1IKUA

Myristoylated recoverin in the calcium-free state, nmr, 22 structures
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
188
structure length
188
Chain Sequence
GNSKSGALSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RECOVERIN
publication title Sequestration of the membrane-targeting myristoyl group of recoverin in the calcium-free state.
pubmed doi rcsb
source organism Bos taurus
molecule tags Calcium-binding protein
total genus 41
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 1996-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ikuA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ikuA01
1DJWA 1S6JA 5DKNA 3DD4A 2JPTA 1MXEA 4I5LB 1F70A 2GV5A 1QX5B 1KK8C 3SIBA 3C1VA 1B8CA 3F45A 4U8DA 3BUXB 4ORCB 1K95A 3IQQA 1WRLA 1G4YR 4MZKA 1B1GA 1DMOA 2M49B 2M1KB 2R2IA 1FPWA 4QJ3B 2LC5A 3A4UB 4PE4A 5I2QA 4FQOA 3KF9A 1Y1XA 2O60A 1MHOA 1CTRA 3SG6A 1VRKA 1KQVA 4DCKA 1RTP1 1GQMA 5HKZA 2M3WA 2PMYA 1K8UA 4I5KA 4PE1A 1A03A 4PHJA 5GQQC 3EVVA 1BU3A 1YURA 1SL9A 2ZNDA 1DJYA 1UHIA 2MRDA 3AAJA 1UP5A 1C7VA 1ZFSA 3BUWB 3CTNA 1TNXA 3AAKA 4MLWA 1EG3A 2NZ0A 4YGCB 1IGVA 1K2HA 3O4YA 3JTDC 1SCVA 2Y1MA 3JVTC 4YRUA 1YR5A 4M2PA 5D69A 2KAVA 1AP4A 4MBEA 4N5XA 1Y0VH 1CMGA 4A4CA 3DVMA 2B1UA 1SR6B 1QASA 2JNFA 4PCWA 1S26D 1DGVA 2L2EA 4Q04A 3VRRA 1DT7B 1SKTA 3LCPC 5HKWA 2P6BB 1KSOA 4BY5A 1AK8A 1DF0A 1KFUL 5CPVA 4MVFA 1J7PA 3CR4X 3PN7B 1EL4A 1SCMB 4YGBB 2A4JA 2L4HA 2WCEA 3OB2B 5D7FA 2HQ8A 2M7LA 1K9PA 1ALWA 5AXIA 1SL7A 2BKIB 1M31A 4AOMA 2TN4A 3DF0A 2KFGA 2MA2A 2LMVA 4FTGA 1DTLA 3O2PA 1NPQA 1C7WA 4GGNA 1XK4C 3TDIA 2MJWB 4E68A 3E3RA 3CR2A 5HLVA 3ZWHA 3TS5B 2MAZA 3BUOB 1B8LA 2K8MB 4TNCA 4XYNA 1LVCD 1OQPA 3BYAA 4QJ5B 4YGAA 3LK0A 2V53A 1X02A 4NQGA 4PHKA 3TUYB 3FWBA 1HT9A 2WCBA 3D0YB 3EK4A 5HLOA 1IH0A 4WQ3A 1QIWA 3PFVA 4AQIA 2EC6B 1N65A 1B47A 1CLMA 1M39A 4PE7A 4DUQA 1W7IB 1F8HA 1DJHA 3IF7A 5I2LA 1J7QA 2ZN8A 3TDZA 1ZOTB 2M9GA 1UHNA 1JWDA 5DKRA 4P2YB 4IL1A 2RGIA 2D8NA 1D1OA 1JC2A 1NCXA 2LVIA 2LHIA 1JFJA 3PM8A 2KDHA 4ETOA 1CMFA 5JOLA 1F71A 1OZSA 4YI9A 1MXLC 3EK7A 2PALA 3CS1A 1RWYA 1PVAA 1UHJA 1NYAA 1GGWA 1SR6C 3ZNIA 4OKHA 4XJKB 2JRFA 2SCPA 2JTZA 2KFHA 1SY9A 1MWNA 2KSPA 4PDZA 4ORAB 1YX7A 2MHHA 2M0RA 2OTGB 1F54A 1A75B 2KGBC 2ZNEA 2CCMA 3PLFB 1OOJA 2KYFA 4GFTA 1EJ3A 3TZ1A 1AHRA 1SMGA 2CNPA 1IJ5A 2K7DA 3H4SE 3PN7C 4MRXA 1SCMC 1LKJA 2EGDA 1EXRA 1PSBA 1YUSA 3MSEB 3EKHA 1MQ1A 3GOFA 3OHMB 5FYXA 3EVRA 3GK1A 1GGZA 1CB1A 1QATA 1M63B 4CPVA 1XFXO 2CTNA 1F4QA 1MUXA 1S6CA 2I7AA 3OX5A 2OS8B 1QVIY 1DJXA 5CSJA 2FCDA 1N2DA 2BE6A 1F55A 3SG7A 1J55A 3TS5C 5PALA 1PK0D 2Q91A 3OB1B 4C0JA 2L0PA 2K2FA 2F8PA 1BF5A 4N1GA 2JZIA 3AKAA 1H8BA 4MN0A 3LL8B 1CLLA 3TUYC 2I2RE 2GGZA 2ZRTA 1YX8A 1ZUZA 1CDMA 1XFWO 3BOWB 1CFPA 2KBMA 4HSZA 4I5JA 1NSHA 3CWGA 2BCBA 1YVHA 2EC6C 4ZCUA 1QJTA 1BMOA 4YGDB 1B7TY 2JTTA 4MRYA 2F3ZA 3D0YA 2JWWA 1EH2A 1BR1B 4USLA 1YRTB 2PSRA 4OCIA 2KAXA 3DVKA 3EVUA 3I5HB 5AANA 2HPSA 1RROA 2LMTA 1LINA 1YRUB 2MLEC 4NDDA 2KBIA 4NDBA 3RM1A 1AUIB 2KAYA 3BUMB 2AMIA 1CDNA 1SK6D 3EK8A 1ALVA 4DIRA 1OMRA 2M8UA 3I5IB 2LUXA 2BBMA 1BOCA 1RECA 1TRFA 5HYDA 4UPGA 1BT6A 1MF8B 2BCAA 4MSPA 3WNXB 1CFFA 4ORBB 1XFZO 3FS7A 1BG1A 1FW4A 2OTGC 4C0KA 2DOQA 2I94A 4XJKA 4M2QA 2CBLA 1Q80A 3HCMA 1H4BA 1NX1A 5TNCA 1CNPA 2F3YA 2KI6D 1A75A 1WRZA 1XA5A 2JOJA 1PRWA 1OMDA 1SBJA 2QACA 3I5FB 1AVSA 4N1FA 2HQWA 1R6PA 1Y1AA 1NWDA 1J1DA 2LCPA 3OP0A 4GNKB 3KPXA 1JFKA 1K93D 1J1EA 1DJGA 1XO5A 2JT8A 1TTXA 2FCEA 2OS8C 1S5GZ 2LAPA 1C07A 1S3PA 1DVIA 2LVVA 1XK4A 1NCYA 3O6BA 4PE0A 1OE9B 1TCOB 2K61A 4YGEB 4CLNA 1XFUO 1B4CA 1XVJA 2ISDA 3BXKA 1IQ5A 1TOPA 1KK7Y 1A4PA 1K90D 1AJ4A 1KQMB 4YBHB 3M0WA 5G08A 3TDUA 1FBVA 2KGRA 2LP3A 2LVKA 2BECA 4PALA 1PALA 1B8RA 1CDPA 2LV7A 4HREE 2M97A 2BL0B 1JF2A 1NP8A 3WHTB 1PSRA 4GGFC 1DJIA 1QVIZ 5ER5A 3NXAA 1M45A 2LVJA 3BOWA 1S36A 4MZLA 2KHNA 4HRGA 2OPOA 1G33A 1U5IB 1JUOA 4OR9B 3I5HC 4GGFA 4HRHA 1HQVA 1ZMZA 4GAOA 3FIAA 4A4BA 4CFQA 2HETA 1EG4A 5K89A 1A29A 1OMVA 3KEVA 1M46A 1CM1A 2JNXA 2E30A 1BR4B 1WDCB 2FOTA 3NSKA 1QS7A 1QV0A 2BKHB 1SW8A 1NX0A 1IG5A 3I5IC 3WHUB 5I2OA 2KQ6A 4M2OA 3SG4A 5KSZA 2H2KA 2Y1NA 1S5GY 1NCZA 1KSMA 2NCOA 1SL8A 2Y5IA 4MEWA 3AKBA 1QLKA 1W7JB 2JXLA 2LE9B 1B7TZ 2L4IA 5CSNA 5CSFA 1K9KA 3I5GB 3DVEA 2K0JA 2LUCA 5BPJA 1NX2A 5DKQA 1QIVA 4JPZB 3PATA 1TNQA 4F0ZB 2LHLA 4PHMA 2LANA 3PALA 3DVJA 1SPYA 1S6IA 3I5FC 2F33A 1IQ3A 2LM5A 2CT9A 2IS9A 3IQOA 1IJ6A 4GUKA 1CFDA 3NSOA 1QTXA 4DS7A 2WC8A 2ZKMX 5I8NA 1F4OA 2LLSA 1NX3A 4C0LA 1UUSA 1RFJA 1TNPA 4JWQA 2WOSA 2ZN9A 1FF1A 1ZACA 1JF0A 2NLNA 1JSAA 4WQ2A 2G2BA 1Y6WA 2KYCA 2JU0A 2LMUA 3SG2A 1YTZC 2E6WA 2NXQA 3EKJA 5JJGA 2WCFA 1S1EA 1KQMC 3VRNA 5KU1A 2QPTA 3NSLA 1BODA 2LP2A 2KFFA 2WNDA 2MLFC 1TNWA 3RLZA 4OVNF 2BL0C 1QXPA 1KFXS 2KI6C 5KTYA 4OV2A 1PVBA 1FI5A 1KCYA 1K9UA 2I18A 1V1FA 2GGMA 1E8AA 1WY9A 4P5OE 2MBXA 1DGUA 1OSAA 2L5XB 4L9MA 3CLNA 2M7NA 1KK7Z 1TN4A 1L2OB 2M29A 2KI4B 1IKUA 1WDCC 1J7RA 5J3XA 3CR5X 1U5IA 3VGOA 4ZCVA 1WLZA 1V1GA 3CZTX 3ICBA 3O78A 1JBAA 3SIAA 2BCXA 2JC2A 4GBAA 2EHBA 3D10A 2K7BA 1NIWA 3BQ3A 3LK1A 1FI6A 3FWCA 2K2AA 4PHNA 1CDLA 3I5GC 1R2UA 1SRAA 4WRIA 1IRJA 1KWOB 1QV1A 5AFPA 1PULA 1RK9A 1XFVO 2JT3A 1KK8B 3GK2A 1BJFA 2O5GA 3HX4A 1UWOA 2L98A 1ODBA 3PSRA 4CIDA 1B9AA 1QX7A 1LA0A 2L51A 2JT0A 1CKKA 2KNEA 2PRUA 4AQJA 3GK4X 3SG5A 3VRPA 1LA3A 3K21A 3SJSA 1TIZA 1J7OA 2K7CA 3A8RA 2JQ6A 2SASA 1UHHA 1YUTA 2PASA 2F2OA 5AERA 3CGAA 2JULA 3WXAA 1UHKA 3SG3A 2BBNA 2L50A 5CSIA 5B8IB 4MZJA 1RJVA 1YVLA 1TCFA 5F6TA 2JXCA 2Q4UA 1G8IA 2ZRSA 3OX6A 4CFRA 1SYMA 1BLQA 2NCPA 1SNLA 2Y4QA 1IWQA 4JQ0D 1CM4A 4NDCA 2M1UA 2WORA 2KQYA 1CLBA 3KO0A 2CXJA 2H61C 5HKYA 1K94A 1L7ZA 1N0YA 1UURA 1Y1UA 1AJ5A 1MR8A 1K96A 4QJ4B 5IBWA 1DJZA 3QRXA 1QLSA 2FJUB 3NSIA 1LXFC 1QX2A 2AUCA 2G9BA 1KFUS 4I5NB 2COLB 1WRKA 2H61A 2LLTA 1WLMA 3LLEA 2PVBA 2LLUA 1GJYA 2AAOA 3JTDB 3JVTB 2LNKA 4R1EA 1L2OC 2KI4C 1XFYO 2F2PA 2KOTA 4GPLB 2HF5A 1DF0B 1KFXL 2VRGA 1A2XA 1CFCA 1OZOA 2BE4A 3VRQA 4BY4A 5ER4X 4YI8A 1YUUA 3BUNB 3VROA 1NUBA 1XYDA 5AEQA 1KWOC 4DRWA 4D1EA 2K7OA 4ICBA 3DF0B 3KHEA 2ZFDA
chains in the Genus database with same CATH superfamily
1DJWA 1S6JA 5DKNA 3DD4A 2JPTA 1MXEA 3L4AA 4I5LB 1F70A 3R1PA 2GV5A 1QX5B 1KK8C 3SIBA 3C1VA 1B8CA 3F45A 4U8DA 3BUXB 4ORCB 1K95A 3IQQA 1WRLA 1G4YR 4MZKA 1B1GA 1DMOA 2M49B 2M1KB 2R2IA 1FPWA 1IIOA 4QJ3B 2LC5A 3A4UB 1TWOA 4PE4A 3UO9A 4FQOA 5I2QA 3KF9A 1Y1XA 2O60A 1MHOA 1CTRA 3VB1A 3SG6A 1VRKA 1KQVA 4DCKA 5DICA 1RTP1 1GQMA 5HKZA 2M3WA 2WC6A 2PMYA 1K8UA 2QDIA 4I5KA 4FQTA 4PE1A 1A03A 4PHJA 5GQQC 3EVVA 1BU3A 1YURA 2KPHA 1SL9A 2ZNDA 1DJYA 1UHIA 2MRDA 3AAJA 1UP5A 1C3ZA 1C7VA 1ZFSA 3BUWB 3CTNA 1TNXA 3AAKA 4MLWA 1EG3A 2NZ0A 4YGCB 1IGVA 3S0DA 1K2HA 3O4YA 3JTDC 1SCVA 2Y1MA 3JVTC 4YRUA 1YR5A 4M2PA 5D69A 2KAVA 1AP4A 4MBEA 4N5XA 1Y0VH 1CMGA 4A4CA 1TUJA 3DVMA 2B1UA 1SR6B 3S0AA 1QASA 2JNFA 4PCWA 1S26D 1DGVA 2L2EA 2WCLA 4Q04A 3N7HA 3VRRA 1DT7B 1SKTA 3LCPC 5HKWA 2P6BB 1KSOA 3EG5B 4BY5A 3NHIA 1DF0A 1AK8A 1KFUL 3CZ0A 5CPVA 4MVFA 1J7PA 3CR4X 3PN7B 1EL4A 1SCMB 4YGBB 2A4JA 2L4HA 2WCEA 3OB2B 3Q8IA 5D7FA 2HQ8A 2M7LA 1K9PA 1ALWA 5AXIA 1SL7A 1XFRA 2BKIB 1M31A 4AOMA 2TN4A 3DF0A 2KFGA 2MA2A 2LMVA 3QMEA 4FTGA 3BFAA 1DTLA 3O2PA 1NPQA 1C7WA 4GGNA 1XK4C 3TDIA 2MJWB 4E68A 3E3RA 3CR2A 5HLVA 3ZWHA 3TS5B 2MAZA 3BUOB 1B8LA 2K8MB 3CZ1A 4TNCA 4XYNA 1LVCD 1OQPA 3BYAA 4QJ5B 4YGAA 3K1EA 3LK0A 2V53A 1X02A 4NQGA 4PHKA 5I94A 3TUYB 3FWBA 1HT9A 2WCBA 3D0YB 3EK4A 5HLOA 1IH0A 2L2CA 4WQ3A 1QIWA 3PFVA 4AQIA 2EC6B 1N65A 1B47A 1CLMA 3FE8A 1M39A 4PE7A 4DUQA 1W7IB 1F8HA 1DJHA 3IF7A 5I2LA 1J7QA 2ZN8A 3TDZA 1ZOTB 2M9GA 1UHNA 1JWDA 5DKRA 3PM2A 4P2YB 4IL1A 2RGIA 2D8NA 1D1OA 3SS4A 1JC2A 1NCXA 2LVIA 2L5YA 2LHIA 3D78A 1JFJA 3R1VA 3PM8A 2KDHA 4ETOA 1CMFA 2K60A 5JOLA 3SS5A 1F71A 1OZSA 4YI9A 1MXLC 3EK7A 2PALA 3CS1A 1RWYA 1PVAA 1UHJA 1NYAA 1GGWA 1SR6C 3ZNIA 4OKHA 4XJKB 2JRFA 2SCPA 2JTZA 2KFHA 1SY9A 3D76A 1MWNA 2KSPA 4PDZA 4ORAB 1YX7A 1J7OA 2MHHA 2M0RA 2OTGB 1F54A 1A75B 2KGBC 2ZNEA 2CCMA 3PLFB 1OOJA 2KYFA 1T14A 4GFTA 1EJ3A 3TZ1A 1AHRA 1SMGA 2CNPA 1IJ5A 2K7DA 3H4SE 3PN7C 4INXA 1SCMC 1LKJA 4MRXA 2EGDA 1EXRA 1PSBA 1YUSA 3MSEB 3DYEA 3EKHA 1MQ1A 3GOFA 3OHMB 5FYXA 4IJ7A 3EVRA 3GK1A 3UNWA 1GGZA 1CB1A 1QATA 1M63B 4CPVA 1XFXO 2CTNA 5EL2A 1F4QA 1MUXA 1S6CA 2I7AA 3OX5A 1GM0A 2OS8B 1QVIY 1DJXA 5CSJA 2FCDA 1N2DA 1Z4HA 2BE6A 3SG7A 1F55A 1J55A 3TS5C 1P28A 5PALA 1PK0D 2Q91A 3OB1B 4C0JA 2L0PA 2WCJA 2K2FA 2F8PA 1BF5A 4N1GA 2JZIA 3AKAA 1H8BA 4MN0A 3LL8B 1ORGA 1CLLA 3TUYC 2I2RE 2GGZA 2ZRTA 1YX8A 1ZUZA 1CDMA 1XFWO 3BOWB 1CFPA 2KBMA 3BJHA 4HSZA 4I5JA 1NSHA 3CWGA 2BCBA 1YVHA 2EC6C 4ZCUA 1QJTA 3OGNA 3CABA 3FE6A 1BMOA 4YGDB 3B88A 2WCMA 1B7TY 2JTTA 4MRYA 2F3ZA 3D0YA 2JWWA 1EH2A 1BR1B 4USLA 1YRTB 2PSRA 4OCIA 2KAXA 3DVKA 5D3OA 3EVUA 3I5HB 5AANA 2HPSA 1RROA 2LMTA 1LINA 1YRUB 2MLEC 4NDDA 2KBIA 4NDBA 3RM1A 1AUIB 2KAYA 3BUMB 2AMIA 1CDNA 1SK6D 3EK8A 1ALVA 4DIRA 1OMRA 2M8UA 3I5IB 2LUXA 2BBMA 2QEOA 2BNXA 1BOCA 1RECA 1TRFA 5HYDA 4UPGA 3FE9A 1BT6A 1MF8B 2BCAA 4MSPA 3WNXB 1CFFA 4ORBB 1XFZO 3FS7A 1BG1A 1FW4A 2OTGC 4C0KA 2DOQA 2I94A 4XJKA 4M2QA 1DEKA 2CBLA 1Q80A 2P71A 3HCMA 1H4BA 1NX1A 5TNCA 1CNPA 2F3YA 2KI6D 1A75A 1W9ZA 1WRZA 1XA5A 3R1OA 4F7FA 2JOJA 1PRWA 1OMDA 1SBJA 2PYQA 2QACA 1AVSA 3I5FB 2HQWA 4N1FA 1R6PA 2FJYA 1Y1AA 1NWDA 1J1DA 2LCPA 3OP0A 4GNKB 3KPXA 1JFKA 1K93D 1J1EA 1DJGA 1XO5A 2JT8A 1OOGA 1TTXA 2FCEA 2OS8C 1S5GZ 2LAPA 1C07A 1S3PA 1DVIA 2LVVA 1XK4A 1NCYA 3O6BA 1QWVA 4PE0A 1OE9B 1TCOB 2K61A 4YGEB 4CLNA 1XFUO 1B4CA 1XVJA 2ISDA 3BXKA 1IQ5A 3D73A 1TOPA 1KK7Y 1A4PA 1K90D 1AJ4A 1KQMB 4YBHB 3M0WA 5G08A 3TDUA 1FBVA 1OOFA 2KGRA 2LP3A 2LVKA 2BECA 2PQLA 4PALA 3NGVA 1PALA 1B8RA 1CDPA 2LV7A 4HREE 2M97A 2BL0B 4INWA 1JF2A 1NP8A 3WHTB 1PSRA 4GGFC 1DJIA 1QVIZ 5ER5A 3NXAA 1M45A 2LVJA 3BOWA 1S36A 4MZLA 2QEBA 2KHNA 4HRGA 2P70A 2OPOA 1G33A 1U5IB 1DC1A 1JUOA 4OR9B 3I5HC 2JPOA 4GGFA 4HRHA 1HQVA 1ZMZA 4GAOA 3FIAA 4A4BA 4CFQA 2HETA 1EG4A 5K89A 1A29A 1OMVA 3RZSA 3CYZA 1M46A 3KEVA 1CM1A 2JNXA 2E30A 1BR4B 1WDCB 2FOTA 1TUZA 3NSKA 3S0BA 1QS7A 1QV0A 2BKHB 3D74A 1SW8A 1NX0A 1IG5A 3I5IC 4JD9A 3WHUB 5I2OA 2KQ6A 4M2OA 3SG4A 1SSEB 5KSZA 2H2KA 2Y1NA 1S5GY 1NCZA 1KSMA 2NCOA 1SL8A 2Y5IA 4MEWA 3AKBA 1QLKA 1W7JB 2JXLA 2LE9B 1B7TZ 2L4IA 5CSNA 5CSFA 1K9KA 3I5GB 1OOIX 3DVEA 1LS8A 2K0JA 2LUCA 4PT1A 5BPJA 1NX2A 5DKQA 1QIVA 4JPZB 3PATA 1TNQA 3L47A 4F0ZB 5FI7A 2LHLA 4PHMA 2LANA 3PALA 4JKTA 3CDNA 3DVJA 1SPYA 1S6IA 3I5FC 2F33A 1IQ3A 2LM5A 2CT9A 2IS9A 3IQOA 1IJ6A 4GUKA 1CFDA 3NSOA 1QTXA 4DS7A 2WC8A 2ZKMX 5I8NA 1F4OA 2LLSA 1NX3A 4C0LA 1UUSA 1RFJA 1TNPA 5FI6A 4JWQA 2WOSA 2ZN9A 1FF1A 1ZACA 1JF0A 2NLNA 1JSAA 4WQ2A 2G2BA 1Y6WA 2KYCA 2JU0A 2LMUA 4OZDA 3SG2A 1YTZC 2E6WA 2NXQA 3EKJA 3L4LA 3V2LA 3B7AA 2WCFA 5JJGA 1S1EA 1KQMC 3VRNA 2KLEA 3PJIA 5KU1A 2QPTA 3NSLA 3D77A 1BODA 2LP2A 2KFFA 2WNDA 2MLFC 1TNWA 3RLZA 4OVNF 1QXPA 1KFXS 2BL0C 2KI6C 5KTYA 4OV2A 1PVBA 2H8VA 3R72A 1FI5A 1KCYA 3CZ2A 1K9UA 2I18A 1V1FA 2GGMA 2WCHA 1E8AA 1WY9A 3BFBA 4P5OE 2MBXA 1DGUA 3D75A 1OSAA 2L5XB 2YGUA 3BFHA 4L9MA 3CLNA 2M7NA 5HL1A 1KK7Z 1TN4A 1L2OB 2M29A 2KI4B 1IKUA 1WDCC 1J7RA 5J3XA 3CR5X 1U5IA 2QEHA 3VGOA 4ZCVA 1WLZA 1OOHA 1V1GA 3CZTX 3ICBA 3O78A 1JBAA 3SIAA 1Z2CB 2BCXA 2JC2A 4GBAA 2EHBA 3D10A 2K7BA 1NIWA 3BQ3A 2GTEA 3LK1A 1FI6A 2BAPA 3FWCA 2K2AA 4PHNA 1CDLA 3I5GC 1R2UA 1SRAA 4WRIA 1IRJA 1KWOB 1QV1A 5AFPA 1PULA 1RK9A 1XFVO 2JT3A 1KK8B 3GK2A 1BJFA 2O5GA 3HX4A 1UWOA 2L98A 1ODBA 3PSRA 4CIDA 1B9AA 1QX7A 1LA0A 2L51A 2JT0A 1CKKA 2KNEA 2PRUA 4AQJA 3GK4X 3SG5A 3VRPA 1LA3A 3K21A 2WCKA 1TIZA 3SJSA 3S0FA 2K7CA 3A8RA 2JQ6A 2SASA 3B87A 1UHHA 1YUTA 2PASA 1OW4A 2F2OA 3B6XA 5AERA 3CGAA 2JULA 3DZTA 3WXAA 1UHKA 3SG3A 2BBNA 1DQEA 2L50A 5CSIA 5B8IB 4MZJA 1RJVA 1YVLA 1TCFA 5F6TA 2JXCA 2Q4UA 1G8IA 2ZRSA 3OX6A 4CFRA 1SYMA 1BLQA 2NCPA 3NHTA 1SNLA 2Y4QA 1IWQA 4KYNA 4JQ0D 3DY9A 3S0EA 1DELA 1CM4A 3OBVA 2M1UA 2WORA 2KQYA 3IVTA 4NDCA 1CLBA 3DXLA 2CXJA 3KO0A 3SS3A 2H61C 5HKYA 1K94A 1L7ZA 1N0YA 1UURA 3O4XA 1Y1UA 1AJ5A 1MR8A 2ERBA 1K96A 4QJ4B 5IBWA 1DJZA 3QRXA 5FI2A 1QLSA 2FJUB 3NSIA 1LXFC 1QX2A 2AUCA 2G9BA 1KFUS 3B86A 4I5NB 2COLB 1WRKA 2H61A 2LLTA 1WLMA 3LLEA 2PVBA 2LLUA 1GJYA 2AAOA 3JTDB 3JVTB 2LNKA 4R1EA 1L2OC 2KI4C 1XFYO 2F2PA 2KOTA 4GPLB 2HF5A 1DF0B 1KFXL 2VRGA 1A2XA 1CFCA 1OZOA 2QEVA 3S0GA 2BE4A 3VRQA 2KLDA 4BY4A 5ER4X 4YI8A 1YUUA 3BUNB 3VROA 1NUBA 1XYDA 5AEQA 1KWOC 4DRWA 4D1EA 2K7OA 1C3YA 4ICBA 3DF0B 2WC5A 3KHEA 2ZFDA
chains in the Genus database with same CATH topology
1DJWA 1S6JA 5DKNA 3DD4A 2JPTA 1MXEA 4I5LB 1F70A 2GV5A 1QX5B 1KK8C 3SIBA 3C1VA 1B8CA 3F45A 4U8DA 3BUXB 4ORCB 1K95A 3IQQA 1WRLA 1G4YR 4MZKA 1B1GA 1DMOA 2M49B 2M1KB 2R2IA 1FPWA 4QJ3B 2LC5A 3A4UB 4PE4A 5I2QA 4FQOA 3KF9A 1Y1XA 2O60A 1MHOA 1CTRA 3SG6A 1VRKA 1KQVA 4DCKA 1RTP1 1GQMA 5HKZA 2M3WA 2PMYA 1K8UA 4I5KA 4PE1A 1A03A 4PHJA 5GQQC 3EVVA 1BU3A 1YURA 1SL9A 2ZNDA 1DJYA 1UHIA 2MRDA 3AAJA 1UP5A 1C7VA 1ZFSA 3BUWB 3CTNA 1TNXA 3AAKA 4MLWA 1EG3A 2NZ0A 4YGCB 1IGVA 1K2HA 3O4YA 3JTDC 1SCVA 2Y1MA 3JVTC 4YRUA 1YR5A 4M2PA 5D69A 2KAVA 1AP4A 4MBEA 4N5XA 1Y0VH 1CMGA 4A4CA 3DVMA 2B1UA 1SR6B 1QASA 2JNFA 4PCWA 1S26D 1DGVA 2L2EA 4Q04A 3VRRA 1DT7B 1SKTA 3LCPC 5HKWA 2P6BB 1KSOA 4BY5A 1AK8A 1DF0A 1KFUL 5CPVA 4MVFA 1J7PA 3CR4X 3PN7B 1EL4A 1SCMB 4YGBB 2A4JA 2L4HA 2WCEA 3OB2B 5D7FA 2HQ8A 2M7LA 1K9PA 1ALWA 5AXIA 1SL7A 2BKIB 1M31A 4AOMA 2TN4A 3DF0A 2KFGA 2MA2A 2LMVA 4FTGA 1DTLA 3O2PA 1NPQA 1C7WA 4GGNA 1XK4C 3TDIA 2MJWB 4E68A 3E3RA 3CR2A 5HLVA 3ZWHA 3TS5B 2MAZA 3BUOB 1B8LA 2K8MB 4TNCA 4XYNA 1LVCD 1OQPA 3BYAA 4QJ5B 4YGAA 3LK0A 2V53A 1X02A 4NQGA 4PHKA 3TUYB 3FWBA 1HT9A 2WCBA 3D0YB 3EK4A 5HLOA 1IH0A 4WQ3A 1QIWA 3PFVA 4AQIA 2EC6B 1N65A 1B47A 1CLMA 1M39A 4PE7A 4DUQA 1W7IB 1F8HA 1DJHA 3IF7A 5I2LA 1J7QA 2ZN8A 3TDZA 1ZOTB 2M9GA 1UHNA 1JWDA 5DKRA 4P2YB 4IL1A 2RGIA 2D8NA 1D1OA 1JC2A 1NCXA 2LVIA 2LHIA 1JFJA 3PM8A 2KDHA 4ETOA 1CMFA 5JOLA 1F71A 1OZSA 4YI9A 1MXLC 3EK7A 2PALA 3CS1A 1RWYA 1PVAA 1UHJA 1NYAA 1GGWA 1SR6C 3ZNIA 4OKHA 4XJKB 2JRFA 2SCPA 2JTZA 2KFHA 1SY9A 1MWNA 2KSPA 4PDZA 4ORAB 1YX7A 2MHHA 2M0RA 2OTGB 1F54A 1A75B 2KGBC 2ZNEA 2CCMA 3PLFB 1OOJA 2KYFA 4GFTA 1EJ3A 3TZ1A 1AHRA 1SMGA 2CNPA 1IJ5A 2K7DA 3H4SE 3PN7C 4MRXA 1SCMC 1LKJA 2EGDA 1EXRA 1PSBA 1YUSA 3MSEB 3EKHA 1MQ1A 3GOFA 3OHMB 5FYXA 3EVRA 3GK1A 1GGZA 1CB1A 1QATA 1M63B 4CPVA 1XFXO 2CTNA 1F4QA 1MUXA 1S6CA 2I7AA 3OX5A 2OS8B 1QVIY 1DJXA 5CSJA 2FCDA 1N2DA 2BE6A 1F55A 3SG7A 1J55A 3TS5C 5PALA 1PK0D 2Q91A 3OB1B 4C0JA 2L0PA 2K2FA 2F8PA 1BF5A 4N1GA 2JZIA 3AKAA 1H8BA 4MN0A 3LL8B 1CLLA 3TUYC 2I2RE 2GGZA 2ZRTA 1YX8A 1ZUZA 1CDMA 1XFWO 3BOWB 1CFPA 2KBMA 4HSZA 4I5JA 1NSHA 3CWGA 2BCBA 1YVHA 2EC6C 4ZCUA 1QJTA 1BMOA 4YGDB 1B7TY 2JTTA 4MRYA 2F3ZA 3D0YA 2JWWA 1EH2A 1BR1B 4USLA 1YRTB 2PSRA 4OCIA 2KAXA 3DVKA 3EVUA 3I5HB 5AANA 2HPSA 1RROA 2LMTA 1LINA 1YRUB 2MLEC 4NDDA 2KBIA 4NDBA 3RM1A 1AUIB 2KAYA 3BUMB 2AMIA 1CDNA 1SK6D 3EK8A 1ALVA 4DIRA 1OMRA 2M8UA 3I5IB 2LUXA 2BBMA 1BOCA 1RECA 1TRFA 5HYDA 4UPGA 1BT6A 1MF8B 2BCAA 4MSPA 3WNXB 1CFFA 4ORBB 1XFZO 3FS7A 1BG1A 1FW4A 2OTGC 4C0KA 2DOQA 2I94A 4XJKA 4M2QA 2CBLA 1Q80A 3HCMA 1H4BA 1NX1A 5TNCA 1CNPA 2F3YA 2KI6D 1A75A 1WRZA 1XA5A 2JOJA 1PRWA 1OMDA 1SBJA 2QACA 3I5FB 1AVSA 4N1FA 2HQWA 1R6PA 1Y1AA 1NWDA 1J1DA 2LCPA 3OP0A 4GNKB 3KPXA 1JFKA 1K93D 1J1EA 1DJGA 1XO5A 2JT8A 1TTXA 2FCEA 2OS8C 1S5GZ 2LAPA 1C07A 1S3PA 1DVIA 2LVVA 1XK4A 1NCYA 3O6BA 4PE0A 1OE9B 1TCOB 2K61A 4YGEB 4CLNA 1XFUO 1B4CA 1XVJA 2ISDA 3BXKA 1IQ5A 1TOPA 1KK7Y 1A4PA 1K90D 1AJ4A 1KQMB 4YBHB 3M0WA 5G08A 3TDUA 1FBVA 2KGRA 2LP3A 2LVKA 2BECA 4PALA 1PALA 1B8RA 1CDPA 2LV7A 4HREE 2M97A 2BL0B 1JF2A 1NP8A 3WHTB 1PSRA 4GGFC 1DJIA 1QVIZ 5ER5A 3NXAA 1M45A 2LVJA 3BOWA 1S36A 4MZLA 2KHNA 4HRGA 2OPOA 1G33A 1U5IB 1JUOA 4OR9B 3I5HC 4GGFA 4HRHA 1HQVA 1ZMZA 4GAOA 3FIAA 4A4BA 4CFQA 2HETA 1EG4A 5K89A 1A29A 1OMVA 3KEVA 1M46A 1CM1A 2JNXA 2E30A 1BR4B 1WDCB 2FOTA 3NSKA 1QS7A 1QV0A 2BKHB 1SW8A 1NX0A 1IG5A 3I5IC 3WHUB 5I2OA 2KQ6A 4M2OA 3SG4A 5KSZA 2H2KA 2Y1NA 1S5GY 1NCZA 1KSMA 2NCOA 1SL8A 2Y5IA 4MEWA 3AKBA 1QLKA 1W7JB 2JXLA 2LE9B 1B7TZ 2L4IA 5CSNA 5CSFA 1K9KA 3I5GB 3DVEA 2K0JA 2LUCA 5BPJA 1NX2A 5DKQA 1QIVA 4JPZB 3PATA 1TNQA 4F0ZB 2LHLA 4PHMA 2LANA 3PALA 3DVJA 1SPYA 1S6IA 3I5FC 2F33A 1IQ3A 2LM5A 2CT9A 2IS9A 3IQOA 1IJ6A 4GUKA 1CFDA 3NSOA 1QTXA 4DS7A 2WC8A 2ZKMX 5I8NA 1F4OA 2LLSA 1NX3A 4C0LA 1UUSA 1RFJA 1TNPA 4JWQA 2WOSA 2ZN9A 1FF1A 1ZACA 1JF0A 2NLNA 1JSAA 4WQ2A 2G2BA 1Y6WA 2KYCA 2JU0A 2LMUA 3SG2A 1YTZC 2E6WA 2NXQA 3EKJA 5JJGA 2WCFA 1S1EA 1KQMC 3VRNA 5KU1A 2QPTA 3NSLA 1BODA 2LP2A 2KFFA 2WNDA 2MLFC 1TNWA 3RLZA 4OVNF 2BL0C 1QXPA 1KFXS 2KI6C 5KTYA 4OV2A 1PVBA 1FI5A 1KCYA 1K9UA 2I18A 1V1FA 2GGMA 1E8AA 1WY9A 4P5OE 2MBXA 1DGUA 1OSAA 2L5XB 4L9MA 3CLNA 2M7NA 1KK7Z 1TN4A 1L2OB 2M29A 2KI4B 1IKUA 1WDCC 1J7RA 5J3XA 3CR5X 1U5IA 3VGOA 4ZCVA 1WLZA 1V1GA 3CZTX 3ICBA 3O78A 1JBAA 3SIAA 2BCXA 2JC2A 4GBAA 2EHBA 3D10A 2K7BA 1NIWA 3BQ3A 3LK1A 1FI6A 3FWCA 2K2AA 4PHNA 1CDLA 3I5GC 1R2UA 1SRAA 4WRIA 1IRJA 1KWOB 1QV1A 5AFPA 1PULA 1RK9A 1XFVO 2JT3A 1KK8B 3GK2A 1BJFA 2O5GA 3HX4A 1UWOA 2L98A 1ODBA 3PSRA 4CIDA 1B9AA 1QX7A 1LA0A 2L51A 2JT0A 1CKKA 2KNEA 2PRUA 4AQJA 3GK4X 3SG5A 3VRPA 1LA3A 3K21A 3SJSA 1TIZA 1J7OA 2K7CA 3A8RA 2JQ6A 2SASA 1UHHA 1YUTA 2PASA 2F2OA 5AERA 3CGAA 2JULA 3WXAA 1UHKA 3SG3A 2BBNA 2L50A 5CSIA 5B8IB 4MZJA 1RJVA 1YVLA 1TCFA 5F6TA 2JXCA 2Q4UA 1G8IA 2ZRSA 3OX6A 4CFRA 1SYMA 1BLQA 2NCPA 1SNLA 2Y4QA 1IWQA 4JQ0D 1CM4A 4NDCA 2M1UA 2WORA 2KQYA 1CLBA 3KO0A 2CXJA 2H61C 5HKYA 1K94A 1L7ZA 1N0YA 1UURA 1Y1UA 1AJ5A 1MR8A 1K96A 4QJ4B 5IBWA 1DJZA 3QRXA 1QLSA 2FJUB 3NSIA 1LXFC 1QX2A 2AUCA 2G9BA 1KFUS 4I5NB 2COLB 1WRKA 2H61A 2LLTA 1WLMA 3LLEA 2PVBA 2LLUA 1GJYA 2AAOA 3JTDB 3JVTB 2LNKA 4R1EA 1L2OC 2KI4C 1XFYO 2F2PA 2KOTA 4GPLB 2HF5A 1DF0B 1KFXL 2VRGA 1A2XA 1CFCA 1OZOA 2BE4A 3VRQA 4BY4A 5ER4X 4YI8A 1YUUA 3BUNB 3VROA 1NUBA 1XYDA 5AEQA 1KWOC 4DRWA 4D1EA 2K7OA 4ICBA 3DF0B 3KHEA 2ZFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DJW A;  1S6J A;  5DKN A;  3DD4 A;  2JPT A;  1MXE A;  4I5L B;  1F70 A;  2GV5 A;  1QX5 B;  1KK8 C;  3SIB A;  3C1V A;  1B8C A;  3F45 A;  4U8D A;  3BUX B;  4ORC B;  1K95 A;  3IQQ A;  1WRL A;  1G4Y R;  4MZK A;  1B1G A;  1DMO A;  2M49 B;  2M1K B;  2R2I A;  1FPW A;  4QJ3 B;  2LC5 A;  3A4U B;  4PE4 A;  5I2Q A;  4FQO A;  3KF9 A;  1Y1X A;  2O60 A;  1MHO A;  1CTR A;  3SG6 A;  1VRK A;  1KQV A;  4DCK A;  1RTP 1;  1GQM A;  5HKZ A;  2M3W A;  2PMY A;  1K8U A;  4I5K A;  4PE1 A;  1A03 A;  4PHJ A;  5GQQ C;  3EVV A;  1BU3 A;  1YUR A;  1SL9 A;  2ZND A;  1DJY A;  1UHI A;  2MRD A;  3AAJ A;  1UP5 A;  1C7V A;  1ZFS A;  3BUW B;  3CTN A;  1TNX A;  3AAK A;  4MLW A;  1EG3 A;  2NZ0 A;  4YGC B;  1IGV A;  1K2H A;  3O4Y A;  3JTD C;  1SCV A;  2Y1M A;  3JVT C;  4YRU A;  1YR5 A;  4M2P A;  5D69 A;  2KAV A;  1AP4 A;  4MBE A;  4N5X A;  1Y0V H;  1CMG A;  4A4C A;  3DVM A;  2B1U A;  1SR6 B;  1QAS A;  2JNF A;  4PCW A;  1S26 D;  1DGV A;  2L2E A;  4Q04 A;  3VRR A;  1DT7 B;  1SKT A;  3LCP C;  5HKW A;  2P6B B;  1KSO A;  4BY5 A;  1AK8 A;  1DF0 A;  1KFU L;  5CPV A;  4MVF A;  1J7P A;  3CR4 X;  3PN7 B;  1EL4 A;  1SCM B;  4YGB B;  2A4J A;  2L4H A;  2WCE A;  3OB2 B;  5D7F A;  2HQ8 A;  2M7L A;  1K9P A;  1ALW A;  5AXI A;  1SL7 A;  2BKI B;  1M31 A;  4AOM A;  2TN4 A;  3DF0 A;  2KFG A;  2MA2 A;  2LMV A;  4FTG A;  1DTL A;  3O2P A;  1NPQ A;  1C7W A;  4GGN A;  1XK4 C;  3TDI A;  2MJW B;  4E68 A;  3E3R A;  3CR2 A;  5HLV A;  3ZWH A;  3TS5 B;  2MAZ A;  3BUO B;  1B8L A;  2K8M B;  4TNC A;  4XYN A;  1LVC D;  1OQP A;  3BYA A;  4QJ5 B;  4YGA A;  3LK0 A;  2V53 A;  1X02 A;  4NQG A;  4PHK A;  3TUY B;  3FWB A;  1HT9 A;  2WCB A;  3D0Y B;  3EK4 A;  5HLO A;  1IH0 A;  4WQ3 A;  1QIW A;  3PFV A;  4AQI A;  2EC6 B;  1N65 A;  1B47 A;  1CLM A;  1M39 A;  4PE7 A;  4DUQ A;  1W7I B;  1F8H A;  1DJH A;  3IF7 A;  5I2L A;  1J7Q A;  2ZN8 A;  3TDZ A;  1ZOT B;  2M9G A;  1UHN A;  1JWD A;  5DKR A;  4P2Y B;  4IL1 A;  2RGI A;  2D8N A;  1D1O A;  1JC2 A;  1NCX A;  2LVI A;  2LHI A;  1JFJ A;  3PM8 A;  2KDH A;  4ETO A;  1CMF A;  5JOL A;  1F71 A;  1OZS A;  4YI9 A;  1MXL C;  3EK7 A;  2PAL A;  3CS1 A;  1RWY A;  1PVA A;  1UHJ A;  1NYA A;  1GGW A;  1SR6 C;  3ZNI A;  4OKH A;  4XJK B;  2JRF A;  2SCP A;  2JTZ A;  2KFH A;  1SY9 A;  1MWN A;  2KSP A;  4PDZ A;  4ORA B;  1YX7 A;  2MHH A;  2M0R A;  2OTG B;  1F54 A;  1A75 B;  2KGB C;  2ZNE A;  2CCM A;  3PLF B;  1OOJ A;  2KYF A;  4GFT A;  1EJ3 A;  3TZ1 A;  1AHR A;  1SMG A;  2CNP A;  1IJ5 A;  2K7D A;  3H4S E;  3PN7 C;  4MRX A;  1SCM C;  1LKJ A;  2EGD A;  1EXR A;  1PSB A;  1YUS A;  3MSE B;  3EKH A;  1MQ1 A;  3GOF A;  3OHM B;  5FYX A;  3EVR A;  3GK1 A;  1GGZ A;  1CB1 A;  1QAT A;  1M63 B;  4CPV A;  1XFX O;  2CTN A;  1F4Q A;  1MUX A;  1S6C A;  2I7A A;  3OX5 A;  2OS8 B;  1QVI Y;  1DJX A;  5CSJ A;  2FCD A;  1N2D A;  2BE6 A;  1F55 A;  3SG7 A;  1J55 A;  3TS5 C;  5PAL A;  1PK0 D;  2Q91 A;  3OB1 B;  4C0J A;  2L0P A;  2K2F A;  2F8P A;  1BF5 A;  4N1G A;  2JZI A;  3AKA A;  1H8B A;  4MN0 A;  3LL8 B;  1CLL A;  3TUY C;  2I2R E;  2GGZ A;  2ZRT A;  1YX8 A;  1ZUZ A;  1CDM A;  1XFW O;  3BOW B;  1CFP A;  2KBM A;  4HSZ A;  4I5J A;  1NSH A;  3CWG A;  2BCB A;  1YVH A;  2EC6 C;  4ZCU A;  1QJT A;  1BMO A;  4YGD B;  1B7T Y;  2JTT A;  4MRY A;  2F3Z A;  3D0Y A;  2JWW A;  1EH2 A;  1BR1 B;  4USL A;  1YRT B;  2PSR A;  4OCI A;  2KAX A;  3DVK A;  3EVU A;  3I5H B;  5AAN A;  2HPS A;  1RRO A;  2LMT A;  1LIN A;  1YRU B;  2MLE C;  4NDD A;  2KBI A;  4NDB A;  3RM1 A;  1AUI B;  2KAY A;  3BUM B;  2AMI A;  1CDN A;  1SK6 D;  3EK8 A;  1ALV A;  4DIR A;  1OMR A;  2M8U A;  3I5I B;  2LUX A;  2BBM A;  1BOC A;  1REC A;  1TRF A;  5HYD A;  4UPG A;  1BT6 A;  1MF8 B;  2BCA A;  4MSP A;  3WNX B;  1CFF A;  4ORB B;  1XFZ O;  3FS7 A;  1BG1 A;  1FW4 A;  2OTG C;  4C0K A;  2DOQ A;  2I94 A;  4XJK A;  4M2Q A;  2CBL A;  1Q80 A;  3HCM A;  1H4B A;  1NX1 A;  5TNC A;  1CNP A;  2F3Y A;  2KI6 D;  1A75 A;  1WRZ A;  1XA5 A;  2JOJ A;  1PRW A;  1OMD A;  1SBJ A;  2QAC A;  3I5F B;  1AVS A;  4N1F A;  2HQW A;  1R6P A;  1Y1A A;  1NWD A;  1J1D A;  2LCP A;  3OP0 A;  4GNK B;  3KPX A;  1JFK A;  1K93 D;  1J1E A;  1DJG A;  1XO5 A;  2JT8 A;  1TTX A;  2FCE A;  2OS8 C;  1S5G Z;  2LAP A;  1C07 A;  1S3P A;  1DVI A;  2LVV A;  1XK4 A;  1NCY A;  3O6B A;  4PE0 A;  1OE9 B;  1TCO B;  2K61 A;  4YGE B;  4CLN A;  1XFU O;  1B4C A;  1XVJ A;  2ISD A;  3BXK A;  1IQ5 A;  1TOP A;  1KK7 Y;  1A4P A;  1K90 D;  1AJ4 A;  1KQM B;  4YBH B;  3M0W A;  5G08 A;  3TDU A;  1FBV A;  2KGR A;  2LP3 A;  2LVK A;  2BEC A;  4PAL A;  1PAL A;  1B8R A;  1CDP A;  2LV7 A;  4HRE E;  2M97 A;  2BL0 B;  1JF2 A;  1NP8 A;  3WHT B;  1PSR A;  4GGF C;  1DJI A;  1QVI Z;  5ER5 A;  3NXA A;  1M45 A;  2LVJ A;  3BOW A;  1S36 A;  4MZL A;  2KHN A;  4HRG A;  2OPO A;  1G33 A;  1U5I B;  1JUO A;  4OR9 B;  3I5H C;  4GGF A;  4HRH A;  1HQV A;  1ZMZ A;  4GAO A;  3FIA A;  4A4B A;  4CFQ A;  2HET A;  1EG4 A;  5K89 A;  1A29 A;  1OMV A;  3KEV A;  1M46 A;  1CM1 A;  2JNX A;  2E30 A;  1BR4 B;  1WDC B;  2FOT A;  3NSK A;  1QS7 A;  1QV0 A;  2BKH B;  1SW8 A;  1NX0 A;  1IG5 A;  3I5I C;  3WHU B;  5I2O A;  2KQ6 A;  4M2O A;  3SG4 A;  5KSZ A;  2H2K A;  2Y1N A;  1S5G Y;  1NCZ A;  1KSM A;  2NCO A;  1SL8 A;  2Y5I A;  4MEW A;  3AKB A;  1QLK A;  1W7J B;  2JXL A;  2LE9 B;  1B7T Z;  2L4I A;  5CSN A;  5CSF A;  1K9K A;  3I5G B;  3DVE A;  2K0J A;  2LUC A;  5BPJ A;  1NX2 A;  5DKQ A;  1QIV A;  4JPZ B;  3PAT A;  1TNQ A;  4F0Z B;  2LHL A;  4PHM A;  2LAN A;  3PAL A;  3DVJ A;  1SPY A;  1S6I A;  3I5F C;  2F33 A;  1IQ3 A;  2LM5 A;  2CT9 A;  2IS9 A;  3IQO A;  1IJ6 A;  4GUK A;  1CFD A;  3NSO A;  1QTX A;  4DS7 A;  2WC8 A;  2ZKM X;  5I8N A;  1F4O A;  2LLS A;  1NX3 A;  4C0L A;  1UUS A;  1RFJ A;  1TNP A;  4JWQ A;  2WOS A;  2ZN9 A;  1FF1 A;  1ZAC A;  1JF0 A;  2NLN A;  1JSA A;  4WQ2 A;  2G2B A;  1Y6W A;  2KYC A;  2JU0 A;  2LMU A;  3SG2 A;  1YTZ C;  2E6W A;  2NXQ A;  3EKJ A;  5JJG A;  2WCF A;  1S1E A;  1KQM C;  3VRN A;  5KU1 A;  2QPT A;  3NSL A;  1BOD A;  2LP2 A;  2KFF A;  2WND A;  2MLF C;  1TNW A;  3RLZ A;  4OVN F;  2BL0 C;  1QXP A;  1KFX S;  2KI6 C;  5KTY A;  4OV2 A;  1PVB A;  1FI5 A;  1KCY A;  1K9U A;  2I18 A;  1V1F A;  2GGM A;  1E8A A;  1WY9 A;  4P5O E;  2MBX A;  1DGU A;  1OSA A;  2L5X B;  4L9M A;  3CLN A;  2M7N A;  1KK7 Z;  1TN4 A;  1L2O B;  2M29 A;  2KI4 B;  1IKU A;  1WDC C;  1J7R A;  5J3X A;  3CR5 X;  1U5I A;  3VGO A;  4ZCV A;  1WLZ A;  1V1G A;  3CZT X;  3ICB A;  3O78 A;  1JBA A;  3SIA A;  2BCX A;  2JC2 A;  4GBA A;  2EHB A;  3D10 A;  2K7B A;  1NIW A;  3BQ3 A;  3LK1 A;  1FI6 A;  3FWC A;  2K2A A;  4PHN A;  1CDL A;  3I5G C;  1R2U A;  1SRA A;  4WRI A;  1IRJ A;  1KWO B;  1QV1 A;  5AFP A;  1PUL A;  1RK9 A;  1XFV O;  2JT3 A;  1KK8 B;  3GK2 A;  1BJF A;  2O5G A;  3HX4 A;  1UWO A;  2L98 A;  1ODB A;  3PSR A;  4CID A;  1B9A A;  1QX7 A;  1LA0 A;  2L51 A;  2JT0 A;  1CKK A;  2KNE A;  2PRU A;  4AQJ A;  3GK4 X;  3SG5 A;  3VRP A;  1LA3 A;  3K21 A;  3SJS A;  1TIZ A;  1J7O A;  2K7C A;  3A8R A;  2JQ6 A;  2SAS A;  1UHH A;  1YUT A;  2PAS A;  2F2O A;  5AER A;  3CGA A;  2JUL A;  3WXA A;  1UHK A;  3SG3 A;  2BBN A;  2L50 A;  5CSI A;  5B8I B;  4MZJ A;  1RJV A;  1YVL A;  1TCF A;  5F6T A;  2JXC A;  2Q4U A;  1G8I A;  2ZRS A;  3OX6 A;  4CFR A;  1SYM A;  1BLQ A;  2NCP A;  1SNL A;  2Y4Q A;  1IWQ A;  4JQ0 D;  1CM4 A;  4NDC A;  2M1U A;  2WOR A;  2KQY A;  1CLB A;  3KO0 A;  2CXJ A;  2H61 C;  5HKY A;  1K94 A;  1L7Z A;  1N0Y A;  1UUR A;  1Y1U A;  1AJ5 A;  1MR8 A;  1K96 A;  4QJ4 B;  5IBW A;  1DJZ A;  3QRX A;  1QLS A;  2FJU B;  3NSI A;  1LXF C;  1QX2 A;  2AUC A;  2G9B A;  1KFU S;  4I5N B;  2COL B;  1WRK A;  2H61 A;  2LLT A;  1WLM A;  3LLE A;  2PVB A;  2LLU A;  1GJY A;  2AAO A;  3JTD B;  3JVT B;  2LNK A;  4R1E A;  1L2O C;  2KI4 C;  1XFY O;  2F2P A;  2KOT A;  4GPL B;  2HF5 A;  1DF0 B;  1KFX L;  2VRG A;  1A2X A;  1CFC A;  1OZO A;  2BE4 A;  3VRQ A;  4BY4 A;  5ER4 X;  4YI8 A;  1YUU A;  3BUN B;  3VRO A;  1NUB A;  1XYD A;  5AEQ A;  1KWO C;  4DRW A;  4D1E A;  2K7O A;  4ICB A;  3DF0 B;  3KHE A;  2ZFD A; 
#chains in the Genus database with same CATH topology
 1DJW A;  1S6J A;  5DKN A;  3DD4 A;  2JPT A;  1MXE A;  3L4A A;  4I5L B;  1F70 A;  3R1P A;  2GV5 A;  1QX5 B;  1KK8 C;  3SIB A;  3C1V A;  1B8C A;  3F45 A;  4U8D A;  3BUX B;  4ORC B;  1K95 A;  3IQQ A;  1WRL A;  1G4Y R;  4MZK A;  1B1G A;  1DMO A;  2M49 B;  2M1K B;  2R2I A;  1FPW A;  1IIO A;  4QJ3 B;  2LC5 A;  3A4U B;  1TWO A;  4PE4 A;  3UO9 A;  4FQO A;  5I2Q A;  3KF9 A;  1Y1X A;  2O60 A;  1MHO A;  1CTR A;  3VB1 A;  3SG6 A;  1VRK A;  1KQV A;  4DCK A;  5DIC A;  1RTP 1;  1GQM A;  5HKZ A;  2M3W A;  2WC6 A;  2PMY A;  1K8U A;  2QDI A;  4I5K A;  4FQT A;  4PE1 A;  1A03 A;  4PHJ A;  5GQQ C;  3EVV A;  1BU3 A;  1YUR A;  2KPH A;  1SL9 A;  2ZND A;  1DJY A;  1UHI A;  2MRD A;  3AAJ A;  1UP5 A;  1C3Z A;  1C7V A;  1ZFS A;  3BUW B;  3CTN A;  1TNX A;  3AAK A;  4MLW A;  1EG3 A;  2NZ0 A;  4YGC B;  1IGV A;  3S0D A;  1K2H A;  3O4Y A;  3JTD C;  1SCV A;  2Y1M A;  3JVT C;  4YRU A;  1YR5 A;  4M2P A;  5D69 A;  2KAV A;  1AP4 A;  4MBE A;  4N5X A;  1Y0V H;  1CMG A;  4A4C A;  1TUJ A;  3DVM A;  2B1U A;  1SR6 B;  3S0A A;  1QAS A;  2JNF A;  4PCW A;  1S26 D;  1DGV A;  2L2E A;  2WCL A;  4Q04 A;  3N7H A;  3VRR A;  1DT7 B;  1SKT A;  3LCP C;  5HKW A;  2P6B B;  1KSO A;  3EG5 B;  4BY5 A;  3NHI A;  1DF0 A;  1AK8 A;  1KFU L;  3CZ0 A;  5CPV A;  4MVF A;  1J7P A;  3CR4 X;  3PN7 B;  1EL4 A;  1SCM B;  4YGB B;  2A4J A;  2L4H A;  2WCE A;  3OB2 B;  3Q8I A;  5D7F A;  2HQ8 A;  2M7L A;  1K9P A;  1ALW A;  5AXI A;  1SL7 A;  1XFR A;  2BKI B;  1M31 A;  4AOM A;  2TN4 A;  3DF0 A;  2KFG A;  2MA2 A;  2LMV A;  3QME A;  4FTG A;  3BFA A;  1DTL A;  3O2P A;  1NPQ A;  1C7W A;  4GGN A;  1XK4 C;  3TDI A;  2MJW B;  4E68 A;  3E3R A;  3CR2 A;  5HLV A;  3ZWH A;  3TS5 B;  2MAZ A;  3BUO B;  1B8L A;  2K8M B;  3CZ1 A;  4TNC A;  4XYN A;  1LVC D;  1OQP A;  3BYA A;  4QJ5 B;  4YGA A;  3K1E A;  3LK0 A;  2V53 A;  1X02 A;  4NQG A;  4PHK A;  5I94 A;  3TUY B;  3FWB A;  1HT9 A;  2WCB A;  3D0Y B;  3EK4 A;  5HLO A;  1IH0 A;  2L2C A;  4WQ3 A;  1QIW A;  3PFV A;  4AQI A;  2EC6 B;  1N65 A;  1B47 A;  1CLM A;  3FE8 A;  1M39 A;  4PE7 A;  4DUQ A;  1W7I B;  1F8H A;  1DJH A;  3IF7 A;  5I2L A;  1J7Q A;  2ZN8 A;  3TDZ A;  1ZOT B;  2M9G A;  1UHN A;  1JWD A;  5DKR A;  3PM2 A;  4P2Y B;  4IL1 A;  2RGI A;  2D8N A;  1D1O A;  3SS4 A;  1JC2 A;  1NCX A;  2LVI A;  2L5Y A;  2LHI A;  3D78 A;  1JFJ A;  3R1V A;  3PM8 A;  2KDH A;  4ETO A;  1CMF A;  2K60 A;  5JOL A;  3SS5 A;  1F71 A;  1OZS A;  4YI9 A;  1MXL C;  3EK7 A;  2PAL A;  3CS1 A;  1RWY A;  1PVA A;  1UHJ A;  1NYA A;  1GGW A;  1SR6 C;  3ZNI A;  4OKH A;  4XJK B;  2JRF A;  2SCP A;  2JTZ A;  2KFH A;  1SY9 A;  3D76 A;  1MWN A;  2KSP A;  4PDZ A;  4ORA B;  1YX7 A;  1J7O A;  2MHH A;  2M0R A;  2OTG B;  1F54 A;  1A75 B;  2KGB C;  2ZNE A;  2CCM A;  3PLF B;  1OOJ A;  2KYF A;  1T14 A;  4GFT A;  1EJ3 A;  3TZ1 A;  1AHR A;  1SMG A;  2CNP A;  1IJ5 A;  2K7D A;  3H4S E;  3PN7 C;  4INX A;  1SCM C;  1LKJ A;  4MRX A;  2EGD A;  1EXR A;  1PSB A;  1YUS A;  3MSE B;  3DYE A;  3EKH A;  1MQ1 A;  3GOF A;  3OHM B;  5FYX A;  4IJ7 A;  3EVR A;  3GK1 A;  3UNW A;  1GGZ A;  1CB1 A;  1QAT A;  1M63 B;  4CPV A;  1XFX O;  2CTN A;  5EL2 A;  1F4Q A;  1MUX A;  1S6C A;  2I7A A;  3OX5 A;  1GM0 A;  2OS8 B;  1QVI Y;  1DJX A;  5CSJ A;  2FCD A;  1N2D A;  1Z4H A;  2BE6 A;  3SG7 A;  1F55 A;  1J55 A;  3TS5 C;  1P28 A;  5PAL A;  1PK0 D;  2Q91 A;  3OB1 B;  4C0J A;  2L0P A;  2WCJ A;  2K2F A;  2F8P A;  1BF5 A;  4N1G A;  2JZI A;  3AKA A;  1H8B A;  4MN0 A;  3LL8 B;  1ORG A;  1CLL A;  3TUY C;  2I2R E;  2GGZ A;  2ZRT A;  1YX8 A;  1ZUZ A;  1CDM A;  1XFW O;  3BOW B;  1CFP A;  2KBM A;  3BJH A;  4HSZ A;  4I5J A;  1NSH A;  3CWG A;  2BCB A;  1YVH A;  2EC6 C;  4ZCU A;  1QJT A;  3OGN A;  3CAB A;  3FE6 A;  1BMO A;  4YGD B;  3B88 A;  2WCM A;  1B7T Y;  2JTT A;  4MRY A;  2F3Z A;  3D0Y A;  2JWW A;  1EH2 A;  1BR1 B;  4USL A;  1YRT B;  2PSR A;  4OCI A;  2KAX A;  3DVK A;  5D3O A;  3EVU A;  3I5H B;  5AAN A;  2HPS A;  1RRO A;  2LMT A;  1LIN A;  1YRU B;  2MLE C;  4NDD A;  2KBI A;  4NDB A;  3RM1 A;  1AUI B;  2KAY A;  3BUM B;  2AMI A;  1CDN A;  1SK6 D;  3EK8 A;  1ALV A;  4DIR A;  1OMR A;  2M8U A;  3I5I B;  2LUX A;  2BBM A;  2QEO A;  2BNX A;  1BOC A;  1REC A;  1TRF A;  5HYD A;  4UPG A;  3FE9 A;  1BT6 A;  1MF8 B;  2BCA A;  4MSP A;  3WNX B;  1CFF A;  4ORB B;  1XFZ O;  3FS7 A;  1BG1 A;  1FW4 A;  2OTG C;  4C0K A;  2DOQ A;  2I94 A;  4XJK A;  4M2Q A;  1DEK A;  2CBL A;  1Q80 A;  2P71 A;  3HCM A;  1H4B A;  1NX1 A;  5TNC A;  1CNP A;  2F3Y A;  2KI6 D;  1A75 A;  1W9Z A;  1WRZ A;  1XA5 A;  3R1O A;  4F7F A;  2JOJ A;  1PRW A;  1OMD A;  1SBJ A;  2PYQ A;  2QAC A;  1AVS A;  3I5F B;  2HQW A;  4N1F A;  1R6P A;  2FJY A;  1Y1A A;  1NWD A;  1J1D A;  2LCP A;  3OP0 A;  4GNK B;  3KPX A;  1JFK A;  1K93 D;  1J1E A;  1DJG A;  1XO5 A;  2JT8 A;  1OOG A;  1TTX A;  2FCE A;  2OS8 C;  1S5G Z;  2LAP A;  1C07 A;  1S3P A;  1DVI A;  2LVV A;  1XK4 A;  1NCY A;  3O6B A;  1QWV A;  4PE0 A;  1OE9 B;  1TCO B;  2K61 A;  4YGE B;  4CLN A;  1XFU O;  1B4C A;  1XVJ A;  2ISD A;  3BXK A;  1IQ5 A;  3D73 A;  1TOP A;  1KK7 Y;  1A4P A;  1K90 D;  1AJ4 A;  1KQM B;  4YBH B;  3M0W A;  5G08 A;  3TDU A;  1FBV A;  1OOF A;  2KGR A;  2LP3 A;  2LVK A;  2BEC A;  2PQL A;  4PAL A;  3NGV A;  1PAL A;  1B8R A;  1CDP A;  2LV7 A;  4HRE E;  2M97 A;  2BL0 B;  4INW A;  1JF2 A;  1NP8 A;  3WHT B;  1PSR A;  4GGF C;  1DJI A;  1QVI Z;  5ER5 A;  3NXA A;  1M45 A;  2LVJ A;  3BOW A;  1S36 A;  4MZL A;  2QEB A;  2KHN A;  4HRG A;  2P70 A;  2OPO A;  1G33 A;  1U5I B;  1DC1 A;  1JUO A;  4OR9 B;  3I5H C;  2JPO A;  4GGF A;  4HRH A;  1HQV A;  1ZMZ A;  4GAO A;  3FIA A;  4A4B A;  4CFQ A;  2HET A;  1EG4 A;  5K89 A;  1A29 A;  1OMV A;  3RZS A;  3CYZ A;  1M46 A;  3KEV A;  1CM1 A;  2JNX A;  2E30 A;  1BR4 B;  1WDC B;  2FOT A;  1TUZ A;  3NSK A;  3S0B A;  1QS7 A;  1QV0 A;  2BKH B;  3D74 A;  1SW8 A;  1NX0 A;  1IG5 A;  3I5I C;  4JD9 A;  3WHU B;  5I2O A;  2KQ6 A;  4M2O A;  3SG4 A;  1SSE B;  5KSZ A;  2H2K A;  2Y1N A;  1S5G Y;  1NCZ A;  1KSM A;  2NCO A;  1SL8 A;  2Y5I A;  4MEW A;  3AKB A;  1QLK A;  1W7J B;  2JXL A;  2LE9 B;  1B7T Z;  2L4I A;  5CSN A;  5CSF A;  1K9K A;  3I5G B;  1OOI X;  3DVE A;  1LS8 A;  2K0J A;  2LUC A;  4PT1 A;  5BPJ A;  1NX2 A;  5DKQ A;  1QIV A;  4JPZ B;  3PAT A;  1TNQ A;  3L47 A;  4F0Z B;  5FI7 A;  2LHL A;  4PHM A;  2LAN A;  3PAL A;  4JKT A;  3CDN A;  3DVJ A;  1SPY A;  1S6I A;  3I5F C;  2F33 A;  1IQ3 A;  2LM5 A;  2CT9 A;  2IS9 A;  3IQO A;  1IJ6 A;  4GUK A;  1CFD A;  3NSO A;  1QTX A;  4DS7 A;  2WC8 A;  2ZKM X;  5I8N A;  1F4O A;  2LLS A;  1NX3 A;  4C0L A;  1UUS A;  1RFJ A;  1TNP A;  5FI6 A;  4JWQ A;  2WOS A;  2ZN9 A;  1FF1 A;  1ZAC A;  1JF0 A;  2NLN A;  1JSA A;  4WQ2 A;  2G2B A;  1Y6W A;  2KYC A;  2JU0 A;  2LMU A;  4OZD A;  3SG2 A;  1YTZ C;  2E6W A;  2NXQ A;  3EKJ A;  3L4L A;  3V2L A;  3B7A A;  2WCF A;  5JJG A;  1S1E A;  1KQM C;  3VRN A;  2KLE A;  3PJI A;  5KU1 A;  2QPT A;  3NSL A;  3D77 A;  1BOD A;  2LP2 A;  2KFF A;  2WND A;  2MLF C;  1TNW A;  3RLZ A;  4OVN F;  1QXP A;  1KFX S;  2BL0 C;  2KI6 C;  5KTY A;  4OV2 A;  1PVB A;  2H8V A;  3R72 A;  1FI5 A;  1KCY A;  3CZ2 A;  1K9U A;  2I18 A;  1V1F A;  2GGM A;  2WCH A;  1E8A A;  1WY9 A;  3BFB A;  4P5O E;  2MBX A;  1DGU A;  3D75 A;  1OSA A;  2L5X B;  2YGU A;  3BFH A;  4L9M A;  3CLN A;  2M7N A;  5HL1 A;  1KK7 Z;  1TN4 A;  1L2O B;  2M29 A;  2KI4 B;  1IKU A;  1WDC C;  1J7R A;  5J3X A;  3CR5 X;  1U5I A;  2QEH A;  3VGO A;  4ZCV A;  1WLZ A;  1OOH A;  1V1G A;  3CZT X;  3ICB A;  3O78 A;  1JBA A;  3SIA A;  1Z2C B;  2BCX A;  2JC2 A;  4GBA A;  2EHB A;  3D10 A;  2K7B A;  1NIW A;  3BQ3 A;  2GTE A;  3LK1 A;  1FI6 A;  2BAP A;  3FWC A;  2K2A A;  4PHN A;  1CDL A;  3I5G C;  1R2U A;  1SRA A;  4WRI A;  1IRJ A;  1KWO B;  1QV1 A;  5AFP A;  1PUL A;  1RK9 A;  1XFV O;  2JT3 A;  1KK8 B;  3GK2 A;  1BJF A;  2O5G A;  3HX4 A;  1UWO A;  2L98 A;  1ODB A;  3PSR A;  4CID A;  1B9A A;  1QX7 A;  1LA0 A;  2L51 A;  2JT0 A;  1CKK A;  2KNE A;  2PRU A;  4AQJ A;  3GK4 X;  3SG5 A;  3VRP A;  1LA3 A;  3K21 A;  2WCK A;  1TIZ A;  3SJS A;  3S0F A;  2K7C A;  3A8R A;  2JQ6 A;  2SAS A;  3B87 A;  1UHH A;  1YUT A;  2PAS A;  1OW4 A;  2F2O A;  3B6X A;  5AER A;  3CGA A;  2JUL A;  3DZT A;  3WXA A;  1UHK A;  3SG3 A;  2BBN A;  1DQE A;  2L50 A;  5CSI A;  5B8I B;  4MZJ A;  1RJV A;  1YVL A;  1TCF A;  5F6T A;  2JXC A;  2Q4U A;  1G8I A;  2ZRS A;  3OX6 A;  4CFR A;  1SYM A;  1BLQ A;  2NCP A;  3NHT A;  1SNL A;  2Y4Q A;  1IWQ A;  4KYN A;  4JQ0 D;  3DY9 A;  3S0E A;  1DEL A;  1CM4 A;  3OBV A;  2M1U A;  2WOR A;  2KQY A;  3IVT A;  4NDC A;  1CLB A;  3DXL A;  2CXJ A;  3KO0 A;  3SS3 A;  2H61 C;  5HKY A;  1K94 A;  1L7Z A;  1N0Y A;  1UUR A;  3O4X A;  1Y1U A;  1AJ5 A;  1MR8 A;  2ERB A;  1K96 A;  4QJ4 B;  5IBW A;  1DJZ A;  3QRX A;  5FI2 A;  1QLS A;  2FJU B;  3NSI A;  1LXF C;  1QX2 A;  2AUC A;  2G9B A;  1KFU S;  3B86 A;  4I5N B;  2COL B;  1WRK A;  2H61 A;  2LLT A;  1WLM A;  3LLE A;  2PVB A;  2LLU A;  1GJY A;  2AAO A;  3JTD B;  3JVT B;  2LNK A;  4R1E A;  1L2O C;  2KI4 C;  1XFY O;  2F2P A;  2KOT A;  4GPL B;  2HF5 A;  1DF0 B;  1KFX L;  2VRG A;  1A2X A;  1CFC A;  1OZO A;  2QEV A;  3S0G A;  2BE4 A;  3VRQ A;  2KLD A;  4BY4 A;  5ER4 X;  4YI8 A;  1YUU A;  3BUN B;  3VRO A;  1NUB A;  1XYD A;  5AEQ A;  1KWO C;  4DRW A;  4D1E A;  2K7O A;  1C3Y A;  4ICB A;  3DF0 B;  2WC5 A;  3KHE A;  2ZFD A; 
#chains in the Genus database with same CATH homology
 1DJW A;  1S6J A;  5DKN A;  3DD4 A;  2JPT A;  1MXE A;  4I5L B;  1F70 A;  2GV5 A;  1QX5 B;  1KK8 C;  3SIB A;  3C1V A;  1B8C A;  3F45 A;  4U8D A;  3BUX B;  4ORC B;  1K95 A;  3IQQ A;  1WRL A;  1G4Y R;  4MZK A;  1B1G A;  1DMO A;  2M49 B;  2M1K B;  2R2I A;  1FPW A;  4QJ3 B;  2LC5 A;  3A4U B;  4PE4 A;  5I2Q A;  4FQO A;  3KF9 A;  1Y1X A;  2O60 A;  1MHO A;  1CTR A;  3SG6 A;  1VRK A;  1KQV A;  4DCK A;  1RTP 1;  1GQM A;  5HKZ A;  2M3W A;  2PMY A;  1K8U A;  4I5K A;  4PE1 A;  1A03 A;  4PHJ A;  5GQQ C;  3EVV A;  1BU3 A;  1YUR A;  1SL9 A;  2ZND A;  1DJY A;  1UHI A;  2MRD A;  3AAJ A;  1UP5 A;  1C7V A;  1ZFS A;  3BUW B;  3CTN A;  1TNX A;  3AAK A;  4MLW A;  1EG3 A;  2NZ0 A;  4YGC B;  1IGV A;  1K2H A;  3O4Y A;  3JTD C;  1SCV A;  2Y1M A;  3JVT C;  4YRU A;  1YR5 A;  4M2P A;  5D69 A;  2KAV A;  1AP4 A;  4MBE A;  4N5X A;  1Y0V H;  1CMG A;  4A4C A;  3DVM A;  2B1U A;  1SR6 B;  1QAS A;  2JNF A;  4PCW A;  1S26 D;  1DGV A;  2L2E A;  4Q04 A;  3VRR A;  1DT7 B;  1SKT A;  3LCP C;  5HKW A;  2P6B B;  1KSO A;  4BY5 A;  1AK8 A;  1DF0 A;  1KFU L;  5CPV A;  4MVF A;  1J7P A;  3CR4 X;  3PN7 B;  1EL4 A;  1SCM B;  4YGB B;  2A4J A;  2L4H A;  2WCE A;  3OB2 B;  5D7F A;  2HQ8 A;  2M7L A;  1K9P A;  1ALW A;  5AXI A;  1SL7 A;  2BKI B;  1M31 A;  4AOM A;  2TN4 A;  3DF0 A;  2KFG A;  2MA2 A;  2LMV A;  4FTG A;  1DTL A;  3O2P A;  1NPQ A;  1C7W A;  4GGN A;  1XK4 C;  3TDI A;  2MJW B;  4E68 A;  3E3R A;  3CR2 A;  5HLV A;  3ZWH A;  3TS5 B;  2MAZ A;  3BUO B;  1B8L A;  2K8M B;  4TNC A;  4XYN A;  1LVC D;  1OQP A;  3BYA A;  4QJ5 B;  4YGA A;  3LK0 A;  2V53 A;  1X02 A;  4NQG A;  4PHK A;  3TUY B;  3FWB A;  1HT9 A;  2WCB A;  3D0Y B;  3EK4 A;  5HLO A;  1IH0 A;  4WQ3 A;  1QIW A;  3PFV A;  4AQI A;  2EC6 B;  1N65 A;  1B47 A;  1CLM A;  1M39 A;  4PE7 A;  4DUQ A;  1W7I B;  1F8H A;  1DJH A;  3IF7 A;  5I2L A;  1J7Q A;  2ZN8 A;  3TDZ A;  1ZOT B;  2M9G A;  1UHN A;  1JWD A;  5DKR A;  4P2Y B;  4IL1 A;  2RGI A;  2D8N A;  1D1O A;  1JC2 A;  1NCX A;  2LVI A;  2LHI A;  1JFJ A;  3PM8 A;  2KDH A;  4ETO A;  1CMF A;  5JOL A;  1F71 A;  1OZS A;  4YI9 A;  1MXL C;  3EK7 A;  2PAL A;  3CS1 A;  1RWY A;  1PVA A;  1UHJ A;  1NYA A;  1GGW A;  1SR6 C;  3ZNI A;  4OKH A;  4XJK B;  2JRF A;  2SCP A;  2JTZ A;  2KFH A;  1SY9 A;  1MWN A;  2KSP A;  4PDZ A;  4ORA B;  1YX7 A;  2MHH A;  2M0R A;  2OTG B;  1F54 A;  1A75 B;  2KGB C;  2ZNE A;  2CCM A;  3PLF B;  1OOJ A;  2KYF A;  4GFT A;  1EJ3 A;  3TZ1 A;  1AHR A;  1SMG A;  2CNP A;  1IJ5 A;  2K7D A;  3H4S E;  3PN7 C;  4MRX A;  1SCM C;  1LKJ A;  2EGD A;  1EXR A;  1PSB A;  1YUS A;  3MSE B;  3EKH A;  1MQ1 A;  3GOF A;  3OHM B;  5FYX A;  3EVR A;  3GK1 A;  1GGZ A;  1CB1 A;  1QAT A;  1M63 B;  4CPV A;  1XFX O;  2CTN A;  1F4Q A;  1MUX A;  1S6C A;  2I7A A;  3OX5 A;  2OS8 B;  1QVI Y;  1DJX A;  5CSJ A;  2FCD A;  1N2D A;  2BE6 A;  1F55 A;  3SG7 A;  1J55 A;  3TS5 C;  5PAL A;  1PK0 D;  2Q91 A;  3OB1 B;  4C0J A;  2L0P A;  2K2F A;  2F8P A;  1BF5 A;  4N1G A;  2JZI A;  3AKA A;  1H8B A;  4MN0 A;  3LL8 B;  1CLL A;  3TUY C;  2I2R E;  2GGZ A;  2ZRT A;  1YX8 A;  1ZUZ A;  1CDM A;  1XFW O;  3BOW B;  1CFP A;  2KBM A;  4HSZ A;  4I5J A;  1NSH A;  3CWG A;  2BCB A;  1YVH A;  2EC6 C;  4ZCU A;  1QJT A;  1BMO A;  4YGD B;  1B7T Y;  2JTT A;  4MRY A;  2F3Z A;  3D0Y A;  2JWW A;  1EH2 A;  1BR1 B;  4USL A;  1YRT B;  2PSR A;  4OCI A;  2KAX A;  3DVK A;  3EVU A;  3I5H B;  5AAN A;  2HPS A;  1RRO A;  2LMT A;  1LIN A;  1YRU B;  2MLE C;  4NDD A;  2KBI A;  4NDB A;  3RM1 A;  1AUI B;  2KAY A;  3BUM B;  2AMI A;  1CDN A;  1SK6 D;  3EK8 A;  1ALV A;  4DIR A;  1OMR A;  2M8U A;  3I5I B;  2LUX A;  2BBM A;  1BOC A;  1REC A;  1TRF A;  5HYD A;  4UPG A;  1BT6 A;  1MF8 B;  2BCA A;  4MSP A;  3WNX B;  1CFF A;  4ORB B;  1XFZ O;  3FS7 A;  1BG1 A;  1FW4 A;  2OTG C;  4C0K A;  2DOQ A;  2I94 A;  4XJK A;  4M2Q A;  2CBL A;  1Q80 A;  3HCM A;  1H4B A;  1NX1 A;  5TNC A;  1CNP A;  2F3Y A;  2KI6 D;  1A75 A;  1WRZ A;  1XA5 A;  2JOJ A;  1PRW A;  1OMD A;  1SBJ A;  2QAC A;  3I5F B;  1AVS A;  4N1F A;  2HQW A;  1R6P A;  1Y1A A;  1NWD A;  1J1D A;  2LCP A;  3OP0 A;  4GNK B;  3KPX A;  1JFK A;  1K93 D;  1J1E A;  1DJG A;  1XO5 A;  2JT8 A;  1TTX A;  2FCE A;  2OS8 C;  1S5G Z;  2LAP A;  1C07 A;  1S3P A;  1DVI A;  2LVV A;  1XK4 A;  1NCY A;  3O6B A;  4PE0 A;  1OE9 B;  1TCO B;  2K61 A;  4YGE B;  4CLN A;  1XFU O;  1B4C A;  1XVJ A;  2ISD A;  3BXK A;  1IQ5 A;  1TOP A;  1KK7 Y;  1A4P A;  1K90 D;  1AJ4 A;  1KQM B;  4YBH B;  3M0W A;  5G08 A;  3TDU A;  1FBV A;  2KGR A;  2LP3 A;  2LVK A;  2BEC A;  4PAL A;  1PAL A;  1B8R A;  1CDP A;  2LV7 A;  4HRE E;  2M97 A;  2BL0 B;  1JF2 A;  1NP8 A;  3WHT B;  1PSR A;  4GGF C;  1DJI A;  1QVI Z;  5ER5 A;  3NXA A;  1M45 A;  2LVJ A;  3BOW A;  1S36 A;  4MZL A;  2KHN A;  4HRG A;  2OPO A;  1G33 A;  1U5I B;  1JUO A;  4OR9 B;  3I5H C;  4GGF A;  4HRH A;  1HQV A;  1ZMZ A;  4GAO A;  3FIA A;  4A4B A;  4CFQ A;  2HET A;  1EG4 A;  5K89 A;  1A29 A;  1OMV A;  3KEV A;  1M46 A;  1CM1 A;  2JNX A;  2E30 A;  1BR4 B;  1WDC B;  2FOT A;  3NSK A;  1QS7 A;  1QV0 A;  2BKH B;  1SW8 A;  1NX0 A;  1IG5 A;  3I5I C;  3WHU B;  5I2O A;  2KQ6 A;  4M2O A;  3SG4 A;  5KSZ A;  2H2K A;  2Y1N A;  1S5G Y;  1NCZ A;  1KSM A;  2NCO A;  1SL8 A;  2Y5I A;  4MEW A;  3AKB A;  1QLK A;  1W7J B;  2JXL A;  2LE9 B;  1B7T Z;  2L4I A;  5CSN A;  5CSF A;  1K9K A;  3I5G B;  3DVE A;  2K0J A;  2LUC A;  5BPJ A;  1NX2 A;  5DKQ A;  1QIV A;  4JPZ B;  3PAT A;  1TNQ A;  4F0Z B;  2LHL A;  4PHM A;  2LAN A;  3PAL A;  3DVJ A;  1SPY A;  1S6I A;  3I5F C;  2F33 A;  1IQ3 A;  2LM5 A;  2CT9 A;  2IS9 A;  3IQO A;  1IJ6 A;  4GUK A;  1CFD A;  3NSO A;  1QTX A;  4DS7 A;  2WC8 A;  2ZKM X;  5I8N A;  1F4O A;  2LLS A;  1NX3 A;  4C0L A;  1UUS A;  1RFJ A;  1TNP A;  4JWQ A;  2WOS A;  2ZN9 A;  1FF1 A;  1ZAC A;  1JF0 A;  2NLN A;  1JSA A;  4WQ2 A;  2G2B A;  1Y6W A;  2KYC A;  2JU0 A;  2LMU A;  3SG2 A;  1YTZ C;  2E6W A;  2NXQ A;  3EKJ A;  5JJG A;  2WCF A;  1S1E A;  1KQM C;  3VRN A;  5KU1 A;  2QPT A;  3NSL A;  1BOD A;  2LP2 A;  2KFF A;  2WND A;  2MLF C;  1TNW A;  3RLZ A;  4OVN F;  2BL0 C;  1QXP A;  1KFX S;  2KI6 C;  5KTY A;  4OV2 A;  1PVB A;  1FI5 A;  1KCY A;  1K9U A;  2I18 A;  1V1F A;  2GGM A;  1E8A A;  1WY9 A;  4P5O E;  2MBX A;  1DGU A;  1OSA A;  2L5X B;  4L9M A;  3CLN A;  2M7N A;  1KK7 Z;  1TN4 A;  1L2O B;  2M29 A;  2KI4 B;  1IKU A;  1WDC C;  1J7R A;  5J3X A;  3CR5 X;  1U5I A;  3VGO A;  4ZCV A;  1WLZ A;  1V1G A;  3CZT X;  3ICB A;  3O78 A;  1JBA A;  3SIA A;  2BCX A;  2JC2 A;  4GBA A;  2EHB A;  3D10 A;  2K7B A;  1NIW A;  3BQ3 A;  3LK1 A;  1FI6 A;  3FWC A;  2K2A A;  4PHN A;  1CDL A;  3I5G C;  1R2U A;  1SRA A;  4WRI A;  1IRJ A;  1KWO B;  1QV1 A;  5AFP A;  1PUL A;  1RK9 A;  1XFV O;  2JT3 A;  1KK8 B;  3GK2 A;  1BJF A;  2O5G A;  3HX4 A;  1UWO A;  2L98 A;  1ODB A;  3PSR A;  4CID A;  1B9A A;  1QX7 A;  1LA0 A;  2L51 A;  2JT0 A;  1CKK A;  2KNE A;  2PRU A;  4AQJ A;  3GK4 X;  3SG5 A;  3VRP A;  1LA3 A;  3K21 A;  3SJS A;  1TIZ A;  1J7O A;  2K7C A;  3A8R A;  2JQ6 A;  2SAS A;  1UHH A;  1YUT A;  2PAS A;  2F2O A;  5AER A;  3CGA A;  2JUL A;  3WXA A;  1UHK A;  3SG3 A;  2BBN A;  2L50 A;  5CSI A;  5B8I B;  4MZJ A;  1RJV A;  1YVL A;  1TCF A;  5F6T A;  2JXC A;  2Q4U A;  1G8I A;  2ZRS A;  3OX6 A;  4CFR A;  1SYM A;  1BLQ A;  2NCP A;  1SNL A;  2Y4Q A;  1IWQ A;  4JQ0 D;  1CM4 A;  4NDC A;  2M1U A;  2WOR A;  2KQY A;  1CLB A;  3KO0 A;  2CXJ A;  2H61 C;  5HKY A;  1K94 A;  1L7Z A;  1N0Y A;  1UUR A;  1Y1U A;  1AJ5 A;  1MR8 A;  1K96 A;  4QJ4 B;  5IBW A;  1DJZ A;  3QRX A;  1QLS A;  2FJU B;  3NSI A;  1LXF C;  1QX2 A;  2AUC A;  2G9B A;  1KFU S;  4I5N B;  2COL B;  1WRK A;  2H61 A;  2LLT A;  1WLM A;  3LLE A;  2PVB A;  2LLU A;  1GJY A;  2AAO A;  3JTD B;  3JVT B;  2LNK A;  4R1E A;  1L2O C;  2KI4 C;  1XFY O;  2F2P A;  2KOT A;  4GPL B;  2HF5 A;  1DF0 B;  1KFX L;  2VRG A;  1A2X A;  1CFC A;  1OZO A;  2BE4 A;  3VRQ A;  4BY4 A;  5ER4 X;  4YI8 A;  1YUU A;  3BUN B;  3VRO A;  1NUB A;  1XYD A;  5AEQ A;  1KWO C;  4DRW A;  4D1E A;  2K7O A;  4ICB A;  3DF0 B;  3KHE A;  2ZFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...