1SCMB

Structure of the regulatory domain of scallop myosin at 2.8 angstroms resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
138
structure length
138
Chain Sequence
LPQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYOSIN HEAVY CHAIN
publication title Structure of the regulatory domain of scallop myosin at 2.8 A resolution.
pubmed doi rcsb
source organism Argopecten irradians
molecule tags Calcium-binding protein
total genus 34
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 1994-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1scmB01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1scmB02
1K9PA 3VRRA 3O4YA 1CFCA 1PK0D 1XVJA 1YRTB 2JNFA 3SG5A 1UHKA 2JT0A 2JXCA 1MR8A 1QX7A 3BXKA 3A4UB 3NSIA 4MLWA 2IS9A 2ZNEA 1AP4A 1TNQA 1UHIA 1SNLA 1WDCC 2LMVA 4I5NB 2CBLA 1K8UA 2LMUA 3D0YA 1K93D 1LINA 4YGEB 4I5KA 2OTGB 3GK1A 2EC6B 3SIBA 4ICBA 3CWGA 1NX0A 2G9BA 1RFJA 4IL1A 1NCYA 3WXAA 1H8BA 2BCXA 1GGZA 1KWOB 3TDUA 1AJ4A 1IH0A 1MHOA 2K7BA 4CPVA 1DMOA 1RROA 5TNCA 2F2OA 2MJWB 3CR2A 2KGRA 4WQ3A 3SG3A 1DF0B 3CR4X 1KQVA 2M8UA 1RK9A 5KU1A 1QTXA 1U5IB 2ZNDA 4GFTA 1C07A 2LANA 4OR9B 2ZN9A 1KFXL 2MHHA 3DVKA 1AUIB 1IQ5A 2KNEA 5D69A 1ZFSA 3PSRA 1YR5A 4GAOA 2LP2A 1W7JB 3KEVA 1CLLA 2OS8C 2M9GA 2G2BA 2SCPA 1EJ3A 2WNDA 4DCKA 2JZIA 5KSZA 1B4CA 2JULA 3PLFB 1BOCA 1G33A 1SCMB 1DJHA 2BE6A 1NIWA 3I5IC 3VGOA 4JWQA 2I94A 5BPJA 1A2XA 1KQMC 5K89A 2QPTA 3BYAA 5DKNA 2E30A 1DJYA 2F3YA 2SASA 3RM1A 1XFWO 5HKYA 1N2DA 5KTYA 4XYNA 4N1GA 2EC6C 1UP5A 3LCPC 5I2OA 1TCFA 2I7AA 1X02A 3JVTC 4PHKA 1PRWA 1BJFA 4OV2A 4GGFC 4DRWA 1CTRA 2M49B 1TOPA 2NXQA 2JRFA 2LE9B 1NX3A 1GJYA 5CSNA 2MBXA 1UHNA 2KFHA 1DF0A 4USLA 5AEQA 3VROA 1U5IA 2MA2A 4M2PA 4MRXA 1TN4A 1CLBA 1SW8A 2H61C 2WORA 3TUYC 1A03A 4HRHA 4ZCVA 1A4PA 1RECA 2GGZA 4C0JA 3BQ3A 1F4OA 3PN7C 1MWNA 2JNXA 1K9KA 3LLEA 4CIDA 1LA3A 1JWDA 2KGBC 1QS7A 1SCMC 2P6BB 3FIAA 4FTGA 3FWBA 1JFJA 1DJZA 3JTDB 1CFDA 1M31A 3DD4A 1B7TZ 2I18A 3H4SE 4NDBA 4PCWA 4U8DA 1E8AA 3WNXB 1FW4A 1CMFA 4E68A 2KFGA 2L0PA 1Q80A 4GBAA 1MUXA 4PE4A 4BY5A 1B8LA 2KI4C 2BBMA 1S1EA 3ZNIA 1KCYA 2FCEA 1SR6B 2JT3A 4NDCA 1L7ZA 2NCOA 3D0YB 2QACA 1C7VA 1YUTA 2BKIB 4ORBB 1H4BA 2ZKMX 1J7OA 2KBIA 2LLTA 1CNPA 2LHIA 1PULA 4MEWA 3D10A 1QV1A 1K94A 1BF5A 3OX6A 2I2RE 2NZ0A 2KYFA 1UUSA 3K21A 1QX2A 1QATA 1QLKA 1R6PA 2TN4A 3VRNA 2K0JA 2HQ8A 1AK8A 1BODA 3EVUA 3M0WA 1GGWA 1KSOA 2BCAA 2LC5A 1TNWA 1OZSA 1M45A 4NQGA 1ZMZA 3AAJA 2VRGA 1SPYA 2LM5A 4YBHB 3TZ1A 2Y1MA 1YVHA 1EXRA 3GK4X 2DOQA 1RTP1 1YX8A 3HX4A 1J55A 1SR6C 2KYCA 1MXEA 1NCZA 1J1EA 1S6CA 1B1GA 2GGMA 1QASA 3DF0A 4YGAA 4A4CA 1UURA 3I5FB 1AHRA 1J7RA 4P5OE 1OZOA 2L50A 2JU0A 3I5HB 1GQMA 1YRUB 2LHLA 3BUOB 3ICBA 1NWDA 3IF7A 2KI6C 3TS5B 1XO5A 1NPQA 1M63B 3PALA 4TNCA 4DIRA 1WRLA 3WHUB 2Y4QA 5B8IB 2ZN8A 5AFPA 4ETOA 4YGCB 1OSAA 1EL4A 4MBEA 1KK7Z 1PSRA 5GQQC 1W7IB 4HSZA 2PASA 1S5GY 2L4IA 4JQ0D 1J7QA 1NYAA 4ORAB 3BUNB 3TDIA 2JWWA 3OB1B 1WLMA 2OTGC 4MSPA 1SYMA 3PFVA 4YGBB 1Y6WA 1FBVA 4PHJA 4MZKA 1JF0A 1KWOC 1ZOTB 3TDZA 3O2PA 1WY9A 1QVIZ 4GNKB 4MVFA 4WQ2A 1LVCD 1NCXA 1K95A 2K7DA 3SG6A 4XJKB 3I5HC 3O78A 1KFUS 1DJGA 3WHTB 4D1EA 3TS5C 1XA5A 2AAOA 2K2FA 1IRJA 1DVIA 1RWYA 2PRUA 3CGAA 1SBJA 1CM4A 1NSHA 1TTXA 2M1KB 4OVNF 1IGVA 2NLNA 1JC2A 5HLVA 1J1DA 1VRKA 3A8RA 2EHBA 1DJIA 2JOJA 1C7WA 1XFZO 2KQ6A 4ORCB 1SRAA 4PE0A 1SMGA 4WRIA 1TIZA 2L5XB 1OOJA 2MAZA 3FS7A 2JPTA 2KQYA 2WOSA 1OQPA 2BE4A 2LVKA 1OMVA 1KK8B 1WRZA 4AQJA 4AOMA 1QXPA 1IQ3A 2JXLA 2HPSA 4CFRA 1G8IA 1N0YA 2H61A 1M39A 2F8PA 1ODBA 3VRQA 2JT8A 2L4HA 1S6JA 5IBWA 3OHMB 4JPZB 3BUXB 5DKQA 4FQOA 2PALA 5HYDA 4YGDB 3ZWHA 2K61A 1SL8A 1WRKA 1Y1XA 5JOLA 3KO0A 3KPXA 4PE1A 3DVEA 2ZFDA 3DVMA 4XJKA 1CDPA 2F33A 1QIWA 3DF0B 3CLNA 4OCIA 1CB1A 2Q91A 1ZUZA 2JC2A 2H2KA 2ZRSA 4UPGA 1Y1UA 1S3PA 2A4JA 3NSOA 2PSRA 2JTTA 2K7OA 1DGUA 2M0RA 1CFPA 2O60A 1XYDA 1Y1AA 4M2OA 1WDCB 3NXAA 1FI5A 2KBMA 2BCBA 1BR4B 1JUOA 1EG4A 2AUCA 2CXJA 3O6BA 1KFXS 3LK0A 3KHEA 2LVVA 4YI9A 1TNPA 3JTDC 5ER4X 3CS1A 1NUBA 2HF5A 2MRDA 3SIAA 3NSLA 3VRPA 3SJSA 3SG2A 4N5XA 3SG7A 1CMGA 2M7NA 1F70A 3F45A 1JSAA 1OMDA 1BLQA 1XFVO 3AAKA 1BMOA 1TCOB 1YUUA 1TRFA 3KF9A 1Y0VH 2BL0B 1FI6A 3EK4A 2LUXA 3GK2A 5CSFA 5I8NA 2JQ6A 1D1OA 2JTZA 2LV7A 2M3WA 5FYXA 4BY4A 2BBNA 3C1VA 2NCPA 5J3XA 1JF2A 1XK4A 2D8NA 3BUMB 2WCEA 5HLOA 1ZACA 2OS8B 3CZTX 4PHMA 1J7PA 1DTLA 1BT6A 1WLZA 2LVIA 2PMYA 3DVJA 1K96A 4L9MA 3I5IB 1JBAA 1G4YR 1ALWA 1KQMB 1SL9A 1YVLA 2KHNA 2RGIA 2Y1NA 1PVAA 4PALA 2B1UA 1V1GA 2K7CA 1IWQA 2E6WA 1XFXO 5PALA 2Q4UA 1BG1A 5HKZA 2CCMA 1B8CA 1CLMA 1KK7Y 3EK8A 2V53A 2LUCA 3IQQA 2M97A 5ER5A 3JVTB 5HKWA 1F55A 1LKJA 1AJ5A 1MXLC 1S6IA 1YUSA 4R1EA 1KSMA 4Q04A 5DKRA 1YURA 1K2HA 1A75A 1S36A 1YTZC 2Y5IA 3BOWA 3IQOA 1IJ5A 1EG3A 4MZLA 1CKKA 2LVJA 2BL0C 5CPVA 3PM8A 3TUYB 5AERA 1DGVA 1L2OB 1PALA 1QVIY 1BU3A 1LXFC 1UWOA 1QX5B 2HETA 2FOTA 3EKHA 1DJWA 3I5FC 2F2PA 1R2UA 1UHJA 3PN7B 3RLZA 4QJ5B 1K90D 3OX5A 3EVVA 2HQWA 3I5GB 2WC8A 4QJ4B 2LMTA 1NX1A 5AANA 3EVRA 4MN0A 2KAVA 3LL8B 4ZCUA 1PSBA 4MRYA 1MF8B 2F3ZA 2EGDA 1QV0A 4YI8A 3NSKA 2MLEC 1QJTA 1CDMA 3MSEB 2LNKA 5AXIA 4I5JA 2ZRTA 5CSJA 1OE9B 1S5GZ 1UHHA 1XFUO 3CR5X 1SL7A 3OB2B 1B9AA 3EKJA 2LLUA 1YX7A 2FJUB 1SKTA 2AMIA 2KAXA 2M7LA 4GGFA 1JFKA 1AVSA 1SY9A 2KI4B 3BUWB 5F6TA 4CLNA 1B7TY 1ALVA 1LA0A 1RJVA 1M46A 2LP3A 5I2LA 1PVBA 4N1FA 3FWCA 1F8HA 4YRUA 1DT7B 4PE7A 3EK7A 4AQIA 1F71A 2CTNA 4A4BA 1L2OC 2BECA 1A29A 2K8MB 1NP8A 2KAYA 2COLB 1F54A 2L98A 4OKHA 5CSIA 4PDZA 2K2AA 1DJXA 5JJGA 1IKUA 2PVBA 3PATA 2M29A 1XFYO 3I5GC 1QLSA 4P2YB 1OMRA 2WCFA 2ISDA 1NX2A 1CDNA 2O5GA 1CDLA 4MZJA 2LLSA 1B8RA 1SCVA 4CFQA 2FCDA 1V1FA 4C0KA 1HT9A 4HRGA 2KFFA 2L2EA 4I5LB 5I2QA 1SK6D 2KI6D 2LCPA 1IG5A 1N65A 3HCMA 3AKAA 4DS7A 2CT9A 1CM1A 3SG4A 1TNXA 3GOFA 1BR1B 2MLFC 4DUQA 4HREE 1EH2A 2KSPA 2KDHA 1KK8C 2BKHB 4NDDA 4GPLB 2KOTA 1B47A 1HQVA 1KFUL 2L51A 2CNPA 2WCBA 4M2QA 5D7FA 1IJ6A 5G08A 4GGNA 4GUKA 4C0LA 1F4QA 3AKBA 3E3RA 1FPWA 4F0ZB 1A75B 2OPOA 3QRXA 2R2IA 3BOWB 1QIVA 2LAPA 2M1UA 4PHNA 3OP0A 1FF1A 1CFFA 2GV5A 1S26D 1K9UA 1MQ1A 3LK1A 4QJ3B 1XK4C 3CTNA
chains in the Genus database with same CATH superfamily
1K9PA 3VRRA 2FJYA 3O4YA 1CFCA 1PK0D 1XVJA 3N7HA 1YRTB 2JNFA 3SG5A 1UHKA 2JT0A 2JXCA 1MR8A 1QX7A 3BXKA 3A4UB 3NSIA 4MLWA 2IS9A 2ZNEA 1AP4A 1TNQA 1UHIA 1SNLA 1WDCC 2LMVA 4I5NB 2CBLA 3RZSA 1K8UA 2LMUA 3D0YA 1K93D 1LINA 4YGEB 4I5KA 2OTGB 3GK1A 2EC6B 3SIBA 4ICBA 3CWGA 1NX0A 2G9BA 1RFJA 4IL1A 1NCYA 3WXAA 1H8BA 2BCXA 1GGZA 1KWOB 3TDUA 1AJ4A 1IH0A 1MHOA 2K7BA 4CPVA 1DMOA 1RROA 5TNCA 3S0AA 2F2OA 2MJWB 2PYQA 3CR2A 2KGRA 4WQ3A 3SG3A 1DF0B 3CR4X 1OOIX 1KQVA 2M8UA 1RK9A 5KU1A 1QTXA 1U5IB 2ZNDA 4GFTA 1C07A 2LANA 4OR9B 2ZN9A 1TUZA 1KFXL 2MHHA 3DVKA 1AUIB 3V2LA 1IQ5A 2KNEA 5D69A 2ERBA 1ZFSA 3PSRA 1YR5A 4GAOA 2LP2A 3D76A 1W7JB 3D73A 3KEVA 1CLLA 2OS8C 2M9GA 2G2BA 2SCPA 1EJ3A 2WNDA 4DCKA 2JZIA 5KSZA 1B4CA 2JULA 3B87A 3PLFB 3L4LA 1BOCA 1G33A 1SCMB 1W9ZA 1DJHA 2BE6A 1NIWA 3I5IC 3VGOA 4JWQA 2I94A 5BPJA 1A2XA 1KQMC 5K89A 2QPTA 3BYAA 5DKNA 2E30A 1DJYA 2F3YA 2KLDA 2SASA 1XFWO 3RM1A 5HKYA 1N2DA 5KTYA 4XYNA 4N1GA 3D77A 2EC6C 1UP5A 3LCPC 4JD9A 1TCFA 5I2OA 2I7AA 1X02A 3JVTC 4PHKA 1PRWA 1BJFA 3B7AA 4GGFC 4OV2A 4DRWA 1CTRA 2M49B 2QEVA 1TOPA 2NXQA 2JRFA 2LE9B 1NX3A 1GJYA 5CSNA 2MBXA 1UHNA 2KFHA 1DF0A 4USLA 1OOGA 5AEQA 3VROA 1ORGA 1U5IA 2MA2A 4M2PA 4MRXA 1TN4A 3DYEA 1CLBA 1SW8A 2H61C 2WORA 3B86A 3TUYC 1A03A 4HRHA 4ZCVA 3PJIA 1A4PA 5D3OA 1RECA 2GGZA 4C0JA 3BQ3A 1F4OA 3PN7C 1MWNA 2JNXA 1K9KA 3LLEA 4CIDA 1LA3A 1JWDA 2KGBC 1QS7A 1SCMC 2P6BB 3FIAA 4FTGA 3FWBA 1JFJA 1DJZA 3JTDB 1CFDA 1M31A 3DD4A 1B7TZ 2I18A 3H4SE 4NDBA 4PCWA 4U8DA 1E8AA 3WNXB 1FW4A 1CMFA 3R1PA 4E68A 2KFGA 2L0PA 1Q80A 2YGUA 4GBAA 1MUXA 4PE4A 4BY5A 1B8LA 2KI4C 3QMEA 2BBMA 1S1EA 3ZNIA 1KCYA 2FCEA 1SR6B 2JT3A 4NDCA 1L7ZA 2NCOA 3D0YB 2QACA 1T14A 2K60A 1C7VA 1YUTA 2BKIB 4ORBB 1H4BA 2ZKMX 3S0EA 1J7OA 2KBIA 2LLTA 3S0GA 1CNPA 2LHIA 1PULA 2WCJA 4MEWA 3D10A 1QV1A 1K94A 1Z2CB 1BF5A 3OX6A 3DZTA 2I2RE 2NZ0A 3DXLA 2KYFA 1UUSA 5FI6A 3K21A 1QX2A 1QATA 1QLKA 1R6PA 2TN4A 3VRNA 2K0JA 2KLEA 2HQ8A 1AK8A 1BODA 3EVUA 3M0WA 1GGWA 1KSOA 2BCAA 2LC5A 1TNWA 1OZSA 1M45A 4NQGA 2KPHA 3BJHA 1ZMZA 3AAJA 3D75A 2VRGA 1SPYA 2LM5A 4YBHB 3TZ1A 2Y1MA 1YVHA 1EXRA 5FI7A 3GK4X 2DOQA 1RTP1 1LS8A 1YX8A 3HX4A 1J55A 1SR6C 2KYCA 1XFRA 3OBVA 1MXEA 1NCZA 1J1EA 1S6CA 1B1GA 1QWVA 2L2CA 2PQLA 2GGMA 1QASA 3DF0A 4YGAA 4A4CA 1UURA 3I5FB 1AHRA 1J7RA 4P5OE 1OZOA 2L50A 2JU0A 3I5HB 1GQMA 1YRUB 2LHLA 3BUOB 3ICBA 3K1EA 3Q8IA 3S0FA 1NWDA 3IF7A 3PM2A 2KI6C 3TS5B 1XO5A 1NPQA 1M63B 3PALA 2WC5A 4TNCA 3R1OA 3BFBA 4DIRA 1WRLA 5FI2A 3WHUB 2Y4QA 5B8IB 2ZN8A 5AFPA 3L47A 4ETOA 4YGCB 1OSAA 1EL4A 4MBEA 3D78A 2QDIA 1KK7Z 1PSRA 5GQQC 1W7IB 4HSZA 2PASA 1S5GY 2L4IA 4JQ0D 1J7QA 1NYAA 4ORAB 3BUNB 3TDIA 2JWWA 3OB1B 1WLMA 2OTGC 4MSPA 1SYMA 3PFVA 4YGBB 1Y6WA 2H8VA 3UO9A 1FBVA 4PHJA 4MZKA 1JF0A 1KWOC 1ZOTB 2WCLA 3TDZA 3O2PA 1WY9A 1QVIZ 4GNKB 4MVFA 4WQ2A 1LVCD 3BFHA 1NCXA 3CABA 1K95A 2K7DA 3CZ1A 3SG6A 4XJKB 3I5HC 3O78A 3S0DA 1KFUS 1DJGA 3WHTB 4D1EA 3TS5C 1XA5A 2AAOA 2K2FA 1IRJA 1DVIA 1RWYA 2L5YA 2PRUA 1SBJA 1CM4A 1NSHA 2QEHA 3CGAA 1TTXA 2M1KB 4OVNF 1IGVA 2NLNA 2BNXA 1TUJA 1JC2A 5HLVA 1J1DA 1VRKA 3A8RA 2EHBA 1DJIA 2JOJA 3FE9A 1C7WA 1XFZO 2KQ6A 3B6XA 1SRAA 3DY9A 4ORCB 1SMGA 4PE0A 4WRIA 1TIZA 2L5XB 1OOJA 2MAZA 3FS7A 2JPTA 2KQYA 2WOSA 1OQPA 2BE4A 2LVKA 3NHIA 1SSEB 3VB1A 1OMVA 1KK8B 3SS3A 1WRZA 4AQJA 4AOMA 1QXPA 1IQ3A 2JXLA 2HPSA 4CFRA 1GM0A 1G8IA 1N0YA 2H61A 1M39A 2F8PA 1ODBA 3VRQA 2JT8A 2L4HA 1S6JA 5IBWA 3OHMB 4JPZB 3BUXB 5DKQA 4FQOA 3D74A 2PALA 3R1VA 4YGDB 3SS5A 3ZWHA 2K61A 5HYDA 1SL8A 1WRKA 1Y1XA 5JOLA 3KO0A 3KPXA 4PE1A 3DVEA 2ZFDA 3DVMA 4XJKA 1CDPA 2F33A 2WCMA 1QIWA 3DF0B 4INXA 3CLNA 4OCIA 1CB1A 2Q91A 1ZUZA 1DELA 1IIOA 2JC2A 2H2KA 2ZRSA 4UPGA 1Y1UA 1S3PA 2A4JA 3NSOA 2PSRA 2JTTA 2K7OA 1DGUA 2M0RA 1CFPA 2O60A 1XYDA 1Y1AA 4M2OA 1WDCB 3NXAA 1FI5A 1OW4A 2KBMA 2BCBA 1BR4B 1JUOA 1EG4A 2AUCA 2CXJA 3O6BA 1KFXS 3LK0A 3KHEA 2LVVA 3CDNA 4YI9A 1TNPA 3O4XA 3JTDC 3EG5B 5ER4X 4JKTA 3CS1A 1NUBA 3FE6A 2HF5A 2MRDA 3SIAA 3NSLA 3VRPA 3SJSA 3SG2A 4N5XA 1OOFA 5DICA 2M7NA 3OGNA 3F45A 3SG7A 1OMDA 1CMGA 1F70A 1BLQA 1XFVO 3AAKA 1BMOA 1TCOB 1YUUA 1TRFA 3KF9A 1Y0VH 2BL0B 1FI6A 3L4AA 3EK4A 2LUXA 3GK2A 4FQTA 5CSFA 2JQ6A 5I8NA 1D1OA 2JTZA 2LV7A 2M3WA 5FYXA 4BY4A 2BBNA 3C1VA 2P70A 2NCPA 5J3XA 1JF2A 1C3ZA 1XK4A 2D8NA 3BUMB 2WCEA 5HLOA 1ZACA 2OS8B 3CZTX 4OZDA 4PHMA 1J7PA 1DTLA 1BT6A 1WLZA 2LVIA 2PMYA 3DVJA 3CYZA 1K96A 2WCKA 4L9MA 3I5IB 1JBAA 1G4YR 1ALWA 1KQMB 1SL9A 1YVLA 2KHNA 2RGIA 2Y1NA 1PVAA 4PALA 2B1UA 1V1GA 2K7CA 1IWQA 2E6WA 1XFXO 5PALA 2Q4UA 1BG1A 5HKZA 2CCMA 1B8CA 4PT1A 1CLMA 1OOHA 1KK7Y 3EK8A 2V53A 2QEOA 2LUCA 3IQQA 2M97A 5ER5A 3FE8A 3JVTB 5HKWA 1F55A 1LKJA 1AJ5A 3BFAA 1MXLC 1S6IA 1YUSA 4R1EA 1KSMA 4Q04A 5DKRA 1YURA 1K2HA 1A75A 1S36A 1YTZC 2Y5IA 4KYNA 3BOWA 3IQOA 1IJ5A 1EG3A 4MZLA 1CKKA 2LVJA 2BL0C 5CPVA 3PM8A 5EL2A 3TUYB 1DGVA 1L2OB 5AERA 1PALA 1QVIY 1BU3A 1LXFC 1UWOA 4IJ7A 1QX5B 2HETA 2FOTA 1TWOA 3EKHA 1DJWA 3I5FC 2F2PA 1R2UA 1UHJA 3PN7B 3RLZA 4QJ5B 1C3YA 1K90D 3OX5A 3EVVA 2HQWA 3I5GB 3UNWA 2WC8A 4QJ4B 2LMTA 1NX1A 2WCHA 3EVRA 4MN0A 5AANA 2KAVA 3LL8B 1P28A 1PSBA 4MRYA 4ZCUA 1MF8B 2F3ZA 2EGDA 1QV0A 4YI8A 3NSKA 2MLEC 1QJTA 1CDMA 3MSEB 2LNKA 5AXIA 4I5JA 2ZRTA 5CSJA 1OE9B 1S5GZ 1UHHA 1XFUO 3CR5X 1SL7A 3OB2B 1B9AA 3EKJA 2LLUA 1YX7A 2FJUB 1SKTA 2AMIA 2KAXA 2M7LA 4GGFA 1JFKA 3IVTA 1AVSA 1SY9A 2KI4B 3BUWB 5F6TA 4CLNA 5I94A 1B7TY 1ALVA 1LA0A 1RJVA 1DQEA 1M46A 2LP3A 5I2LA 1PVBA 4N1FA 3FWCA 1F8HA 4YRUA 1DT7B 4PE7A 1Z4HA 3EK7A 4AQIA 3SS4A 3NHTA 1F71A 2CTNA 4A4BA 1L2OC 1A29A 2BECA 2K8MB 1NP8A 2KAYA 2COLB 1F54A 2L98A 2QEBA 4OKHA 5CSIA 4PDZA 2K2AA 1DJXA 5JJGA 1IKUA 2PVBA 3PATA 2M29A 1XFYO 3I5GC 1QLSA 4P2YB 1OMRA 2WCFA 2ISDA 1NX2A 2JPOA 1CDNA 2O5GA 4INWA 5HL1A 1CDLA 3NGVA 4MZJA 2LLSA 3CZ2A 1B8RA 1SCVA 4CFQA 2FCDA 1V1FA 4C0KA 1HT9A 1DC1A 4HRGA 3B88A 2KFFA 2L2EA 4I5LB 5I2QA 1SK6D 2BAPA 2KI6D 2LCPA 1IG5A 1N65A 3HCMA 3AKAA 4DS7A 1DEKA 1CM1A 2CT9A 3SG4A 1TNXA 3GOFA 1BR1B 2MLFC 4DUQA 4HREE 1EH2A 2KSPA 2P71A 2KDHA 1KK8C 2BKHB 4NDDA 4GPLB 2KOTA 1B47A 1HQVA 1KFUL 2L51A 2CNPA 2WCBA 3R72A 4M2QA 1IJ6A 5D7FA 5G08A 3S0BA 4GGNA 4GUKA 4C0LA 1F4QA 2GTEA 3AKBA 3E3RA 1JSAA 2WC6A 1FPWA 4F0ZB 1A75B 3CZ0A 2OPOA 3QRXA 2R2IA 3BOWB 1QIVA 2LAPA 2M1UA 4PHNA 3OP0A 1FF1A 1CFFA 2GV5A 1S26D 1K9UA 1MQ1A 3LK1A 4F7FA 4QJ3B 1XK4C 3CTNA
chains in the Genus database with same CATH topology
1K9PA 3VRRA 3O4YA 1CFCA 1PK0D 1XVJA 1YRTB 2JNFA 3SG5A 1UHKA 2JT0A 2JXCA 1MR8A 1QX7A 3BXKA 3A4UB 3NSIA 4MLWA 2IS9A 2ZNEA 1AP4A 1TNQA 1UHIA 1SNLA 1WDCC 2LMVA 4I5NB 2CBLA 1K8UA 2LMUA 3D0YA 1K93D 1LINA 4YGEB 4I5KA 2OTGB 3GK1A 2EC6B 3SIBA 4ICBA 3CWGA 1NX0A 2G9BA 1RFJA 4IL1A 1NCYA 3WXAA 1H8BA 2BCXA 1GGZA 1KWOB 3TDUA 1AJ4A 1IH0A 1MHOA 2K7BA 4CPVA 1DMOA 1RROA 5TNCA 2F2OA 2MJWB 3CR2A 2KGRA 4WQ3A 3SG3A 1DF0B 3CR4X 1KQVA 2M8UA 1RK9A 5KU1A 1QTXA 1U5IB 2ZNDA 4GFTA 1C07A 2LANA 4OR9B 2ZN9A 1KFXL 2MHHA 3DVKA 1AUIB 1IQ5A 2KNEA 5D69A 1ZFSA 3PSRA 1YR5A 4GAOA 2LP2A 1W7JB 3KEVA 1CLLA 2OS8C 2M9GA 2G2BA 2SCPA 1EJ3A 2WNDA 4DCKA 2JZIA 5KSZA 1B4CA 2JULA 3PLFB 1BOCA 1G33A 1SCMB 1DJHA 2BE6A 1NIWA 3I5IC 3VGOA 4JWQA 2I94A 5BPJA 1A2XA 1KQMC 5K89A 2QPTA 3BYAA 5DKNA 2E30A 1DJYA 2F3YA 2SASA 3RM1A 1XFWO 5HKYA 1N2DA 5KTYA 4XYNA 4N1GA 2EC6C 1UP5A 3LCPC 5I2OA 1TCFA 2I7AA 1X02A 3JVTC 4PHKA 1PRWA 1BJFA 4OV2A 4GGFC 4DRWA 1CTRA 2M49B 1TOPA 2NXQA 2JRFA 2LE9B 1NX3A 1GJYA 5CSNA 2MBXA 1UHNA 2KFHA 1DF0A 4USLA 5AEQA 3VROA 1U5IA 2MA2A 4M2PA 4MRXA 1TN4A 1CLBA 1SW8A 2H61C 2WORA 3TUYC 1A03A 4HRHA 4ZCVA 1A4PA 1RECA 2GGZA 4C0JA 3BQ3A 1F4OA 3PN7C 1MWNA 2JNXA 1K9KA 3LLEA 4CIDA 1LA3A 1JWDA 2KGBC 1QS7A 1SCMC 2P6BB 3FIAA 4FTGA 3FWBA 1JFJA 1DJZA 3JTDB 1CFDA 1M31A 3DD4A 1B7TZ 2I18A 3H4SE 4NDBA 4PCWA 4U8DA 1E8AA 3WNXB 1FW4A 1CMFA 4E68A 2KFGA 2L0PA 1Q80A 4GBAA 1MUXA 4PE4A 4BY5A 1B8LA 2KI4C 2BBMA 1S1EA 3ZNIA 1KCYA 2FCEA 1SR6B 2JT3A 4NDCA 1L7ZA 2NCOA 3D0YB 2QACA 1C7VA 1YUTA 2BKIB 4ORBB 1H4BA 2ZKMX 1J7OA 2KBIA 2LLTA 1CNPA 2LHIA 1PULA 4MEWA 3D10A 1QV1A 1K94A 1BF5A 3OX6A 2I2RE 2NZ0A 2KYFA 1UUSA 3K21A 1QX2A 1QATA 1QLKA 1R6PA 2TN4A 3VRNA 2K0JA 2HQ8A 1AK8A 1BODA 3EVUA 3M0WA 1GGWA 1KSOA 2BCAA 2LC5A 1TNWA 1OZSA 1M45A 4NQGA 1ZMZA 3AAJA 2VRGA 1SPYA 2LM5A 4YBHB 3TZ1A 2Y1MA 1YVHA 1EXRA 3GK4X 2DOQA 1RTP1 1YX8A 3HX4A 1J55A 1SR6C 2KYCA 1MXEA 1NCZA 1J1EA 1S6CA 1B1GA 2GGMA 1QASA 3DF0A 4YGAA 4A4CA 1UURA 3I5FB 1AHRA 1J7RA 4P5OE 1OZOA 2L50A 2JU0A 3I5HB 1GQMA 1YRUB 2LHLA 3BUOB 3ICBA 1NWDA 3IF7A 2KI6C 3TS5B 1XO5A 1NPQA 1M63B 3PALA 4TNCA 4DIRA 1WRLA 3WHUB 2Y4QA 5B8IB 2ZN8A 5AFPA 4ETOA 4YGCB 1OSAA 1EL4A 4MBEA 1KK7Z 1PSRA 5GQQC 1W7IB 4HSZA 2PASA 1S5GY 2L4IA 4JQ0D 1J7QA 1NYAA 4ORAB 3BUNB 3TDIA 2JWWA 3OB1B 1WLMA 2OTGC 4MSPA 1SYMA 3PFVA 4YGBB 1Y6WA 1FBVA 4PHJA 4MZKA 1JF0A 1KWOC 1ZOTB 3TDZA 3O2PA 1WY9A 1QVIZ 4GNKB 4MVFA 4WQ2A 1LVCD 1NCXA 1K95A 2K7DA 3SG6A 4XJKB 3I5HC 3O78A 1KFUS 1DJGA 3WHTB 4D1EA 3TS5C 1XA5A 2AAOA 2K2FA 1IRJA 1DVIA 1RWYA 2PRUA 3CGAA 1SBJA 1CM4A 1NSHA 1TTXA 2M1KB 4OVNF 1IGVA 2NLNA 1JC2A 5HLVA 1J1DA 1VRKA 3A8RA 2EHBA 1DJIA 2JOJA 1C7WA 1XFZO 2KQ6A 4ORCB 1SRAA 4PE0A 1SMGA 4WRIA 1TIZA 2L5XB 1OOJA 2MAZA 3FS7A 2JPTA 2KQYA 2WOSA 1OQPA 2BE4A 2LVKA 1OMVA 1KK8B 1WRZA 4AQJA 4AOMA 1QXPA 1IQ3A 2JXLA 2HPSA 4CFRA 1G8IA 1N0YA 2H61A 1M39A 2F8PA 1ODBA 3VRQA 2JT8A 2L4HA 1S6JA 5IBWA 3OHMB 4JPZB 3BUXB 5DKQA 4FQOA 2PALA 5HYDA 4YGDB 3ZWHA 2K61A 1SL8A 1WRKA 1Y1XA 5JOLA 3KO0A 3KPXA 4PE1A 3DVEA 2ZFDA 3DVMA 4XJKA 1CDPA 2F33A 1QIWA 3DF0B 3CLNA 4OCIA 1CB1A 2Q91A 1ZUZA 2JC2A 2H2KA 2ZRSA 4UPGA 1Y1UA 1S3PA 2A4JA 3NSOA 2PSRA 2JTTA 2K7OA 1DGUA 2M0RA 1CFPA 2O60A 1XYDA 1Y1AA 4M2OA 1WDCB 3NXAA 1FI5A 2KBMA 2BCBA 1BR4B 1JUOA 1EG4A 2AUCA 2CXJA 3O6BA 1KFXS 3LK0A 3KHEA 2LVVA 4YI9A 1TNPA 3JTDC 5ER4X 3CS1A 1NUBA 2HF5A 2MRDA 3SIAA 3NSLA 3VRPA 3SJSA 3SG2A 4N5XA 3SG7A 1CMGA 2M7NA 1F70A 3F45A 1JSAA 1OMDA 1BLQA 1XFVO 3AAKA 1BMOA 1TCOB 1YUUA 1TRFA 3KF9A 1Y0VH 2BL0B 1FI6A 3EK4A 2LUXA 3GK2A 5CSFA 5I8NA 2JQ6A 1D1OA 2JTZA 2LV7A 2M3WA 5FYXA 4BY4A 2BBNA 3C1VA 2NCPA 5J3XA 1JF2A 1XK4A 2D8NA 3BUMB 2WCEA 5HLOA 1ZACA 2OS8B 3CZTX 4PHMA 1J7PA 1DTLA 1BT6A 1WLZA 2LVIA 2PMYA 3DVJA 1K96A 4L9MA 3I5IB 1JBAA 1G4YR 1ALWA 1KQMB 1SL9A 1YVLA 2KHNA 2RGIA 2Y1NA 1PVAA 4PALA 2B1UA 1V1GA 2K7CA 1IWQA 2E6WA 1XFXO 5PALA 2Q4UA 1BG1A 5HKZA 2CCMA 1B8CA 1CLMA 1KK7Y 3EK8A 2V53A 2LUCA 3IQQA 2M97A 5ER5A 3JVTB 5HKWA 1F55A 1LKJA 1AJ5A 1MXLC 1S6IA 1YUSA 4R1EA 1KSMA 4Q04A 5DKRA 1YURA 1K2HA 1A75A 1S36A 1YTZC 2Y5IA 3BOWA 3IQOA 1IJ5A 1EG3A 4MZLA 1CKKA 2LVJA 2BL0C 5CPVA 3PM8A 3TUYB 5AERA 1DGVA 1L2OB 1PALA 1QVIY 1BU3A 1LXFC 1UWOA 1QX5B 2HETA 2FOTA 3EKHA 1DJWA 3I5FC 2F2PA 1R2UA 1UHJA 3PN7B 3RLZA 4QJ5B 1K90D 3OX5A 3EVVA 2HQWA 3I5GB 2WC8A 4QJ4B 2LMTA 1NX1A 5AANA 3EVRA 4MN0A 2KAVA 3LL8B 4ZCUA 1PSBA 4MRYA 1MF8B 2F3ZA 2EGDA 1QV0A 4YI8A 3NSKA 2MLEC 1QJTA 1CDMA 3MSEB 2LNKA 5AXIA 4I5JA 2ZRTA 5CSJA 1OE9B 1S5GZ 1UHHA 1XFUO 3CR5X 1SL7A 3OB2B 1B9AA 3EKJA 2LLUA 1YX7A 2FJUB 1SKTA 2AMIA 2KAXA 2M7LA 4GGFA 1JFKA 1AVSA 1SY9A 2KI4B 3BUWB 5F6TA 4CLNA 1B7TY 1ALVA 1LA0A 1RJVA 1M46A 2LP3A 5I2LA 1PVBA 4N1FA 3FWCA 1F8HA 4YRUA 1DT7B 4PE7A 3EK7A 4AQIA 1F71A 2CTNA 4A4BA 1L2OC 2BECA 1A29A 2K8MB 1NP8A 2KAYA 2COLB 1F54A 2L98A 4OKHA 5CSIA 4PDZA 2K2AA 1DJXA 5JJGA 1IKUA 2PVBA 3PATA 2M29A 1XFYO 3I5GC 1QLSA 4P2YB 1OMRA 2WCFA 2ISDA 1NX2A 1CDNA 2O5GA 1CDLA 4MZJA 2LLSA 1B8RA 1SCVA 4CFQA 2FCDA 1V1FA 4C0KA 1HT9A 4HRGA 2KFFA 2L2EA 4I5LB 5I2QA 1SK6D 2KI6D 2LCPA 1IG5A 1N65A 3HCMA 3AKAA 4DS7A 2CT9A 1CM1A 3SG4A 1TNXA 3GOFA 1BR1B 2MLFC 4DUQA 4HREE 1EH2A 2KSPA 2KDHA 1KK8C 2BKHB 4NDDA 4GPLB 2KOTA 1B47A 1HQVA 1KFUL 2L51A 2CNPA 2WCBA 4M2QA 5D7FA 1IJ6A 5G08A 4GGNA 4GUKA 4C0LA 1F4QA 3AKBA 3E3RA 1FPWA 4F0ZB 1A75B 2OPOA 3QRXA 2R2IA 3BOWB 1QIVA 2LAPA 2M1UA 4PHNA 3OP0A 1FF1A 1CFFA 2GV5A 1S26D 1K9UA 1MQ1A 3LK1A 4QJ3B 1XK4C 3CTNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9P A;  3VRR A;  3O4Y A;  1CFC A;  1PK0 D;  1XVJ A;  1YRT B;  2JNF A;  3SG5 A;  1UHK A;  2JT0 A;  2JXC A;  1MR8 A;  1QX7 A;  3BXK A;  3A4U B;  3NSI A;  4MLW A;  2IS9 A;  2ZNE A;  1AP4 A;  1TNQ A;  1UHI A;  1SNL A;  1WDC C;  2LMV A;  4I5N B;  2CBL A;  1K8U A;  2LMU A;  3D0Y A;  1K93 D;  1LIN A;  4YGE B;  4I5K A;  2OTG B;  3GK1 A;  2EC6 B;  3SIB A;  4ICB A;  3CWG A;  1NX0 A;  2G9B A;  1RFJ A;  4IL1 A;  1NCY A;  3WXA A;  1H8B A;  2BCX A;  1GGZ A;  1KWO B;  3TDU A;  1AJ4 A;  1IH0 A;  1MHO A;  2K7B A;  4CPV A;  1DMO A;  1RRO A;  5TNC A;  2F2O A;  2MJW B;  3CR2 A;  2KGR A;  4WQ3 A;  3SG3 A;  1DF0 B;  3CR4 X;  1KQV A;  2M8U A;  1RK9 A;  5KU1 A;  1QTX A;  1U5I B;  2ZND A;  4GFT A;  1C07 A;  2LAN A;  4OR9 B;  2ZN9 A;  1KFX L;  2MHH A;  3DVK A;  1AUI B;  1IQ5 A;  2KNE A;  5D69 A;  1ZFS A;  3PSR A;  1YR5 A;  4GAO A;  2LP2 A;  1W7J B;  3KEV A;  1CLL A;  2OS8 C;  2M9G A;  2G2B A;  2SCP A;  1EJ3 A;  2WND A;  4DCK A;  2JZI A;  5KSZ A;  1B4C A;  2JUL A;  3PLF B;  1BOC A;  1G33 A;  1SCM B;  1DJH A;  2BE6 A;  1NIW A;  3I5I C;  3VGO A;  4JWQ A;  2I94 A;  5BPJ A;  1A2X A;  1KQM C;  5K89 A;  2QPT A;  3BYA A;  5DKN A;  2E30 A;  1DJY A;  2F3Y A;  2SAS A;  3RM1 A;  1XFW O;  5HKY A;  1N2D A;  5KTY A;  4XYN A;  4N1G A;  2EC6 C;  1UP5 A;  3LCP C;  5I2O A;  1TCF A;  2I7A A;  1X02 A;  3JVT C;  4PHK A;  1PRW A;  1BJF A;  4OV2 A;  4GGF C;  4DRW A;  1CTR A;  2M49 B;  1TOP A;  2NXQ A;  2JRF A;  2LE9 B;  1NX3 A;  1GJY A;  5CSN A;  2MBX A;  1UHN A;  2KFH A;  1DF0 A;  4USL A;  5AEQ A;  3VRO A;  1U5I A;  2MA2 A;  4M2P A;  4MRX A;  1TN4 A;  1CLB A;  1SW8 A;  2H61 C;  2WOR A;  3TUY C;  1A03 A;  4HRH A;  4ZCV A;  1A4P A;  1REC A;  2GGZ A;  4C0J A;  3BQ3 A;  1F4O A;  3PN7 C;  1MWN A;  2JNX A;  1K9K A;  3LLE A;  4CID A;  1LA3 A;  1JWD A;  2KGB C;  1QS7 A;  1SCM C;  2P6B B;  3FIA A;  4FTG A;  3FWB A;  1JFJ A;  1DJZ A;  3JTD B;  1CFD A;  1M31 A;  3DD4 A;  1B7T Z;  2I18 A;  3H4S E;  4NDB A;  4PCW A;  4U8D A;  1E8A A;  3WNX B;  1FW4 A;  1CMF A;  4E68 A;  2KFG A;  2L0P A;  1Q80 A;  4GBA A;  1MUX A;  4PE4 A;  4BY5 A;  1B8L A;  2KI4 C;  2BBM A;  1S1E A;  3ZNI A;  1KCY A;  2FCE A;  1SR6 B;  2JT3 A;  4NDC A;  1L7Z A;  2NCO A;  3D0Y B;  2QAC A;  1C7V A;  1YUT A;  2BKI B;  4ORB B;  1H4B A;  2ZKM X;  1J7O A;  2KBI A;  2LLT A;  1CNP A;  2LHI A;  1PUL A;  4MEW A;  3D10 A;  1QV1 A;  1K94 A;  1BF5 A;  3OX6 A;  2I2R E;  2NZ0 A;  2KYF A;  1UUS A;  3K21 A;  1QX2 A;  1QAT A;  1QLK A;  1R6P A;  2TN4 A;  3VRN A;  2K0J A;  2HQ8 A;  1AK8 A;  1BOD A;  3EVU A;  3M0W A;  1GGW A;  1KSO A;  2BCA A;  2LC5 A;  1TNW A;  1OZS A;  1M45 A;  4NQG A;  1ZMZ A;  3AAJ A;  2VRG A;  1SPY A;  2LM5 A;  4YBH B;  3TZ1 A;  2Y1M A;  1YVH A;  1EXR A;  3GK4 X;  2DOQ A;  1RTP 1;  1YX8 A;  3HX4 A;  1J55 A;  1SR6 C;  2KYC A;  1MXE A;  1NCZ A;  1J1E A;  1S6C A;  1B1G A;  2GGM A;  1QAS A;  3DF0 A;  4YGA A;  4A4C A;  1UUR A;  3I5F B;  1AHR A;  1J7R A;  4P5O E;  1OZO A;  2L50 A;  2JU0 A;  3I5H B;  1GQM A;  1YRU B;  2LHL A;  3BUO B;  3ICB A;  1NWD A;  3IF7 A;  2KI6 C;  3TS5 B;  1XO5 A;  1NPQ A;  1M63 B;  3PAL A;  4TNC A;  4DIR A;  1WRL A;  3WHU B;  2Y4Q A;  5B8I B;  2ZN8 A;  5AFP A;  4ETO A;  4YGC B;  1OSA A;  1EL4 A;  4MBE A;  1KK7 Z;  1PSR A;  5GQQ C;  1W7I B;  4HSZ A;  2PAS A;  1S5G Y;  2L4I A;  4JQ0 D;  1J7Q A;  1NYA A;  4ORA B;  3BUN B;  3TDI A;  2JWW A;  3OB1 B;  1WLM A;  2OTG C;  4MSP A;  1SYM A;  3PFV A;  4YGB B;  1Y6W A;  1FBV A;  4PHJ A;  4MZK A;  1JF0 A;  1KWO C;  1ZOT B;  3TDZ A;  3O2P A;  1WY9 A;  1QVI Z;  4GNK B;  4MVF A;  4WQ2 A;  1LVC D;  1NCX A;  1K95 A;  2K7D A;  3SG6 A;  4XJK B;  3I5H C;  3O78 A;  1KFU S;  1DJG A;  3WHT B;  4D1E A;  3TS5 C;  1XA5 A;  2AAO A;  2K2F A;  1IRJ A;  1DVI A;  1RWY A;  2PRU A;  3CGA A;  1SBJ A;  1CM4 A;  1NSH A;  1TTX A;  2M1K B;  4OVN F;  1IGV A;  2NLN A;  1JC2 A;  5HLV A;  1J1D A;  1VRK A;  3A8R A;  2EHB A;  1DJI A;  2JOJ A;  1C7W A;  1XFZ O;  2KQ6 A;  4ORC B;  1SRA A;  4PE0 A;  1SMG A;  4WRI A;  1TIZ A;  2L5X B;  1OOJ A;  2MAZ A;  3FS7 A;  2JPT A;  2KQY A;  2WOS A;  1OQP A;  2BE4 A;  2LVK A;  1OMV A;  1KK8 B;  1WRZ A;  4AQJ A;  4AOM A;  1QXP A;  1IQ3 A;  2JXL A;  2HPS A;  4CFR A;  1G8I A;  1N0Y A;  2H61 A;  1M39 A;  2F8P A;  1ODB A;  3VRQ A;  2JT8 A;  2L4H A;  1S6J A;  5IBW A;  3OHM B;  4JPZ B;  3BUX B;  5DKQ A;  4FQO A;  2PAL A;  5HYD A;  4YGD B;  3ZWH A;  2K61 A;  1SL8 A;  1WRK A;  1Y1X A;  5JOL A;  3KO0 A;  3KPX A;  4PE1 A;  3DVE A;  2ZFD A;  3DVM A;  4XJK A;  1CDP A;  2F33 A;  1QIW A;  3DF0 B;  3CLN A;  4OCI A;  1CB1 A;  2Q91 A;  1ZUZ A;  2JC2 A;  2H2K A;  2ZRS A;  4UPG A;  1Y1U A;  1S3P A;  2A4J A;  3NSO A;  2PSR A;  2JTT A;  2K7O A;  1DGU A;  2M0R A;  1CFP A;  2O60 A;  1XYD A;  1Y1A A;  4M2O A;  1WDC B;  3NXA A;  1FI5 A;  2KBM A;  2BCB A;  1BR4 B;  1JUO A;  1EG4 A;  2AUC A;  2CXJ A;  3O6B A;  1KFX S;  3LK0 A;  3KHE A;  2LVV A;  4YI9 A;  1TNP A;  3JTD C;  5ER4 X;  3CS1 A;  1NUB A;  2HF5 A;  2MRD A;  3SIA A;  3NSL A;  3VRP A;  3SJS A;  3SG2 A;  4N5X A;  3SG7 A;  1CMG A;  2M7N A;  1F70 A;  3F45 A;  1JSA A;  1OMD A;  1BLQ A;  1XFV O;  3AAK A;  1BMO A;  1TCO B;  1YUU A;  1TRF A;  3KF9 A;  1Y0V H;  2BL0 B;  1FI6 A;  3EK4 A;  2LUX A;  3GK2 A;  5CSF A;  5I8N A;  2JQ6 A;  1D1O A;  2JTZ A;  2LV7 A;  2M3W A;  5FYX A;  4BY4 A;  2BBN A;  3C1V A;  2NCP A;  5J3X A;  1JF2 A;  1XK4 A;  2D8N A;  3BUM B;  2WCE A;  5HLO A;  1ZAC A;  2OS8 B;  3CZT X;  4PHM A;  1J7P A;  1DTL A;  1BT6 A;  1WLZ A;  2LVI A;  2PMY A;  3DVJ A;  1K96 A;  4L9M A;  3I5I B;  1JBA A;  1G4Y R;  1ALW A;  1KQM B;  1SL9 A;  1YVL A;  2KHN A;  2RGI A;  2Y1N A;  1PVA A;  4PAL A;  2B1U A;  1V1G A;  2K7C A;  1IWQ A;  2E6W A;  1XFX O;  5PAL A;  2Q4U A;  1BG1 A;  5HKZ A;  2CCM A;  1B8C A;  1CLM A;  1KK7 Y;  3EK8 A;  2V53 A;  2LUC A;  3IQQ A;  2M97 A;  5ER5 A;  3JVT B;  5HKW A;  1F55 A;  1LKJ A;  1AJ5 A;  1MXL C;  1S6I A;  1YUS A;  4R1E A;  1KSM A;  4Q04 A;  5DKR A;  1YUR A;  1K2H A;  1A75 A;  1S36 A;  1YTZ C;  2Y5I A;  3BOW A;  3IQO A;  1IJ5 A;  1EG3 A;  4MZL A;  1CKK A;  2LVJ A;  2BL0 C;  5CPV A;  3PM8 A;  3TUY B;  5AER A;  1DGV A;  1L2O B;  1PAL A;  1QVI Y;  1BU3 A;  1LXF C;  1UWO A;  1QX5 B;  2HET A;  2FOT A;  3EKH A;  1DJW A;  3I5F C;  2F2P A;  1R2U A;  1UHJ A;  3PN7 B;  3RLZ A;  4QJ5 B;  1K90 D;  3OX5 A;  3EVV A;  2HQW A;  3I5G B;  2WC8 A;  4QJ4 B;  2LMT A;  1NX1 A;  5AAN A;  3EVR A;  4MN0 A;  2KAV A;  3LL8 B;  4ZCU A;  1PSB A;  4MRY A;  1MF8 B;  2F3Z A;  2EGD A;  1QV0 A;  4YI8 A;  3NSK A;  2MLE C;  1QJT A;  1CDM A;  3MSE B;  2LNK A;  5AXI A;  4I5J A;  2ZRT A;  5CSJ A;  1OE9 B;  1S5G Z;  1UHH A;  1XFU O;  3CR5 X;  1SL7 A;  3OB2 B;  1B9A A;  3EKJ A;  2LLU A;  1YX7 A;  2FJU B;  1SKT A;  2AMI A;  2KAX A;  2M7L A;  4GGF A;  1JFK A;  1AVS A;  1SY9 A;  2KI4 B;  3BUW B;  5F6T A;  4CLN A;  1B7T Y;  1ALV A;  1LA0 A;  1RJV A;  1M46 A;  2LP3 A;  5I2L A;  1PVB A;  4N1F A;  3FWC A;  1F8H A;  4YRU A;  1DT7 B;  4PE7 A;  3EK7 A;  4AQI A;  1F71 A;  2CTN A;  4A4B A;  1L2O C;  2BEC A;  1A29 A;  2K8M B;  1NP8 A;  2KAY A;  2COL B;  1F54 A;  2L98 A;  4OKH A;  5CSI A;  4PDZ A;  2K2A A;  1DJX A;  5JJG A;  1IKU A;  2PVB A;  3PAT A;  2M29 A;  1XFY O;  3I5G C;  1QLS A;  4P2Y B;  1OMR A;  2WCF A;  2ISD A;  1NX2 A;  1CDN A;  2O5G A;  1CDL A;  4MZJ A;  2LLS A;  1B8R A;  1SCV A;  4CFQ A;  2FCD A;  1V1F A;  4C0K A;  1HT9 A;  4HRG A;  2KFF A;  2L2E A;  4I5L B;  5I2Q A;  1SK6 D;  2KI6 D;  2LCP A;  1IG5 A;  1N65 A;  3HCM A;  3AKA A;  4DS7 A;  2CT9 A;  1CM1 A;  3SG4 A;  1TNX A;  3GOF A;  1BR1 B;  2MLF C;  4DUQ A;  4HRE E;  1EH2 A;  2KSP A;  2KDH A;  1KK8 C;  2BKH B;  4NDD A;  4GPL B;  2KOT A;  1B47 A;  1HQV A;  1KFU L;  2L51 A;  2CNP A;  2WCB A;  4M2Q A;  5D7F A;  1IJ6 A;  5G08 A;  4GGN A;  4GUK A;  4C0L A;  1F4Q A;  3AKB A;  3E3R A;  1FPW A;  4F0Z B;  1A75 B;  2OPO A;  3QRX A;  2R2I A;  3BOW B;  1QIV A;  2LAP A;  2M1U A;  4PHN A;  3OP0 A;  1FF1 A;  1CFF A;  2GV5 A;  1S26 D;  1K9U A;  1MQ1 A;  3LK1 A;  4QJ3 B;  1XK4 C;  3CTN A; 
#chains in the Genus database with same CATH topology
 1K9P A;  3VRR A;  2FJY A;  3O4Y A;  1CFC A;  1PK0 D;  1XVJ A;  3N7H A;  1YRT B;  2JNF A;  3SG5 A;  1UHK A;  2JT0 A;  2JXC A;  1MR8 A;  1QX7 A;  3BXK A;  3A4U B;  3NSI A;  4MLW A;  2IS9 A;  2ZNE A;  1AP4 A;  1TNQ A;  1UHI A;  1SNL A;  1WDC C;  2LMV A;  4I5N B;  2CBL A;  3RZS A;  1K8U A;  2LMU A;  3D0Y A;  1K93 D;  1LIN A;  4YGE B;  4I5K A;  2OTG B;  3GK1 A;  2EC6 B;  3SIB A;  4ICB A;  3CWG A;  1NX0 A;  2G9B A;  1RFJ A;  4IL1 A;  1NCY A;  3WXA A;  1H8B A;  2BCX A;  1GGZ A;  1KWO B;  3TDU A;  1AJ4 A;  1IH0 A;  1MHO A;  2K7B A;  4CPV A;  1DMO A;  1RRO A;  5TNC A;  3S0A A;  2F2O A;  2MJW B;  2PYQ A;  3CR2 A;  2KGR A;  4WQ3 A;  3SG3 A;  1DF0 B;  3CR4 X;  1OOI X;  1KQV A;  2M8U A;  1RK9 A;  5KU1 A;  1QTX A;  1U5I B;  2ZND A;  4GFT A;  1C07 A;  2LAN A;  4OR9 B;  2ZN9 A;  1TUZ A;  1KFX L;  2MHH A;  3DVK A;  1AUI B;  3V2L A;  1IQ5 A;  2KNE A;  5D69 A;  2ERB A;  1ZFS A;  3PSR A;  1YR5 A;  4GAO A;  2LP2 A;  3D76 A;  1W7J B;  3D73 A;  3KEV A;  1CLL A;  2OS8 C;  2M9G A;  2G2B A;  2SCP A;  1EJ3 A;  2WND A;  4DCK A;  2JZI A;  5KSZ A;  1B4C A;  2JUL A;  3B87 A;  3PLF B;  3L4L A;  1BOC A;  1G33 A;  1SCM B;  1W9Z A;  1DJH A;  2BE6 A;  1NIW A;  3I5I C;  3VGO A;  4JWQ A;  2I94 A;  5BPJ A;  1A2X A;  1KQM C;  5K89 A;  2QPT A;  3BYA A;  5DKN A;  2E30 A;  1DJY A;  2F3Y A;  2KLD A;  2SAS A;  1XFW O;  3RM1 A;  5HKY A;  1N2D A;  5KTY A;  4XYN A;  4N1G A;  3D77 A;  2EC6 C;  1UP5 A;  3LCP C;  4JD9 A;  1TCF A;  5I2O A;  2I7A A;  1X02 A;  3JVT C;  4PHK A;  1PRW A;  1BJF A;  3B7A A;  4GGF C;  4OV2 A;  4DRW A;  1CTR A;  2M49 B;  2QEV A;  1TOP A;  2NXQ A;  2JRF A;  2LE9 B;  1NX3 A;  1GJY A;  5CSN A;  2MBX A;  1UHN A;  2KFH A;  1DF0 A;  4USL A;  1OOG A;  5AEQ A;  3VRO A;  1ORG A;  1U5I A;  2MA2 A;  4M2P A;  4MRX A;  1TN4 A;  3DYE A;  1CLB A;  1SW8 A;  2H61 C;  2WOR A;  3B86 A;  3TUY C;  1A03 A;  4HRH A;  4ZCV A;  3PJI A;  1A4P A;  5D3O A;  1REC A;  2GGZ A;  4C0J A;  3BQ3 A;  1F4O A;  3PN7 C;  1MWN A;  2JNX A;  1K9K A;  3LLE A;  4CID A;  1LA3 A;  1JWD A;  2KGB C;  1QS7 A;  1SCM C;  2P6B B;  3FIA A;  4FTG A;  3FWB A;  1JFJ A;  1DJZ A;  3JTD B;  1CFD A;  1M31 A;  3DD4 A;  1B7T Z;  2I18 A;  3H4S E;  4NDB A;  4PCW A;  4U8D A;  1E8A A;  3WNX B;  1FW4 A;  1CMF A;  3R1P A;  4E68 A;  2KFG A;  2L0P A;  1Q80 A;  2YGU A;  4GBA A;  1MUX A;  4PE4 A;  4BY5 A;  1B8L A;  2KI4 C;  3QME A;  2BBM A;  1S1E A;  3ZNI A;  1KCY A;  2FCE A;  1SR6 B;  2JT3 A;  4NDC A;  1L7Z A;  2NCO A;  3D0Y B;  2QAC A;  1T14 A;  2K60 A;  1C7V A;  1YUT A;  2BKI B;  4ORB B;  1H4B A;  2ZKM X;  3S0E A;  1J7O A;  2KBI A;  2LLT A;  3S0G A;  1CNP A;  2LHI A;  1PUL A;  2WCJ A;  4MEW A;  3D10 A;  1QV1 A;  1K94 A;  1Z2C B;  1BF5 A;  3OX6 A;  3DZT A;  2I2R E;  2NZ0 A;  3DXL A;  2KYF A;  1UUS A;  5FI6 A;  3K21 A;  1QX2 A;  1QAT A;  1QLK A;  1R6P A;  2TN4 A;  3VRN A;  2K0J A;  2KLE A;  2HQ8 A;  1AK8 A;  1BOD A;  3EVU A;  3M0W A;  1GGW A;  1KSO A;  2BCA A;  2LC5 A;  1TNW A;  1OZS A;  1M45 A;  4NQG A;  2KPH A;  3BJH A;  1ZMZ A;  3AAJ A;  3D75 A;  2VRG A;  1SPY A;  2LM5 A;  4YBH B;  3TZ1 A;  2Y1M A;  1YVH A;  1EXR A;  5FI7 A;  3GK4 X;  2DOQ A;  1RTP 1;  1LS8 A;  1YX8 A;  3HX4 A;  1J55 A;  1SR6 C;  2KYC A;  1XFR A;  3OBV A;  1MXE A;  1NCZ A;  1J1E A;  1S6C A;  1B1G A;  1QWV A;  2L2C A;  2PQL A;  2GGM A;  1QAS A;  3DF0 A;  4YGA A;  4A4C A;  1UUR A;  3I5F B;  1AHR A;  1J7R A;  4P5O E;  1OZO A;  2L50 A;  2JU0 A;  3I5H B;  1GQM A;  1YRU B;  2LHL A;  3BUO B;  3ICB A;  3K1E A;  3Q8I A;  3S0F A;  1NWD A;  3IF7 A;  3PM2 A;  2KI6 C;  3TS5 B;  1XO5 A;  1NPQ A;  1M63 B;  3PAL A;  2WC5 A;  4TNC A;  3R1O A;  3BFB A;  4DIR A;  1WRL A;  5FI2 A;  3WHU B;  2Y4Q A;  5B8I B;  2ZN8 A;  5AFP A;  3L47 A;  4ETO A;  4YGC B;  1OSA A;  1EL4 A;  4MBE A;  3D78 A;  2QDI A;  1KK7 Z;  1PSR A;  5GQQ C;  1W7I B;  4HSZ A;  2PAS A;  1S5G Y;  2L4I A;  4JQ0 D;  1J7Q A;  1NYA A;  4ORA B;  3BUN B;  3TDI A;  2JWW A;  3OB1 B;  1WLM A;  2OTG C;  4MSP A;  1SYM A;  3PFV A;  4YGB B;  1Y6W A;  2H8V A;  3UO9 A;  1FBV A;  4PHJ A;  4MZK A;  1JF0 A;  1KWO C;  1ZOT B;  2WCL A;  3TDZ A;  3O2P A;  1WY9 A;  1QVI Z;  4GNK B;  4MVF A;  4WQ2 A;  1LVC D;  3BFH A;  1NCX A;  3CAB A;  1K95 A;  2K7D A;  3CZ1 A;  3SG6 A;  4XJK B;  3I5H C;  3O78 A;  3S0D A;  1KFU S;  1DJG A;  3WHT B;  4D1E A;  3TS5 C;  1XA5 A;  2AAO A;  2K2F A;  1IRJ A;  1DVI A;  1RWY A;  2L5Y A;  2PRU A;  1SBJ A;  1CM4 A;  1NSH A;  2QEH A;  3CGA A;  1TTX A;  2M1K B;  4OVN F;  1IGV A;  2NLN A;  2BNX A;  1TUJ A;  1JC2 A;  5HLV A;  1J1D A;  1VRK A;  3A8R A;  2EHB A;  1DJI A;  2JOJ A;  3FE9 A;  1C7W A;  1XFZ O;  2KQ6 A;  3B6X A;  1SRA A;  3DY9 A;  4ORC B;  1SMG A;  4PE0 A;  4WRI A;  1TIZ A;  2L5X B;  1OOJ A;  2MAZ A;  3FS7 A;  2JPT A;  2KQY A;  2WOS A;  1OQP A;  2BE4 A;  2LVK A;  3NHI A;  1SSE B;  3VB1 A;  1OMV A;  1KK8 B;  3SS3 A;  1WRZ A;  4AQJ A;  4AOM A;  1QXP A;  1IQ3 A;  2JXL A;  2HPS A;  4CFR A;  1GM0 A;  1G8I A;  1N0Y A;  2H61 A;  1M39 A;  2F8P A;  1ODB A;  3VRQ A;  2JT8 A;  2L4H A;  1S6J A;  5IBW A;  3OHM B;  4JPZ B;  3BUX B;  5DKQ A;  4FQO A;  3D74 A;  2PAL A;  3R1V A;  4YGD B;  3SS5 A;  3ZWH A;  2K61 A;  5HYD A;  1SL8 A;  1WRK A;  1Y1X A;  5JOL A;  3KO0 A;  3KPX A;  4PE1 A;  3DVE A;  2ZFD A;  3DVM A;  4XJK A;  1CDP A;  2F33 A;  2WCM A;  1QIW A;  3DF0 B;  4INX A;  3CLN A;  4OCI A;  1CB1 A;  2Q91 A;  1ZUZ A;  1DEL A;  1IIO A;  2JC2 A;  2H2K A;  2ZRS A;  4UPG A;  1Y1U A;  1S3P A;  2A4J A;  3NSO A;  2PSR A;  2JTT A;  2K7O A;  1DGU A;  2M0R A;  1CFP A;  2O60 A;  1XYD A;  1Y1A A;  4M2O A;  1WDC B;  3NXA A;  1FI5 A;  1OW4 A;  2KBM A;  2BCB A;  1BR4 B;  1JUO A;  1EG4 A;  2AUC A;  2CXJ A;  3O6B A;  1KFX S;  3LK0 A;  3KHE A;  2LVV A;  3CDN A;  4YI9 A;  1TNP A;  3O4X A;  3JTD C;  3EG5 B;  5ER4 X;  4JKT A;  3CS1 A;  1NUB A;  3FE6 A;  2HF5 A;  2MRD A;  3SIA A;  3NSL A;  3VRP A;  3SJS A;  3SG2 A;  4N5X A;  1OOF A;  5DIC A;  2M7N A;  3OGN A;  3F45 A;  3SG7 A;  1OMD A;  1CMG A;  1F70 A;  1BLQ A;  1XFV O;  3AAK A;  1BMO A;  1TCO B;  1YUU A;  1TRF A;  3KF9 A;  1Y0V H;  2BL0 B;  1FI6 A;  3L4A A;  3EK4 A;  2LUX A;  3GK2 A;  4FQT A;  5CSF A;  2JQ6 A;  5I8N A;  1D1O A;  2JTZ A;  2LV7 A;  2M3W A;  5FYX A;  4BY4 A;  2BBN A;  3C1V A;  2P70 A;  2NCP A;  5J3X A;  1JF2 A;  1C3Z A;  1XK4 A;  2D8N A;  3BUM B;  2WCE A;  5HLO A;  1ZAC A;  2OS8 B;  3CZT X;  4OZD A;  4PHM A;  1J7P A;  1DTL A;  1BT6 A;  1WLZ A;  2LVI A;  2PMY A;  3DVJ A;  3CYZ A;  1K96 A;  2WCK A;  4L9M A;  3I5I B;  1JBA A;  1G4Y R;  1ALW A;  1KQM B;  1SL9 A;  1YVL A;  2KHN A;  2RGI A;  2Y1N A;  1PVA A;  4PAL A;  2B1U A;  1V1G A;  2K7C A;  1IWQ A;  2E6W A;  1XFX O;  5PAL A;  2Q4U A;  1BG1 A;  5HKZ A;  2CCM A;  1B8C A;  4PT1 A;  1CLM A;  1OOH A;  1KK7 Y;  3EK8 A;  2V53 A;  2QEO A;  2LUC A;  3IQQ A;  2M97 A;  5ER5 A;  3FE8 A;  3JVT B;  5HKW A;  1F55 A;  1LKJ A;  1AJ5 A;  3BFA A;  1MXL C;  1S6I A;  1YUS A;  4R1E A;  1KSM A;  4Q04 A;  5DKR A;  1YUR A;  1K2H A;  1A75 A;  1S36 A;  1YTZ C;  2Y5I A;  4KYN A;  3BOW A;  3IQO A;  1IJ5 A;  1EG3 A;  4MZL A;  1CKK A;  2LVJ A;  2BL0 C;  5CPV A;  3PM8 A;  5EL2 A;  3TUY B;  1DGV A;  1L2O B;  5AER A;  1PAL A;  1QVI Y;  1BU3 A;  1LXF C;  1UWO A;  4IJ7 A;  1QX5 B;  2HET A;  2FOT A;  1TWO A;  3EKH A;  1DJW A;  3I5F C;  2F2P A;  1R2U A;  1UHJ A;  3PN7 B;  3RLZ A;  4QJ5 B;  1C3Y A;  1K90 D;  3OX5 A;  3EVV A;  2HQW A;  3I5G B;  3UNW A;  2WC8 A;  4QJ4 B;  2LMT A;  1NX1 A;  2WCH A;  3EVR A;  4MN0 A;  5AAN A;  2KAV A;  3LL8 B;  1P28 A;  1PSB A;  4MRY A;  4ZCU A;  1MF8 B;  2F3Z A;  2EGD A;  1QV0 A;  4YI8 A;  3NSK A;  2MLE C;  1QJT A;  1CDM A;  3MSE B;  2LNK A;  5AXI A;  4I5J A;  2ZRT A;  5CSJ A;  1OE9 B;  1S5G Z;  1UHH A;  1XFU O;  3CR5 X;  1SL7 A;  3OB2 B;  1B9A A;  3EKJ A;  2LLU A;  1YX7 A;  2FJU B;  1SKT A;  2AMI A;  2KAX A;  2M7L A;  4GGF A;  1JFK A;  3IVT A;  1AVS A;  1SY9 A;  2KI4 B;  3BUW B;  5F6T A;  4CLN A;  5I94 A;  1B7T Y;  1ALV A;  1LA0 A;  1RJV A;  1DQE A;  1M46 A;  2LP3 A;  5I2L A;  1PVB A;  4N1F A;  3FWC A;  1F8H A;  4YRU A;  1DT7 B;  4PE7 A;  1Z4H A;  3EK7 A;  4AQI A;  3SS4 A;  3NHT A;  1F71 A;  2CTN A;  4A4B A;  1L2O C;  1A29 A;  2BEC A;  2K8M B;  1NP8 A;  2KAY A;  2COL B;  1F54 A;  2L98 A;  2QEB A;  4OKH A;  5CSI A;  4PDZ A;  2K2A A;  1DJX A;  5JJG A;  1IKU A;  2PVB A;  3PAT A;  2M29 A;  1XFY O;  3I5G C;  1QLS A;  4P2Y B;  1OMR A;  2WCF A;  2ISD A;  1NX2 A;  2JPO A;  1CDN A;  2O5G A;  4INW A;  5HL1 A;  1CDL A;  3NGV A;  4MZJ A;  2LLS A;  3CZ2 A;  1B8R A;  1SCV A;  4CFQ A;  2FCD A;  1V1F A;  4C0K A;  1HT9 A;  1DC1 A;  4HRG A;  3B88 A;  2KFF A;  2L2E A;  4I5L B;  5I2Q A;  1SK6 D;  2BAP A;  2KI6 D;  2LCP A;  1IG5 A;  1N65 A;  3HCM A;  3AKA A;  4DS7 A;  1DEK A;  1CM1 A;  2CT9 A;  3SG4 A;  1TNX A;  3GOF A;  1BR1 B;  2MLF C;  4DUQ A;  4HRE E;  1EH2 A;  2KSP A;  2P71 A;  2KDH A;  1KK8 C;  2BKH B;  4NDD A;  4GPL B;  2KOT A;  1B47 A;  1HQV A;  1KFU L;  2L51 A;  2CNP A;  2WCB A;  3R72 A;  4M2Q A;  1IJ6 A;  5D7F A;  5G08 A;  3S0B A;  4GGN A;  4GUK A;  4C0L A;  1F4Q A;  2GTE A;  3AKB A;  3E3R A;  1JSA A;  2WC6 A;  1FPW A;  4F0Z B;  1A75 B;  3CZ0 A;  2OPO A;  3QRX A;  2R2I A;  3BOW B;  1QIV A;  2LAP A;  2M1U A;  4PHN A;  3OP0 A;  1FF1 A;  1CFF A;  2GV5 A;  1S26 D;  1K9U A;  1MQ1 A;  3LK1 A;  4F7F A;  4QJ3 B;  1XK4 C;  3CTN A; 
#chains in the Genus database with same CATH homology
 1K9P A;  3VRR A;  3O4Y A;  1CFC A;  1PK0 D;  1XVJ A;  1YRT B;  2JNF A;  3SG5 A;  1UHK A;  2JT0 A;  2JXC A;  1MR8 A;  1QX7 A;  3BXK A;  3A4U B;  3NSI A;  4MLW A;  2IS9 A;  2ZNE A;  1AP4 A;  1TNQ A;  1UHI A;  1SNL A;  1WDC C;  2LMV A;  4I5N B;  2CBL A;  1K8U A;  2LMU A;  3D0Y A;  1K93 D;  1LIN A;  4YGE B;  4I5K A;  2OTG B;  3GK1 A;  2EC6 B;  3SIB A;  4ICB A;  3CWG A;  1NX0 A;  2G9B A;  1RFJ A;  4IL1 A;  1NCY A;  3WXA A;  1H8B A;  2BCX A;  1GGZ A;  1KWO B;  3TDU A;  1AJ4 A;  1IH0 A;  1MHO A;  2K7B A;  4CPV A;  1DMO A;  1RRO A;  5TNC A;  2F2O A;  2MJW B;  3CR2 A;  2KGR A;  4WQ3 A;  3SG3 A;  1DF0 B;  3CR4 X;  1KQV A;  2M8U A;  1RK9 A;  5KU1 A;  1QTX A;  1U5I B;  2ZND A;  4GFT A;  1C07 A;  2LAN A;  4OR9 B;  2ZN9 A;  1KFX L;  2MHH A;  3DVK A;  1AUI B;  1IQ5 A;  2KNE A;  5D69 A;  1ZFS A;  3PSR A;  1YR5 A;  4GAO A;  2LP2 A;  1W7J B;  3KEV A;  1CLL A;  2OS8 C;  2M9G A;  2G2B A;  2SCP A;  1EJ3 A;  2WND A;  4DCK A;  2JZI A;  5KSZ A;  1B4C A;  2JUL A;  3PLF B;  1BOC A;  1G33 A;  1SCM B;  1DJH A;  2BE6 A;  1NIW A;  3I5I C;  3VGO A;  4JWQ A;  2I94 A;  5BPJ A;  1A2X A;  1KQM C;  5K89 A;  2QPT A;  3BYA A;  5DKN A;  2E30 A;  1DJY A;  2F3Y A;  2SAS A;  3RM1 A;  1XFW O;  5HKY A;  1N2D A;  5KTY A;  4XYN A;  4N1G A;  2EC6 C;  1UP5 A;  3LCP C;  5I2O A;  1TCF A;  2I7A A;  1X02 A;  3JVT C;  4PHK A;  1PRW A;  1BJF A;  4OV2 A;  4GGF C;  4DRW A;  1CTR A;  2M49 B;  1TOP A;  2NXQ A;  2JRF A;  2LE9 B;  1NX3 A;  1GJY A;  5CSN A;  2MBX A;  1UHN A;  2KFH A;  1DF0 A;  4USL A;  5AEQ A;  3VRO A;  1U5I A;  2MA2 A;  4M2P A;  4MRX A;  1TN4 A;  1CLB A;  1SW8 A;  2H61 C;  2WOR A;  3TUY C;  1A03 A;  4HRH A;  4ZCV A;  1A4P A;  1REC A;  2GGZ A;  4C0J A;  3BQ3 A;  1F4O A;  3PN7 C;  1MWN A;  2JNX A;  1K9K A;  3LLE A;  4CID A;  1LA3 A;  1JWD A;  2KGB C;  1QS7 A;  1SCM C;  2P6B B;  3FIA A;  4FTG A;  3FWB A;  1JFJ A;  1DJZ A;  3JTD B;  1CFD A;  1M31 A;  3DD4 A;  1B7T Z;  2I18 A;  3H4S E;  4NDB A;  4PCW A;  4U8D A;  1E8A A;  3WNX B;  1FW4 A;  1CMF A;  4E68 A;  2KFG A;  2L0P A;  1Q80 A;  4GBA A;  1MUX A;  4PE4 A;  4BY5 A;  1B8L A;  2KI4 C;  2BBM A;  1S1E A;  3ZNI A;  1KCY A;  2FCE A;  1SR6 B;  2JT3 A;  4NDC A;  1L7Z A;  2NCO A;  3D0Y B;  2QAC A;  1C7V A;  1YUT A;  2BKI B;  4ORB B;  1H4B A;  2ZKM X;  1J7O A;  2KBI A;  2LLT A;  1CNP A;  2LHI A;  1PUL A;  4MEW A;  3D10 A;  1QV1 A;  1K94 A;  1BF5 A;  3OX6 A;  2I2R E;  2NZ0 A;  2KYF A;  1UUS A;  3K21 A;  1QX2 A;  1QAT A;  1QLK A;  1R6P A;  2TN4 A;  3VRN A;  2K0J A;  2HQ8 A;  1AK8 A;  1BOD A;  3EVU A;  3M0W A;  1GGW A;  1KSO A;  2BCA A;  2LC5 A;  1TNW A;  1OZS A;  1M45 A;  4NQG A;  1ZMZ A;  3AAJ A;  2VRG A;  1SPY A;  2LM5 A;  4YBH B;  3TZ1 A;  2Y1M A;  1YVH A;  1EXR A;  3GK4 X;  2DOQ A;  1RTP 1;  1YX8 A;  3HX4 A;  1J55 A;  1SR6 C;  2KYC A;  1MXE A;  1NCZ A;  1J1E A;  1S6C A;  1B1G A;  2GGM A;  1QAS A;  3DF0 A;  4YGA A;  4A4C A;  1UUR A;  3I5F B;  1AHR A;  1J7R A;  4P5O E;  1OZO A;  2L50 A;  2JU0 A;  3I5H B;  1GQM A;  1YRU B;  2LHL A;  3BUO B;  3ICB A;  1NWD A;  3IF7 A;  2KI6 C;  3TS5 B;  1XO5 A;  1NPQ A;  1M63 B;  3PAL A;  4TNC A;  4DIR A;  1WRL A;  3WHU B;  2Y4Q A;  5B8I B;  2ZN8 A;  5AFP A;  4ETO A;  4YGC B;  1OSA A;  1EL4 A;  4MBE A;  1KK7 Z;  1PSR A;  5GQQ C;  1W7I B;  4HSZ A;  2PAS A;  1S5G Y;  2L4I A;  4JQ0 D;  1J7Q A;  1NYA A;  4ORA B;  3BUN B;  3TDI A;  2JWW A;  3OB1 B;  1WLM A;  2OTG C;  4MSP A;  1SYM A;  3PFV A;  4YGB B;  1Y6W A;  1FBV A;  4PHJ A;  4MZK A;  1JF0 A;  1KWO C;  1ZOT B;  3TDZ A;  3O2P A;  1WY9 A;  1QVI Z;  4GNK B;  4MVF A;  4WQ2 A;  1LVC D;  1NCX A;  1K95 A;  2K7D A;  3SG6 A;  4XJK B;  3I5H C;  3O78 A;  1KFU S;  1DJG A;  3WHT B;  4D1E A;  3TS5 C;  1XA5 A;  2AAO A;  2K2F A;  1IRJ A;  1DVI A;  1RWY A;  2PRU A;  3CGA A;  1SBJ A;  1CM4 A;  1NSH A;  1TTX A;  2M1K B;  4OVN F;  1IGV A;  2NLN A;  1JC2 A;  5HLV A;  1J1D A;  1VRK A;  3A8R A;  2EHB A;  1DJI A;  2JOJ A;  1C7W A;  1XFZ O;  2KQ6 A;  4ORC B;  1SRA A;  4PE0 A;  1SMG A;  4WRI A;  1TIZ A;  2L5X B;  1OOJ A;  2MAZ A;  3FS7 A;  2JPT A;  2KQY A;  2WOS A;  1OQP A;  2BE4 A;  2LVK A;  1OMV A;  1KK8 B;  1WRZ A;  4AQJ A;  4AOM A;  1QXP A;  1IQ3 A;  2JXL A;  2HPS A;  4CFR A;  1G8I A;  1N0Y A;  2H61 A;  1M39 A;  2F8P A;  1ODB A;  3VRQ A;  2JT8 A;  2L4H A;  1S6J A;  5IBW A;  3OHM B;  4JPZ B;  3BUX B;  5DKQ A;  4FQO A;  2PAL A;  5HYD A;  4YGD B;  3ZWH A;  2K61 A;  1SL8 A;  1WRK A;  1Y1X A;  5JOL A;  3KO0 A;  3KPX A;  4PE1 A;  3DVE A;  2ZFD A;  3DVM A;  4XJK A;  1CDP A;  2F33 A;  1QIW A;  3DF0 B;  3CLN A;  4OCI A;  1CB1 A;  2Q91 A;  1ZUZ A;  2JC2 A;  2H2K A;  2ZRS A;  4UPG A;  1Y1U A;  1S3P A;  2A4J A;  3NSO A;  2PSR A;  2JTT A;  2K7O A;  1DGU A;  2M0R A;  1CFP A;  2O60 A;  1XYD A;  1Y1A A;  4M2O A;  1WDC B;  3NXA A;  1FI5 A;  2KBM A;  2BCB A;  1BR4 B;  1JUO A;  1EG4 A;  2AUC A;  2CXJ A;  3O6B A;  1KFX S;  3LK0 A;  3KHE A;  2LVV A;  4YI9 A;  1TNP A;  3JTD C;  5ER4 X;  3CS1 A;  1NUB A;  2HF5 A;  2MRD A;  3SIA A;  3NSL A;  3VRP A;  3SJS A;  3SG2 A;  4N5X A;  3SG7 A;  1CMG A;  2M7N A;  1F70 A;  3F45 A;  1JSA A;  1OMD A;  1BLQ A;  1XFV O;  3AAK A;  1BMO A;  1TCO B;  1YUU A;  1TRF A;  3KF9 A;  1Y0V H;  2BL0 B;  1FI6 A;  3EK4 A;  2LUX A;  3GK2 A;  5CSF A;  5I8N A;  2JQ6 A;  1D1O A;  2JTZ A;  2LV7 A;  2M3W A;  5FYX A;  4BY4 A;  2BBN A;  3C1V A;  2NCP A;  5J3X A;  1JF2 A;  1XK4 A;  2D8N A;  3BUM B;  2WCE A;  5HLO A;  1ZAC A;  2OS8 B;  3CZT X;  4PHM A;  1J7P A;  1DTL A;  1BT6 A;  1WLZ A;  2LVI A;  2PMY A;  3DVJ A;  1K96 A;  4L9M A;  3I5I B;  1JBA A;  1G4Y R;  1ALW A;  1KQM B;  1SL9 A;  1YVL A;  2KHN A;  2RGI A;  2Y1N A;  1PVA A;  4PAL A;  2B1U A;  1V1G A;  2K7C A;  1IWQ A;  2E6W A;  1XFX O;  5PAL A;  2Q4U A;  1BG1 A;  5HKZ A;  2CCM A;  1B8C A;  1CLM A;  1KK7 Y;  3EK8 A;  2V53 A;  2LUC A;  3IQQ A;  2M97 A;  5ER5 A;  3JVT B;  5HKW A;  1F55 A;  1LKJ A;  1AJ5 A;  1MXL C;  1S6I A;  1YUS A;  4R1E A;  1KSM A;  4Q04 A;  5DKR A;  1YUR A;  1K2H A;  1A75 A;  1S36 A;  1YTZ C;  2Y5I A;  3BOW A;  3IQO A;  1IJ5 A;  1EG3 A;  4MZL A;  1CKK A;  2LVJ A;  2BL0 C;  5CPV A;  3PM8 A;  3TUY B;  5AER A;  1DGV A;  1L2O B;  1PAL A;  1QVI Y;  1BU3 A;  1LXF C;  1UWO A;  1QX5 B;  2HET A;  2FOT A;  3EKH A;  1DJW A;  3I5F C;  2F2P A;  1R2U A;  1UHJ A;  3PN7 B;  3RLZ A;  4QJ5 B;  1K90 D;  3OX5 A;  3EVV A;  2HQW A;  3I5G B;  2WC8 A;  4QJ4 B;  2LMT A;  1NX1 A;  5AAN A;  3EVR A;  4MN0 A;  2KAV A;  3LL8 B;  4ZCU A;  1PSB A;  4MRY A;  1MF8 B;  2F3Z A;  2EGD A;  1QV0 A;  4YI8 A;  3NSK A;  2MLE C;  1QJT A;  1CDM A;  3MSE B;  2LNK A;  5AXI A;  4I5J A;  2ZRT A;  5CSJ A;  1OE9 B;  1S5G Z;  1UHH A;  1XFU O;  3CR5 X;  1SL7 A;  3OB2 B;  1B9A A;  3EKJ A;  2LLU A;  1YX7 A;  2FJU B;  1SKT A;  2AMI A;  2KAX A;  2M7L A;  4GGF A;  1JFK A;  1AVS A;  1SY9 A;  2KI4 B;  3BUW B;  5F6T A;  4CLN A;  1B7T Y;  1ALV A;  1LA0 A;  1RJV A;  1M46 A;  2LP3 A;  5I2L A;  1PVB A;  4N1F A;  3FWC A;  1F8H A;  4YRU A;  1DT7 B;  4PE7 A;  3EK7 A;  4AQI A;  1F71 A;  2CTN A;  4A4B A;  1L2O C;  2BEC A;  1A29 A;  2K8M B;  1NP8 A;  2KAY A;  2COL B;  1F54 A;  2L98 A;  4OKH A;  5CSI A;  4PDZ A;  2K2A A;  1DJX A;  5JJG A;  1IKU A;  2PVB A;  3PAT A;  2M29 A;  1XFY O;  3I5G C;  1QLS A;  4P2Y B;  1OMR A;  2WCF A;  2ISD A;  1NX2 A;  1CDN A;  2O5G A;  1CDL A;  4MZJ A;  2LLS A;  1B8R A;  1SCV A;  4CFQ A;  2FCD A;  1V1F A;  4C0K A;  1HT9 A;  4HRG A;  2KFF A;  2L2E A;  4I5L B;  5I2Q A;  1SK6 D;  2KI6 D;  2LCP A;  1IG5 A;  1N65 A;  3HCM A;  3AKA A;  4DS7 A;  2CT9 A;  1CM1 A;  3SG4 A;  1TNX A;  3GOF A;  1BR1 B;  2MLF C;  4DUQ A;  4HRE E;  1EH2 A;  2KSP A;  2KDH A;  1KK8 C;  2BKH B;  4NDD A;  4GPL B;  2KOT A;  1B47 A;  1HQV A;  1KFU L;  2L51 A;  2CNP A;  2WCB A;  4M2Q A;  5D7F A;  1IJ6 A;  5G08 A;  4GGN A;  4GUK A;  4C0L A;  1F4Q A;  3AKB A;  3E3R A;  1FPW A;  4F0Z B;  1A75 B;  2OPO A;  3QRX A;  2R2I A;  3BOW B;  1QIV A;  2LAP A;  2M1U A;  4PHN A;  3OP0 A;  1FF1 A;  1CFF A;  2GV5 A;  1S26 D;  1K9U A;  1MQ1 A;  3LK1 A;  4QJ3 B;  1XK4 C;  3CTN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...