1IKUA

Myristoylated recoverin in the calcium-free state, nmr, 22 structures
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
188
structure length
188
Chain Sequence
GNSKSGALSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding protein
molecule keywords RECOVERIN
publication title Sequestration of the membrane-targeting myristoyl group of recoverin in the calcium-free state.
pubmed doi rcsb
source organism Bos taurus
total genus 41
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 1996-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ikuA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ikuA01
2L0PA 2CCMA 2E30A 3OB2B 4NQGA 3HCMA 2BCAA 2Q91A 1SW8A 1XFZO 1QV1A 2L51A 1ALVA 2WCFA 2MA2A 4QJ5B 4BY4A 1PSBA 4MSPA 1JFKA 3SG5A 3CGAA 2JXCA 3DF0B 2CTNA 4OVNF 1KFXS 4Q04A 1YUSA 2AAOA 3TZ1A 3C1VA 3VGOA 4DIRA 1XFWO 3HX4A 1NCXA 1GGZA 4HRGA 1K9PA 2KSPA 4UPGA 1M45A 1J7OA 4I5LB 5FYXA 1B8LA 3SG6A 1QXPA 1QVIY 3NSIA 4CFRA 3RM1A 2RGIA 4MVFA 1OQPA 1SBJA 3WHTB 3CR5X 3TUYB 1SPYA 1FPWA 5I2LA 5TNCA 1M46A 3M0WA 2BL0C 3TS5B 3E3RA 3I5IC 1RFJA 3PALA 3EVRA 2NCOA 3BOWB 1CMFA 1PULA 1IGVA 1B7TZ 4ORAB 3ZNIA 1XFVO 4PE7A 1CFFA 2LVKA 1DJXA 1BJFA 2ZFDA 4MZKA 2CBLA 1RWYA 2L5XB 3LLEA 1WY9A 2LV7A 2M3WA 2M8UA 1MUXA 3I5GC 4GGNA 5IBWA 1CM1A 1LVCD 1DJIA 1RTP1 2LANA 2KOTA 1EG4A 1CFCA 2KBIA 1MF8B 2WCEA 1S6JA 1C7WA 2KHNA 2MRDA 1F4OA 1JUOA 1SR6C 2BBMA 2JPTA 2Q4UA 1SL8A 2ISDA 2NLNA 1LINA 1IJ5A 1CMGA 3A8RA 3CR2A 1PRWA 1QVIZ 1CDMA 1IWQA 1DTLA 1NSHA 5CSNA 2BBNA 2BKIB 2KQYA 1B8RA 1UUSA 1TNWA 4WQ2A 1SCMB 4JQ0D 2HF5A 5HLOA 1JF2A 1BU3A 5D69A 2MBXA 3SIBA 1JWDA 1A03A 1TIZA 1SCVA 1XYDA 2KBMA 2KDHA 1KQVA 1K96A 1LA0A 1TTXA 1IRJA 3CLNA 1TNQA 1YURA 1QLKA 1BR1B 3CS1A 4OKHA 1UHHA 4C0LA 1DT7B 3KO0A 2G2BA 1RK9A 2K2FA 2KYCA 5AFPA 3CZTX 1WLZA 1YUUA 4GBAA 1J55A 1SK6D 1QIWA 3BXKA 4I5KA 1YX8A 1AJ5A 2BCXA 3VROA 1F71A 1EXRA 3PN7C 1AJ4A 3TS5C 2B1UA 1NX0A 2JTZA 4JPZB 1NCZA 1YRUB 2LLSA 1W7IB 1WRZA 4YI8A 2M29A 3PLFB 5CSIA 2I18A 2NCPA 4C0JA 1RJVA 1WLMA 3CTNA 1TRFA 3LCPC 1G33A 4HSZA 2BE4A 2F3YA 1B8CA 3SIAA 1LXFC 4WQ3A 1BLQA 1ZACA 3GK2A 1NPQA 4YRUA 2JZIA 4TNCA 1IQ5A 1DF0A 3I5FB 1W7JB 1S1EA 1OMRA 1BR4B 1ZOTB 2FJUB 2OPOA 1DGVA 2BCBA 2BL0B 2TN4A 3DVMA 3TDIA 2CXJA 1YTZC 1Y1AA 2L4IA 1EJ3A 2KAVA 2L4HA 3GOFA 2LP3A 4YI9A 1H4BA 2HQWA 1MWNA 3BYAA 1RECA 2KQ6A 2PASA 1TOPA 1Y6WA 1UHJA 2MLEC 3CR4X 4WRIA 1SKTA 2JNFA 3I5GB 5DKQA 1Y0VH 1J1DA 3IQQA 2R2IA 4ORCB 2JC2A 3FIAA 2FOTA 2KI6C 2LE9B 3PFVA 2HQ8A 4N1GA 4PHKA 1BMOA 3NSKA 2K61A 1G8IA 1XO5A 1TCFA 1SR6B 2LAPA 3BUMB 1OE9B 3EK4A 3SG3A 4AQJA 1MXEA 2MAZA 1OMDA 3O6BA 3EVVA 3MSEB 3VRRA 4OCIA 1N0YA 4PDZA 2L50A 1NX1A 2JQ6A 2M7LA 4DUQA 1JSAA 1TN4A 2Y5IA 3AAJA 1PALA 2I94A 1IJ6A 1QLSA 1FW4A 1MXLC 1SY9A 2EC6B 1R2UA 1CFDA 3I5FC 4HREE 5ER4X 1KK8B 1KSMA 2JT8A 1YVLA 1XFXO 2IS9A 2ZN9A 4P2YB 4NDDA 3I5HC 3FWBA 5KSZA 1EH2A 3PN7B 1NUBA 4PE4A 2ZRTA 1JC2A 1R6PA 1WRKA 1UHIA 1H8BA 1RROA 1F8HA 3BUXB 3D0YA 2ZKMX 4D1EA 1BT6A 2JXLA 4MZLA 2H2KA 2KYFA 1BODA 4MZJA 1AP4A 4PALA 1K9UA 1M31A 1NP8A 4NDBA 4PE0A 3WHUB 4GAOA 1PVAA 5K89A 1N2DA 1S6IA 1UP5A 3JVTC 2MJWB 3GK1A 3D10A 1FI5A 1QX7A 2PMYA 2F2PA 1J7QA 4R1EA 4A4CA 1B9AA 1LKJA 1S3PA 4AQIA 1N65A 1A29A 2COLB 5I2OA 1WDCC 2LC5A 4QJ4B 1NWDA 1AK8A 1K95A 1M63B 1IQ3A 1JFJA 5ER5A 5I2QA 5CSJA 2EC6C 1C7VA 1VRKA 2PRUA 4ORBB 1XA5A 2A4JA 2F33A 4MRXA 1KK8C 3KEVA 3LK1A 4FTGA 2WNDA 1KCYA 1V1GA 1TNXA 4GNKB 4M2QA 1IG5A 3FS7A 5CPVA 1CLMA 1CLLA 4DRWA 3NSOA 1DVIA 1CDLA 1J1EA 5DKRA 4XJKA 2LHLA 2KGRA 2M0RA 4ICBA 2M9GA 1KQMC 1EL4A 3PM8A 2Y4QA 1BG1A 2NXQA 2LVJA 4P5OE 4PHMA 4YGBB 1KFUS 1DJYA 1ZFSA 1KWOB 1GQMA 5F6TA 4MEWA 2FCEA 2BE6A 5D7FA 2KI4C 3K21A 2M1KB 2KFGA 2V53A 5KTYA 1BOCA 2LLTA 2P6BB 2PVBA 4OR9B 3LK0A 3I5HB 1Y1XA 1HT9A 1L2OC 2WORA 1GGWA 2JNXA 2KAXA 3D0YB 3CWGA 4CIDA 1XVJA 1BF5A 1YVHA 4YGDB 4GUKA 5DKNA 3SG2A 1NX3A 2LUCA 1F55A 2M97A 1UURA 2NZ0A 2GV5A 3O4YA 2ZRSA 2MLFC 2DOQA 1KSOA 1J7PA 3JVTB 4OV2A 2KAYA 5PALA 5JJGA 5G08A 5BPJA 2F8PA 3F45A 3EK7A 5JOLA 1AVSA 1B1GA 4MN0A 1ZMZA 4USLA 1G4YR 4JWQA 1SRAA 1NCYA 3BUOB 2D8NA 4N1FA 4ETOA 1WDCB 1CM4A 2LHIA 1QTXA 4C0KA 2HETA 3WNXB 2BKHB 1K94A 3AKBA 1XK4A 1YR5A 2ZN8A 1J7RA 1CTRA 1PSRA 4QJ3B 1DJWA 1KWOC 2EGDA 2K2AA 3AAKA 2AUCA 3O2PA 5GQQC 2LMUA 2ZNEA 3VRNA 3DD4A 2O60A 4MBEA 1B7TY 3FWCA 2H61A 1ALWA 2PSRA 1YX7A 3PATA 4IL1A 4PE1A 5HKZA 1S5GY 1QATA 4GFTA 4N5XA 1X02A 4XJKB 1QS7A 1V1FA 2M49B 1ODBA 4L9MA 1A75A 1MR8A 3KPXA 2JWWA 5J3XA 1HQVA 2HPSA 2AMIA 1YUTA 3JTDC 3OHMB 1K8UA 1KQMB 4MRYA 1KFXL 1TCOB 1S26D 3NXAA 2ZNDA 4U8DA 5AANA 4M2OA 4A4BA 1C07A 2JT0A 1CFPA 1GJYA 2OS8C 1QJTA 2KGBC 4PCWA 1MHOA 3KF9A 2WCBA 1DF0B 2QACA 1D1OA 1K2HA 1B4CA 1B47A 4PHJA 2KI4B 3DVJA 1UHNA 4ZCVA 1CKKA 2LVVA 1A4PA 1CDNA 3TDUA 1UWOA 2G9BA 2K7DA 3VRQA 2M1UA 3VRPA 1QX2A 2LP2A 4DS7A 1L2OB 2CNPA 2JULA 2LUXA 4YGEB 1Q80A 1OZOA 2BECA 2K7CA 1S5GZ 5HKWA 2F3ZA 3SJSA 4F0ZB 3DVKA 3TDZA 4GGFC 5CSFA 1AUIB 1KK7Y 1OMVA 4YGAA 1CDPA 2VRGA 1U5IA 1M39A 1XFYO 4GGFA 3IQOA 1E8AA 2JT3A 3OB1B 2LMVA 4XYNA 4BY5A 3PSRA 4GPLB 2K7OA 2K7BA 1OOJA 1NYAA 2K8MB 2OTGB 4PHNA 2E6WA 4AOMA 1PK0D 2KNEA 4YGCB 1DJHA 1NIWA 4YBHB 2KFHA 1YRTB 1UHKA 4I5JA 4NDCA 1SNLA 1DMOA 3QRXA 2FCDA 3DF0A 1AHRA 5AEQA 1DGUA 2I2RE 3SG7A 1CB1A 2CT9A 1WRLA 3OP0A 4FQOA 4DCKA 5HKYA 3A4UB 3OX6A 2JTTA 1PVBA 2Y1NA 3ICBA 3EVUA 3RLZA 4CPVA 1ZUZA 3BUNB 3EKHA 2LMTA 4M2PA 1JBAA 2WOSA 3WXAA 1QIVA 3EKJA 3TUYC 1F70A 1XFUO 3ZWHA 1A2XA 1OZSA 1KK7Z 2LLUA 1NX2A 1SYMA 5I8NA 2SCPA 1L7ZA 1K9KA 1SL7A 3H4SE 5HYDA 1QASA 3AKAA 1A75B 3BQ3A 1F54A 4HRHA 2KFFA 1EG3A 3OX5A 2WC8A 3BOWA 5AERA 2QPTA 1IH0A 3BUWB 2F2OA 1DJZA 3JTDB 2LM5A 2JRFA 3IF7A 1FBVA 1KFUL 1IKUA 3DVEA 2OS8B 1MQ1A 2GGMA 3KHEA 1SMGA 1JF0A 1TNPA 2GGZA 5B8IB 1QV0A 2Y1MA 5KU1A 2L2EA 2JU0A 3NSLA 1K93D 4CFQA 2OTGC 1LA3A 3GK4X 2LNKA 2EHBA 3O78A 1DJGA 3I5IB 1S36A 1CNPA 4I5NB 2M7NA 4MLWA 5AXIA 1SL9A 1OSAA 2JOJA 1K90D 1SCMC 1XK4C 1CLBA 2K0JA 5HLVA 1FI6A 1U5IB 2KI6D 2MHHA 1FF1A 2I7AA 4E68A 2SASA 1Y1UA 2LVIA 1F4QA 1QX5B 1S6CA 2H61C 2LCPA 3EK8A 3LL8B 2PALA 3SG4A 4CLNA 4ZCUA 2L98A 2O5GA
chains in the Genus database with same CATH superfamily
2L0PA 2CCMA 2E30A 3OB2B 4NQGA 3HCMA 2BCAA 2Q91A 3BJHA 1SW8A 3S0GA 1XFZO 1QV1A 3NHTA 1C3ZA 2L51A 1ALVA 1GM0A 3B88A 2WCFA 2MA2A 4QJ5B 4BY4A 1PSBA 4MSPA 1JFKA 3SG5A 3CGAA 2QDIA 2JXCA 3DF0B 2CTNA 4OVNF 1KFXS 4Q04A 1YUSA 2AAOA 3TZ1A 3C1VA 3VGOA 4DIRA 1XFWO 3HX4A 1NCXA 4INWA 3UNWA 4KYNA 1GGZA 4HRGA 1K9PA 2KSPA 4UPGA 1M45A 1J7OA 4I5LB 5FYXA 1B8LA 3SG6A 1QXPA 1QVIY 3DY9A 3NSIA 4CFRA 3RM1A 2RGIA 4MVFA 1OQPA 1SBJA 3BFBA 1C3YA 3WHTB 3CR5X 3TUYB 1SPYA 1FPWA 5I2LA 5TNCA 1M46A 3M0WA 2BL0C 3TS5B 3B86A 3E3RA 3I5IC 1RFJA 3PALA 3EVRA 2NCOA 3BOWB 1CMFA 1PULA 1IGVA 1B7TZ 4ORAB 3ZNIA 1XFVO 4PE7A 1CFFA 3VB1A 2LVKA 1DJXA 1BJFA 2ZFDA 4MZKA 2CBLA 1RWYA 2L5XB 3LLEA 1WY9A 2LV7A 2M3WA 2M8UA 1MUXA 3I5GC 4GGNA 5IBWA 1CM1A 3R72A 1LVCD 2L5YA 1DJIA 1RTP1 2LANA 2KOTA 1EG4A 1CFCA 2KBIA 1MF8B 2WCEA 1S6JA 1C7WA 2KHNA 2MRDA 1F4OA 1JUOA 1SR6C 1W9ZA 2BBMA 2JPTA 1SL8A 2Q4UA 2ISDA 2NLNA 1LINA 3SS3A 1IJ5A 1CMGA 2QEBA 3A8RA 3CR2A 1PRWA 1QVIZ 1CDMA 1IWQA 1DTLA 1NSHA 5CSNA 3CZ2A 2BBNA 2BKIB 2KQYA 1B8RA 1UUSA 1TNWA 4WQ2A 1SCMB 4JQ0D 2HF5A 5HLOA 1JF2A 1BU3A 5D69A 2MBXA 3SIBA 1JWDA 1A03A 1TIZA 1OOHA 1XYDA 1SCVA 2KBMA 2KDHA 1TTXA 1K96A 1LA0A 1KQVA 1IRJA 3CLNA 1TNQA 1YURA 1QLKA 1BR1B 1TUJA 3CS1A 1UHHA 2L2CA 4OKHA 4C0LA 3KO0A 1DT7B 2G2BA 1RK9A 2K2FA 2KYCA 5AFPA 3CZTX 1WLZA 1YUUA 4GBAA 1J55A 1SK6D 4JD9A 2WCKA 1QIWA 3BXKA 4I5KA 1YX8A 1AJ5A 2BCXA 3VROA 1F71A 1EXRA 2WC6A 3PN7C 1AJ4A 2QEOA 2B1UA 3TS5C 1NX0A 2JTZA 5EL2A 4JPZB 1NCZA 1YRUB 2LLSA 2WCJA 1W7IB 1WRZA 4YI8A 2M29A 3PLFB 4PT1A 5CSIA 2I18A 2NCPA 4C0JA 1RJVA 1WLMA 3CTNA 1TRFA 3LCPC 1G33A 3CYZA 4HSZA 2BE4A 2F3YA 1B8CA 3SIAA 1LXFC 4WQ3A 1BLQA 1ZACA 3GK2A 1NPQA 4YRUA 2JZIA 4TNCA 1IQ5A 3S0BA 1DF0A 3I5FB 1W7JB 1S1EA 1OMRA 1BR4B 1ZOTB 2FJUB 2OPOA 1DGVA 3B87A 2BCBA 3PM2A 2BL0B 2TN4A 3DVMA 3TDIA 2CXJA 1YTZC 3R1VA 1Y1AA 2L4IA 1EJ3A 2KAVA 2L4HA 3GOFA 2LP3A 4YI9A 1H4BA 2HQWA 1IIOA 1MWNA 3BYAA 1RECA 2KQ6A 2PASA 1TOPA 1Y6WA 3D78A 1UHJA 2MLEC 2KLEA 3CR4X 4WRIA 1SKTA 2JNFA 3I5GB 5DKQA 1Y0VH 1J1DA 3IQQA 2R2IA 4ORCB 2JC2A 3FIAA 2FOTA 2KI6C 2LE9B 3PFVA 2HQ8A 4N1GA 4PHKA 1BMOA 3NSKA 2K61A 1G8IA 1XO5A 1TCFA 1SR6B 2LAPA 3D73A 3BUMB 1OE9B 3EK4A 3SG3A 3IVTA 4AQJA 1MXEA 2MAZA 1OMDA 3O6BA 3EVVA 3MSEB 3VRRA 4OCIA 1N0YA 4PDZA 2L50A 1NX1A 2JQ6A 2M7LA 3SS5A 4DUQA 1JSAA 1TN4A 2Y5IA 3AAJA 2PQLA 1PALA 2I94A 3L47A 1IJ6A 1QLSA 1FW4A 1MXLC 1SY9A 2EC6B 1R2UA 1CFDA 3I5FC 4HREE 5ER4X 1KK8B 1KSMA 2JT8A 1YVLA 1XFXO 2IS9A 2ZN9A 3CZ0A 4NDDA 4P2YB 5D3OA 3I5HC 3FWBA 5KSZA 1EH2A 3PN7B 1NUBA 4PE4A 2ZRTA 2PYQA 1JC2A 1R6PA 3K1EA 1WRKA 1UHIA 1H8BA 1RROA 1F8HA 3BUXB 3D0YA 2ZKMX 4D1EA 1BT6A 2JXLA 4MZLA 2H2KA 2KYFA 1BODA 4MZJA 1AP4A 4PALA 1K9UA 1M31A 1NP8A 1OW4A 3L4LA 4NDBA 4PE0A 3WHUB 3D76A 4GAOA 1PVAA 1TWOA 5K89A 1DEKA 1N2DA 1S6IA 1UP5A 3JVTC 1XFRA 2MJWB 3GK1A 3D10A 1FI5A 1QX7A 2GTEA 2PMYA 3DXLA 2F2PA 1J7QA 4R1EA 4A4CA 1B9AA 3N7HA 1LKJA 1S3PA 4AQIA 1N65A 4FQTA 2QEVA 1A29A 2COLB 5I2OA 3B7AA 1WDCC 2FJYA 2LC5A 4QJ4B 5FI2A 3S0EA 1NWDA 1AK8A 1K95A 1M63B 1IQ3A 1JFJA 5ER5A 5I2QA 5CSJA 2EC6C 1C7VA 1VRKA 2JPOA 2PRUA 1XA5A 2A4JA 2F33A 3PJIA 4MRXA 4ORBB 1KK8C 3KEVA 3LK1A 4FTGA 2WNDA 1KCYA 1V1GA 1TNXA 4GNKB 4M2QA 1IG5A 3FS7A 3UO9A 5CPVA 1CLMA 1Z4HA 1CLLA 4DRWA 3NSOA 1DVIA 1CDLA 1J1EA 5DKRA 4IJ7A 4XJKA 2LHLA 2KGRA 2M0RA 4ICBA 2M9GA 3CZ1A 1KQMC 1EL4A 3EG5B 3PM8A 2Y4QA 1BG1A 2NXQA 3D77A 2LVJA 4P5OE 4PHMA 4YGBB 1KFUS 1DJYA 1ZFSA 1KWOB 1GQMA 5F6TA 4MEWA 2FCEA 2BE6A 5D7FA 2KI4C 3K21A 2M1KB 2H8VA 1ORGA 2KFGA 2V53A 5KTYA 1BOCA 2LLTA 2P6BB 2PVBA 4OR9B 3LK0A 4OZDA 3I5HB 1Y1XA 1HT9A 1L2OC 2WORA 1GGWA 3FE8A 2JNXA 2KAXA 3D0YB 3CWGA 4CIDA 1DQEA 1XVJA 1BF5A 1YVHA 4YGDB 4GUKA 3B6XA 5DKNA 3SG2A 1NX3A 2LUCA 1F55A 2M97A 1UURA 2NZ0A 2GV5A 3S0FA 3V2LA 3O4YA 2ZRSA 2MLFC 2DOQA 1KSOA 3CDNA 1J7PA 3JVTB 4OV2A 2KAYA 5PALA 5JJGA 5G08A 5BPJA 2F8PA 3F45A 3EK7A 5JOLA 1AVSA 3S0DA 1B1GA 2QEHA 4MN0A 1ZMZA 2YGUA 4USLA 1G4YR 4JWQA 1SRAA 3R1OA 3RZSA 1NCYA 3BFHA 2D8NA 3BUOB 3R1PA 4N1FA 4ETOA 1WDCB 1CM4A 2LHIA 1QTXA 4C0KA 2HETA 3WNXB 2BKHB 1K94A 3AKBA 1XK4A 1YR5A 2ZN8A 1J7RA 1CTRA 2K60A 1PSRA 4QJ3B 1DJWA 1KWOC 1QWVA 2EGDA 4JKTA 2K2AA 3AAKA 2AUCA 3O2PA 5GQQC 2LMUA 2ZNEA 3VRNA 3DD4A 2O60A 4MBEA 1B7TY 3FWCA 2H61A 1ALWA 2PSRA 1YX7A 3PATA 4IL1A 4PE1A 5HKZA 1S5GY 1QATA 3QMEA 4GFTA 4N5XA 1X02A 4XJKB 3DYEA 1QS7A 1V1FA 2M49B 3SS4A 1ODBA 3OGNA 4L9MA 1A75A 1MR8A 3KPXA 2JWWA 5J3XA 1HQVA 2HPSA 2AMIA 1YUTA 3NHIA 3JTDC 3OHMB 1K8UA 1KQMB 4MRYA 1KFXL 1TCOB 1S26D 3NXAA 2ZNDA 4U8DA 5FI7A 4M2OA 5AANA 4A4BA 2JT0A 1C07A 1CFPA 1GJYA 2OS8C 1QJTA 2KGBC 4PCWA 1MHOA 3KF9A 2WCBA 1DF0B 2QACA 1D1OA 1K2HA 1B4CA 1B47A 4PHJA 2KI4B 3DVJA 1UHNA 4ZCVA 1CKKA 2LVVA 1A4PA 1CDNA 3TDUA 1UWOA 2G9BA 2K7DA 3VRQA 2M1UA 3VRPA 5HL1A 1QX2A 2LP2A 4DS7A 1L2OB 2CNPA 2JULA 2LUXA 1TUZA 4YGEB 1Q80A 1OZOA 2BECA 1Z2CB 2BNXA 2K7CA 3OBVA 3CABA 1S5GZ 3FE6A 2BAPA 5HKWA 2F3ZA 3SJSA 4F0ZB 3DVKA 3TDZA 4GGFC 5CSFA 1AUIB 1KK7Y 1OMVA 3D74A 1CDPA 2VRGA 4YGAA 1U5IA 2KLDA 1DELA 1M39A 1XFYO 4GGFA 3IQOA 1E8AA 2JT3A 4INXA 3OB1B 2LMVA 4XYNA 4BY5A 3NGVA 3O4XA 3PSRA 2K7OA 2K7BA 1OOJA 1NYAA 2K8MB 4GPLB 5DICA 2OTGB 1P28A 2E6WA 4PHNA 1PK0D 2KNEA 4AOMA 4YGCB 2WCMA 2P70A 1DJHA 1NIWA 4YBHB 2KFHA 1YRTB 1UHKA 1OOFA 4I5JA 4NDCA 1SNLA 1DMOA 3QRXA 2FCDA 3DF0A 1AHRA 5AEQA 2WCLA 1DGUA 2I2RE 3SG7A 4F7FA 1CB1A 2CT9A 3FE9A 1WRLA 3OP0A 1LS8A 4FQOA 4DCKA 5HKYA 3A4UB 3OX6A 2JTTA 1PVBA 2Y1NA 2WCHA 3ICBA 3EVUA 3RLZA 3S0AA 4CPVA 1ZUZA 3BUNB 3EKHA 2LMTA 4M2PA 1JBAA 2WOSA 3WXAA 1QIVA 3EKJA 3TUYC 1F70A 1XFUO 3ZWHA 1A2XA 1OOIX 1OZSA 1KK7Z 2LLUA 1NX2A 1SYMA 5I8NA 2SCPA 1L7ZA 1K9KA 1SL7A 3H4SE 5HYDA 1QASA 3AKAA 1SSEB 1A75B 3BQ3A 1F54A 4HRHA 3Q8IA 1T14A 2KFFA 1EG3A 3OX5A 2WC8A 3BOWA 5AERA 5I94A 2QPTA 1IH0A 3BUWB 2F2OA 1DJZA 3JTDB 2LM5A 2JRFA 3IF7A 1FBVA 1KFUL 1IKUA 3DVEA 2OS8B 1MQ1A 2GGMA 3KHEA 1SMGA 1JF0A 1TNPA 2GGZA 5B8IB 5FI6A 1QV0A 2Y1MA 3DZTA 2L2EA 5KU1A 2JU0A 3NSLA 1K93D 4CFQA 2OTGC 1LA3A 3GK4X 2LNKA 1DC1A 2EHBA 3O78A 1DJGA 3I5IB 2KPHA 1S36A 1CNPA 1OOGA 4I5NB 2M7NA 4MLWA 5AXIA 1SL9A 1OSAA 2JOJA 1K90D 1SCMC 1XK4C 1CLBA 3BFAA 2K0JA 3D75A 5HLVA 1FI6A 1U5IB 2KI6D 2MHHA 2P71A 2I7AA 3L4AA 4E68A 2SASA 1Y1UA 2LVIA 1FF1A 1F4QA 1QX5B 1S6CA 2H61C 2LCPA 3EK8A 3LL8B 2PALA 3SG4A 4CLNA 2ERBA 4ZCUA 2L98A 2O5GA 2WC5A
chains in the Genus database with same CATH topology
2L0PA 2CCMA 2E30A 3OB2B 4NQGA 3HCMA 2BCAA 2Q91A 1SW8A 1XFZO 1QV1A 2L51A 1ALVA 2WCFA 2MA2A 4QJ5B 4BY4A 1PSBA 4MSPA 1JFKA 3SG5A 3CGAA 2JXCA 3DF0B 2CTNA 4OVNF 1KFXS 4Q04A 1YUSA 2AAOA 3TZ1A 3C1VA 3VGOA 4DIRA 1XFWO 3HX4A 1NCXA 1GGZA 4HRGA 1K9PA 2KSPA 4UPGA 1M45A 1J7OA 4I5LB 5FYXA 1B8LA 3SG6A 1QXPA 1QVIY 3NSIA 4CFRA 3RM1A 2RGIA 4MVFA 1OQPA 1SBJA 3WHTB 3CR5X 3TUYB 1SPYA 1FPWA 5I2LA 5TNCA 1M46A 3M0WA 2BL0C 3TS5B 3E3RA 3I5IC 1RFJA 3PALA 3EVRA 2NCOA 3BOWB 1CMFA 1PULA 1IGVA 1B7TZ 4ORAB 3ZNIA 1XFVO 4PE7A 1CFFA 2LVKA 1DJXA 1BJFA 2ZFDA 4MZKA 2CBLA 1RWYA 2L5XB 3LLEA 1WY9A 2LV7A 2M3WA 2M8UA 1MUXA 3I5GC 4GGNA 5IBWA 1CM1A 1LVCD 1DJIA 1RTP1 2LANA 2KOTA 1EG4A 1CFCA 2KBIA 1MF8B 2WCEA 1S6JA 1C7WA 2KHNA 2MRDA 1F4OA 1JUOA 1SR6C 2BBMA 2JPTA 2Q4UA 1SL8A 2ISDA 2NLNA 1LINA 1IJ5A 1CMGA 3A8RA 3CR2A 1PRWA 1QVIZ 1CDMA 1IWQA 1DTLA 1NSHA 5CSNA 2BBNA 2BKIB 2KQYA 1B8RA 1UUSA 1TNWA 4WQ2A 1SCMB 4JQ0D 2HF5A 5HLOA 1JF2A 1BU3A 5D69A 2MBXA 3SIBA 1JWDA 1A03A 1TIZA 1SCVA 1XYDA 2KBMA 2KDHA 1KQVA 1K96A 1LA0A 1TTXA 1IRJA 3CLNA 1TNQA 1YURA 1QLKA 1BR1B 3CS1A 4OKHA 1UHHA 4C0LA 1DT7B 3KO0A 2G2BA 1RK9A 2K2FA 2KYCA 5AFPA 3CZTX 1WLZA 1YUUA 4GBAA 1J55A 1SK6D 1QIWA 3BXKA 4I5KA 1YX8A 1AJ5A 2BCXA 3VROA 1F71A 1EXRA 3PN7C 1AJ4A 3TS5C 2B1UA 1NX0A 2JTZA 4JPZB 1NCZA 1YRUB 2LLSA 1W7IB 1WRZA 4YI8A 2M29A 3PLFB 5CSIA 2I18A 2NCPA 4C0JA 1RJVA 1WLMA 3CTNA 1TRFA 3LCPC 1G33A 4HSZA 2BE4A 2F3YA 1B8CA 3SIAA 1LXFC 4WQ3A 1BLQA 1ZACA 3GK2A 1NPQA 4YRUA 2JZIA 4TNCA 1IQ5A 1DF0A 3I5FB 1W7JB 1S1EA 1OMRA 1BR4B 1ZOTB 2FJUB 2OPOA 1DGVA 2BCBA 2BL0B 2TN4A 3DVMA 3TDIA 2CXJA 1YTZC 1Y1AA 2L4IA 1EJ3A 2KAVA 2L4HA 3GOFA 2LP3A 4YI9A 1H4BA 2HQWA 1MWNA 3BYAA 1RECA 2KQ6A 2PASA 1TOPA 1Y6WA 1UHJA 2MLEC 3CR4X 4WRIA 1SKTA 2JNFA 3I5GB 5DKQA 1Y0VH 1J1DA 3IQQA 2R2IA 4ORCB 2JC2A 3FIAA 2FOTA 2KI6C 2LE9B 3PFVA 2HQ8A 4N1GA 4PHKA 1BMOA 3NSKA 2K61A 1G8IA 1XO5A 1TCFA 1SR6B 2LAPA 3BUMB 1OE9B 3EK4A 3SG3A 4AQJA 1MXEA 2MAZA 1OMDA 3O6BA 3EVVA 3MSEB 3VRRA 4OCIA 1N0YA 4PDZA 2L50A 1NX1A 2JQ6A 2M7LA 4DUQA 1JSAA 1TN4A 2Y5IA 3AAJA 1PALA 2I94A 1IJ6A 1QLSA 1FW4A 1MXLC 1SY9A 2EC6B 1R2UA 1CFDA 3I5FC 4HREE 5ER4X 1KK8B 1KSMA 2JT8A 1YVLA 1XFXO 2IS9A 2ZN9A 4P2YB 4NDDA 3I5HC 3FWBA 5KSZA 1EH2A 3PN7B 1NUBA 4PE4A 2ZRTA 1JC2A 1R6PA 1WRKA 1UHIA 1H8BA 1RROA 1F8HA 3BUXB 3D0YA 2ZKMX 4D1EA 1BT6A 2JXLA 4MZLA 2H2KA 2KYFA 1BODA 4MZJA 1AP4A 4PALA 1K9UA 1M31A 1NP8A 4NDBA 4PE0A 3WHUB 4GAOA 1PVAA 5K89A 1N2DA 1S6IA 1UP5A 3JVTC 2MJWB 3GK1A 3D10A 1FI5A 1QX7A 2PMYA 2F2PA 1J7QA 4R1EA 4A4CA 1B9AA 1LKJA 1S3PA 4AQIA 1N65A 1A29A 2COLB 5I2OA 1WDCC 2LC5A 4QJ4B 1NWDA 1AK8A 1K95A 1M63B 1IQ3A 1JFJA 5ER5A 5I2QA 5CSJA 2EC6C 1C7VA 1VRKA 2PRUA 4ORBB 1XA5A 2A4JA 2F33A 4MRXA 1KK8C 3KEVA 3LK1A 4FTGA 2WNDA 1KCYA 1V1GA 1TNXA 4GNKB 4M2QA 1IG5A 3FS7A 5CPVA 1CLMA 1CLLA 4DRWA 3NSOA 1DVIA 1CDLA 1J1EA 5DKRA 4XJKA 2LHLA 2KGRA 2M0RA 4ICBA 2M9GA 1KQMC 1EL4A 3PM8A 2Y4QA 1BG1A 2NXQA 2LVJA 4P5OE 4PHMA 4YGBB 1KFUS 1DJYA 1ZFSA 1KWOB 1GQMA 5F6TA 4MEWA 2FCEA 2BE6A 5D7FA 2KI4C 3K21A 2M1KB 2KFGA 2V53A 5KTYA 1BOCA 2LLTA 2P6BB 2PVBA 4OR9B 3LK0A 3I5HB 1Y1XA 1HT9A 1L2OC 2WORA 1GGWA 2JNXA 2KAXA 3D0YB 3CWGA 4CIDA 1XVJA 1BF5A 1YVHA 4YGDB 4GUKA 5DKNA 3SG2A 1NX3A 2LUCA 1F55A 2M97A 1UURA 2NZ0A 2GV5A 3O4YA 2ZRSA 2MLFC 2DOQA 1KSOA 1J7PA 3JVTB 4OV2A 2KAYA 5PALA 5JJGA 5G08A 5BPJA 2F8PA 3F45A 3EK7A 5JOLA 1AVSA 1B1GA 4MN0A 1ZMZA 4USLA 1G4YR 4JWQA 1SRAA 1NCYA 3BUOB 2D8NA 4N1FA 4ETOA 1WDCB 1CM4A 2LHIA 1QTXA 4C0KA 2HETA 3WNXB 2BKHB 1K94A 3AKBA 1XK4A 1YR5A 2ZN8A 1J7RA 1CTRA 1PSRA 4QJ3B 1DJWA 1KWOC 2EGDA 2K2AA 3AAKA 2AUCA 3O2PA 5GQQC 2LMUA 2ZNEA 3VRNA 3DD4A 2O60A 4MBEA 1B7TY 3FWCA 2H61A 1ALWA 2PSRA 1YX7A 3PATA 4IL1A 4PE1A 5HKZA 1S5GY 1QATA 4GFTA 4N5XA 1X02A 4XJKB 1QS7A 1V1FA 2M49B 1ODBA 4L9MA 1A75A 1MR8A 3KPXA 2JWWA 5J3XA 1HQVA 2HPSA 2AMIA 1YUTA 3JTDC 3OHMB 1K8UA 1KQMB 4MRYA 1KFXL 1TCOB 1S26D 3NXAA 2ZNDA 4U8DA 5AANA 4M2OA 4A4BA 1C07A 2JT0A 1CFPA 1GJYA 2OS8C 1QJTA 2KGBC 4PCWA 1MHOA 3KF9A 2WCBA 1DF0B 2QACA 1D1OA 1K2HA 1B4CA 1B47A 4PHJA 2KI4B 3DVJA 1UHNA 4ZCVA 1CKKA 2LVVA 1A4PA 1CDNA 3TDUA 1UWOA 2G9BA 2K7DA 3VRQA 2M1UA 3VRPA 1QX2A 2LP2A 4DS7A 1L2OB 2CNPA 2JULA 2LUXA 4YGEB 1Q80A 1OZOA 2BECA 2K7CA 1S5GZ 5HKWA 2F3ZA 3SJSA 4F0ZB 3DVKA 3TDZA 4GGFC 5CSFA 1AUIB 1KK7Y 1OMVA 4YGAA 1CDPA 2VRGA 1U5IA 1M39A 1XFYO 4GGFA 3IQOA 1E8AA 2JT3A 3OB1B 2LMVA 4XYNA 4BY5A 3PSRA 4GPLB 2K7OA 2K7BA 1OOJA 1NYAA 2K8MB 2OTGB 4PHNA 2E6WA 4AOMA 1PK0D 2KNEA 4YGCB 1DJHA 1NIWA 4YBHB 2KFHA 1YRTB 1UHKA 4I5JA 4NDCA 1SNLA 1DMOA 3QRXA 2FCDA 3DF0A 1AHRA 5AEQA 1DGUA 2I2RE 3SG7A 1CB1A 2CT9A 1WRLA 3OP0A 4FQOA 4DCKA 5HKYA 3A4UB 3OX6A 2JTTA 1PVBA 2Y1NA 3ICBA 3EVUA 3RLZA 4CPVA 1ZUZA 3BUNB 3EKHA 2LMTA 4M2PA 1JBAA 2WOSA 3WXAA 1QIVA 3EKJA 3TUYC 1F70A 1XFUO 3ZWHA 1A2XA 1OZSA 1KK7Z 2LLUA 1NX2A 1SYMA 5I8NA 2SCPA 1L7ZA 1K9KA 1SL7A 3H4SE 5HYDA 1QASA 3AKAA 1A75B 3BQ3A 1F54A 4HRHA 2KFFA 1EG3A 3OX5A 2WC8A 3BOWA 5AERA 2QPTA 1IH0A 3BUWB 2F2OA 1DJZA 3JTDB 2LM5A 2JRFA 3IF7A 1FBVA 1KFUL 1IKUA 3DVEA 2OS8B 1MQ1A 2GGMA 3KHEA 1SMGA 1JF0A 1TNPA 2GGZA 5B8IB 1QV0A 2Y1MA 5KU1A 2L2EA 2JU0A 3NSLA 1K93D 4CFQA 2OTGC 1LA3A 3GK4X 2LNKA 2EHBA 3O78A 1DJGA 3I5IB 1S36A 1CNPA 4I5NB 2M7NA 4MLWA 5AXIA 1SL9A 1OSAA 2JOJA 1K90D 1SCMC 1XK4C 1CLBA 2K0JA 5HLVA 1FI6A 1U5IB 2KI6D 2MHHA 1FF1A 2I7AA 4E68A 2SASA 1Y1UA 2LVIA 1F4QA 1QX5B 1S6CA 2H61C 2LCPA 3EK8A 3LL8B 2PALA 3SG4A 4CLNA 4ZCUA 2L98A 2O5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L0P A;  2CCM A;  2E30 A;  3OB2 B;  4NQG A;  3HCM A;  2BCA A;  2Q91 A;  1SW8 A;  1XFZ O;  1QV1 A;  2L51 A;  1ALV A;  2WCF A;  2MA2 A;  4QJ5 B;  4BY4 A;  1PSB A;  4MSP A;  1JFK A;  3SG5 A;  3CGA A;  2JXC A;  3DF0 B;  2CTN A;  4OVN F;  1KFX S;  4Q04 A;  1YUS A;  2AAO A;  3TZ1 A;  3C1V A;  3VGO A;  4DIR A;  1XFW O;  3HX4 A;  1NCX A;  1GGZ A;  4HRG A;  1K9P A;  2KSP A;  4UPG A;  1M45 A;  1J7O A;  4I5L B;  5FYX A;  1B8L A;  3SG6 A;  1QXP A;  1QVI Y;  3NSI A;  4CFR A;  3RM1 A;  2RGI A;  4MVF A;  1OQP A;  1SBJ A;  3WHT B;  3CR5 X;  3TUY B;  1SPY A;  1FPW A;  5I2L A;  5TNC A;  1M46 A;  3M0W A;  2BL0 C;  3TS5 B;  3E3R A;  3I5I C;  1RFJ A;  3PAL A;  3EVR A;  2NCO A;  3BOW B;  1CMF A;  1PUL A;  1IGV A;  1B7T Z;  4ORA B;  3ZNI A;  1XFV O;  4PE7 A;  1CFF A;  2LVK A;  1DJX A;  1BJF A;  2ZFD A;  4MZK A;  2CBL A;  1RWY A;  2L5X B;  3LLE A;  1WY9 A;  2LV7 A;  2M3W A;  2M8U A;  1MUX A;  3I5G C;  4GGN A;  5IBW A;  1CM1 A;  1LVC D;  1DJI A;  1RTP 1;  2LAN A;  2KOT A;  1EG4 A;  1CFC A;  2KBI A;  1MF8 B;  2WCE A;  1S6J A;  1C7W A;  2KHN A;  2MRD A;  1F4O A;  1JUO A;  1SR6 C;  2BBM A;  2JPT A;  2Q4U A;  1SL8 A;  2ISD A;  2NLN A;  1LIN A;  1IJ5 A;  1CMG A;  3A8R A;  3CR2 A;  1PRW A;  1QVI Z;  1CDM A;  1IWQ A;  1DTL A;  1NSH A;  5CSN A;  2BBN A;  2BKI B;  2KQY A;  1B8R A;  1UUS A;  1TNW A;  4WQ2 A;  1SCM B;  4JQ0 D;  2HF5 A;  5HLO A;  1JF2 A;  1BU3 A;  5D69 A;  2MBX A;  3SIB A;  1JWD A;  1A03 A;  1TIZ A;  1SCV A;  1XYD A;  2KBM A;  2KDH A;  1KQV A;  1K96 A;  1LA0 A;  1TTX A;  1IRJ A;  3CLN A;  1TNQ A;  1YUR A;  1QLK A;  1BR1 B;  3CS1 A;  4OKH A;  1UHH A;  4C0L A;  1DT7 B;  3KO0 A;  2G2B A;  1RK9 A;  2K2F A;  2KYC A;  5AFP A;  3CZT X;  1WLZ A;  1YUU A;  4GBA A;  1J55 A;  1SK6 D;  1QIW A;  3BXK A;  4I5K A;  1YX8 A;  1AJ5 A;  2BCX A;  3VRO A;  1F71 A;  1EXR A;  3PN7 C;  1AJ4 A;  3TS5 C;  2B1U A;  1NX0 A;  2JTZ A;  4JPZ B;  1NCZ A;  1YRU B;  2LLS A;  1W7I B;  1WRZ A;  4YI8 A;  2M29 A;  3PLF B;  5CSI A;  2I18 A;  2NCP A;  4C0J A;  1RJV A;  1WLM A;  3CTN A;  1TRF A;  3LCP C;  1G33 A;  4HSZ A;  2BE4 A;  2F3Y A;  1B8C A;  3SIA A;  1LXF C;  4WQ3 A;  1BLQ A;  1ZAC A;  3GK2 A;  1NPQ A;  4YRU A;  2JZI A;  4TNC A;  1IQ5 A;  1DF0 A;  3I5F B;  1W7J B;  1S1E A;  1OMR A;  1BR4 B;  1ZOT B;  2FJU B;  2OPO A;  1DGV A;  2BCB A;  2BL0 B;  2TN4 A;  3DVM A;  3TDI A;  2CXJ A;  1YTZ C;  1Y1A A;  2L4I A;  1EJ3 A;  2KAV A;  2L4H A;  3GOF A;  2LP3 A;  4YI9 A;  1H4B A;  2HQW A;  1MWN A;  3BYA A;  1REC A;  2KQ6 A;  2PAS A;  1TOP A;  1Y6W A;  1UHJ A;  2MLE C;  3CR4 X;  4WRI A;  1SKT A;  2JNF A;  3I5G B;  5DKQ A;  1Y0V H;  1J1D A;  3IQQ A;  2R2I A;  4ORC B;  2JC2 A;  3FIA A;  2FOT A;  2KI6 C;  2LE9 B;  3PFV A;  2HQ8 A;  4N1G A;  4PHK A;  1BMO A;  3NSK A;  2K61 A;  1G8I A;  1XO5 A;  1TCF A;  1SR6 B;  2LAP A;  3BUM B;  1OE9 B;  3EK4 A;  3SG3 A;  4AQJ A;  1MXE A;  2MAZ A;  1OMD A;  3O6B A;  3EVV A;  3MSE B;  3VRR A;  4OCI A;  1N0Y A;  4PDZ A;  2L50 A;  1NX1 A;  2JQ6 A;  2M7L A;  4DUQ A;  1JSA A;  1TN4 A;  2Y5I A;  3AAJ A;  1PAL A;  2I94 A;  1IJ6 A;  1QLS A;  1FW4 A;  1MXL C;  1SY9 A;  2EC6 B;  1R2U A;  1CFD A;  3I5F C;  4HRE E;  5ER4 X;  1KK8 B;  1KSM A;  2JT8 A;  1YVL A;  1XFX O;  2IS9 A;  2ZN9 A;  4P2Y B;  4NDD A;  3I5H C;  3FWB A;  5KSZ A;  1EH2 A;  3PN7 B;  1NUB A;  4PE4 A;  2ZRT A;  1JC2 A;  1R6P A;  1WRK A;  1UHI A;  1H8B A;  1RRO A;  1F8H A;  3BUX B;  3D0Y A;  2ZKM X;  4D1E A;  1BT6 A;  2JXL A;  4MZL A;  2H2K A;  2KYF A;  1BOD A;  4MZJ A;  1AP4 A;  4PAL A;  1K9U A;  1M31 A;  1NP8 A;  4NDB A;  4PE0 A;  3WHU B;  4GAO A;  1PVA A;  5K89 A;  1N2D A;  1S6I A;  1UP5 A;  3JVT C;  2MJW B;  3GK1 A;  3D10 A;  1FI5 A;  1QX7 A;  2PMY A;  2F2P A;  1J7Q A;  4R1E A;  4A4C A;  1B9A A;  1LKJ A;  1S3P A;  4AQI A;  1N65 A;  1A29 A;  2COL B;  5I2O A;  1WDC C;  2LC5 A;  4QJ4 B;  1NWD A;  1AK8 A;  1K95 A;  1M63 B;  1IQ3 A;  1JFJ A;  5ER5 A;  5I2Q A;  5CSJ A;  2EC6 C;  1C7V A;  1VRK A;  2PRU A;  4ORB B;  1XA5 A;  2A4J A;  2F33 A;  4MRX A;  1KK8 C;  3KEV A;  3LK1 A;  4FTG A;  2WND A;  1KCY A;  1V1G A;  1TNX A;  4GNK B;  4M2Q A;  1IG5 A;  3FS7 A;  5CPV A;  1CLM A;  1CLL A;  4DRW A;  3NSO A;  1DVI A;  1CDL A;  1J1E A;  5DKR A;  4XJK A;  2LHL A;  2KGR A;  2M0R A;  4ICB A;  2M9G A;  1KQM C;  1EL4 A;  3PM8 A;  2Y4Q A;  1BG1 A;  2NXQ A;  2LVJ A;  4P5O E;  4PHM A;  4YGB B;  1KFU S;  1DJY A;  1ZFS A;  1KWO B;  1GQM A;  5F6T A;  4MEW A;  2FCE A;  2BE6 A;  5D7F A;  2KI4 C;  3K21 A;  2M1K B;  2KFG A;  2V53 A;  5KTY A;  1BOC A;  2LLT A;  2P6B B;  2PVB A;  4OR9 B;  3LK0 A;  3I5H B;  1Y1X A;  1HT9 A;  1L2O C;  2WOR A;  1GGW A;  2JNX A;  2KAX A;  3D0Y B;  3CWG A;  4CID A;  1XVJ A;  1BF5 A;  1YVH A;  4YGD B;  4GUK A;  5DKN A;  3SG2 A;  1NX3 A;  2LUC A;  1F55 A;  2M97 A;  1UUR A;  2NZ0 A;  2GV5 A;  3O4Y A;  2ZRS A;  2MLF C;  2DOQ A;  1KSO A;  1J7P A;  3JVT B;  4OV2 A;  2KAY A;  5PAL A;  5JJG A;  5G08 A;  5BPJ A;  2F8P A;  3F45 A;  3EK7 A;  5JOL A;  1AVS A;  1B1G A;  4MN0 A;  1ZMZ A;  4USL A;  1G4Y R;  4JWQ A;  1SRA A;  1NCY A;  3BUO B;  2D8N A;  4N1F A;  4ETO A;  1WDC B;  1CM4 A;  2LHI A;  1QTX A;  4C0K A;  2HET A;  3WNX B;  2BKH B;  1K94 A;  3AKB A;  1XK4 A;  1YR5 A;  2ZN8 A;  1J7R A;  1CTR A;  1PSR A;  4QJ3 B;  1DJW A;  1KWO C;  2EGD A;  2K2A A;  3AAK A;  2AUC A;  3O2P A;  5GQQ C;  2LMU A;  2ZNE A;  3VRN A;  3DD4 A;  2O60 A;  4MBE A;  1B7T Y;  3FWC A;  2H61 A;  1ALW A;  2PSR A;  1YX7 A;  3PAT A;  4IL1 A;  4PE1 A;  5HKZ A;  1S5G Y;  1QAT A;  4GFT A;  4N5X A;  1X02 A;  4XJK B;  1QS7 A;  1V1F A;  2M49 B;  1ODB A;  4L9M A;  1A75 A;  1MR8 A;  3KPX A;  2JWW A;  5J3X A;  1HQV A;  2HPS A;  2AMI A;  1YUT A;  3JTD C;  3OHM B;  1K8U A;  1KQM B;  4MRY A;  1KFX L;  1TCO B;  1S26 D;  3NXA A;  2ZND A;  4U8D A;  5AAN A;  4M2O A;  4A4B A;  1C07 A;  2JT0 A;  1CFP A;  1GJY A;  2OS8 C;  1QJT A;  2KGB C;  4PCW A;  1MHO A;  3KF9 A;  2WCB A;  1DF0 B;  2QAC A;  1D1O A;  1K2H A;  1B4C A;  1B47 A;  4PHJ A;  2KI4 B;  3DVJ A;  1UHN A;  4ZCV A;  1CKK A;  2LVV A;  1A4P A;  1CDN A;  3TDU A;  1UWO A;  2G9B A;  2K7D A;  3VRQ A;  2M1U A;  3VRP A;  1QX2 A;  2LP2 A;  4DS7 A;  1L2O B;  2CNP A;  2JUL A;  2LUX A;  4YGE B;  1Q80 A;  1OZO A;  2BEC A;  2K7C A;  1S5G Z;  5HKW A;  2F3Z A;  3SJS A;  4F0Z B;  3DVK A;  3TDZ A;  4GGF C;  5CSF A;  1AUI B;  1KK7 Y;  1OMV A;  4YGA A;  1CDP A;  2VRG A;  1U5I A;  1M39 A;  1XFY O;  4GGF A;  3IQO A;  1E8A A;  2JT3 A;  3OB1 B;  2LMV A;  4XYN A;  4BY5 A;  3PSR A;  4GPL B;  2K7O A;  2K7B A;  1OOJ A;  1NYA A;  2K8M B;  2OTG B;  4PHN A;  2E6W A;  4AOM A;  1PK0 D;  2KNE A;  4YGC B;  1DJH A;  1NIW A;  4YBH B;  2KFH A;  1YRT B;  1UHK A;  4I5J A;  4NDC A;  1SNL A;  1DMO A;  3QRX A;  2FCD A;  3DF0 A;  1AHR A;  5AEQ A;  1DGU A;  2I2R E;  3SG7 A;  1CB1 A;  2CT9 A;  1WRL A;  3OP0 A;  4FQO A;  4DCK A;  5HKY A;  3A4U B;  3OX6 A;  2JTT A;  1PVB A;  2Y1N A;  3ICB A;  3EVU A;  3RLZ A;  4CPV A;  1ZUZ A;  3BUN B;  3EKH A;  2LMT A;  4M2P A;  1JBA A;  2WOS A;  3WXA A;  1QIV A;  3EKJ A;  3TUY C;  1F70 A;  1XFU O;  3ZWH A;  1A2X A;  1OZS A;  1KK7 Z;  2LLU A;  1NX2 A;  1SYM A;  5I8N A;  2SCP A;  1L7Z A;  1K9K A;  1SL7 A;  3H4S E;  5HYD A;  1QAS A;  3AKA A;  1A75 B;  3BQ3 A;  1F54 A;  4HRH A;  2KFF A;  1EG3 A;  3OX5 A;  2WC8 A;  3BOW A;  5AER A;  2QPT A;  1IH0 A;  3BUW B;  2F2O A;  1DJZ A;  3JTD B;  2LM5 A;  2JRF A;  3IF7 A;  1FBV A;  1KFU L;  1IKU A;  3DVE A;  2OS8 B;  1MQ1 A;  2GGM A;  3KHE A;  1SMG A;  1JF0 A;  1TNP A;  2GGZ A;  5B8I B;  1QV0 A;  2Y1M A;  5KU1 A;  2L2E A;  2JU0 A;  3NSL A;  1K93 D;  4CFQ A;  2OTG C;  1LA3 A;  3GK4 X;  2LNK A;  2EHB A;  3O78 A;  1DJG A;  3I5I B;  1S36 A;  1CNP A;  4I5N B;  2M7N A;  4MLW A;  5AXI A;  1SL9 A;  1OSA A;  2JOJ A;  1K90 D;  1SCM C;  1XK4 C;  1CLB A;  2K0J A;  5HLV A;  1FI6 A;  1U5I B;  2KI6 D;  2MHH A;  1FF1 A;  2I7A A;  4E68 A;  2SAS A;  1Y1U A;  2LVI A;  1F4Q A;  1QX5 B;  1S6C A;  2H61 C;  2LCP A;  3EK8 A;  3LL8 B;  2PAL A;  3SG4 A;  4CLN A;  4ZCU A;  2L98 A;  2O5G A; 
#chains in the Genus database with same CATH topology
 2L0P A;  2CCM A;  2E30 A;  3OB2 B;  4NQG A;  3HCM A;  2BCA A;  2Q91 A;  3BJH A;  1SW8 A;  3S0G A;  1XFZ O;  1QV1 A;  3NHT A;  1C3Z A;  2L51 A;  1ALV A;  1GM0 A;  3B88 A;  2WCF A;  2MA2 A;  4QJ5 B;  4BY4 A;  1PSB A;  4MSP A;  1JFK A;  3SG5 A;  3CGA A;  2QDI A;  2JXC A;  3DF0 B;  2CTN A;  4OVN F;  1KFX S;  4Q04 A;  1YUS A;  2AAO A;  3TZ1 A;  3C1V A;  3VGO A;  4DIR A;  1XFW O;  3HX4 A;  1NCX A;  4INW A;  3UNW A;  4KYN A;  1GGZ A;  4HRG A;  1K9P A;  2KSP A;  4UPG A;  1M45 A;  1J7O A;  4I5L B;  5FYX A;  1B8L A;  3SG6 A;  1QXP A;  1QVI Y;  3DY9 A;  3NSI A;  4CFR A;  3RM1 A;  2RGI A;  4MVF A;  1OQP A;  1SBJ A;  3BFB A;  1C3Y A;  3WHT B;  3CR5 X;  3TUY B;  1SPY A;  1FPW A;  5I2L A;  5TNC A;  1M46 A;  3M0W A;  2BL0 C;  3TS5 B;  3B86 A;  3E3R A;  3I5I C;  1RFJ A;  3PAL A;  3EVR A;  2NCO A;  3BOW B;  1CMF A;  1PUL A;  1IGV A;  1B7T Z;  4ORA B;  3ZNI A;  1XFV O;  4PE7 A;  1CFF A;  3VB1 A;  2LVK A;  1DJX A;  1BJF A;  2ZFD A;  4MZK A;  2CBL A;  1RWY A;  2L5X B;  3LLE A;  1WY9 A;  2LV7 A;  2M3W A;  2M8U A;  1MUX A;  3I5G C;  4GGN A;  5IBW A;  1CM1 A;  3R72 A;  1LVC D;  2L5Y A;  1DJI A;  1RTP 1;  2LAN A;  2KOT A;  1EG4 A;  1CFC A;  2KBI A;  1MF8 B;  2WCE A;  1S6J A;  1C7W A;  2KHN A;  2MRD A;  1F4O A;  1JUO A;  1SR6 C;  1W9Z A;  2BBM A;  2JPT A;  1SL8 A;  2Q4U A;  2ISD A;  2NLN A;  1LIN A;  3SS3 A;  1IJ5 A;  1CMG A;  2QEB A;  3A8R A;  3CR2 A;  1PRW A;  1QVI Z;  1CDM A;  1IWQ A;  1DTL A;  1NSH A;  5CSN A;  3CZ2 A;  2BBN A;  2BKI B;  2KQY A;  1B8R A;  1UUS A;  1TNW A;  4WQ2 A;  1SCM B;  4JQ0 D;  2HF5 A;  5HLO A;  1JF2 A;  1BU3 A;  5D69 A;  2MBX A;  3SIB A;  1JWD A;  1A03 A;  1TIZ A;  1OOH A;  1XYD A;  1SCV A;  2KBM A;  2KDH A;  1TTX A;  1K96 A;  1LA0 A;  1KQV A;  1IRJ A;  3CLN A;  1TNQ A;  1YUR A;  1QLK A;  1BR1 B;  1TUJ A;  3CS1 A;  1UHH A;  2L2C A;  4OKH A;  4C0L A;  3KO0 A;  1DT7 B;  2G2B A;  1RK9 A;  2K2F A;  2KYC A;  5AFP A;  3CZT X;  1WLZ A;  1YUU A;  4GBA A;  1J55 A;  1SK6 D;  4JD9 A;  2WCK A;  1QIW A;  3BXK A;  4I5K A;  1YX8 A;  1AJ5 A;  2BCX A;  3VRO A;  1F71 A;  1EXR A;  2WC6 A;  3PN7 C;  1AJ4 A;  2QEO A;  2B1U A;  3TS5 C;  1NX0 A;  2JTZ A;  5EL2 A;  4JPZ B;  1NCZ A;  1YRU B;  2LLS A;  2WCJ A;  1W7I B;  1WRZ A;  4YI8 A;  2M29 A;  3PLF B;  4PT1 A;  5CSI A;  2I18 A;  2NCP A;  4C0J A;  1RJV A;  1WLM A;  3CTN A;  1TRF A;  3LCP C;  1G33 A;  3CYZ A;  4HSZ A;  2BE4 A;  2F3Y A;  1B8C A;  3SIA A;  1LXF C;  4WQ3 A;  1BLQ A;  1ZAC A;  3GK2 A;  1NPQ A;  4YRU A;  2JZI A;  4TNC A;  1IQ5 A;  3S0B A;  1DF0 A;  3I5F B;  1W7J B;  1S1E A;  1OMR A;  1BR4 B;  1ZOT B;  2FJU B;  2OPO A;  1DGV A;  3B87 A;  2BCB A;  3PM2 A;  2BL0 B;  2TN4 A;  3DVM A;  3TDI A;  2CXJ A;  1YTZ C;  3R1V A;  1Y1A A;  2L4I A;  1EJ3 A;  2KAV A;  2L4H A;  3GOF A;  2LP3 A;  4YI9 A;  1H4B A;  2HQW A;  1IIO A;  1MWN A;  3BYA A;  1REC A;  2KQ6 A;  2PAS A;  1TOP A;  1Y6W A;  3D78 A;  1UHJ A;  2MLE C;  2KLE A;  3CR4 X;  4WRI A;  1SKT A;  2JNF A;  3I5G B;  5DKQ A;  1Y0V H;  1J1D A;  3IQQ A;  2R2I A;  4ORC B;  2JC2 A;  3FIA A;  2FOT A;  2KI6 C;  2LE9 B;  3PFV A;  2HQ8 A;  4N1G A;  4PHK A;  1BMO A;  3NSK A;  2K61 A;  1G8I A;  1XO5 A;  1TCF A;  1SR6 B;  2LAP A;  3D73 A;  3BUM B;  1OE9 B;  3EK4 A;  3SG3 A;  3IVT A;  4AQJ A;  1MXE A;  2MAZ A;  1OMD A;  3O6B A;  3EVV A;  3MSE B;  3VRR A;  4OCI A;  1N0Y A;  4PDZ A;  2L50 A;  1NX1 A;  2JQ6 A;  2M7L A;  3SS5 A;  4DUQ A;  1JSA A;  1TN4 A;  2Y5I A;  3AAJ A;  2PQL A;  1PAL A;  2I94 A;  3L47 A;  1IJ6 A;  1QLS A;  1FW4 A;  1MXL C;  1SY9 A;  2EC6 B;  1R2U A;  1CFD A;  3I5F C;  4HRE E;  5ER4 X;  1KK8 B;  1KSM A;  2JT8 A;  1YVL A;  1XFX O;  2IS9 A;  2ZN9 A;  3CZ0 A;  4NDD A;  4P2Y B;  5D3O A;  3I5H C;  3FWB A;  5KSZ A;  1EH2 A;  3PN7 B;  1NUB A;  4PE4 A;  2ZRT A;  2PYQ A;  1JC2 A;  1R6P A;  3K1E A;  1WRK A;  1UHI A;  1H8B A;  1RRO A;  1F8H A;  3BUX B;  3D0Y A;  2ZKM X;  4D1E A;  1BT6 A;  2JXL A;  4MZL A;  2H2K A;  2KYF A;  1BOD A;  4MZJ A;  1AP4 A;  4PAL A;  1K9U A;  1M31 A;  1NP8 A;  1OW4 A;  3L4L A;  4NDB A;  4PE0 A;  3WHU B;  3D76 A;  4GAO A;  1PVA A;  1TWO A;  5K89 A;  1DEK A;  1N2D A;  1S6I A;  1UP5 A;  3JVT C;  1XFR A;  2MJW B;  3GK1 A;  3D10 A;  1FI5 A;  1QX7 A;  2GTE A;  2PMY A;  3DXL A;  2F2P A;  1J7Q A;  4R1E A;  4A4C A;  1B9A A;  3N7H A;  1LKJ A;  1S3P A;  4AQI A;  1N65 A;  4FQT A;  2QEV A;  1A29 A;  2COL B;  5I2O A;  3B7A A;  1WDC C;  2FJY A;  2LC5 A;  4QJ4 B;  5FI2 A;  3S0E A;  1NWD A;  1AK8 A;  1K95 A;  1M63 B;  1IQ3 A;  1JFJ A;  5ER5 A;  5I2Q A;  5CSJ A;  2EC6 C;  1C7V A;  1VRK A;  2JPO A;  2PRU A;  1XA5 A;  2A4J A;  2F33 A;  3PJI A;  4MRX A;  4ORB B;  1KK8 C;  3KEV A;  3LK1 A;  4FTG A;  2WND A;  1KCY A;  1V1G A;  1TNX A;  4GNK B;  4M2Q A;  1IG5 A;  3FS7 A;  3UO9 A;  5CPV A;  1CLM A;  1Z4H A;  1CLL A;  4DRW A;  3NSO A;  1DVI A;  1CDL A;  1J1E A;  5DKR A;  4IJ7 A;  4XJK A;  2LHL A;  2KGR A;  2M0R A;  4ICB A;  2M9G A;  3CZ1 A;  1KQM C;  1EL4 A;  3EG5 B;  3PM8 A;  2Y4Q A;  1BG1 A;  2NXQ A;  3D77 A;  2LVJ A;  4P5O E;  4PHM A;  4YGB B;  1KFU S;  1DJY A;  1ZFS A;  1KWO B;  1GQM A;  5F6T A;  4MEW A;  2FCE A;  2BE6 A;  5D7F A;  2KI4 C;  3K21 A;  2M1K B;  2H8V A;  1ORG A;  2KFG A;  2V53 A;  5KTY A;  1BOC A;  2LLT A;  2P6B B;  2PVB A;  4OR9 B;  3LK0 A;  4OZD A;  3I5H B;  1Y1X A;  1HT9 A;  1L2O C;  2WOR A;  1GGW A;  3FE8 A;  2JNX A;  2KAX A;  3D0Y B;  3CWG A;  4CID A;  1DQE A;  1XVJ A;  1BF5 A;  1YVH A;  4YGD B;  4GUK A;  3B6X A;  5DKN A;  3SG2 A;  1NX3 A;  2LUC A;  1F55 A;  2M97 A;  1UUR A;  2NZ0 A;  2GV5 A;  3S0F A;  3V2L A;  3O4Y A;  2ZRS A;  2MLF C;  2DOQ A;  1KSO A;  3CDN A;  1J7P A;  3JVT B;  4OV2 A;  2KAY A;  5PAL A;  5JJG A;  5G08 A;  5BPJ A;  2F8P A;  3F45 A;  3EK7 A;  5JOL A;  1AVS A;  3S0D A;  1B1G A;  2QEH A;  4MN0 A;  1ZMZ A;  2YGU A;  4USL A;  1G4Y R;  4JWQ A;  1SRA A;  3R1O A;  3RZS A;  1NCY A;  3BFH A;  2D8N A;  3BUO B;  3R1P A;  4N1F A;  4ETO A;  1WDC B;  1CM4 A;  2LHI A;  1QTX A;  4C0K A;  2HET A;  3WNX B;  2BKH B;  1K94 A;  3AKB A;  1XK4 A;  1YR5 A;  2ZN8 A;  1J7R A;  1CTR A;  2K60 A;  1PSR A;  4QJ3 B;  1DJW A;  1KWO C;  1QWV A;  2EGD A;  4JKT A;  2K2A A;  3AAK A;  2AUC A;  3O2P A;  5GQQ C;  2LMU A;  2ZNE A;  3VRN A;  3DD4 A;  2O60 A;  4MBE A;  1B7T Y;  3FWC A;  2H61 A;  1ALW A;  2PSR A;  1YX7 A;  3PAT A;  4IL1 A;  4PE1 A;  5HKZ A;  1S5G Y;  1QAT A;  3QME A;  4GFT A;  4N5X A;  1X02 A;  4XJK B;  3DYE A;  1QS7 A;  1V1F A;  2M49 B;  3SS4 A;  1ODB A;  3OGN A;  4L9M A;  1A75 A;  1MR8 A;  3KPX A;  2JWW A;  5J3X A;  1HQV A;  2HPS A;  2AMI A;  1YUT A;  3NHI A;  3JTD C;  3OHM B;  1K8U A;  1KQM B;  4MRY A;  1KFX L;  1TCO B;  1S26 D;  3NXA A;  2ZND A;  4U8D A;  5FI7 A;  4M2O A;  5AAN A;  4A4B A;  2JT0 A;  1C07 A;  1CFP A;  1GJY A;  2OS8 C;  1QJT A;  2KGB C;  4PCW A;  1MHO A;  3KF9 A;  2WCB A;  1DF0 B;  2QAC A;  1D1O A;  1K2H A;  1B4C A;  1B47 A;  4PHJ A;  2KI4 B;  3DVJ A;  1UHN A;  4ZCV A;  1CKK A;  2LVV A;  1A4P A;  1CDN A;  3TDU A;  1UWO A;  2G9B A;  2K7D A;  3VRQ A;  2M1U A;  3VRP A;  5HL1 A;  1QX2 A;  2LP2 A;  4DS7 A;  1L2O B;  2CNP A;  2JUL A;  2LUX A;  1TUZ A;  4YGE B;  1Q80 A;  1OZO A;  2BEC A;  1Z2C B;  2BNX A;  2K7C A;  3OBV A;  3CAB A;  1S5G Z;  3FE6 A;  2BAP A;  5HKW A;  2F3Z A;  3SJS A;  4F0Z B;  3DVK A;  3TDZ A;  4GGF C;  5CSF A;  1AUI B;  1KK7 Y;  1OMV A;  3D74 A;  1CDP A;  2VRG A;  4YGA A;  1U5I A;  2KLD A;  1DEL A;  1M39 A;  1XFY O;  4GGF A;  3IQO A;  1E8A A;  2JT3 A;  4INX A;  3OB1 B;  2LMV A;  4XYN A;  4BY5 A;  3NGV A;  3O4X A;  3PSR A;  2K7O A;  2K7B A;  1OOJ A;  1NYA A;  2K8M B;  4GPL B;  5DIC A;  2OTG B;  1P28 A;  2E6W A;  4PHN A;  1PK0 D;  2KNE A;  4AOM A;  4YGC B;  2WCM A;  2P70 A;  1DJH A;  1NIW A;  4YBH B;  2KFH A;  1YRT B;  1UHK A;  1OOF A;  4I5J A;  4NDC A;  1SNL A;  1DMO A;  3QRX A;  2FCD A;  3DF0 A;  1AHR A;  5AEQ A;  2WCL A;  1DGU A;  2I2R E;  3SG7 A;  4F7F A;  1CB1 A;  2CT9 A;  3FE9 A;  1WRL A;  3OP0 A;  1LS8 A;  4FQO A;  4DCK A;  5HKY A;  3A4U B;  3OX6 A;  2JTT A;  1PVB A;  2Y1N A;  2WCH A;  3ICB A;  3EVU A;  3RLZ A;  3S0A A;  4CPV A;  1ZUZ A;  3BUN B;  3EKH A;  2LMT A;  4M2P A;  1JBA A;  2WOS A;  3WXA A;  1QIV A;  3EKJ A;  3TUY C;  1F70 A;  1XFU O;  3ZWH A;  1A2X A;  1OOI X;  1OZS A;  1KK7 Z;  2LLU A;  1NX2 A;  1SYM A;  5I8N A;  2SCP A;  1L7Z A;  1K9K A;  1SL7 A;  3H4S E;  5HYD A;  1QAS A;  3AKA A;  1SSE B;  1A75 B;  3BQ3 A;  1F54 A;  4HRH A;  3Q8I A;  1T14 A;  2KFF A;  1EG3 A;  3OX5 A;  2WC8 A;  3BOW A;  5AER A;  5I94 A;  2QPT A;  1IH0 A;  3BUW B;  2F2O A;  1DJZ A;  3JTD B;  2LM5 A;  2JRF A;  3IF7 A;  1FBV A;  1KFU L;  1IKU A;  3DVE A;  2OS8 B;  1MQ1 A;  2GGM A;  3KHE A;  1SMG A;  1JF0 A;  1TNP A;  2GGZ A;  5B8I B;  5FI6 A;  1QV0 A;  2Y1M A;  3DZT A;  2L2E A;  5KU1 A;  2JU0 A;  3NSL A;  1K93 D;  4CFQ A;  2OTG C;  1LA3 A;  3GK4 X;  2LNK A;  1DC1 A;  2EHB A;  3O78 A;  1DJG A;  3I5I B;  2KPH A;  1S36 A;  1CNP A;  1OOG A;  4I5N B;  2M7N A;  4MLW A;  5AXI A;  1SL9 A;  1OSA A;  2JOJ A;  1K90 D;  1SCM C;  1XK4 C;  1CLB A;  3BFA A;  2K0J A;  3D75 A;  5HLV A;  1FI6 A;  1U5I B;  2KI6 D;  2MHH A;  2P71 A;  2I7A A;  3L4A A;  4E68 A;  2SAS A;  1Y1U A;  2LVI A;  1FF1 A;  1F4Q A;  1QX5 B;  1S6C A;  2H61 C;  2LCP A;  3EK8 A;  3LL8 B;  2PAL A;  3SG4 A;  4CLN A;  2ERB A;  4ZCU A;  2L98 A;  2O5G A;  2WC5 A; 
#chains in the Genus database with same CATH homology
 2L0P A;  2CCM A;  2E30 A;  3OB2 B;  4NQG A;  3HCM A;  2BCA A;  2Q91 A;  1SW8 A;  1XFZ O;  1QV1 A;  2L51 A;  1ALV A;  2WCF A;  2MA2 A;  4QJ5 B;  4BY4 A;  1PSB A;  4MSP A;  1JFK A;  3SG5 A;  3CGA A;  2JXC A;  3DF0 B;  2CTN A;  4OVN F;  1KFX S;  4Q04 A;  1YUS A;  2AAO A;  3TZ1 A;  3C1V A;  3VGO A;  4DIR A;  1XFW O;  3HX4 A;  1NCX A;  1GGZ A;  4HRG A;  1K9P A;  2KSP A;  4UPG A;  1M45 A;  1J7O A;  4I5L B;  5FYX A;  1B8L A;  3SG6 A;  1QXP A;  1QVI Y;  3NSI A;  4CFR A;  3RM1 A;  2RGI A;  4MVF A;  1OQP A;  1SBJ A;  3WHT B;  3CR5 X;  3TUY B;  1SPY A;  1FPW A;  5I2L A;  5TNC A;  1M46 A;  3M0W A;  2BL0 C;  3TS5 B;  3E3R A;  3I5I C;  1RFJ A;  3PAL A;  3EVR A;  2NCO A;  3BOW B;  1CMF A;  1PUL A;  1IGV A;  1B7T Z;  4ORA B;  3ZNI A;  1XFV O;  4PE7 A;  1CFF A;  2LVK A;  1DJX A;  1BJF A;  2ZFD A;  4MZK A;  2CBL A;  1RWY A;  2L5X B;  3LLE A;  1WY9 A;  2LV7 A;  2M3W A;  2M8U A;  1MUX A;  3I5G C;  4GGN A;  5IBW A;  1CM1 A;  1LVC D;  1DJI A;  1RTP 1;  2LAN A;  2KOT A;  1EG4 A;  1CFC A;  2KBI A;  1MF8 B;  2WCE A;  1S6J A;  1C7W A;  2KHN A;  2MRD A;  1F4O A;  1JUO A;  1SR6 C;  2BBM A;  2JPT A;  2Q4U A;  1SL8 A;  2ISD A;  2NLN A;  1LIN A;  1IJ5 A;  1CMG A;  3A8R A;  3CR2 A;  1PRW A;  1QVI Z;  1CDM A;  1IWQ A;  1DTL A;  1NSH A;  5CSN A;  2BBN A;  2BKI B;  2KQY A;  1B8R A;  1UUS A;  1TNW A;  4WQ2 A;  1SCM B;  4JQ0 D;  2HF5 A;  5HLO A;  1JF2 A;  1BU3 A;  5D69 A;  2MBX A;  3SIB A;  1JWD A;  1A03 A;  1TIZ A;  1SCV A;  1XYD A;  2KBM A;  2KDH A;  1KQV A;  1K96 A;  1LA0 A;  1TTX A;  1IRJ A;  3CLN A;  1TNQ A;  1YUR A;  1QLK A;  1BR1 B;  3CS1 A;  4OKH A;  1UHH A;  4C0L A;  1DT7 B;  3KO0 A;  2G2B A;  1RK9 A;  2K2F A;  2KYC A;  5AFP A;  3CZT X;  1WLZ A;  1YUU A;  4GBA A;  1J55 A;  1SK6 D;  1QIW A;  3BXK A;  4I5K A;  1YX8 A;  1AJ5 A;  2BCX A;  3VRO A;  1F71 A;  1EXR A;  3PN7 C;  1AJ4 A;  3TS5 C;  2B1U A;  1NX0 A;  2JTZ A;  4JPZ B;  1NCZ A;  1YRU B;  2LLS A;  1W7I B;  1WRZ A;  4YI8 A;  2M29 A;  3PLF B;  5CSI A;  2I18 A;  2NCP A;  4C0J A;  1RJV A;  1WLM A;  3CTN A;  1TRF A;  3LCP C;  1G33 A;  4HSZ A;  2BE4 A;  2F3Y A;  1B8C A;  3SIA A;  1LXF C;  4WQ3 A;  1BLQ A;  1ZAC A;  3GK2 A;  1NPQ A;  4YRU A;  2JZI A;  4TNC A;  1IQ5 A;  1DF0 A;  3I5F B;  1W7J B;  1S1E A;  1OMR A;  1BR4 B;  1ZOT B;  2FJU B;  2OPO A;  1DGV A;  2BCB A;  2BL0 B;  2TN4 A;  3DVM A;  3TDI A;  2CXJ A;  1YTZ C;  1Y1A A;  2L4I A;  1EJ3 A;  2KAV A;  2L4H A;  3GOF A;  2LP3 A;  4YI9 A;  1H4B A;  2HQW A;  1MWN A;  3BYA A;  1REC A;  2KQ6 A;  2PAS A;  1TOP A;  1Y6W A;  1UHJ A;  2MLE C;  3CR4 X;  4WRI A;  1SKT A;  2JNF A;  3I5G B;  5DKQ A;  1Y0V H;  1J1D A;  3IQQ A;  2R2I A;  4ORC B;  2JC2 A;  3FIA A;  2FOT A;  2KI6 C;  2LE9 B;  3PFV A;  2HQ8 A;  4N1G A;  4PHK A;  1BMO A;  3NSK A;  2K61 A;  1G8I A;  1XO5 A;  1TCF A;  1SR6 B;  2LAP A;  3BUM B;  1OE9 B;  3EK4 A;  3SG3 A;  4AQJ A;  1MXE A;  2MAZ A;  1OMD A;  3O6B A;  3EVV A;  3MSE B;  3VRR A;  4OCI A;  1N0Y A;  4PDZ A;  2L50 A;  1NX1 A;  2JQ6 A;  2M7L A;  4DUQ A;  1JSA A;  1TN4 A;  2Y5I A;  3AAJ A;  1PAL A;  2I94 A;  1IJ6 A;  1QLS A;  1FW4 A;  1MXL C;  1SY9 A;  2EC6 B;  1R2U A;  1CFD A;  3I5F C;  4HRE E;  5ER4 X;  1KK8 B;  1KSM A;  2JT8 A;  1YVL A;  1XFX O;  2IS9 A;  2ZN9 A;  4P2Y B;  4NDD A;  3I5H C;  3FWB A;  5KSZ A;  1EH2 A;  3PN7 B;  1NUB A;  4PE4 A;  2ZRT A;  1JC2 A;  1R6P A;  1WRK A;  1UHI A;  1H8B A;  1RRO A;  1F8H A;  3BUX B;  3D0Y A;  2ZKM X;  4D1E A;  1BT6 A;  2JXL A;  4MZL A;  2H2K A;  2KYF A;  1BOD A;  4MZJ A;  1AP4 A;  4PAL A;  1K9U A;  1M31 A;  1NP8 A;  4NDB A;  4PE0 A;  3WHU B;  4GAO A;  1PVA A;  5K89 A;  1N2D A;  1S6I A;  1UP5 A;  3JVT C;  2MJW B;  3GK1 A;  3D10 A;  1FI5 A;  1QX7 A;  2PMY A;  2F2P A;  1J7Q A;  4R1E A;  4A4C A;  1B9A A;  1LKJ A;  1S3P A;  4AQI A;  1N65 A;  1A29 A;  2COL B;  5I2O A;  1WDC C;  2LC5 A;  4QJ4 B;  1NWD A;  1AK8 A;  1K95 A;  1M63 B;  1IQ3 A;  1JFJ A;  5ER5 A;  5I2Q A;  5CSJ A;  2EC6 C;  1C7V A;  1VRK A;  2PRU A;  4ORB B;  1XA5 A;  2A4J A;  2F33 A;  4MRX A;  1KK8 C;  3KEV A;  3LK1 A;  4FTG A;  2WND A;  1KCY A;  1V1G A;  1TNX A;  4GNK B;  4M2Q A;  1IG5 A;  3FS7 A;  5CPV A;  1CLM A;  1CLL A;  4DRW A;  3NSO A;  1DVI A;  1CDL A;  1J1E A;  5DKR A;  4XJK A;  2LHL A;  2KGR A;  2M0R A;  4ICB A;  2M9G A;  1KQM C;  1EL4 A;  3PM8 A;  2Y4Q A;  1BG1 A;  2NXQ A;  2LVJ A;  4P5O E;  4PHM A;  4YGB B;  1KFU S;  1DJY A;  1ZFS A;  1KWO B;  1GQM A;  5F6T A;  4MEW A;  2FCE A;  2BE6 A;  5D7F A;  2KI4 C;  3K21 A;  2M1K B;  2KFG A;  2V53 A;  5KTY A;  1BOC A;  2LLT A;  2P6B B;  2PVB A;  4OR9 B;  3LK0 A;  3I5H B;  1Y1X A;  1HT9 A;  1L2O C;  2WOR A;  1GGW A;  2JNX A;  2KAX A;  3D0Y B;  3CWG A;  4CID A;  1XVJ A;  1BF5 A;  1YVH A;  4YGD B;  4GUK A;  5DKN A;  3SG2 A;  1NX3 A;  2LUC A;  1F55 A;  2M97 A;  1UUR A;  2NZ0 A;  2GV5 A;  3O4Y A;  2ZRS A;  2MLF C;  2DOQ A;  1KSO A;  1J7P A;  3JVT B;  4OV2 A;  2KAY A;  5PAL A;  5JJG A;  5G08 A;  5BPJ A;  2F8P A;  3F45 A;  3EK7 A;  5JOL A;  1AVS A;  1B1G A;  4MN0 A;  1ZMZ A;  4USL A;  1G4Y R;  4JWQ A;  1SRA A;  1NCY A;  3BUO B;  2D8N A;  4N1F A;  4ETO A;  1WDC B;  1CM4 A;  2LHI A;  1QTX A;  4C0K A;  2HET A;  3WNX B;  2BKH B;  1K94 A;  3AKB A;  1XK4 A;  1YR5 A;  2ZN8 A;  1J7R A;  1CTR A;  1PSR A;  4QJ3 B;  1DJW A;  1KWO C;  2EGD A;  2K2A A;  3AAK A;  2AUC A;  3O2P A;  5GQQ C;  2LMU A;  2ZNE A;  3VRN A;  3DD4 A;  2O60 A;  4MBE A;  1B7T Y;  3FWC A;  2H61 A;  1ALW A;  2PSR A;  1YX7 A;  3PAT A;  4IL1 A;  4PE1 A;  5HKZ A;  1S5G Y;  1QAT A;  4GFT A;  4N5X A;  1X02 A;  4XJK B;  1QS7 A;  1V1F A;  2M49 B;  1ODB A;  4L9M A;  1A75 A;  1MR8 A;  3KPX A;  2JWW A;  5J3X A;  1HQV A;  2HPS A;  2AMI A;  1YUT A;  3JTD C;  3OHM B;  1K8U A;  1KQM B;  4MRY A;  1KFX L;  1TCO B;  1S26 D;  3NXA A;  2ZND A;  4U8D A;  5AAN A;  4M2O A;  4A4B A;  1C07 A;  2JT0 A;  1CFP A;  1GJY A;  2OS8 C;  1QJT A;  2KGB C;  4PCW A;  1MHO A;  3KF9 A;  2WCB A;  1DF0 B;  2QAC A;  1D1O A;  1K2H A;  1B4C A;  1B47 A;  4PHJ A;  2KI4 B;  3DVJ A;  1UHN A;  4ZCV A;  1CKK A;  2LVV A;  1A4P A;  1CDN A;  3TDU A;  1UWO A;  2G9B A;  2K7D A;  3VRQ A;  2M1U A;  3VRP A;  1QX2 A;  2LP2 A;  4DS7 A;  1L2O B;  2CNP A;  2JUL A;  2LUX A;  4YGE B;  1Q80 A;  1OZO A;  2BEC A;  2K7C A;  1S5G Z;  5HKW A;  2F3Z A;  3SJS A;  4F0Z B;  3DVK A;  3TDZ A;  4GGF C;  5CSF A;  1AUI B;  1KK7 Y;  1OMV A;  4YGA A;  1CDP A;  2VRG A;  1U5I A;  1M39 A;  1XFY O;  4GGF A;  3IQO A;  1E8A A;  2JT3 A;  3OB1 B;  2LMV A;  4XYN A;  4BY5 A;  3PSR A;  4GPL B;  2K7O A;  2K7B A;  1OOJ A;  1NYA A;  2K8M B;  2OTG B;  4PHN A;  2E6W A;  4AOM A;  1PK0 D;  2KNE A;  4YGC B;  1DJH A;  1NIW A;  4YBH B;  2KFH A;  1YRT B;  1UHK A;  4I5J A;  4NDC A;  1SNL A;  1DMO A;  3QRX A;  2FCD A;  3DF0 A;  1AHR A;  5AEQ A;  1DGU A;  2I2R E;  3SG7 A;  1CB1 A;  2CT9 A;  1WRL A;  3OP0 A;  4FQO A;  4DCK A;  5HKY A;  3A4U B;  3OX6 A;  2JTT A;  1PVB A;  2Y1N A;  3ICB A;  3EVU A;  3RLZ A;  4CPV A;  1ZUZ A;  3BUN B;  3EKH A;  2LMT A;  4M2P A;  1JBA A;  2WOS A;  3WXA A;  1QIV A;  3EKJ A;  3TUY C;  1F70 A;  1XFU O;  3ZWH A;  1A2X A;  1OZS A;  1KK7 Z;  2LLU A;  1NX2 A;  1SYM A;  5I8N A;  2SCP A;  1L7Z A;  1K9K A;  1SL7 A;  3H4S E;  5HYD A;  1QAS A;  3AKA A;  1A75 B;  3BQ3 A;  1F54 A;  4HRH A;  2KFF A;  1EG3 A;  3OX5 A;  2WC8 A;  3BOW A;  5AER A;  2QPT A;  1IH0 A;  3BUW B;  2F2O A;  1DJZ A;  3JTD B;  2LM5 A;  2JRF A;  3IF7 A;  1FBV A;  1KFU L;  1IKU A;  3DVE A;  2OS8 B;  1MQ1 A;  2GGM A;  3KHE A;  1SMG A;  1JF0 A;  1TNP A;  2GGZ A;  5B8I B;  1QV0 A;  2Y1M A;  5KU1 A;  2L2E A;  2JU0 A;  3NSL A;  1K93 D;  4CFQ A;  2OTG C;  1LA3 A;  3GK4 X;  2LNK A;  2EHB A;  3O78 A;  1DJG A;  3I5I B;  1S36 A;  1CNP A;  4I5N B;  2M7N A;  4MLW A;  5AXI A;  1SL9 A;  1OSA A;  2JOJ A;  1K90 D;  1SCM C;  1XK4 C;  1CLB A;  2K0J A;  5HLV A;  1FI6 A;  1U5I B;  2KI6 D;  2MHH A;  1FF1 A;  2I7A A;  4E68 A;  2SAS A;  1Y1U A;  2LVI A;  1F4Q A;  1QX5 B;  1S6C A;  2H61 C;  2LCP A;  3EK8 A;  3LL8 B;  2PAL A;  3SG4 A;  4CLN A;  4ZCU A;  2L98 A;  2O5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...