1IKUA

Myristoylated recoverin in the calcium-free state, nmr, 22 structures
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
188
structure length
188
Chain Sequence
b'GNSKSGALSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RECOVERIN
publication title Sequestration of the membrane-targeting myristoyl group of recoverin in the calcium-free state.
pubmed doi rcsb
source organism Bos taurus
molecule tags Calcium-binding protein
total genus 41
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 1996-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ikuA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ikuA01
1F4OA 1CKKA 1QIVA 2WCBA 1J7RA 2LUCA 3TS5C 1BU3A 2MJWB 3VROA 1NPQA 1SRAA 1QX7A 1AVSA 2ZRTA 1QX5B 4C0LA 3CGAA 1YRTB 2I7AA 3EKHA 2ISDA 3SG4A 4M2OA 3VRRA 1TRFA 1V1FA 1A2XA 1CM1A 1QVIY 3AAJA 1YUTA 5B8IB 2BCXA 1OMVA 1AJ4A 1RWYA 2KI6D 1DJIA 1AK8A 3DVMA 1OQPA 2WCEA 1QV0A 1UHNA 2KI4C 2L4IA 1JF0A 2F2PA 1K9KA 2LP3A 1B7TZ 1YX8A 3I5IB 2LLSA 3OB1B 3BOWA 1A75B 1CLMA 1SBJA 1N2DA 4A4BA 1FI5A 1CNPA 4WRIA 5J3XA 1FW4A 1MR8A 1G8IA 2JXLA 4PE4A 1TCOB 4IL1A 1QASA 3MSEB 1CTRA 2LVJA 1TNXA 2K2FA 4PDZA 3A8RA 2KFGA 2PMYA 1UHJA 1SY9A 3I5GB 4ZCUA 1RROA 2FJUB 2CCMA 2NLNA 4YGDB 4MZJA 2LCPA 2SASA 3E3RA 1JF2A 2PALA 3WNXB 2Y5IA 2ZN9A 1BODA 1CFFA 3F45A 3TDZA 1S1EA 4AQJA 3NSKA 3SG5A 4YGEB 2BKHB 3PATA 1IQ3A 2HPSA 1QVIZ 2OS8C 1OZOA 1IJ5A 1IG5A 2GV5A 2LANA 3KHEA 4I5NB 3D10A 1AJ5A 3PN7B 3EKJA 1ALWA 4M2QA 3IQQA 1S6IA 2LMUA 2ZFDA 1K2HA 1W7JB 2Q4UA 4BY5A 3D0YA 1XK4A 1J7QA 1J55A 1MWNA 2PRUA 3KPXA 4GFTA 1WRKA 3IQOA 3SG2A 3KF9A 1CDMA 1KK8C 3OX6A 1K9PA 2JTZA 3PALA 4MRYA 3CR5X 4MRXA 1SK6D 1SL7A 2E30A 2K8MB 2L50A 3RM1A 1DMOA 1OMRA 1HT9A 1CLLA 1TIZA 2KGBC 2V53A 2OTGC 1B8CA 2BECA 3FWBA 1L2OC 4C0KA 5KTYA 1BLQA 5HKYA 1MUXA 2CTNA 1XFZO 3NSOA 4MEWA 1NCZA 1XO5A 1TTXA 1NX3A 2KHNA 1HQVA 2JU0A 5CSJA 2M0RA 2HF5A 3I5FC 1A4PA 1NCYA 1K96A 1F70A 2BBNA 4P5OE 4NDDA 2ZRSA 4PCWA 2ZNEA 2M29A 4ZCVA 1CMGA 5IBWA 5I2OA 1DGVA 1KQVA 1LINA 1KFUL 2JT0A 1F54A 1XFUO 1ZUZA 3NSIA 1WRLA 1EJ3A 3O78A 1SKTA 4PHJA 3O4YA 1JWDA 1J1EA 2D8NA 2KBMA 1WDCB 4ORBB 1AP4A 2LC5A 4CFRA 1NWDA 1R2UA 5I2LA 2LM5A 2ZN8A 1QLKA 2K61A 1B47A 1QATA 2KAVA 2F2OA 1K95A 1V1GA 4MZLA 4MN0A 1KSMA 1J7OA 4MSPA 2JXCA 5AXIA 1B7TY 1K9UA 1JC2A 4QJ5B 1WLZA 1ZMZA 2HETA 1CFPA 2LE9B 1DGUA 1XFXO 1Y1AA 5PALA 2NCPA 1KSOA 1CDNA 1B8RA 2KAYA 3PLFB 5CSIA 5AFPA 2JOJA 3I5IC 4FQOA 4GAOA 4NDCA 3JTDB 1S6CA 1DJYA 1XYDA 3BUWB 2M1UA 1UP5A 4PHMA 2AMIA 2DOQA 1Y0VH 2G9BA 4GUKA 4MZKA 3VGOA 2CT9A 5I8NA 4HRHA 4DRWA 1X02A 3AKAA 2LV7A 4QJ4B 2O5GA 3I5HB 1XFWO 2EHBA 1SL8A 1NP8A 1GJYA 4R1EA 3I5GC 1TNQA 2CXJA 4XYNA 3CTNA 4NQGA 5TNCA 3VRQA 4PE7A 1K93D 3CR2A 4P2YB 2L2EA 2WCFA 4C0JA 2MAZA 1S36A 2JQ6A 1PSRA 1S6JA 3KO0A 3O6BA 1CLBA 2M7LA 4PHNA 2EC6B 1JFKA 4CLNA 1KFUS 3PN7C 1F4QA 1J7PA 3EVUA 1FBVA 4PALA 2P6BB 4ETOA 1AHRA 1KK7Z 3JVTB 2CBLA 4PE0A 1PK0D 1EG3A 2KQ6A 3FS7A 2WC8A 2KAXA 4GGFA 3GK1A 4D1EA 1KQMB 2LHLA 3FWCA 1DT7B 1SL9A 3TDIA 1SR6B 2MHHA 1UWOA 1F55A 2FCEA 4BY4A 3DVEA 1UHIA 1W7IB 2QPTA 1ALVA 3EK7A 1QIWA 4YGBB 1K8UA 3PFVA 2MRDA 1EXRA 2BL0B 2K0JA 3WHUB 2A4JA 1QS7A 2K7DA 3GK2A 2LAPA 3EK8A 4OCIA 5GQQC 2JZIA 2WORA 3DF0B 2M9GA 1CFCA 3O2PA 1EH2A 2RGIA 1RTP1 2LMVA 1QV1A 1RECA 2LNKA 1SYMA 1IH0A 2JRFA 2L5XB 1DJWA 1XK4C 3TUYB 1SPYA 1CDLA 1OSAA 2LP2A 5G08A 4N1FA 2KDHA 4MVFA 2KFHA 1DJXA 2KYFA 1WDCC 1M63B 1CM4A 4DCKA 3CZTX 2LMTA 1LXFC 1BG1A 1OOJA 3K21A 4I5JA 1S3PA 3GOFA 2KNEA 1IQ5A 2I94A 1CMFA 1YRUB 2B1UA 1B1GA 1FF1A 1M31A 1YX7A 2O60A 2NCOA 1NX2A 1CB1A 5AERA 2CNPA 1XFYO 2MLFC 4UPGA 4YGAA 1C7VA 1F8HA 1FPWA 1BR4B 1JUOA 2KSPA 1LKJA 3H4SE 3CWGA 1L7ZA 4YRUA 1RK9A 4FTGA 2JT3A 1Y1UA 3BUXB 2F3YA 3JTDC 3RLZA 5D7FA 1JBAA 4OVNF 3QRXA 5HLVA 4GBAA 2KOTA 4CPVA 4DS7A 1TN4A 1G33A 2JULA 2LLUA 3PSRA 5AEQA 3TDUA 2Y1NA 1QJTA 1IJ6A 1DTLA 3LCPC 1TNPA 2LVKA 3CR4X 1IRJA 2L0PA 3I5HC 4OR9B 2JTTA 1NIWA 1WRZA 5DKNA 1ZOTB 2EGDA 1S26D 3SG7A 1JFJA 3BUOB 3PM8A 1KWOB 1A29A 2JT8A 3EVRA 1S5GY 3DVJA 2JWWA 5DKQA 2M1KB 2MLEC 1MXEA 5CSNA 2IS9A 2L51A 4ORAB 4OV2A 1YTZC 4AQIA 1FI6A 3M0WA 1MXLC 4MLWA 5D69A 1F71A 1KK7Y 1PULA 1JSAA 1CFDA 1LA0A 3IF7A 3OB2B 3WHTB 2EC6C 2AUCA 1SW8A 3GK4X 5F6TA 2PVBA 1CDPA 1EL4A 2Y4QA 1PVAA 2R2IA 3LL8B 1U5IA 3JVTC 4ICBA 5HYDA 1M45A 1QX2A 2F8PA 2M97A 2HQ8A 2H2KA 2KI6C 3LK1A 4TNCA 1YVLA 4HRGA 1KQMC 1SR6C 2LHIA 2MA2A 3ZNIA 2L98A 3KEVA 4XJKB 5DKRA 2NXQA 3BQ3A 3OP0A 1B4CA 1E8AA 1NYAA 2BCAA 3BXKA 3FIAA 3SIBA 1TOPA 3DF0A 1QXPA 4CIDA 4E68A 1XA5A 1SCMB 1WY9A 4ORCB 1H8BA 1S5GZ 3OHMB 3AAKA 3SG3A 2BL0C 4HREE 1GQMA 1K90D 2K7OA 3SJSA 4MBEA 1N0YA 1M39A 1YVHA 4DIRA 1TCFA 5HKWA 2MBXA 3NXAA 4Q04A 1R6PA 3VRPA 2FCDA 3SG6A 1MHOA 1C7WA 1PRWA 1OE9B 1UUSA 2JC2A 3BUNB 2BE4A 3EK4A 4PE1A 1VRKA 2M7NA 2KFFA 1U5IB 2OPOA 3TUYC 3TS5B 1OMDA 2GGMA 1BJFA 1WLMA 2KGRA 3HCMA 3ICBA 4GGFC 4WQ2A 4CFQA 2KYCA 3HX4A 1N65A 1DJGA 2KQYA 2BBMA 1NCXA 1PALA 2M3WA 4GPLB 4HSZA 4GNKB 2TN4A 4YBHB 5ER5A 5KU1A 1BT6A 4JQ0D 5FYXA 1NX0A 1C07A 1GGWA 2WNDA 5I2QA 2M8UA 1M46A 4WQ3A 1OZSA 2QACA 2Q91A 2KI4B 1YUUA 4U8DA 1XFVO 4N5XA 2JPTA 2NZ0A 3WXAA 5K89A 2LUXA 1RJVA 1GGZA 2HQWA 5JOLA 1NUBA 1BR1B 1KFXL 4QJ3B 2BKIB 3VRNA 5KSZA 1UHKA 3ZWHA 1MF8B 1B9AA 1K94A 2G2BA 2ZNDA 1DF0A 5HKZA 4A4CA 3TZ1A 3C1VA 1Y6WA 4AOMA 5JJGA 3A4UB 2PASA 5ER4X 2FOTA 1LA3A 2ZKMX 3BOWB 1ODBA 4OKHA 5AANA 2K2AA 1NX1A 3CLNA 2KBIA 4YGCB 1QLSA 1D1OA 3EVVA 1XVJA 3BUMB 1KWOC 4NDBA 2BCBA 1PSBA 4I5LB 4PHKA 1DJZA 1AUIB 1EG4A 4M2PA 1KCYA 2VRGA 2OS8B 2COLB 3DD4A 3NSLA 2H61A 1YURA 1UURA 2LLTA 1LVCD 1SNLA 2K7CA 1SCVA 4USLA 1H4BA 1IWQA 3SIAA 2GGZA 1YUSA 1BMOA 1UHHA 1DVIA 2SCPA 3OX5A 5BPJA 4GGNA 2BE6A 2H61C 2I18A 4L9MA 4XJKA 2PSRA 1YR5A 1IGVA 1KK8B 2LVVA 5HLOA 2K7BA 4DUQA 1DF0B 1J1DA 1ZACA 3LLEA 1IKUA 4F0ZB 1QTXA 1MQ1A 1RFJA 3CS1A 2F33A 3D0YB 2JNFA 1A03A 4JPZB 2LVIA 3BYAA 1TNWA 1Y1XA 2AAOA 2F3ZA 4YI8A 2OTGB 2L4HA 5CSFA 1L2OB 4N1GA 1G4YR 1SCMC 3DVKA 1PVBA 2Y1MA 2E6WA 1KFXS 5CPVA 3AKBA 4YI9A 1BOCA 3I5FB 2WOSA 1Q80A 2I2RE 1A75A 2JNXA 1B8LA 3LK0A 4JWQA 1DJHA 1NSHA 1ZFSA 1BF5A 4I5KA 2M49B 1SMGA
chains in the Genus database with same CATH superfamily
1F4OA 1CKKA 1QIVA 2WCBA 1J7RA 2LUCA 2QEOA 3SS5A 3TS5C 1BU3A 2MJWB 3VROA 1NPQA 1SRAA 1QX7A 1AVSA 2ZRTA 1QX5B 3OGNA 4C0LA 3CGAA 1YRTB 2I7AA 3EKHA 2ISDA 3SG4A 4M2OA 3VRRA 1ORGA 2BAPA 1TRFA 1V1FA 2QDIA 1A2XA 1CM1A 1QVIY 3AAJA 1YUTA 3D73A 2PQLA 5B8IB 2BCXA 1OMVA 1AJ4A 1RWYA 3CYZA 2KI6D 1DJIA 1AK8A 3DVMA 1OQPA 2WCEA 1QV0A 1UHNA 2KI4C 2L4IA 2P71A 3L4AA 1JF0A 2F2PA 1K9KA 2LP3A 1B7TZ 1YX8A 3I5IB 2LLSA 3OB1B 3BOWA 1A75B 5I94A 1CLMA 3R1VA 1SBJA 1N2DA 4A4BA 1OOIX 1FI5A 1CNPA 3DXLA 4WRIA 5J3XA 1FW4A 1MR8A 3CZ2A 1G8IA 4JKTA 2JXLA 4PE4A 1TCOB 4IL1A 1QASA 3MSEB 2WCHA 1CTRA 2LVJA 1TNXA 2K2FA 4PDZA 3A8RA 2KFGA 2PMYA 1UHJA 1SY9A 3I5GB 4ZCUA 1RROA 2FJUB 2CCMA 2NLNA 4YGDB 4MZJA 2LCPA 2SASA 3E3RA 1JF2A 2PALA 3WNXB 1XFRA 3L47A 2Y5IA 2ZN9A 1BODA 1CFFA 3F45A 3TDZA 1S1EA 4AQJA 3NSKA 3SG5A 2KLEA 4YGEB 2BKHB 3PATA 1IQ3A 2HPSA 1QVIZ 2OS8C 1OZOA 1IJ5A 1IG5A 2GV5A 2LANA 3DY9A 3KHEA 5FI2A 4I5NB 3D10A 1AJ5A 3PN7B 3EKJA 1DC1A 1ALWA 4M2QA 3IQQA 1S6IA 2LMUA 2ZFDA 1K2HA 1W7JB 2Q4UA 4BY5A 3D0YA 1XK4A 1J7QA 4OZDA 1J55A 1MWNA 2PRUA 3KPXA 4GFTA 1WRKA 3D74A 3IQOA 1QWVA 3SG2A 3KF9A 1CDMA 1KK8C 3OX6A 3B88A 1K9PA 2JTZA 3FE9A 3PALA 4MRYA 3CR5X 4MRXA 1SK6D 1SL7A 3IVTA 2E30A 1C3ZA 2K8MB 2L50A 3RM1A 1DMOA 1OMRA 1HT9A 3CDNA 1CLLA 1TIZA 2KGBC 2V53A 3CZ1A 2OTGC 1B8CA 2BECA 3FWBA 1L2OC 4C0KA 5KTYA 1BLQA 5HKYA 1MUXA 2CTNA 1XFZO 3NSOA 4MEWA 1NCZA 5DICA 1XO5A 1TTXA 1NX3A 2KHNA 1HQVA 2JU0A 5CSJA 2M0RA 2HF5A 3I5FC 1A4PA 1NCYA 1K96A 1F70A 2BBNA 4P5OE 4NDDA 2ZRSA 4PCWA 2ZNEA 2M29A 4ZCVA 1CMGA 5IBWA 5I2OA 1DGVA 1KQVA 1LINA 1KFUL 2JT0A 2QEBA 1F54A 1XFUO 1ZUZA 3NSIA 1WRLA 1EJ3A 3O78A 3V2LA 1SKTA 4PHJA 3O4YA 1JWDA 1J1EA 2D8NA 3Q8IA 2KBMA 1WDCB 4ORBB 3S0DA 1AP4A 2LC5A 4CFRA 1NWDA 1R2UA 5I2LA 2LM5A 2ZN8A 1QLKA 2K61A 1B47A 1QATA 2KAVA 2F2OA 1K95A 1V1GA 4MZLA 4MN0A 1KSMA 1J7OA 2GTEA 4MSPA 2JXCA 3D78A 5AXIA 1B7TY 1K9UA 5HL1A 1JC2A 4QJ5B 1WLZA 1ZMZA 2HETA 1CFPA 2LE9B 1DGUA 1XFXO 1Y1AA 3L4LA 5PALA 2NCPA 1KSOA 1CDNA 2YGUA 1B8RA 2KAYA 3R1OA 3PLFB 5CSIA 5AFPA 2JOJA 3I5IC 2L5YA 4FQOA 4GAOA 3JTDB 1S6CA 4NDCA 3S0GA 1DJYA 1XYDA 3BUWB 2M1UA 1UP5A 4PHMA 2AMIA 2DOQA 1Y0VH 2G9BA 4GUKA 4MZKA 3VGOA 2CT9A 5I8NA 4HRHA 4DRWA 5FI7A 1X02A 3AKAA 2LV7A 4QJ4B 2O5GA 2PYQA 1DQEA 3I5HB 1XFWO 3BFAA 2EHBA 1SL8A 1NP8A 2WCMA 1GJYA 4R1EA 3I5GC 1TNQA 3NHTA 2CXJA 4XYNA 3CTNA 4NQGA 5TNCA 3VRQA 4PE7A 1K93D 3CR2A 4P2YB 2L2EA 2WCFA 4C0JA 3CABA 2MAZA 1S36A 2JQ6A 1PSRA 1S6JA 3KO0A 3O6BA 1CLBA 2M7LA 2WCJA 4PHNA 2EC6B 1JFKA 4CLNA 1KFUS 3PN7C 1F4QA 1J7PA 3EVUA 1FBVA 4PALA 2P6BB 4ETOA 3N7HA 1AHRA 1KK7Z 3JVTB 2CBLA 4PE0A 1PK0D 1EG3A 1DELA 2KQ6A 3FS7A 2WC8A 2KAXA 4GGFA 3NGVA 5BPJA 3GK1A 3D77A 4D1EA 1KQMB 2LHLA 3FWCA 1DT7B 1SL9A 3TDIA 1SR6B 2MHHA 1UWOA 1F55A 2FCEA 4BY4A 3DVEA 4INXA 3CZ0A 1UHIA 1W7IB 2QPTA 1ALVA 3EK7A 1QIWA 2K60A 1K8UA 3PFVA 4YGBB 2MRDA 1OW4A 1EXRA 2BL0B 2K0JA 3WHUB 2A4JA 1QS7A 3BJHA 2ERBA 3B6XA 2K7DA 2FJYA 3GK2A 2LAPA 2BNXA 3EK8A 3R1PA 4JD9A 4OCIA 5GQQC 2JZIA 2WORA 3DF0B 1C3YA 2M9GA 1CFCA 3O2PA 1EH2A 2RGIA 1RTP1 2LMVA 1QV1A 1RECA 2LNKA 1SYMA 1IH0A 2JRFA 3K1EA 2L5XB 3UNWA 3PM2A 3VB1A 1DJWA 1XK4C 3TUYB 1SPYA 1CDLA 1OSAA 2LP2A 3NHIA 5G08A 3S0BA 4N1FA 2KDHA 4MVFA 2KFHA 1DJXA 2KYFA 1WDCC 1M63B 3R72A 1CM4A 3FE6A 4DCKA 3CZTX 1Z2CB 2LMTA 1LXFC 1BG1A 1OOJA 3K21A 4I5JA 1S3PA 3GOFA 2KNEA 1IQ5A 2I94A 1W9ZA 1CMFA 3EG5B 3BFBA 1YRUB 2B1UA 1B1GA 1FF1A 1M31A 1YX7A 2O60A 2NCOA 1NX2A 3DYEA 5AERA 1CB1A 2CNPA 1XFYO 2MLFC 4UPGA 4YGAA 4FQTA 1C7VA 1F8HA 1FPWA 1BR4B 5D3OA 1JUOA 2KSPA 1LKJA 3H4SE 2WC6A 3CWGA 1L7ZA 4YRUA 1RK9A 4FTGA 2JT3A 1Y1UA 3BUXB 2F3YA 3JTDC 3RLZA 5D7FA 1JBAA 4OVNF 3QRXA 5HLVA 4GBAA 2KOTA 4CPVA 4DS7A 1TN4A 1G33A 2JULA 2LLUA 3PSRA 5AEQA 2JPOA 2Y1NA 1QJTA 1IJ6A 1DTLA 3TDUA 1OOGA 1TNPA 3LCPC 2LVKA 3CR4X 1IRJA 2L0PA 3I5HC 4OR9B 2JTTA 1NIWA 1WRZA 5DKNA 1ZOTB 4IJ7A 2EGDA 1S26D 2WCKA 3SG7A 1JFJA 3BUOB 3PM8A 1KWOB 3PJIA 1A29A 2JT8A 3EVRA 1S5GY 3DVJA 2JWWA 5DKQA 2M1KB 2MLEC 1MXEA 5CSNA 1LS8A 2IS9A 2L51A 4ORAB 4OV2A 1YTZC 4AQIA 1FI6A 3M0WA 1MXLC 4MLWA 5D69A 1F71A 1KK7Y 1PULA 1JSAA 1CFDA 1LA0A 3IF7A 3OB2B 3WHTB 2QEHA 2EC6C 2AUCA 1SW8A 3GK4X 2L2CA 5EL2A 5F6TA 2PVBA 1CDPA 1EL4A 2Y4QA 1PVAA 2R2IA 3LL8B 1U5IA 3JVTC 4ICBA 5HYDA 1M45A 1QX2A 3UO9A 2F8PA 2M97A 2HQ8A 2H2KA 2KI6C 3LK1A 4TNCA 1YVLA 4HRGA 1KQMC 1SR6C 2LHIA 2MA2A 3ZNIA 2L98A 3KEVA 4XJKB 5DKRA 3S0EA 2NXQA 3BQ3A 3OP0A 3S0AA 1B4CA 1E8AA 1NYAA 2BCAA 3BXKA 3FIAA 5FI6A 3SIBA 1TOPA 3DF0A 1QXPA 4CIDA 4E68A 1XA5A 1SCMB 1WY9A 4ORCB 1H8BA 1S5GZ 4PT1A 3OHMB 3BFHA 3AAKA 2H8VA 4INWA 3SG3A 2BL0C 4HREE 1GQMA 1K90D 2K7OA 3SJSA 4MBEA 1N0YA 1M39A 1YVHA 4DIRA 1TCFA 3OBVA 5HKWA 2MBXA 3NXAA 4Q04A 1R6PA 3VRPA 2WC5A 1GM0A 2FCDA 3SG6A 1MHOA 1C7WA 1PRWA 1OE9B 1UUSA 2JC2A 3BUNB 2BE4A 3EK4A 4PE1A 1VRKA 2M7NA 1OOFA 2KFFA 1U5IB 2OPOA 1IIOA 3TUYC 3QMEA 3TS5B 1OMDA 4KYNA 3S0FA 2GGMA 1BJFA 1WLMA 2KGRA 3B87A 3HCMA 3ICBA 4GGFC 4WQ2A 4CFQA 2P70A 2KYCA 3HX4A 1N65A 1DJGA 3DZTA 2KQYA 2BBMA 1NCXA 1PALA 2M3WA 4GPLB 4HSZA 4GNKB 2TN4A 4YBHB 5ER5A 5KU1A 1BT6A 4JQ0D 5FYXA 1NX0A 1C07A 3SS3A 1GGWA 2WNDA 5I2QA 1SSEB 2M8UA 1M46A 4WQ3A 1OZSA 2QACA 3B7AA 2Q91A 3D75A 2KI4B 1YUUA 4U8DA 1XFVO 4N5XA 2QEVA 2JPTA 2NZ0A 3WXAA 5K89A 2LUXA 1RJVA 1GGZA 2HQWA 5JOLA 1NUBA 1BR1B 1KFXL 4QJ3B 2BKIB 3VRNA 5KSZA 1UHKA 3ZWHA 1MF8B 1B9AA 1K94A 2G2BA 2ZNDA 1DF0A 5HKZA 4A4CA 3TZ1A 3C1VA 1Y6WA 3SS4A 4AOMA 5JJGA 3A4UB 2PASA 3B86A 5ER4X 2FOTA 1LA3A 2ZKMX 3BOWB 1ODBA 4OKHA 5AANA 2K2AA 1NX1A 3CLNA 2KBIA 4YGCB 1QLSA 1D1OA 3EVVA 1XVJA 3BUMB 1KWOC 4NDBA 1Z4HA 1OOHA 2BCBA 1PSBA 4I5LB 4PHKA 1DJZA 1AUIB 1EG4A 4M2PA 3D76A 1KCYA 2VRGA 2OS8B 2COLB 3DD4A 3NSLA 2H61A 1YURA 2KLDA 1UURA 2KPHA 2LLTA 1LVCD 1SNLA 1T14A 2K7CA 1SCVA 4USLA 1P28A 1IWQA 1H4BA 3SIAA 2GGZA 1YUSA 1BMOA 1UHHA 1DVIA 2SCPA 3O4XA 3OX5A 4GGNA 2BE6A 2H61C 2I18A 4L9MA 4XJKA 2PSRA 1DEKA 1YR5A 1IGVA 1KK8B 2LVVA 5HLOA 1TUJA 2K7BA 1DF0B 4DUQA 1J1DA 1ZACA 3LLEA 1IKUA 4F0ZB 1QTXA 1MQ1A 1RFJA 3CS1A 2F33A 3D0YB 2JNFA 1A03A 4JPZB 2LVIA 3BYAA 1TNWA 1Y1XA 2AAOA 2F3ZA 4YI8A 2OTGB 2L4HA 3FE8A 5CSFA 1L2OB 4N1GA 1G4YR 1SCMC 3DVKA 1PVBA 2Y1MA 2E6WA 1TUZA 1KFXS 5CPVA 3AKBA 4YI9A 1BOCA 3I5FB 2WOSA 1Q80A 2I2RE 1A75A 1TWOA 2JNXA 1B8LA 3RZSA 3LK0A 4F7FA 2WCLA 4JWQA 1DJHA 1NSHA 1ZFSA 1BF5A 4I5KA 2M49B 1SMGA
chains in the Genus database with same CATH topology
1F4OA 1CKKA 1QIVA 2WCBA 1J7RA 2LUCA 3TS5C 1BU3A 2MJWB 3VROA 1NPQA 1SRAA 1QX7A 1AVSA 2ZRTA 1QX5B 4C0LA 3CGAA 1YRTB 2I7AA 3EKHA 2ISDA 3SG4A 4M2OA 3VRRA 1TRFA 1V1FA 1A2XA 1CM1A 1QVIY 3AAJA 1YUTA 5B8IB 2BCXA 1OMVA 1AJ4A 1RWYA 2KI6D 1DJIA 1AK8A 3DVMA 1OQPA 2WCEA 1QV0A 1UHNA 2KI4C 2L4IA 1JF0A 2F2PA 1K9KA 2LP3A 1B7TZ 1YX8A 3I5IB 2LLSA 3OB1B 3BOWA 1A75B 1CLMA 1SBJA 1N2DA 4A4BA 1FI5A 1CNPA 4WRIA 5J3XA 1FW4A 1MR8A 1G8IA 2JXLA 4PE4A 1TCOB 4IL1A 1QASA 3MSEB 1CTRA 2LVJA 1TNXA 2K2FA 4PDZA 3A8RA 2KFGA 2PMYA 1UHJA 1SY9A 3I5GB 4ZCUA 1RROA 2FJUB 2CCMA 2NLNA 4YGDB 4MZJA 2LCPA 2SASA 3E3RA 1JF2A 2PALA 3WNXB 2Y5IA 2ZN9A 1BODA 1CFFA 3F45A 3TDZA 1S1EA 4AQJA 3NSKA 3SG5A 4YGEB 2BKHB 3PATA 1IQ3A 2HPSA 1QVIZ 2OS8C 1OZOA 1IJ5A 1IG5A 2GV5A 2LANA 3KHEA 4I5NB 3D10A 1AJ5A 3PN7B 3EKJA 1ALWA 4M2QA 3IQQA 1S6IA 2LMUA 2ZFDA 1K2HA 1W7JB 2Q4UA 4BY5A 3D0YA 1XK4A 1J7QA 1J55A 1MWNA 2PRUA 3KPXA 4GFTA 1WRKA 3IQOA 3SG2A 3KF9A 1CDMA 1KK8C 3OX6A 1K9PA 2JTZA 3PALA 4MRYA 3CR5X 4MRXA 1SK6D 1SL7A 2E30A 2K8MB 2L50A 3RM1A 1DMOA 1OMRA 1HT9A 1CLLA 1TIZA 2KGBC 2V53A 2OTGC 1B8CA 2BECA 3FWBA 1L2OC 4C0KA 5KTYA 1BLQA 5HKYA 1MUXA 2CTNA 1XFZO 3NSOA 4MEWA 1NCZA 1XO5A 1TTXA 1NX3A 2KHNA 1HQVA 2JU0A 5CSJA 2M0RA 2HF5A 3I5FC 1A4PA 1NCYA 1K96A 1F70A 2BBNA 4P5OE 4NDDA 2ZRSA 4PCWA 2ZNEA 2M29A 4ZCVA 1CMGA 5IBWA 5I2OA 1DGVA 1KQVA 1LINA 1KFUL 2JT0A 1F54A 1XFUO 1ZUZA 3NSIA 1WRLA 1EJ3A 3O78A 1SKTA 4PHJA 3O4YA 1JWDA 1J1EA 2D8NA 2KBMA 1WDCB 4ORBB 1AP4A 2LC5A 4CFRA 1NWDA 1R2UA 5I2LA 2LM5A 2ZN8A 1QLKA 2K61A 1B47A 1QATA 2KAVA 2F2OA 1K95A 1V1GA 4MZLA 4MN0A 1KSMA 1J7OA 4MSPA 2JXCA 5AXIA 1B7TY 1K9UA 1JC2A 4QJ5B 1WLZA 1ZMZA 2HETA 1CFPA 2LE9B 1DGUA 1XFXO 1Y1AA 5PALA 2NCPA 1KSOA 1CDNA 1B8RA 2KAYA 3PLFB 5CSIA 5AFPA 2JOJA 3I5IC 4FQOA 4GAOA 4NDCA 3JTDB 1S6CA 1DJYA 1XYDA 3BUWB 2M1UA 1UP5A 4PHMA 2AMIA 2DOQA 1Y0VH 2G9BA 4GUKA 4MZKA 3VGOA 2CT9A 5I8NA 4HRHA 4DRWA 1X02A 3AKAA 2LV7A 4QJ4B 2O5GA 3I5HB 1XFWO 2EHBA 1SL8A 1NP8A 1GJYA 4R1EA 3I5GC 1TNQA 2CXJA 4XYNA 3CTNA 4NQGA 5TNCA 3VRQA 4PE7A 1K93D 3CR2A 4P2YB 2L2EA 2WCFA 4C0JA 2MAZA 1S36A 2JQ6A 1PSRA 1S6JA 3KO0A 3O6BA 1CLBA 2M7LA 4PHNA 2EC6B 1JFKA 4CLNA 1KFUS 3PN7C 1F4QA 1J7PA 3EVUA 1FBVA 4PALA 2P6BB 4ETOA 1AHRA 1KK7Z 3JVTB 2CBLA 4PE0A 1PK0D 1EG3A 2KQ6A 3FS7A 2WC8A 2KAXA 4GGFA 3GK1A 4D1EA 1KQMB 2LHLA 3FWCA 1DT7B 1SL9A 3TDIA 1SR6B 2MHHA 1UWOA 1F55A 2FCEA 4BY4A 3DVEA 1UHIA 1W7IB 2QPTA 1ALVA 3EK7A 1QIWA 4YGBB 1K8UA 3PFVA 2MRDA 1EXRA 2BL0B 2K0JA 3WHUB 2A4JA 1QS7A 2K7DA 3GK2A 2LAPA 3EK8A 4OCIA 5GQQC 2JZIA 2WORA 3DF0B 2M9GA 1CFCA 3O2PA 1EH2A 2RGIA 1RTP1 2LMVA 1QV1A 1RECA 2LNKA 1SYMA 1IH0A 2JRFA 2L5XB 1DJWA 1XK4C 3TUYB 1SPYA 1CDLA 1OSAA 2LP2A 5G08A 4N1FA 2KDHA 4MVFA 2KFHA 1DJXA 2KYFA 1WDCC 1M63B 1CM4A 4DCKA 3CZTX 2LMTA 1LXFC 1BG1A 1OOJA 3K21A 4I5JA 1S3PA 3GOFA 2KNEA 1IQ5A 2I94A 1CMFA 1YRUB 2B1UA 1B1GA 1FF1A 1M31A 1YX7A 2O60A 2NCOA 1NX2A 1CB1A 5AERA 2CNPA 1XFYO 2MLFC 4UPGA 4YGAA 1C7VA 1F8HA 1FPWA 1BR4B 1JUOA 2KSPA 1LKJA 3H4SE 3CWGA 1L7ZA 4YRUA 1RK9A 4FTGA 2JT3A 1Y1UA 3BUXB 2F3YA 3JTDC 3RLZA 5D7FA 1JBAA 4OVNF 3QRXA 5HLVA 4GBAA 2KOTA 4CPVA 4DS7A 1TN4A 1G33A 2JULA 2LLUA 3PSRA 5AEQA 3TDUA 2Y1NA 1QJTA 1IJ6A 1DTLA 3LCPC 1TNPA 2LVKA 3CR4X 1IRJA 2L0PA 3I5HC 4OR9B 2JTTA 1NIWA 1WRZA 5DKNA 1ZOTB 2EGDA 1S26D 3SG7A 1JFJA 3BUOB 3PM8A 1KWOB 1A29A 2JT8A 3EVRA 1S5GY 3DVJA 2JWWA 5DKQA 2M1KB 2MLEC 1MXEA 5CSNA 2IS9A 2L51A 4ORAB 4OV2A 1YTZC 4AQIA 1FI6A 3M0WA 1MXLC 4MLWA 5D69A 1F71A 1KK7Y 1PULA 1JSAA 1CFDA 1LA0A 3IF7A 3OB2B 3WHTB 2EC6C 2AUCA 1SW8A 3GK4X 5F6TA 2PVBA 1CDPA 1EL4A 2Y4QA 1PVAA 2R2IA 3LL8B 1U5IA 3JVTC 4ICBA 5HYDA 1M45A 1QX2A 2F8PA 2M97A 2HQ8A 2H2KA 2KI6C 3LK1A 4TNCA 1YVLA 4HRGA 1KQMC 1SR6C 2LHIA 2MA2A 3ZNIA 2L98A 3KEVA 4XJKB 5DKRA 2NXQA 3BQ3A 3OP0A 1B4CA 1E8AA 1NYAA 2BCAA 3BXKA 3FIAA 3SIBA 1TOPA 3DF0A 1QXPA 4CIDA 4E68A 1XA5A 1SCMB 1WY9A 4ORCB 1H8BA 1S5GZ 3OHMB 3AAKA 3SG3A 2BL0C 4HREE 1GQMA 1K90D 2K7OA 3SJSA 4MBEA 1N0YA 1M39A 1YVHA 4DIRA 1TCFA 5HKWA 2MBXA 3NXAA 4Q04A 1R6PA 3VRPA 2FCDA 3SG6A 1MHOA 1C7WA 1PRWA 1OE9B 1UUSA 2JC2A 3BUNB 2BE4A 3EK4A 4PE1A 1VRKA 2M7NA 2KFFA 1U5IB 2OPOA 3TUYC 3TS5B 1OMDA 2GGMA 1BJFA 1WLMA 2KGRA 3HCMA 3ICBA 4GGFC 4WQ2A 4CFQA 2KYCA 3HX4A 1N65A 1DJGA 2KQYA 2BBMA 1NCXA 1PALA 2M3WA 4GPLB 4HSZA 4GNKB 2TN4A 4YBHB 5ER5A 5KU1A 1BT6A 4JQ0D 5FYXA 1NX0A 1C07A 1GGWA 2WNDA 5I2QA 2M8UA 1M46A 4WQ3A 1OZSA 2QACA 2Q91A 2KI4B 1YUUA 4U8DA 1XFVO 4N5XA 2JPTA 2NZ0A 3WXAA 5K89A 2LUXA 1RJVA 1GGZA 2HQWA 5JOLA 1NUBA 1BR1B 1KFXL 4QJ3B 2BKIB 3VRNA 5KSZA 1UHKA 3ZWHA 1MF8B 1B9AA 1K94A 2G2BA 2ZNDA 1DF0A 5HKZA 4A4CA 3TZ1A 3C1VA 1Y6WA 4AOMA 5JJGA 3A4UB 2PASA 5ER4X 2FOTA 1LA3A 2ZKMX 3BOWB 1ODBA 4OKHA 5AANA 2K2AA 1NX1A 3CLNA 2KBIA 4YGCB 1QLSA 1D1OA 3EVVA 1XVJA 3BUMB 1KWOC 4NDBA 2BCBA 1PSBA 4I5LB 4PHKA 1DJZA 1AUIB 1EG4A 4M2PA 1KCYA 2VRGA 2OS8B 2COLB 3DD4A 3NSLA 2H61A 1YURA 1UURA 2LLTA 1LVCD 1SNLA 2K7CA 1SCVA 4USLA 1H4BA 1IWQA 3SIAA 2GGZA 1YUSA 1BMOA 1UHHA 1DVIA 2SCPA 3OX5A 5BPJA 4GGNA 2BE6A 2H61C 2I18A 4L9MA 4XJKA 2PSRA 1YR5A 1IGVA 1KK8B 2LVVA 5HLOA 2K7BA 4DUQA 1DF0B 1J1DA 1ZACA 3LLEA 1IKUA 4F0ZB 1QTXA 1MQ1A 1RFJA 3CS1A 2F33A 3D0YB 2JNFA 1A03A 4JPZB 2LVIA 3BYAA 1TNWA 1Y1XA 2AAOA 2F3ZA 4YI8A 2OTGB 2L4HA 5CSFA 1L2OB 4N1GA 1G4YR 1SCMC 3DVKA 1PVBA 2Y1MA 2E6WA 1KFXS 5CPVA 3AKBA 4YI9A 1BOCA 3I5FB 2WOSA 1Q80A 2I2RE 1A75A 2JNXA 1B8LA 3LK0A 4JWQA 1DJHA 1NSHA 1ZFSA 1BF5A 4I5KA 2M49B 1SMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F4O A;  1CKK A;  1QIV A;  2WCB A;  1J7R A;  2LUC A;  3TS5 C;  1BU3 A;  2MJW B;  3VRO A;  1NPQ A;  1SRA A;  1QX7 A;  1AVS A;  2ZRT A;  1QX5 B;  4C0L A;  3CGA A;  1YRT B;  2I7A A;  3EKH A;  2ISD A;  3SG4 A;  4M2O A;  3VRR A;  1TRF A;  1V1F A;  1A2X A;  1CM1 A;  1QVI Y;  3AAJ A;  1YUT A;  5B8I B;  2BCX A;  1OMV A;  1AJ4 A;  1RWY A;  2KI6 D;  1DJI A;  1AK8 A;  3DVM A;  1OQP A;  2WCE A;  1QV0 A;  1UHN A;  2KI4 C;  2L4I A;  1JF0 A;  2F2P A;  1K9K A;  2LP3 A;  1B7T Z;  1YX8 A;  3I5I B;  2LLS A;  3OB1 B;  3BOW A;  1A75 B;  1CLM A;  1SBJ A;  1N2D A;  4A4B A;  1FI5 A;  1CNP A;  4WRI A;  5J3X A;  1FW4 A;  1MR8 A;  1G8I A;  2JXL A;  4PE4 A;  1TCO B;  4IL1 A;  1QAS A;  3MSE B;  1CTR A;  2LVJ A;  1TNX A;  2K2F A;  4PDZ A;  3A8R A;  2KFG A;  2PMY A;  1UHJ A;  1SY9 A;  3I5G B;  4ZCU A;  1RRO A;  2FJU B;  2CCM A;  2NLN A;  4YGD B;  4MZJ A;  2LCP A;  2SAS A;  3E3R A;  1JF2 A;  2PAL A;  3WNX B;  2Y5I A;  2ZN9 A;  1BOD A;  1CFF A;  3F45 A;  3TDZ A;  1S1E A;  4AQJ A;  3NSK A;  3SG5 A;  4YGE B;  2BKH B;  3PAT A;  1IQ3 A;  2HPS A;  1QVI Z;  2OS8 C;  1OZO A;  1IJ5 A;  1IG5 A;  2GV5 A;  2LAN A;  3KHE A;  4I5N B;  3D10 A;  1AJ5 A;  3PN7 B;  3EKJ A;  1ALW A;  4M2Q A;  3IQQ A;  1S6I A;  2LMU A;  2ZFD A;  1K2H A;  1W7J B;  2Q4U A;  4BY5 A;  3D0Y A;  1XK4 A;  1J7Q A;  1J55 A;  1MWN A;  2PRU A;  3KPX A;  4GFT A;  1WRK A;  3IQO A;  3SG2 A;  3KF9 A;  1CDM A;  1KK8 C;  3OX6 A;  1K9P A;  2JTZ A;  3PAL A;  4MRY A;  3CR5 X;  4MRX A;  1SK6 D;  1SL7 A;  2E30 A;  2K8M B;  2L50 A;  3RM1 A;  1DMO A;  1OMR A;  1HT9 A;  1CLL A;  1TIZ A;  2KGB C;  2V53 A;  2OTG C;  1B8C A;  2BEC A;  3FWB A;  1L2O C;  4C0K A;  5KTY A;  1BLQ A;  5HKY A;  1MUX A;  2CTN A;  1XFZ O;  3NSO A;  4MEW A;  1NCZ A;  1XO5 A;  1TTX A;  1NX3 A;  2KHN A;  1HQV A;  2JU0 A;  5CSJ A;  2M0R A;  2HF5 A;  3I5F C;  1A4P A;  1NCY A;  1K96 A;  1F70 A;  2BBN A;  4P5O E;  4NDD A;  2ZRS A;  4PCW A;  2ZNE A;  2M29 A;  4ZCV A;  1CMG A;  5IBW A;  5I2O A;  1DGV A;  1KQV A;  1LIN A;  1KFU L;  2JT0 A;  1F54 A;  1XFU O;  1ZUZ A;  3NSI A;  1WRL A;  1EJ3 A;  3O78 A;  1SKT A;  4PHJ A;  3O4Y A;  1JWD A;  1J1E A;  2D8N A;  2KBM A;  1WDC B;  4ORB B;  1AP4 A;  2LC5 A;  4CFR A;  1NWD A;  1R2U A;  5I2L A;  2LM5 A;  2ZN8 A;  1QLK A;  2K61 A;  1B47 A;  1QAT A;  2KAV A;  2F2O A;  1K95 A;  1V1G A;  4MZL A;  4MN0 A;  1KSM A;  1J7O A;  4MSP A;  2JXC A;  5AXI A;  1B7T Y;  1K9U A;  1JC2 A;  4QJ5 B;  1WLZ A;  1ZMZ A;  2HET A;  1CFP A;  2LE9 B;  1DGU A;  1XFX O;  1Y1A A;  5PAL A;  2NCP A;  1KSO A;  1CDN A;  1B8R A;  2KAY A;  3PLF B;  5CSI A;  5AFP A;  2JOJ A;  3I5I C;  4FQO A;  4GAO A;  4NDC A;  3JTD B;  1S6C A;  1DJY A;  1XYD A;  3BUW B;  2M1U A;  1UP5 A;  4PHM A;  2AMI A;  2DOQ A;  1Y0V H;  2G9B A;  4GUK A;  4MZK A;  3VGO A;  2CT9 A;  5I8N A;  4HRH A;  4DRW A;  1X02 A;  3AKA A;  2LV7 A;  4QJ4 B;  2O5G A;  3I5H B;  1XFW O;  2EHB A;  1SL8 A;  1NP8 A;  1GJY A;  4R1E A;  3I5G C;  1TNQ A;  2CXJ A;  4XYN A;  3CTN A;  4NQG A;  5TNC A;  3VRQ A;  4PE7 A;  1K93 D;  3CR2 A;  4P2Y B;  2L2E A;  2WCF A;  4C0J A;  2MAZ A;  1S36 A;  2JQ6 A;  1PSR A;  1S6J A;  3KO0 A;  3O6B A;  1CLB A;  2M7L A;  4PHN A;  2EC6 B;  1JFK A;  4CLN A;  1KFU S;  3PN7 C;  1F4Q A;  1J7P A;  3EVU A;  1FBV A;  4PAL A;  2P6B B;  4ETO A;  1AHR A;  1KK7 Z;  3JVT B;  2CBL A;  4PE0 A;  1PK0 D;  1EG3 A;  2KQ6 A;  3FS7 A;  2WC8 A;  2KAX A;  4GGF A;  3GK1 A;  4D1E A;  1KQM B;  2LHL A;  3FWC A;  1DT7 B;  1SL9 A;  3TDI A;  1SR6 B;  2MHH A;  1UWO A;  1F55 A;  2FCE A;  4BY4 A;  3DVE A;  1UHI A;  1W7I B;  2QPT A;  1ALV A;  3EK7 A;  1QIW A;  4YGB B;  1K8U A;  3PFV A;  2MRD A;  1EXR A;  2BL0 B;  2K0J A;  3WHU B;  2A4J A;  1QS7 A;  2K7D A;  3GK2 A;  2LAP A;  3EK8 A;  4OCI A;  5GQQ C;  2JZI A;  2WOR A;  3DF0 B;  2M9G A;  1CFC A;  3O2P A;  1EH2 A;  2RGI A;  1RTP 1;  2LMV A;  1QV1 A;  1REC A;  2LNK A;  1SYM A;  1IH0 A;  2JRF A;  2L5X B;  1DJW A;  1XK4 C;  3TUY B;  1SPY A;  1CDL A;  1OSA A;  2LP2 A;  5G08 A;  4N1F A;  2KDH A;  4MVF A;  2KFH A;  1DJX A;  2KYF A;  1WDC C;  1M63 B;  1CM4 A;  4DCK A;  3CZT X;  2LMT A;  1LXF C;  1BG1 A;  1OOJ A;  3K21 A;  4I5J A;  1S3P A;  3GOF A;  2KNE A;  1IQ5 A;  2I94 A;  1CMF A;  1YRU B;  2B1U A;  1B1G A;  1FF1 A;  1M31 A;  1YX7 A;  2O60 A;  2NCO A;  1NX2 A;  1CB1 A;  5AER A;  2CNP A;  1XFY O;  2MLF C;  4UPG A;  4YGA A;  1C7V A;  1F8H A;  1FPW A;  1BR4 B;  1JUO A;  2KSP A;  1LKJ A;  3H4S E;  3CWG A;  1L7Z A;  4YRU A;  1RK9 A;  4FTG A;  2JT3 A;  1Y1U A;  3BUX B;  2F3Y A;  3JTD C;  3RLZ A;  5D7F A;  1JBA A;  4OVN F;  3QRX A;  5HLV A;  4GBA A;  2KOT A;  4CPV A;  4DS7 A;  1TN4 A;  1G33 A;  2JUL A;  2LLU A;  3PSR A;  5AEQ A;  3TDU A;  2Y1N A;  1QJT A;  1IJ6 A;  1DTL A;  3LCP C;  1TNP A;  2LVK A;  3CR4 X;  1IRJ A;  2L0P A;  3I5H C;  4OR9 B;  2JTT A;  1NIW A;  1WRZ A;  5DKN A;  1ZOT B;  2EGD A;  1S26 D;  3SG7 A;  1JFJ A;  3BUO B;  3PM8 A;  1KWO B;  1A29 A;  2JT8 A;  3EVR A;  1S5G Y;  3DVJ A;  2JWW A;  5DKQ A;  2M1K B;  2MLE C;  1MXE A;  5CSN A;  2IS9 A;  2L51 A;  4ORA B;  4OV2 A;  1YTZ C;  4AQI A;  1FI6 A;  3M0W A;  1MXL C;  4MLW A;  5D69 A;  1F71 A;  1KK7 Y;  1PUL A;  1JSA A;  1CFD A;  1LA0 A;  3IF7 A;  3OB2 B;  3WHT B;  2EC6 C;  2AUC A;  1SW8 A;  3GK4 X;  5F6T A;  2PVB A;  1CDP A;  1EL4 A;  2Y4Q A;  1PVA A;  2R2I A;  3LL8 B;  1U5I A;  3JVT C;  4ICB A;  5HYD A;  1M45 A;  1QX2 A;  2F8P A;  2M97 A;  2HQ8 A;  2H2K A;  2KI6 C;  3LK1 A;  4TNC A;  1YVL A;  4HRG A;  1KQM C;  1SR6 C;  2LHI A;  2MA2 A;  3ZNI A;  2L98 A;  3KEV A;  4XJK B;  5DKR A;  2NXQ A;  3BQ3 A;  3OP0 A;  1B4C A;  1E8A A;  1NYA A;  2BCA A;  3BXK A;  3FIA A;  3SIB A;  1TOP A;  3DF0 A;  1QXP A;  4CID A;  4E68 A;  1XA5 A;  1SCM B;  1WY9 A;  4ORC B;  1H8B A;  1S5G Z;  3OHM B;  3AAK A;  3SG3 A;  2BL0 C;  4HRE E;  1GQM A;  1K90 D;  2K7O A;  3SJS A;  4MBE A;  1N0Y A;  1M39 A;  1YVH A;  4DIR A;  1TCF A;  5HKW A;  2MBX A;  3NXA A;  4Q04 A;  1R6P A;  3VRP A;  2FCD A;  3SG6 A;  1MHO A;  1C7W A;  1PRW A;  1OE9 B;  1UUS A;  2JC2 A;  3BUN B;  2BE4 A;  3EK4 A;  4PE1 A;  1VRK A;  2M7N A;  2KFF A;  1U5I B;  2OPO A;  3TUY C;  3TS5 B;  1OMD A;  2GGM A;  1BJF A;  1WLM A;  2KGR A;  3HCM A;  3ICB A;  4GGF C;  4WQ2 A;  4CFQ A;  2KYC A;  3HX4 A;  1N65 A;  1DJG A;  2KQY A;  2BBM A;  1NCX A;  1PAL A;  2M3W A;  4GPL B;  4HSZ A;  4GNK B;  2TN4 A;  4YBH B;  5ER5 A;  5KU1 A;  1BT6 A;  4JQ0 D;  5FYX A;  1NX0 A;  1C07 A;  1GGW A;  2WND A;  5I2Q A;  2M8U A;  1M46 A;  4WQ3 A;  1OZS A;  2QAC A;  2Q91 A;  2KI4 B;  1YUU A;  4U8D A;  1XFV O;  4N5X A;  2JPT A;  2NZ0 A;  3WXA A;  5K89 A;  2LUX A;  1RJV A;  1GGZ A;  2HQW A;  5JOL A;  1NUB A;  1BR1 B;  1KFX L;  4QJ3 B;  2BKI B;  3VRN A;  5KSZ A;  1UHK A;  3ZWH A;  1MF8 B;  1B9A A;  1K94 A;  2G2B A;  2ZND A;  1DF0 A;  5HKZ A;  4A4C A;  3TZ1 A;  3C1V A;  1Y6W A;  4AOM A;  5JJG A;  3A4U B;  2PAS A;  5ER4 X;  2FOT A;  1LA3 A;  2ZKM X;  3BOW B;  1ODB A;  4OKH A;  5AAN A;  2K2A A;  1NX1 A;  3CLN A;  2KBI A;  4YGC B;  1QLS A;  1D1O A;  3EVV A;  1XVJ A;  3BUM B;  1KWO C;  4NDB A;  2BCB A;  1PSB A;  4I5L B;  4PHK A;  1DJZ A;  1AUI B;  1EG4 A;  4M2P A;  1KCY A;  2VRG A;  2OS8 B;  2COL B;  3DD4 A;  3NSL A;  2H61 A;  1YUR A;  1UUR A;  2LLT A;  1LVC D;  1SNL A;  2K7C A;  1SCV A;  4USL A;  1H4B A;  1IWQ A;  3SIA A;  2GGZ A;  1YUS A;  1BMO A;  1UHH A;  1DVI A;  2SCP A;  3OX5 A;  5BPJ A;  4GGN A;  2BE6 A;  2H61 C;  2I18 A;  4L9M A;  4XJK A;  2PSR A;  1YR5 A;  1IGV A;  1KK8 B;  2LVV A;  5HLO A;  2K7B A;  4DUQ A;  1DF0 B;  1J1D A;  1ZAC A;  3LLE A;  1IKU A;  4F0Z B;  1QTX A;  1MQ1 A;  1RFJ A;  3CS1 A;  2F33 A;  3D0Y B;  2JNF A;  1A03 A;  4JPZ B;  2LVI A;  3BYA A;  1TNW A;  1Y1X A;  2AAO A;  2F3Z A;  4YI8 A;  2OTG B;  2L4H A;  5CSF A;  1L2O B;  4N1G A;  1G4Y R;  1SCM C;  3DVK A;  1PVB A;  2Y1M A;  2E6W A;  1KFX S;  5CPV A;  3AKB A;  4YI9 A;  1BOC A;  3I5F B;  2WOS A;  1Q80 A;  2I2R E;  1A75 A;  2JNX A;  1B8L A;  3LK0 A;  4JWQ A;  1DJH A;  1NSH A;  1ZFS A;  1BF5 A;  4I5K A;  2M49 B;  1SMG A; 
#chains in the Genus database with same CATH topology
 1F4O A;  1CKK A;  1QIV A;  2WCB A;  1J7R A;  2LUC A;  2QEO A;  3SS5 A;  3TS5 C;  1BU3 A;  2MJW B;  3VRO A;  1NPQ A;  1SRA A;  1QX7 A;  1AVS A;  2ZRT A;  1QX5 B;  3OGN A;  4C0L A;  3CGA A;  1YRT B;  2I7A A;  3EKH A;  2ISD A;  3SG4 A;  4M2O A;  3VRR A;  1ORG A;  2BAP A;  1TRF A;  1V1F A;  2QDI A;  1A2X A;  1CM1 A;  1QVI Y;  3AAJ A;  1YUT A;  3D73 A;  2PQL A;  5B8I B;  2BCX A;  1OMV A;  1AJ4 A;  1RWY A;  3CYZ A;  2KI6 D;  1DJI A;  1AK8 A;  3DVM A;  1OQP A;  2WCE A;  1QV0 A;  1UHN A;  2KI4 C;  2L4I A;  2P71 A;  3L4A A;  1JF0 A;  2F2P A;  1K9K A;  2LP3 A;  1B7T Z;  1YX8 A;  3I5I B;  2LLS A;  3OB1 B;  3BOW A;  1A75 B;  5I94 A;  1CLM A;  3R1V A;  1SBJ A;  1N2D A;  4A4B A;  1OOI X;  1FI5 A;  1CNP A;  3DXL A;  4WRI A;  5J3X A;  1FW4 A;  1MR8 A;  3CZ2 A;  1G8I A;  4JKT A;  2JXL A;  4PE4 A;  1TCO B;  4IL1 A;  1QAS A;  3MSE B;  2WCH A;  1CTR A;  2LVJ A;  1TNX A;  2K2F A;  4PDZ A;  3A8R A;  2KFG A;  2PMY A;  1UHJ A;  1SY9 A;  3I5G B;  4ZCU A;  1RRO A;  2FJU B;  2CCM A;  2NLN A;  4YGD B;  4MZJ A;  2LCP A;  2SAS A;  3E3R A;  1JF2 A;  2PAL A;  3WNX B;  1XFR A;  3L47 A;  2Y5I A;  2ZN9 A;  1BOD A;  1CFF A;  3F45 A;  3TDZ A;  1S1E A;  4AQJ A;  3NSK A;  3SG5 A;  2KLE A;  4YGE B;  2BKH B;  3PAT A;  1IQ3 A;  2HPS A;  1QVI Z;  2OS8 C;  1OZO A;  1IJ5 A;  1IG5 A;  2GV5 A;  2LAN A;  3DY9 A;  3KHE A;  5FI2 A;  4I5N B;  3D10 A;  1AJ5 A;  3PN7 B;  3EKJ A;  1DC1 A;  1ALW A;  4M2Q A;  3IQQ A;  1S6I A;  2LMU A;  2ZFD A;  1K2H A;  1W7J B;  2Q4U A;  4BY5 A;  3D0Y A;  1XK4 A;  1J7Q A;  4OZD A;  1J55 A;  1MWN A;  2PRU A;  3KPX A;  4GFT A;  1WRK A;  3D74 A;  3IQO A;  1QWV A;  3SG2 A;  3KF9 A;  1CDM A;  1KK8 C;  3OX6 A;  3B88 A;  1K9P A;  2JTZ A;  3FE9 A;  3PAL A;  4MRY A;  3CR5 X;  4MRX A;  1SK6 D;  1SL7 A;  3IVT A;  2E30 A;  1C3Z A;  2K8M B;  2L50 A;  3RM1 A;  1DMO A;  1OMR A;  1HT9 A;  3CDN A;  1CLL A;  1TIZ A;  2KGB C;  2V53 A;  3CZ1 A;  2OTG C;  1B8C A;  2BEC A;  3FWB A;  1L2O C;  4C0K A;  5KTY A;  1BLQ A;  5HKY A;  1MUX A;  2CTN A;  1XFZ O;  3NSO A;  4MEW A;  1NCZ A;  5DIC A;  1XO5 A;  1TTX A;  1NX3 A;  2KHN A;  1HQV A;  2JU0 A;  5CSJ A;  2M0R A;  2HF5 A;  3I5F C;  1A4P A;  1NCY A;  1K96 A;  1F70 A;  2BBN A;  4P5O E;  4NDD A;  2ZRS A;  4PCW A;  2ZNE A;  2M29 A;  4ZCV A;  1CMG A;  5IBW A;  5I2O A;  1DGV A;  1KQV A;  1LIN A;  1KFU L;  2JT0 A;  2QEB A;  1F54 A;  1XFU O;  1ZUZ A;  3NSI A;  1WRL A;  1EJ3 A;  3O78 A;  3V2L A;  1SKT A;  4PHJ A;  3O4Y A;  1JWD A;  1J1E A;  2D8N A;  3Q8I A;  2KBM A;  1WDC B;  4ORB B;  3S0D A;  1AP4 A;  2LC5 A;  4CFR A;  1NWD A;  1R2U A;  5I2L A;  2LM5 A;  2ZN8 A;  1QLK A;  2K61 A;  1B47 A;  1QAT A;  2KAV A;  2F2O A;  1K95 A;  1V1G A;  4MZL A;  4MN0 A;  1KSM A;  1J7O A;  2GTE A;  4MSP A;  2JXC A;  3D78 A;  5AXI A;  1B7T Y;  1K9U A;  5HL1 A;  1JC2 A;  4QJ5 B;  1WLZ A;  1ZMZ A;  2HET A;  1CFP A;  2LE9 B;  1DGU A;  1XFX O;  1Y1A A;  3L4L A;  5PAL A;  2NCP A;  1KSO A;  1CDN A;  2YGU A;  1B8R A;  2KAY A;  3R1O A;  3PLF B;  5CSI A;  5AFP A;  2JOJ A;  3I5I C;  2L5Y A;  4FQO A;  4GAO A;  3JTD B;  1S6C A;  4NDC A;  3S0G A;  1DJY A;  1XYD A;  3BUW B;  2M1U A;  1UP5 A;  4PHM A;  2AMI A;  2DOQ A;  1Y0V H;  2G9B A;  4GUK A;  4MZK A;  3VGO A;  2CT9 A;  5I8N A;  4HRH A;  4DRW A;  5FI7 A;  1X02 A;  3AKA A;  2LV7 A;  4QJ4 B;  2O5G A;  2PYQ A;  1DQE A;  3I5H B;  1XFW O;  3BFA A;  2EHB A;  1SL8 A;  1NP8 A;  2WCM A;  1GJY A;  4R1E A;  3I5G C;  1TNQ A;  3NHT A;  2CXJ A;  4XYN A;  3CTN A;  4NQG A;  5TNC A;  3VRQ A;  4PE7 A;  1K93 D;  3CR2 A;  4P2Y B;  2L2E A;  2WCF A;  4C0J A;  3CAB A;  2MAZ A;  1S36 A;  2JQ6 A;  1PSR A;  1S6J A;  3KO0 A;  3O6B A;  1CLB A;  2M7L A;  2WCJ A;  4PHN A;  2EC6 B;  1JFK A;  4CLN A;  1KFU S;  3PN7 C;  1F4Q A;  1J7P A;  3EVU A;  1FBV A;  4PAL A;  2P6B B;  4ETO A;  3N7H A;  1AHR A;  1KK7 Z;  3JVT B;  2CBL A;  4PE0 A;  1PK0 D;  1EG3 A;  1DEL A;  2KQ6 A;  3FS7 A;  2WC8 A;  2KAX A;  4GGF A;  3NGV A;  5BPJ A;  3GK1 A;  3D77 A;  4D1E A;  1KQM B;  2LHL A;  3FWC A;  1DT7 B;  1SL9 A;  3TDI A;  1SR6 B;  2MHH A;  1UWO A;  1F55 A;  2FCE A;  4BY4 A;  3DVE A;  4INX A;  3CZ0 A;  1UHI A;  1W7I B;  2QPT A;  1ALV A;  3EK7 A;  1QIW A;  2K60 A;  1K8U A;  3PFV A;  4YGB B;  2MRD A;  1OW4 A;  1EXR A;  2BL0 B;  2K0J A;  3WHU B;  2A4J A;  1QS7 A;  3BJH A;  2ERB A;  3B6X A;  2K7D A;  2FJY A;  3GK2 A;  2LAP A;  2BNX A;  3EK8 A;  3R1P A;  4JD9 A;  4OCI A;  5GQQ C;  2JZI A;  2WOR A;  3DF0 B;  1C3Y A;  2M9G A;  1CFC A;  3O2P A;  1EH2 A;  2RGI A;  1RTP 1;  2LMV A;  1QV1 A;  1REC A;  2LNK A;  1SYM A;  1IH0 A;  2JRF A;  3K1E A;  2L5X B;  3UNW A;  3PM2 A;  3VB1 A;  1DJW A;  1XK4 C;  3TUY B;  1SPY A;  1CDL A;  1OSA A;  2LP2 A;  3NHI A;  5G08 A;  3S0B A;  4N1F A;  2KDH A;  4MVF A;  2KFH A;  1DJX A;  2KYF A;  1WDC C;  1M63 B;  3R72 A;  1CM4 A;  3FE6 A;  4DCK A;  3CZT X;  1Z2C B;  2LMT A;  1LXF C;  1BG1 A;  1OOJ A;  3K21 A;  4I5J A;  1S3P A;  3GOF A;  2KNE A;  1IQ5 A;  2I94 A;  1W9Z A;  1CMF A;  3EG5 B;  3BFB A;  1YRU B;  2B1U A;  1B1G A;  1FF1 A;  1M31 A;  1YX7 A;  2O60 A;  2NCO A;  1NX2 A;  3DYE A;  5AER A;  1CB1 A;  2CNP A;  1XFY O;  2MLF C;  4UPG A;  4YGA A;  4FQT A;  1C7V A;  1F8H A;  1FPW A;  1BR4 B;  5D3O A;  1JUO A;  2KSP A;  1LKJ A;  3H4S E;  2WC6 A;  3CWG A;  1L7Z A;  4YRU A;  1RK9 A;  4FTG A;  2JT3 A;  1Y1U A;  3BUX B;  2F3Y A;  3JTD C;  3RLZ A;  5D7F A;  1JBA A;  4OVN F;  3QRX A;  5HLV A;  4GBA A;  2KOT A;  4CPV A;  4DS7 A;  1TN4 A;  1G33 A;  2JUL A;  2LLU A;  3PSR A;  5AEQ A;  2JPO A;  2Y1N A;  1QJT A;  1IJ6 A;  1DTL A;  3TDU A;  1OOG A;  1TNP A;  3LCP C;  2LVK A;  3CR4 X;  1IRJ A;  2L0P A;  3I5H C;  4OR9 B;  2JTT A;  1NIW A;  1WRZ A;  5DKN A;  1ZOT B;  4IJ7 A;  2EGD A;  1S26 D;  2WCK A;  3SG7 A;  1JFJ A;  3BUO B;  3PM8 A;  1KWO B;  3PJI A;  1A29 A;  2JT8 A;  3EVR A;  1S5G Y;  3DVJ A;  2JWW A;  5DKQ A;  2M1K B;  2MLE C;  1MXE A;  5CSN A;  1LS8 A;  2IS9 A;  2L51 A;  4ORA B;  4OV2 A;  1YTZ C;  4AQI A;  1FI6 A;  3M0W A;  1MXL C;  4MLW A;  5D69 A;  1F71 A;  1KK7 Y;  1PUL A;  1JSA A;  1CFD A;  1LA0 A;  3IF7 A;  3OB2 B;  3WHT B;  2QEH A;  2EC6 C;  2AUC A;  1SW8 A;  3GK4 X;  2L2C A;  5EL2 A;  5F6T A;  2PVB A;  1CDP A;  1EL4 A;  2Y4Q A;  1PVA A;  2R2I A;  3LL8 B;  1U5I A;  3JVT C;  4ICB A;  5HYD A;  1M45 A;  1QX2 A;  3UO9 A;  2F8P A;  2M97 A;  2HQ8 A;  2H2K A;  2KI6 C;  3LK1 A;  4TNC A;  1YVL A;  4HRG A;  1KQM C;  1SR6 C;  2LHI A;  2MA2 A;  3ZNI A;  2L98 A;  3KEV A;  4XJK B;  5DKR A;  3S0E A;  2NXQ A;  3BQ3 A;  3OP0 A;  3S0A A;  1B4C A;  1E8A A;  1NYA A;  2BCA A;  3BXK A;  3FIA A;  5FI6 A;  3SIB A;  1TOP A;  3DF0 A;  1QXP A;  4CID A;  4E68 A;  1XA5 A;  1SCM B;  1WY9 A;  4ORC B;  1H8B A;  1S5G Z;  4PT1 A;  3OHM B;  3BFH A;  3AAK A;  2H8V A;  4INW A;  3SG3 A;  2BL0 C;  4HRE E;  1GQM A;  1K90 D;  2K7O A;  3SJS A;  4MBE A;  1N0Y A;  1M39 A;  1YVH A;  4DIR A;  1TCF A;  3OBV A;  5HKW A;  2MBX A;  3NXA A;  4Q04 A;  1R6P A;  3VRP A;  2WC5 A;  1GM0 A;  2FCD A;  3SG6 A;  1MHO A;  1C7W A;  1PRW A;  1OE9 B;  1UUS A;  2JC2 A;  3BUN B;  2BE4 A;  3EK4 A;  4PE1 A;  1VRK A;  2M7N A;  1OOF A;  2KFF A;  1U5I B;  2OPO A;  1IIO A;  3TUY C;  3QME A;  3TS5 B;  1OMD A;  4KYN A;  3S0F A;  2GGM A;  1BJF A;  1WLM A;  2KGR A;  3B87 A;  3HCM A;  3ICB A;  4GGF C;  4WQ2 A;  4CFQ A;  2P70 A;  2KYC A;  3HX4 A;  1N65 A;  1DJG A;  3DZT A;  2KQY A;  2BBM A;  1NCX A;  1PAL A;  2M3W A;  4GPL B;  4HSZ A;  4GNK B;  2TN4 A;  4YBH B;  5ER5 A;  5KU1 A;  1BT6 A;  4JQ0 D;  5FYX A;  1NX0 A;  1C07 A;  3SS3 A;  1GGW A;  2WND A;  5I2Q A;  1SSE B;  2M8U A;  1M46 A;  4WQ3 A;  1OZS A;  2QAC A;  3B7A A;  2Q91 A;  3D75 A;  2KI4 B;  1YUU A;  4U8D A;  1XFV O;  4N5X A;  2QEV A;  2JPT A;  2NZ0 A;  3WXA A;  5K89 A;  2LUX A;  1RJV A;  1GGZ A;  2HQW A;  5JOL A;  1NUB A;  1BR1 B;  1KFX L;  4QJ3 B;  2BKI B;  3VRN A;  5KSZ A;  1UHK A;  3ZWH A;  1MF8 B;  1B9A A;  1K94 A;  2G2B A;  2ZND A;  1DF0 A;  5HKZ A;  4A4C A;  3TZ1 A;  3C1V A;  1Y6W A;  3SS4 A;  4AOM A;  5JJG A;  3A4U B;  2PAS A;  3B86 A;  5ER4 X;  2FOT A;  1LA3 A;  2ZKM X;  3BOW B;  1ODB A;  4OKH A;  5AAN A;  2K2A A;  1NX1 A;  3CLN A;  2KBI A;  4YGC B;  1QLS A;  1D1O A;  3EVV A;  1XVJ A;  3BUM B;  1KWO C;  4NDB A;  1Z4H A;  1OOH A;  2BCB A;  1PSB A;  4I5L B;  4PHK A;  1DJZ A;  1AUI B;  1EG4 A;  4M2P A;  3D76 A;  1KCY A;  2VRG A;  2OS8 B;  2COL B;  3DD4 A;  3NSL A;  2H61 A;  1YUR A;  2KLD A;  1UUR A;  2KPH A;  2LLT A;  1LVC D;  1SNL A;  1T14 A;  2K7C A;  1SCV A;  4USL A;  1P28 A;  1IWQ A;  1H4B A;  3SIA A;  2GGZ A;  1YUS A;  1BMO A;  1UHH A;  1DVI A;  2SCP A;  3O4X A;  3OX5 A;  4GGN A;  2BE6 A;  2H61 C;  2I18 A;  4L9M A;  4XJK A;  2PSR A;  1DEK A;  1YR5 A;  1IGV A;  1KK8 B;  2LVV A;  5HLO A;  1TUJ A;  2K7B A;  1DF0 B;  4DUQ A;  1J1D A;  1ZAC A;  3LLE A;  1IKU A;  4F0Z B;  1QTX A;  1MQ1 A;  1RFJ A;  3CS1 A;  2F33 A;  3D0Y B;  2JNF A;  1A03 A;  4JPZ B;  2LVI A;  3BYA A;  1TNW A;  1Y1X A;  2AAO A;  2F3Z A;  4YI8 A;  2OTG B;  2L4H A;  3FE8 A;  5CSF A;  1L2O B;  4N1G A;  1G4Y R;  1SCM C;  3DVK A;  1PVB A;  2Y1M A;  2E6W A;  1TUZ A;  1KFX S;  5CPV A;  3AKB A;  4YI9 A;  1BOC A;  3I5F B;  2WOS A;  1Q80 A;  2I2R E;  1A75 A;  1TWO A;  2JNX A;  1B8L A;  3RZS A;  3LK0 A;  4F7F A;  2WCL A;  4JWQ A;  1DJH A;  1NSH A;  1ZFS A;  1BF5 A;  4I5K A;  2M49 B;  1SMG A; 
#chains in the Genus database with same CATH homology
 1F4O A;  1CKK A;  1QIV A;  2WCB A;  1J7R A;  2LUC A;  3TS5 C;  1BU3 A;  2MJW B;  3VRO A;  1NPQ A;  1SRA A;  1QX7 A;  1AVS A;  2ZRT A;  1QX5 B;  4C0L A;  3CGA A;  1YRT B;  2I7A A;  3EKH A;  2ISD A;  3SG4 A;  4M2O A;  3VRR A;  1TRF A;  1V1F A;  1A2X A;  1CM1 A;  1QVI Y;  3AAJ A;  1YUT A;  5B8I B;  2BCX A;  1OMV A;  1AJ4 A;  1RWY A;  2KI6 D;  1DJI A;  1AK8 A;  3DVM A;  1OQP A;  2WCE A;  1QV0 A;  1UHN A;  2KI4 C;  2L4I A;  1JF0 A;  2F2P A;  1K9K A;  2LP3 A;  1B7T Z;  1YX8 A;  3I5I B;  2LLS A;  3OB1 B;  3BOW A;  1A75 B;  1CLM A;  1SBJ A;  1N2D A;  4A4B A;  1FI5 A;  1CNP A;  4WRI A;  5J3X A;  1FW4 A;  1MR8 A;  1G8I A;  2JXL A;  4PE4 A;  1TCO B;  4IL1 A;  1QAS A;  3MSE B;  1CTR A;  2LVJ A;  1TNX A;  2K2F A;  4PDZ A;  3A8R A;  2KFG A;  2PMY A;  1UHJ A;  1SY9 A;  3I5G B;  4ZCU A;  1RRO A;  2FJU B;  2CCM A;  2NLN A;  4YGD B;  4MZJ A;  2LCP A;  2SAS A;  3E3R A;  1JF2 A;  2PAL A;  3WNX B;  2Y5I A;  2ZN9 A;  1BOD A;  1CFF A;  3F45 A;  3TDZ A;  1S1E A;  4AQJ A;  3NSK A;  3SG5 A;  4YGE B;  2BKH B;  3PAT A;  1IQ3 A;  2HPS A;  1QVI Z;  2OS8 C;  1OZO A;  1IJ5 A;  1IG5 A;  2GV5 A;  2LAN A;  3KHE A;  4I5N B;  3D10 A;  1AJ5 A;  3PN7 B;  3EKJ A;  1ALW A;  4M2Q A;  3IQQ A;  1S6I A;  2LMU A;  2ZFD A;  1K2H A;  1W7J B;  2Q4U A;  4BY5 A;  3D0Y A;  1XK4 A;  1J7Q A;  1J55 A;  1MWN A;  2PRU A;  3KPX A;  4GFT A;  1WRK A;  3IQO A;  3SG2 A;  3KF9 A;  1CDM A;  1KK8 C;  3OX6 A;  1K9P A;  2JTZ A;  3PAL A;  4MRY A;  3CR5 X;  4MRX A;  1SK6 D;  1SL7 A;  2E30 A;  2K8M B;  2L50 A;  3RM1 A;  1DMO A;  1OMR A;  1HT9 A;  1CLL A;  1TIZ A;  2KGB C;  2V53 A;  2OTG C;  1B8C A;  2BEC A;  3FWB A;  1L2O C;  4C0K A;  5KTY A;  1BLQ A;  5HKY A;  1MUX A;  2CTN A;  1XFZ O;  3NSO A;  4MEW A;  1NCZ A;  1XO5 A;  1TTX A;  1NX3 A;  2KHN A;  1HQV A;  2JU0 A;  5CSJ A;  2M0R A;  2HF5 A;  3I5F C;  1A4P A;  1NCY A;  1K96 A;  1F70 A;  2BBN A;  4P5O E;  4NDD A;  2ZRS A;  4PCW A;  2ZNE A;  2M29 A;  4ZCV A;  1CMG A;  5IBW A;  5I2O A;  1DGV A;  1KQV A;  1LIN A;  1KFU L;  2JT0 A;  1F54 A;  1XFU O;  1ZUZ A;  3NSI A;  1WRL A;  1EJ3 A;  3O78 A;  1SKT A;  4PHJ A;  3O4Y A;  1JWD A;  1J1E A;  2D8N A;  2KBM A;  1WDC B;  4ORB B;  1AP4 A;  2LC5 A;  4CFR A;  1NWD A;  1R2U A;  5I2L A;  2LM5 A;  2ZN8 A;  1QLK A;  2K61 A;  1B47 A;  1QAT A;  2KAV A;  2F2O A;  1K95 A;  1V1G A;  4MZL A;  4MN0 A;  1KSM A;  1J7O A;  4MSP A;  2JXC A;  5AXI A;  1B7T Y;  1K9U A;  1JC2 A;  4QJ5 B;  1WLZ A;  1ZMZ A;  2HET A;  1CFP A;  2LE9 B;  1DGU A;  1XFX O;  1Y1A A;  5PAL A;  2NCP A;  1KSO A;  1CDN A;  1B8R A;  2KAY A;  3PLF B;  5CSI A;  5AFP A;  2JOJ A;  3I5I C;  4FQO A;  4GAO A;  4NDC A;  3JTD B;  1S6C A;  1DJY A;  1XYD A;  3BUW B;  2M1U A;  1UP5 A;  4PHM A;  2AMI A;  2DOQ A;  1Y0V H;  2G9B A;  4GUK A;  4MZK A;  3VGO A;  2CT9 A;  5I8N A;  4HRH A;  4DRW A;  1X02 A;  3AKA A;  2LV7 A;  4QJ4 B;  2O5G A;  3I5H B;  1XFW O;  2EHB A;  1SL8 A;  1NP8 A;  1GJY A;  4R1E A;  3I5G C;  1TNQ A;  2CXJ A;  4XYN A;  3CTN A;  4NQG A;  5TNC A;  3VRQ A;  4PE7 A;  1K93 D;  3CR2 A;  4P2Y B;  2L2E A;  2WCF A;  4C0J A;  2MAZ A;  1S36 A;  2JQ6 A;  1PSR A;  1S6J A;  3KO0 A;  3O6B A;  1CLB A;  2M7L A;  4PHN A;  2EC6 B;  1JFK A;  4CLN A;  1KFU S;  3PN7 C;  1F4Q A;  1J7P A;  3EVU A;  1FBV A;  4PAL A;  2P6B B;  4ETO A;  1AHR A;  1KK7 Z;  3JVT B;  2CBL A;  4PE0 A;  1PK0 D;  1EG3 A;  2KQ6 A;  3FS7 A;  2WC8 A;  2KAX A;  4GGF A;  3GK1 A;  4D1E A;  1KQM B;  2LHL A;  3FWC A;  1DT7 B;  1SL9 A;  3TDI A;  1SR6 B;  2MHH A;  1UWO A;  1F55 A;  2FCE A;  4BY4 A;  3DVE A;  1UHI A;  1W7I B;  2QPT A;  1ALV A;  3EK7 A;  1QIW A;  4YGB B;  1K8U A;  3PFV A;  2MRD A;  1EXR A;  2BL0 B;  2K0J A;  3WHU B;  2A4J A;  1QS7 A;  2K7D A;  3GK2 A;  2LAP A;  3EK8 A;  4OCI A;  5GQQ C;  2JZI A;  2WOR A;  3DF0 B;  2M9G A;  1CFC A;  3O2P A;  1EH2 A;  2RGI A;  1RTP 1;  2LMV A;  1QV1 A;  1REC A;  2LNK A;  1SYM A;  1IH0 A;  2JRF A;  2L5X B;  1DJW A;  1XK4 C;  3TUY B;  1SPY A;  1CDL A;  1OSA A;  2LP2 A;  5G08 A;  4N1F A;  2KDH A;  4MVF A;  2KFH A;  1DJX A;  2KYF A;  1WDC C;  1M63 B;  1CM4 A;  4DCK A;  3CZT X;  2LMT A;  1LXF C;  1BG1 A;  1OOJ A;  3K21 A;  4I5J A;  1S3P A;  3GOF A;  2KNE A;  1IQ5 A;  2I94 A;  1CMF A;  1YRU B;  2B1U A;  1B1G A;  1FF1 A;  1M31 A;  1YX7 A;  2O60 A;  2NCO A;  1NX2 A;  1CB1 A;  5AER A;  2CNP A;  1XFY O;  2MLF C;  4UPG A;  4YGA A;  1C7V A;  1F8H A;  1FPW A;  1BR4 B;  1JUO A;  2KSP A;  1LKJ A;  3H4S E;  3CWG A;  1L7Z A;  4YRU A;  1RK9 A;  4FTG A;  2JT3 A;  1Y1U A;  3BUX B;  2F3Y A;  3JTD C;  3RLZ A;  5D7F A;  1JBA A;  4OVN F;  3QRX A;  5HLV A;  4GBA A;  2KOT A;  4CPV A;  4DS7 A;  1TN4 A;  1G33 A;  2JUL A;  2LLU A;  3PSR A;  5AEQ A;  3TDU A;  2Y1N A;  1QJT A;  1IJ6 A;  1DTL A;  3LCP C;  1TNP A;  2LVK A;  3CR4 X;  1IRJ A;  2L0P A;  3I5H C;  4OR9 B;  2JTT A;  1NIW A;  1WRZ A;  5DKN A;  1ZOT B;  2EGD A;  1S26 D;  3SG7 A;  1JFJ A;  3BUO B;  3PM8 A;  1KWO B;  1A29 A;  2JT8 A;  3EVR A;  1S5G Y;  3DVJ A;  2JWW A;  5DKQ A;  2M1K B;  2MLE C;  1MXE A;  5CSN A;  2IS9 A;  2L51 A;  4ORA B;  4OV2 A;  1YTZ C;  4AQI A;  1FI6 A;  3M0W A;  1MXL C;  4MLW A;  5D69 A;  1F71 A;  1KK7 Y;  1PUL A;  1JSA A;  1CFD A;  1LA0 A;  3IF7 A;  3OB2 B;  3WHT B;  2EC6 C;  2AUC A;  1SW8 A;  3GK4 X;  5F6T A;  2PVB A;  1CDP A;  1EL4 A;  2Y4Q A;  1PVA A;  2R2I A;  3LL8 B;  1U5I A;  3JVT C;  4ICB A;  5HYD A;  1M45 A;  1QX2 A;  2F8P A;  2M97 A;  2HQ8 A;  2H2K A;  2KI6 C;  3LK1 A;  4TNC A;  1YVL A;  4HRG A;  1KQM C;  1SR6 C;  2LHI A;  2MA2 A;  3ZNI A;  2L98 A;  3KEV A;  4XJK B;  5DKR A;  2NXQ A;  3BQ3 A;  3OP0 A;  1B4C A;  1E8A A;  1NYA A;  2BCA A;  3BXK A;  3FIA A;  3SIB A;  1TOP A;  3DF0 A;  1QXP A;  4CID A;  4E68 A;  1XA5 A;  1SCM B;  1WY9 A;  4ORC B;  1H8B A;  1S5G Z;  3OHM B;  3AAK A;  3SG3 A;  2BL0 C;  4HRE E;  1GQM A;  1K90 D;  2K7O A;  3SJS A;  4MBE A;  1N0Y A;  1M39 A;  1YVH A;  4DIR A;  1TCF A;  5HKW A;  2MBX A;  3NXA A;  4Q04 A;  1R6P A;  3VRP A;  2FCD A;  3SG6 A;  1MHO A;  1C7W A;  1PRW A;  1OE9 B;  1UUS A;  2JC2 A;  3BUN B;  2BE4 A;  3EK4 A;  4PE1 A;  1VRK A;  2M7N A;  2KFF A;  1U5I B;  2OPO A;  3TUY C;  3TS5 B;  1OMD A;  2GGM A;  1BJF A;  1WLM A;  2KGR A;  3HCM A;  3ICB A;  4GGF C;  4WQ2 A;  4CFQ A;  2KYC A;  3HX4 A;  1N65 A;  1DJG A;  2KQY A;  2BBM A;  1NCX A;  1PAL A;  2M3W A;  4GPL B;  4HSZ A;  4GNK B;  2TN4 A;  4YBH B;  5ER5 A;  5KU1 A;  1BT6 A;  4JQ0 D;  5FYX A;  1NX0 A;  1C07 A;  1GGW A;  2WND A;  5I2Q A;  2M8U A;  1M46 A;  4WQ3 A;  1OZS A;  2QAC A;  2Q91 A;  2KI4 B;  1YUU A;  4U8D A;  1XFV O;  4N5X A;  2JPT A;  2NZ0 A;  3WXA A;  5K89 A;  2LUX A;  1RJV A;  1GGZ A;  2HQW A;  5JOL A;  1NUB A;  1BR1 B;  1KFX L;  4QJ3 B;  2BKI B;  3VRN A;  5KSZ A;  1UHK A;  3ZWH A;  1MF8 B;  1B9A A;  1K94 A;  2G2B A;  2ZND A;  1DF0 A;  5HKZ A;  4A4C A;  3TZ1 A;  3C1V A;  1Y6W A;  4AOM A;  5JJG A;  3A4U B;  2PAS A;  5ER4 X;  2FOT A;  1LA3 A;  2ZKM X;  3BOW B;  1ODB A;  4OKH A;  5AAN A;  2K2A A;  1NX1 A;  3CLN A;  2KBI A;  4YGC B;  1QLS A;  1D1O A;  3EVV A;  1XVJ A;  3BUM B;  1KWO C;  4NDB A;  2BCB A;  1PSB A;  4I5L B;  4PHK A;  1DJZ A;  1AUI B;  1EG4 A;  4M2P A;  1KCY A;  2VRG A;  2OS8 B;  2COL B;  3DD4 A;  3NSL A;  2H61 A;  1YUR A;  1UUR A;  2LLT A;  1LVC D;  1SNL A;  2K7C A;  1SCV A;  4USL A;  1H4B A;  1IWQ A;  3SIA A;  2GGZ A;  1YUS A;  1BMO A;  1UHH A;  1DVI A;  2SCP A;  3OX5 A;  5BPJ A;  4GGN A;  2BE6 A;  2H61 C;  2I18 A;  4L9M A;  4XJK A;  2PSR A;  1YR5 A;  1IGV A;  1KK8 B;  2LVV A;  5HLO A;  2K7B A;  4DUQ A;  1DF0 B;  1J1D A;  1ZAC A;  3LLE A;  1IKU A;  4F0Z B;  1QTX A;  1MQ1 A;  1RFJ A;  3CS1 A;  2F33 A;  3D0Y B;  2JNF A;  1A03 A;  4JPZ B;  2LVI A;  3BYA A;  1TNW A;  1Y1X A;  2AAO A;  2F3Z A;  4YI8 A;  2OTG B;  2L4H A;  5CSF A;  1L2O B;  4N1G A;  1G4Y R;  1SCM C;  3DVK A;  1PVB A;  2Y1M A;  2E6W A;  1KFX S;  5CPV A;  3AKB A;  4YI9 A;  1BOC A;  3I5F B;  2WOS A;  1Q80 A;  2I2R E;  1A75 A;  2JNX A;  1B8L A;  3LK0 A;  4JWQ A;  1DJH A;  1NSH A;  1ZFS A;  1BF5 A;  4I5K A;  2M49 B;  1SMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...