1YRUB

Crystal structure analysis of the adenylyl cyclaes catalytic domain of adenylyl cyclase toxin of bordetella pertussis in presence of c-terminal calmodulin and 1mm calcium chloride
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
69
structure length
69
Chain Sequence
TDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Layse, toxin
molecule keywords Bifunctional hemolysin-adenylate cyclase
publication title Structural basis for the interaction of Bordetella pertussis adenylyl cyclase toxin with calmodulin
pubmed doi rcsb
source organism Bordetella pertussis
total genus 20
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2005-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1yruB00
4ORCB 4PE7A 1NX3A 1BR1B 1J7QA 3WHUB 2Q4UA 2KHNA 4GGFC 5J3XA 3PSRA 4JQ0D 1XO5A 1NCYA 2H61C 2HQWA 1DGUA 3GOFA 1SNLA 3O4YA 2BBNA 2KGRA 3NSKA 5AFPA 2KGBC 3A8RA 3CS1A 1YUTA 1KFXL 3CR5X 1OE9B 2LP3A 2MHHA 1UHIA 4I5LB 2LAPA 5D69A 3EKHA 3SG5A 3DVEA 1MHOA 2K2AA 3OP0A 4I5KA 1GJYA 1QLKA 2L4HA 2Q91A 3FWBA 1QX2A 2H61A 1K95A 4JPZB 3DD4A 2F2PA 4MBEA 1UWOA 3MSEB 2LC5A 2I94A 4OV2A 2HF5A 4CFQA 3CZTX 3A4UB 2PASA 4QJ3B 1S1EA 1QXPA 1KK7Y 1NIWA 3TDIA 1L7ZA 1RJVA 1IJ5A 3I5HC 3WHTB 2F3ZA 2GGMA 1NSHA 1ZUZA 2F2OA 1J7PA 2KBIA 4YRUA 1K9UA 1BLQA 1KFUL 2ZKMX 5DKQA 2ZN9A 3LLEA 3WNXB 2A4JA 1CKKA 1MUXA 3PM8A 1OQPA 5JJGA 2LCPA 1J1EA 2KYCA 3K21A 1XFZO 1BG1A 3PLFB 4CPVA 1BODA 3DVJA 2JT8A 5HYDA 2AMIA 2WOSA 3I5IC 2LMUA 4NDBA 1CTRA 1KK8C 2FOTA 1WRZA 2KAYA 1FI5A 2NZ0A 4P2YB 4MEWA 1L2OC 2HPSA 3SIBA 4TNCA 5HLVA 5I2OA 4GAOA 2LMTA 1EJ3A 1C07A 3D10A 3VGOA 2LM5A 1M31A 1M45A 1CMFA 1WLMA 1QX7A 2JXCA 4CFRA 1OMDA 1KFUS 1FBVA 3PALA 1S26D 2KBMA 1KK8B 1K94A 1DJWA 2JTTA 2MA2A 1U5IA 5HLOA 1MXEA 2OS8C 1QLSA 1K9KA 2WNDA 2K7OA 2JPTA 2V53A 1CDPA 1L2OB 1ODBA 1U5IB 1DGVA 3BOWB 4GFTA 2JNXA 1IG5A 1H4BA 3SG4A 1RK9A 4HSZA 5AXIA 4YGDB 2QPTA 1FW4A 4A4CA 2KQYA 2H2KA 3TUYB 2K8MB 3VRRA 2K7BA 3KHEA 1S6JA 2B1UA 2OS8B 4M2PA 1JWDA 1EH2A 2M7NA 4GNKB 4N5XA 2QACA 2LVKA 1UUSA 2CTNA 1SK6D 1XFXO 1TTXA 2BECA 2F33A 1TCOB 1CFDA 1IJ6A 1S36A 1RROA 4GBAA 4ORAB 1Q80A 1A75A 1B7TY 3CR2A 4IL1A 3BXKA 2KI6D 1A03A 1G8IA 1A75B 2MRDA 4NDDA 3DF0A 4XJKA 1KCYA 2ZFDA 3GK1A 3LK1A 2GGZA 3DF0B 1PSBA 4XJKB 3O78A 1OZSA 2M3WA 5B8IB 1B4CA 4R1EA 3OB1B 1KQMC 1RWYA 1EG4A 1CDNA 1HQVA 4ICBA 3LL8B 1FPWA 4FQOA 1SKTA 3SIAA 2ZNDA 1K8UA 3CTNA 2P6BB 1K2HA 1KQVA 1SYMA 2KNEA 1KSMA 2KI4B 4GGFA 3SJSA 1PK0D 3ZWHA 1TOPA 1C7WA 4NDCA 1CLBA 3EK4A 1SCVA 1KQMB 1BT6A 1B47A 2LMVA 4AOMA 4DCKA 1ZOTB 3NSOA 2JU0A 4DS7A 2JC2A 3BUOB 1PALA 4HRGA 2IS9A 1QATA 5I2QA 3CWGA 2BCBA 1S3PA 1AJ5A 1JC2A 1XFUO 4MRYA 1KK7Z 4PE4A 3AAKA 1CLLA 2KOTA 1DT7B 4M2QA 2LVIA 4L9MA 1WY9A 1F4QA 2JOJA 1SCMC 4YI8A 1F55A 4I5NB 1Y0VH 3VROA 1CNPA 1FI6A 5I8NA 4QJ4B 1K9PA 1A29A 1QX5B 2F3YA 5BPJA 1SL9A 2KSPA 2O5GA 3PFVA 1X02A 3CGAA 2KFGA 1TNWA 3FS7A 2LANA 1DF0A 1CFFA 2LLTA 3C1VA 2KFHA 1KFXS 2PALA 2R2IA 2OPOA 5CSNA 1DF0B 1M39A 3JVTC 4PHKA 4E68A 1YR5A 2L50A 3PATA 1WRLA 1ALWA 1J7RA 1DJZA 1UHJA 1N0YA 4ETOA 1SCMB 2MBXA 1SL7A 3H4SE 1IRJA 4P5OE 1JF0A 3NSIA 1A4PA 4BY4A 4WQ2A 2D8NA 1QS7A 2AUCA 4Q04A 3EK8A 1XYDA 1V1FA 1MR8A 1SL8A 1JSAA 1AP4A 4OR9B 1EL4A 1YX7A 2TN4A 2MLEC 3JVTB 2JXLA 2L0PA 2LNKA 2LUCA 3TZ1A 1TN4A 2LHLA 1K93D 4DRWA 1WDCC 1QV1A 4PE0A 1N2DA 3OX5A 4F0ZB 1F70A 1GGZA 1KSOA 1CDLA 2MJWB 1PSRA 3FIAA 3KF9A 1QVIZ 4UPGA 3TUYC 5I2LA 1MQ1A 2HETA 5KTYA 2BKHB 1WRKA 4N1GA 2L98A 5AERA 1R6PA 1H8BA 3BOWA 1YUUA 3LK0A 4AQIA 1LXFC 1S6CA 2MLFC 4QJ5B 1CMGA 1F8HA 4OVNF 1IQ3A 2E6WA 1WDCB 4PE1A 2WCFA 4OKHA 1J55A 1R2UA 2M1KB 1XVJA 2SASA 4MSPA 1EXRA 3DVKA 2Y5IA 2COLB 1DTLA 2GV5A 2LE9B 2FCDA 4MVFA 3GK4X 4WRIA 1A2XA 1NWDA 1D1OA 4MN0A 1YRTB 2CT9A 4C0LA 1NCXA 1M46A 2CXJA 1DJGA 1B7TZ 2KYFA 3IF7A 2M8UA 5CPVA 4WQ3A 3TS5C 4I5JA 1GQMA 1XFYO 1YVLA 1SY9A 2JT0A 2L4IA 1TIZA 1M63B 3BUWB 2E30A 3AKBA 2DOQA 2EHBA 3NSLA 4CLNA 2NCOA 5KSZA 2NCPA 5ER4X 2BL0C 2KI4C 2JZIA 3IQOA 1SRAA 2RGIA 2ZRSA 1UP5A 2CNPA 1BF5A 1QTXA 3NXAA 1F54A 2BE4A 2CBLA 3TS5B 4PHMA 4YGBB 3TDZA 2JWWA 1YVHA 1CB1A 3EVVA 4YGEB 2EGDA 3BUNB 1B1GA 5PALA 1Y1UA 1S5GY 5IBWA 4C0JA 2KAXA 4CIDA 2NXQA 1HT9A 1TNXA 4NQGA 1SR6C 2BL0B 1Y1XA 2I2RE 2VRGA 2K2FA 5TNCA 1NCZA 1RFJA 5KU1A 1BMOA 5G08A 3RLZA 4YGAA 1MWNA 2HQ8A 1NP8A 3KPXA 4PDZA 1PRWA 2I18A 3OHMB 2L51A 1IGVA 5CSJA 2BCXA 2MAZA 2L2EA 3E3RA 1AK8A 1LINA 2K7CA 1TRFA 2Y4QA 1JF2A 1QIWA 1SMGA 1F71A 4GPLB 1TCFA 2LVVA 1SR6B 1IQ5A 5DKRA 2KI6C 3AKAA 2M7LA 3OX6A 1OOJA 4PHJA 1NX0A 1F4OA 4MZJA 5CSFA 1ZMZA 3CR4X 1NPQA 1CFCA 2PVBA 1OZOA 2K7DA 4AQJA 1UHKA 2G9BA 1BOCA 1J7OA 1E8AA 1YRUB 1B8LA 5AEQA 1DJHA 1YTZC 2NLNA 4N1FA 5AANA 4D1EA 3I5GC 4JWQA 1B8CA 3D0YA 4GGNA 5HKYA 3I5FC 1S6IA 1QASA 3D0YB 4ZCVA 1IKUA 3ZNIA 2JTZA 4PHNA 2M9GA 4YI9A 1GGWA 2JNFA 4HRHA 2K61A 1JUOA 1LVCD 4MZKA 2BKIB 1QJTA 2Y1MA 1XFVO 2M0RA 2LLUA 2M49B 2G2BA 1J1DA 1MXLC 4HREE 1NX2A 1PVBA 1DVIA 1FF1A 4PCWA 1CLMA 1XK4C 4DUQA 2KAVA 1KWOC 2WC8A 1UHHA 2JT3A 1QV0A 3I5GB 3JTDC 2PSRA 3O6BA 2AAOA 2KFFA 2M97A 3EK7A 3O2PA 2K0JA 3I5FB 4A4BA 2FJUB 1LA3A 3QRXA 1CFPA 1JFJA 3VRNA 2WCBA 3GK2A 3HCMA 5JOLA 5FYXA 3EKJA 2PRUA 1BU3A 1IWQA 2O60A 1AHRA 2ZN8A 1JFKA 1DMOA 2JQ6A 3F45A 3I5HB 3PN7C 1RTP1 1XK4A 2BCAA 1LKJA 1RECA 2M29A 2WCEA 5CSIA 3RM1A 4C0KA 3WXAA 5ER5A 2PMYA 1EG3A 3EVRA 2BBMA 3IQQA 3VRQA 2ZRTA 2LVJA 4FTGA 1KWOB 1PVAA 3JTDB 1CDMA 2LLSA 2LV7A 3KO0A 1AUIB 1G4YR 1CM1A 3BYAA 1JBAA 5F6TA 1B8RA 1OSAA 4OCIA 2I7AA 1N65A 5HKZA 3PN7B 1K96A 4XYNA 3I5IB 4YBHB 1BJFA 3SG6A 1LA0A 2LUXA 2SCPA 1SPYA 1W7IB 1YUSA 1YX8A 1ZACA 1K90D 2OTGC 3KEVA 5HKWA 1QVIY 1UHNA 1XA5A 2Y1NA 5K89A 4DIRA 1V1GA 2KDHA 5GQQC 1AJ4A 1DJXA 1B9AA 1DJYA 2FCEA 3HX4A 3AAJA 4YGCB 4MZLA 1OMRA 1UURA 4MRXA 4U8DA 4ZCUA 4BY5A 2F8PA 1G33A 3TDUA 3SG3A 4USLA 1W7JB 3FWCA 4ORBB 3SG7A 1NX1A 1ZFSA 3SG2A 1Y6WA 1MF8B 2WORA 2ZNEA 5DKNA 4MLWA 1QIVA 2CCMA 3OB2B 2OTGB 3BQ3A 3M0WA 4M2OA 1SBJA 1PULA 1YURA 2EC6C 1XFWO 1Y1AA 3DVMA 3LCPC 1DJIA 1OMVA 1VRKA 2LP2A 1NUBA 3CLNA 1ALVA 1TNPA 2JRFA 1BR4B 3ICBA 3VRPA 1S5GZ 1IH0A 1TNQA 2KQ6A 2BE6A 2M1UA 4PALA 2LHIA 1SW8A 4GUKA 1NYAA 5D7FA 1AVSA 3BUXB 2L5XB 2ISDA 1CM4A 3BUMB 3EVUA 1C7VA 2EC6B 2JULA 1WLZA
chains in the Genus database with same CATH superfamily
4ORCB 4PE7A 1NX3A 1BR1B 1DELA 2QEBA 2Q4UA 2KHNA 4GGFC 5J3XA 3WHUB 1J7QA 5FI6A 3PSRA 4JQ0D 2WCJA 1XO5A 1NCYA 2H61C 2L5YA 2HQWA 1DGUA 1Z2CB 3GOFA 1SNLA 3O4YA 2BBNA 2KGRA 3NSKA 5AFPA 2KGBC 3A8RA 3CS1A 1YUTA 1KFXL 3CR5X 1OE9B 2LP3A 2MHHA 1UHIA 3L4LA 2LAPA 4I5LB 5D69A 3EKHA 3SG5A 3DXLA 1GM0A 3DVEA 1MHOA 2K2AA 3CYZA 3OP0A 1GJYA 1QLKA 2L4HA 2Q91A 4I5KA 3FWBA 4F7FA 1QX2A 2H61A 1K95A 4JPZB 3DD4A 2F2PA 4MBEA 1UWOA 3MSEB 3Q8IA 3VB1A 2LC5A 2I94A 4OV2A 2HF5A 2KLEA 3CZTX 4CFQA 3A4UB 2PASA 4QJ3B 3NGVA 1C3YA 1S1EA 1QXPA 1KK7Y 1NIWA 3TDIA 3CABA 3QMEA 1L7ZA 1RJVA 1IJ5A 3I5HC 3WHTB 2F3ZA 2GGMA 3D77A 1NSHA 1ZUZA 2F2OA 1ORGA 1J7PA 2KBIA 4YRUA 1K9UA 1BLQA 1KFUL 2ZKMX 5DKQA 2ZN9A 3LLEA 3OBVA 3WNXB 2A4JA 1CKKA 3OGNA 1MUXA 3PM8A 1OQPA 5JJGA 2LCPA 2SCPA 1J1EA 2KYCA 3K21A 1XFZO 3D76A 2P70A 3PLFB 4CPVA 1BG1A 1BODA 3DVJA 2JT8A 5HYDA 2AMIA 2WOSA 3I5IC 2LMUA 2PQLA 4NDBA 1CTRA 1KK8C 2FOTA 1WRZA 2KAYA 1FI5A 2NZ0A 4P2YB 3CZ0A 5FI7A 4MEWA 1L2OC 2HPSA 3SIBA 2WC6A 3L4AA 4TNCA 1XFRA 5HLVA 5I2OA 4GAOA 2LMTA 1EJ3A 1C07A 3D10A 3VGOA 2LM5A 1M31A 1M45A 3R1PA 1CMFA 1WLMA 2P71A 1QX7A 2JXCA 4CFRA 1OMDA 1KFUS 1FBVA 3PALA 5DICA 1S26D 2KBMA 3UNWA 1KK8B 1K94A 1DJWA 2JTTA 3D75A 2MA2A 1U5IA 5HLOA 1MXEA 2OS8C 1GGWA 1QLSA 1K9KA 2WNDA 5I94A 2K7OA 2JPTA 2V53A 1CDPA 1L2OB 1ODBA 1U5IB 1DQEA 3S0BA 2K60A 1DGVA 3BOWB 4GFTA 2JNXA 1IG5A 1H4BA 3SG4A 1RK9A 4HSZA 5AXIA 4YGDB 2QPTA 2QEOA 1FW4A 4A4CA 2KQYA 2H2KA 3TUYB 2K8MB 3VRRA 2K7BA 3KHEA 1S6JA 2B1UA 2OS8B 4INXA 4M2PA 1JWDA 1EH2A 2M7NA 4GNKB 4N5XA 2QACA 2LVKA 1UUSA 3V2LA 2CTNA 1SK6D 5FI2A 1XFXO 1TTXA 2BECA 2F33A 1OW4A 1TCOB 1CFDA 1IJ6A 1S36A 1RROA 2WCMA 4GBAA 4ORAB 1Q80A 1A75A 1B7TY 3CR2A 3O4XA 3BXKA 4IL1A 5D3OA 2KI6D 1A03A 1G8IA 1A75B 2MRDA 4NDDA 4FQTA 3DF0A 2KPHA 2YGUA 4XJKA 1KCYA 2ZFDA 3GK1A 3LK1A 2GGZA 3DF0B 1PSBA 1SSEB 4XJKB 3O78A 1OZSA 2M3WA 5B8IB 1DC1A 4R1EA 3OB1B 1KQMC 1RWYA 1B4CA 1EG4A 1CDNA 1HQVA 4ICBA 3LL8B 2QDIA 1FPWA 4FQOA 1SKTA 3SIAA 2ZNDA 1K8UA 3CTNA 3FE6A 2P6BB 1K2HA 1KQVA 1SYMA 2KNEA 3FE8A 1KSMA 2KI4B 4GGFA 3SJSA 1PK0D 3ZWHA 1P28A 1TOPA 3B87A 3R72A 1C7WA 4NDCA 1CLBA 3EK4A 1SCVA 1KQMB 3S0AA 3BFHA 1BT6A 1B47A 2LMVA 3B6XA 4AOMA 4DCKA 1ZOTB 3NSOA 2JU0A 4DS7A 2JC2A 3BUOB 1PALA 4HRGA 2IS9A 1QATA 5I2QA 3CWGA 2BCBA 3D73A 2WCHA 1S3PA 1AJ5A 3SS5A 1JC2A 1T14A 1XFUO 4MRYA 4INWA 1KK7Z 4PE4A 3AAKA 1CLLA 2KOTA 1DT7B 4M2QA 2LVIA 4L9MA 1WY9A 1F4QA 2JOJA 1SCMC 4YI8A 1F55A 4I5NB 1Y0VH 3VROA 1CNPA 1FI6A 5I8NA 4QJ4B 1K9PA 1A29A 1QX5B 2F3YA 5BPJA 1SL9A 2KSPA 2O5GA 3PFVA 1X02A 3CGAA 2KFGA 1TNWA 3FS7A 2LANA 1DF0A 1CFFA 2LLTA 3C1VA 2KFHA 1KFXS 3L47A 2PALA 2R2IA 3UO9A 2OPOA 2QEHA 1DF0B 5CSNA 1M39A 3JVTC 2QEVA 4PHKA 4E68A 2ERBA 1YR5A 2L50A 3DY9A 3PATA 1WRLA 1ALWA 1J7RA 1DJZA 1QWVA 1UHJA 1N0YA 4ETOA 1SCMB 2MBXA 1SL7A 3CDNA 1IRJA 3H4SE 1JF0A 3NSIA 1A4PA 2BNXA 4P5OE 5HL1A 4BY4A 4WQ2A 2D8NA 1QS7A 2AUCA 4Q04A 3EK8A 1XYDA 1V1FA 1MR8A 1SL8A 1JSAA 1AP4A 4OR9B 1EL4A 1YX7A 2TN4A 2MLEC 3JVTB 2JXLA 2L0PA 2LNKA 2LUCA 3TZ1A 1TN4A 2LHLA 1K93D 1TUJA 3BFAA 4DRWA 3S0GA 1WDCC 1QV1A 4PE0A 1N2DA 3OX5A 4F0ZB 1F70A 1GGZA 1KSOA 1CDLA 2MJWB 1PSRA 3FIAA 3KF9A 1QVIZ 4UPGA 3TUYC 5I2LA 1MQ1A 2HETA 3RZSA 4PT1A 2BAPA 1Z4HA 5KTYA 2BKHB 1WRKA 4N1GA 2L98A 5AERA 1R6PA 1H8BA 3BOWA 1YUUA 3LK0A 1JFJA 4AQIA 3CZ1A 1LXFC 1S6CA 3B88A 2MLFC 4QJ5B 1CMGA 1F8HA 4OVNF 1IQ3A 2E6WA 1WDCB 4PE1A 2WCFA 4OKHA 1J55A 1R2UA 2M1KB 1XVJA 2SASA 4MSPA 1EXRA 3DVKA 2Y5IA 2COLB 1DEKA 1DTLA 2GV5A 2LE9B 2FCDA 4MVFA 3GK4X 4WRIA 1A2XA 1NWDA 1D1OA 4MN0A 1YRTB 2CT9A 4C0LA 2FJYA 1NCXA 1M46A 3R1OA 2CXJA 3S0FA 1DJGA 1B7TZ 2KYFA 3IF7A 2M8UA 5CPVA 4WQ3A 3TS5C 4I5JA 1GQMA 1XFYO 5EL2A 1YVLA 1SY9A 2JT0A 2L4IA 1TIZA 1M63B 3SS4A 3BUWB 2E30A 3AKBA 3O6BA 2DOQA 2EHBA 3NSLA 4CLNA 2NCOA 5KSZA 2NCPA 5ER4X 1IIOA 2KLDA 2BL0C 2KI4C 2JZIA 3IQOA 1SRAA 2RGIA 2ZRSA 1UP5A 2CNPA 1BF5A 1QTXA 3NXAA 1F54A 2BE4A 2CBLA 3TS5B 4PHMA 4YGBB 3TDZA 2JWWA 1YVHA 1CB1A 3EVVA 4YGEB 2EGDA 3BUNB 1B1GA 5PALA 1Y1UA 1S5GY 5IBWA 4C0JA 2KAXA 4CIDA 2NXQA 1HT9A 1TNXA 4NQGA 3B7AA 1SR6C 2BL0B 1Y1XA 2I2RE 2WCKA 2VRGA 2K2FA 5TNCA 4OZDA 1NCZA 1RFJA 5KU1A 1BMOA 5G08A 3RLZA 4YGAA 1MWNA 2HQ8A 1NP8A 3KPXA 4PDZA 1PRWA 2I18A 3OHMB 2L51A 1IGVA 5CSJA 2BCXA 3PJIA 2MAZA 2L2EA 3E3RA 1AK8A 1LINA 2K7CA 1TRFA 2Y4QA 1JF2A 1QIWA 1SMGA 3PM2A 4IJ7A 1F71A 4GPLB 1TCFA 2LVVA 1SR6B 3B86A 1IQ5A 5DKRA 2KI6C 3AKAA 2M7LA 3OX6A 1OOJA 4PHJA 1NX0A 1F4OA 4MZJA 2GTEA 5CSFA 1ZMZA 3CR4X 1NPQA 1CFCA 2PVBA 1OZOA 2K7DA 3FE9A 4AQJA 1UHKA 2G9BA 1BOCA 1J7OA 1E8AA 1YRUB 1B8LA 5AEQA 1DJHA 1YTZC 2NLNA 4N1FA 5AANA 4D1EA 3I5GC 4JWQA 1B8CA 3D0YA 4GGNA 5HKYA 3I5FC 1S6IA 1QASA 3D0YB 4ZCVA 4JKTA 3ZNIA 2JTZA 4PHNA 1TUZA 2M9GA 4YI9A 1IKUA 2JNFA 3N7HA 4HRHA 2K61A 1JUOA 1LVCD 4MZKA 2BKIB 1QJTA 2Y1MA 1XFVO 2M0RA 2LLUA 2M49B 2G2BA 1J1DA 1MXLC 4HREE 1NX2A 1PVBA 1DVIA 1C3ZA 1FF1A 4PCWA 1CLMA 1XK4C 4DUQA 2KAVA 1KWOC 2WC8A 1UHHA 2JT3A 1QV0A 3BFBA 3I5GB 2PSRA 3JTDC 2AAOA 2KFFA 2M97A 3EK7A 3O2PA 2K0JA 3S0DA 3I5FB 4A4BA 2FJUB 1LA3A 3QRXA 4KYNA 1CFPA 3VRNA 2WCBA 3GK2A 3HCMA 5JOLA 5FYXA 3EKJA 2PRUA 1BU3A 1IWQA 2O60A 1AHRA 2ZN8A 1JFKA 3D78A 2JQ6A 1DMOA 3F45A 3I5HB 3CZ2A 4JD9A 3PN7C 1RTP1 1XK4A 2BCAA 1LKJA 1RECA 2M29A 2WCEA 5CSIA 3RM1A 4C0KA 3DZTA 1OOGA 3WXAA 5ER5A 2PMYA 1EG3A 3EVRA 1OOFA 2BBMA 3IQQA 3S0EA 3VRQA 2ZRTA 2LVJA 4FTGA 1KWOB 3EG5B 1PVAA 3JTDB 1CDMA 2LLSA 2LV7A 3KO0A 1AUIB 1G4YR 1CM1A 3BYAA 1JBAA 5F6TA 1B8RA 1OSAA 4OCIA 2I7AA 1N65A 5HKZA 3PN7B 1K96A 4XYNA 3I5IB 4YBHB 1BJFA 3SG6A 1OOHA 1LA0A 2LUXA 2PYQA 1SPYA 1W7IB 1YUSA 1YX8A 1ZACA 1K90D 2OTGC 3K1EA 3KEVA 5HKWA 1QVIY 1UHNA 1XA5A 2Y1NA 5K89A 4DIRA 1V1GA 2KDHA 5GQQC 1AJ4A 1DJXA 1B9AA 1DJYA 1LS8A 2FCEA 2WCLA 3AAJA 3HX4A 3IVTA 4YGCB 4MZLA 1OMRA 1UURA 4MRXA 4U8DA 4ZCUA 4BY5A 2F8PA 2L2CA 1G33A 1OOIX 1W9ZA 3D74A 3TDUA 3DYEA 3SG3A 4USLA 1W7JB 3FWCA 4ORBB 3SG7A 1NX1A 1ZFSA 3SG2A 1Y6WA 1MF8B 2WORA 2ZNEA 5DKNA 4MLWA 1QIVA 2CCMA 3OB2B 3SS3A 2OTGB 3BQ3A 2JPOA 3M0WA 4M2OA 1SBJA 1PULA 1YURA 2H8VA 2EC6C 1XFWO 1Y1AA 3DVMA 3LCPC 1DJIA 1OMVA 1VRKA 2LP2A 1NUBA 3CLNA 3R1VA 1ALVA 1TNPA 2JRFA 3BJHA 1BR4B 3ICBA 3VRPA 1S5GZ 1IH0A 1TNQA 3NHTA 2KQ6A 2BE6A 3NHIA 2M1UA 4PALA 2LHIA 1SW8A 4GUKA 2WC5A 1NYAA 5D7FA 1AVSA 3BUXB 2L5XB 1TWOA 2ISDA 1CM4A 3BUMB 3EVUA 1C7VA 2EC6B 2JULA 1WLZA
chains in the Genus database with same CATH topology
4ORCB 4PE7A 1NX3A 1BR1B 1J7QA 3WHUB 2Q4UA 2KHNA 4GGFC 5J3XA 3PSRA 4JQ0D 1XO5A 1NCYA 2H61C 2HQWA 1DGUA 3GOFA 1SNLA 3O4YA 2BBNA 2KGRA 3NSKA 5AFPA 2KGBC 3A8RA 3CS1A 1YUTA 1KFXL 3CR5X 1OE9B 2LP3A 2MHHA 1UHIA 4I5LB 2LAPA 5D69A 3EKHA 3SG5A 3DVEA 1MHOA 2K2AA 3OP0A 4I5KA 1GJYA 1QLKA 2L4HA 2Q91A 3FWBA 1QX2A 2H61A 1K95A 4JPZB 3DD4A 2F2PA 4MBEA 1UWOA 3MSEB 2LC5A 2I94A 4OV2A 2HF5A 4CFQA 3CZTX 3A4UB 2PASA 4QJ3B 1S1EA 1QXPA 1KK7Y 1NIWA 3TDIA 1L7ZA 1RJVA 1IJ5A 3I5HC 3WHTB 2F3ZA 2GGMA 1NSHA 1ZUZA 2F2OA 1J7PA 2KBIA 4YRUA 1K9UA 1BLQA 1KFUL 2ZKMX 5DKQA 2ZN9A 3LLEA 3WNXB 2A4JA 1CKKA 1MUXA 3PM8A 1OQPA 5JJGA 2LCPA 1J1EA 2KYCA 3K21A 1XFZO 1BG1A 3PLFB 4CPVA 1BODA 3DVJA 2JT8A 5HYDA 2AMIA 2WOSA 3I5IC 2LMUA 4NDBA 1CTRA 1KK8C 2FOTA 1WRZA 2KAYA 1FI5A 2NZ0A 4P2YB 4MEWA 1L2OC 2HPSA 3SIBA 4TNCA 5HLVA 5I2OA 4GAOA 2LMTA 1EJ3A 1C07A 3D10A 3VGOA 2LM5A 1M31A 1M45A 1CMFA 1WLMA 1QX7A 2JXCA 4CFRA 1OMDA 1KFUS 1FBVA 3PALA 1S26D 2KBMA 1KK8B 1K94A 1DJWA 2JTTA 2MA2A 1U5IA 5HLOA 1MXEA 2OS8C 1QLSA 1K9KA 2WNDA 2K7OA 2JPTA 2V53A 1CDPA 1L2OB 1ODBA 1U5IB 1DGVA 3BOWB 4GFTA 2JNXA 1IG5A 1H4BA 3SG4A 1RK9A 4HSZA 5AXIA 4YGDB 2QPTA 1FW4A 4A4CA 2KQYA 2H2KA 3TUYB 2K8MB 3VRRA 2K7BA 3KHEA 1S6JA 2B1UA 2OS8B 4M2PA 1JWDA 1EH2A 2M7NA 4GNKB 4N5XA 2QACA 2LVKA 1UUSA 2CTNA 1SK6D 1XFXO 1TTXA 2BECA 2F33A 1TCOB 1CFDA 1IJ6A 1S36A 1RROA 4GBAA 4ORAB 1Q80A 1A75A 1B7TY 3CR2A 4IL1A 3BXKA 2KI6D 1A03A 1G8IA 1A75B 2MRDA 4NDDA 3DF0A 4XJKA 1KCYA 2ZFDA 3GK1A 3LK1A 2GGZA 3DF0B 1PSBA 4XJKB 3O78A 1OZSA 2M3WA 5B8IB 1B4CA 4R1EA 3OB1B 1KQMC 1RWYA 1EG4A 1CDNA 1HQVA 4ICBA 3LL8B 1FPWA 4FQOA 1SKTA 3SIAA 2ZNDA 1K8UA 3CTNA 2P6BB 1K2HA 1KQVA 1SYMA 2KNEA 1KSMA 2KI4B 4GGFA 3SJSA 1PK0D 3ZWHA 1TOPA 1C7WA 4NDCA 1CLBA 3EK4A 1SCVA 1KQMB 1BT6A 1B47A 2LMVA 4AOMA 4DCKA 1ZOTB 3NSOA 2JU0A 4DS7A 2JC2A 3BUOB 1PALA 4HRGA 2IS9A 1QATA 5I2QA 3CWGA 2BCBA 1S3PA 1AJ5A 1JC2A 1XFUO 4MRYA 1KK7Z 4PE4A 3AAKA 1CLLA 2KOTA 1DT7B 4M2QA 2LVIA 4L9MA 1WY9A 1F4QA 2JOJA 1SCMC 4YI8A 1F55A 4I5NB 1Y0VH 3VROA 1CNPA 1FI6A 5I8NA 4QJ4B 1K9PA 1A29A 1QX5B 2F3YA 5BPJA 1SL9A 2KSPA 2O5GA 3PFVA 1X02A 3CGAA 2KFGA 1TNWA 3FS7A 2LANA 1DF0A 1CFFA 2LLTA 3C1VA 2KFHA 1KFXS 2PALA 2R2IA 2OPOA 5CSNA 1DF0B 1M39A 3JVTC 4PHKA 4E68A 1YR5A 2L50A 3PATA 1WRLA 1ALWA 1J7RA 1DJZA 1UHJA 1N0YA 4ETOA 1SCMB 2MBXA 1SL7A 3H4SE 1IRJA 4P5OE 1JF0A 3NSIA 1A4PA 4BY4A 4WQ2A 2D8NA 1QS7A 2AUCA 4Q04A 3EK8A 1XYDA 1V1FA 1MR8A 1SL8A 1JSAA 1AP4A 4OR9B 1EL4A 1YX7A 2TN4A 2MLEC 3JVTB 2JXLA 2L0PA 2LNKA 2LUCA 3TZ1A 1TN4A 2LHLA 1K93D 4DRWA 1WDCC 1QV1A 4PE0A 1N2DA 3OX5A 4F0ZB 1F70A 1GGZA 1KSOA 1CDLA 2MJWB 1PSRA 3FIAA 3KF9A 1QVIZ 4UPGA 3TUYC 5I2LA 1MQ1A 2HETA 5KTYA 2BKHB 1WRKA 4N1GA 2L98A 5AERA 1R6PA 1H8BA 3BOWA 1YUUA 3LK0A 4AQIA 1LXFC 1S6CA 2MLFC 4QJ5B 1CMGA 1F8HA 4OVNF 1IQ3A 2E6WA 1WDCB 4PE1A 2WCFA 4OKHA 1J55A 1R2UA 2M1KB 1XVJA 2SASA 4MSPA 1EXRA 3DVKA 2Y5IA 2COLB 1DTLA 2GV5A 2LE9B 2FCDA 4MVFA 3GK4X 4WRIA 1A2XA 1NWDA 1D1OA 4MN0A 1YRTB 2CT9A 4C0LA 1NCXA 1M46A 2CXJA 1DJGA 1B7TZ 2KYFA 3IF7A 2M8UA 5CPVA 4WQ3A 3TS5C 4I5JA 1GQMA 1XFYO 1YVLA 1SY9A 2JT0A 2L4IA 1TIZA 1M63B 3BUWB 2E30A 3AKBA 2DOQA 2EHBA 3NSLA 4CLNA 2NCOA 5KSZA 2NCPA 5ER4X 2BL0C 2KI4C 2JZIA 3IQOA 1SRAA 2RGIA 2ZRSA 1UP5A 2CNPA 1BF5A 1QTXA 3NXAA 1F54A 2BE4A 2CBLA 3TS5B 4PHMA 4YGBB 3TDZA 2JWWA 1YVHA 1CB1A 3EVVA 4YGEB 2EGDA 3BUNB 1B1GA 5PALA 1Y1UA 1S5GY 5IBWA 4C0JA 2KAXA 4CIDA 2NXQA 1HT9A 1TNXA 4NQGA 1SR6C 2BL0B 1Y1XA 2I2RE 2VRGA 2K2FA 5TNCA 1NCZA 1RFJA 5KU1A 1BMOA 5G08A 3RLZA 4YGAA 1MWNA 2HQ8A 1NP8A 3KPXA 4PDZA 1PRWA 2I18A 3OHMB 2L51A 1IGVA 5CSJA 2BCXA 2MAZA 2L2EA 3E3RA 1AK8A 1LINA 2K7CA 1TRFA 2Y4QA 1JF2A 1QIWA 1SMGA 1F71A 4GPLB 1TCFA 2LVVA 1SR6B 1IQ5A 5DKRA 2KI6C 3AKAA 2M7LA 3OX6A 1OOJA 4PHJA 1NX0A 1F4OA 4MZJA 5CSFA 1ZMZA 3CR4X 1NPQA 1CFCA 2PVBA 1OZOA 2K7DA 4AQJA 1UHKA 2G9BA 1BOCA 1J7OA 1E8AA 1YRUB 1B8LA 5AEQA 1DJHA 1YTZC 2NLNA 4N1FA 5AANA 4D1EA 3I5GC 4JWQA 1B8CA 3D0YA 4GGNA 5HKYA 3I5FC 1S6IA 1QASA 3D0YB 4ZCVA 1IKUA 3ZNIA 2JTZA 4PHNA 2M9GA 4YI9A 1GGWA 2JNFA 4HRHA 2K61A 1JUOA 1LVCD 4MZKA 2BKIB 1QJTA 2Y1MA 1XFVO 2M0RA 2LLUA 2M49B 2G2BA 1J1DA 1MXLC 4HREE 1NX2A 1PVBA 1DVIA 1FF1A 4PCWA 1CLMA 1XK4C 4DUQA 2KAVA 1KWOC 2WC8A 1UHHA 2JT3A 1QV0A 3I5GB 3JTDC 2PSRA 3O6BA 2AAOA 2KFFA 2M97A 3EK7A 3O2PA 2K0JA 3I5FB 4A4BA 2FJUB 1LA3A 3QRXA 1CFPA 1JFJA 3VRNA 2WCBA 3GK2A 3HCMA 5JOLA 5FYXA 3EKJA 2PRUA 1BU3A 1IWQA 2O60A 1AHRA 2ZN8A 1JFKA 1DMOA 2JQ6A 3F45A 3I5HB 3PN7C 1RTP1 1XK4A 2BCAA 1LKJA 1RECA 2M29A 2WCEA 5CSIA 3RM1A 4C0KA 3WXAA 5ER5A 2PMYA 1EG3A 3EVRA 2BBMA 3IQQA 3VRQA 2ZRTA 2LVJA 4FTGA 1KWOB 1PVAA 3JTDB 1CDMA 2LLSA 2LV7A 3KO0A 1AUIB 1G4YR 1CM1A 3BYAA 1JBAA 5F6TA 1B8RA 1OSAA 4OCIA 2I7AA 1N65A 5HKZA 3PN7B 1K96A 4XYNA 3I5IB 4YBHB 1BJFA 3SG6A 1LA0A 2LUXA 2SCPA 1SPYA 1W7IB 1YUSA 1YX8A 1ZACA 1K90D 2OTGC 3KEVA 5HKWA 1QVIY 1UHNA 1XA5A 2Y1NA 5K89A 4DIRA 1V1GA 2KDHA 5GQQC 1AJ4A 1DJXA 1B9AA 1DJYA 2FCEA 3HX4A 3AAJA 4YGCB 4MZLA 1OMRA 1UURA 4MRXA 4U8DA 4ZCUA 4BY5A 2F8PA 1G33A 3TDUA 3SG3A 4USLA 1W7JB 3FWCA 4ORBB 3SG7A 1NX1A 1ZFSA 3SG2A 1Y6WA 1MF8B 2WORA 2ZNEA 5DKNA 4MLWA 1QIVA 2CCMA 3OB2B 2OTGB 3BQ3A 3M0WA 4M2OA 1SBJA 1PULA 1YURA 2EC6C 1XFWO 1Y1AA 3DVMA 3LCPC 1DJIA 1OMVA 1VRKA 2LP2A 1NUBA 3CLNA 1ALVA 1TNPA 2JRFA 1BR4B 3ICBA 3VRPA 1S5GZ 1IH0A 1TNQA 2KQ6A 2BE6A 2M1UA 4PALA 2LHIA 1SW8A 4GUKA 1NYAA 5D7FA 1AVSA 3BUXB 2L5XB 2ISDA 1CM4A 3BUMB 3EVUA 1C7VA 2EC6B 2JULA 1WLZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ORC B;  4PE7 A;  1NX3 A;  1BR1 B;  1J7Q A;  3WHU B;  2Q4U A;  2KHN A;  4GGF C;  5J3X A;  3PSR A;  4JQ0 D;  1XO5 A;  1NCY A;  2H61 C;  2HQW A;  1DGU A;  3GOF A;  1SNL A;  3O4Y A;  2BBN A;  2KGR A;  3NSK A;  5AFP A;  2KGB C;  3A8R A;  3CS1 A;  1YUT A;  1KFX L;  3CR5 X;  1OE9 B;  2LP3 A;  2MHH A;  1UHI A;  4I5L B;  2LAP A;  5D69 A;  3EKH A;  3SG5 A;  3DVE A;  1MHO A;  2K2A A;  3OP0 A;  4I5K A;  1GJY A;  1QLK A;  2L4H A;  2Q91 A;  3FWB A;  1QX2 A;  2H61 A;  1K95 A;  4JPZ B;  3DD4 A;  2F2P A;  4MBE A;  1UWO A;  3MSE B;  2LC5 A;  2I94 A;  4OV2 A;  2HF5 A;  4CFQ A;  3CZT X;  3A4U B;  2PAS A;  4QJ3 B;  1S1E A;  1QXP A;  1KK7 Y;  1NIW A;  3TDI A;  1L7Z A;  1RJV A;  1IJ5 A;  3I5H C;  3WHT B;  2F3Z A;  2GGM A;  1NSH A;  1ZUZ A;  2F2O A;  1J7P A;  2KBI A;  4YRU A;  1K9U A;  1BLQ A;  1KFU L;  2ZKM X;  5DKQ A;  2ZN9 A;  3LLE A;  3WNX B;  2A4J A;  1CKK A;  1MUX A;  3PM8 A;  1OQP A;  5JJG A;  2LCP A;  1J1E A;  2KYC A;  3K21 A;  1XFZ O;  1BG1 A;  3PLF B;  4CPV A;  1BOD A;  3DVJ A;  2JT8 A;  5HYD A;  2AMI A;  2WOS A;  3I5I C;  2LMU A;  4NDB A;  1CTR A;  1KK8 C;  2FOT A;  1WRZ A;  2KAY A;  1FI5 A;  2NZ0 A;  4P2Y B;  4MEW A;  1L2O C;  2HPS A;  3SIB A;  4TNC A;  5HLV A;  5I2O A;  4GAO A;  2LMT A;  1EJ3 A;  1C07 A;  3D10 A;  3VGO A;  2LM5 A;  1M31 A;  1M45 A;  1CMF A;  1WLM A;  1QX7 A;  2JXC A;  4CFR A;  1OMD A;  1KFU S;  1FBV A;  3PAL A;  1S26 D;  2KBM A;  1KK8 B;  1K94 A;  1DJW A;  2JTT A;  2MA2 A;  1U5I A;  5HLO A;  1MXE A;  2OS8 C;  1QLS A;  1K9K A;  2WND A;  2K7O A;  2JPT A;  2V53 A;  1CDP A;  1L2O B;  1ODB A;  1U5I B;  1DGV A;  3BOW B;  4GFT A;  2JNX A;  1IG5 A;  1H4B A;  3SG4 A;  1RK9 A;  4HSZ A;  5AXI A;  4YGD B;  2QPT A;  1FW4 A;  4A4C A;  2KQY A;  2H2K A;  3TUY B;  2K8M B;  3VRR A;  2K7B A;  3KHE A;  1S6J A;  2B1U A;  2OS8 B;  4M2P A;  1JWD A;  1EH2 A;  2M7N A;  4GNK B;  4N5X A;  2QAC A;  2LVK A;  1UUS A;  2CTN A;  1SK6 D;  1XFX O;  1TTX A;  2BEC A;  2F33 A;  1TCO B;  1CFD A;  1IJ6 A;  1S36 A;  1RRO A;  4GBA A;  4ORA B;  1Q80 A;  1A75 A;  1B7T Y;  3CR2 A;  4IL1 A;  3BXK A;  2KI6 D;  1A03 A;  1G8I A;  1A75 B;  2MRD A;  4NDD A;  3DF0 A;  4XJK A;  1KCY A;  2ZFD A;  3GK1 A;  3LK1 A;  2GGZ A;  3DF0 B;  1PSB A;  4XJK B;  3O78 A;  1OZS A;  2M3W A;  5B8I B;  1B4C A;  4R1E A;  3OB1 B;  1KQM C;  1RWY A;  1EG4 A;  1CDN A;  1HQV A;  4ICB A;  3LL8 B;  1FPW A;  4FQO A;  1SKT A;  3SIA A;  2ZND A;  1K8U A;  3CTN A;  2P6B B;  1K2H A;  1KQV A;  1SYM A;  2KNE A;  1KSM A;  2KI4 B;  4GGF A;  3SJS A;  1PK0 D;  3ZWH A;  1TOP A;  1C7W A;  4NDC A;  1CLB A;  3EK4 A;  1SCV A;  1KQM B;  1BT6 A;  1B47 A;  2LMV A;  4AOM A;  4DCK A;  1ZOT B;  3NSO A;  2JU0 A;  4DS7 A;  2JC2 A;  3BUO B;  1PAL A;  4HRG A;  2IS9 A;  1QAT A;  5I2Q A;  3CWG A;  2BCB A;  1S3P A;  1AJ5 A;  1JC2 A;  1XFU O;  4MRY A;  1KK7 Z;  4PE4 A;  3AAK A;  1CLL A;  2KOT A;  1DT7 B;  4M2Q A;  2LVI A;  4L9M A;  1WY9 A;  1F4Q A;  2JOJ A;  1SCM C;  4YI8 A;  1F55 A;  4I5N B;  1Y0V H;  3VRO A;  1CNP A;  1FI6 A;  5I8N A;  4QJ4 B;  1K9P A;  1A29 A;  1QX5 B;  2F3Y A;  5BPJ A;  1SL9 A;  2KSP A;  2O5G A;  3PFV A;  1X02 A;  3CGA A;  2KFG A;  1TNW A;  3FS7 A;  2LAN A;  1DF0 A;  1CFF A;  2LLT A;  3C1V A;  2KFH A;  1KFX S;  2PAL A;  2R2I A;  2OPO A;  5CSN A;  1DF0 B;  1M39 A;  3JVT C;  4PHK A;  4E68 A;  1YR5 A;  2L50 A;  3PAT A;  1WRL A;  1ALW A;  1J7R A;  1DJZ A;  1UHJ A;  1N0Y A;  4ETO A;  1SCM B;  2MBX A;  1SL7 A;  3H4S E;  1IRJ A;  4P5O E;  1JF0 A;  3NSI A;  1A4P A;  4BY4 A;  4WQ2 A;  2D8N A;  1QS7 A;  2AUC A;  4Q04 A;  3EK8 A;  1XYD A;  1V1F A;  1MR8 A;  1SL8 A;  1JSA A;  1AP4 A;  4OR9 B;  1EL4 A;  1YX7 A;  2TN4 A;  2MLE C;  3JVT B;  2JXL A;  2L0P A;  2LNK A;  2LUC A;  3TZ1 A;  1TN4 A;  2LHL A;  1K93 D;  4DRW A;  1WDC C;  1QV1 A;  4PE0 A;  1N2D A;  3OX5 A;  4F0Z B;  1F70 A;  1GGZ A;  1KSO A;  1CDL A;  2MJW B;  1PSR A;  3FIA A;  3KF9 A;  1QVI Z;  4UPG A;  3TUY C;  5I2L A;  1MQ1 A;  2HET A;  5KTY A;  2BKH B;  1WRK A;  4N1G A;  2L98 A;  5AER A;  1R6P A;  1H8B A;  3BOW A;  1YUU A;  3LK0 A;  4AQI A;  1LXF C;  1S6C A;  2MLF C;  4QJ5 B;  1CMG A;  1F8H A;  4OVN F;  1IQ3 A;  2E6W A;  1WDC B;  4PE1 A;  2WCF A;  4OKH A;  1J55 A;  1R2U A;  2M1K B;  1XVJ A;  2SAS A;  4MSP A;  1EXR A;  3DVK A;  2Y5I A;  2COL B;  1DTL A;  2GV5 A;  2LE9 B;  2FCD A;  4MVF A;  3GK4 X;  4WRI A;  1A2X A;  1NWD A;  1D1O A;  4MN0 A;  1YRT B;  2CT9 A;  4C0L A;  1NCX A;  1M46 A;  2CXJ A;  1DJG A;  1B7T Z;  2KYF A;  3IF7 A;  2M8U A;  5CPV A;  4WQ3 A;  3TS5 C;  4I5J A;  1GQM A;  1XFY O;  1YVL A;  1SY9 A;  2JT0 A;  2L4I A;  1TIZ A;  1M63 B;  3BUW B;  2E30 A;  3AKB A;  2DOQ A;  2EHB A;  3NSL A;  4CLN A;  2NCO A;  5KSZ A;  2NCP A;  5ER4 X;  2BL0 C;  2KI4 C;  2JZI A;  3IQO A;  1SRA A;  2RGI A;  2ZRS A;  1UP5 A;  2CNP A;  1BF5 A;  1QTX A;  3NXA A;  1F54 A;  2BE4 A;  2CBL A;  3TS5 B;  4PHM A;  4YGB B;  3TDZ A;  2JWW A;  1YVH A;  1CB1 A;  3EVV A;  4YGE B;  2EGD A;  3BUN B;  1B1G A;  5PAL A;  1Y1U A;  1S5G Y;  5IBW A;  4C0J A;  2KAX A;  4CID A;  2NXQ A;  1HT9 A;  1TNX A;  4NQG A;  1SR6 C;  2BL0 B;  1Y1X A;  2I2R E;  2VRG A;  2K2F A;  5TNC A;  1NCZ A;  1RFJ A;  5KU1 A;  1BMO A;  5G08 A;  3RLZ A;  4YGA A;  1MWN A;  2HQ8 A;  1NP8 A;  3KPX A;  4PDZ A;  1PRW A;  2I18 A;  3OHM B;  2L51 A;  1IGV A;  5CSJ A;  2BCX A;  2MAZ A;  2L2E A;  3E3R A;  1AK8 A;  1LIN A;  2K7C A;  1TRF A;  2Y4Q A;  1JF2 A;  1QIW A;  1SMG A;  1F71 A;  4GPL B;  1TCF A;  2LVV A;  1SR6 B;  1IQ5 A;  5DKR A;  2KI6 C;  3AKA A;  2M7L A;  3OX6 A;  1OOJ A;  4PHJ A;  1NX0 A;  1F4O A;  4MZJ A;  5CSF A;  1ZMZ A;  3CR4 X;  1NPQ A;  1CFC A;  2PVB A;  1OZO A;  2K7D A;  4AQJ A;  1UHK A;  2G9B A;  1BOC A;  1J7O A;  1E8A A;  1YRU B;  1B8L A;  5AEQ A;  1DJH A;  1YTZ C;  2NLN A;  4N1F A;  5AAN A;  4D1E A;  3I5G C;  4JWQ A;  1B8C A;  3D0Y A;  4GGN A;  5HKY A;  3I5F C;  1S6I A;  1QAS A;  3D0Y B;  4ZCV A;  1IKU A;  3ZNI A;  2JTZ A;  4PHN A;  2M9G A;  4YI9 A;  1GGW A;  2JNF A;  4HRH A;  2K61 A;  1JUO A;  1LVC D;  4MZK A;  2BKI B;  1QJT A;  2Y1M A;  1XFV O;  2M0R A;  2LLU A;  2M49 B;  2G2B A;  1J1D A;  1MXL C;  4HRE E;  1NX2 A;  1PVB A;  1DVI A;  1FF1 A;  4PCW A;  1CLM A;  1XK4 C;  4DUQ A;  2KAV A;  1KWO C;  2WC8 A;  1UHH A;  2JT3 A;  1QV0 A;  3I5G B;  3JTD C;  2PSR A;  3O6B A;  2AAO A;  2KFF A;  2M97 A;  3EK7 A;  3O2P A;  2K0J A;  3I5F B;  4A4B A;  2FJU B;  1LA3 A;  3QRX A;  1CFP A;  1JFJ A;  3VRN A;  2WCB A;  3GK2 A;  3HCM A;  5JOL A;  5FYX A;  3EKJ A;  2PRU A;  1BU3 A;  1IWQ A;  2O60 A;  1AHR A;  2ZN8 A;  1JFK A;  1DMO A;  2JQ6 A;  3F45 A;  3I5H B;  3PN7 C;  1RTP 1;  1XK4 A;  2BCA A;  1LKJ A;  1REC A;  2M29 A;  2WCE A;  5CSI A;  3RM1 A;  4C0K A;  3WXA A;  5ER5 A;  2PMY A;  1EG3 A;  3EVR A;  2BBM A;  3IQQ A;  3VRQ A;  2ZRT A;  2LVJ A;  4FTG A;  1KWO B;  1PVA A;  3JTD B;  1CDM A;  2LLS A;  2LV7 A;  3KO0 A;  1AUI B;  1G4Y R;  1CM1 A;  3BYA A;  1JBA A;  5F6T A;  1B8R A;  1OSA A;  4OCI A;  2I7A A;  1N65 A;  5HKZ A;  3PN7 B;  1K96 A;  4XYN A;  3I5I B;  4YBH B;  1BJF A;  3SG6 A;  1LA0 A;  2LUX A;  2SCP A;  1SPY A;  1W7I B;  1YUS A;  1YX8 A;  1ZAC A;  1K90 D;  2OTG C;  3KEV A;  5HKW A;  1QVI Y;  1UHN A;  1XA5 A;  2Y1N A;  5K89 A;  4DIR A;  1V1G A;  2KDH A;  5GQQ C;  1AJ4 A;  1DJX A;  1B9A A;  1DJY A;  2FCE A;  3HX4 A;  3AAJ A;  4YGC B;  4MZL A;  1OMR A;  1UUR A;  4MRX A;  4U8D A;  4ZCU A;  4BY5 A;  2F8P A;  1G33 A;  3TDU A;  3SG3 A;  4USL A;  1W7J B;  3FWC A;  4ORB B;  3SG7 A;  1NX1 A;  1ZFS A;  3SG2 A;  1Y6W A;  1MF8 B;  2WOR A;  2ZNE A;  5DKN A;  4MLW A;  1QIV A;  2CCM A;  3OB2 B;  2OTG B;  3BQ3 A;  3M0W A;  4M2O A;  1SBJ A;  1PUL A;  1YUR A;  2EC6 C;  1XFW O;  1Y1A A;  3DVM A;  3LCP C;  1DJI A;  1OMV A;  1VRK A;  2LP2 A;  1NUB A;  3CLN A;  1ALV A;  1TNP A;  2JRF A;  1BR4 B;  3ICB A;  3VRP A;  1S5G Z;  1IH0 A;  1TNQ A;  2KQ6 A;  2BE6 A;  2M1U A;  4PAL A;  2LHI A;  1SW8 A;  4GUK A;  1NYA A;  5D7F A;  1AVS A;  3BUX B;  2L5X B;  2ISD A;  1CM4 A;  3BUM B;  3EVU A;  1C7V A;  2EC6 B;  2JUL A;  1WLZ A; 
#chains in the Genus database with same CATH topology
 4ORC B;  4PE7 A;  1NX3 A;  1BR1 B;  1DEL A;  2QEB A;  2Q4U A;  2KHN A;  4GGF C;  5J3X A;  3WHU B;  1J7Q A;  5FI6 A;  3PSR A;  4JQ0 D;  2WCJ A;  1XO5 A;  1NCY A;  2H61 C;  2L5Y A;  2HQW A;  1DGU A;  1Z2C B;  3GOF A;  1SNL A;  3O4Y A;  2BBN A;  2KGR A;  3NSK A;  5AFP A;  2KGB C;  3A8R A;  3CS1 A;  1YUT A;  1KFX L;  3CR5 X;  1OE9 B;  2LP3 A;  2MHH A;  1UHI A;  3L4L A;  2LAP A;  4I5L B;  5D69 A;  3EKH A;  3SG5 A;  3DXL A;  1GM0 A;  3DVE A;  1MHO A;  2K2A A;  3CYZ A;  3OP0 A;  1GJY A;  1QLK A;  2L4H A;  2Q91 A;  4I5K A;  3FWB A;  4F7F A;  1QX2 A;  2H61 A;  1K95 A;  4JPZ B;  3DD4 A;  2F2P A;  4MBE A;  1UWO A;  3MSE B;  3Q8I A;  3VB1 A;  2LC5 A;  2I94 A;  4OV2 A;  2HF5 A;  2KLE A;  3CZT X;  4CFQ A;  3A4U B;  2PAS A;  4QJ3 B;  3NGV A;  1C3Y A;  1S1E A;  1QXP A;  1KK7 Y;  1NIW A;  3TDI A;  3CAB A;  3QME A;  1L7Z A;  1RJV A;  1IJ5 A;  3I5H C;  3WHT B;  2F3Z A;  2GGM A;  3D77 A;  1NSH A;  1ZUZ A;  2F2O A;  1ORG A;  1J7P A;  2KBI A;  4YRU A;  1K9U A;  1BLQ A;  1KFU L;  2ZKM X;  5DKQ A;  2ZN9 A;  3LLE A;  3OBV A;  3WNX B;  2A4J A;  1CKK A;  3OGN A;  1MUX A;  3PM8 A;  1OQP A;  5JJG A;  2LCP A;  2SCP A;  1J1E A;  2KYC A;  3K21 A;  1XFZ O;  3D76 A;  2P70 A;  3PLF B;  4CPV A;  1BG1 A;  1BOD A;  3DVJ A;  2JT8 A;  5HYD A;  2AMI A;  2WOS A;  3I5I C;  2LMU A;  2PQL A;  4NDB A;  1CTR A;  1KK8 C;  2FOT A;  1WRZ A;  2KAY A;  1FI5 A;  2NZ0 A;  4P2Y B;  3CZ0 A;  5FI7 A;  4MEW A;  1L2O C;  2HPS A;  3SIB A;  2WC6 A;  3L4A A;  4TNC A;  1XFR A;  5HLV A;  5I2O A;  4GAO A;  2LMT A;  1EJ3 A;  1C07 A;  3D10 A;  3VGO A;  2LM5 A;  1M31 A;  1M45 A;  3R1P A;  1CMF A;  1WLM A;  2P71 A;  1QX7 A;  2JXC A;  4CFR A;  1OMD A;  1KFU S;  1FBV A;  3PAL A;  5DIC A;  1S26 D;  2KBM A;  3UNW A;  1KK8 B;  1K94 A;  1DJW A;  2JTT A;  3D75 A;  2MA2 A;  1U5I A;  5HLO A;  1MXE A;  2OS8 C;  1GGW A;  1QLS A;  1K9K A;  2WND A;  5I94 A;  2K7O A;  2JPT A;  2V53 A;  1CDP A;  1L2O B;  1ODB A;  1U5I B;  1DQE A;  3S0B A;  2K60 A;  1DGV A;  3BOW B;  4GFT A;  2JNX A;  1IG5 A;  1H4B A;  3SG4 A;  1RK9 A;  4HSZ A;  5AXI A;  4YGD B;  2QPT A;  2QEO A;  1FW4 A;  4A4C A;  2KQY A;  2H2K A;  3TUY B;  2K8M B;  3VRR A;  2K7B A;  3KHE A;  1S6J A;  2B1U A;  2OS8 B;  4INX A;  4M2P A;  1JWD A;  1EH2 A;  2M7N A;  4GNK B;  4N5X A;  2QAC A;  2LVK A;  1UUS A;  3V2L A;  2CTN A;  1SK6 D;  5FI2 A;  1XFX O;  1TTX A;  2BEC A;  2F33 A;  1OW4 A;  1TCO B;  1CFD A;  1IJ6 A;  1S36 A;  1RRO A;  2WCM A;  4GBA A;  4ORA B;  1Q80 A;  1A75 A;  1B7T Y;  3CR2 A;  3O4X A;  3BXK A;  4IL1 A;  5D3O A;  2KI6 D;  1A03 A;  1G8I A;  1A75 B;  2MRD A;  4NDD A;  4FQT A;  3DF0 A;  2KPH A;  2YGU A;  4XJK A;  1KCY A;  2ZFD A;  3GK1 A;  3LK1 A;  2GGZ A;  3DF0 B;  1PSB A;  1SSE B;  4XJK B;  3O78 A;  1OZS A;  2M3W A;  5B8I B;  1DC1 A;  4R1E A;  3OB1 B;  1KQM C;  1RWY A;  1B4C A;  1EG4 A;  1CDN A;  1HQV A;  4ICB A;  3LL8 B;  2QDI A;  1FPW A;  4FQO A;  1SKT A;  3SIA A;  2ZND A;  1K8U A;  3CTN A;  3FE6 A;  2P6B B;  1K2H A;  1KQV A;  1SYM A;  2KNE A;  3FE8 A;  1KSM A;  2KI4 B;  4GGF A;  3SJS A;  1PK0 D;  3ZWH A;  1P28 A;  1TOP A;  3B87 A;  3R72 A;  1C7W A;  4NDC A;  1CLB A;  3EK4 A;  1SCV A;  1KQM B;  3S0A A;  3BFH A;  1BT6 A;  1B47 A;  2LMV A;  3B6X A;  4AOM A;  4DCK A;  1ZOT B;  3NSO A;  2JU0 A;  4DS7 A;  2JC2 A;  3BUO B;  1PAL A;  4HRG A;  2IS9 A;  1QAT A;  5I2Q A;  3CWG A;  2BCB A;  3D73 A;  2WCH A;  1S3P A;  1AJ5 A;  3SS5 A;  1JC2 A;  1T14 A;  1XFU O;  4MRY A;  4INW A;  1KK7 Z;  4PE4 A;  3AAK A;  1CLL A;  2KOT A;  1DT7 B;  4M2Q A;  2LVI A;  4L9M A;  1WY9 A;  1F4Q A;  2JOJ A;  1SCM C;  4YI8 A;  1F55 A;  4I5N B;  1Y0V H;  3VRO A;  1CNP A;  1FI6 A;  5I8N A;  4QJ4 B;  1K9P A;  1A29 A;  1QX5 B;  2F3Y A;  5BPJ A;  1SL9 A;  2KSP A;  2O5G A;  3PFV A;  1X02 A;  3CGA A;  2KFG A;  1TNW A;  3FS7 A;  2LAN A;  1DF0 A;  1CFF A;  2LLT A;  3C1V A;  2KFH A;  1KFX S;  3L47 A;  2PAL A;  2R2I A;  3UO9 A;  2OPO A;  2QEH A;  1DF0 B;  5CSN A;  1M39 A;  3JVT C;  2QEV A;  4PHK A;  4E68 A;  2ERB A;  1YR5 A;  2L50 A;  3DY9 A;  3PAT A;  1WRL A;  1ALW A;  1J7R A;  1DJZ A;  1QWV A;  1UHJ A;  1N0Y A;  4ETO A;  1SCM B;  2MBX A;  1SL7 A;  3CDN A;  1IRJ A;  3H4S E;  1JF0 A;  3NSI A;  1A4P A;  2BNX A;  4P5O E;  5HL1 A;  4BY4 A;  4WQ2 A;  2D8N A;  1QS7 A;  2AUC A;  4Q04 A;  3EK8 A;  1XYD A;  1V1F A;  1MR8 A;  1SL8 A;  1JSA A;  1AP4 A;  4OR9 B;  1EL4 A;  1YX7 A;  2TN4 A;  2MLE C;  3JVT B;  2JXL A;  2L0P A;  2LNK A;  2LUC A;  3TZ1 A;  1TN4 A;  2LHL A;  1K93 D;  1TUJ A;  3BFA A;  4DRW A;  3S0G A;  1WDC C;  1QV1 A;  4PE0 A;  1N2D A;  3OX5 A;  4F0Z B;  1F70 A;  1GGZ A;  1KSO A;  1CDL A;  2MJW B;  1PSR A;  3FIA A;  3KF9 A;  1QVI Z;  4UPG A;  3TUY C;  5I2L A;  1MQ1 A;  2HET A;  3RZS A;  4PT1 A;  2BAP A;  1Z4H A;  5KTY A;  2BKH B;  1WRK A;  4N1G A;  2L98 A;  5AER A;  1R6P A;  1H8B A;  3BOW A;  1YUU A;  3LK0 A;  1JFJ A;  4AQI A;  3CZ1 A;  1LXF C;  1S6C A;  3B88 A;  2MLF C;  4QJ5 B;  1CMG A;  1F8H A;  4OVN F;  1IQ3 A;  2E6W A;  1WDC B;  4PE1 A;  2WCF A;  4OKH A;  1J55 A;  1R2U A;  2M1K B;  1XVJ A;  2SAS A;  4MSP A;  1EXR A;  3DVK A;  2Y5I A;  2COL B;  1DEK A;  1DTL A;  2GV5 A;  2LE9 B;  2FCD A;  4MVF A;  3GK4 X;  4WRI A;  1A2X A;  1NWD A;  1D1O A;  4MN0 A;  1YRT B;  2CT9 A;  4C0L A;  2FJY A;  1NCX A;  1M46 A;  3R1O A;  2CXJ A;  3S0F A;  1DJG A;  1B7T Z;  2KYF A;  3IF7 A;  2M8U A;  5CPV A;  4WQ3 A;  3TS5 C;  4I5J A;  1GQM A;  1XFY O;  5EL2 A;  1YVL A;  1SY9 A;  2JT0 A;  2L4I A;  1TIZ A;  1M63 B;  3SS4 A;  3BUW B;  2E30 A;  3AKB A;  3O6B A;  2DOQ A;  2EHB A;  3NSL A;  4CLN A;  2NCO A;  5KSZ A;  2NCP A;  5ER4 X;  1IIO A;  2KLD A;  2BL0 C;  2KI4 C;  2JZI A;  3IQO A;  1SRA A;  2RGI A;  2ZRS A;  1UP5 A;  2CNP A;  1BF5 A;  1QTX A;  3NXA A;  1F54 A;  2BE4 A;  2CBL A;  3TS5 B;  4PHM A;  4YGB B;  3TDZ A;  2JWW A;  1YVH A;  1CB1 A;  3EVV A;  4YGE B;  2EGD A;  3BUN B;  1B1G A;  5PAL A;  1Y1U A;  1S5G Y;  5IBW A;  4C0J A;  2KAX A;  4CID A;  2NXQ A;  1HT9 A;  1TNX A;  4NQG A;  3B7A A;  1SR6 C;  2BL0 B;  1Y1X A;  2I2R E;  2WCK A;  2VRG A;  2K2F A;  5TNC A;  4OZD A;  1NCZ A;  1RFJ A;  5KU1 A;  1BMO A;  5G08 A;  3RLZ A;  4YGA A;  1MWN A;  2HQ8 A;  1NP8 A;  3KPX A;  4PDZ A;  1PRW A;  2I18 A;  3OHM B;  2L51 A;  1IGV A;  5CSJ A;  2BCX A;  3PJI A;  2MAZ A;  2L2E A;  3E3R A;  1AK8 A;  1LIN A;  2K7C A;  1TRF A;  2Y4Q A;  1JF2 A;  1QIW A;  1SMG A;  3PM2 A;  4IJ7 A;  1F71 A;  4GPL B;  1TCF A;  2LVV A;  1SR6 B;  3B86 A;  1IQ5 A;  5DKR A;  2KI6 C;  3AKA A;  2M7L A;  3OX6 A;  1OOJ A;  4PHJ A;  1NX0 A;  1F4O A;  4MZJ A;  2GTE A;  5CSF A;  1ZMZ A;  3CR4 X;  1NPQ A;  1CFC A;  2PVB A;  1OZO A;  2K7D A;  3FE9 A;  4AQJ A;  1UHK A;  2G9B A;  1BOC A;  1J7O A;  1E8A A;  1YRU B;  1B8L A;  5AEQ A;  1DJH A;  1YTZ C;  2NLN A;  4N1F A;  5AAN A;  4D1E A;  3I5G C;  4JWQ A;  1B8C A;  3D0Y A;  4GGN A;  5HKY A;  3I5F C;  1S6I A;  1QAS A;  3D0Y B;  4ZCV A;  4JKT A;  3ZNI A;  2JTZ A;  4PHN A;  1TUZ A;  2M9G A;  4YI9 A;  1IKU A;  2JNF A;  3N7H A;  4HRH A;  2K61 A;  1JUO A;  1LVC D;  4MZK A;  2BKI B;  1QJT A;  2Y1M A;  1XFV O;  2M0R A;  2LLU A;  2M49 B;  2G2B A;  1J1D A;  1MXL C;  4HRE E;  1NX2 A;  1PVB A;  1DVI A;  1C3Z A;  1FF1 A;  4PCW A;  1CLM A;  1XK4 C;  4DUQ A;  2KAV A;  1KWO C;  2WC8 A;  1UHH A;  2JT3 A;  1QV0 A;  3BFB A;  3I5G B;  2PSR A;  3JTD C;  2AAO A;  2KFF A;  2M97 A;  3EK7 A;  3O2P A;  2K0J A;  3S0D A;  3I5F B;  4A4B A;  2FJU B;  1LA3 A;  3QRX A;  4KYN A;  1CFP A;  3VRN A;  2WCB A;  3GK2 A;  3HCM A;  5JOL A;  5FYX A;  3EKJ A;  2PRU A;  1BU3 A;  1IWQ A;  2O60 A;  1AHR A;  2ZN8 A;  1JFK A;  3D78 A;  2JQ6 A;  1DMO A;  3F45 A;  3I5H B;  3CZ2 A;  4JD9 A;  3PN7 C;  1RTP 1;  1XK4 A;  2BCA A;  1LKJ A;  1REC A;  2M29 A;  2WCE A;  5CSI A;  3RM1 A;  4C0K A;  3DZT A;  1OOG A;  3WXA A;  5ER5 A;  2PMY A;  1EG3 A;  3EVR A;  1OOF A;  2BBM A;  3IQQ A;  3S0E A;  3VRQ A;  2ZRT A;  2LVJ A;  4FTG A;  1KWO B;  3EG5 B;  1PVA A;  3JTD B;  1CDM A;  2LLS A;  2LV7 A;  3KO0 A;  1AUI B;  1G4Y R;  1CM1 A;  3BYA A;  1JBA A;  5F6T A;  1B8R A;  1OSA A;  4OCI A;  2I7A A;  1N65 A;  5HKZ A;  3PN7 B;  1K96 A;  4XYN A;  3I5I B;  4YBH B;  1BJF A;  3SG6 A;  1OOH A;  1LA0 A;  2LUX A;  2PYQ A;  1SPY A;  1W7I B;  1YUS A;  1YX8 A;  1ZAC A;  1K90 D;  2OTG C;  3K1E A;  3KEV A;  5HKW A;  1QVI Y;  1UHN A;  1XA5 A;  2Y1N A;  5K89 A;  4DIR A;  1V1G A;  2KDH A;  5GQQ C;  1AJ4 A;  1DJX A;  1B9A A;  1DJY A;  1LS8 A;  2FCE A;  2WCL A;  3AAJ A;  3HX4 A;  3IVT A;  4YGC B;  4MZL A;  1OMR A;  1UUR A;  4MRX A;  4U8D A;  4ZCU A;  4BY5 A;  2F8P A;  2L2C A;  1G33 A;  1OOI X;  1W9Z A;  3D74 A;  3TDU A;  3DYE A;  3SG3 A;  4USL A;  1W7J B;  3FWC A;  4ORB B;  3SG7 A;  1NX1 A;  1ZFS A;  3SG2 A;  1Y6W A;  1MF8 B;  2WOR A;  2ZNE A;  5DKN A;  4MLW A;  1QIV A;  2CCM A;  3OB2 B;  3SS3 A;  2OTG B;  3BQ3 A;  2JPO A;  3M0W A;  4M2O A;  1SBJ A;  1PUL A;  1YUR A;  2H8V A;  2EC6 C;  1XFW O;  1Y1A A;  3DVM A;  3LCP C;  1DJI A;  1OMV A;  1VRK A;  2LP2 A;  1NUB A;  3CLN A;  3R1V A;  1ALV A;  1TNP A;  2JRF A;  3BJH A;  1BR4 B;  3ICB A;  3VRP A;  1S5G Z;  1IH0 A;  1TNQ A;  3NHT A;  2KQ6 A;  2BE6 A;  3NHI A;  2M1U A;  4PAL A;  2LHI A;  1SW8 A;  4GUK A;  2WC5 A;  1NYA A;  5D7F A;  1AVS A;  3BUX B;  2L5X B;  1TWO A;  2ISD A;  1CM4 A;  3BUM B;  3EVU A;  1C7V A;  2EC6 B;  2JUL A;  1WLZ A; 
#chains in the Genus database with same CATH homology
 4ORC B;  4PE7 A;  1NX3 A;  1BR1 B;  1J7Q A;  3WHU B;  2Q4U A;  2KHN A;  4GGF C;  5J3X A;  3PSR A;  4JQ0 D;  1XO5 A;  1NCY A;  2H61 C;  2HQW A;  1DGU A;  3GOF A;  1SNL A;  3O4Y A;  2BBN A;  2KGR A;  3NSK A;  5AFP A;  2KGB C;  3A8R A;  3CS1 A;  1YUT A;  1KFX L;  3CR5 X;  1OE9 B;  2LP3 A;  2MHH A;  1UHI A;  4I5L B;  2LAP A;  5D69 A;  3EKH A;  3SG5 A;  3DVE A;  1MHO A;  2K2A A;  3OP0 A;  4I5K A;  1GJY A;  1QLK A;  2L4H A;  2Q91 A;  3FWB A;  1QX2 A;  2H61 A;  1K95 A;  4JPZ B;  3DD4 A;  2F2P A;  4MBE A;  1UWO A;  3MSE B;  2LC5 A;  2I94 A;  4OV2 A;  2HF5 A;  4CFQ A;  3CZT X;  3A4U B;  2PAS A;  4QJ3 B;  1S1E A;  1QXP A;  1KK7 Y;  1NIW A;  3TDI A;  1L7Z A;  1RJV A;  1IJ5 A;  3I5H C;  3WHT B;  2F3Z A;  2GGM A;  1NSH A;  1ZUZ A;  2F2O A;  1J7P A;  2KBI A;  4YRU A;  1K9U A;  1BLQ A;  1KFU L;  2ZKM X;  5DKQ A;  2ZN9 A;  3LLE A;  3WNX B;  2A4J A;  1CKK A;  1MUX A;  3PM8 A;  1OQP A;  5JJG A;  2LCP A;  1J1E A;  2KYC A;  3K21 A;  1XFZ O;  1BG1 A;  3PLF B;  4CPV A;  1BOD A;  3DVJ A;  2JT8 A;  5HYD A;  2AMI A;  2WOS A;  3I5I C;  2LMU A;  4NDB A;  1CTR A;  1KK8 C;  2FOT A;  1WRZ A;  2KAY A;  1FI5 A;  2NZ0 A;  4P2Y B;  4MEW A;  1L2O C;  2HPS A;  3SIB A;  4TNC A;  5HLV A;  5I2O A;  4GAO A;  2LMT A;  1EJ3 A;  1C07 A;  3D10 A;  3VGO A;  2LM5 A;  1M31 A;  1M45 A;  1CMF A;  1WLM A;  1QX7 A;  2JXC A;  4CFR A;  1OMD A;  1KFU S;  1FBV A;  3PAL A;  1S26 D;  2KBM A;  1KK8 B;  1K94 A;  1DJW A;  2JTT A;  2MA2 A;  1U5I A;  5HLO A;  1MXE A;  2OS8 C;  1QLS A;  1K9K A;  2WND A;  2K7O A;  2JPT A;  2V53 A;  1CDP A;  1L2O B;  1ODB A;  1U5I B;  1DGV A;  3BOW B;  4GFT A;  2JNX A;  1IG5 A;  1H4B A;  3SG4 A;  1RK9 A;  4HSZ A;  5AXI A;  4YGD B;  2QPT A;  1FW4 A;  4A4C A;  2KQY A;  2H2K A;  3TUY B;  2K8M B;  3VRR A;  2K7B A;  3KHE A;  1S6J A;  2B1U A;  2OS8 B;  4M2P A;  1JWD A;  1EH2 A;  2M7N A;  4GNK B;  4N5X A;  2QAC A;  2LVK A;  1UUS A;  2CTN A;  1SK6 D;  1XFX O;  1TTX A;  2BEC A;  2F33 A;  1TCO B;  1CFD A;  1IJ6 A;  1S36 A;  1RRO A;  4GBA A;  4ORA B;  1Q80 A;  1A75 A;  1B7T Y;  3CR2 A;  4IL1 A;  3BXK A;  2KI6 D;  1A03 A;  1G8I A;  1A75 B;  2MRD A;  4NDD A;  3DF0 A;  4XJK A;  1KCY A;  2ZFD A;  3GK1 A;  3LK1 A;  2GGZ A;  3DF0 B;  1PSB A;  4XJK B;  3O78 A;  1OZS A;  2M3W A;  5B8I B;  1B4C A;  4R1E A;  3OB1 B;  1KQM C;  1RWY A;  1EG4 A;  1CDN A;  1HQV A;  4ICB A;  3LL8 B;  1FPW A;  4FQO A;  1SKT A;  3SIA A;  2ZND A;  1K8U A;  3CTN A;  2P6B B;  1K2H A;  1KQV A;  1SYM A;  2KNE A;  1KSM A;  2KI4 B;  4GGF A;  3SJS A;  1PK0 D;  3ZWH A;  1TOP A;  1C7W A;  4NDC A;  1CLB A;  3EK4 A;  1SCV A;  1KQM B;  1BT6 A;  1B47 A;  2LMV A;  4AOM A;  4DCK A;  1ZOT B;  3NSO A;  2JU0 A;  4DS7 A;  2JC2 A;  3BUO B;  1PAL A;  4HRG A;  2IS9 A;  1QAT A;  5I2Q A;  3CWG A;  2BCB A;  1S3P A;  1AJ5 A;  1JC2 A;  1XFU O;  4MRY A;  1KK7 Z;  4PE4 A;  3AAK A;  1CLL A;  2KOT A;  1DT7 B;  4M2Q A;  2LVI A;  4L9M A;  1WY9 A;  1F4Q A;  2JOJ A;  1SCM C;  4YI8 A;  1F55 A;  4I5N B;  1Y0V H;  3VRO A;  1CNP A;  1FI6 A;  5I8N A;  4QJ4 B;  1K9P A;  1A29 A;  1QX5 B;  2F3Y A;  5BPJ A;  1SL9 A;  2KSP A;  2O5G A;  3PFV A;  1X02 A;  3CGA A;  2KFG A;  1TNW A;  3FS7 A;  2LAN A;  1DF0 A;  1CFF A;  2LLT A;  3C1V A;  2KFH A;  1KFX S;  2PAL A;  2R2I A;  2OPO A;  5CSN A;  1DF0 B;  1M39 A;  3JVT C;  4PHK A;  4E68 A;  1YR5 A;  2L50 A;  3PAT A;  1WRL A;  1ALW A;  1J7R A;  1DJZ A;  1UHJ A;  1N0Y A;  4ETO A;  1SCM B;  2MBX A;  1SL7 A;  3H4S E;  1IRJ A;  4P5O E;  1JF0 A;  3NSI A;  1A4P A;  4BY4 A;  4WQ2 A;  2D8N A;  1QS7 A;  2AUC A;  4Q04 A;  3EK8 A;  1XYD A;  1V1F A;  1MR8 A;  1SL8 A;  1JSA A;  1AP4 A;  4OR9 B;  1EL4 A;  1YX7 A;  2TN4 A;  2MLE C;  3JVT B;  2JXL A;  2L0P A;  2LNK A;  2LUC A;  3TZ1 A;  1TN4 A;  2LHL A;  1K93 D;  4DRW A;  1WDC C;  1QV1 A;  4PE0 A;  1N2D A;  3OX5 A;  4F0Z B;  1F70 A;  1GGZ A;  1KSO A;  1CDL A;  2MJW B;  1PSR A;  3FIA A;  3KF9 A;  1QVI Z;  4UPG A;  3TUY C;  5I2L A;  1MQ1 A;  2HET A;  5KTY A;  2BKH B;  1WRK A;  4N1G A;  2L98 A;  5AER A;  1R6P A;  1H8B A;  3BOW A;  1YUU A;  3LK0 A;  4AQI A;  1LXF C;  1S6C A;  2MLF C;  4QJ5 B;  1CMG A;  1F8H A;  4OVN F;  1IQ3 A;  2E6W A;  1WDC B;  4PE1 A;  2WCF A;  4OKH A;  1J55 A;  1R2U A;  2M1K B;  1XVJ A;  2SAS A;  4MSP A;  1EXR A;  3DVK A;  2Y5I A;  2COL B;  1DTL A;  2GV5 A;  2LE9 B;  2FCD A;  4MVF A;  3GK4 X;  4WRI A;  1A2X A;  1NWD A;  1D1O A;  4MN0 A;  1YRT B;  2CT9 A;  4C0L A;  1NCX A;  1M46 A;  2CXJ A;  1DJG A;  1B7T Z;  2KYF A;  3IF7 A;  2M8U A;  5CPV A;  4WQ3 A;  3TS5 C;  4I5J A;  1GQM A;  1XFY O;  1YVL A;  1SY9 A;  2JT0 A;  2L4I A;  1TIZ A;  1M63 B;  3BUW B;  2E30 A;  3AKB A;  2DOQ A;  2EHB A;  3NSL A;  4CLN A;  2NCO A;  5KSZ A;  2NCP A;  5ER4 X;  2BL0 C;  2KI4 C;  2JZI A;  3IQO A;  1SRA A;  2RGI A;  2ZRS A;  1UP5 A;  2CNP A;  1BF5 A;  1QTX A;  3NXA A;  1F54 A;  2BE4 A;  2CBL A;  3TS5 B;  4PHM A;  4YGB B;  3TDZ A;  2JWW A;  1YVH A;  1CB1 A;  3EVV A;  4YGE B;  2EGD A;  3BUN B;  1B1G A;  5PAL A;  1Y1U A;  1S5G Y;  5IBW A;  4C0J A;  2KAX A;  4CID A;  2NXQ A;  1HT9 A;  1TNX A;  4NQG A;  1SR6 C;  2BL0 B;  1Y1X A;  2I2R E;  2VRG A;  2K2F A;  5TNC A;  1NCZ A;  1RFJ A;  5KU1 A;  1BMO A;  5G08 A;  3RLZ A;  4YGA A;  1MWN A;  2HQ8 A;  1NP8 A;  3KPX A;  4PDZ A;  1PRW A;  2I18 A;  3OHM B;  2L51 A;  1IGV A;  5CSJ A;  2BCX A;  2MAZ A;  2L2E A;  3E3R A;  1AK8 A;  1LIN A;  2K7C A;  1TRF A;  2Y4Q A;  1JF2 A;  1QIW A;  1SMG A;  1F71 A;  4GPL B;  1TCF A;  2LVV A;  1SR6 B;  1IQ5 A;  5DKR A;  2KI6 C;  3AKA A;  2M7L A;  3OX6 A;  1OOJ A;  4PHJ A;  1NX0 A;  1F4O A;  4MZJ A;  5CSF A;  1ZMZ A;  3CR4 X;  1NPQ A;  1CFC A;  2PVB A;  1OZO A;  2K7D A;  4AQJ A;  1UHK A;  2G9B A;  1BOC A;  1J7O A;  1E8A A;  1YRU B;  1B8L A;  5AEQ A;  1DJH A;  1YTZ C;  2NLN A;  4N1F A;  5AAN A;  4D1E A;  3I5G C;  4JWQ A;  1B8C A;  3D0Y A;  4GGN A;  5HKY A;  3I5F C;  1S6I A;  1QAS A;  3D0Y B;  4ZCV A;  1IKU A;  3ZNI A;  2JTZ A;  4PHN A;  2M9G A;  4YI9 A;  1GGW A;  2JNF A;  4HRH A;  2K61 A;  1JUO A;  1LVC D;  4MZK A;  2BKI B;  1QJT A;  2Y1M A;  1XFV O;  2M0R A;  2LLU A;  2M49 B;  2G2B A;  1J1D A;  1MXL C;  4HRE E;  1NX2 A;  1PVB A;  1DVI A;  1FF1 A;  4PCW A;  1CLM A;  1XK4 C;  4DUQ A;  2KAV A;  1KWO C;  2WC8 A;  1UHH A;  2JT3 A;  1QV0 A;  3I5G B;  3JTD C;  2PSR A;  3O6B A;  2AAO A;  2KFF A;  2M97 A;  3EK7 A;  3O2P A;  2K0J A;  3I5F B;  4A4B A;  2FJU B;  1LA3 A;  3QRX A;  1CFP A;  1JFJ A;  3VRN A;  2WCB A;  3GK2 A;  3HCM A;  5JOL A;  5FYX A;  3EKJ A;  2PRU A;  1BU3 A;  1IWQ A;  2O60 A;  1AHR A;  2ZN8 A;  1JFK A;  1DMO A;  2JQ6 A;  3F45 A;  3I5H B;  3PN7 C;  1RTP 1;  1XK4 A;  2BCA A;  1LKJ A;  1REC A;  2M29 A;  2WCE A;  5CSI A;  3RM1 A;  4C0K A;  3WXA A;  5ER5 A;  2PMY A;  1EG3 A;  3EVR A;  2BBM A;  3IQQ A;  3VRQ A;  2ZRT A;  2LVJ A;  4FTG A;  1KWO B;  1PVA A;  3JTD B;  1CDM A;  2LLS A;  2LV7 A;  3KO0 A;  1AUI B;  1G4Y R;  1CM1 A;  3BYA A;  1JBA A;  5F6T A;  1B8R A;  1OSA A;  4OCI A;  2I7A A;  1N65 A;  5HKZ A;  3PN7 B;  1K96 A;  4XYN A;  3I5I B;  4YBH B;  1BJF A;  3SG6 A;  1LA0 A;  2LUX A;  2SCP A;  1SPY A;  1W7I B;  1YUS A;  1YX8 A;  1ZAC A;  1K90 D;  2OTG C;  3KEV A;  5HKW A;  1QVI Y;  1UHN A;  1XA5 A;  2Y1N A;  5K89 A;  4DIR A;  1V1G A;  2KDH A;  5GQQ C;  1AJ4 A;  1DJX A;  1B9A A;  1DJY A;  2FCE A;  3HX4 A;  3AAJ A;  4YGC B;  4MZL A;  1OMR A;  1UUR A;  4MRX A;  4U8D A;  4ZCU A;  4BY5 A;  2F8P A;  1G33 A;  3TDU A;  3SG3 A;  4USL A;  1W7J B;  3FWC A;  4ORB B;  3SG7 A;  1NX1 A;  1ZFS A;  3SG2 A;  1Y6W A;  1MF8 B;  2WOR A;  2ZNE A;  5DKN A;  4MLW A;  1QIV A;  2CCM A;  3OB2 B;  2OTG B;  3BQ3 A;  3M0W A;  4M2O A;  1SBJ A;  1PUL A;  1YUR A;  2EC6 C;  1XFW O;  1Y1A A;  3DVM A;  3LCP C;  1DJI A;  1OMV A;  1VRK A;  2LP2 A;  1NUB A;  3CLN A;  1ALV A;  1TNP A;  2JRF A;  1BR4 B;  3ICB A;  3VRP A;  1S5G Z;  1IH0 A;  1TNQ A;  2KQ6 A;  2BE6 A;  2M1U A;  4PAL A;  2LHI A;  1SW8 A;  4GUK A;  1NYA A;  5D7F A;  1AVS A;  3BUX B;  2L5X B;  2ISD A;  1CM4 A;  3BUM B;  3EVU A;  1C7V A;  2EC6 B;  2JUL A;  1WLZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...