1F4OA

Crystal structure of grancalcin with bound calcium
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
165
structure length
165
Chain Sequence
SVYTYFSAVAGQDGEVDAEELQRCLTQSGINGTYSPFSLETCRIMIAMLDRDHTGKMGFNAFKELWAALNAWKENFMTVDQDGSGTVEHHELRQAIGLMGYRLSPQTLTTIVKRYSKNGRIFFDDYVACCVKLRALTDFFKKRDHLQQGSADFIYDDFLQGTMAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human grancalcin, a member of the penta-EF-hand protein family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
molecule keywords GRANCALCIN
total genus 59
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1f4oA00
3BUWB 1JF0A 1JFJA 1AVSA 2MRDA 1PSRA 3SIBA 1JC2A 1AK8A 2KBMA 1F71A 2F2OA 5F6TA 2NZ0A 1WDCC 2AAOA 2LUCA 3PSRA 2JPTA 2JU0A 2KI4C 1NCXA 1B8RA 1UHJA 3PN7B 4ICBA 2LVJA 1SCMC 1J1EA 4QJ4B 3TUYB 1N2DA 1ZFSA 1TN4A 1N65A 1K9UA 2MLEC 5DKRA 1IGVA 3LL8B 4YGAA 1J1DA 4AQJA 1LKJA 4WRIA 1DJZA 1QIVA 1QJTA 3AAJA 1DJYA 1F70A 4M2OA 1LVCD 2HETA 1RECA 4GBAA 1RWYA 1TRFA 4N1GA 3CZTX 3BUXB 2BKHB 1W7IB 1NCYA 1SMGA 1NIWA 3VRQA 1XYDA 2ZKMX 1RJVA 4GAOA 1CDLA 2ZN8A 1UURA 1XFVO 2WCEA 1Y1XA 1K94A 4P2YB 5GQQC 1CLMA 1GJYA 1SCMB 1KK7Z 2LP2A 5CPVA 2KQ6A 2KI4B 2M97A 4C0LA 1CLBA 4CFRA 1WDCB 3SG5A 1EG4A 3SIAA 1NWDA 1C07A 1KWOC 1M46A 1L7ZA 2CCMA 4UPGA 1J7RA 3DVMA 1BR4B 4JPZB 1ZACA 2O60A 4DIRA 1UHNA 3KF9A 1A4PA 2NLNA 2ISDA 3TS5C 2GGZA 3GK1A 1SNLA 3GK4X 3PFVA 1QS7A 3PLFB 3EK7A 2M0RA 2K7DA 1KWOB 1TIZA 1GGWA 1TTXA 4MZKA 4CFQA 2L4IA 4TNCA 4C0KA 1DF0B 2Y5IA 1S36A 3LK0A 2KGBC 3NSIA 1IRJA 1KK8C 3BXKA 2EHBA 3JVTB 2E6WA 1QV1A 4MRYA 4HRHA 2G9BA 1CFPA 1FPWA 2BCXA 3NSLA 1IH0A 1PULA 1F4OA 2PMYA 4ZCVA 2M49B 5B8IB 4MEWA 1FBVA 1C7WA 5I2QA 1K96A 1RK9A 1YVLA 4CPVA 1B47A 1MHOA 4E68A 5I2LA 1KSMA 3AAKA 5FYXA 1SYMA 3WHUB 2L51A 1HQVA 4PDZA 1A2XA 1NX2A 2F3YA 5D69A 5AXIA 1BOCA 1F55A 4GNKB 1PVAA 3WNXB 2D8NA 2OTGB 4F0ZB 1R6PA 1SL9A 2K8MB 3KPXA 2A4JA 4DS7A 2L98A 1N0YA 1LA0A 4XJKA 2MJWB 3SG3A 4N1FA 5HKWA 1CMGA 1PALA 1B9AA 1QX7A 3I5IB 2PSRA 1XO5A 4FTGA 4DCKA 2GGMA 1QASA 2PRUA 4DUQA 1NX1A 1W7JB 2BL0C 1UWOA 1DJIA 1OQPA 1NP8A 1MXLC 1YX8A 2JC2A 4GGFA 1MF8B 1S5GY 3TDUA 5HYDA 2KI6D 1AJ5A 4OVNF 4PE0A 4OV2A 1BG1A 2LMVA 2VRGA 2B1UA 4L9MA 5CSNA 2MBXA 3FWCA 1K9PA 3IQOA 3VROA 2M1UA 1CFCA 2JNFA 1V1GA 5HLVA 1IJ5A 4ETOA 4AQIA 3DD4A 1SW8A 2Q4UA 1RFJA 2ZFDA 1YX7A 2H61C 1OZOA 2K2FA 3NSKA 1BMOA 4MBEA 1DJXA 1QX5B 4IL1A 4GGNA 4CLNA 1KQMC 3I5FC 4D1EA 1JUOA 2JXLA 2L5XB 3SJSA 1DT7B 2LMUA 1MQ1A 5DKNA 2F33A 1SL8A 1SK6D 1UHKA 1MUXA 4I5NB 2PALA 2ZNEA 3EK4A 4PHJA 2M29A 2EGDA 4OKHA 1CKKA 4MLWA 3E3RA 2KQYA 5HKYA 3GK2A 4N5XA 1VRKA 2RGIA 2MA2A 3EVUA 1BU3A 2M7LA 3KHEA 3D0YB 1DMOA 3EK8A 1D1OA 4PE4A 2LUXA 3AKAA 1A75A 5D7FA 2KBIA 2NCPA 2WOSA 3I5IC 2ZRTA 2CXJA 4MSPA 2KDHA 3TZ1A 1IJ6A 1DVIA 1YVHA 2JRFA 1SL7A 1GGZA 1LA3A 1XFYO 2EC6C 4OR9B 1KQVA 2QPTA 1BJFA 2NXQA 3SG7A 5G08A 2WNDA 5IBWA 2JT8A 3OHMB 1CDNA 1K93D 3CR2A 2L0PA 3BUNB 3O78A 1KCYA 1A03A 3SG4A 3MSEB 1B8LA 2V53A 1J55A 1BT6A 3ICBA 1QXPA 1G8IA 2K7BA 4HREE 2OPOA 4AOMA 1NPQA 3KO0A 1QVIY 4P5OE 3DF0B 1XK4C 4YGBB 2KFFA 2LAPA 1AJ4A 3EVVA 3O6BA 1CFFA 3DF0A 2GV5A 4R1EA 4BY4A 1RTP1 1UUSA 3TDIA 1BR1B 3PATA 3O4YA 5DKQA 1HT9A 1KFXS 3OP0A 2ZRSA 3I5GB 4MZJA 2AMIA 2LVIA 1S26D 1K9KA 3CGAA 4FQOA 4CIDA 3CLNA 3C1VA 1SRAA 1JSAA 5AANA 2M9GA 1XA5A 2K61A 2FOTA 3D10A 3OX6A 4YRUA 1NCZA 2BL0B 1QIWA 1SR6B 3CR5X 2K2AA 1SCVA 1YUSA 1IQ5A 4BY5A 1YUTA 2LP3A 1WRKA 2M7NA 1EJ3A 4HRGA 1IQ3A 4C0JA 2AUCA 3WXAA 1F8HA 2OTGC 4M2PA 5CSIA 1SY9A 2OS8B 1JWDA 2K0JA 3K21A 5J3XA 2FJUB 1B7TY 4M2QA 4QJ5B 1TNXA 1B4CA 3EKHA 1M45A 1MR8A 2KGRA 3HCMA 1ODBA 4PE1A 3OX5A 1XVJA 1JFKA 2LMTA 2F3ZA 1QVIZ 1UP5A 1C7VA 3BUMB 4Q04A 2JULA 4GGFC 1ZOTB 1M31A 1F54A 4I5KA 4PALA 1OMVA 3OB1B 1NUBA 3O2PA 3VGOA 1AHRA 3QRXA 2JNXA 5AERA 1CFDA 2G2BA 2WORA 2PASA 3BYAA 2I18A 1GQMA 1CM1A 2F8PA 1DJHA 1S1EA 2LLSA 3VRRA 3TUYC 1Y1UA 2BCAA 3FS7A 2LCPA 3CTNA 2TN4A 1EG3A 5I8NA 1WLMA 1DTLA 2JXCA 1YRUB 2NCOA 5CSJA 3VRNA 1OSAA 1U5IA 2LE9B 4GFTA 2Y4QA 1TNWA 2KYCA 2JQ6A 3TS5B 3DVJA 1BODA 1KFXL 3KEVA 4MRXA 4NDCA 1TCOB 1EXRA 1XFUO 3ZWHA 2BBMA 1SR6C 3RM1A 4WQ3A 1PRWA 2Q91A 1XFZO 2LLUA 2WCBA 3D0YA 3NXAA 2KNEA 1YURA 1A29A 2M8UA 1E8AA 3BQ3A 1XFWO 1B8CA 1S6JA 1PSBA 5HKZA 4NDBA 1K2HA 2K7OA 1NSHA 1OMRA 1MXEA 1J7PA 3IF7A 2M3WA 3TDZA 1SPYA 1FW4A 2BECA 1IG5A 1K8UA 2HF5A 1TCFA 1ZUZA 2O5GA 3A8RA 1JF2A 3ZNIA 1J7QA 3F45A 1DGUA 2K7CA 5JOLA 3VRPA 3EKJA 5JJGA 1PK0D 2KSPA 2Y1MA 4I5LB 2SASA 4QJ3B 1LXFC 3OB2B 2MHHA 1L2OC 2ZNDA 5ER5A 5KU1A 1KFUL 3NSOA 2FCEA 1Y0VH 2CBLA 2OS8C 3PN7C 1BLQA 2R2IA 1TNQA 1YRTB 2LANA 2LLTA 2F2PA 1RROA 4XJKB 1XFXO 1KFUS 3DVEA 3M0WA 4NDDA 4PE7A 1ALWA 4OCIA 1CDMA 2Y1NA 3JTDB 4DRWA 1CM4A 1CNPA 2PVBA 1CDPA 4MVFA 1WRLA 2LV7A 2I7AA 2BCBA 1TNPA 1JBAA 1YUUA 1OMDA 3LLEA 4PCWA 2LNKA 1DJGA 2LHIA 4YGDB 5AFPA 1EL4A 2JZIA 2KAVA 3A4UB 3AKBA 2JT0A 3EVRA 4NQGA 3SG6A 4YI8A 2M1KB 2LVVA 1ALVA 1M39A 3CS1A 1OZSA 5ER4X 4YGEB 1EH2A 3I5GC 1FI5A 3H4SE 2CT9A 2ZN9A 1U5IB 1QX2A 3GOFA 2KOTA 5PALA 4YBHB 1PVBA 1WLZA 2WCFA 3CR4X 3BOWA 1FF1A 2CNPA 2JT3A 1CTRA 2H61A 2MAZA 4MZLA 1S6CA 4WQ2A 1QV0A 5TNCA 2L2EA 3CWGA 4XYNA 2KYFA 4PHKA 2H2KA 4PHMA 4JWQA 3LK1A 2L50A 1UHIA 3RLZA 1F4QA 4A4BA 5BPJA 1SKTA 1CLLA 4JQ0D 5CSFA 4A4CA 2BKIB 3DVKA 1ZMZA 1G33A 2SCPA 1B7TZ 2EC6B 2KAXA 2KI6C 3PALA 1TOPA 4GUKA 2JOJA 3I5HB 1NX3A 1S3PA 4GPLB 1MWNA 1H8BA 3WHTB 2HQWA 2BE6A 1M63B 2COLB 3FIAA 1OE9B 2JWWA 3JTDC 1QTXA 1DGVA 3PM8A 3I5HC 2DOQA 4ORCB 4YI9A 3BUOB 2KFGA 2LVKA 1KSOA 1LINA 1R2UA 2HPSA 2I2RE 1S5GZ 4ORAB 3BOWB 1B1GA 1IKUA 1QLSA 1YR5A 2FCDA 2L4HA 4ZCUA 2BE4A 1BF5A 1Q80A 4USLA 1L2OB 2P6BB 2KHNA 1OOJA 1KK7Y 1XK4A 1SBJA 2BBNA 2I94A 1DJWA 1AP4A 5K89A 1KQMB 3I5FB 1H4BA 3HX4A 1X02A 1WY9A 1NYAA 5I2OA 4PHNA 4ORBB 2CTNA 1G4YR 1Y6WA 2KAYA 1AUIB 2QACA 5AEQA 3FWBA 2E30A 1V1FA 1CB1A 3JVTC 4MN0A 1S6IA 2MLFC 3IQQA 1DF0A 1K95A 2IS9A 5KSZA 1KK8B 1Y1AA 1IWQA 3LCPC 1FI6A 1WRZA 4I5JA 1QATA 1NX0A 3SG2A 2HQ8A 1J7OA 1YTZC 2WC8A 2JTTA 4U8DA 2LC5A 1A75B 1QLKA 1UHHA 2LM5A 2KFHA 4YGCB 5HLOA 2JTZA 1CMFA 4HSZA 5KTYA 2LHLA 1K90D
chains in the Genus database with same CATH superfamily
3BUWB 1JF0A 1JFJA 1AVSA 2MRDA 1PSRA 3SIBA 1JC2A 1AK8A 2KBMA 1F71A 2F2OA 5F6TA 2NZ0A 1WDCC 2AAOA 2LUCA 3PSRA 2ERBA 2JPTA 2JU0A 2KI4C 1NCXA 1B8RA 1UHJA 3PN7B 4ICBA 2LVJA 1SCMC 1J1EA 4QJ4B 3TUYB 1N2DA 1ZFSA 1TN4A 1N65A 1K9UA 2MLEC 5DKRA 1IGVA 3LL8B 4YGAA 1J1DA 3R1OA 1LKJA 4AQJA 3PM2A 4WRIA 1DJZA 1QIVA 1QJTA 3AAJA 4INWA 1DJYA 1F70A 4M2OA 1LVCD 2HETA 1RECA 4GBAA 1RWYA 1TRFA 4N1GA 3CZTX 3BUXB 2BKHB 1W7IB 1NCYA 1SMGA 1NIWA 3VRQA 1XYDA 2ZKMX 1RJVA 3IVTA 1CDLA 4GAOA 2ZN8A 2KPHA 1UURA 1W9ZA 1XFVO 2WCEA 1Y1XA 1K94A 4P2YB 5GQQC 3FE6A 1CLMA 1GJYA 1SCMB 1KK7Z 2LP2A 5CPVA 2KQ6A 2KI4B 2M97A 3DY9A 4C0LA 1CLBA 4CFRA 1WDCB 3S0BA 3NHIA 3SG5A 1EG4A 3SIAA 1NWDA 2KLEA 1C07A 1KWOC 1M46A 1L7ZA 2WCMA 4FQTA 3BFAA 2CCMA 4UPGA 1J7RA 3DVMA 1BR4B 4JPZB 1ZACA 2O60A 4DIRA 1UHNA 3KF9A 1A4PA 2NLNA 2ISDA 3TS5C 2GGZA 3GK1A 1SNLA 3GK4X 3PFVA 1QS7A 3PLFB 3EK7A 2M0RA 2K7DA 1KWOB 1TIZA 1GGWA 1TTXA 4MZKA 4CFQA 2L4IA 4TNCA 4C0KA 1DF0B 2Y5IA 1S36A 3LK0A 2KGBC 3NSIA 1IRJA 1KK8C 3BXKA 2EHBA 3JVTB 2E6WA 1QV1A 3SS4A 2WCKA 1TUJA 4MRYA 3CZ1A 4HRHA 2G9BA 1CFPA 1FPWA 2BCXA 3NSLA 1IH0A 1PULA 1F4OA 2PMYA 4ZCVA 2M49B 5B8IB 4MEWA 1FBVA 1C7WA 5I2QA 1K96A 1RK9A 1YVLA 2QDIA 1B47A 1MHOA 5EL2A 4CPVA 4E68A 5I2LA 1KSMA 3AAKA 5FYXA 1SYMA 3UO9A 2L51A 3WHUB 1HQVA 3CYZA 4PDZA 1A2XA 1NX2A 2F3YA 5D69A 5AXIA 1BOCA 1F55A 4GNKB 1PVAA 3WNXB 2D8NA 2OTGB 4F0ZB 1R6PA 1SL9A 2K8MB 3KPXA 2A4JA 4DS7A 2L98A 1N0YA 1LA0A 4XJKA 2MJWB 3SG3A 4N1FA 5HKWA 1CMGA 3SS5A 1PALA 3NHTA 1B9AA 1QX7A 3I5IB 2PSRA 1XO5A 4FTGA 4DCKA 2GTEA 2GGMA 1QASA 2PRUA 4DUQA 1NX1A 1W7JB 2BL0C 1UWOA 1DJIA 1OQPA 1NP8A 1MXLC 1YX8A 3PJIA 2JC2A 4GGFA 1MF8B 1S5GY 3TDUA 5HYDA 2KI6D 1AJ5A 4OVNF 4PE0A 4OV2A 1C3ZA 1BG1A 2LMVA 2VRGA 2B1UA 4L9MA 5CSNA 2MBXA 3FWCA 1K9PA 3IQOA 3VROA 1OW4A 2WC5A 2M1UA 1CFCA 2JNFA 1V1GA 5HLVA 1IJ5A 4ETOA 4AQIA 3DD4A 1SW8A 2Q4UA 1RFJA 2ZFDA 3R1VA 1YX7A 1DQEA 2H61C 1OZOA 2K2FA 3NSKA 1BMOA 4MBEA 3DZTA 1DJXA 1QX5B 4IL1A 4GGNA 4CLNA 1KQMC 3I5FC 4D1EA 1JUOA 2JXLA 2L5XB 3SJSA 1DT7B 2LMUA 3CZ0A 1MQ1A 5DKNA 2F33A 1DEKA 1SL8A 1SK6D 1UHKA 3L47A 1MUXA 4I5NB 2PALA 2ZNEA 3EK4A 4PHJA 2M29A 2EGDA 3L4LA 4OKHA 1CKKA 3NGVA 4MLWA 3E3RA 2KQYA 5HKYA 3GK2A 4N5XA 1VRKA 2RGIA 2MA2A 3R72A 3EVUA 1BU3A 2M7LA 3KHEA 3D0YB 1DMOA 3EK8A 1D1OA 4PE4A 2LUXA 3B87A 3FE8A 1GM0A 3AKAA 1A75A 5D7FA 2KBIA 2NCPA 3BJHA 1Z4HA 2WOSA 3I5IC 2ZRTA 3S0DA 2CXJA 4MSPA 2KDHA 3TZ1A 1IJ6A 1DVIA 1YVHA 5FI7A 2JRFA 1SL7A 1GGZA 1LA3A 1XFYO 2EC6C 4OR9B 1KQVA 2QPTA 1BJFA 2NXQA 3SG7A 5G08A 2WNDA 5IBWA 2JT8A 3OHMB 1DC1A 1CDNA 1K93D 2WC6A 2L0PA 3BUNB 3CR2A 3O78A 3Q8IA 1KCYA 1A03A 3SG4A 3MSEB 1B8LA 2V53A 1J55A 1BT6A 3V2LA 3ICBA 1QXPA 1G8IA 2K7BA 4HREE 2OPOA 4AOMA 1NPQA 3KO0A 3BFBA 1QVIY 4P5OE 3DF0B 1XK4C 2QEOA 4YGBB 2KFFA 2LAPA 1AJ4A 3EVVA 3O6BA 1CFFA 2BAPA 3DF0A 2GV5A 4R1EA 4BY4A 1RTP1 1UUSA 3TDIA 5FI2A 1BR1B 3PATA 3O4YA 5DKQA 1HT9A 1KFXS 3OP0A 2ZRSA 3I5GB 4MZJA 4INXA 2AMIA 2LVIA 1S26D 1K9KA 3CGAA 4FQOA 4CIDA 3CLNA 2K60A 3C1VA 1SRAA 1JSAA 5AANA 2M9GA 5D3OA 1OOFA 1XA5A 2K61A 2FOTA 3D10A 3OX6A 4YRUA 1NCZA 2BL0B 1QIWA 1SR6B 3CR5X 2K2AA 1SCVA 1YUSA 1DELA 1IQ5A 4BY5A 3B7AA 1YUTA 2LP3A 1WRKA 2M7NA 1EJ3A 4HRGA 1IQ3A 3S0FA 4C0JA 5HL1A 2AUCA 3WXAA 1F8HA 2OTGC 4M2PA 5CSIA 3D74A 4IJ7A 1SY9A 2OS8B 1JWDA 2K0JA 3K21A 5J3XA 2FJUB 1B7TY 4M2QA 4QJ5B 1TNXA 1B4CA 3EKHA 1M45A 3DXLA 1MR8A 2KGRA 3HCMA 1ODBA 4PE1A 3RZSA 2QEHA 1XVJA 1JFKA 2LMTA 1QVIZ 2F3ZA 1UP5A 3OX5A 1C7VA 3BUMB 2P71A 1OOGA 3D75A 4Q04A 2JULA 5I94A 4GGFC 1ZOTB 1M31A 1F54A 4I5KA 4PALA 1OMVA 3OB1B 1NUBA 3O2PA 2KLDA 3VGOA 1AHRA 3QRXA 1T14A 2JNXA 5AERA 1CFDA 2G2BA 2WORA 3N7HA 2PASA 3BYAA 2I18A 1GQMA 3SS3A 1CM1A 2F8PA 2YGUA 1DJHA 1S1EA 2LLSA 2WCHA 3VRRA 1Y1UA 2BCAA 3FS7A 2LCPA 3CTNA 3TUYC 2TN4A 1EG3A 5I8NA 1WLMA 2WCJA 1DTLA 2JXCA 1YRUB 2NCOA 5CSJA 3VRNA 1OSAA 1U5IA 2LE9B 3S0GA 4GFTA 1Z2CB 2Y4QA 1TNWA 2KYCA 2JQ6A 3TS5B 3DVJA 1BODA 1KFXL 3KEVA 4MRXA 4NDCA 1TCOB 1EXRA 1XFUO 3ZWHA 2BBMA 1SR6C 3RM1A 3QMEA 4WQ3A 1PRWA 2Q91A 1XFZO 2LLUA 2WCBA 3D0YA 3NXAA 2KNEA 3EG5B 1YURA 1A29A 2M8UA 1E8AA 3BQ3A 1XFWO 1B8CA 1S6JA 1PSBA 5HKZA 2JPOA 4NDBA 5DICA 2K7OA 1K2HA 1NSHA 1OMRA 1MXEA 1J7PA 3IF7A 2M3WA 3FE9A 3TDZA 1SPYA 1FW4A 2BECA 1IG5A 2L2CA 1K8UA 2HF5A 1TCFA 1ZUZA 2O5GA 3A8RA 1JF2A 3ZNIA 1J7QA 3F45A 1DGUA 4OZDA 2K7CA 5FI6A 1IIOA 1QWVA 5JOLA 3VRPA 3EKJA 5JJGA 1PK0D 2KSPA 2Y1MA 4I5LB 2SASA 4QJ3B 1LXFC 3OB2B 1LS8A 1L2OC 2MHHA 2ZNDA 5ER5A 5KU1A 1KFUL 3D77A 3NSOA 2FCEA 1Y0VH 2CBLA 2OS8C 3PN7C 1BLQA 2R2IA 1TNQA 1YRTB 2LANA 2LLTA 2F2PA 1RROA 4XJKB 3CDNA 1XFXO 2QEVA 3VB1A 1KFUS 3DVEA 1OOIX 3M0WA 4NDDA 1ALWA 4KYNA 4OCIA 1CDMA 4PE7A 2Y1NA 3JTDB 4DRWA 1CM4A 1CNPA 2PVBA 1CDPA 4MVFA 4JD9A 1WRLA 2L5YA 2I7AA 2LV7A 2BCBA 1TNPA 1JBAA 1YUUA 1OMDA 2WCLA 3LLEA 4PCWA 2LNKA 1DJGA 2LHIA 4YGDB 5AFPA 1EL4A 2JZIA 2FJYA 2KAVA 3A4UB 3AKBA 2JT0A 3EVRA 2PYQA 4NQGA 3SG6A 3UNWA 4YI8A 2M1KB 2LVVA 1ALVA 1M39A 3CS1A 1OZSA 5ER4X 4YGEB 1EH2A 3I5GC 1FI5A 3B86A 1SSEB 3H4SE 2CT9A 2ZN9A 1U5IB 1QX2A 3GOFA 2KOTA 5PALA 4YBHB 1PVBA 1WLZA 2WCFA 3CR4X 1OOHA 3BOWA 1FF1A 2CNPA 2JT3A 2QEBA 1CTRA 2H61A 2MAZA 4MZLA 1S6CA 4WQ2A 1QV0A 5TNCA 2L2EA 3CWGA 4XYNA 2KYFA 4PHKA 2H2KA 4PHMA 4JWQA 3LK1A 2L50A 1UHIA 1TUZA 3L4AA 1F4QA 3RLZA 4A4BA 5BPJA 1SKTA 1CLLA 4JQ0D 5CSFA 1TWOA 4A4CA 2BKIB 3DVKA 1ZMZA 4JKTA 1G33A 2SCPA 1B7TZ 2EC6B 2KAXA 2KI6C 3PALA 1TOPA 2BNXA 4GUKA 2JOJA 3I5HB 1NX3A 1S3PA 4GPLB 3S0EA 1MWNA 1H8BA 3R1PA 2HQWA 2BE6A 1M63B 2COLB 3FIAA 1OE9B 2JWWA 3WHTB 3JTDC 1QTXA 1DGVA 3PM8A 3I5HC 2DOQA 4ORCB 4YI9A 3BUOB 2KFGA 2LVKA 1KSOA 1LINA 1R2UA 2HPSA 2I2RE 1S5GZ 4ORAB 3BOWB 1B1GA 1IKUA 4PT1A 1QLSA 1YR5A 2FCDA 2L4HA 4ZCUA 2BE4A 3OGNA 1BF5A 1Q80A 4USLA 1L2OB 2P6BB 2KHNA 2PQLA 1OOJA 1KK7Y 1XK4A 3BFHA 1SBJA 2BBNA 2I94A 1DJWA 1AP4A 5K89A 1KQMB 3I5FB 3D76A 3CZ2A 3HX4A 1H4BA 1X02A 1WY9A 1NYAA 3D78A 5I2OA 3O4XA 2P70A 3K1EA 4PHNA 1C3YA 4ORBB 2CTNA 3CABA 3DYEA 1XFRA 3OBVA 1G4YR 1Y6WA 1P28A 1AUIB 2KAYA 2QACA 5AEQA 3FWBA 2E30A 1V1FA 1CB1A 3JVTC 4MN0A 1S6IA 2MLFC 3IQQA 1DF0A 3B6XA 1K95A 2IS9A 5KSZA 1KK8B 1Y1AA 4F7FA 1IWQA 3LCPC 1FI6A 1WRZA 4I5JA 1QATA 1NX0A 3SG2A 3B88A 2HQ8A 1J7OA 1YTZC 2WC8A 2JTTA 4U8DA 3D73A 2LC5A 1A75B 1QLKA 1UHHA 2H8VA 2LM5A 1ORGA 2KFHA 4YGCB 5HLOA 2JTZA 1CMFA 4HSZA 5KTYA 3S0AA 2LHLA 1K90D
chains in the Genus database with same CATH topology
3BUWB 1JF0A 1JFJA 1AVSA 2MRDA 1PSRA 3SIBA 1JC2A 1AK8A 2KBMA 1F71A 2F2OA 5F6TA 2NZ0A 1WDCC 2AAOA 2LUCA 3PSRA 2JPTA 2JU0A 2KI4C 1NCXA 1B8RA 1UHJA 3PN7B 4ICBA 2LVJA 1SCMC 1J1EA 4QJ4B 3TUYB 1N2DA 1ZFSA 1TN4A 1N65A 1K9UA 2MLEC 5DKRA 1IGVA 3LL8B 4YGAA 1J1DA 4AQJA 1LKJA 4WRIA 1DJZA 1QIVA 1QJTA 3AAJA 1DJYA 1F70A 4M2OA 1LVCD 2HETA 1RECA 4GBAA 1RWYA 1TRFA 4N1GA 3CZTX 3BUXB 2BKHB 1W7IB 1NCYA 1SMGA 1NIWA 3VRQA 1XYDA 2ZKMX 1RJVA 4GAOA 1CDLA 2ZN8A 1UURA 1XFVO 2WCEA 1Y1XA 1K94A 4P2YB 5GQQC 1CLMA 1GJYA 1SCMB 1KK7Z 2LP2A 5CPVA 2KQ6A 2KI4B 2M97A 4C0LA 1CLBA 4CFRA 1WDCB 3SG5A 1EG4A 3SIAA 1NWDA 1C07A 1KWOC 1M46A 1L7ZA 2CCMA 4UPGA 1J7RA 3DVMA 1BR4B 4JPZB 1ZACA 2O60A 4DIRA 1UHNA 3KF9A 1A4PA 2NLNA 2ISDA 3TS5C 2GGZA 3GK1A 1SNLA 3GK4X 3PFVA 1QS7A 3PLFB 3EK7A 2M0RA 2K7DA 1KWOB 1TIZA 1GGWA 1TTXA 4MZKA 4CFQA 2L4IA 4TNCA 4C0KA 1DF0B 2Y5IA 1S36A 3LK0A 2KGBC 3NSIA 1IRJA 1KK8C 3BXKA 2EHBA 3JVTB 2E6WA 1QV1A 4MRYA 4HRHA 2G9BA 1CFPA 1FPWA 2BCXA 3NSLA 1IH0A 1PULA 1F4OA 2PMYA 4ZCVA 2M49B 5B8IB 4MEWA 1FBVA 1C7WA 5I2QA 1K96A 1RK9A 1YVLA 4CPVA 1B47A 1MHOA 4E68A 5I2LA 1KSMA 3AAKA 5FYXA 1SYMA 3WHUB 2L51A 1HQVA 4PDZA 1A2XA 1NX2A 2F3YA 5D69A 5AXIA 1BOCA 1F55A 4GNKB 1PVAA 3WNXB 2D8NA 2OTGB 4F0ZB 1R6PA 1SL9A 2K8MB 3KPXA 2A4JA 4DS7A 2L98A 1N0YA 1LA0A 4XJKA 2MJWB 3SG3A 4N1FA 5HKWA 1CMGA 1PALA 1B9AA 1QX7A 3I5IB 2PSRA 1XO5A 4FTGA 4DCKA 2GGMA 1QASA 2PRUA 4DUQA 1NX1A 1W7JB 2BL0C 1UWOA 1DJIA 1OQPA 1NP8A 1MXLC 1YX8A 2JC2A 4GGFA 1MF8B 1S5GY 3TDUA 5HYDA 2KI6D 1AJ5A 4OVNF 4PE0A 4OV2A 1BG1A 2LMVA 2VRGA 2B1UA 4L9MA 5CSNA 2MBXA 3FWCA 1K9PA 3IQOA 3VROA 2M1UA 1CFCA 2JNFA 1V1GA 5HLVA 1IJ5A 4ETOA 4AQIA 3DD4A 1SW8A 2Q4UA 1RFJA 2ZFDA 1YX7A 2H61C 1OZOA 2K2FA 3NSKA 1BMOA 4MBEA 1DJXA 1QX5B 4IL1A 4GGNA 4CLNA 1KQMC 3I5FC 4D1EA 1JUOA 2JXLA 2L5XB 3SJSA 1DT7B 2LMUA 1MQ1A 5DKNA 2F33A 1SL8A 1SK6D 1UHKA 1MUXA 4I5NB 2PALA 2ZNEA 3EK4A 4PHJA 2M29A 2EGDA 4OKHA 1CKKA 4MLWA 3E3RA 2KQYA 5HKYA 3GK2A 4N5XA 1VRKA 2RGIA 2MA2A 3EVUA 1BU3A 2M7LA 3KHEA 3D0YB 1DMOA 3EK8A 1D1OA 4PE4A 2LUXA 3AKAA 1A75A 5D7FA 2KBIA 2NCPA 2WOSA 3I5IC 2ZRTA 2CXJA 4MSPA 2KDHA 3TZ1A 1IJ6A 1DVIA 1YVHA 2JRFA 1SL7A 1GGZA 1LA3A 1XFYO 2EC6C 4OR9B 1KQVA 2QPTA 1BJFA 2NXQA 3SG7A 5G08A 2WNDA 5IBWA 2JT8A 3OHMB 1CDNA 1K93D 3CR2A 2L0PA 3BUNB 3O78A 1KCYA 1A03A 3SG4A 3MSEB 1B8LA 2V53A 1J55A 1BT6A 3ICBA 1QXPA 1G8IA 2K7BA 4HREE 2OPOA 4AOMA 1NPQA 3KO0A 1QVIY 4P5OE 3DF0B 1XK4C 4YGBB 2KFFA 2LAPA 1AJ4A 3EVVA 3O6BA 1CFFA 3DF0A 2GV5A 4R1EA 4BY4A 1RTP1 1UUSA 3TDIA 1BR1B 3PATA 3O4YA 5DKQA 1HT9A 1KFXS 3OP0A 2ZRSA 3I5GB 4MZJA 2AMIA 2LVIA 1S26D 1K9KA 3CGAA 4FQOA 4CIDA 3CLNA 3C1VA 1SRAA 1JSAA 5AANA 2M9GA 1XA5A 2K61A 2FOTA 3D10A 3OX6A 4YRUA 1NCZA 2BL0B 1QIWA 1SR6B 3CR5X 2K2AA 1SCVA 1YUSA 1IQ5A 4BY5A 1YUTA 2LP3A 1WRKA 2M7NA 1EJ3A 4HRGA 1IQ3A 4C0JA 2AUCA 3WXAA 1F8HA 2OTGC 4M2PA 5CSIA 1SY9A 2OS8B 1JWDA 2K0JA 3K21A 5J3XA 2FJUB 1B7TY 4M2QA 4QJ5B 1TNXA 1B4CA 3EKHA 1M45A 1MR8A 2KGRA 3HCMA 1ODBA 4PE1A 3OX5A 1XVJA 1JFKA 2LMTA 2F3ZA 1QVIZ 1UP5A 1C7VA 3BUMB 4Q04A 2JULA 4GGFC 1ZOTB 1M31A 1F54A 4I5KA 4PALA 1OMVA 3OB1B 1NUBA 3O2PA 3VGOA 1AHRA 3QRXA 2JNXA 5AERA 1CFDA 2G2BA 2WORA 2PASA 3BYAA 2I18A 1GQMA 1CM1A 2F8PA 1DJHA 1S1EA 2LLSA 3VRRA 3TUYC 1Y1UA 2BCAA 3FS7A 2LCPA 3CTNA 2TN4A 1EG3A 5I8NA 1WLMA 1DTLA 2JXCA 1YRUB 2NCOA 5CSJA 3VRNA 1OSAA 1U5IA 2LE9B 4GFTA 2Y4QA 1TNWA 2KYCA 2JQ6A 3TS5B 3DVJA 1BODA 1KFXL 3KEVA 4MRXA 4NDCA 1TCOB 1EXRA 1XFUO 3ZWHA 2BBMA 1SR6C 3RM1A 4WQ3A 1PRWA 2Q91A 1XFZO 2LLUA 2WCBA 3D0YA 3NXAA 2KNEA 1YURA 1A29A 2M8UA 1E8AA 3BQ3A 1XFWO 1B8CA 1S6JA 1PSBA 5HKZA 4NDBA 1K2HA 2K7OA 1NSHA 1OMRA 1MXEA 1J7PA 3IF7A 2M3WA 3TDZA 1SPYA 1FW4A 2BECA 1IG5A 1K8UA 2HF5A 1TCFA 1ZUZA 2O5GA 3A8RA 1JF2A 3ZNIA 1J7QA 3F45A 1DGUA 2K7CA 5JOLA 3VRPA 3EKJA 5JJGA 1PK0D 2KSPA 2Y1MA 4I5LB 2SASA 4QJ3B 1LXFC 3OB2B 2MHHA 1L2OC 2ZNDA 5ER5A 5KU1A 1KFUL 3NSOA 2FCEA 1Y0VH 2CBLA 2OS8C 3PN7C 1BLQA 2R2IA 1TNQA 1YRTB 2LANA 2LLTA 2F2PA 1RROA 4XJKB 1XFXO 1KFUS 3DVEA 3M0WA 4NDDA 4PE7A 1ALWA 4OCIA 1CDMA 2Y1NA 3JTDB 4DRWA 1CM4A 1CNPA 2PVBA 1CDPA 4MVFA 1WRLA 2LV7A 2I7AA 2BCBA 1TNPA 1JBAA 1YUUA 1OMDA 3LLEA 4PCWA 2LNKA 1DJGA 2LHIA 4YGDB 5AFPA 1EL4A 2JZIA 2KAVA 3A4UB 3AKBA 2JT0A 3EVRA 4NQGA 3SG6A 4YI8A 2M1KB 2LVVA 1ALVA 1M39A 3CS1A 1OZSA 5ER4X 4YGEB 1EH2A 3I5GC 1FI5A 3H4SE 2CT9A 2ZN9A 1U5IB 1QX2A 3GOFA 2KOTA 5PALA 4YBHB 1PVBA 1WLZA 2WCFA 3CR4X 3BOWA 1FF1A 2CNPA 2JT3A 1CTRA 2H61A 2MAZA 4MZLA 1S6CA 4WQ2A 1QV0A 5TNCA 2L2EA 3CWGA 4XYNA 2KYFA 4PHKA 2H2KA 4PHMA 4JWQA 3LK1A 2L50A 1UHIA 3RLZA 1F4QA 4A4BA 5BPJA 1SKTA 1CLLA 4JQ0D 5CSFA 4A4CA 2BKIB 3DVKA 1ZMZA 1G33A 2SCPA 1B7TZ 2EC6B 2KAXA 2KI6C 3PALA 1TOPA 4GUKA 2JOJA 3I5HB 1NX3A 1S3PA 4GPLB 1MWNA 1H8BA 3WHTB 2HQWA 2BE6A 1M63B 2COLB 3FIAA 1OE9B 2JWWA 3JTDC 1QTXA 1DGVA 3PM8A 3I5HC 2DOQA 4ORCB 4YI9A 3BUOB 2KFGA 2LVKA 1KSOA 1LINA 1R2UA 2HPSA 2I2RE 1S5GZ 4ORAB 3BOWB 1B1GA 1IKUA 1QLSA 1YR5A 2FCDA 2L4HA 4ZCUA 2BE4A 1BF5A 1Q80A 4USLA 1L2OB 2P6BB 2KHNA 1OOJA 1KK7Y 1XK4A 1SBJA 2BBNA 2I94A 1DJWA 1AP4A 5K89A 1KQMB 3I5FB 1H4BA 3HX4A 1X02A 1WY9A 1NYAA 5I2OA 4PHNA 4ORBB 2CTNA 1G4YR 1Y6WA 2KAYA 1AUIB 2QACA 5AEQA 3FWBA 2E30A 1V1FA 1CB1A 3JVTC 4MN0A 1S6IA 2MLFC 3IQQA 1DF0A 1K95A 2IS9A 5KSZA 1KK8B 1Y1AA 1IWQA 3LCPC 1FI6A 1WRZA 4I5JA 1QATA 1NX0A 3SG2A 2HQ8A 1J7OA 1YTZC 2WC8A 2JTTA 4U8DA 2LC5A 1A75B 1QLKA 1UHHA 2LM5A 2KFHA 4YGCB 5HLOA 2JTZA 1CMFA 4HSZA 5KTYA 2LHLA 1K90D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BUW B;  1JF0 A;  1JFJ A;  1AVS A;  2MRD A;  1PSR A;  3SIB A;  1JC2 A;  1AK8 A;  2KBM A;  1F71 A;  2F2O A;  5F6T A;  2NZ0 A;  1WDC C;  2AAO A;  2LUC A;  3PSR A;  2JPT A;  2JU0 A;  2KI4 C;  1NCX A;  1B8R A;  1UHJ A;  3PN7 B;  4ICB A;  2LVJ A;  1SCM C;  1J1E A;  4QJ4 B;  3TUY B;  1N2D A;  1ZFS A;  1TN4 A;  1N65 A;  1K9U A;  2MLE C;  5DKR A;  1IGV A;  3LL8 B;  4YGA A;  1J1D A;  4AQJ A;  1LKJ A;  4WRI A;  1DJZ A;  1QIV A;  1QJT A;  3AAJ A;  1DJY A;  1F70 A;  4M2O A;  1LVC D;  2HET A;  1REC A;  4GBA A;  1RWY A;  1TRF A;  4N1G A;  3CZT X;  3BUX B;  2BKH B;  1W7I B;  1NCY A;  1SMG A;  1NIW A;  3VRQ A;  1XYD A;  2ZKM X;  1RJV A;  4GAO A;  1CDL A;  2ZN8 A;  1UUR A;  1XFV O;  2WCE A;  1Y1X A;  1K94 A;  4P2Y B;  5GQQ C;  1CLM A;  1GJY A;  1SCM B;  1KK7 Z;  2LP2 A;  5CPV A;  2KQ6 A;  2KI4 B;  2M97 A;  4C0L A;  1CLB A;  4CFR A;  1WDC B;  3SG5 A;  1EG4 A;  3SIA A;  1NWD A;  1C07 A;  1KWO C;  1M46 A;  1L7Z A;  2CCM A;  4UPG A;  1J7R A;  3DVM A;  1BR4 B;  4JPZ B;  1ZAC A;  2O60 A;  4DIR A;  1UHN A;  3KF9 A;  1A4P A;  2NLN A;  2ISD A;  3TS5 C;  2GGZ A;  3GK1 A;  1SNL A;  3GK4 X;  3PFV A;  1QS7 A;  3PLF B;  3EK7 A;  2M0R A;  2K7D A;  1KWO B;  1TIZ A;  1GGW A;  1TTX A;  4MZK A;  4CFQ A;  2L4I A;  4TNC A;  4C0K A;  1DF0 B;  2Y5I A;  1S36 A;  3LK0 A;  2KGB C;  3NSI A;  1IRJ A;  1KK8 C;  3BXK A;  2EHB A;  3JVT B;  2E6W A;  1QV1 A;  4MRY A;  4HRH A;  2G9B A;  1CFP A;  1FPW A;  2BCX A;  3NSL A;  1IH0 A;  1PUL A;  1F4O A;  2PMY A;  4ZCV A;  2M49 B;  5B8I B;  4MEW A;  1FBV A;  1C7W A;  5I2Q A;  1K96 A;  1RK9 A;  1YVL A;  4CPV A;  1B47 A;  1MHO A;  4E68 A;  5I2L A;  1KSM A;  3AAK A;  5FYX A;  1SYM A;  3WHU B;  2L51 A;  1HQV A;  4PDZ A;  1A2X A;  1NX2 A;  2F3Y A;  5D69 A;  5AXI A;  1BOC A;  1F55 A;  4GNK B;  1PVA A;  3WNX B;  2D8N A;  2OTG B;  4F0Z B;  1R6P A;  1SL9 A;  2K8M B;  3KPX A;  2A4J A;  4DS7 A;  2L98 A;  1N0Y A;  1LA0 A;  4XJK A;  2MJW B;  3SG3 A;  4N1F A;  5HKW A;  1CMG A;  1PAL A;  1B9A A;  1QX7 A;  3I5I B;  2PSR A;  1XO5 A;  4FTG A;  4DCK A;  2GGM A;  1QAS A;  2PRU A;  4DUQ A;  1NX1 A;  1W7J B;  2BL0 C;  1UWO A;  1DJI A;  1OQP A;  1NP8 A;  1MXL C;  1YX8 A;  2JC2 A;  4GGF A;  1MF8 B;  1S5G Y;  3TDU A;  5HYD A;  2KI6 D;  1AJ5 A;  4OVN F;  4PE0 A;  4OV2 A;  1BG1 A;  2LMV A;  2VRG A;  2B1U A;  4L9M A;  5CSN A;  2MBX A;  3FWC A;  1K9P A;  3IQO A;  3VRO A;  2M1U A;  1CFC A;  2JNF A;  1V1G A;  5HLV A;  1IJ5 A;  4ETO A;  4AQI A;  3DD4 A;  1SW8 A;  2Q4U A;  1RFJ A;  2ZFD A;  1YX7 A;  2H61 C;  1OZO A;  2K2F A;  3NSK A;  1BMO A;  4MBE A;  1DJX A;  1QX5 B;  4IL1 A;  4GGN A;  4CLN A;  1KQM C;  3I5F C;  4D1E A;  1JUO A;  2JXL A;  2L5X B;  3SJS A;  1DT7 B;  2LMU A;  1MQ1 A;  5DKN A;  2F33 A;  1SL8 A;  1SK6 D;  1UHK A;  1MUX A;  4I5N B;  2PAL A;  2ZNE A;  3EK4 A;  4PHJ A;  2M29 A;  2EGD A;  4OKH A;  1CKK A;  4MLW A;  3E3R A;  2KQY A;  5HKY A;  3GK2 A;  4N5X A;  1VRK A;  2RGI A;  2MA2 A;  3EVU A;  1BU3 A;  2M7L A;  3KHE A;  3D0Y B;  1DMO A;  3EK8 A;  1D1O A;  4PE4 A;  2LUX A;  3AKA A;  1A75 A;  5D7F A;  2KBI A;  2NCP A;  2WOS A;  3I5I C;  2ZRT A;  2CXJ A;  4MSP A;  2KDH A;  3TZ1 A;  1IJ6 A;  1DVI A;  1YVH A;  2JRF A;  1SL7 A;  1GGZ A;  1LA3 A;  1XFY O;  2EC6 C;  4OR9 B;  1KQV A;  2QPT A;  1BJF A;  2NXQ A;  3SG7 A;  5G08 A;  2WND A;  5IBW A;  2JT8 A;  3OHM B;  1CDN A;  1K93 D;  3CR2 A;  2L0P A;  3BUN B;  3O78 A;  1KCY A;  1A03 A;  3SG4 A;  3MSE B;  1B8L A;  2V53 A;  1J55 A;  1BT6 A;  3ICB A;  1QXP A;  1G8I A;  2K7B A;  4HRE E;  2OPO A;  4AOM A;  1NPQ A;  3KO0 A;  1QVI Y;  4P5O E;  3DF0 B;  1XK4 C;  4YGB B;  2KFF A;  2LAP A;  1AJ4 A;  3EVV A;  3O6B A;  1CFF A;  3DF0 A;  2GV5 A;  4R1E A;  4BY4 A;  1RTP 1;  1UUS A;  3TDI A;  1BR1 B;  3PAT A;  3O4Y A;  5DKQ A;  1HT9 A;  1KFX S;  3OP0 A;  2ZRS A;  3I5G B;  4MZJ A;  2AMI A;  2LVI A;  1S26 D;  1K9K A;  3CGA A;  4FQO A;  4CID A;  3CLN A;  3C1V A;  1SRA A;  1JSA A;  5AAN A;  2M9G A;  1XA5 A;  2K61 A;  2FOT A;  3D10 A;  3OX6 A;  4YRU A;  1NCZ A;  2BL0 B;  1QIW A;  1SR6 B;  3CR5 X;  2K2A A;  1SCV A;  1YUS A;  1IQ5 A;  4BY5 A;  1YUT A;  2LP3 A;  1WRK A;  2M7N A;  1EJ3 A;  4HRG A;  1IQ3 A;  4C0J A;  2AUC A;  3WXA A;  1F8H A;  2OTG C;  4M2P A;  5CSI A;  1SY9 A;  2OS8 B;  1JWD A;  2K0J A;  3K21 A;  5J3X A;  2FJU B;  1B7T Y;  4M2Q A;  4QJ5 B;  1TNX A;  1B4C A;  3EKH A;  1M45 A;  1MR8 A;  2KGR A;  3HCM A;  1ODB A;  4PE1 A;  3OX5 A;  1XVJ A;  1JFK A;  2LMT A;  2F3Z A;  1QVI Z;  1UP5 A;  1C7V A;  3BUM B;  4Q04 A;  2JUL A;  4GGF C;  1ZOT B;  1M31 A;  1F54 A;  4I5K A;  4PAL A;  1OMV A;  3OB1 B;  1NUB A;  3O2P A;  3VGO A;  1AHR A;  3QRX A;  2JNX A;  5AER A;  1CFD A;  2G2B A;  2WOR A;  2PAS A;  3BYA A;  2I18 A;  1GQM A;  1CM1 A;  2F8P A;  1DJH A;  1S1E A;  2LLS A;  3VRR A;  3TUY C;  1Y1U A;  2BCA A;  3FS7 A;  2LCP A;  3CTN A;  2TN4 A;  1EG3 A;  5I8N A;  1WLM A;  1DTL A;  2JXC A;  1YRU B;  2NCO A;  5CSJ A;  3VRN A;  1OSA A;  1U5I A;  2LE9 B;  4GFT A;  2Y4Q A;  1TNW A;  2KYC A;  2JQ6 A;  3TS5 B;  3DVJ A;  1BOD A;  1KFX L;  3KEV A;  4MRX A;  4NDC A;  1TCO B;  1EXR A;  1XFU O;  3ZWH A;  2BBM A;  1SR6 C;  3RM1 A;  4WQ3 A;  1PRW A;  2Q91 A;  1XFZ O;  2LLU A;  2WCB A;  3D0Y A;  3NXA A;  2KNE A;  1YUR A;  1A29 A;  2M8U A;  1E8A A;  3BQ3 A;  1XFW O;  1B8C A;  1S6J A;  1PSB A;  5HKZ A;  4NDB A;  1K2H A;  2K7O A;  1NSH A;  1OMR A;  1MXE A;  1J7P A;  3IF7 A;  2M3W A;  3TDZ A;  1SPY A;  1FW4 A;  2BEC A;  1IG5 A;  1K8U A;  2HF5 A;  1TCF A;  1ZUZ A;  2O5G A;  3A8R A;  1JF2 A;  3ZNI A;  1J7Q A;  3F45 A;  1DGU A;  2K7C A;  5JOL A;  3VRP A;  3EKJ A;  5JJG A;  1PK0 D;  2KSP A;  2Y1M A;  4I5L B;  2SAS A;  4QJ3 B;  1LXF C;  3OB2 B;  2MHH A;  1L2O C;  2ZND A;  5ER5 A;  5KU1 A;  1KFU L;  3NSO A;  2FCE A;  1Y0V H;  2CBL A;  2OS8 C;  3PN7 C;  1BLQ A;  2R2I A;  1TNQ A;  1YRT B;  2LAN A;  2LLT A;  2F2P A;  1RRO A;  4XJK B;  1XFX O;  1KFU S;  3DVE A;  3M0W A;  4NDD A;  4PE7 A;  1ALW A;  4OCI A;  1CDM A;  2Y1N A;  3JTD B;  4DRW A;  1CM4 A;  1CNP A;  2PVB A;  1CDP A;  4MVF A;  1WRL A;  2LV7 A;  2I7A A;  2BCB A;  1TNP A;  1JBA A;  1YUU A;  1OMD A;  3LLE A;  4PCW A;  2LNK A;  1DJG A;  2LHI A;  4YGD B;  5AFP A;  1EL4 A;  2JZI A;  2KAV A;  3A4U B;  3AKB A;  2JT0 A;  3EVR A;  4NQG A;  3SG6 A;  4YI8 A;  2M1K B;  2LVV A;  1ALV A;  1M39 A;  3CS1 A;  1OZS A;  5ER4 X;  4YGE B;  1EH2 A;  3I5G C;  1FI5 A;  3H4S E;  2CT9 A;  2ZN9 A;  1U5I B;  1QX2 A;  3GOF A;  2KOT A;  5PAL A;  4YBH B;  1PVB A;  1WLZ A;  2WCF A;  3CR4 X;  3BOW A;  1FF1 A;  2CNP A;  2JT3 A;  1CTR A;  2H61 A;  2MAZ A;  4MZL A;  1S6C A;  4WQ2 A;  1QV0 A;  5TNC A;  2L2E A;  3CWG A;  4XYN A;  2KYF A;  4PHK A;  2H2K A;  4PHM A;  4JWQ A;  3LK1 A;  2L50 A;  1UHI A;  3RLZ A;  1F4Q A;  4A4B A;  5BPJ A;  1SKT A;  1CLL A;  4JQ0 D;  5CSF A;  4A4C A;  2BKI B;  3DVK A;  1ZMZ A;  1G33 A;  2SCP A;  1B7T Z;  2EC6 B;  2KAX A;  2KI6 C;  3PAL A;  1TOP A;  4GUK A;  2JOJ A;  3I5H B;  1NX3 A;  1S3P A;  4GPL B;  1MWN A;  1H8B A;  3WHT B;  2HQW A;  2BE6 A;  1M63 B;  2COL B;  3FIA A;  1OE9 B;  2JWW A;  3JTD C;  1QTX A;  1DGV A;  3PM8 A;  3I5H C;  2DOQ A;  4ORC B;  4YI9 A;  3BUO B;  2KFG A;  2LVK A;  1KSO A;  1LIN A;  1R2U A;  2HPS A;  2I2R E;  1S5G Z;  4ORA B;  3BOW B;  1B1G A;  1IKU A;  1QLS A;  1YR5 A;  2FCD A;  2L4H A;  4ZCU A;  2BE4 A;  1BF5 A;  1Q80 A;  4USL A;  1L2O B;  2P6B B;  2KHN A;  1OOJ A;  1KK7 Y;  1XK4 A;  1SBJ A;  2BBN A;  2I94 A;  1DJW A;  1AP4 A;  5K89 A;  1KQM B;  3I5F B;  1H4B A;  3HX4 A;  1X02 A;  1WY9 A;  1NYA A;  5I2O A;  4PHN A;  4ORB B;  2CTN A;  1G4Y R;  1Y6W A;  2KAY A;  1AUI B;  2QAC A;  5AEQ A;  3FWB A;  2E30 A;  1V1F A;  1CB1 A;  3JVT C;  4MN0 A;  1S6I A;  2MLF C;  3IQQ A;  1DF0 A;  1K95 A;  2IS9 A;  5KSZ A;  1KK8 B;  1Y1A A;  1IWQ A;  3LCP C;  1FI6 A;  1WRZ A;  4I5J A;  1QAT A;  1NX0 A;  3SG2 A;  2HQ8 A;  1J7O A;  1YTZ C;  2WC8 A;  2JTT A;  4U8D A;  2LC5 A;  1A75 B;  1QLK A;  1UHH A;  2LM5 A;  2KFH A;  4YGC B;  5HLO A;  2JTZ A;  1CMF A;  4HSZ A;  5KTY A;  2LHL A;  1K90 D; 
#chains in the Genus database with same CATH topology
 3BUW B;  1JF0 A;  1JFJ A;  1AVS A;  2MRD A;  1PSR A;  3SIB A;  1JC2 A;  1AK8 A;  2KBM A;  1F71 A;  2F2O A;  5F6T A;  2NZ0 A;  1WDC C;  2AAO A;  2LUC A;  3PSR A;  2ERB A;  2JPT A;  2JU0 A;  2KI4 C;  1NCX A;  1B8R A;  1UHJ A;  3PN7 B;  4ICB A;  2LVJ A;  1SCM C;  1J1E A;  4QJ4 B;  3TUY B;  1N2D A;  1ZFS A;  1TN4 A;  1N65 A;  1K9U A;  2MLE C;  5DKR A;  1IGV A;  3LL8 B;  4YGA A;  1J1D A;  3R1O A;  1LKJ A;  4AQJ A;  3PM2 A;  4WRI A;  1DJZ A;  1QIV A;  1QJT A;  3AAJ A;  4INW A;  1DJY A;  1F70 A;  4M2O A;  1LVC D;  2HET A;  1REC A;  4GBA A;  1RWY A;  1TRF A;  4N1G A;  3CZT X;  3BUX B;  2BKH B;  1W7I B;  1NCY A;  1SMG A;  1NIW A;  3VRQ A;  1XYD A;  2ZKM X;  1RJV A;  3IVT A;  1CDL A;  4GAO A;  2ZN8 A;  2KPH A;  1UUR A;  1W9Z A;  1XFV O;  2WCE A;  1Y1X A;  1K94 A;  4P2Y B;  5GQQ C;  3FE6 A;  1CLM A;  1GJY A;  1SCM B;  1KK7 Z;  2LP2 A;  5CPV A;  2KQ6 A;  2KI4 B;  2M97 A;  3DY9 A;  4C0L A;  1CLB A;  4CFR A;  1WDC B;  3S0B A;  3NHI A;  3SG5 A;  1EG4 A;  3SIA A;  1NWD A;  2KLE A;  1C07 A;  1KWO C;  1M46 A;  1L7Z A;  2WCM A;  4FQT A;  3BFA A;  2CCM A;  4UPG A;  1J7R A;  3DVM A;  1BR4 B;  4JPZ B;  1ZAC A;  2O60 A;  4DIR A;  1UHN A;  3KF9 A;  1A4P A;  2NLN A;  2ISD A;  3TS5 C;  2GGZ A;  3GK1 A;  1SNL A;  3GK4 X;  3PFV A;  1QS7 A;  3PLF B;  3EK7 A;  2M0R A;  2K7D A;  1KWO B;  1TIZ A;  1GGW A;  1TTX A;  4MZK A;  4CFQ A;  2L4I A;  4TNC A;  4C0K A;  1DF0 B;  2Y5I A;  1S36 A;  3LK0 A;  2KGB C;  3NSI A;  1IRJ A;  1KK8 C;  3BXK A;  2EHB A;  3JVT B;  2E6W A;  1QV1 A;  3SS4 A;  2WCK A;  1TUJ A;  4MRY A;  3CZ1 A;  4HRH A;  2G9B A;  1CFP A;  1FPW A;  2BCX A;  3NSL A;  1IH0 A;  1PUL A;  1F4O A;  2PMY A;  4ZCV A;  2M49 B;  5B8I B;  4MEW A;  1FBV A;  1C7W A;  5I2Q A;  1K96 A;  1RK9 A;  1YVL A;  2QDI A;  1B47 A;  1MHO A;  5EL2 A;  4CPV A;  4E68 A;  5I2L A;  1KSM A;  3AAK A;  5FYX A;  1SYM A;  3UO9 A;  2L51 A;  3WHU B;  1HQV A;  3CYZ A;  4PDZ A;  1A2X A;  1NX2 A;  2F3Y A;  5D69 A;  5AXI A;  1BOC A;  1F55 A;  4GNK B;  1PVA A;  3WNX B;  2D8N A;  2OTG B;  4F0Z B;  1R6P A;  1SL9 A;  2K8M B;  3KPX A;  2A4J A;  4DS7 A;  2L98 A;  1N0Y A;  1LA0 A;  4XJK A;  2MJW B;  3SG3 A;  4N1F A;  5HKW A;  1CMG A;  3SS5 A;  1PAL A;  3NHT A;  1B9A A;  1QX7 A;  3I5I B;  2PSR A;  1XO5 A;  4FTG A;  4DCK A;  2GTE A;  2GGM A;  1QAS A;  2PRU A;  4DUQ A;  1NX1 A;  1W7J B;  2BL0 C;  1UWO A;  1DJI A;  1OQP A;  1NP8 A;  1MXL C;  1YX8 A;  3PJI A;  2JC2 A;  4GGF A;  1MF8 B;  1S5G Y;  3TDU A;  5HYD A;  2KI6 D;  1AJ5 A;  4OVN F;  4PE0 A;  4OV2 A;  1C3Z A;  1BG1 A;  2LMV A;  2VRG A;  2B1U A;  4L9M A;  5CSN A;  2MBX A;  3FWC A;  1K9P A;  3IQO A;  3VRO A;  1OW4 A;  2WC5 A;  2M1U A;  1CFC A;  2JNF A;  1V1G A;  5HLV A;  1IJ5 A;  4ETO A;  4AQI A;  3DD4 A;  1SW8 A;  2Q4U A;  1RFJ A;  2ZFD A;  3R1V A;  1YX7 A;  1DQE A;  2H61 C;  1OZO A;  2K2F A;  3NSK A;  1BMO A;  4MBE A;  3DZT A;  1DJX A;  1QX5 B;  4IL1 A;  4GGN A;  4CLN A;  1KQM C;  3I5F C;  4D1E A;  1JUO A;  2JXL A;  2L5X B;  3SJS A;  1DT7 B;  2LMU A;  3CZ0 A;  1MQ1 A;  5DKN A;  2F33 A;  1DEK A;  1SL8 A;  1SK6 D;  1UHK A;  3L47 A;  1MUX A;  4I5N B;  2PAL A;  2ZNE A;  3EK4 A;  4PHJ A;  2M29 A;  2EGD A;  3L4L A;  4OKH A;  1CKK A;  3NGV A;  4MLW A;  3E3R A;  2KQY A;  5HKY A;  3GK2 A;  4N5X A;  1VRK A;  2RGI A;  2MA2 A;  3R72 A;  3EVU A;  1BU3 A;  2M7L A;  3KHE A;  3D0Y B;  1DMO A;  3EK8 A;  1D1O A;  4PE4 A;  2LUX A;  3B87 A;  3FE8 A;  1GM0 A;  3AKA A;  1A75 A;  5D7F A;  2KBI A;  2NCP A;  3BJH A;  1Z4H A;  2WOS A;  3I5I C;  2ZRT A;  3S0D A;  2CXJ A;  4MSP A;  2KDH A;  3TZ1 A;  1IJ6 A;  1DVI A;  1YVH A;  5FI7 A;  2JRF A;  1SL7 A;  1GGZ A;  1LA3 A;  1XFY O;  2EC6 C;  4OR9 B;  1KQV A;  2QPT A;  1BJF A;  2NXQ A;  3SG7 A;  5G08 A;  2WND A;  5IBW A;  2JT8 A;  3OHM B;  1DC1 A;  1CDN A;  1K93 D;  2WC6 A;  2L0P A;  3BUN B;  3CR2 A;  3O78 A;  3Q8I A;  1KCY A;  1A03 A;  3SG4 A;  3MSE B;  1B8L A;  2V53 A;  1J55 A;  1BT6 A;  3V2L A;  3ICB A;  1QXP A;  1G8I A;  2K7B A;  4HRE E;  2OPO A;  4AOM A;  1NPQ A;  3KO0 A;  3BFB A;  1QVI Y;  4P5O E;  3DF0 B;  1XK4 C;  2QEO A;  4YGB B;  2KFF A;  2LAP A;  1AJ4 A;  3EVV A;  3O6B A;  1CFF A;  2BAP A;  3DF0 A;  2GV5 A;  4R1E A;  4BY4 A;  1RTP 1;  1UUS A;  3TDI A;  5FI2 A;  1BR1 B;  3PAT A;  3O4Y A;  5DKQ A;  1HT9 A;  1KFX S;  3OP0 A;  2ZRS A;  3I5G B;  4MZJ A;  4INX A;  2AMI A;  2LVI A;  1S26 D;  1K9K A;  3CGA A;  4FQO A;  4CID A;  3CLN A;  2K60 A;  3C1V A;  1SRA A;  1JSA A;  5AAN A;  2M9G A;  5D3O A;  1OOF A;  1XA5 A;  2K61 A;  2FOT A;  3D10 A;  3OX6 A;  4YRU A;  1NCZ A;  2BL0 B;  1QIW A;  1SR6 B;  3CR5 X;  2K2A A;  1SCV A;  1YUS A;  1DEL A;  1IQ5 A;  4BY5 A;  3B7A A;  1YUT A;  2LP3 A;  1WRK A;  2M7N A;  1EJ3 A;  4HRG A;  1IQ3 A;  3S0F A;  4C0J A;  5HL1 A;  2AUC A;  3WXA A;  1F8H A;  2OTG C;  4M2P A;  5CSI A;  3D74 A;  4IJ7 A;  1SY9 A;  2OS8 B;  1JWD A;  2K0J A;  3K21 A;  5J3X A;  2FJU B;  1B7T Y;  4M2Q A;  4QJ5 B;  1TNX A;  1B4C A;  3EKH A;  1M45 A;  3DXL A;  1MR8 A;  2KGR A;  3HCM A;  1ODB A;  4PE1 A;  3RZS A;  2QEH A;  1XVJ A;  1JFK A;  2LMT A;  1QVI Z;  2F3Z A;  1UP5 A;  3OX5 A;  1C7V A;  3BUM B;  2P71 A;  1OOG A;  3D75 A;  4Q04 A;  2JUL A;  5I94 A;  4GGF C;  1ZOT B;  1M31 A;  1F54 A;  4I5K A;  4PAL A;  1OMV A;  3OB1 B;  1NUB A;  3O2P A;  2KLD A;  3VGO A;  1AHR A;  3QRX A;  1T14 A;  2JNX A;  5AER A;  1CFD A;  2G2B A;  2WOR A;  3N7H A;  2PAS A;  3BYA A;  2I18 A;  1GQM A;  3SS3 A;  1CM1 A;  2F8P A;  2YGU A;  1DJH A;  1S1E A;  2LLS A;  2WCH A;  3VRR A;  1Y1U A;  2BCA A;  3FS7 A;  2LCP A;  3CTN A;  3TUY C;  2TN4 A;  1EG3 A;  5I8N A;  1WLM A;  2WCJ A;  1DTL A;  2JXC A;  1YRU B;  2NCO A;  5CSJ A;  3VRN A;  1OSA A;  1U5I A;  2LE9 B;  3S0G A;  4GFT A;  1Z2C B;  2Y4Q A;  1TNW A;  2KYC A;  2JQ6 A;  3TS5 B;  3DVJ A;  1BOD A;  1KFX L;  3KEV A;  4MRX A;  4NDC A;  1TCO B;  1EXR A;  1XFU O;  3ZWH A;  2BBM A;  1SR6 C;  3RM1 A;  3QME A;  4WQ3 A;  1PRW A;  2Q91 A;  1XFZ O;  2LLU A;  2WCB A;  3D0Y A;  3NXA A;  2KNE A;  3EG5 B;  1YUR A;  1A29 A;  2M8U A;  1E8A A;  3BQ3 A;  1XFW O;  1B8C A;  1S6J A;  1PSB A;  5HKZ A;  2JPO A;  4NDB A;  5DIC A;  2K7O A;  1K2H A;  1NSH A;  1OMR A;  1MXE A;  1J7P A;  3IF7 A;  2M3W A;  3FE9 A;  3TDZ A;  1SPY A;  1FW4 A;  2BEC A;  1IG5 A;  2L2C A;  1K8U A;  2HF5 A;  1TCF A;  1ZUZ A;  2O5G A;  3A8R A;  1JF2 A;  3ZNI A;  1J7Q A;  3F45 A;  1DGU A;  4OZD A;  2K7C A;  5FI6 A;  1IIO A;  1QWV A;  5JOL A;  3VRP A;  3EKJ A;  5JJG A;  1PK0 D;  2KSP A;  2Y1M A;  4I5L B;  2SAS A;  4QJ3 B;  1LXF C;  3OB2 B;  1LS8 A;  1L2O C;  2MHH A;  2ZND A;  5ER5 A;  5KU1 A;  1KFU L;  3D77 A;  3NSO A;  2FCE A;  1Y0V H;  2CBL A;  2OS8 C;  3PN7 C;  1BLQ A;  2R2I A;  1TNQ A;  1YRT B;  2LAN A;  2LLT A;  2F2P A;  1RRO A;  4XJK B;  3CDN A;  1XFX O;  2QEV A;  3VB1 A;  1KFU S;  3DVE A;  1OOI X;  3M0W A;  4NDD A;  1ALW A;  4KYN A;  4OCI A;  1CDM A;  4PE7 A;  2Y1N A;  3JTD B;  4DRW A;  1CM4 A;  1CNP A;  2PVB A;  1CDP A;  4MVF A;  4JD9 A;  1WRL A;  2L5Y A;  2I7A A;  2LV7 A;  2BCB A;  1TNP A;  1JBA A;  1YUU A;  1OMD A;  2WCL A;  3LLE A;  4PCW A;  2LNK A;  1DJG A;  2LHI A;  4YGD B;  5AFP A;  1EL4 A;  2JZI A;  2FJY A;  2KAV A;  3A4U B;  3AKB A;  2JT0 A;  3EVR A;  2PYQ A;  4NQG A;  3SG6 A;  3UNW A;  4YI8 A;  2M1K B;  2LVV A;  1ALV A;  1M39 A;  3CS1 A;  1OZS A;  5ER4 X;  4YGE B;  1EH2 A;  3I5G C;  1FI5 A;  3B86 A;  1SSE B;  3H4S E;  2CT9 A;  2ZN9 A;  1U5I B;  1QX2 A;  3GOF A;  2KOT A;  5PAL A;  4YBH B;  1PVB A;  1WLZ A;  2WCF A;  3CR4 X;  1OOH A;  3BOW A;  1FF1 A;  2CNP A;  2JT3 A;  2QEB A;  1CTR A;  2H61 A;  2MAZ A;  4MZL A;  1S6C A;  4WQ2 A;  1QV0 A;  5TNC A;  2L2E A;  3CWG A;  4XYN A;  2KYF A;  4PHK A;  2H2K A;  4PHM A;  4JWQ A;  3LK1 A;  2L50 A;  1UHI A;  1TUZ A;  3L4A A;  1F4Q A;  3RLZ A;  4A4B A;  5BPJ A;  1SKT A;  1CLL A;  4JQ0 D;  5CSF A;  1TWO A;  4A4C A;  2BKI B;  3DVK A;  1ZMZ A;  4JKT A;  1G33 A;  2SCP A;  1B7T Z;  2EC6 B;  2KAX A;  2KI6 C;  3PAL A;  1TOP A;  2BNX A;  4GUK A;  2JOJ A;  3I5H B;  1NX3 A;  1S3P A;  4GPL B;  3S0E A;  1MWN A;  1H8B A;  3R1P A;  2HQW A;  2BE6 A;  1M63 B;  2COL B;  3FIA A;  1OE9 B;  2JWW A;  3WHT B;  3JTD C;  1QTX A;  1DGV A;  3PM8 A;  3I5H C;  2DOQ A;  4ORC B;  4YI9 A;  3BUO B;  2KFG A;  2LVK A;  1KSO A;  1LIN A;  1R2U A;  2HPS A;  2I2R E;  1S5G Z;  4ORA B;  3BOW B;  1B1G A;  1IKU A;  4PT1 A;  1QLS A;  1YR5 A;  2FCD A;  2L4H A;  4ZCU A;  2BE4 A;  3OGN A;  1BF5 A;  1Q80 A;  4USL A;  1L2O B;  2P6B B;  2KHN A;  2PQL A;  1OOJ A;  1KK7 Y;  1XK4 A;  3BFH A;  1SBJ A;  2BBN A;  2I94 A;  1DJW A;  1AP4 A;  5K89 A;  1KQM B;  3I5F B;  3D76 A;  3CZ2 A;  3HX4 A;  1H4B A;  1X02 A;  1WY9 A;  1NYA A;  3D78 A;  5I2O A;  3O4X A;  2P70 A;  3K1E A;  4PHN A;  1C3Y A;  4ORB B;  2CTN A;  3CAB A;  3DYE A;  1XFR A;  3OBV A;  1G4Y R;  1Y6W A;  1P28 A;  1AUI B;  2KAY A;  2QAC A;  5AEQ A;  3FWB A;  2E30 A;  1V1F A;  1CB1 A;  3JVT C;  4MN0 A;  1S6I A;  2MLF C;  3IQQ A;  1DF0 A;  3B6X A;  1K95 A;  2IS9 A;  5KSZ A;  1KK8 B;  1Y1A A;  4F7F A;  1IWQ A;  3LCP C;  1FI6 A;  1WRZ A;  4I5J A;  1QAT A;  1NX0 A;  3SG2 A;  3B88 A;  2HQ8 A;  1J7O A;  1YTZ C;  2WC8 A;  2JTT A;  4U8D A;  3D73 A;  2LC5 A;  1A75 B;  1QLK A;  1UHH A;  2H8V A;  2LM5 A;  1ORG A;  2KFH A;  4YGC B;  5HLO A;  2JTZ A;  1CMF A;  4HSZ A;  5KTY A;  3S0A A;  2LHL A;  1K90 D; 
#chains in the Genus database with same CATH homology
 3BUW B;  1JF0 A;  1JFJ A;  1AVS A;  2MRD A;  1PSR A;  3SIB A;  1JC2 A;  1AK8 A;  2KBM A;  1F71 A;  2F2O A;  5F6T A;  2NZ0 A;  1WDC C;  2AAO A;  2LUC A;  3PSR A;  2JPT A;  2JU0 A;  2KI4 C;  1NCX A;  1B8R A;  1UHJ A;  3PN7 B;  4ICB A;  2LVJ A;  1SCM C;  1J1E A;  4QJ4 B;  3TUY B;  1N2D A;  1ZFS A;  1TN4 A;  1N65 A;  1K9U A;  2MLE C;  5DKR A;  1IGV A;  3LL8 B;  4YGA A;  1J1D A;  4AQJ A;  1LKJ A;  4WRI A;  1DJZ A;  1QIV A;  1QJT A;  3AAJ A;  1DJY A;  1F70 A;  4M2O A;  1LVC D;  2HET A;  1REC A;  4GBA A;  1RWY A;  1TRF A;  4N1G A;  3CZT X;  3BUX B;  2BKH B;  1W7I B;  1NCY A;  1SMG A;  1NIW A;  3VRQ A;  1XYD A;  2ZKM X;  1RJV A;  4GAO A;  1CDL A;  2ZN8 A;  1UUR A;  1XFV O;  2WCE A;  1Y1X A;  1K94 A;  4P2Y B;  5GQQ C;  1CLM A;  1GJY A;  1SCM B;  1KK7 Z;  2LP2 A;  5CPV A;  2KQ6 A;  2KI4 B;  2M97 A;  4C0L A;  1CLB A;  4CFR A;  1WDC B;  3SG5 A;  1EG4 A;  3SIA A;  1NWD A;  1C07 A;  1KWO C;  1M46 A;  1L7Z A;  2CCM A;  4UPG A;  1J7R A;  3DVM A;  1BR4 B;  4JPZ B;  1ZAC A;  2O60 A;  4DIR A;  1UHN A;  3KF9 A;  1A4P A;  2NLN A;  2ISD A;  3TS5 C;  2GGZ A;  3GK1 A;  1SNL A;  3GK4 X;  3PFV A;  1QS7 A;  3PLF B;  3EK7 A;  2M0R A;  2K7D A;  1KWO B;  1TIZ A;  1GGW A;  1TTX A;  4MZK A;  4CFQ A;  2L4I A;  4TNC A;  4C0K A;  1DF0 B;  2Y5I A;  1S36 A;  3LK0 A;  2KGB C;  3NSI A;  1IRJ A;  1KK8 C;  3BXK A;  2EHB A;  3JVT B;  2E6W A;  1QV1 A;  4MRY A;  4HRH A;  2G9B A;  1CFP A;  1FPW A;  2BCX A;  3NSL A;  1IH0 A;  1PUL A;  1F4O A;  2PMY A;  4ZCV A;  2M49 B;  5B8I B;  4MEW A;  1FBV A;  1C7W A;  5I2Q A;  1K96 A;  1RK9 A;  1YVL A;  4CPV A;  1B47 A;  1MHO A;  4E68 A;  5I2L A;  1KSM A;  3AAK A;  5FYX A;  1SYM A;  3WHU B;  2L51 A;  1HQV A;  4PDZ A;  1A2X A;  1NX2 A;  2F3Y A;  5D69 A;  5AXI A;  1BOC A;  1F55 A;  4GNK B;  1PVA A;  3WNX B;  2D8N A;  2OTG B;  4F0Z B;  1R6P A;  1SL9 A;  2K8M B;  3KPX A;  2A4J A;  4DS7 A;  2L98 A;  1N0Y A;  1LA0 A;  4XJK A;  2MJW B;  3SG3 A;  4N1F A;  5HKW A;  1CMG A;  1PAL A;  1B9A A;  1QX7 A;  3I5I B;  2PSR A;  1XO5 A;  4FTG A;  4DCK A;  2GGM A;  1QAS A;  2PRU A;  4DUQ A;  1NX1 A;  1W7J B;  2BL0 C;  1UWO A;  1DJI A;  1OQP A;  1NP8 A;  1MXL C;  1YX8 A;  2JC2 A;  4GGF A;  1MF8 B;  1S5G Y;  3TDU A;  5HYD A;  2KI6 D;  1AJ5 A;  4OVN F;  4PE0 A;  4OV2 A;  1BG1 A;  2LMV A;  2VRG A;  2B1U A;  4L9M A;  5CSN A;  2MBX A;  3FWC A;  1K9P A;  3IQO A;  3VRO A;  2M1U A;  1CFC A;  2JNF A;  1V1G A;  5HLV A;  1IJ5 A;  4ETO A;  4AQI A;  3DD4 A;  1SW8 A;  2Q4U A;  1RFJ A;  2ZFD A;  1YX7 A;  2H61 C;  1OZO A;  2K2F A;  3NSK A;  1BMO A;  4MBE A;  1DJX A;  1QX5 B;  4IL1 A;  4GGN A;  4CLN A;  1KQM C;  3I5F C;  4D1E A;  1JUO A;  2JXL A;  2L5X B;  3SJS A;  1DT7 B;  2LMU A;  1MQ1 A;  5DKN A;  2F33 A;  1SL8 A;  1SK6 D;  1UHK A;  1MUX A;  4I5N B;  2PAL A;  2ZNE A;  3EK4 A;  4PHJ A;  2M29 A;  2EGD A;  4OKH A;  1CKK A;  4MLW A;  3E3R A;  2KQY A;  5HKY A;  3GK2 A;  4N5X A;  1VRK A;  2RGI A;  2MA2 A;  3EVU A;  1BU3 A;  2M7L A;  3KHE A;  3D0Y B;  1DMO A;  3EK8 A;  1D1O A;  4PE4 A;  2LUX A;  3AKA A;  1A75 A;  5D7F A;  2KBI A;  2NCP A;  2WOS A;  3I5I C;  2ZRT A;  2CXJ A;  4MSP A;  2KDH A;  3TZ1 A;  1IJ6 A;  1DVI A;  1YVH A;  2JRF A;  1SL7 A;  1GGZ A;  1LA3 A;  1XFY O;  2EC6 C;  4OR9 B;  1KQV A;  2QPT A;  1BJF A;  2NXQ A;  3SG7 A;  5G08 A;  2WND A;  5IBW A;  2JT8 A;  3OHM B;  1CDN A;  1K93 D;  3CR2 A;  2L0P A;  3BUN B;  3O78 A;  1KCY A;  1A03 A;  3SG4 A;  3MSE B;  1B8L A;  2V53 A;  1J55 A;  1BT6 A;  3ICB A;  1QXP A;  1G8I A;  2K7B A;  4HRE E;  2OPO A;  4AOM A;  1NPQ A;  3KO0 A;  1QVI Y;  4P5O E;  3DF0 B;  1XK4 C;  4YGB B;  2KFF A;  2LAP A;  1AJ4 A;  3EVV A;  3O6B A;  1CFF A;  3DF0 A;  2GV5 A;  4R1E A;  4BY4 A;  1RTP 1;  1UUS A;  3TDI A;  1BR1 B;  3PAT A;  3O4Y A;  5DKQ A;  1HT9 A;  1KFX S;  3OP0 A;  2ZRS A;  3I5G B;  4MZJ A;  2AMI A;  2LVI A;  1S26 D;  1K9K A;  3CGA A;  4FQO A;  4CID A;  3CLN A;  3C1V A;  1SRA A;  1JSA A;  5AAN A;  2M9G A;  1XA5 A;  2K61 A;  2FOT A;  3D10 A;  3OX6 A;  4YRU A;  1NCZ A;  2BL0 B;  1QIW A;  1SR6 B;  3CR5 X;  2K2A A;  1SCV A;  1YUS A;  1IQ5 A;  4BY5 A;  1YUT A;  2LP3 A;  1WRK A;  2M7N A;  1EJ3 A;  4HRG A;  1IQ3 A;  4C0J A;  2AUC A;  3WXA A;  1F8H A;  2OTG C;  4M2P A;  5CSI A;  1SY9 A;  2OS8 B;  1JWD A;  2K0J A;  3K21 A;  5J3X A;  2FJU B;  1B7T Y;  4M2Q A;  4QJ5 B;  1TNX A;  1B4C A;  3EKH A;  1M45 A;  1MR8 A;  2KGR A;  3HCM A;  1ODB A;  4PE1 A;  3OX5 A;  1XVJ A;  1JFK A;  2LMT A;  2F3Z A;  1QVI Z;  1UP5 A;  1C7V A;  3BUM B;  4Q04 A;  2JUL A;  4GGF C;  1ZOT B;  1M31 A;  1F54 A;  4I5K A;  4PAL A;  1OMV A;  3OB1 B;  1NUB A;  3O2P A;  3VGO A;  1AHR A;  3QRX A;  2JNX A;  5AER A;  1CFD A;  2G2B A;  2WOR A;  2PAS A;  3BYA A;  2I18 A;  1GQM A;  1CM1 A;  2F8P A;  1DJH A;  1S1E A;  2LLS A;  3VRR A;  3TUY C;  1Y1U A;  2BCA A;  3FS7 A;  2LCP A;  3CTN A;  2TN4 A;  1EG3 A;  5I8N A;  1WLM A;  1DTL A;  2JXC A;  1YRU B;  2NCO A;  5CSJ A;  3VRN A;  1OSA A;  1U5I A;  2LE9 B;  4GFT A;  2Y4Q A;  1TNW A;  2KYC A;  2JQ6 A;  3TS5 B;  3DVJ A;  1BOD A;  1KFX L;  3KEV A;  4MRX A;  4NDC A;  1TCO B;  1EXR A;  1XFU O;  3ZWH A;  2BBM A;  1SR6 C;  3RM1 A;  4WQ3 A;  1PRW A;  2Q91 A;  1XFZ O;  2LLU A;  2WCB A;  3D0Y A;  3NXA A;  2KNE A;  1YUR A;  1A29 A;  2M8U A;  1E8A A;  3BQ3 A;  1XFW O;  1B8C A;  1S6J A;  1PSB A;  5HKZ A;  4NDB A;  1K2H A;  2K7O A;  1NSH A;  1OMR A;  1MXE A;  1J7P A;  3IF7 A;  2M3W A;  3TDZ A;  1SPY A;  1FW4 A;  2BEC A;  1IG5 A;  1K8U A;  2HF5 A;  1TCF A;  1ZUZ A;  2O5G A;  3A8R A;  1JF2 A;  3ZNI A;  1J7Q A;  3F45 A;  1DGU A;  2K7C A;  5JOL A;  3VRP A;  3EKJ A;  5JJG A;  1PK0 D;  2KSP A;  2Y1M A;  4I5L B;  2SAS A;  4QJ3 B;  1LXF C;  3OB2 B;  2MHH A;  1L2O C;  2ZND A;  5ER5 A;  5KU1 A;  1KFU L;  3NSO A;  2FCE A;  1Y0V H;  2CBL A;  2OS8 C;  3PN7 C;  1BLQ A;  2R2I A;  1TNQ A;  1YRT B;  2LAN A;  2LLT A;  2F2P A;  1RRO A;  4XJK B;  1XFX O;  1KFU S;  3DVE A;  3M0W A;  4NDD A;  4PE7 A;  1ALW A;  4OCI A;  1CDM A;  2Y1N A;  3JTD B;  4DRW A;  1CM4 A;  1CNP A;  2PVB A;  1CDP A;  4MVF A;  1WRL A;  2LV7 A;  2I7A A;  2BCB A;  1TNP A;  1JBA A;  1YUU A;  1OMD A;  3LLE A;  4PCW A;  2LNK A;  1DJG A;  2LHI A;  4YGD B;  5AFP A;  1EL4 A;  2JZI A;  2KAV A;  3A4U B;  3AKB A;  2JT0 A;  3EVR A;  4NQG A;  3SG6 A;  4YI8 A;  2M1K B;  2LVV A;  1ALV A;  1M39 A;  3CS1 A;  1OZS A;  5ER4 X;  4YGE B;  1EH2 A;  3I5G C;  1FI5 A;  3H4S E;  2CT9 A;  2ZN9 A;  1U5I B;  1QX2 A;  3GOF A;  2KOT A;  5PAL A;  4YBH B;  1PVB A;  1WLZ A;  2WCF A;  3CR4 X;  3BOW A;  1FF1 A;  2CNP A;  2JT3 A;  1CTR A;  2H61 A;  2MAZ A;  4MZL A;  1S6C A;  4WQ2 A;  1QV0 A;  5TNC A;  2L2E A;  3CWG A;  4XYN A;  2KYF A;  4PHK A;  2H2K A;  4PHM A;  4JWQ A;  3LK1 A;  2L50 A;  1UHI A;  3RLZ A;  1F4Q A;  4A4B A;  5BPJ A;  1SKT A;  1CLL A;  4JQ0 D;  5CSF A;  4A4C A;  2BKI B;  3DVK A;  1ZMZ A;  1G33 A;  2SCP A;  1B7T Z;  2EC6 B;  2KAX A;  2KI6 C;  3PAL A;  1TOP A;  4GUK A;  2JOJ A;  3I5H B;  1NX3 A;  1S3P A;  4GPL B;  1MWN A;  1H8B A;  3WHT B;  2HQW A;  2BE6 A;  1M63 B;  2COL B;  3FIA A;  1OE9 B;  2JWW A;  3JTD C;  1QTX A;  1DGV A;  3PM8 A;  3I5H C;  2DOQ A;  4ORC B;  4YI9 A;  3BUO B;  2KFG A;  2LVK A;  1KSO A;  1LIN A;  1R2U A;  2HPS A;  2I2R E;  1S5G Z;  4ORA B;  3BOW B;  1B1G A;  1IKU A;  1QLS A;  1YR5 A;  2FCD A;  2L4H A;  4ZCU A;  2BE4 A;  1BF5 A;  1Q80 A;  4USL A;  1L2O B;  2P6B B;  2KHN A;  1OOJ A;  1KK7 Y;  1XK4 A;  1SBJ A;  2BBN A;  2I94 A;  1DJW A;  1AP4 A;  5K89 A;  1KQM B;  3I5F B;  1H4B A;  3HX4 A;  1X02 A;  1WY9 A;  1NYA A;  5I2O A;  4PHN A;  4ORB B;  2CTN A;  1G4Y R;  1Y6W A;  2KAY A;  1AUI B;  2QAC A;  5AEQ A;  3FWB A;  2E30 A;  1V1F A;  1CB1 A;  3JVT C;  4MN0 A;  1S6I A;  2MLF C;  3IQQ A;  1DF0 A;  1K95 A;  2IS9 A;  5KSZ A;  1KK8 B;  1Y1A A;  1IWQ A;  3LCP C;  1FI6 A;  1WRZ A;  4I5J A;  1QAT A;  1NX0 A;  3SG2 A;  2HQ8 A;  1J7O A;  1YTZ C;  2WC8 A;  2JTT A;  4U8D A;  2LC5 A;  1A75 B;  1QLK A;  1UHH A;  2LM5 A;  2KFH A;  4YGC B;  5HLO A;  2JTZ A;  1CMF A;  4HSZ A;  5KTY A;  2LHL A;  1K90 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...