A 4PE4A 4ZCVA 2V53A 3S0EA 1DJGA 1K9KA 1OSAA 2K60A 2WCJA 1UURA 2KNEA 1UUSA 2Y5IA 3I5HB 1NX1A 2PQLA 4PE0A 2H61A 4HSZA 3SG3A 5CSFA 4I5NB 1TWOA 3FE6A 3I5GB 2EHBA 4FTGA 1K96A 2BE6A 5DKRA 4MRYA 1OQPA 1QIVA 1Y6WA 3DVJA 1MQ1A 3GK2A 3L47A 4JKTA 1RROA 1S5GZ 1KFUL 1PSBA 3KHEA 3VGOA 1WRLA 1YTZC 2LHIA 4ICBA 1M45A 1JC2A 1J1EA 1NYAA 3D73A 4QJ4B 1LVCD 3TDIA 2EGDA 5D3OA 4C0KA 5JOLA 1IH0A 3FWBA 1G8IA 2HPSA 5ER5A 1L2OB 2LLTA 3FWCA 1LKJA 5I8NA 3L4AA 1MXLC 3QRXA 1SCVA 5F6TA 1EXRA 2BL0B 2PYQA 1B7TZ 1SRAA 3B88A 1H8BA 2JQ6A 3FE8A 4TNCA 4CFRA 4CPVA 1J7OA 4Q04A 1C7WA 2G2BA 3R72A 2M1KB 1DGVA 1TTXA 4PE7A 1SBJA 3SS4A 1BJFA 1FBVA 1JF2A 1ORGA 3CZTX 2LP3A 1SK6D 2NCPA 4P2YB 1KK8B 1UHNA 3OB2B 1CDNA 2BCXA 1CKKA 3HCMA 3O4YA 1CLBA 2AMIA 2BECA 3TDZA 2WNDA 2L98A 1MWNA 2LM5A 3DY9A 1TN4A 3PJIA 1XO5A 2KI6D 2SCPA 2F3YA 5HYDA 1C3YA 3BUMB 1SCMB 2QEBA 3BXKA 5D7FA 3SG7A 1RFJA 1DJWA 1XFVO 3KF9A 3DD4A 2JXLA 3EK8A 2WOSA 1M39A 1DMOA 2PSRA 3TS5C 2F3ZA 3TUYC 1GGWA 2ZKMX 3CABA 1LA0A 1QX7A 3R1OA 1PRWA 1ALWA 4P5OE 1AJ5A 5TNCA 4NQGA 2BAPA 1TOPA 2KAYA 3O2PA 5I2OA 5I94A 1OMVA 2MBXA 4MLWA 1UP5A 2HF5A 3NHTA 3LCPC 3SJSA 1F4OA 2GTEA 4I5KA 3OX5A 1DJHA 2KQYA 4DIRA 1NPQA 1VRKA 2KI4C 2MJWB 1H4BA 1IJ5A 3ZWHA 1LA3A 1BR1B 1YURA 2BCAA 1S1EA 4OZDA 1BG1A 1Y1XA 4M2QA 3I5FB 1XYDA 1CTRA 5HLVA 5ER4X 1S3PA 2NZ0A 5EL2A 2KDHA 5HKZA 5I2LA 4UPGA 1W7IB 4I5LB 2B1UA 4A4BA 2GGMA 2ZRSA 1D1OA 1J7RA 1C3ZA 1CDMA 1J1DA 1QASA 3IF7A 3JVTC 3TS5B 3TZ1A 3JTDB 1PALA 3EK4A 1XFYO 1DJXA 3OP0A 2QDIA 4PHJA 1KSMA 3OB1B 3SIAA 3NSIA 3R1PA 2M8UA 1AK8A 2KLEA 1OMRA 1EG4A 1NX0A 4MSPA 2Y1MA 4N5XA 2ISDA 1JBAA 2KI4B 1SSEB 1DJIA 1YUSA 4NDCA 1BLQA 2JT3A 2JPOA 1YRTB 2WC5A 2Y4QA 2GGZA 2LUXA 1BU3A 1K9PA 1CFDA 1R6PA 4OCIA 2GV5A 3CS1A 4INWA 4OR9B 2CTNA 2PMYA 1B1GA 1W9ZA 1K2HA 1DEKA 1CFPA 1B47A 3TDUA 2LP2A 3PALA 1PSRA 1EL4A 4YI9A 1FW4A 2WCBA 2KYFA 1YX8A 3CZ2A 4U8DA 3VB1A 3D76A 2NLNA 2WCEA 3VRNA 2I94A 2LC5A 1K9UA 3FS7A 1SL8A 2KFGA 2ZNDA 3S0BA 3BOWA 4HRGA 2ZN8A 5B8IB 5KU1A 1DC1A 1LS8A 1QX2A 4GBAA 4I5JA 1PK0D 4E68A 4HRHA 3EKHA 1IRJA 1EJ3A 1DJYA 1N0YA 1QS7A 3FE9A 2H2KA 3CR4X 1OZOA 3DZTA 3EVVA 1WLMA 2HQWA 1KSOA 1KQVA 3D0YA 3BFHA 3KPXA 2LLSA 3BUOB 2L50A 2Q91A 4GGFC 2QPTA 1DT7B 1BODA 5BPJA 1J7QA 3BFAA 3EVRA 4IL1A 2FJYA 1QTXA 1QVIY 2L4HA 4NDBA 2BBNA 1GJYA 1IGVA 2KPHA 3H4SE 2MAZA 3VRPA 1CFFA 1U5IB 2M1UA 1XVJA 4PHMA 1BOCA 3BUNB 4M2PA 4USLA 5D69A 1JFKA 4QJ5B 2OS8C 2E30A 2L5YA 4XJKA 2JTZA 3ICBA 3GK1A 2K7DA 2EC6C 2D8NA 3CZ1A 3D74A 4YGBB 2L2CA 1ZACA 3OHMB
chains in the Genus database with same CATH topology
3IQOA 2QACA 2OTGC 5AANA 1K8UA 2KAVA 2FCDA 1CM1A 1V1GA 2LCPA 3BOWB 5AEQA 2KSPA 2ZFDA 1CLLA 1MF8B 2ZRTA 1S6IA 2L51A 3SG4A 4DRWA 2ZNEA 4F0ZB 1QV0A 1TCOB 4PHKA 3WNXB 5HKWA 2BKIB 4PHNA 1WY9A 1IWQA 2LMVA 5DKQA 1B4CA 2BBMA 4YGAA 4A4CA 4GFTA 1UHHA 1XFWO 1Y1AA 5I2QA 3WHUB 2JZIA 1A75A 1S5GY 2K61A 1LINA 2OS8B 3D0YB 1CFCA 1TNXA 3DVEA 5AFPA 2JWWA 2EC6B 1FF1A 4ETOA 1ZOTB 2PALA 1TNWA 3PSRA 1M31A 1DJZA 4M2OA 4GNKB 2KGBC 3VROA 1BF5A 1J55A 1YRUB 1B7TY 5FYXA 4XJKB 4L9MA 1R2UA 3BUWB 1CLMA 1X02A 4MZLA 4NDDA 1CB1A 1WDCC 1NUBA 1Q80A 4GPLB 2L4IA 1G33A 4XYNA 4HREE 1DF0A 4DUQA 1CNPA 1IJ6A 2A4JA 4ORCB 1CMGA 2DOQA 5AERA 1UHJA 2P6BB 1JFJA 3F45A 4DCKA 4WQ2A 4YBHB 2F2PA 5J3XA 3AKAA 3DVMA 1B8LA 1DVIA 2Q4UA 4MZKA 1Y1UA 3TUYB 3DF0A 3EVUA 5CSJA 1F71A 2KOTA 2WCFA 3WXAA 1KK7Z 1AUIB 2TN4A 1HT9A 1EG3A 2JNXA 3CR5X 1A75B 1KFXL 1RTP1 1NCYA 4MZJA 3NSKA 1KCYA 1NCZA 1S6JA 3E3RA 4ZCUA 2PRUA 1AP4A 3PATA 4JQ0D 4WRIA 1FPWA 2JRFA 3DVKA 3NSOA 2PASA 2JT8A 1JUOA 1A03A 4AQJA 2K7OA 5CPVA 2I7AA 4MN0A 3PLFB 1SR6C 3VRQA 3AKBA 2LVKA 3RLZA 1QX5B 5KTYA 1OOJA 1NX3A 2KBIA 3A4UB 2KYCA 1TRFA 3I5HC 1B8RA 2MHHA 3HX4A 1BR4B 1W7JB 2JC2A 1XA5A 3JVTB 1JF0A 1AHRA 1K94A 5HLOA 1QATA 1F4QA 4OKHA 3I5GC 2BKHB 1G4YR 4MRXA 2LE9B 2KQ6A 1A4PA 1JWDA 4GGFA 1QJTA 5HKYA 1CDLA 1YVLA 1QLKA 1CM4A 1Y0VH 2AUCA 3KO0A 1SKTA 3PM8A 2FCEA 2LMTA 2M49B 1KWOC 3FIAA 1SMGA 3DF0B 2K7BA 3SG5A 1F54A 1S36A 2M0RA 1IQ3A 1CMFA 1L2OC 1TIZA 1M46A 1PVAA 1SY9A 4MEWA 1DTLA 2LNKA 2BL0C 3BQ3A 1XK4A 1S6CA 1NWDA 2M97A 1EH2A 2K7CA 2LV7A 1NSHA 2M29A 2KGRA 1NIWA 1C07A 2CNPA 2F2OA 4PE1A 1YUUA 2CBLA 2K2AA 3EK7A 2WORA 1NX2A 1LXFC 2M7LA 4OV2A 3RM1A 1MHOA 4BY5A 1F55A 1C7VA 3A8RA 2NXQA 5G08A 1IG5A 1XK4C 1RJVA 1KK8C 1YVHA 3GK4X 2E6WA 3LK1A 2LHLA 3LL8B 2MA2A 4ORAB 4JPZB 2LMUA 1E8AA 2JPTA 2H61C 1J7PA 4AOMA 1KWOB 2WC8A 4GAOA 2JXCA 4D1EA 1N2DA 3M0WA 2LVJA 2RGIA 4N1FA 3ZNIA 2KHNA 1OMDA 1AJ4A 2F33A 3SG2A 1OZSA 1SW8A 1SCMC 3BUXB 5DKNA 2AAOA 1K90D 1IKUA 2KBMA 2NCOA 4MBEA 2FJUB 1IQ5A 2FOTA 2L2EA 3EKJA 1ZMZA 5CSIA 1RECA 2M9GA 3CGAA 3GOFA 4GUKA 1L7ZA 4PALA 2MLEC 2LAPA 2LVIA 2KI6C 2M7NA 4CIDA 2L5XB 1TNQA 1YX7A 2O5GA 3PFVA 2KAXA 1JSAA 1M63B 2K2FA 2LANA 1GQMA 3AAJA 3NSLA 1PULA 1KQMB 2JOJA 2MRDA 2OPOA 1HQVA 2OTGB 5AXIA 1B9AA 2O60A 3BYAA 3VRRA 5CSNA 5KSZA 1ALVA 1BMOA 2SASA 3LK0A 3I5FC 3OX6A 3CWGA 1V1FA 1BT6A 1QLSA 4YRUA 1XFUO 4BY4A 1KFXS 2CXJA 2CT9A 1N65A 1MXEA 1QIWA 4C0LA 1K95A 4OVNF 3SIBA 1WLZA 3PN7C 3CTNA 2KFFA 3O6BA 3O78A 3JTDC 3D10A 3IQQA 5IBWA 1A2XA 3WHTB 1FI6A 3CLNA 4QJ3B 2F8PA 4GGNA 2CCMA 1XFXO 1WRZA 2K8MB 2KFHA 1TNPA 1AVSA 1NP8A 1K93D 2Y1NA 4R1EA 1TCFA 1A29A 4PDZA 2HETA 1S26D 4PCWA 1F70A 1RWYA 1ZFSA 1KQMC 4JWQA 2BE4A 4CLNA 1WDCB 5PALA 1OE9B 1WRKA 1NCXA 2HQ8A 3PN7B 2LVVA 4CFQA 3I5IC 1UHIA 3MSEB 2ZN9A 4YGEB 2MLFC 2PVBA 1MR8A 2LLUA 4YI8A 4MVFA 1B8CA 1UHKA 3C1VA 2JU0A 2M3WA 1UWOA 4N1GA 1MUXA 4YGDB 2I2RE 1SL9A 4YGCB 2I18A 1QV1A 1DF0B 2VRGA 1QXPA 1DGUA 1ODBA 2JNFA 1QVIZ 2JTTA 1CDPA 1XFZO 3AAKA 1SYMA 1F8HA 4AQIA 2K0JA 2R2IA 1U5IA 4FQOA 5GQQC 2JULA 2L0PA 2JT0A 3CR2A 1YUTA 1GGZA 4C0JA 1PVBA 1SL7A 3LLEA 2BCBA 2COLB 2LUCA 1KFUS 1RK9A 1SNLA 3NXAA 5JJGA 5K89A 3SG6A 1ZUZA 2IS9A 4ORBB 1KK7Y 1SPYA 3I5IB 1YR5A 3K21A 2G9BA 4WQ3A 4DS7A 1SR6B 3KEVA 1FI5A 4PE4A 4ZCVA 2V53A 1DJGA 1K9KA 1OSAA 3I5HB 1UURA 2KNEA 1UUSA 2Y5IA 4PE0A 1NX1A 2H61A 4HSZA 3SG3A 5CSFA 4I5NB 4FTGA 3I5GB 2EHBA 1K96A 2BE6A 5DKRA 4MRYA 1OQPA 1QIVA 1Y6WA 3DVJA 1MQ1A 3GK2A 1RROA 1S5GZ 1KFUL 1PSBA 3KHEA 3VGOA 1WRLA 1YTZC 2LHIA 4ICBA 1M45A 1JC2A 1J1EA 1NYAA 4QJ4B 1LVCD 3TDIA 2EGDA 4C0KA 5JOLA 1IH0A 3FWBA 1G8IA 2HPSA 5ER5A 1L2OB 2LLTA 3FWCA 1LKJA 5I8NA 1MXLC 3QRXA 1SCVA 5F6TA 2BL0B 1EXRA 1B7TZ 1SRAA 1H8BA 2JQ6A 4TNCA 4CFRA 4CPVA 1J7OA 4Q04A 1C7WA 2G2BA 2M1KB 1DGVA 1TTXA 4PE7A 1SBJA 1BJFA 1FBVA 1JF2A 3CZTX 2LP3A 1SK6D 2NCPA 4P2YB 1KK8B 1UHNA 3OB2B 1CDNA 2BCXA 1CKKA 3HCMA 3O4YA 1CLBA 2AMIA 2BECA 3TDZA 2WNDA 2L98A 1MWNA 2LM5A 1TN4A 1XO5A 2KI6D 2SCPA 2F3YA 5HYDA 3BUMB 1SCMB 3BXKA 5D7FA 3SG7A 1RFJA 1DJWA 1XFVO 3KF9A 3DD4A 2JXLA 3EK8A 2WOSA 1M39A 1DMOA 2PSRA 3TS5C 2F3ZA 3TUYC 1GGWA 2ZKMX 1LA0A 1QX7A 1PRWA 1ALWA 4P5OE 1AJ5A 5TNCA 4NQGA 1TOPA 2KAYA 3O2PA 5I2OA 1OMVA 2MBXA 4MLWA 1UP5A 2HF5A 3SJSA 3LCPC 1F4OA 4I5KA 3OX5A 1DJHA 2KQYA 4DIRA 1NPQA 1VRKA 2KI4C 2MJWB 1H4BA 1IJ5A 3ZWHA 1LA3A 1BR1B 1YURA 2BCAA 1S1EA 1BG1A 1Y1XA 4M2QA 3I5FB 1XYDA 1CTRA 5HLVA 5ER4X 1S3PA 2NZ0A 2KDHA 5HKZA 5I2LA 4UPGA 1W7IB 4I5LB 2B1UA 4A4BA 2GGMA 2ZRSA 1D1OA 1J7RA 1CDMA 1J1DA 1QASA 3IF7A 3JVTC 3TS5B 3TZ1A 3JTDB 1PALA 3EK4A 1XFYO 1DJXA 3OP0A 4PHJA 1KSMA 3OB1B 3SIAA 3NSIA 2M8UA 1AK8A 1OMRA 1EG4A 1NX0A 4MSPA 2Y1MA 4N5XA 2ISDA 1JBAA 2KI4B 1YUSA 1DJIA 4NDCA 1BLQA 2JT3A 1YRTB 2Y4QA 2GGZA 2LUXA 1BU3A 1K9PA 1CFDA 1R6PA 4OCIA 2GV5A 3CS1A 4OR9B 2CTNA 2PMYA 1B1GA 1K2HA 1CFPA 1B47A 3TDUA 2LP2A 3PALA 1PSRA 1EL4A 4YI9A 1FW4A 2WCBA 2KYFA 1YX8A 4U8DA 2NLNA 2WCEA 3VRNA 2I94A 2LC5A 1K9UA 3FS7A 1SL8A 2KFGA 2ZNDA 3BOWA 4HRGA 2ZN8A 5B8IB 5KU1A 1QX2A 4GBAA 4I5JA 1PK0D 4E68A 4HRHA 3EKHA 1IRJA 1EJ3A 1DJYA 1N0YA 1QS7A 2H2KA 3CR4X 1OZOA 3EVVA 1WLMA 2HQWA 1KSOA 1KQVA 3D0YA 3KPXA 2LLSA 3BUOB 2L50A 2Q91A 4GGFC 2QPTA 1DT7B 1BODA 5BPJA 1J7QA 3EVRA 4IL1A 1QTXA 1QVIY 2L4HA 4NDBA 2BBNA 1GJYA 1IGVA 3H4SE 3VRPA 2MAZA 1CFFA 1BOCA 1U5IB 2M1UA 1XVJA 4PHMA 3BUNB 4M2PA 4USLA 5D69A 1JFKA 4QJ5B 2OS8C 2E30A 4XJKA 2JTZA 3ICBA 3GK1A 2K7DA 2EC6C 2D8NA 4YGBB 1ZACA 3OHMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IQO A;  2QAC A;  2OTG C;  5AAN A;  1K8U A;  2KAV A;  2FCD A;  1CM1 A;  1V1G A;  2LCP A;  3BOW B;  5AEQ A;  2KSP A;  2ZFD A;  1CLL A;  1MF8 B;  2ZRT A;  1S6I A;  2L51 A;  3SG4 A;  4DRW A;  2ZNE A;  4F0Z B;  1QV0 A;  1TCO B;  4PHK A;  3WNX B;  5HKW A;  2BKI B;  4PHN A;  1WY9 A;  1IWQ A;  2LMV A;  5DKQ A;  1B4C A;  2BBM A;  4YGA A;  4A4C A;  4GFT A;  1UHH A;  1XFW O;  1Y1A A;  5I2Q A;  3WHU B;  2JZI A;  1A75 A;  1S5G Y;  2K61 A;  1LIN A;  2OS8 B;  3D0Y B;  1CFC A;  1TNX A;  3DVE A;  5AFP A;  2JWW A;  2EC6 B;  1FF1 A;  4ETO A;  1ZOT B;  2PAL A;  1TNW A;  3PSR A;  1M31 A;  1DJZ A;  4M2O A;  4GNK B;  2KGB C;  3VRO A;  1BF5 A;  1J55 A;  1YRU B;  1B7T Y;  5FYX A;  4XJK B;  4L9M A;  1R2U A;  3BUW B;  1CLM A;  1X02 A;  4MZL A;  4NDD A;  1CB1 A;  1WDC C;  1NUB A;  1Q80 A;  4GPL B;  2L4I A;  1G33 A;  4XYN A;  4HRE E;  1DF0 A;  4DUQ A;  1CNP A;  1IJ6 A;  2A4J A;  4ORC B;  1CMG A;  2DOQ A;  5AER A;  1UHJ A;  2P6B B;  1JFJ A;  3F45 A;  4DCK A;  4WQ2 A;  4YBH B;  2F2P A;  5J3X A;  3AKA A;  3DVM A;  1B8L A;  1DVI A;  2Q4U A;  4MZK A;  1Y1U A;  3TUY B;  3DF0 A;  3EVU A;  5CSJ A;  1F71 A;  2KOT A;  2WCF A;  3WXA A;  1KK7 Z;  1AUI B;  2TN4 A;  1HT9 A;  1EG3 A;  2JNX A;  3CR5 X;  1A75 B;  1KFX L;  1RTP 1;  1NCY A;  4MZJ A;  3NSK A;  1KCY A;  1NCZ A;  1S6J A;  3E3R A;  4ZCU A;  2PRU A;  1AP4 A;  3PAT A;  4JQ0 D;  4WRI A;  1FPW A;  2JRF A;  3DVK A;  3NSO A;  2PAS A;  2JT8 A;  1JUO A;  1A03 A;  4AQJ A;  2K7O A;  5CPV A;  2I7A A;  4MN0 A;  3PLF B;  1SR6 C;  3VRQ A;  3AKB A;  2LVK A;  3RLZ A;  1QX5 B;  5KTY A;  1OOJ A;  1NX3 A;  2KBI A;  3A4U B;  2KYC A;  1TRF A;  3I5H C;  1B8R A;  2MHH A;  3HX4 A;  1BR4 B;  1W7J B;  2JC2 A;  1XA5 A;  3JVT B;  1JF0 A;  1AHR A;  1K94 A;  5HLO A;  1QAT A;  1F4Q A;  4OKH A;  3I5G C;  2BKH B;  1G4Y R;  4MRX A;  2LE9 B;  2KQ6 A;  1A4P A;  1JWD A;  4GGF A;  1QJT A;  5HKY A;  1CDL A;  1YVL A;  1QLK A;  1CM4 A;  1Y0V H;  2AUC A;  3KO0 A;  1SKT A;  3PM8 A;  2FCE A;  2LMT A;  2M49 B;  1KWO C;  3FIA A;  1SMG A;  3DF0 B;  2K7B A;  3SG5 A;  1F54 A;  1S36 A;  2M0R A;  1IQ3 A;  1CMF A;  1L2O C;  1TIZ A;  1M46 A;  1PVA A;  1SY9 A;  4MEW A;  1DTL A;  2LNK A;  2BL0 C;  3BQ3 A;  1XK4 A;  1S6C A;  1NWD A;  2M97 A;  1EH2 A;  2K7C A;  2LV7 A;  1NSH A;  2M29 A;  2KGR A;  1NIW A;  1C07 A;  2CNP A;  2F2O A;  4PE1 A;  1YUU A;  2CBL A;  2K2A A;  3EK7 A;  2WOR A;  1NX2 A;  1LXF C;  2M7L A;  4OV2 A;  3RM1 A;  1MHO A;  4BY5 A;  1F55 A;  1C7V A;  3A8R A;  2NXQ A;  5G08 A;  1IG5 A;  1XK4 C;  1RJV A;  1KK8 C;  1YVH A;  3GK4 X;  2E6W A;  3LK1 A;  2LHL A;  3LL8 B;  2MA2 A;  4ORA B;  4JPZ B;  2LMU A;  1E8A A;  2JPT A;  2H61 C;  1J7P A;  4AOM A;  1KWO B;  2WC8 A;  4GAO A;  2JXC A;  4D1E A;  1N2D A;  3M0W A;  2LVJ A;  2RGI A;  4N1F A;  3ZNI A;  2KHN A;  1OMD A;  1AJ4 A;  2F33 A;  3SG2 A;  1OZS A;  1SW8 A;  1SCM C;  3BUX B;  5DKN A;  2AAO A;  1K90 D;  1IKU A;  2KBM A;  2NCO A;  4MBE A;  2FJU B;  1IQ5 A;  2FOT A;  2L2E A;  3EKJ A;  1ZMZ A;  5CSI A;  1REC A;  2M9G A;  3CGA A;  3GOF A;  4GUK A;  1L7Z A;  4PAL A;  2MLE C;  2LAP A;  2LVI A;  2KI6 C;  2M7N A;  4CID A;  2L5X B;  1TNQ A;  1YX7 A;  2O5G A;  3PFV A;  2KAX A;  1JSA A;  1M63 B;  2K2F A;  2LAN A;  1GQM A;  3AAJ A;  3NSL A;  1PUL A;  1KQM B;  2JOJ A;  2MRD A;  2OPO A;  1HQV A;  2OTG B;  5AXI A;  1B9A A;  2O60 A;  3BYA A;  3VRR A;  5CSN A;  5KSZ A;  1ALV A;  1BMO A;  2SAS A;  3LK0 A;  3I5F C;  3OX6 A;  3CWG A;  1V1F A;  1BT6 A;  1QLS A;  4YRU A;  1XFU O;  4BY4 A;  1KFX S;  2CXJ A;  2CT9 A;  1N65 A;  1MXE A;  1QIW A;  4C0L A;  1K95 A;  4OVN F;  3SIB A;  1WLZ A;  3PN7 C;  3CTN A;  2KFF A;  3O6B A;  3O78 A;  3JTD C;  3D10 A;  3IQQ A;  5IBW A;  1A2X A;  3WHT B;  1FI6 A;  3CLN A;  4QJ3 B;  2F8P A;  4GGN A;  2CCM A;  1XFX O;  1WRZ A;  2K8M B;  2KFH A;  1TNP A;  1AVS A;  1NP8 A;  1K93 D;  2Y1N A;  4R1E A;  1TCF A;  1A29 A;  4PDZ A;  2HET A;  1S26 D;  4PCW A;  1F70 A;  1RWY A;  1ZFS A;  1KQM C;  4JWQ A;  2BE4 A;  4CLN A;  1WDC B;  5PAL A;  1OE9 B;  1WRK A;  1NCX A;  2HQ8 A;  3PN7 B;  2LVV A;  4CFQ A;  3I5I C;  1UHI A;  3MSE B;  2ZN9 A;  4YGE B;  2MLF C;  2PVB A;  1MR8 A;  2LLU A;  4YI8 A;  4MVF A;  1B8C A;  1UHK A;  3C1V A;  2JU0 A;  2M3W A;  1UWO A;  4N1G A;  1MUX A;  4YGD B;  2I2R E;  1SL9 A;  4YGC B;  2I18 A;  1QV1 A;  1DF0 B;  2VRG A;  1QXP A;  1DGU A;  1ODB A;  2JNF A;  1QVI Z;  2JTT A;  1CDP A;  1XFZ O;  3AAK A;  1SYM A;  1F8H A;  4AQI A;  2K0J A;  2R2I A;  1U5I A;  4FQO A;  5GQQ C;  2JUL A;  2L0P A;  2JT0 A;  3CR2 A;  1YUT A;  1GGZ A;  4C0J A;  1PVB A;  1SL7 A;  3LLE A;  2BCB A;  2COL B;  2LUC A;  1KFU S;  1RK9 A;  1SNL A;  3NXA A;  5JJG A;  5K89 A;  3SG6 A;  1ZUZ A;  2IS9 A;  4ORB B;  1KK7 Y;  1SPY A;  3I5I B;  1YR5 A;  3K21 A;  2G9B A;  4WQ3 A;  4DS7 A;  1SR6 B;  3KEV A;  1FI5 A;  4PE4 A;  4ZCV A;  2V53 A;  1DJG A;  1K9K A;  1OSA A;  3I5H B;  1UUR A;  2KNE A;  1UUS A;  2Y5I A;  4PE0 A;  1NX1 A;  2H61 A;  4HSZ A;  3SG3 A;  5CSF A;  4I5N B;  4FTG A;  3I5G B;  2EHB A;  1K96 A;  2BE6 A;  5DKR A;  4MRY A;  1OQP A;  1QIV A;  1Y6W A;  3DVJ A;  1MQ1 A;  3GK2 A;  1RRO A;  1S5G Z;  1KFU L;  1PSB A;  3KHE A;  3VGO A;  1WRL A;  1YTZ C;  2LHI A;  4ICB A;  1M45 A;  1JC2 A;  1J1E A;  1NYA A;  4QJ4 B;  1LVC D;  3TDI A;  2EGD A;  4C0K A;  5JOL A;  1IH0 A;  3FWB A;  1G8I A;  2HPS A;  5ER5 A;  1L2O B;  2LLT A;  3FWC A;  1LKJ A;  5I8N A;  1MXL C;  3QRX A;  1SCV A;  5F6T A;  2BL0 B;  1EXR A;  1B7T Z;  1SRA A;  1H8B A;  2JQ6 A;  4TNC A;  4CFR A;  4CPV A;  1J7O A;  4Q04 A;  1C7W A;  2G2B A;  2M1K B;  1DGV A;  1TTX A;  4PE7 A;  1SBJ A;  1BJF A;  1FBV A;  1JF2 A;  3CZT X;  2LP3 A;  1SK6 D;  2NCP A;  4P2Y B;  1KK8 B;  1UHN A;  3OB2 B;  1CDN A;  2BCX A;  1CKK A;  3HCM A;  3O4Y A;  1CLB A;  2AMI A;  2BEC A;  3TDZ A;  2WND A;  2L98 A;  1MWN A;  2LM5 A;  1TN4 A;  1XO5 A;  2KI6 D;  2SCP A;  2F3Y A;  5HYD A;  3BUM B;  1SCM B;  3BXK A;  5D7F A;  3SG7 A;  1RFJ A;  1DJW A;  1XFV O;  3KF9 A;  3DD4 A;  2JXL A;  3EK8 A;  2WOS A;  1M39 A;  1DMO A;  2PSR A;  3TS5 C;  2F3Z A;  3TUY C;  1GGW A;  2ZKM X;  1LA0 A;  1QX7 A;  1PRW A;  1ALW A;  4P5O E;  1AJ5 A;  5TNC A;  4NQG A;  1TOP A;  2KAY A;  3O2P A;  5I2O A;  1OMV A;  2MBX A;  4MLW A;  1UP5 A;  2HF5 A;  3SJS A;  3LCP C;  1F4O A;  4I5K A;  3OX5 A;  1DJH A;  2KQY A;  4DIR A;  1NPQ A;  1VRK A;  2KI4 C;  2MJW B;  1H4B A;  1IJ5 A;  3ZWH A;  1LA3 A;  1BR1 B;  1YUR A;  2BCA A;  1S1E A;  1BG1 A;  1Y1X A;  4M2Q A;  3I5F B;  1XYD A;  1CTR A;  5HLV A;  5ER4 X;  1S3P A;  2NZ0 A;  2KDH A;  5HKZ A;  5I2L A;  4UPG A;  1W7I B;  4I5L B;  2B1U A;  4A4B A;  2GGM A;  2ZRS A;  1D1O A;  1J7R A;  1CDM A;  1J1D A;  1QAS A;  3IF7 A;  3JVT C;  3TS5 B;  3TZ1 A;  3JTD B;  1PAL A;  3EK4 A;  1XFY O;  1DJX A;  3OP0 A;  4PHJ A;  1KSM A;  3OB1 B;  3SIA A;  3NSI A;  2M8U A;  1AK8 A;  1OMR A;  1EG4 A;  1NX0 A;  4MSP A;  2Y1M A;  4N5X A;  2ISD A;  1JBA A;  2KI4 B;  1YUS A;  1DJI A;  4NDC A;  1BLQ A;  2JT3 A;  1YRT B;  2Y4Q A;  2GGZ A;  2LUX A;  1BU3 A;  1K9P A;  1CFD A;  1R6P A;  4OCI A;  2GV5 A;  3CS1 A;  4OR9 B;  2CTN A;  2PMY A;  1B1G A;  1K2H A;  1CFP A;  1B47 A;  3TDU A;  2LP2 A;  3PAL A;  1PSR A;  1EL4 A;  4YI9 A;  1FW4 A;  2WCB A;  2KYF A;  1YX8 A;  4U8D A;  2NLN A;  2WCE A;  3VRN A;  2I94 A;  2LC5 A;  1K9U A;  3FS7 A;  1SL8 A;  2KFG A;  2ZND A;  3BOW A;  4HRG A;  2ZN8 A;  5B8I B;  5KU1 A;  1QX2 A;  4GBA A;  4I5J A;  1PK0 D;  4E68 A;  4HRH A;  3EKH A;  1IRJ A;  1EJ3 A;  1DJY A;  1N0Y A;  1QS7 A;  2H2K A;  3CR4 X;  1OZO A;  3EVV A;  1WLM A;  2HQW A;  1KSO A;  1KQV A;  3D0Y A;  3KPX A;  2LLS A;  3BUO B;  2L50 A;  2Q91 A;  4GGF C;  2QPT A;  1DT7 B;  1BOD A;  5BPJ A;  1J7Q A;  3EVR A;  4IL1 A;  1QTX A;  1QVI Y;  2L4H A;  4NDB A;  2BBN A;  1GJY A;  1IGV A;  3H4S E;  3VRP A;  2MAZ A;  1CFF A;  1BOC A;  1U5I B;  2M1U A;  1XVJ A;  4PHM A;  3BUN B;  4M2P A;  4USL A;  5D69 A;  1JFK A;  4QJ5 B;  2OS8 C;  2E30 A;  4XJK A;  2JTZ A;  3ICB A;  3GK1 A;  2K7D A;  2EC6 C;  2D8N A;  4YGB B;  1ZAC A;  3OHM B; 
#chains in the Genus database with same CATH topology
 3IQO A;  2QAC A;  3SS3 A;  2OTG C;  5AAN A;  1K8U A;  2KAV A;  2FCD A;  1CM1 A;  1V1G A;  2LCP A;  3BOW B;  5AEQ A;  2KSP A;  2ZFD A;  1CLL A;  1MF8 B;  2ZRT A;  1S6I A;  2L51 A;  3SG4 A;  4DRW A;  2ZNE A;  4F0Z B;  1QV0 A;  1TCO B;  4PHK A;  3WNX B;  5HKW A;  2BKI B;  4PHN A;  2H8V A;  1WY9 A;  1IWQ A;  3UO9 A;  2LMV A;  5DKQ A;  2P71 A;  2BBM A;  1B4C A;  4YGA A;  4A4C A;  4GFT A;  1UHH A;  1XFW O;  1Y1A A;  3O4X A;  5I2Q A;  1TUZ A;  2JZI A;  1A75 A;  1S5G Y;  2K61 A;  1LIN A;  2OS8 B;  3D0Y B;  3WHU B;  1CFC A;  1TNX A;  3DVE A;  5AFP A;  2JWW A;  2EC6 B;  1FF1 A;  4ETO A;  3B87 A;  1ZOT B;  2PAL A;  1TNW A;  3PSR A;  1M31 A;  1DJZ A;  4M2O A;  4GNK B;  2KGB C;  3VRO A;  1BF5 A;  1J55 A;  1YRU B;  1B7T Y;  3DYE A;  5FYX A;  5FI7 A;  4XJK B;  4L9M A;  1R2U A;  3BUW B;  1CLM A;  1X02 A;  3BJH A;  4MZL A;  4NDD A;  1CB1 A;  1WDC C;  1NUB A;  1Q80 A;  4GPL B;  2L4I A;  1DEL A;  1G33 A;  4XYN A;  4KYN A;  4HRE E;  1DF0 A;  5FI6 A;  4DUQ A;  1CNP A;  1IJ6 A;  3L4L A;  2A4J A;  4ORC B;  3S0F A;  4JD9 A;  1CMG A;  2DOQ A;  5AER A;  1UHJ A;  2P6B B;  1JFJ A;  3F45 A;  4DCK A;  4IJ7 A;  4WQ2 A;  4YBH B;  2F2P A;  5J3X A;  1OOI X;  3AKA A;  3DVM A;  1B8L A;  1DVI A;  2Q4U A;  4MZK A;  1Y1U A;  3S0D A;  3TUY B;  3DF0 A;  1P28 A;  3EVU A;  3IVT A;  5CSJ A;  2KOT A;  2WCF A;  1F71 A;  3WXA A;  1KK7 Z;  1AUI B;  2TN4 A;  1HT9 A;  1EG3 A;  2JNX A;  3CR5 X;  1A75 B;  1KFX L;  1RTP 1;  1NCY A;  4MZJ A;  3NSK A;  1KCY A;  1NCZ A;  1S6J A;  3E3R A;  4ZCU A;  2PRU A;  1AP4 A;  3PAT A;  4JQ0 D;  4WRI A;  1FPW A;  2JRF A;  3DVK A;  3NSO A;  3QME A;  2PAS A;  1Z4H A;  2JT8 A;  1JUO A;  1A03 A;  4AQJ A;  2K7O A;  5CPV A;  2I7A A;  4MN0 A;  3PLF B;  1SR6 C;  3VRQ A;  3AKB A;  2LVK A;  3RLZ A;  1QX5 B;  5KTY A;  1OOJ A;  1NX3 A;  2KBI A;  3A4U B;  2KYC A;  1TRF A;  3I5H C;  1B8R A;  2MHH A;  3HX4 A;  1BR4 B;  1W7J B;  2JC2 A;  1XA5 A;  3R1V A;  4F7F A;  3JVT B;  1JF0 A;  1AHR A;  4INX A;  1K94 A;  1QWV A;  1QAT A;  3B86 A;  5HLO A;  1F4Q A;  4OKH A;  3I5G C;  2BKH B;  1G4Y R;  4MRX A;  2LE9 B;  2KQ6 A;  1A4P A;  1JWD A;  4GGF A;  1QJT A;  5HKY A;  1CDL A;  1YVL A;  1QLK A;  1CM4 A;  1Y0V H;  2AUC A;  3KO0 A;  1SKT A;  3PM8 A;  2FCE A;  2LMT A;  2M49 B;  1XFR A;  1KWO C;  1SMG A;  3DF0 B;  3FIA A;  1DQE A;  2K7B A;  3SG5 A;  1F54 A;  2QEH A;  1S36 A;  2M0R A;  1IQ3 A;  1CMF A;  1L2O C;  1TIZ A;  1M46 A;  1PVA A;  1SY9 A;  4MEW A;  1DTL A;  2LNK A;  2BL0 C;  3B6X A;  3BQ3 A;  1XK4 A;  1S6C A;  1NWD A;  2M97 A;  2WCH A;  2K7C A;  2LV7 A;  1EH2 A;  1NSH A;  2M29 A;  2KGR A;  5HL1 A;  1NIW A;  1C07 A;  2CNP A;  3S0G A;  2F2O A;  4PE1 A;  1YUU A;  2CBL A;  2K2A A;  3EK7 A;  2WOR A;  1NX2 A;  1LXF C;  3K1E A;  4OV2 A;  2M7L A;  3RM1 A;  1MHO A;  4BY5 A;  3S0A A;  3Q8I A;  1C7V A;  3A8R A;  1F55 A;  2NXQ A;  5G08 A;  1IG5 A;  1XK4 C;  1RJV A;  1KK8 C;  1YVH A;  3GK4 X;  2E6W A;  3LK1 A;  2LHL A;  3LL8 B;  2MA2 A;  3B7A A;  4ORA B;  4JPZ B;  2LMU A;  1E8A A;  2JPT A;  2H61 C;  1J7P A;  2QEV A;  4AOM A;  1KWO B;  2WC8 A;  4GAO A;  2JXC A;  4D1E A;  3DXL A;  1N2D A;  3M0W A;  2LVJ A;  2RGI A;  4N1F A;  3ZNI A;  4FQT A;  2KHN A;  1OMD A;  1AJ4 A;  2F33 A;  3SG2 A;  1OZS A;  1SW8 A;  1SCM C;  3BUX B;  5DKN A;  2AAO A;  3SS5 A;  1K90 D;  1IKU A;  2KBM A;  3D75 A;  2NCO A;  4MBE A;  3NGV A;  2FJU B;  1IQ5 A;  1Z2C B;  2FOT A;  2L2E A;  1ZMZ A;  3EKJ A;  5CSI A;  1REC A;  2M9G A;  3CGA A;  3GOF A;  4GUK A;  5FI2 A;  3CZ0 A;  3NHI A;  1L7Z A;  4PAL A;  2MLE C;  2LAP A;  2WC6 A;  2LVI A;  2KI6 C;  2M7N A;  3OBV A;  4CID A;  2L5X B;  3UNW A;  2WCM A;  1TNQ A;  1YX7 A;  2O5G A;  3PFV A;  2KAX A;  1JSA A;  1M63 B;  2K2F A;  2LAN A;  1GQM A;  3AAJ A;  3NSL A;  3D77 A;  1PUL A;  1KQM B;  2JOJ A;  2KLD A;  2MRD A;  2OPO A;  1HQV A;  2OTG B;  5AXI A;  1B9A A;  2O60 A;  3BYA A;  3VRR A;  5DIC A;  5CSN A;  1OW4 A;  5KSZ A;  1ALV A;  1BMO A;  1TUJ A;  2SAS A;  3LK0 A;  3I5F C;  3OX6 A;  3CWG A;  1V1F A;  1BT6 A;  1QLS A;  2WCL A;  4YRU A;  1XFU O;  4BY4 A;  1KFX S;  2CXJ A;  1N65 A;  1MXE A;  2CT9 A;  1QIW A;  4C0L A;  1K95 A;  4OVN F;  3SIB A;  1WLZ A;  3PN7 C;  3CTN A;  2KFF A;  3O6B A;  3O78 A;  3JTD C;  2ERB A;  3D10 A;  3IQQ A;  5IBW A;  1A2X A;  3WHT B;  1FI6 A;  3CLN A;  4QJ3 B;  2F8P A;  4GGN A;  3RZS A;  2CCM A;  1XFX O;  1WRZ A;  3EG5 B;  2K8M B;  2KFH A;  1TNP A;  1AVS A;  1NP8 A;  1K93 D;  2Y1N A;  4R1E A;  1TCF A;  1A29 A;  4PDZ A;  2HET A;  1S26 D;  4PCW A;  1F70 A;  1RWY A;  1ZFS A;  1KQM C;  2BNX A;  4JWQ A;  3OGN A;  3N7H A;  2BE4 A;  2P70 A;  4CLN A;  1WDC B;  5PAL A;  1T14 A;  1OE9 B;  1WRK A;  1NCX A;  2HQ8 A;  3PN7 B;  2LVV A;  4CFQ A;  3I5I C;  1UHI A;  1OOG A;  3MSE B;  2ZN9 A;  4YGE B;  1OOF A;  2MLF C;  3V2L A;  2PVB A;  1MR8 A;  2LLU A;  4YI8 A;  4MVF A;  1B8C A;  1UHK A;  3C1V A;  2JU0 A;  2M3W A;  1UWO A;  4N1G A;  1MUX A;  4YGD B;  2I2R E;  3CDN A;  1SL9 A;  4YGC B;  2I18 A;  1QV1 A;  3CYZ A;  1DF0 B;  2VRG A;  2YGU A;  3PM2 A;  1GM0 A;  1QXP A;  1DGU A;  1ODB A;  2JNF A;  1QVI Z;  2JTT A;  1CDP A;  1XFZ O;  3AAK A;  1SYM A;  1F8H A;  4AQI A;  2K0J A;  2R2I A;  1U5I A;  2QEO A;  4FQO A;  5GQQ C;  2JUL A;  2L0P A;  2JT0 A;  3CR2 A;  1YUT A;  3D78 A;  1GGZ A;  4C0J A;  1PVB A;  1SL7 A;  3LLE A;  2BCB A;  2COL B;  2LUC A;  1IIO A;  1KFU S;  1RK9 A;  1SNL A;  3NXA A;  5JJG A;  5K89 A;  4PT1 A;  3SG6 A;  1ZUZ A;  2IS9 A;  4ORB B;  1KK7 Y;  1OOH A;  1SPY A;  3I5I B;  1YR5 A;  3K21 A;  2G9B A;  2WCK A;  4WQ3 A;  3BFB A;  1SR6 B;  3KEV A;  4DS7 A;  1FI5 A;  4PE4 A;  4ZCV A;  2V53 A;  3S0E A;  1DJG A;  1K9K A;  1OSA A;  2K60 A;  2WCJ A;  1UUR A;  2KNE A;  1UUS A;  2Y5I A;  3I5H B;  1NX1 A;  2PQL A;  4PE0 A;  2H61 A;  4HSZ A;  3SG3 A;  5CSF A;  4I5N B;  1TWO A;  3FE6 A;  3I5G B;  2EHB A;  4FTG A;  1K96 A;  2BE6 A;  5DKR A;  4MRY A;  1OQP A;  1QIV A;  1Y6W A;  3DVJ A;  1MQ1 A;  3GK2 A;  3L47 A;  4JKT A;  1RRO A;  1S5G Z;  1KFU L;  1PSB A;  3KHE A;  3VGO A;  1WRL A;  1YTZ C;  2LHI A;  4ICB A;  1M45 A;  1JC2 A;  1J1E A;  1NYA A;  3D73 A;  4QJ4 B;  1LVC D;  3TDI A;  2EGD A;  5D3O A;  4C0K A;  5JOL A;  1IH0 A;  3FWB A;  1G8I A;  2HPS A;  5ER5 A;  1L2O B;  2LLT A;  3FWC A;  1LKJ A;  5I8N A;  3L4A A;  1MXL C;  3QRX A;  1SCV A;  5F6T A;  1EXR A;  2BL0 B;  2PYQ A;  1B7T Z;  1SRA A;  3B88 A;  1H8B A;  2JQ6 A;  3FE8 A;  4TNC A;  4CFR A;  4CPV A;  1J7O A;  4Q04 A;  1C7W A;  2G2B A;  3R72 A;  2M1K B;  1DGV A;  1TTX A;  4PE7 A;  1SBJ A;  3SS4 A;  1BJF A;  1FBV A;  1JF2 A;  1ORG A;  3CZT X;  2LP3 A;  1SK6 D;  2NCP A;  4P2Y B;  1KK8 B;  1UHN A;  3OB2 B;  1CDN A;  2BCX A;  1CKK A;  3HCM A;  3O4Y A;  1CLB A;  2AMI A;  2BEC A;  3TDZ A;  2WND A;  2L98 A;  1MWN A;  2LM5 A;  3DY9 A;  1TN4 A;  3PJI A;  1XO5 A;  2KI6 D;  2SCP A;  2F3Y A;  5HYD A;  1C3Y A;  3BUM B;  1SCM B;  2QEB A;  3BXK A;  5D7F A;  3SG7 A;  1RFJ A;  1DJW A;  1XFV O;  3KF9 A;  3DD4 A;  2JXL A;  3EK8 A;  2WOS A;  1M39 A;  1DMO A;  2PSR A;  3TS5 C;  2F3Z A;  3TUY C;  1GGW A;  2ZKM X;  3CAB A;  1LA0 A;  1QX7 A;  3R1O A;  1PRW A;  1ALW A;  4P5O E;  1AJ5 A;  5TNC A;  4NQG A;  2BAP A;  1TOP A;  2KAY A;  3O2P A;  5I2O A;  5I94 A;  1OMV A;  2MBX A;  4MLW A;  1UP5 A;  2HF5 A;  3NHT A;  3LCP C;  3SJS A;  1F4O A;  2GTE A;  4I5K A;  3OX5 A;  1DJH A;  2KQY A;  4DIR A;  1NPQ A;  1VRK A;  2KI4 C;  2MJW B;  1H4B A;  1IJ5 A;  3ZWH A;  1LA3 A;  1BR1 B;  1YUR A;  2BCA A;  1S1E A;  4OZD A;  1BG1 A;  1Y1X A;  4M2Q A;  3I5F B;  1XYD A;  1CTR A;  5HLV A;  5ER4 X;  1S3P A;  2NZ0 A;  5EL2 A;  2KDH A;  5HKZ A;  5I2L A;  4UPG A;  1W7I B;  4I5L B;  2B1U A;  4A4B A;  2GGM A;  2ZRS A;  1D1O A;  1J7R A;  1C3Z A;  1CDM A;  1J1D A;  1QAS A;  3IF7 A;  3JVT C;  3TS5 B;  3TZ1 A;  3JTD B;  1PAL A;  3EK4 A;  1XFY O;  1DJX A;  3OP0 A;  2QDI A;  4PHJ A;  1KSM A;  3OB1 B;  3SIA A;  3NSI A;  3R1P A;  2M8U A;  1AK8 A;  2KLE A;  1OMR A;  1EG4 A;  1NX0 A;  4MSP A;  2Y1M A;  4N5X A;  2ISD A;  1JBA A;  2KI4 B;  1SSE B;  1DJI A;  1YUS A;  4NDC A;  1BLQ A;  2JT3 A;  2JPO A;  1YRT B;  2WC5 A;  2Y4Q A;  2GGZ A;  2LUX A;  1BU3 A;  1K9P A;  1CFD A;  1R6P A;  4OCI A;  2GV5 A;  3CS1 A;  4INW A;  4OR9 B;  2CTN A;  2PMY A;  1B1G A;  1W9Z A;  1K2H A;  1DEK A;  1CFP A;  1B47 A;  3TDU A;  2LP2 A;  3PAL A;  1PSR A;  1EL4 A;  4YI9 A;  1FW4 A;  2WCB A;  2KYF A;  1YX8 A;  3CZ2 A;  4U8D A;  3VB1 A;  3D76 A;  2NLN A;  2WCE A;  3VRN A;  2I94 A;  2LC5 A;  1K9U A;  3FS7 A;  1SL8 A;  2KFG A;  2ZND A;  3S0B A;  3BOW A;  4HRG A;  2ZN8 A;  5B8I B;  5KU1 A;  1DC1 A;  1LS8 A;  1QX2 A;  4GBA A;  4I5J A;  1PK0 D;  4E68 A;  4HRH A;  3EKH A;  1IRJ A;  1EJ3 A;  1DJY A;  1N0Y A;  1QS7 A;  3FE9 A;  2H2K A;  3CR4 X;  1OZO A;  3DZT A;  3EVV A;  1WLM A;  2HQW A;  1KSO A;  1KQV A;  3D0Y A;  3BFH A;  3KPX A;  2LLS A;  3BUO B;  2L50 A;  2Q91 A;  4GGF C;  2QPT A;  1DT7 B;  1BOD A;  5BPJ A;  1J7Q A;  3BFA A;  3EVR A;  4IL1 A;  2FJY A;  1QTX A;  1QVI Y;  2L4H A;  4NDB A;  2BBN A;  1GJY A;  1IGV A;  2KPH A;  3H4S E;  2MAZ A;  3VRP A;  1CFF A;  1U5I B;  2M1U A;  1XVJ A;  4PHM A;  1BOC A;  3BUN B;  4M2P A;  4USL A;  5D69 A;  1JFK A;  4QJ5 B;  2OS8 C;  2E30 A;  2L5Y A;  4XJK A;  2JTZ A;  3ICB A;  3GK1 A;  2K7D A;  2EC6 C;  2D8N A;  3CZ1 A;  3D74 A;  4YGB B;  2L2C A;  1ZAC A;  3OHM B; 
#chains in the Genus database with same CATH homology
 3IQO A;  2QAC A;  2OTG C;  5AAN A;  1K8U A;  2KAV A;  2FCD A;  1CM1 A;  1V1G A;  2LCP A;  3BOW B;  5AEQ A;  2KSP A;  2ZFD A;  1CLL A;  1MF8 B;  2ZRT A;  1S6I A;  2L51 A;  3SG4 A;  4DRW A;  2ZNE A;  4F0Z B;  1QV0 A;  1TCO B;  4PHK A;  3WNX B;  5HKW A;  2BKI B;  4PHN A;  1WY9 A;  1IWQ A;  2LMV A;  5DKQ A;  1B4C A;  2BBM A;  4YGA A;  4A4C A;  4GFT A;  1UHH A;  1XFW O;  1Y1A A;  5I2Q A;  3WHU B;  2JZI A;  1A75 A;  1S5G Y;  2K61 A;  1LIN A;  2OS8 B;  3D0Y B;  1CFC A;  1TNX A;  3DVE A;  5AFP A;  2JWW A;  2EC6 B;  1FF1 A;  4ETO A;  1ZOT B;  2PAL A;  1TNW A;  3PSR A;  1M31 A;  1DJZ A;  4M2O A;  4GNK B;  2KGB C;  3VRO A;  1BF5 A;  1J55 A;  1YRU B;  1B7T Y;  5FYX A;  4XJK B;  4L9M A;  1R2U A;  3BUW B;  1CLM A;  1X02 A;  4MZL A;  4NDD A;  1CB1 A;  1WDC C;  1NUB A;  1Q80 A;  4GPL B;  2L4I A;  1G33 A;  4XYN A;  4HRE E;  1DF0 A;  4DUQ A;  1CNP A;  1IJ6 A;  2A4J A;  4ORC B;  1CMG A;  2DOQ A;  5AER A;  1UHJ A;  2P6B B;  1JFJ A;  3F45 A;  4DCK A;  4WQ2 A;  4YBH B;  2F2P A;  5J3X A;  3AKA A;  3DVM A;  1B8L A;  1DVI A;  2Q4U A;  4MZK A;  1Y1U A;  3TUY B;  3DF0 A;  3EVU A;  5CSJ A;  1F71 A;  2KOT A;  2WCF A;  3WXA A;  1KK7 Z;  1AUI B;  2TN4 A;  1HT9 A;  1EG3 A;  2JNX A;  3CR5 X;  1A75 B;  1KFX L;  1RTP 1;  1NCY A;  4MZJ A;  3NSK A;  1KCY A;  1NCZ A;  1S6J A;  3E3R A;  4ZCU A;  2PRU A;  1AP4 A;  3PAT A;  4JQ0 D;  4WRI A;  1FPW A;  2JRF A;  3DVK A;  3NSO A;  2PAS A;  2JT8 A;  1JUO A;  1A03 A;  4AQJ A;  2K7O A;  5CPV A;  2I7A A;  4MN0 A;  3PLF B;  1SR6 C;  3VRQ A;  3AKB A;  2LVK A;  3RLZ A;  1QX5 B;  5KTY A;  1OOJ A;  1NX3 A;  2KBI A;  3A4U B;  2KYC A;  1TRF A;  3I5H C;  1B8R A;  2MHH A;  3HX4 A;  1BR4 B;  1W7J B;  2JC2 A;  1XA5 A;  3JVT B;  1JF0 A;  1AHR A;  1K94 A;  5HLO A;  1QAT A;  1F4Q A;  4OKH A;  3I5G C;  2BKH B;  1G4Y R;  4MRX A;  2LE9 B;  2KQ6 A;  1A4P A;  1JWD A;  4GGF A;  1QJT A;  5HKY A;  1CDL A;  1YVL A;  1QLK A;  1CM4 A;  1Y0V H;  2AUC A;  3KO0 A;  1SKT A;  3PM8 A;  2FCE A;  2LMT A;  2M49 B;  1KWO C;  3FIA A;  1SMG A;  3DF0 B;  2K7B A;  3SG5 A;  1F54 A;  1S36 A;  2M0R A;  1IQ3 A;  1CMF A;  1L2O C;  1TIZ A;  1M46 A;  1PVA A;  1SY9 A;  4MEW A;  1DTL A;  2LNK A;  2BL0 C;  3BQ3 A;  1XK4 A;  1S6C A;  1NWD A;  2M97 A;  1EH2 A;  2K7C A;  2LV7 A;  1NSH A;  2M29 A;  2KGR A;  1NIW A;  1C07 A;  2CNP A;  2F2O A;  4PE1 A;  1YUU A;  2CBL A;  2K2A A;  3EK7 A;  2WOR A;  1NX2 A;  1LXF C;  2M7L A;  4OV2 A;  3RM1 A;  1MHO A;  4BY5 A;  1F55 A;  1C7V A;  3A8R A;  2NXQ A;  5G08 A;  1IG5 A;  1XK4 C;  1RJV A;  1KK8 C;  1YVH A;  3GK4 X;  2E6W A;  3LK1 A;  2LHL A;  3LL8 B;  2MA2 A;  4ORA B;  4JPZ B;  2LMU A;  1E8A A;  2JPT A;  2H61 C;  1J7P A;  4AOM A;  1KWO B;  2WC8 A;  4GAO A;  2JXC A;  4D1E A;  1N2D A;  3M0W A;  2LVJ A;  2RGI A;  4N1F A;  3ZNI A;  2KHN A;  1OMD A;  1AJ4 A;  2F33 A;  3SG2 A;  1OZS A;  1SW8 A;  1SCM C;  3BUX B;  5DKN A;  2AAO A;  1K90 D;  1IKU A;  2KBM A;  2NCO A;  4MBE A;  2FJU B;  1IQ5 A;  2FOT A;  2L2E A;  3EKJ A;  1ZMZ A;  5CSI A;  1REC A;  2M9G A;  3CGA A;  3GOF A;  4GUK A;  1L7Z A;  4PAL A;  2MLE C;  2LAP A;  2LVI A;  2KI6 C;  2M7N A;  4CID A;  2L5X B;  1TNQ A;  1YX7 A;  2O5G A;  3PFV A;  2KAX A;  1JSA A;  1M63 B;  2K2F A;  2LAN A;  1GQM A;  3AAJ A;  3NSL A;  1PUL A;  1KQM B;  2JOJ A;  2MRD A;  2OPO A;  1HQV A;  2OTG B;  5AXI A;  1B9A A;  2O60 A;  3BYA A;  3VRR A;  5CSN A;  5KSZ A;  1ALV A;  1BMO A;  2SAS A;  3LK0 A;  3I5F C;  3OX6 A;  3CWG A;  1V1F A;  1BT6 A;  1QLS A;  4YRU A;  1XFU O;  4BY4 A;  1KFX S;  2CXJ A;  2CT9 A;  1N65 A;  1MXE A;  1QIW A;  4C0L A;  1K95 A;  4OVN F;  3SIB A;  1WLZ A;  3PN7 C;  3CTN A;  2KFF A;  3O6B A;  3O78 A;  3JTD C;  3D10 A;  3IQQ A;  5IBW A;  1A2X A;  3WHT B;  1FI6 A;  3CLN A;  4QJ3 B;  2F8P A;  4GGN A;  2CCM A;  1XFX O;  1WRZ A;  2K8M B;  2KFH A;  1TNP A;  1AVS A;  1NP8 A;  1K93 D;  2Y1N A;  4R1E A;  1TCF A;  1A29 A;  4PDZ A;  2HET A;  1S26 D;  4PCW A;  1F70 A;  1RWY A;  1ZFS A;  1KQM C;  4JWQ A;  2BE4 A;  4CLN A;  1WDC B;  5PAL A;  1OE9 B;  1WRK A;  1NCX A;  2HQ8 A;  3PN7 B;  2LVV A;  4CFQ A;  3I5I C;  1UHI A;  3MSE B;  2ZN9 A;  4YGE B;  2MLF C;  2PVB A;  1MR8 A;  2LLU A;  4YI8 A;  4MVF A;  1B8C A;  1UHK A;  3C1V A;  2JU0 A;  2M3W A;  1UWO A;  4N1G A;  1MUX A;  4YGD B;  2I2R E;  1SL9 A;  4YGC B;  2I18 A;  1QV1 A;  1DF0 B;  2VRG A;  1QXP A;  1DGU A;  1ODB A;  2JNF A;  1QVI Z;  2JTT A;  1CDP A;  1XFZ O;  3AAK A;  1SYM A;  1F8H A;  4AQI A;  2K0J A;  2R2I A;  1U5I A;  4FQO A;  5GQQ C;  2JUL A;  2L0P A;  2JT0 A;  3CR2 A;  1YUT A;  1GGZ A;  4C0J A;  1PVB A;  1SL7 A;  3LLE A;  2BCB A;  2COL B;  2LUC A;  1KFU S;  1RK9 A;  1SNL A;  3NXA A;  5JJG A;  5K89 A;  3SG6 A;  1ZUZ A;  2IS9 A;  4ORB B;  1KK7 Y;  1SPY A;  3I5I B;  1YR5 A;  3K21 A;  2G9B A;  4WQ3 A;  4DS7 A;  1SR6 B;  3KEV A;  1FI5 A;  4PE4 A;  4ZCV A;  2V53 A;  1DJG A;  1K9K A;  1OSA A;  3I5H B;  1UUR A;  2KNE A;  1UUS A;  2Y5I A;  4PE0 A;  1NX1 A;  2H61 A;  4HSZ A;  3SG3 A;  5CSF A;  4I5N B;  4FTG A;  3I5G B;  2EHB A;  1K96 A;  2BE6 A;  5DKR A;  4MRY A;  1OQP A;  1QIV A;  1Y6W A;  3DVJ A;  1MQ1 A;  3GK2 A;  1RRO A;  1S5G Z;  1KFU L;  1PSB A;  3KHE A;  3VGO A;  1WRL A;  1YTZ C;  2LHI A;  4ICB A;  1M45 A;  1JC2 A;  1J1E A;  1NYA A;  4QJ4 B;  1LVC D;  3TDI A;  2EGD A;  4C0K A;  5JOL A;  1IH0 A;  3FWB A;  1G8I A;  2HPS A;  5ER5 A;  1L2O B;  2LLT A;  3FWC A;  1LKJ A;  5I8N A;  1MXL C;  3QRX A;  1SCV A;  5F6T A;  2BL0 B;  1EXR A;  1B7T Z;  1SRA A;  1H8B A;  2JQ6 A;  4TNC A;  4CFR A;  4CPV A;  1J7O A;  4Q04 A;  1C7W A;  2G2B A;  2M1K B;  1DGV A;  1TTX A;  4PE7 A;  1SBJ A;  1BJF A;  1FBV A;  1JF2 A;  3CZT X;  2LP3 A;  1SK6 D;  2NCP A;  4P2Y B;  1KK8 B;  1UHN A;  3OB2 B;  1CDN A;  2BCX A;  1CKK A;  3HCM A;  3O4Y A;  1CLB A;  2AMI A;  2BEC A;  3TDZ A;  2WND A;  2L98 A;  1MWN A;  2LM5 A;  1TN4 A;  1XO5 A;  2KI6 D;  2SCP A;  2F3Y A;  5HYD A;  3BUM B;  1SCM B;  3BXK A;  5D7F A;  3SG7 A;  1RFJ A;  1DJW A;  1XFV O;  3KF9 A;  3DD4 A;  2JXL A;  3EK8 A;  2WOS A;  1M39 A;  1DMO A;  2PSR A;  3TS5 C;  2F3Z A;  3TUY C;  1GGW A;  2ZKM X;  1LA0 A;  1QX7 A;  1PRW A;  1ALW A;  4P5O E;  1AJ5 A;  5TNC A;  4NQG A;  1TOP A;  2KAY A;  3O2P A;  5I2O A;  1OMV A;  2MBX A;  4MLW A;  1UP5 A;  2HF5 A;  3SJS A;  3LCP C;  1F4O A;  4I5K A;  3OX5 A;  1DJH A;  2KQY A;  4DIR A;  1NPQ A;  1VRK A;  2KI4 C;  2MJW B;  1H4B A;  1IJ5 A;  3ZWH A;  1LA3 A;  1BR1 B;  1YUR A;  2BCA A;  1S1E A;  1BG1 A;  1Y1X A;  4M2Q A;  3I5F B;  1XYD A;  1CTR A;  5HLV A;  5ER4 X;  1S3P A;  2NZ0 A;  2KDH A;  5HKZ A;  5I2L A;  4UPG A;  1W7I B;  4I5L B;  2B1U A;  4A4B A;  2GGM A;  2ZRS A;  1D1O A;  1J7R A;  1CDM A;  1J1D A;  1QAS A;  3IF7 A;  3JVT C;  3TS5 B;  3TZ1 A;  3JTD B;  1PAL A;  3EK4 A;  1XFY O;  1DJX A;  3OP0 A;  4PHJ A;  1KSM A;  3OB1 B;  3SIA A;  3NSI A;  2M8U A;  1AK8 A;  1OMR A;  1EG4 A;  1NX0 A;  4MSP A;  2Y1M A;  4N5X A;  2ISD A;  1JBA A;  2KI4 B;  1YUS A;  1DJI A;  4NDC A;  1BLQ A;  2JT3 A;  1YRT B;  2Y4Q A;  2GGZ A;  2LUX A;  1BU3 A;  1K9P A;  1CFD A;  1R6P A;  4OCI A;  2GV5 A;  3CS1 A;  4OR9 B;  2CTN A;  2PMY A;  1B1G A;  1K2H A;  1CFP A;  1B47 A;  3TDU A;  2LP2 A;  3PAL A;  1PSR A;  1EL4 A;  4YI9 A;  1FW4 A;  2WCB A;  2KYF A;  1YX8 A;  4U8D A;  2NLN A;  2WCE A;  3VRN A;  2I94 A;  2LC5 A;  1K9U A;  3FS7 A;  1SL8 A;  2KFG A;  2ZND A;  3BOW A;  4HRG A;  2ZN8 A;  5B8I B;  5KU1 A;  1QX2 A;  4GBA A;  4I5J A;  1PK0 D;  4E68 A;  4HRH A;  3EKH A;  1IRJ A;  1EJ3 A;  1DJY A;  1N0Y A;  1QS7 A;  2H2K A;  3CR4 X;  1OZO A;  3EVV A;  1WLM A;  2HQW A;  1KSO A;  1KQV A;  3D0Y A;  3KPX A;  2LLS A;  3BUO B;  2L50 A;  2Q91 A;  4GGF C;  2QPT A;  1DT7 B;  1BOD A;  5BPJ A;  1J7Q A;  3EVR A;  4IL1 A;  1QTX A;  1QVI Y;  2L4H A;  4NDB A;  2BBN A;  1GJY A;  1IGV A;  3H4S E;  3VRP A;  2MAZ A;  1CFF A;  1BOC A;  1U5I B;  2M1U A;  1XVJ A;  4PHM A;  3BUN B;  4M2P A;  4USL A;  5D69 A;  1JFK A;  4QJ5 B;  2OS8 C;  2E30 A;  4XJK A;  2JTZ A;  3ICB A;  3GK1 A;  2K7D A;  2EC6 C;  2D8N A;  4YGB B;  1ZAC A;  3OHM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...