1F4OA

Crystal structure of grancalcin with bound calcium
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
165
structure length
165
Chain Sequence
SVYTYFSAVAGQDGEVDAEELQRCLTQSGINGTYSPFSLETCRIMIAMLDRDHTGKMGFNAFKELWAALNAWKENFMTVDQDGSGTVEHHELRQAIGLMGYRLSPQTLTTIVKRYSKNGRIFFDDYVACCVKLRALTDFFKKRDHLQQGSADFIYDDFLQGTMAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords GRANCALCIN
publication title Crystal structure of human grancalcin, a member of the penta-EF-hand protein family.
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1f4oA00
1YUUA 1M46A 1BR4B 1SPYA 1NYAA 4PDZA 1FI5A 5CSJA 1CDMA 1LVCD 2ZRTA 2M97A 4CFQA 1PSBA 4YGDB 4P2YB 3NXAA 2TN4A 2P6BB 1B8LA 3TS5C 2KAYA 2JC2A 2K7BA 2KYFA 2WCBA 5TNCA 1BG1A 3O78A 2A4JA 2CT9A 3BQ3A 4NDCA 4YGCB 2AAOA 4N1GA 2E6WA 1K93D 3FS7A 3NSKA 1XO5A 3RLZA 5BPJA 1UHNA 4N5XA 1B8RA 2HPSA 2ISDA 5I2QA 1KK7Y 1H8BA 1OZOA 2K2AA 1IJ6A 3OB1B 4M2PA 5CSFA 1CDNA 1PRWA 1Q80A 4R1EA 1DJXA 1QVIZ 2K2FA 3CGAA 4MLWA 5CPVA 3DVJA 1YVHA 2EC6C 1M39A 1XFXO 3GK2A 1Y1XA 1OSAA 1SMGA 3C1VA 2M1KB 2JT3A 3KF9A 2F2PA 1B7TZ 3BYAA 4DUQA 3OX6A 1YR5A 4ORCB 4YI8A 5KTYA 1QIWA 1WDCC 1ODBA 4GGFC 4GGNA 1PVBA 1RFJA 4MZKA 2PASA 5KU1A 4MBEA 3SG7A 3EK4A 1GQMA 1L7ZA 1DJWA 1Y0VH 2FOTA 2L0PA 1QS7A 1F71A 3DF0B 4IL1A 5AERA 4A4BA 1KQMB 2LHLA 1L2OB 2GGZA 5GQQC 2G9BA 3H4SE 4HSZA 1NP8A 1VRKA 4HREE 4WQ2A 1KFXL 2KGBC 5ER4X 1TIZA 2K7CA 4DS7A 1PSRA 1JFKA 2LP3A 1BF5A 1TTXA 3FIAA 1BODA 4YGEB 1WLZA 3I5FB 1NWDA 1EL4A 2F3YA 4GAOA 4GFTA 4YI9A 3VROA 1K90D 1KSOA 2L98A 2WCFA 1WRKA 2Y4QA 3VRNA 4GGFA 2V53A 1YX8A 1SCMC 4MVFA 1H4BA 3M0WA 2KBMA 1XFUO 3SIAA 3K21A 1JF2A 1W7JB 4YGAA 2SCPA 3NSLA 2NLNA 4MZLA 3KEVA 2K7DA 4PHKA 1JC2A 1QATA 1CM1A 1EG3A 5K89A 2L4IA 3BXKA 4ORBB 1QV0A 1AVSA 2O60A 2KI4B 1EJ3A 2LANA 1FPWA 3WNXB 1U5IB 1SYMA 2L51A 3SG2A 4C0KA 1G33A 1KWOC 1QX5B 4JQ0D 2QACA 2GGMA 1DF0A 2M9GA 3EKHA 1DVIA 2BECA 2KBIA 1LXFC 1IQ3A 2F33A 1FI6A 4WRIA 2M49B 1TNWA 4QJ3B 2MA2A 3HCMA 3AAJA 4DRWA 2L5XB 2ZNEA 1M45A 1TRFA 2BKIB 1CM4A 3BUNB 2IS9A 4PE4A 1NSHA 2JPTA 4MZJA 1ZOTB 2LM5A 3LK1A 2LMUA 2JT0A 1IQ5A 3D10A 1S5GY 4MRYA 1HT9A 4MRXA 1SNLA 3D0YB 1YRUB 2WCEA 2K61A 2Y1NA 1A4PA 1XFWO 2CCMA 5J3XA 5DKRA 2RGIA 3IF7A 3EVVA 2PRUA 3DVEA 1M63B 1D1OA 1R6PA 5F6TA 1SL8A 1XVJA 5CSIA 1S6JA 1Y1AA 2JOJA 2KFHA 4XJKB 1DT7B 1J7QA 4FQOA 4NQGA 3PSRA 1JUOA 2BCAA 4PHNA 1L2OC 1DJHA 2F8PA 1SKTA 1NPQA 2KSPA 3O4YA 4TNCA 1IRJA 2I94A 3LK0A 4ETOA 4JPZB 5D69A 1CKKA 1JF0A 4D1EA 2M3WA 1FW4A 1YURA 2KFFA 1XA5A 2LHIA 1CFCA 3I5FC 1S26D 3NSOA 3SG6A 1RJVA 1GJYA 4ZCVA 3VGOA 4YRUA 1Y1UA 3EKJA 2CBLA 4NDBA 2H61A 2MLEC 1YRTB 2OS8B 3TDZA 1CLMA 2JTTA 1PK0D 2LAPA 2OTGC 1ZACA 2JZIA 4I5LB 3GOFA 1WLMA 2KYCA 4UPGA 1J7RA 1IG5A 1LA0A 3SG5A 2KQYA 2SASA 1K9UA 3FWBA 2L2EA 3DF0A 1PALA 3NSIA 4USLA 2KI4C 4GPLB 4I5JA 1LKJA 5JJGA 3JTDB 1NCXA 1QVIY 1SL9A 2CTNA 2I2RE 1BU3A 3MSEB 2K8MB 3CLNA 1BOCA 1QXPA 1RWYA 3CTNA 1TCOB 1K8UA 3AKBA 1KK7Z 1R2UA 2MAZA 3PFVA 2M1UA 1G4YR 2G2BA 4I5NB 2E30A 1S1EA 3SJSA 1KFUL 3PN7B 1MHOA 1J55A 1AK8A 1BLQA 4CIDA 1CFPA 2JULA 1GGZA 4AQJA 1KK8B 1SBJA 2BBMA 3E3RA 2LUCA 4GUKA 4BY4A 1SR6B 1QIVA 1A75A 1LINA 1ALWA 5FYXA 2NCOA 1EH2A 1B47A 1K95A 1J7OA 1F70A 3O2PA 1OQPA 1BMOA 1MXLC 4P5OE 1FF1A 3F45A 1HQVA 2ZFDA 1A29A 1U5IA 2F2OA 1SK6D 4YGBB 5I2OA 1AHRA 1ALVA 2LP2A 2R2IA 1WRLA 1NIWA 4BY5A 1IGVA 2KGRA 1QX7A 2I18A 1IKUA 3PATA 2JNXA 2HF5A 2DOQA 1J1EA 2QPTA 5KSZA 1CLBA 2EGDA 2WNDA 3CR4X 3I5GB 2M8UA 1BJFA 1MF8B 1S36A 1IWQA 3KO0A 1CB1A 2LLTA 1A75B 1BT6A 1NX1A 1RTP1 2Q4UA 3CR5X 1OOJA 2M0RA 1QLKA 2JU0A 1S6IA 1TNXA 2KI6C 2H2KA 4OVNF 3PM8A 2MJWB 1X02A 1CNPA 1DJGA 1OMDA 5D7FA 3D0YA 2I7AA 1MXEA 3OX5A 2KNEA 1RECA 2JWWA 2K7OA 3EK7A 1N0YA 2K0JA 2OS8C 1B1GA 1CFFA 3FWCA 1W7IB 1DGVA 4PHMA 3BOWB 4QJ5B 1E8AA 1K96A 3EVRA 1N65A 1A03A 4JWQA 3GK1A 2NCPA 1S6CA 4U8DA 4XJKA 3ZNIA 2L4HA 2NXQA 4DIRA 1DMOA 1K9KA 4AOMA 2ZN9A 4F0ZB 1UWOA 1CLLA 1QV1A 1KSMA 1B4CA 2JRFA 2VRGA 1CDLA 2JTZA 2MLFC 1TNQA 1CMFA 4PE7A 3DVMA 3WHUB 2CNPA 2LLSA 2BKHB 2H61C 2Q91A 4WQ3A 4XYNA 4QJ4B 1GGWA 3PN7C 1YTZC 1OMRA 3TDUA 3RM1A 1CDPA 4ZCUA 1SW8A 5DKNA 3I5HB 2LCPA 2CXJA 5IBWA 1KK8C 2KFGA 2PMYA 1NCYA 3IQQA 1F4QA 1SR6C 1SY9A 1XK4C 4PHJA 4DCKA 3LCPC 2PALA 1KQMC 3BUMB 1WY9A 2WC8A 2ZRSA 1KCYA 3KHEA 3O6BA 2FCDA 2JNFA 5ER5A 3OB2B 1NUBA 1KFXS 4PCWA 1JBAA 3CS1A 1NX3A 1DTLA 2COLB 2KI6D 2KDHA 4FTGA 2LVVA 1F55A 2WORA 1NCZA 3A8RA 1UUSA 4A4CA 4CLNA 3TDIA 1XFYO 1KQVA 1B9AA 3AKAA 5HLVA 5CSNA 4MEWA 2O5GA 5G08A 4C0LA 1AP4A 3IQOA 1ZFSA 3I5IB 3JVTB 1DJIA 1TN4A 3PALA 2JT8A 1XK4A 4GNKB 2BBNA 5I2LA 1DJZA 5AXIA 1BR1B 1DGUA 2KQ6A 3SIBA 1QTXA 1PVAA 1KWOB 2HETA 2KAVA 3CZTX 1YUTA 1MUXA 2LMVA 1AJ5A 1V1FA 3SG4A 2B1UA 4ORAB 2BCBA 2OPOA 1B7TY 1UHHA 1NX0A 1YX7A 3BUWB 1IH0A 2WOSA 4MSPA 1LA3A 2BL0B 2KOTA 2HQWA 2LE9B 3PLFB 2ZN8A 1OMVA 1FBVA 5AEQA 3BUXB 3CR2A 4MN0A 1XFZO 3KPXA 1CFDA 2BCXA 5B8IB 1A2XA 1J1DA 1MWNA 3AAKA 3BUOB 4PE0A 2PSRA 3LL8B 2PVBA 1UURA 1IJ5A 3DVKA 2M7NA 2LUXA 2GV5A 5I8NA 5HKWA 4E68A 1AUIB 2LNKA 3I5HC 1F8HA 2M29A 1EXRA 1QX2A 1UHKA 2ZNDA 3ZWHA 5AFPA 4OR9B 3BOWA 2ZKMX 2LC5A 1CMGA 1UP5A 3TUYB 4PALA 1Y6WA 1B8CA 5PALA 5HYDA 5JOLA 1J7PA 1NX2A 2L50A 1ZMZA 1YUSA 1TCFA 2LVKA 5HKZA 2Y1MA 5HLOA 4C0JA 1DJYA 1QASA 1K9PA 4L9MA 3WHTB 3EK8A 3TS5B 3VRRA 4GBAA 1CTRA 4YBHB 1PULA 2AUCA 2FCEA 3VRPA 1RROA 4CPVA 4AQIA 2OTGB 1XFVO 3DD4A 1C7WA 1YVLA 3SG3A 1N2DA 3QRXA 1G8IA 3I5IC 3JVTC 5AANA 1JSAA 2EC6B 3JTDC 2KHNA 1RK9A 4N1FA 2NZ0A 4CFRA 1SRAA 2BE4A 4Q04A 1UHIA 2EHBA 5HKYA 2MHHA 3CWGA 1JFJA 1WRZA 1V1GA 4ICBA 3A4UB 2LLUA 1SL7A 1WDCB 1XYDA 2BE6A 1K2HA 2D8NA 1SCVA 4I5KA 3LLEA 4OV2A 1JWDA 2FJUB 2M7LA 2BL0C 2JXCA 2LV7A 2Y5IA 2HQ8A 1KFUS 3HX4A 3WXAA 2KAXA 1ZUZA 3OHMB 4HRGA 1QLSA 1UHJA 1C7VA 1S5GZ 3ICBA 3OP0A 4OKHA 1M31A 2F3ZA 2JQ6A 4OCIA 1S3PA 3VRQA 1AJ4A 1QJTA 2JXLA 1OE9B 1OZSA 1F4OA 1C07A 2LVJA 2MRDA 1EG4A 3TZ1A 1DF0B 4PE1A 1MR8A 1TOPA 4NDDA 1TNPA 3EVUA 3GK4X 2LMTA 4M2OA 2LVIA 1F54A 1MQ1A 4M2QA 1SCMB 1K94A 3I5GC 4HRHA 5DKQA 2AMIA 2MBXA 3TUYC
chains in the Genus database with same CATH superfamily
1YUUA 1M46A 1BR4B 1SPYA 1NYAA 4PDZA 1FI5A 5CSJA 1CDMA 1LVCD 1C3ZA 2ZRTA 2M97A 4CFQA 1PSBA 4YGDB 4P2YB 3NXAA 2TN4A 1DC1A 2P6BB 1B8LA 3TS5C 2KAYA 2JC2A 2K7BA 2KYFA 2WCBA 5TNCA 1BG1A 3O78A 2A4JA 2CT9A 3BQ3A 3FE6A 4NDCA 4YGCB 2AAOA 4N1GA 2E6WA 1K93D 3FS7A 3NSKA 1XO5A 3RLZA 1GM0A 5BPJA 1UHNA 4N5XA 1B8RA 2HPSA 2ISDA 5I2QA 1KK7Y 1H8BA 3NHTA 1OZOA 2K2AA 1IJ6A 3OB1B 2K60A 3R72A 4M2PA 5CSFA 1CDNA 1PRWA 1Q80A 4R1EA 1DELA 1DJXA 1QVIZ 1TUJA 2K2FA 3CGAA 2WCKA 4MLWA 5CPVA 3DVJA 1YVHA 2EC6C 1M39A 1XFXO 3CYZA 3GK2A 3CABA 3B86A 1Y1XA 3CZ0A 1OSAA 1SMGA 3C1VA 2M1KB 3R1PA 2JT3A 3KF9A 2F2PA 1B7TZ 3BYAA 4DUQA 3OX6A 3S0FA 1YR5A 4ORCB 4YI8A 5KTYA 2WC5A 1QIWA 1WDCC 1ODBA 4GGFC 4GGNA 1PVBA 1RFJA 4MZKA 2PASA 5KU1A 4MBEA 3SG7A 3EK4A 3R1VA 1GQMA 1L7ZA 1DJWA 1Y0VH 2PYQA 2FOTA 2L0PA 1QS7A 1F71A 3DF0B 4IL1A 5AERA 4A4BA 1KQMB 2LHLA 1L2OB 2GGZA 5GQQC 2G9BA 3H4SE 4HSZA 2KLEA 1NP8A 4OZDA 1VRKA 4HREE 4WQ2A 1T14A 1KFXL 2KGBC 5ER4X 1TIZA 2K7CA 4DS7A 1PSRA 1JFKA 2LP3A 1BF5A 4F7FA 1TTXA 3FIAA 2H8VA 1BODA 4YGEB 1WLZA 4INXA 3RZSA 5D3OA 3I5FB 1NWDA 1EL4A 2F3YA 4GAOA 4GFTA 4YI9A 3VROA 1K90D 2QEOA 1KSOA 2L98A 2WCFA 1WRKA 2Y4QA 3VRNA 4GGFA 2V53A 1YX8A 1SCMC 4MVFA 1H4BA 3M0WA 2KBMA 1XFUO 3D78A 3K21A 1JF2A 1W7JB 4YGAA 3D75A 2SCPA 3PJIA 3NSLA 2NLNA 4MZLA 3KEVA 2K7DA 1OW4A 4PHKA 1JC2A 1QATA 1CM1A 1EG3A 5K89A 2L4IA 3BXKA 4ORBB 1QV0A 1AVSA 2O60A 2KI4B 1EJ3A 2LANA 1FPWA 3D73A 3WNXB 1U5IB 1SYMA 2L51A 3SG2A 4C0KA 2FJYA 1G33A 1KWOC 1QX5B 3R1OA 4JQ0D 2QACA 2GGMA 1DF0A 2M9GA 3EKHA 1DVIA 2BECA 2KBIA 1LXFC 5EL2A 1IQ3A 2F33A 1FI6A 4WRIA 2M49B 1TNWA 4QJ3B 2MA2A 3HCMA 3AAJA 4DRWA 2L5XB 2ZNEA 1M45A 1TRFA 2BKIB 1CM4A 3N7HA 4JKTA 3BUNB 2IS9A 4PE4A 2P70A 3K1EA 3FE8A 1NSHA 2JPTA 4MZJA 1ZOTB 2LM5A 3LK1A 2LMUA 2JT0A 1IQ5A 2KPHA 3D74A 3D10A 1S5GY 4MRYA 1HT9A 3OGNA 4MRXA 1SNLA 3D0YB 1YRUB 2WCEA 2K61A 2Y1NA 3NGVA 1A4PA 1XFWO 2CCMA 3QMEA 5J3XA 1SSEB 3BFHA 2RGIA 5DKRA 3IF7A 3EVVA 2PRUA 3DVEA 1M63B 1D1OA 1R6PA 5F6TA 1SL8A 1XVJA 5CSIA 3BFAA 1S6JA 1Y1AA 2JOJA 5FI7A 2KFHA 4XJKB 3L4AA 1DT7B 1J7QA 4FQOA 4NQGA 3PSRA 1JUOA 2BCAA 4PHNA 1L2OC 1DJHA 2F8PA 1SKTA 1NPQA 2KSPA 3O4YA 4TNCA 1IRJA 2I94A 3LK0A 4ETOA 4JPZB 5D69A 3D76A 1JF0A 1CKKA 4D1EA 2M3WA 5FI2A 1FW4A 1YURA 2KFFA 1XA5A 2LHIA 1CFCA 3I5FC 1S26D 3NSOA 3SG6A 1RJVA 1GJYA 4ZCVA 3VGOA 4YRUA 1OOHA 1Y1UA 3EKJA 2CBLA 4NDBA 2H61A 2MLEC 1YRTB 2OS8B 3TDZA 1CLMA 2JTTA 1PK0D 2LAPA 2OTGC 1ZACA 2JZIA 4I5LB 5HL1A 3GOFA 1WLMA 2KYCA 4UPGA 1J7RA 1IG5A 1LA0A 3SG5A 2KQYA 2SASA 1K9UA 3FWBA 2L2EA 5I94A 3DF0A 1PALA 3NSIA 4USLA 2KI4C 4GPLB 4I5JA 1LKJA 5JJGA 3JTDB 1NCXA 1QVIY 1SL9A 2CTNA 3OBVA 2I2RE 1BU3A 3MSEB 2K8MB 3CLNA 1BOCA 1QXPA 4JD9A 1RWYA 3CTNA 1TCOB 3SS3A 1OOGA 1K8UA 3AKBA 1KK7Z 1R2UA 2MAZA 3PFVA 2M1UA 3FE9A 1G4YR 2G2BA 4I5NB 2E30A 1S1EA 3L4LA 3VB1A 3SJSA 1KFUL 3CZ1A 1MHOA 1J55A 3PN7B 1AK8A 4CIDA 1BLQA 1CFPA 2JULA 1GGZA 4AQJA 1KK8B 1SBJA 2BBMA 3CZ2A 2LUCA 3E3RA 4GUKA 4BY4A 3CDNA 1SR6B 5FI6A 1QIVA 1A75A 1LINA 1ALWA 5FYXA 2NCOA 3DYEA 1EH2A 1B47A 1K95A 1J7OA 1F70A 3O2PA 1OQPA 3B7AA 1BMOA 1MXLC 4P5OE 1FF1A 3F45A 1HQVA 2ZFDA 1A29A 1U5IA 2F2OA 1SK6D 4FQTA 4YGBB 1XFRA 1AHRA 5I2OA 1DEKA 1ALVA 2LP2A 2R2IA 1WRLA 1NIWA 4BY5A 1IGVA 2KGRA 1QX7A 2I18A 1IKUA 3PATA 3UO9A 2BNXA 2HF5A 2JNXA 2DOQA 1J1EA 2QEHA 3DZTA 2QPTA 5KSZA 1CLBA 2EGDA 2WNDA 1Z2CB 3CR4X 3I5GB 2M8UA 3V2LA 1BJFA 1MF8B 1S36A 1IWQA 3KO0A 1CB1A 2LLTA 1A75B 1BT6A 1NX1A 1RTP1 1OOFA 2Q4UA 3CR5X 1OOJA 2M0RA 1QLKA 2JU0A 1S6IA 1TNXA 3S0AA 2KI6C 2H2KA 4OVNF 3PM8A 2MJWB 1X02A 1CNPA 1DJGA 2YGUA 3D77A 1OMDA 5D7FA 3D0YA 2I7AA 1MXEA 1P28A 2KNEA 1RECA 3OX5A 2JWWA 2WCJA 2K7OA 3EK7A 1N0YA 2K0JA 2OS8C 1B1GA 1CFFA 3FWCA 4INWA 1W7IB 3SIAA 1DGVA 4PHMA 3BOWB 4QJ5B 1E8AA 1K96A 3EVRA 1N65A 3B6XA 4JWQA 3GK1A 1A03A 2NCPA 1S6CA 4U8DA 4XJKA 3ZNIA 2L4HA 2NXQA 4DIRA 1DMOA 1K9KA 4AOMA 2ZN9A 4F0ZB 1UWOA 1CLLA 1QV1A 1KSMA 1B4CA 2JRFA 4IJ7A 2VRGA 1CDLA 2JTZA 2MLFC 1TNQA 1CMFA 4PE7A 3DVMA 3WHUB 2CNPA 2LLSA 2BKHB 2H61C 2Q91A 4WQ3A 4XYNA 4QJ4B 1GGWA 3PN7C 1YTZC 1OMRA 3TDUA 3RM1A 3SS5A 1CDPA 4ZCUA 1SW8A 5DKNA 3I5HB 2LCPA 2CXJA 5IBWA 1KK8C 1W9ZA 3O4XA 2KFGA 2PMYA 1C3YA 1NCYA 3IQQA 1F4QA 1SR6C 1SY9A 1XK4C 4PHJA 4DCKA 3LCPC 2PALA 1KQMC 3BUMB 1WY9A 1Z4HA 2WC8A 2ZRSA 1KCYA 3KHEA 3O6BA 2FCDA 2JNFA 5ER5A 3OB2B 1NUBA 3DY9A 1KFXS 4PCWA 1JBAA 3CS1A 3B88A 1NX3A 1DTLA 2BAPA 2COLB 2KI6D 2KDHA 4FTGA 2LVVA 1F55A 2WORA 3B87A 1NCZA 3A8RA 3S0DA 1UUSA 4A4CA 2GTEA 4CLNA 3TDIA 1XFYO 3UNWA 1B9AA 1KQVA 2WCMA 3AKAA 5HLVA 5CSNA 4MEWA 2O5GA 5G08A 4C0LA 1AP4A 3IQOA 1ZFSA 5DICA 3I5IB 3JVTB 1DJIA 1TN4A 3PALA 2JT8A 1XK4A 4GNKB 2BBNA 5I2LA 1DJZA 5AXIA 1BR1B 1DGUA 2KQ6A 3SIBA 1QTXA 1PVAA 1KWOB 2HETA 2KAVA 3CZTX 1YUTA 1MUXA 2LMVA 1AJ5A 1V1FA 3SG4A 2B1UA 4ORAB 2BCBA 2OPOA 1B7TY 2JPOA 1UHHA 1NX0A 1YX7A 3BUWB 2WC6A 1IH0A 2WOSA 4MSPA 1LA3A 2BL0B 2KOTA 2HQWA 2LE9B 3PLFB 2ZN8A 2PQLA 1OMVA 1FBVA 5AEQA 3BUXB 3CR2A 4MN0A 1XFZO 3KPXA 1CFDA 2BCXA 5B8IB 1A2XA 1J1DA 1MWNA 3AAKA 3BUOB 4PE0A 2PSRA 3LL8B 2PVBA 1OOIX 1UURA 1IJ5A 3DVKA 2M7NA 2P71A 3EG5B 1ORGA 2LUXA 2GV5A 2WCLA 5I8NA 5HKWA 4E68A 1AUIB 2LNKA 3I5HC 1F8HA 2WCHA 2M29A 1EXRA 1QX2A 1UHKA 2ZNDA 3ZWHA 5AFPA 4OR9B 3SS4A 3BFBA 3BOWA 2ZKMX 2LC5A 3BJHA 1CMGA 1UP5A 3TUYB 4PALA 1Y6WA 1B8CA 5PALA 5HYDA 5JOLA 1J7PA 1NX2A 2L50A 1ZMZA 2KLDA 1YUSA 1TCFA 2LVKA 5HKZA 2QDIA 2Y1MA 3S0BA 5HLOA 4C0JA 1DJYA 1QASA 1K9PA 2L2CA 4L9MA 4PT1A 3WHTB 3EK8A 3TS5B 3VRRA 4GBAA 1CTRA 4YBHB 1PULA 2AUCA 2FCEA 4KYNA 3VRPA 1DQEA 1RROA 3S0EA 4CPVA 4AQIA 2OTGB 1XFVO 1QWVA 3DD4A 3DXLA 1C7WA 1YVLA 1TWOA 3SG3A 1N2DA 3QRXA 1G8IA 3I5IC 3JVTC 5AANA 1JSAA 2EC6B 3JTDC 2KHNA 1RK9A 4N1FA 2QEBA 3S0GA 2NZ0A 4CFRA 1SRAA 2BE4A 4Q04A 3Q8IA 1UHIA 3L47A 2EHBA 5HKYA 1TUZA 3PM2A 2MHHA 3CWGA 1JFJA 1WRZA 1V1GA 4ICBA 3A4UB 2ERBA 1SL7A 2LLUA 1WDCB 1XYDA 3NHIA 2BE6A 1K2HA 2D8NA 1SCVA 2L5YA 4I5KA 3LLEA 4OV2A 1JWDA 2FJUB 2M7LA 2BL0C 2JXCA 2LV7A 2Y5IA 2HQ8A 1KFUS 3HX4A 3WXAA 2KAXA 1ZUZA 3OHMB 4HRGA 1QLSA 1UHJA 3IVTA 1C7VA 1S5GZ 3ICBA 3OP0A 4OKHA 1M31A 2F3ZA 2JQ6A 4OCIA 1S3PA 3VRQA 1AJ4A 1QJTA 2JXLA 1OE9B 1OZSA 1F4OA 1C07A 2LVJA 2MRDA 1EG4A 2QEVA 3TZ1A 1DF0B 4PE1A 1MR8A 1TOPA 1LS8A 4NDDA 1TNPA 3EVUA 3GK4X 2LMTA 4M2OA 2LVIA 1F54A 1MQ1A 4M2QA 1SCMB 1IIOA 1K94A 3I5GC 4HRHA 5DKQA 2AMIA 2MBXA 3TUYC
chains in the Genus database with same CATH topology
1YUUA 1M46A 1BR4B 1SPYA 1NYAA 4PDZA 1FI5A 5CSJA 1CDMA 1LVCD 2ZRTA 2M97A 4CFQA 1PSBA 4YGDB 4P2YB 3NXAA 2TN4A 2P6BB 1B8LA 3TS5C 2KAYA 2JC2A 2K7BA 2KYFA 2WCBA 5TNCA 1BG1A 3O78A 2A4JA 2CT9A 3BQ3A 4NDCA 4YGCB 2AAOA 4N1GA 2E6WA 1K93D 3FS7A 3NSKA 1XO5A 3RLZA 5BPJA 1UHNA 4N5XA 1B8RA 2HPSA 2ISDA 5I2QA 1KK7Y 1H8BA 1OZOA 2K2AA 1IJ6A 3OB1B 4M2PA 5CSFA 1CDNA 1PRWA 1Q80A 4R1EA 1DJXA 1QVIZ 2K2FA 3CGAA 4MLWA 5CPVA 3DVJA 1YVHA 2EC6C 1M39A 1XFXO 3GK2A 1Y1XA 1OSAA 1SMGA 3C1VA 2M1KB 2JT3A 3KF9A 2F2PA 1B7TZ 3BYAA 4DUQA 3OX6A 1YR5A 4ORCB 4YI8A 5KTYA 1QIWA 1WDCC 1ODBA 4GGFC 4GGNA 1PVBA 1RFJA 4MZKA 2PASA 5KU1A 4MBEA 3SG7A 3EK4A 1GQMA 1L7ZA 1DJWA 1Y0VH 2FOTA 2L0PA 1QS7A 1F71A 3DF0B 4IL1A 5AERA 4A4BA 1KQMB 2LHLA 1L2OB 2GGZA 5GQQC 2G9BA 3H4SE 4HSZA 1NP8A 1VRKA 4HREE 4WQ2A 1KFXL 2KGBC 5ER4X 1TIZA 2K7CA 4DS7A 1PSRA 1JFKA 2LP3A 1BF5A 1TTXA 3FIAA 1BODA 4YGEB 1WLZA 3I5FB 1NWDA 1EL4A 2F3YA 4GAOA 4GFTA 4YI9A 3VROA 1K90D 1KSOA 2L98A 2WCFA 1WRKA 2Y4QA 3VRNA 4GGFA 2V53A 1YX8A 1SCMC 4MVFA 1H4BA 3M0WA 2KBMA 1XFUO 3SIAA 3K21A 1JF2A 1W7JB 4YGAA 2SCPA 3NSLA 2NLNA 4MZLA 3KEVA 2K7DA 4PHKA 1JC2A 1QATA 1CM1A 1EG3A 5K89A 2L4IA 3BXKA 4ORBB 1QV0A 1AVSA 2O60A 2KI4B 1EJ3A 2LANA 1FPWA 3WNXB 1U5IB 1SYMA 2L51A 3SG2A 4C0KA 1G33A 1KWOC 1QX5B 4JQ0D 2QACA 2GGMA 1DF0A 2M9GA 3EKHA 1DVIA 2BECA 2KBIA 1LXFC 1IQ3A 2F33A 1FI6A 4WRIA 2M49B 1TNWA 4QJ3B 2MA2A 3HCMA 3AAJA 4DRWA 2L5XB 2ZNEA 1M45A 1TRFA 2BKIB 1CM4A 3BUNB 2IS9A 4PE4A 1NSHA 2JPTA 4MZJA 1ZOTB 2LM5A 3LK1A 2LMUA 2JT0A 1IQ5A 3D10A 1S5GY 4MRYA 1HT9A 4MRXA 1SNLA 3D0YB 1YRUB 2WCEA 2K61A 2Y1NA 1A4PA 1XFWO 2CCMA 5J3XA 5DKRA 2RGIA 3IF7A 3EVVA 2PRUA 3DVEA 1M63B 1D1OA 1R6PA 5F6TA 1SL8A 1XVJA 5CSIA 1S6JA 1Y1AA 2JOJA 2KFHA 4XJKB 1DT7B 1J7QA 4FQOA 4NQGA 3PSRA 1JUOA 2BCAA 4PHNA 1L2OC 1DJHA 2F8PA 1SKTA 1NPQA 2KSPA 3O4YA 4TNCA 1IRJA 2I94A 3LK0A 4ETOA 4JPZB 5D69A 1CKKA 1JF0A 4D1EA 2M3WA 1FW4A 1YURA 2KFFA 1XA5A 2LHIA 1CFCA 3I5FC 1S26D 3NSOA 3SG6A 1RJVA 1GJYA 4ZCVA 3VGOA 4YRUA 1Y1UA 3EKJA 2CBLA 4NDBA 2H61A 2MLEC 1YRTB 2OS8B 3TDZA 1CLMA 2JTTA 1PK0D 2LAPA 2OTGC 1ZACA 2JZIA 4I5LB 3GOFA 1WLMA 2KYCA 4UPGA 1J7RA 1IG5A 1LA0A 3SG5A 2KQYA 2SASA 1K9UA 3FWBA 2L2EA 3DF0A 1PALA 3NSIA 4USLA 2KI4C 4GPLB 4I5JA 1LKJA 5JJGA 3JTDB 1NCXA 1QVIY 1SL9A 2CTNA 2I2RE 1BU3A 3MSEB 2K8MB 3CLNA 1BOCA 1QXPA 1RWYA 3CTNA 1TCOB 1K8UA 3AKBA 1KK7Z 1R2UA 2MAZA 3PFVA 2M1UA 1G4YR 2G2BA 4I5NB 2E30A 1S1EA 3SJSA 1KFUL 3PN7B 1MHOA 1J55A 1AK8A 1BLQA 4CIDA 1CFPA 2JULA 1GGZA 4AQJA 1KK8B 1SBJA 2BBMA 3E3RA 2LUCA 4GUKA 4BY4A 1SR6B 1QIVA 1A75A 1LINA 1ALWA 5FYXA 2NCOA 1EH2A 1B47A 1K95A 1J7OA 1F70A 3O2PA 1OQPA 1BMOA 1MXLC 4P5OE 1FF1A 3F45A 1HQVA 2ZFDA 1A29A 1U5IA 2F2OA 1SK6D 4YGBB 5I2OA 1AHRA 1ALVA 2LP2A 2R2IA 1WRLA 1NIWA 4BY5A 1IGVA 2KGRA 1QX7A 2I18A 1IKUA 3PATA 2JNXA 2HF5A 2DOQA 1J1EA 2QPTA 5KSZA 1CLBA 2EGDA 2WNDA 3CR4X 3I5GB 2M8UA 1BJFA 1MF8B 1S36A 1IWQA 3KO0A 1CB1A 2LLTA 1A75B 1BT6A 1NX1A 1RTP1 2Q4UA 3CR5X 1OOJA 2M0RA 1QLKA 2JU0A 1S6IA 1TNXA 2KI6C 2H2KA 4OVNF 3PM8A 2MJWB 1X02A 1CNPA 1DJGA 1OMDA 5D7FA 3D0YA 2I7AA 1MXEA 3OX5A 2KNEA 1RECA 2JWWA 2K7OA 3EK7A 1N0YA 2K0JA 2OS8C 1B1GA 1CFFA 3FWCA 1W7IB 1DGVA 4PHMA 3BOWB 4QJ5B 1E8AA 1K96A 3EVRA 1N65A 1A03A 4JWQA 3GK1A 2NCPA 1S6CA 4U8DA 4XJKA 3ZNIA 2L4HA 2NXQA 4DIRA 1DMOA 1K9KA 4AOMA 2ZN9A 4F0ZB 1UWOA 1CLLA 1QV1A 1KSMA 1B4CA 2JRFA 2VRGA 1CDLA 2JTZA 2MLFC 1TNQA 1CMFA 4PE7A 3DVMA 3WHUB 2CNPA 2LLSA 2BKHB 2H61C 2Q91A 4WQ3A 4XYNA 4QJ4B 1GGWA 3PN7C 1YTZC 1OMRA 3TDUA 3RM1A 1CDPA 4ZCUA 1SW8A 5DKNA 3I5HB 2LCPA 2CXJA 5IBWA 1KK8C 2KFGA 2PMYA 1NCYA 3IQQA 1F4QA 1SR6C 1SY9A 1XK4C 4PHJA 4DCKA 3LCPC 2PALA 1KQMC 3BUMB 1WY9A 2WC8A 2ZRSA 1KCYA 3KHEA 3O6BA 2FCDA 2JNFA 5ER5A 3OB2B 1NUBA 1KFXS 4PCWA 1JBAA 3CS1A 1NX3A 1DTLA 2COLB 2KI6D 2KDHA 4FTGA 2LVVA 1F55A 2WORA 1NCZA 3A8RA 1UUSA 4A4CA 4CLNA 3TDIA 1XFYO 1KQVA 1B9AA 3AKAA 5HLVA 5CSNA 4MEWA 2O5GA 5G08A 4C0LA 1AP4A 3IQOA 1ZFSA 3I5IB 3JVTB 1DJIA 1TN4A 3PALA 2JT8A 1XK4A 4GNKB 2BBNA 5I2LA 1DJZA 5AXIA 1BR1B 1DGUA 2KQ6A 3SIBA 1QTXA 1PVAA 1KWOB 2HETA 2KAVA 3CZTX 1YUTA 1MUXA 2LMVA 1AJ5A 1V1FA 3SG4A 2B1UA 4ORAB 2BCBA 2OPOA 1B7TY 1UHHA 1NX0A 1YX7A 3BUWB 1IH0A 2WOSA 4MSPA 1LA3A 2BL0B 2KOTA 2HQWA 2LE9B 3PLFB 2ZN8A 1OMVA 1FBVA 5AEQA 3BUXB 3CR2A 4MN0A 1XFZO 3KPXA 1CFDA 2BCXA 5B8IB 1A2XA 1J1DA 1MWNA 3AAKA 3BUOB 4PE0A 2PSRA 3LL8B 2PVBA 1UURA 1IJ5A 3DVKA 2M7NA 2LUXA 2GV5A 5I8NA 5HKWA 4E68A 1AUIB 2LNKA 3I5HC 1F8HA 2M29A 1EXRA 1QX2A 1UHKA 2ZNDA 3ZWHA 5AFPA 4OR9B 3BOWA 2ZKMX 2LC5A 1CMGA 1UP5A 3TUYB 4PALA 1Y6WA 1B8CA 5PALA 5HYDA 5JOLA 1J7PA 1NX2A 2L50A 1ZMZA 1YUSA 1TCFA 2LVKA 5HKZA 2Y1MA 5HLOA 4C0JA 1DJYA 1QASA 1K9PA 4L9MA 3WHTB 3EK8A 3TS5B 3VRRA 4GBAA 1CTRA 4YBHB 1PULA 2AUCA 2FCEA 3VRPA 1RROA 4CPVA 4AQIA 2OTGB 1XFVO 3DD4A 1C7WA 1YVLA 3SG3A 1N2DA 3QRXA 1G8IA 3I5IC 3JVTC 5AANA 1JSAA 2EC6B 3JTDC 2KHNA 1RK9A 4N1FA 2NZ0A 4CFRA 1SRAA 2BE4A 4Q04A 1UHIA 2EHBA 5HKYA 2MHHA 3CWGA 1JFJA 1WRZA 1V1GA 4ICBA 3A4UB 2LLUA 1SL7A 1WDCB 1XYDA 2BE6A 1K2HA 2D8NA 1SCVA 4I5KA 3LLEA 4OV2A 1JWDA 2FJUB 2M7LA 2BL0C 2JXCA 2LV7A 2Y5IA 2HQ8A 1KFUS 3HX4A 3WXAA 2KAXA 1ZUZA 3OHMB 4HRGA 1QLSA 1UHJA 1C7VA 1S5GZ 3ICBA 3OP0A 4OKHA 1M31A 2F3ZA 2JQ6A 4OCIA 1S3PA 3VRQA 1AJ4A 1QJTA 2JXLA 1OE9B 1OZSA 1F4OA 1C07A 2LVJA 2MRDA 1EG4A 3TZ1A 1DF0B 4PE1A 1MR8A 1TOPA 4NDDA 1TNPA 3EVUA 3GK4X 2LMTA 4M2OA 2LVIA 1F54A 1MQ1A 4M2QA 1SCMB 1K94A 3I5GC 4HRHA 5DKQA 2AMIA 2MBXA 3TUYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YUU A;  1M46 A;  1BR4 B;  1SPY A;  1NYA A;  4PDZ A;  1FI5 A;  5CSJ A;  1CDM A;  1LVC D;  2ZRT A;  2M97 A;  4CFQ A;  1PSB A;  4YGD B;  4P2Y B;  3NXA A;  2TN4 A;  2P6B B;  1B8L A;  3TS5 C;  2KAY A;  2JC2 A;  2K7B A;  2KYF A;  2WCB A;  5TNC A;  1BG1 A;  3O78 A;  2A4J A;  2CT9 A;  3BQ3 A;  4NDC A;  4YGC B;  2AAO A;  4N1G A;  2E6W A;  1K93 D;  3FS7 A;  3NSK A;  1XO5 A;  3RLZ A;  5BPJ A;  1UHN A;  4N5X A;  1B8R A;  2HPS A;  2ISD A;  5I2Q A;  1KK7 Y;  1H8B A;  1OZO A;  2K2A A;  1IJ6 A;  3OB1 B;  4M2P A;  5CSF A;  1CDN A;  1PRW A;  1Q80 A;  4R1E A;  1DJX A;  1QVI Z;  2K2F A;  3CGA A;  4MLW A;  5CPV A;  3DVJ A;  1YVH A;  2EC6 C;  1M39 A;  1XFX O;  3GK2 A;  1Y1X A;  1OSA A;  1SMG A;  3C1V A;  2M1K B;  2JT3 A;  3KF9 A;  2F2P A;  1B7T Z;  3BYA A;  4DUQ A;  3OX6 A;  1YR5 A;  4ORC B;  4YI8 A;  5KTY A;  1QIW A;  1WDC C;  1ODB A;  4GGF C;  4GGN A;  1PVB A;  1RFJ A;  4MZK A;  2PAS A;  5KU1 A;  4MBE A;  3SG7 A;  3EK4 A;  1GQM A;  1L7Z A;  1DJW A;  1Y0V H;  2FOT A;  2L0P A;  1QS7 A;  1F71 A;  3DF0 B;  4IL1 A;  5AER A;  4A4B A;  1KQM B;  2LHL A;  1L2O B;  2GGZ A;  5GQQ C;  2G9B A;  3H4S E;  4HSZ A;  1NP8 A;  1VRK A;  4HRE E;  4WQ2 A;  1KFX L;  2KGB C;  5ER4 X;  1TIZ A;  2K7C A;  4DS7 A;  1PSR A;  1JFK A;  2LP3 A;  1BF5 A;  1TTX A;  3FIA A;  1BOD A;  4YGE B;  1WLZ A;  3I5F B;  1NWD A;  1EL4 A;  2F3Y A;  4GAO A;  4GFT A;  4YI9 A;  3VRO A;  1K90 D;  1KSO A;  2L98 A;  2WCF A;  1WRK A;  2Y4Q A;  3VRN A;  4GGF A;  2V53 A;  1YX8 A;  1SCM C;  4MVF A;  1H4B A;  3M0W A;  2KBM A;  1XFU O;  3SIA A;  3K21 A;  1JF2 A;  1W7J B;  4YGA A;  2SCP A;  3NSL A;  2NLN A;  4MZL A;  3KEV A;  2K7D A;  4PHK A;  1JC2 A;  1QAT A;  1CM1 A;  1EG3 A;  5K89 A;  2L4I A;  3BXK A;  4ORB B;  1QV0 A;  1AVS A;  2O60 A;  2KI4 B;  1EJ3 A;  2LAN A;  1FPW A;  3WNX B;  1U5I B;  1SYM A;  2L51 A;  3SG2 A;  4C0K A;  1G33 A;  1KWO C;  1QX5 B;  4JQ0 D;  2QAC A;  2GGM A;  1DF0 A;  2M9G A;  3EKH A;  1DVI A;  2BEC A;  2KBI A;  1LXF C;  1IQ3 A;  2F33 A;  1FI6 A;  4WRI A;  2M49 B;  1TNW A;  4QJ3 B;  2MA2 A;  3HCM A;  3AAJ A;  4DRW A;  2L5X B;  2ZNE A;  1M45 A;  1TRF A;  2BKI B;  1CM4 A;  3BUN B;  2IS9 A;  4PE4 A;  1NSH A;  2JPT A;  4MZJ A;  1ZOT B;  2LM5 A;  3LK1 A;  2LMU A;  2JT0 A;  1IQ5 A;  3D10 A;  1S5G Y;  4MRY A;  1HT9 A;  4MRX A;  1SNL A;  3D0Y B;  1YRU B;  2WCE A;  2K61 A;  2Y1N A;  1A4P A;  1XFW O;  2CCM A;  5J3X A;  5DKR A;  2RGI A;  3IF7 A;  3EVV A;  2PRU A;  3DVE A;  1M63 B;  1D1O A;  1R6P A;  5F6T A;  1SL8 A;  1XVJ A;  5CSI A;  1S6J A;  1Y1A A;  2JOJ A;  2KFH A;  4XJK B;  1DT7 B;  1J7Q A;  4FQO A;  4NQG A;  3PSR A;  1JUO A;  2BCA A;  4PHN A;  1L2O C;  1DJH A;  2F8P A;  1SKT A;  1NPQ A;  2KSP A;  3O4Y A;  4TNC A;  1IRJ A;  2I94 A;  3LK0 A;  4ETO A;  4JPZ B;  5D69 A;  1CKK A;  1JF0 A;  4D1E A;  2M3W A;  1FW4 A;  1YUR A;  2KFF A;  1XA5 A;  2LHI A;  1CFC A;  3I5F C;  1S26 D;  3NSO A;  3SG6 A;  1RJV A;  1GJY A;  4ZCV A;  3VGO A;  4YRU A;  1Y1U A;  3EKJ A;  2CBL A;  4NDB A;  2H61 A;  2MLE C;  1YRT B;  2OS8 B;  3TDZ A;  1CLM A;  2JTT A;  1PK0 D;  2LAP A;  2OTG C;  1ZAC A;  2JZI A;  4I5L B;  3GOF A;  1WLM A;  2KYC A;  4UPG A;  1J7R A;  1IG5 A;  1LA0 A;  3SG5 A;  2KQY A;  2SAS A;  1K9U A;  3FWB A;  2L2E A;  3DF0 A;  1PAL A;  3NSI A;  4USL A;  2KI4 C;  4GPL B;  4I5J A;  1LKJ A;  5JJG A;  3JTD B;  1NCX A;  1QVI Y;  1SL9 A;  2CTN A;  2I2R E;  1BU3 A;  3MSE B;  2K8M B;  3CLN A;  1BOC A;  1QXP A;  1RWY A;  3CTN A;  1TCO B;  1K8U A;  3AKB A;  1KK7 Z;  1R2U A;  2MAZ A;  3PFV A;  2M1U A;  1G4Y R;  2G2B A;  4I5N B;  2E30 A;  1S1E A;  3SJS A;  1KFU L;  3PN7 B;  1MHO A;  1J55 A;  1AK8 A;  1BLQ A;  4CID A;  1CFP A;  2JUL A;  1GGZ A;  4AQJ A;  1KK8 B;  1SBJ A;  2BBM A;  3E3R A;  2LUC A;  4GUK A;  4BY4 A;  1SR6 B;  1QIV A;  1A75 A;  1LIN A;  1ALW A;  5FYX A;  2NCO A;  1EH2 A;  1B47 A;  1K95 A;  1J7O A;  1F70 A;  3O2P A;  1OQP A;  1BMO A;  1MXL C;  4P5O E;  1FF1 A;  3F45 A;  1HQV A;  2ZFD A;  1A29 A;  1U5I A;  2F2O A;  1SK6 D;  4YGB B;  5I2O A;  1AHR A;  1ALV A;  2LP2 A;  2R2I A;  1WRL A;  1NIW A;  4BY5 A;  1IGV A;  2KGR A;  1QX7 A;  2I18 A;  1IKU A;  3PAT A;  2JNX A;  2HF5 A;  2DOQ A;  1J1E A;  2QPT A;  5KSZ A;  1CLB A;  2EGD A;  2WND A;  3CR4 X;  3I5G B;  2M8U A;  1BJF A;  1MF8 B;  1S36 A;  1IWQ A;  3KO0 A;  1CB1 A;  2LLT A;  1A75 B;  1BT6 A;  1NX1 A;  1RTP 1;  2Q4U A;  3CR5 X;  1OOJ A;  2M0R A;  1QLK A;  2JU0 A;  1S6I A;  1TNX A;  2KI6 C;  2H2K A;  4OVN F;  3PM8 A;  2MJW B;  1X02 A;  1CNP A;  1DJG A;  1OMD A;  5D7F A;  3D0Y A;  2I7A A;  1MXE A;  3OX5 A;  2KNE A;  1REC A;  2JWW A;  2K7O A;  3EK7 A;  1N0Y A;  2K0J A;  2OS8 C;  1B1G A;  1CFF A;  3FWC A;  1W7I B;  1DGV A;  4PHM A;  3BOW B;  4QJ5 B;  1E8A A;  1K96 A;  3EVR A;  1N65 A;  1A03 A;  4JWQ A;  3GK1 A;  2NCP A;  1S6C A;  4U8D A;  4XJK A;  3ZNI A;  2L4H A;  2NXQ A;  4DIR A;  1DMO A;  1K9K A;  4AOM A;  2ZN9 A;  4F0Z B;  1UWO A;  1CLL A;  1QV1 A;  1KSM A;  1B4C A;  2JRF A;  2VRG A;  1CDL A;  2JTZ A;  2MLF C;  1TNQ A;  1CMF A;  4PE7 A;  3DVM A;  3WHU B;  2CNP A;  2LLS A;  2BKH B;  2H61 C;  2Q91 A;  4WQ3 A;  4XYN A;  4QJ4 B;  1GGW A;  3PN7 C;  1YTZ C;  1OMR A;  3TDU A;  3RM1 A;  1CDP A;  4ZCU A;  1SW8 A;  5DKN A;  3I5H B;  2LCP A;  2CXJ A;  5IBW A;  1KK8 C;  2KFG A;  2PMY A;  1NCY A;  3IQQ A;  1F4Q A;  1SR6 C;  1SY9 A;  1XK4 C;  4PHJ A;  4DCK A;  3LCP C;  2PAL A;  1KQM C;  3BUM B;  1WY9 A;  2WC8 A;  2ZRS A;  1KCY A;  3KHE A;  3O6B A;  2FCD A;  2JNF A;  5ER5 A;  3OB2 B;  1NUB A;  1KFX S;  4PCW A;  1JBA A;  3CS1 A;  1NX3 A;  1DTL A;  2COL B;  2KI6 D;  2KDH A;  4FTG A;  2LVV A;  1F55 A;  2WOR A;  1NCZ A;  3A8R A;  1UUS A;  4A4C A;  4CLN A;  3TDI A;  1XFY O;  1KQV A;  1B9A A;  3AKA A;  5HLV A;  5CSN A;  4MEW A;  2O5G A;  5G08 A;  4C0L A;  1AP4 A;  3IQO A;  1ZFS A;  3I5I B;  3JVT B;  1DJI A;  1TN4 A;  3PAL A;  2JT8 A;  1XK4 A;  4GNK B;  2BBN A;  5I2L A;  1DJZ A;  5AXI A;  1BR1 B;  1DGU A;  2KQ6 A;  3SIB A;  1QTX A;  1PVA A;  1KWO B;  2HET A;  2KAV A;  3CZT X;  1YUT A;  1MUX A;  2LMV A;  1AJ5 A;  1V1F A;  3SG4 A;  2B1U A;  4ORA B;  2BCB A;  2OPO A;  1B7T Y;  1UHH A;  1NX0 A;  1YX7 A;  3BUW B;  1IH0 A;  2WOS A;  4MSP A;  1LA3 A;  2BL0 B;  2KOT A;  2HQW A;  2LE9 B;  3PLF B;  2ZN8 A;  1OMV A;  1FBV A;  5AEQ A;  3BUX B;  3CR2 A;  4MN0 A;  1XFZ O;  3KPX A;  1CFD A;  2BCX A;  5B8I B;  1A2X A;  1J1D A;  1MWN A;  3AAK A;  3BUO B;  4PE0 A;  2PSR A;  3LL8 B;  2PVB A;  1UUR A;  1IJ5 A;  3DVK A;  2M7N A;  2LUX A;  2GV5 A;  5I8N A;  5HKW A;  4E68 A;  1AUI B;  2LNK A;  3I5H C;  1F8H A;  2M29 A;  1EXR A;  1QX2 A;  1UHK A;  2ZND A;  3ZWH A;  5AFP A;  4OR9 B;  3BOW A;  2ZKM X;  2LC5 A;  1CMG A;  1UP5 A;  3TUY B;  4PAL A;  1Y6W A;  1B8C A;  5PAL A;  5HYD A;  5JOL A;  1J7P A;  1NX2 A;  2L50 A;  1ZMZ A;  1YUS A;  1TCF A;  2LVK A;  5HKZ A;  2Y1M A;  5HLO A;  4C0J A;  1DJY A;  1QAS A;  1K9P A;  4L9M A;  3WHT B;  3EK8 A;  3TS5 B;  3VRR A;  4GBA A;  1CTR A;  4YBH B;  1PUL A;  2AUC A;  2FCE A;  3VRP A;  1RRO A;  4CPV A;  4AQI A;  2OTG B;  1XFV O;  3DD4 A;  1C7W A;  1YVL A;  3SG3 A;  1N2D A;  3QRX A;  1G8I A;  3I5I C;  3JVT C;  5AAN A;  1JSA A;  2EC6 B;  3JTD C;  2KHN A;  1RK9 A;  4N1F A;  2NZ0 A;  4CFR A;  1SRA A;  2BE4 A;  4Q04 A;  1UHI A;  2EHB A;  5HKY A;  2MHH A;  3CWG A;  1JFJ A;  1WRZ A;  1V1G A;  4ICB A;  3A4U B;  2LLU A;  1SL7 A;  1WDC B;  1XYD A;  2BE6 A;  1K2H A;  2D8N A;  1SCV A;  4I5K A;  3LLE A;  4OV2 A;  1JWD A;  2FJU B;  2M7L A;  2BL0 C;  2JXC A;  2LV7 A;  2Y5I A;  2HQ8 A;  1KFU S;  3HX4 A;  3WXA A;  2KAX A;  1ZUZ A;  3OHM B;  4HRG A;  1QLS A;  1UHJ A;  1C7V A;  1S5G Z;  3ICB A;  3OP0 A;  4OKH A;  1M31 A;  2F3Z A;  2JQ6 A;  4OCI A;  1S3P A;  3VRQ A;  1AJ4 A;  1QJT A;  2JXL A;  1OE9 B;  1OZS A;  1F4O A;  1C07 A;  2LVJ A;  2MRD A;  1EG4 A;  3TZ1 A;  1DF0 B;  4PE1 A;  1MR8 A;  1TOP A;  4NDD A;  1TNP A;  3EVU A;  3GK4 X;  2LMT A;  4M2O A;  2LVI A;  1F54 A;  1MQ1 A;  4M2Q A;  1SCM B;  1K94 A;  3I5G C;  4HRH A;  5DKQ A;  2AMI A;  2MBX A;  3TUY C; 
#chains in the Genus database with same CATH topology
 1YUU A;  1M46 A;  1BR4 B;  1SPY A;  1NYA A;  4PDZ A;  1FI5 A;  5CSJ A;  1CDM A;  1LVC D;  1C3Z A;  2ZRT A;  2M97 A;  4CFQ A;  1PSB A;  4YGD B;  4P2Y B;  3NXA A;  2TN4 A;  1DC1 A;  2P6B B;  1B8L A;  3TS5 C;  2KAY A;  2JC2 A;  2K7B A;  2KYF A;  2WCB A;  5TNC A;  1BG1 A;  3O78 A;  2A4J A;  2CT9 A;  3BQ3 A;  3FE6 A;  4NDC A;  4YGC B;  2AAO A;  4N1G A;  2E6W A;  1K93 D;  3FS7 A;  3NSK A;  1XO5 A;  3RLZ A;  1GM0 A;  5BPJ A;  1UHN A;  4N5X A;  1B8R A;  2HPS A;  2ISD A;  5I2Q A;  1KK7 Y;  1H8B A;  3NHT A;  1OZO A;  2K2A A;  1IJ6 A;  3OB1 B;  2K60 A;  3R72 A;  4M2P A;  5CSF A;  1CDN A;  1PRW A;  1Q80 A;  4R1E A;  1DEL A;  1DJX A;  1QVI Z;  1TUJ A;  2K2F A;  3CGA A;  2WCK A;  4MLW A;  5CPV A;  3DVJ A;  1YVH A;  2EC6 C;  1M39 A;  1XFX O;  3CYZ A;  3GK2 A;  3CAB A;  3B86 A;  1Y1X A;  3CZ0 A;  1OSA A;  1SMG A;  3C1V A;  2M1K B;  3R1P A;  2JT3 A;  3KF9 A;  2F2P A;  1B7T Z;  3BYA A;  4DUQ A;  3OX6 A;  3S0F A;  1YR5 A;  4ORC B;  4YI8 A;  5KTY A;  2WC5 A;  1QIW A;  1WDC C;  1ODB A;  4GGF C;  4GGN A;  1PVB A;  1RFJ A;  4MZK A;  2PAS A;  5KU1 A;  4MBE A;  3SG7 A;  3EK4 A;  3R1V A;  1GQM A;  1L7Z A;  1DJW A;  1Y0V H;  2PYQ A;  2FOT A;  2L0P A;  1QS7 A;  1F71 A;  3DF0 B;  4IL1 A;  5AER A;  4A4B A;  1KQM B;  2LHL A;  1L2O B;  2GGZ A;  5GQQ C;  2G9B A;  3H4S E;  4HSZ A;  2KLE A;  1NP8 A;  4OZD A;  1VRK A;  4HRE E;  4WQ2 A;  1T14 A;  1KFX L;  2KGB C;  5ER4 X;  1TIZ A;  2K7C A;  4DS7 A;  1PSR A;  1JFK A;  2LP3 A;  1BF5 A;  4F7F A;  1TTX A;  3FIA A;  2H8V A;  1BOD A;  4YGE B;  1WLZ A;  4INX A;  3RZS A;  5D3O A;  3I5F B;  1NWD A;  1EL4 A;  2F3Y A;  4GAO A;  4GFT A;  4YI9 A;  3VRO A;  1K90 D;  2QEO A;  1KSO A;  2L98 A;  2WCF A;  1WRK A;  2Y4Q A;  3VRN A;  4GGF A;  2V53 A;  1YX8 A;  1SCM C;  4MVF A;  1H4B A;  3M0W A;  2KBM A;  1XFU O;  3D78 A;  3K21 A;  1JF2 A;  1W7J B;  4YGA A;  3D75 A;  2SCP A;  3PJI A;  3NSL A;  2NLN A;  4MZL A;  3KEV A;  2K7D A;  1OW4 A;  4PHK A;  1JC2 A;  1QAT A;  1CM1 A;  1EG3 A;  5K89 A;  2L4I A;  3BXK A;  4ORB B;  1QV0 A;  1AVS A;  2O60 A;  2KI4 B;  1EJ3 A;  2LAN A;  1FPW A;  3D73 A;  3WNX B;  1U5I B;  1SYM A;  2L51 A;  3SG2 A;  4C0K A;  2FJY A;  1G33 A;  1KWO C;  1QX5 B;  3R1O A;  4JQ0 D;  2QAC A;  2GGM A;  1DF0 A;  2M9G A;  3EKH A;  1DVI A;  2BEC A;  2KBI A;  1LXF C;  5EL2 A;  1IQ3 A;  2F33 A;  1FI6 A;  4WRI A;  2M49 B;  1TNW A;  4QJ3 B;  2MA2 A;  3HCM A;  3AAJ A;  4DRW A;  2L5X B;  2ZNE A;  1M45 A;  1TRF A;  2BKI B;  1CM4 A;  3N7H A;  4JKT A;  3BUN B;  2IS9 A;  4PE4 A;  2P70 A;  3K1E A;  3FE8 A;  1NSH A;  2JPT A;  4MZJ A;  1ZOT B;  2LM5 A;  3LK1 A;  2LMU A;  2JT0 A;  1IQ5 A;  2KPH A;  3D74 A;  3D10 A;  1S5G Y;  4MRY A;  1HT9 A;  3OGN A;  4MRX A;  1SNL A;  3D0Y B;  1YRU B;  2WCE A;  2K61 A;  2Y1N A;  3NGV A;  1A4P A;  1XFW O;  2CCM A;  3QME A;  5J3X A;  1SSE B;  3BFH A;  2RGI A;  5DKR A;  3IF7 A;  3EVV A;  2PRU A;  3DVE A;  1M63 B;  1D1O A;  1R6P A;  5F6T A;  1SL8 A;  1XVJ A;  5CSI A;  3BFA A;  1S6J A;  1Y1A A;  2JOJ A;  5FI7 A;  2KFH A;  4XJK B;  3L4A A;  1DT7 B;  1J7Q A;  4FQO A;  4NQG A;  3PSR A;  1JUO A;  2BCA A;  4PHN A;  1L2O C;  1DJH A;  2F8P A;  1SKT A;  1NPQ A;  2KSP A;  3O4Y A;  4TNC A;  1IRJ A;  2I94 A;  3LK0 A;  4ETO A;  4JPZ B;  5D69 A;  3D76 A;  1JF0 A;  1CKK A;  4D1E A;  2M3W A;  5FI2 A;  1FW4 A;  1YUR A;  2KFF A;  1XA5 A;  2LHI A;  1CFC A;  3I5F C;  1S26 D;  3NSO A;  3SG6 A;  1RJV A;  1GJY A;  4ZCV A;  3VGO A;  4YRU A;  1OOH A;  1Y1U A;  3EKJ A;  2CBL A;  4NDB A;  2H61 A;  2MLE C;  1YRT B;  2OS8 B;  3TDZ A;  1CLM A;  2JTT A;  1PK0 D;  2LAP A;  2OTG C;  1ZAC A;  2JZI A;  4I5L B;  5HL1 A;  3GOF A;  1WLM A;  2KYC A;  4UPG A;  1J7R A;  1IG5 A;  1LA0 A;  3SG5 A;  2KQY A;  2SAS A;  1K9U A;  3FWB A;  2L2E A;  5I94 A;  3DF0 A;  1PAL A;  3NSI A;  4USL A;  2KI4 C;  4GPL B;  4I5J A;  1LKJ A;  5JJG A;  3JTD B;  1NCX A;  1QVI Y;  1SL9 A;  2CTN A;  3OBV A;  2I2R E;  1BU3 A;  3MSE B;  2K8M B;  3CLN A;  1BOC A;  1QXP A;  4JD9 A;  1RWY A;  3CTN A;  1TCO B;  3SS3 A;  1OOG A;  1K8U A;  3AKB A;  1KK7 Z;  1R2U A;  2MAZ A;  3PFV A;  2M1U A;  3FE9 A;  1G4Y R;  2G2B A;  4I5N B;  2E30 A;  1S1E A;  3L4L A;  3VB1 A;  3SJS A;  1KFU L;  3CZ1 A;  1MHO A;  1J55 A;  3PN7 B;  1AK8 A;  4CID A;  1BLQ A;  1CFP A;  2JUL A;  1GGZ A;  4AQJ A;  1KK8 B;  1SBJ A;  2BBM A;  3CZ2 A;  2LUC A;  3E3R A;  4GUK A;  4BY4 A;  3CDN A;  1SR6 B;  5FI6 A;  1QIV A;  1A75 A;  1LIN A;  1ALW A;  5FYX A;  2NCO A;  3DYE A;  1EH2 A;  1B47 A;  1K95 A;  1J7O A;  1F70 A;  3O2P A;  1OQP A;  3B7A A;  1BMO A;  1MXL C;  4P5O E;  1FF1 A;  3F45 A;  1HQV A;  2ZFD A;  1A29 A;  1U5I A;  2F2O A;  1SK6 D;  4FQT A;  4YGB B;  1XFR A;  1AHR A;  5I2O A;  1DEK A;  1ALV A;  2LP2 A;  2R2I A;  1WRL A;  1NIW A;  4BY5 A;  1IGV A;  2KGR A;  1QX7 A;  2I18 A;  1IKU A;  3PAT A;  3UO9 A;  2BNX A;  2HF5 A;  2JNX A;  2DOQ A;  1J1E A;  2QEH A;  3DZT A;  2QPT A;  5KSZ A;  1CLB A;  2EGD A;  2WND A;  1Z2C B;  3CR4 X;  3I5G B;  2M8U A;  3V2L A;  1BJF A;  1MF8 B;  1S36 A;  1IWQ A;  3KO0 A;  1CB1 A;  2LLT A;  1A75 B;  1BT6 A;  1NX1 A;  1RTP 1;  1OOF A;  2Q4U A;  3CR5 X;  1OOJ A;  2M0R A;  1QLK A;  2JU0 A;  1S6I A;  1TNX A;  3S0A A;  2KI6 C;  2H2K A;  4OVN F;  3PM8 A;  2MJW B;  1X02 A;  1CNP A;  1DJG A;  2YGU A;  3D77 A;  1OMD A;  5D7F A;  3D0Y A;  2I7A A;  1MXE A;  1P28 A;  2KNE A;  1REC A;  3OX5 A;  2JWW A;  2WCJ A;  2K7O A;  3EK7 A;  1N0Y A;  2K0J A;  2OS8 C;  1B1G A;  1CFF A;  3FWC A;  4INW A;  1W7I B;  3SIA A;  1DGV A;  4PHM A;  3BOW B;  4QJ5 B;  1E8A A;  1K96 A;  3EVR A;  1N65 A;  3B6X A;  4JWQ A;  3GK1 A;  1A03 A;  2NCP A;  1S6C A;  4U8D A;  4XJK A;  3ZNI A;  2L4H A;  2NXQ A;  4DIR A;  1DMO A;  1K9K A;  4AOM A;  2ZN9 A;  4F0Z B;  1UWO A;  1CLL A;  1QV1 A;  1KSM A;  1B4C A;  2JRF A;  4IJ7 A;  2VRG A;  1CDL A;  2JTZ A;  2MLF C;  1TNQ A;  1CMF A;  4PE7 A;  3DVM A;  3WHU B;  2CNP A;  2LLS A;  2BKH B;  2H61 C;  2Q91 A;  4WQ3 A;  4XYN A;  4QJ4 B;  1GGW A;  3PN7 C;  1YTZ C;  1OMR A;  3TDU A;  3RM1 A;  3SS5 A;  1CDP A;  4ZCU A;  1SW8 A;  5DKN A;  3I5H B;  2LCP A;  2CXJ A;  5IBW A;  1KK8 C;  1W9Z A;  3O4X A;  2KFG A;  2PMY A;  1C3Y A;  1NCY A;  3IQQ A;  1F4Q A;  1SR6 C;  1SY9 A;  1XK4 C;  4PHJ A;  4DCK A;  3LCP C;  2PAL A;  1KQM C;  3BUM B;  1WY9 A;  1Z4H A;  2WC8 A;  2ZRS A;  1KCY A;  3KHE A;  3O6B A;  2FCD A;  2JNF A;  5ER5 A;  3OB2 B;  1NUB A;  3DY9 A;  1KFX S;  4PCW A;  1JBA A;  3CS1 A;  3B88 A;  1NX3 A;  1DTL A;  2BAP A;  2COL B;  2KI6 D;  2KDH A;  4FTG A;  2LVV A;  1F55 A;  2WOR A;  3B87 A;  1NCZ A;  3A8R A;  3S0D A;  1UUS A;  4A4C A;  2GTE A;  4CLN A;  3TDI A;  1XFY O;  3UNW A;  1B9A A;  1KQV A;  2WCM A;  3AKA A;  5HLV A;  5CSN A;  4MEW A;  2O5G A;  5G08 A;  4C0L A;  1AP4 A;  3IQO A;  1ZFS A;  5DIC A;  3I5I B;  3JVT B;  1DJI A;  1TN4 A;  3PAL A;  2JT8 A;  1XK4 A;  4GNK B;  2BBN A;  5I2L A;  1DJZ A;  5AXI A;  1BR1 B;  1DGU A;  2KQ6 A;  3SIB A;  1QTX A;  1PVA A;  1KWO B;  2HET A;  2KAV A;  3CZT X;  1YUT A;  1MUX A;  2LMV A;  1AJ5 A;  1V1F A;  3SG4 A;  2B1U A;  4ORA B;  2BCB A;  2OPO A;  1B7T Y;  2JPO A;  1UHH A;  1NX0 A;  1YX7 A;  3BUW B;  2WC6 A;  1IH0 A;  2WOS A;  4MSP A;  1LA3 A;  2BL0 B;  2KOT A;  2HQW A;  2LE9 B;  3PLF B;  2ZN8 A;  2PQL A;  1OMV A;  1FBV A;  5AEQ A;  3BUX B;  3CR2 A;  4MN0 A;  1XFZ O;  3KPX A;  1CFD A;  2BCX A;  5B8I B;  1A2X A;  1J1D A;  1MWN A;  3AAK A;  3BUO B;  4PE0 A;  2PSR A;  3LL8 B;  2PVB A;  1OOI X;  1UUR A;  1IJ5 A;  3DVK A;  2M7N A;  2P71 A;  3EG5 B;  1ORG A;  2LUX A;  2GV5 A;  2WCL A;  5I8N A;  5HKW A;  4E68 A;  1AUI B;  2LNK A;  3I5H C;  1F8H A;  2WCH A;  2M29 A;  1EXR A;  1QX2 A;  1UHK A;  2ZND A;  3ZWH A;  5AFP A;  4OR9 B;  3SS4 A;  3BFB A;  3BOW A;  2ZKM X;  2LC5 A;  3BJH A;  1CMG A;  1UP5 A;  3TUY B;  4PAL A;  1Y6W A;  1B8C A;  5PAL A;  5HYD A;  5JOL A;  1J7P A;  1NX2 A;  2L50 A;  1ZMZ A;  2KLD A;  1YUS A;  1TCF A;  2LVK A;  5HKZ A;  2QDI A;  2Y1M A;  3S0B A;  5HLO A;  4C0J A;  1DJY A;  1QAS A;  1K9P A;  2L2C A;  4L9M A;  4PT1 A;  3WHT B;  3EK8 A;  3TS5 B;  3VRR A;  4GBA A;  1CTR A;  4YBH B;  1PUL A;  2AUC A;  2FCE A;  4KYN A;  3VRP A;  1DQE A;  1RRO A;  3S0E A;  4CPV A;  4AQI A;  2OTG B;  1XFV O;  1QWV A;  3DD4 A;  3DXL A;  1C7W A;  1YVL A;  1TWO A;  3SG3 A;  1N2D A;  3QRX A;  1G8I A;  3I5I C;  3JVT C;  5AAN A;  1JSA A;  2EC6 B;  3JTD C;  2KHN A;  1RK9 A;  4N1F A;  2QEB A;  3S0G A;  2NZ0 A;  4CFR A;  1SRA A;  2BE4 A;  4Q04 A;  3Q8I A;  1UHI A;  3L47 A;  2EHB A;  5HKY A;  1TUZ A;  3PM2 A;  2MHH A;  3CWG A;  1JFJ A;  1WRZ A;  1V1G A;  4ICB A;  3A4U B;  2ERB A;  1SL7 A;  2LLU A;  1WDC B;  1XYD A;  3NHI A;  2BE6 A;  1K2H A;  2D8N A;  1SCV A;  2L5Y A;  4I5K A;  3LLE A;  4OV2 A;  1JWD A;  2FJU B;  2M7L A;  2BL0 C;  2JXC A;  2LV7 A;  2Y5I A;  2HQ8 A;  1KFU S;  3HX4 A;  3WXA A;  2KAX A;  1ZUZ A;  3OHM B;  4HRG A;  1QLS A;  1UHJ A;  3IVT A;  1C7V A;  1S5G Z;  3ICB A;  3OP0 A;  4OKH A;  1M31 A;  2F3Z A;  2JQ6 A;  4OCI A;  1S3P A;  3VRQ A;  1AJ4 A;  1QJT A;  2JXL A;  1OE9 B;  1OZS A;  1F4O A;  1C07 A;  2LVJ A;  2MRD A;  1EG4 A;  2QEV A;  3TZ1 A;  1DF0 B;  4PE1 A;  1MR8 A;  1TOP A;  1LS8 A;  4NDD A;  1TNP A;  3EVU A;  3GK4 X;  2LMT A;  4M2O A;  2LVI A;  1F54 A;  1MQ1 A;  4M2Q A;  1SCM B;  1IIO A;  1K94 A;  3I5G C;  4HRH A;  5DKQ A;  2AMI A;  2MBX A;  3TUY C; 
#chains in the Genus database with same CATH homology
 1YUU A;  1M46 A;  1BR4 B;  1SPY A;  1NYA A;  4PDZ A;  1FI5 A;  5CSJ A;  1CDM A;  1LVC D;  2ZRT A;  2M97 A;  4CFQ A;  1PSB A;  4YGD B;  4P2Y B;  3NXA A;  2TN4 A;  2P6B B;  1B8L A;  3TS5 C;  2KAY A;  2JC2 A;  2K7B A;  2KYF A;  2WCB A;  5TNC A;  1BG1 A;  3O78 A;  2A4J A;  2CT9 A;  3BQ3 A;  4NDC A;  4YGC B;  2AAO A;  4N1G A;  2E6W A;  1K93 D;  3FS7 A;  3NSK A;  1XO5 A;  3RLZ A;  5BPJ A;  1UHN A;  4N5X A;  1B8R A;  2HPS A;  2ISD A;  5I2Q A;  1KK7 Y;  1H8B A;  1OZO A;  2K2A A;  1IJ6 A;  3OB1 B;  4M2P A;  5CSF A;  1CDN A;  1PRW A;  1Q80 A;  4R1E A;  1DJX A;  1QVI Z;  2K2F A;  3CGA A;  4MLW A;  5CPV A;  3DVJ A;  1YVH A;  2EC6 C;  1M39 A;  1XFX O;  3GK2 A;  1Y1X A;  1OSA A;  1SMG A;  3C1V A;  2M1K B;  2JT3 A;  3KF9 A;  2F2P A;  1B7T Z;  3BYA A;  4DUQ A;  3OX6 A;  1YR5 A;  4ORC B;  4YI8 A;  5KTY A;  1QIW A;  1WDC C;  1ODB A;  4GGF C;  4GGN A;  1PVB A;  1RFJ A;  4MZK A;  2PAS A;  5KU1 A;  4MBE A;  3SG7 A;  3EK4 A;  1GQM A;  1L7Z A;  1DJW A;  1Y0V H;  2FOT A;  2L0P A;  1QS7 A;  1F71 A;  3DF0 B;  4IL1 A;  5AER A;  4A4B A;  1KQM B;  2LHL A;  1L2O B;  2GGZ A;  5GQQ C;  2G9B A;  3H4S E;  4HSZ A;  1NP8 A;  1VRK A;  4HRE E;  4WQ2 A;  1KFX L;  2KGB C;  5ER4 X;  1TIZ A;  2K7C A;  4DS7 A;  1PSR A;  1JFK A;  2LP3 A;  1BF5 A;  1TTX A;  3FIA A;  1BOD A;  4YGE B;  1WLZ A;  3I5F B;  1NWD A;  1EL4 A;  2F3Y A;  4GAO A;  4GFT A;  4YI9 A;  3VRO A;  1K90 D;  1KSO A;  2L98 A;  2WCF A;  1WRK A;  2Y4Q A;  3VRN A;  4GGF A;  2V53 A;  1YX8 A;  1SCM C;  4MVF A;  1H4B A;  3M0W A;  2KBM A;  1XFU O;  3SIA A;  3K21 A;  1JF2 A;  1W7J B;  4YGA A;  2SCP A;  3NSL A;  2NLN A;  4MZL A;  3KEV A;  2K7D A;  4PHK A;  1JC2 A;  1QAT A;  1CM1 A;  1EG3 A;  5K89 A;  2L4I A;  3BXK A;  4ORB B;  1QV0 A;  1AVS A;  2O60 A;  2KI4 B;  1EJ3 A;  2LAN A;  1FPW A;  3WNX B;  1U5I B;  1SYM A;  2L51 A;  3SG2 A;  4C0K A;  1G33 A;  1KWO C;  1QX5 B;  4JQ0 D;  2QAC A;  2GGM A;  1DF0 A;  2M9G A;  3EKH A;  1DVI A;  2BEC A;  2KBI A;  1LXF C;  1IQ3 A;  2F33 A;  1FI6 A;  4WRI A;  2M49 B;  1TNW A;  4QJ3 B;  2MA2 A;  3HCM A;  3AAJ A;  4DRW A;  2L5X B;  2ZNE A;  1M45 A;  1TRF A;  2BKI B;  1CM4 A;  3BUN B;  2IS9 A;  4PE4 A;  1NSH A;  2JPT A;  4MZJ A;  1ZOT B;  2LM5 A;  3LK1 A;  2LMU A;  2JT0 A;  1IQ5 A;  3D10 A;  1S5G Y;  4MRY A;  1HT9 A;  4MRX A;  1SNL A;  3D0Y B;  1YRU B;  2WCE A;  2K61 A;  2Y1N A;  1A4P A;  1XFW O;  2CCM A;  5J3X A;  5DKR A;  2RGI A;  3IF7 A;  3EVV A;  2PRU A;  3DVE A;  1M63 B;  1D1O A;  1R6P A;  5F6T A;  1SL8 A;  1XVJ A;  5CSI A;  1S6J A;  1Y1A A;  2JOJ A;  2KFH A;  4XJK B;  1DT7 B;  1J7Q A;  4FQO A;  4NQG A;  3PSR A;  1JUO A;  2BCA A;  4PHN A;  1L2O C;  1DJH A;  2F8P A;  1SKT A;  1NPQ A;  2KSP A;  3O4Y A;  4TNC A;  1IRJ A;  2I94 A;  3LK0 A;  4ETO A;  4JPZ B;  5D69 A;  1CKK A;  1JF0 A;  4D1E A;  2M3W A;  1FW4 A;  1YUR A;  2KFF A;  1XA5 A;  2LHI A;  1CFC A;  3I5F C;  1S26 D;  3NSO A;  3SG6 A;  1RJV A;  1GJY A;  4ZCV A;  3VGO A;  4YRU A;  1Y1U A;  3EKJ A;  2CBL A;  4NDB A;  2H61 A;  2MLE C;  1YRT B;  2OS8 B;  3TDZ A;  1CLM A;  2JTT A;  1PK0 D;  2LAP A;  2OTG C;  1ZAC A;  2JZI A;  4I5L B;  3GOF A;  1WLM A;  2KYC A;  4UPG A;  1J7R A;  1IG5 A;  1LA0 A;  3SG5 A;  2KQY A;  2SAS A;  1K9U A;  3FWB A;  2L2E A;  3DF0 A;  1PAL A;  3NSI A;  4USL A;  2KI4 C;  4GPL B;  4I5J A;  1LKJ A;  5JJG A;  3JTD B;  1NCX A;  1QVI Y;  1SL9 A;  2CTN A;  2I2R E;  1BU3 A;  3MSE B;  2K8M B;  3CLN A;  1BOC A;  1QXP A;  1RWY A;  3CTN A;  1TCO B;  1K8U A;  3AKB A;  1KK7 Z;  1R2U A;  2MAZ A;  3PFV A;  2M1U A;  1G4Y R;  2G2B A;  4I5N B;  2E30 A;  1S1E A;  3SJS A;  1KFU L;  3PN7 B;  1MHO A;  1J55 A;  1AK8 A;  1BLQ A;  4CID A;  1CFP A;  2JUL A;  1GGZ A;  4AQJ A;  1KK8 B;  1SBJ A;  2BBM A;  3E3R A;  2LUC A;  4GUK A;  4BY4 A;  1SR6 B;  1QIV A;  1A75 A;  1LIN A;  1ALW A;  5FYX A;  2NCO A;  1EH2 A;  1B47 A;  1K95 A;  1J7O A;  1F70 A;  3O2P A;  1OQP A;  1BMO A;  1MXL C;  4P5O E;  1FF1 A;  3F45 A;  1HQV A;  2ZFD A;  1A29 A;  1U5I A;  2F2O A;  1SK6 D;  4YGB B;  5I2O A;  1AHR A;  1ALV A;  2LP2 A;  2R2I A;  1WRL A;  1NIW A;  4BY5 A;  1IGV A;  2KGR A;  1QX7 A;  2I18 A;  1IKU A;  3PAT A;  2JNX A;  2HF5 A;  2DOQ A;  1J1E A;  2QPT A;  5KSZ A;  1CLB A;  2EGD A;  2WND A;  3CR4 X;  3I5G B;  2M8U A;  1BJF A;  1MF8 B;  1S36 A;  1IWQ A;  3KO0 A;  1CB1 A;  2LLT A;  1A75 B;  1BT6 A;  1NX1 A;  1RTP 1;  2Q4U A;  3CR5 X;  1OOJ A;  2M0R A;  1QLK A;  2JU0 A;  1S6I A;  1TNX A;  2KI6 C;  2H2K A;  4OVN F;  3PM8 A;  2MJW B;  1X02 A;  1CNP A;  1DJG A;  1OMD A;  5D7F A;  3D0Y A;  2I7A A;  1MXE A;  3OX5 A;  2KNE A;  1REC A;  2JWW A;  2K7O A;  3EK7 A;  1N0Y A;  2K0J A;  2OS8 C;  1B1G A;  1CFF A;  3FWC A;  1W7I B;  1DGV A;  4PHM A;  3BOW B;  4QJ5 B;  1E8A A;  1K96 A;  3EVR A;  1N65 A;  1A03 A;  4JWQ A;  3GK1 A;  2NCP A;  1S6C A;  4U8D A;  4XJK A;  3ZNI A;  2L4H A;  2NXQ A;  4DIR A;  1DMO A;  1K9K A;  4AOM A;  2ZN9 A;  4F0Z B;  1UWO A;  1CLL A;  1QV1 A;  1KSM A;  1B4C A;  2JRF A;  2VRG A;  1CDL A;  2JTZ A;  2MLF C;  1TNQ A;  1CMF A;  4PE7 A;  3DVM A;  3WHU B;  2CNP A;  2LLS A;  2BKH B;  2H61 C;  2Q91 A;  4WQ3 A;  4XYN A;  4QJ4 B;  1GGW A;  3PN7 C;  1YTZ C;  1OMR A;  3TDU A;  3RM1 A;  1CDP A;  4ZCU A;  1SW8 A;  5DKN A;  3I5H B;  2LCP A;  2CXJ A;  5IBW A;  1KK8 C;  2KFG A;  2PMY A;  1NCY A;  3IQQ A;  1F4Q A;  1SR6 C;  1SY9 A;  1XK4 C;  4PHJ A;  4DCK A;  3LCP C;  2PAL A;  1KQM C;  3BUM B;  1WY9 A;  2WC8 A;  2ZRS A;  1KCY A;  3KHE A;  3O6B A;  2FCD A;  2JNF A;  5ER5 A;  3OB2 B;  1NUB A;  1KFX S;  4PCW A;  1JBA A;  3CS1 A;  1NX3 A;  1DTL A;  2COL B;  2KI6 D;  2KDH A;  4FTG A;  2LVV A;  1F55 A;  2WOR A;  1NCZ A;  3A8R A;  1UUS A;  4A4C A;  4CLN A;  3TDI A;  1XFY O;  1KQV A;  1B9A A;  3AKA A;  5HLV A;  5CSN A;  4MEW A;  2O5G A;  5G08 A;  4C0L A;  1AP4 A;  3IQO A;  1ZFS A;  3I5I B;  3JVT B;  1DJI A;  1TN4 A;  3PAL A;  2JT8 A;  1XK4 A;  4GNK B;  2BBN A;  5I2L A;  1DJZ A;  5AXI A;  1BR1 B;  1DGU A;  2KQ6 A;  3SIB A;  1QTX A;  1PVA A;  1KWO B;  2HET A;  2KAV A;  3CZT X;  1YUT A;  1MUX A;  2LMV A;  1AJ5 A;  1V1F A;  3SG4 A;  2B1U A;  4ORA B;  2BCB A;  2OPO A;  1B7T Y;  1UHH A;  1NX0 A;  1YX7 A;  3BUW B;  1IH0 A;  2WOS A;  4MSP A;  1LA3 A;  2BL0 B;  2KOT A;  2HQW A;  2LE9 B;  3PLF B;  2ZN8 A;  1OMV A;  1FBV A;  5AEQ A;  3BUX B;  3CR2 A;  4MN0 A;  1XFZ O;  3KPX A;  1CFD A;  2BCX A;  5B8I B;  1A2X A;  1J1D A;  1MWN A;  3AAK A;  3BUO B;  4PE0 A;  2PSR A;  3LL8 B;  2PVB A;  1UUR A;  1IJ5 A;  3DVK A;  2M7N A;  2LUX A;  2GV5 A;  5I8N A;  5HKW A;  4E68 A;  1AUI B;  2LNK A;  3I5H C;  1F8H A;  2M29 A;  1EXR A;  1QX2 A;  1UHK A;  2ZND A;  3ZWH A;  5AFP A;  4OR9 B;  3BOW A;  2ZKM X;  2LC5 A;  1CMG A;  1UP5 A;  3TUY B;  4PAL A;  1Y6W A;  1B8C A;  5PAL A;  5HYD A;  5JOL A;  1J7P A;  1NX2 A;  2L50 A;  1ZMZ A;  1YUS A;  1TCF A;  2LVK A;  5HKZ A;  2Y1M A;  5HLO A;  4C0J A;  1DJY A;  1QAS A;  1K9P A;  4L9M A;  3WHT B;  3EK8 A;  3TS5 B;  3VRR A;  4GBA A;  1CTR A;  4YBH B;  1PUL A;  2AUC A;  2FCE A;  3VRP A;  1RRO A;  4CPV A;  4AQI A;  2OTG B;  1XFV O;  3DD4 A;  1C7W A;  1YVL A;  3SG3 A;  1N2D A;  3QRX A;  1G8I A;  3I5I C;  3JVT C;  5AAN A;  1JSA A;  2EC6 B;  3JTD C;  2KHN A;  1RK9 A;  4N1F A;  2NZ0 A;  4CFR A;  1SRA A;  2BE4 A;  4Q04 A;  1UHI A;  2EHB A;  5HKY A;  2MHH A;  3CWG A;  1JFJ A;  1WRZ A;  1V1G A;  4ICB A;  3A4U B;  2LLU A;  1SL7 A;  1WDC B;  1XYD A;  2BE6 A;  1K2H A;  2D8N A;  1SCV A;  4I5K A;  3LLE A;  4OV2 A;  1JWD A;  2FJU B;  2M7L A;  2BL0 C;  2JXC A;  2LV7 A;  2Y5I A;  2HQ8 A;  1KFU S;  3HX4 A;  3WXA A;  2KAX A;  1ZUZ A;  3OHM B;  4HRG A;  1QLS A;  1UHJ A;  1C7V A;  1S5G Z;  3ICB A;  3OP0 A;  4OKH A;  1M31 A;  2F3Z A;  2JQ6 A;  4OCI A;  1S3P A;  3VRQ A;  1AJ4 A;  1QJT A;  2JXL A;  1OE9 B;  1OZS A;  1F4O A;  1C07 A;  2LVJ A;  2MRD A;  1EG4 A;  3TZ1 A;  1DF0 B;  4PE1 A;  1MR8 A;  1TOP A;  4NDD A;  1TNP A;  3EVU A;  3GK4 X;  2LMT A;  4M2O A;  2LVI A;  1F54 A;  1MQ1 A;  4M2Q A;  1SCM B;  1K94 A;  3I5G C;  4HRH A;  5DKQ A;  2AMI A;  2MBX A;  3TUY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...