1YRUB

Crystal structure analysis of the adenylyl cyclaes catalytic domain of adenylyl cyclase toxin of bordetella pertussis in presence of c-terminal calmodulin and 1mm calcium chloride
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
69
structure length
69
Chain Sequence
b'TDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional hemolysin-adenylate cyclase
publication title Structural basis for the interaction of Bordetella pertussis adenylyl cyclase toxin with calmodulin
pubmed doi rcsb
source organism Bordetella pertussis
molecule tags Layse, toxin
total genus 20
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2005-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1yruB00
2BBMA 3SG4A 1EXRA 4MLWA 3TS5C 1QIVA 1PK0D 5PALA 1UHJA 3EVVA 2O5GA 4OV2A 3TZ1A 4AQIA 1MXEA 3TS5B 2TN4A 3VRQA 2QPTA 2NCOA 2GV5A 2Y5IA 1NCYA 1YR5A 5J3XA 3EKJA 1YVHA 1EH2A 2L0PA 1K95A 4QJ5B 2FOTA 3H4SE 4NQGA 5G08A 2LVVA 3OHMB 2G2BA 4YBHB 2LNKA 1M63B 3BUXB 3OX6A 2GGZA 2JNXA 2WNDA 2BE4A 1F8HA 1M46A 1IG5A 1DMOA 2R2IA 1WDCB 3TDZA 4CFRA 4DS7A 1DGVA 2LMVA 3NSKA 2LLTA 4L9MA 1SL7A 2LHIA 3LK0A 1DJGA 1IQ3A 1K2HA 1SMGA 1SRAA 1IWQA 1DJYA 1LINA 1YTZC 1J7OA 3BUWB 4GAOA 2KSPA 2CXJA 5HKZA 3JVTC 3I5IC 2K2FA 2SASA 1DJXA 3BUNB 1MWNA 3JVTB 3I5IB 2BBNA 2KQ6A 4CPVA 1C7VA 3QRXA 3BOWB 1AJ5A 4CFQA 3FWBA 4QJ4B 4FQOA 2Q91A 4JQ0D 1IJ6A 1SK6D 3WHUB 3OB1B 3PFVA 1Y1UA 1B8RA 3VRPA 1N0YA 4GGFC 1QLSA 1KK8C 1OOJA 1KK7Z 2KDHA 2H61C 1YVLA 1A2XA 2MA2A 1KK8B 1IKUA 1ALWA 1LA0A 4C0JA 4CIDA 1JFKA 2LANA 3IQOA 1B7TZ 2AAOA 1SCVA 2EGDA 1JFJA 1DF0B 1OMVA 5BPJA 3VROA 4N1GA 1DJZA 1KWOC 2WCBA 1XFUO 2KBIA 1XK4C 1KWOB 2ZFDA 3BOWA 3EKHA 2KBMA 4MN0A 3FIAA 4QJ3B 1QXPA 1TNQA 1K90D 1XA5A 2OPOA 2V53A 2JT0A 2M7NA 2BKHB 2JNFA 3CS1A 1UP5A 2M1KB 4CLNA 1QJTA 2DOQA 3VRNA 4C0LA 1M31A 2JC2A 2LC5A 1PALA 2FJUB 1D1OA 3BXKA 2M29A 3D0YB 2LUCA 4ORAB 1CKKA 1NX2A 3TDIA 1Y1XA 4PALA 1DF0A 4I5KA 2KOTA 5CSFA 1KK7Y 3SJSA 3SG2A 2P6BB 1JSAA 2KFHA 1V1GA 1GGWA 1FBVA 1S1EA 1YRTB 1JUOA 4AOMA 1FI6A 1CNPA 4PHMA 1SKTA 4MZLA 3VGOA 4D1EA 3C1VA 1TTXA 2LP3A 1TCFA 2MLEC 3VRRA 1KFXS 1JWDA 1NWDA 1XFVO 2LM5A 1WY9A 1SR6C 1XFYO 3D0YA 1NP8A 5ER5A 4TNCA 1AJ4A 3DVEA 1SR6B 1S3PA 3M0WA 1A75A 2LCPA 1Q80A 3WXAA 4YGCB 1G33A 2KQYA 2L4HA 2LP2A 4MSPA 4PHNA 1FF1A 3I5HC 1S6IA 3CWGA 1WRLA 1LXFC 4M2OA 1BU3A 2CCMA 3I5HB 4MEWA 2JZIA 4YGAA 5ER4X 2L2EA 3RM1A 1KSOA 1CMFA 4AQJA 2F2OA 1B8LA 4YGDB 1OE9B 3HCMA 1RK9A 1L2OC 2Y1MA 2K8MB 1ZOTB 1S6JA 4PCWA 3OB2B 2K7OA 4DUQA 1L2OB 1N65A 1F70A 2I2RE 1F71A 2E30A 1UWOA 3I5FC 4USLA 4A4CA 2HETA 1JF2A 1BMOA 1XYDA 3I5FB 3CTNA 1PVAA 1QIWA 2KYCA 2ZN9A 2BL0C 2JQ6A 4YRUA 4I5JA 3EVRA 2K7BA 3LK1A 1DJIA 1KFUL 2BL0B 2LLSA 1EJ3A 3NSOA 2WC8A 1TIZA 3LLEA 1RECA 3DVMA 4IL1A 3ICBA 4BY4A 4OR9B 3GK4X 5CPVA 2HQ8A 1K93D 2A4JA 1S5GY 1L7ZA 1BOCA 1Y6WA 2JTZA 3AAKA 1K96A 2BCBA 1NSHA 4NDCA 2HPSA 2ISDA 1FW4A 2JT8A 4MRXA 1B4CA 1R2UA 2COLB 4P5OE 1CMGA 2ZKMX 4NDDA 2L5XB 1FPWA 1PVBA 1YX7A 2KNEA 3OP0A 4XYNA 3SG3A 1UHHA 2LMUA 3WHTB 1YUUA 2M0RA 2BECA 3LCPC 4GBAA 5TNCA 1ZACA 1SW8A 2PMYA 2Y4QA 4MBEA 1QTXA 3CR4X 2KGBC 1Y0VH 2OTGC 3PM8A 1YUSA 3CR2A 2OS8C 1S6CA 2OTGB 4WQ3A 1MQ1A 3DF0B 2K7DA 2KI6C 2OS8B 4Q04A 1JC2A 1IJ5A 1TCOB 2KI4C 2LVIA 1J1DA 5KTYA 4MZJA 1TOPA 4P2YB 1CM1A 1YRUB 5I2LA 1AUIB 4UPGA 2L4IA 1WRZA 1CDNA 4A4BA 2M97A 1LKJA 2H2KA 1OZSA 1AP4A 2E6WA 2KAXA 2MRDA 4YGBB 2PVBA 4PDZA 1UHNA 5AXIA 4PHKA 2K61A 1CDLA 1QX2A 2LV7A 2O60A 3F45A 1BODA 2KGRA 3KO0A 1EG4A 1J7RA 2LAPA 2MHHA 2F8PA 4PHJA 3PATA 4GGFA 2JU0A 4PE7A 5JJGA 2H61A 1JBAA 3IF7A 1PRWA 3DF0A 1W7IB 3RLZA 1TN4A 1WRKA 5I2QA 4WRIA 3PLFB 4HRGA 1A75B 3DVKA 2WORA 3NSIA 4C0KA 2MLFC 1CFPA 2F3ZA 1BR4B 1LVCD 2QACA 5I8NA 1NX3A 5D69A 1XK4A 4ORCB 2JPTA 3LL8B 1CFCA 3AAJA 1XFZO 1NIWA 1NUBA 5AFPA 1K9PA 1K8UA 1OMDA 1UUSA 3KF9A 4I5NB 2MBXA 3SG5A 2EC6C 2L98A 3E3RA 3O78A 3KHEA 4GUKA 5AERA 1U5IB 2KAVA 5D7FA 1J7PA 2EC6B 2HQWA 1DTLA 1CFDA 4BY5A 3CLNA 1IH0A 1HT9A 4ZCUA 1SYMA 1OMRA 1S26D 1S5GZ 2WCEA 3ZNIA 2JRFA 4YGEB 1AHRA 5DKQA 1IGVA 1TRFA 2JTTA 4OVNF 2JULA 2F33A 1YUTA 1QX5B 2CBLA 2M1UA 1TNXA 1XFWO 3AKAA 3CZTX 4OCIA 1U5IA 5KU1A 3JTDC 5B8IB 1SPYA 4GPLB 1BLQA 3FWCA 3ZWHA 3JTDB 3O2PA 1QVIY 3CR5X 1KQMC 4I5LB 2EHBA 1OQPA 4DIRA 2JOJA 4JPZB 4DRWA 5FYXA 1ZFSA 2LMTA 1H8BA 2KI6D 4GNKB 1SNLA 4NDBA 3TUYC 2NXQA 2VRGA 1MXLC 5JOLA 1CLLA 2Y1NA 1EG3A 1DVIA 4DCKA 1SL9A 2HF5A 4M2QA 3EK8A 5F6TA 4U8DA 1M39A 3PN7C 2LHLA 3SIAA 4MVFA 1RFJA 3EK4A 1N2DA 5DKNA 1BG1A 4WQ2A 3PSRA 1OZOA 2NLNA 3PN7B 2BCXA 1HQVA 2KHNA 3CGAA 1CTRA 2LUXA 1S36A 4JWQA 1XFXO 2KYFA 2PRUA 3KPXA 1KSMA 3HX4A 2M8UA 1WDCC 3GOFA 1F55A 1RJVA 1CLBA 4R1EA 4YI9A 2I7AA 5DKRA 3TDUA 3BQ3A 2WOSA 2F3YA 3KEVA 1MHOA 2M3WA 2SCPA 3OX5A 2G9BA 3MSEB 3EVUA 3O4YA 1NCZA 2L50A 1C7WA 1MR8A 4F0ZB 1CB1A 1EL4A 2BCAA 1YX8A 2ZNEA 1BJFA 4FTGA 1BF5A 2MAZA 2LVKA 2NCPA 2KAYA 4N5XA 1DT7B 1CLMA 2WCFA 1QV1A 1G4YR 2CT9A 1K9KA 2KI4B 2KFGA 3GK2A 1G8IA 1QS7A 2FCDA 1LA3A 2JWWA 1MF8B 2D8NA 1B47A 1ZUZA 2PSRA 3NSLA 4GFTA 2JT3A 1B8CA 4MZKA 2BE6A 3BUOB 4M2PA 1TNPA 5CSIA 1KFUS 4N1FA 1CDMA 3I5GC 1QLKA 2K7CA 1XO5A 1KFXL 2F2PA 1E8AA 4XJKB 1J7QA 3I5GB 5HKWA 1VRKA 1PULA 2M9GA 2PASA 4ICBA 5CSNA 2LE9B 1AVSA 1B1GA 1A4PA 1CFFA 2Q4UA 1SY9A 2ZRTA 1CDPA 1CM4A 1RROA 1GGZA 1SL8A 1IQ5A 3A4UB 3DVJA 2L51A 1FI5A 1WLMA 1GJYA 1QV0A 1BT6A 1YURA 3BYAA 1H4BA 1ZMZA 1QATA 2K0JA 2GGMA 3WNXB 1ALVA 1V1FA 4PE4A 1DGUA 1X02A 3EK7A 2K2AA 2JXLA 5AEQA 1QASA 1J1EA 2ZRSA 1NPQA 2CTNA 1QVIZ 1QX7A 4PE0A 4ZCVA 4XJKA 2KFFA 1RWYA 3SG6A 1UURA 2ZN8A 1PSRA 1J55A 1F4QA 3K21A 1R6PA 3IQQA 1W7JB 5HKYA 1NCXA 5AANA 1K94A 4OKHA 2AUCA 3SG7A 1JF0A 1C07A 1M45A 3AKBA 1KQVA 1MUXA 3A8RA 2LVJA 4HSZA 4PE1A 2IS9A 1B7TY 1RTP1 1WLZA 2M7LA 1OSAA 2I94A 1XVJA 4MRYA 1TNWA 5HYDA 1B9AA 1K9UA 1SCMC 1AK8A 1DJHA 1GQMA 4HREE 1Y1AA 1UHIA 4ORBB 2LLUA 3PALA 5GQQC 1A03A 1SCMB 2FCEA 2M49B 1UHKA 4E68A 1NX0A 5K89A 2ZNDA 5KSZA 1ODBA 2NZ0A 3BUMB 3FS7A 3SIBA 1F4OA 1F54A 2AMIA 2PALA 5IBWA 1PSBA 1NX1A 1A29A 5CSJA 1DJWA 2CNPA 5I2OA 1KCYA 2BKIB 1SBJA 1IRJA 4YI8A 3D10A 1NYAA 3DD4A 2JXCA 1KQMB 2B1UA 3GK1A 4HRHA 2I18A 4GGNA 2RGIA 4ETOA 3O6BA 5HLVA 2MJWB 3NXAA 1BR1B 5HLOA 3TUYB
chains in the Genus database with same CATH superfamily
2BBMA 3SG4A 1EXRA 2WC5A 4MLWA 3TS5C 1QIVA 1PK0D 5PALA 1UHJA 3EVVA 2O5GA 3D74A 4OV2A 3TZ1A 1MXEA 3TS5B 4AQIA 2TN4A 3VRQA 3L4LA 2QPTA 2NCOA 2GV5A 2Y5IA 1NCYA 1YR5A 5J3XA 3EKJA 1YVHA 1EH2A 2L0PA 1K95A 4QJ5B 2FOTA 3H4SE 4NQGA 5G08A 2LVVA 3OHMB 2G2BA 4YBHB 2LNKA 1M63B 3BUXB 3OX6A 2GGZA 2JNXA 2WNDA 2BE4A 2BAPA 1F8HA 1M46A 1IG5A 1DMOA 2R2IA 1WDCB 3TDZA 4CFRA 4DS7A 1DGVA 2LMVA 3NSKA 2LLTA 3DYEA 1SL7A 4L9MA 3SG3A 2LHIA 3LK0A 1DJGA 1IQ3A 1K2HA 1SMGA 1SRAA 2H8VA 1IWQA 1DJYA 1LINA 1YTZC 1J7OA 3BUWB 4GAOA 1OOIX 1SSEB 2CXJA 2KSPA 5HKZA 3JVTC 2KPHA 2K2FA 3I5IC 2SASA 1DJXA 3BUNB 1TUJA 1MWNA 3JVTB 3I5IB 2BBNA 2KQ6A 2GTEA 4CPVA 1C7VA 3DXLA 3QRXA 3BOWB 1AJ5A 4CFQA 3FWBA 4QJ4B 4FQOA 2Q91A 4JQ0D 1IJ6A 4JKTA 1SK6D 3WHUB 3OB1B 3PFVA 5D3OA 3WHTB 1Y1UA 1B8RA 3VRPA 1N0YA 4GGFC 1QLSA 1KK8C 1OOJA 1KK7Z 2KDHA 2H61C 1YVLA 1A2XA 2MA2A 1KK8B 1IKUA 1ALWA 1LA0A 4C0JA 4CIDA 1JFKA 2LANA 3IQOA 1B7TZ 2AAOA 1SCVA 2EGDA 1JFJA 1DF0B 1OMVA 5BPJA 3VROA 4N1GA 1DJZA 1KWOC 2WCBA 1XFUO 2KBIA 1XK4C 1KWOB 2ZFDA 3BOWA 3EKHA 2KBMA 4MN0A 3B87A 3FIAA 4QJ3B 3EG5B 1QXPA 1TNQA 1K90D 1XA5A 2OPOA 3S0BA 2V53A 2JT0A 2M7NA 2BKHB 2JNFA 3CS1A 1UP5A 2M1KB 4CLNA 1QJTA 3UO9A 2DOQA 3VRNA 4C0LA 1M31A 2JC2A 2LC5A 3CZ2A 1PALA 2FJUB 1D1OA 3BXKA 2M29A 3D0YB 2LUCA 4ORAB 1CKKA 1NX2A 3TDIA 1Y1XA 1C3YA 4PALA 1DF0A 2KLEA 4I5KA 2KOTA 5CSFA 1KK7Y 3SJSA 3SG2A 2P6BB 1JSAA 2KFHA 1V1GA 2P70A 1GGWA 1FBVA 1S1EA 1YRTB 1JUOA 4AOMA 5HL1A 1FI6A 1CNPA 4PHMA 5FI6A 1SKTA 4MZLA 3VGOA 1ORGA 4D1EA 3C1VA 1TTXA 3R1PA 3B88A 2LP3A 1TCFA 2MLEC 3VRRA 1KFXS 1JWDA 1NWDA 1XFVO 2LM5A 3FE8A 1Z2CB 1WY9A 2QEHA 1SR6C 1XFYO 3D0YA 1NP8A 5ER5A 4TNCA 1AJ4A 3BFAA 3DVEA 1SR6B 1S3PA 5I94A 3M0WA 1A75A 2LCPA 1Q80A 3WXAA 4YGCB 1G33A 2KQYA 2L4HA 2LP2A 4MSPA 4PHNA 1FF1A 3I5HC 1DQEA 1S6IA 3CWGA 1WRLA 1LXFC 4M2OA 1BU3A 2CCMA 3I5HB 4MEWA 3CZ1A 2JZIA 4YGAA 3FE6A 5ER4X 1OOGA 2L2EA 2P71A 3B7AA 3O4XA 1KSOA 3RM1A 1CMFA 4AQJA 2F2OA 1B8LA 4YGDB 1OE9B 3HCMA 1RK9A 1L2OC 2Y1MA 2K8MB 1ZOTB 1S6JA 4PCWA 3OB2B 2K7OA 4DUQA 1L2OB 1N65A 1F70A 2I2RE 1F71A 2E30A 1UWOA 3I5FC 4USLA 4A4CA 2HETA 1JF2A 1BMOA 1XYDA 2QDIA 3I5FB 3CTNA 1PVAA 1QIWA 2KYCA 2ZN9A 2BL0C 3SS4A 2JQ6A 4YRUA 4I5JA 3EVRA 2K7BA 3LK1A 1DJIA 1KFUL 2BL0B 2LLSA 1EJ3A 3NSOA 2WC8A 1TIZA 3LLEA 1RECA 3DVMA 4IL1A 3ICBA 4BY4A 4OR9B 3GK4X 2ERBA 5CPVA 2HQ8A 1K93D 2A4JA 1S5GY 1L7ZA 1BOCA 1Y6WA 2JTZA 3AAKA 1K96A 2BCBA 1NSHA 4NDCA 2HPSA 2ISDA 1FW4A 2JT8A 3S0FA 4MRXA 1B4CA 1R2UA 2COLB 4P5OE 1CMGA 1T14A 2ZKMX 4NDDA 2L5XB 1OOFA 1FPWA 1PVBA 1YX7A 2KNEA 3OP0A 2WCMA 4XYNA 1UHHA 1LS8A 2LMUA 1YUUA 3CABA 4KYNA 2M0RA 3S0DA 2BECA 3S0GA 2PYQA 3LCPC 4GBAA 5TNCA 1ZACA 1QWVA 3R72A 1SW8A 2PMYA 3K1EA 2Y4QA 4MBEA 1QTXA 3CR4X 2KGBC 3DY9A 1Y0VH 2OTGC 3PM8A 1YUSA 3CR2A 2OS8C 1S6CA 2OTGB 4WQ3A 1MQ1A 3DF0B 2K7DA 2KI6C 2OS8B 4Q04A 1JC2A 1IJ5A 1TCOB 4INXA 2KI4C 2LVIA 1J1DA 3Q8IA 5KTYA 4MZJA 1TOPA 4P2YB 1CM1A 1YRUB 5I2LA 1AUIB 4UPGA 2L4IA 2WC6A 1WRZA 3R1VA 1CDNA 4A4BA 2M97A 1LKJA 2PQLA 3RZSA 2H2KA 1OZSA 2L2CA 1AP4A 2E6WA 2KAXA 2MRDA 3BFHA 4YGBB 2PVBA 4PDZA 1UHNA 5AXIA 4PHKA 2K61A 1CDLA 1QX2A 2LV7A 2O60A 3F45A 1BODA 2KGRA 3KO0A 1EG4A 1J7RA 3OBVA 2LAPA 2MHHA 2F8PA 4PHJA 2L5YA 3PATA 4GGFA 2JU0A 4PE7A 5JJGA 1Z4HA 2H61A 1JBAA 3IF7A 1PRWA 3DF0A 1W7IB 3RLZA 1TN4A 1WRKA 5I2QA 3S0AA 4WRIA 3PLFB 4HRGA 1A75B 3DVKA 2WORA 3NSIA 1XFRA 4C0KA 2MLFC 3DZTA 1CFPA 2F3ZA 1BR4B 1LVCD 2QACA 5I8NA 1NX3A 5D69A 4JD9A 1XK4A 3NHIA 1OOHA 4ORCB 2JPTA 3LL8B 1CFCA 3AAJA 1XFZO 1NIWA 1NUBA 5AFPA 1K9PA 1K8UA 1OMDA 5FI2A 1UUSA 3D75A 3V2LA 3KF9A 4I5NB 2MBXA 1BG1A 3SG5A 2EC6C 2L98A 3E3RA 3O78A 3KHEA 4GUKA 5AERA 1U5IB 3OGNA 2KAVA 5D7FA 1J7PA 2EC6B 2HQWA 1DTLA 1CFDA 4BY5A 3CYZA 3CLNA 3CZ0A 1IH0A 1HT9A 3D73A 4ZCUA 1SYMA 1OMRA 1S26D 1S5GZ 2WCEA 3ZNIA 2JRFA 4YGEB 1AHRA 5DKQA 1W9ZA 1IGVA 1TRFA 2JTTA 3NHTA 4OVNF 2JULA 3IVTA 2F33A 1YUTA 5DICA 1QX5B 2CBLA 2M1UA 1TNXA 1XFWO 3AKAA 3CZTX 4OCIA 4OZDA 1U5IA 5KU1A 3JTDC 5B8IB 1SPYA 2WCHA 4GPLB 1BLQA 3FWCA 3ZWHA 3JTDB 3O2PA 1QVIY 3CR5X 1KQMC 4I5LB 2EHBA 1OQPA 4DIRA 2JOJA 4JPZB 4DRWA 5FYXA 1ZFSA 2LMTA 2YGUA 1H8BA 2KI6D 4GNKB 1SNLA 4NDBA 3TUYC 2NXQA 2VRGA 1MXLC 5JOLA 1CLLA 2Y1NA 1EG3A 1DVIA 4DCKA 1SL9A 2HF5A 4M2QA 3PJIA 3EK8A 5F6TA 4U8DA 1M39A 3PN7C 2LHLA 3SIAA 4MVFA 1RFJA 3EK4A 1N2DA 2JPOA 4IJ7A 4WQ2A 5DKNA 3PSRA 3SS5A 1OZOA 2FJYA 2NLNA 3PN7B 2BCXA 1HQVA 2KHNA 3CGAA 1CTRA 1TUZA 2LUXA 3NGVA 1S36A 1P28A 4JWQA 1XFXO 4F7FA 2KYFA 2PRUA 3KPXA 1KSMA 3HX4A 2M8UA 1WDCC 3L4AA 3GOFA 1TWOA 2WCKA 1F55A 1RJVA 1CLBA 4R1EA 4YI9A 2I7AA 3R1OA 5DKRA 3TDUA 3BQ3A 2WOSA 2F3YA 3KEVA 1MHOA 2M3WA 2SCPA 3OX5A 2G9BA 3MSEB 3EVUA 3O4YA 1NCZA 2L50A 3FE9A 4INWA 1C7WA 1MR8A 4F0ZB 1CB1A 1EL4A 2BCAA 1YX8A 2KLDA 2ZNEA 5EL2A 1GM0A 3B6XA 1BJFA 4FTGA 1BF5A 2MAZA 3N7HA 2LVKA 2NCPA 2KAYA 4N5XA 1DT7B 1CLMA 2WCFA 3SS3A 1QV1A 1G4YR 2CT9A 3BJHA 1K9KA 2KI4B 2KFGA 3GK2A 1DC1A 1G8IA 1QS7A 2FCDA 1LA3A 2JWWA 1MF8B 2D8NA 2BNXA 1B47A 1ZUZA 2PSRA 3NSLA 4GFTA 2JT3A 3PM2A 1B8CA 4MZKA 2BE6A 3BUOB 1OW4A 1IIOA 4M2PA 1TNPA 5CSIA 1KFUS 4N1FA 1CDMA 3I5GC 1QLKA 2K7CA 1XO5A 1KFXL 2F2PA 1E8AA 4XJKB 2QEOA 1J7QA 3I5GB 5HKWA 1VRKA 1PULA 2M9GA 3L47A 2PASA 4ICBA 5CSNA 2LE9B 1AVSA 1B1GA 3BFBA 1A4PA 4FQTA 1CFFA 3CDNA 2Q4UA 1SY9A 2ZRTA 1CDPA 1CM4A 1RROA 1GGZA 2WCJA 1SL8A 1IQ5A 2QEVA 3A4UB 3DVJA 2L51A 1FI5A 1WLMA 1GJYA 1QV0A 3B86A 1BT6A 1YURA 3BYAA 1H4BA 1ZMZA 1QATA 2K0JA 2GGMA 3WNXB 1ALVA 1V1FA 4PE4A 1DGUA 1X02A 3EK7A 2K2AA 2JXLA 5AEQA 1QASA 1J1EA 2ZRSA 1NPQA 2CTNA 1QVIZ 1QX7A 4PE0A 4ZCVA 4XJKA 2KFFA 1RWYA 3SG6A 1UURA 2ZN8A 1PSRA 1J55A 1F4QA 3K21A 2QEBA 1R6PA 3IQQA 3D77A 1W7JB 5HKYA 1NCXA 5AANA 1K94A 4OKHA 2AUCA 3SG7A 1JF0A 1C07A 1M45A 3AKBA 1KQVA 1MUXA 3A8RA 2LVJA 4HSZA 4PE1A 2IS9A 1B7TY 3QMEA 1RTP1 1WLZA 2M7LA 1OSAA 2I94A 1XVJA 4MRYA 3UNWA 1TNWA 2WCLA 5HYDA 1B9AA 1K9UA 1SCMC 1AK8A 1DJHA 1GQMA 4HREE 1Y1AA 1UHIA 4ORBB 2LLUA 3PALA 5GQQC 1A03A 1SCMB 3VB1A 2FCEA 2M49B 1UHKA 4E68A 1NX0A 5K89A 2ZNDA 5KSZA 1ODBA 1C3ZA 2NZ0A 3BUMB 5FI7A 3FS7A 3SIBA 1F4OA 1F54A 2AMIA 2PALA 4PT1A 1PSBA 3S0EA 1NX1A 2K60A 5IBWA 1A29A 5CSJA 3D78A 1DJWA 2CNPA 5I2OA 1KCYA 2BKIB 1SBJA 1IRJA 4YI8A 3D10A 1NYAA 3DD4A 2JXCA 1KQMB 2B1UA 3GK1A 1DELA 4HRHA 2I18A 4GGNA 2RGIA 4ETOA 3O6BA 1DEKA 5HLVA 2MJWB 3NXAA 1BR1B 5HLOA 3TUYB 3D76A
chains in the Genus database with same CATH topology
2BBMA 3SG4A 1EXRA 4MLWA 3TS5C 1QIVA 1PK0D 5PALA 1UHJA 3EVVA 2O5GA 4OV2A 3TZ1A 4AQIA 1MXEA 3TS5B 2TN4A 3VRQA 2QPTA 2NCOA 2GV5A 2Y5IA 1NCYA 1YR5A 5J3XA 3EKJA 1YVHA 1EH2A 2L0PA 1K95A 4QJ5B 2FOTA 3H4SE 4NQGA 5G08A 2LVVA 3OHMB 2G2BA 4YBHB 2LNKA 1M63B 3BUXB 3OX6A 2GGZA 2JNXA 2WNDA 2BE4A 1F8HA 1M46A 1IG5A 1DMOA 2R2IA 1WDCB 3TDZA 4CFRA 4DS7A 1DGVA 2LMVA 3NSKA 2LLTA 4L9MA 1SL7A 2LHIA 3LK0A 1DJGA 1IQ3A 1K2HA 1SMGA 1SRAA 1IWQA 1DJYA 1LINA 1YTZC 1J7OA 3BUWB 4GAOA 2KSPA 2CXJA 5HKZA 3JVTC 3I5IC 2K2FA 2SASA 1DJXA 3BUNB 1MWNA 3JVTB 3I5IB 2BBNA 2KQ6A 4CPVA 1C7VA 3QRXA 3BOWB 1AJ5A 4CFQA 3FWBA 4QJ4B 4FQOA 2Q91A 4JQ0D 1IJ6A 1SK6D 3WHUB 3OB1B 3PFVA 1Y1UA 1B8RA 3VRPA 1N0YA 4GGFC 1QLSA 1KK8C 1OOJA 1KK7Z 2KDHA 2H61C 1YVLA 1A2XA 2MA2A 1KK8B 1IKUA 1ALWA 1LA0A 4C0JA 4CIDA 1JFKA 2LANA 3IQOA 1B7TZ 2AAOA 1SCVA 2EGDA 1JFJA 1DF0B 1OMVA 5BPJA 3VROA 4N1GA 1DJZA 1KWOC 2WCBA 1XFUO 2KBIA 1XK4C 1KWOB 2ZFDA 3BOWA 3EKHA 2KBMA 4MN0A 3FIAA 4QJ3B 1QXPA 1TNQA 1K90D 1XA5A 2OPOA 2V53A 2JT0A 2M7NA 2BKHB 2JNFA 3CS1A 1UP5A 2M1KB 4CLNA 1QJTA 2DOQA 3VRNA 4C0LA 1M31A 2JC2A 2LC5A 1PALA 2FJUB 1D1OA 3BXKA 2M29A 3D0YB 2LUCA 4ORAB 1CKKA 1NX2A 3TDIA 1Y1XA 4PALA 1DF0A 4I5KA 2KOTA 5CSFA 1KK7Y 3SJSA 3SG2A 2P6BB 1JSAA 2KFHA 1V1GA 1GGWA 1FBVA 1S1EA 1YRTB 1JUOA 4AOMA 1FI6A 1CNPA 4PHMA 1SKTA 4MZLA 3VGOA 4D1EA 3C1VA 1TTXA 2LP3A 1TCFA 2MLEC 3VRRA 1KFXS 1JWDA 1NWDA 1XFVO 2LM5A 1WY9A 1SR6C 1XFYO 3D0YA 1NP8A 5ER5A 4TNCA 1AJ4A 3DVEA 1SR6B 1S3PA 3M0WA 1A75A 2LCPA 1Q80A 3WXAA 4YGCB 1G33A 2KQYA 2L4HA 2LP2A 4MSPA 4PHNA 1FF1A 3I5HC 1S6IA 3CWGA 1WRLA 1LXFC 4M2OA 1BU3A 2CCMA 3I5HB 4MEWA 2JZIA 4YGAA 5ER4X 2L2EA 3RM1A 1KSOA 1CMFA 4AQJA 2F2OA 1B8LA 4YGDB 1OE9B 3HCMA 1RK9A 1L2OC 2Y1MA 2K8MB 1ZOTB 1S6JA 4PCWA 3OB2B 2K7OA 4DUQA 1L2OB 1N65A 1F70A 2I2RE 1F71A 2E30A 1UWOA 3I5FC 4USLA 4A4CA 2HETA 1JF2A 1BMOA 1XYDA 3I5FB 3CTNA 1PVAA 1QIWA 2KYCA 2ZN9A 2BL0C 2JQ6A 4YRUA 4I5JA 3EVRA 2K7BA 3LK1A 1DJIA 1KFUL 2BL0B 2LLSA 1EJ3A 3NSOA 2WC8A 1TIZA 3LLEA 1RECA 3DVMA 4IL1A 3ICBA 4BY4A 4OR9B 3GK4X 5CPVA 2HQ8A 1K93D 2A4JA 1S5GY 1L7ZA 1BOCA 1Y6WA 2JTZA 3AAKA 1K96A 2BCBA 1NSHA 4NDCA 2HPSA 2ISDA 1FW4A 2JT8A 4MRXA 1B4CA 1R2UA 2COLB 4P5OE 1CMGA 2ZKMX 4NDDA 2L5XB 1FPWA 1PVBA 1YX7A 2KNEA 3OP0A 4XYNA 3SG3A 1UHHA 2LMUA 3WHTB 1YUUA 2M0RA 2BECA 3LCPC 4GBAA 5TNCA 1ZACA 1SW8A 2PMYA 2Y4QA 4MBEA 1QTXA 3CR4X 2KGBC 1Y0VH 2OTGC 3PM8A 1YUSA 3CR2A 2OS8C 1S6CA 2OTGB 4WQ3A 1MQ1A 3DF0B 2K7DA 2KI6C 2OS8B 4Q04A 1JC2A 1IJ5A 1TCOB 2KI4C 2LVIA 1J1DA 5KTYA 4MZJA 1TOPA 4P2YB 1CM1A 1YRUB 5I2LA 1AUIB 4UPGA 2L4IA 1WRZA 1CDNA 4A4BA 2M97A 1LKJA 2H2KA 1OZSA 1AP4A 2E6WA 2KAXA 2MRDA 4YGBB 2PVBA 4PDZA 1UHNA 5AXIA 4PHKA 2K61A 1CDLA 1QX2A 2LV7A 2O60A 3F45A 1BODA 2KGRA 3KO0A 1EG4A 1J7RA 2LAPA 2MHHA 2F8PA 4PHJA 3PATA 4GGFA 2JU0A 4PE7A 5JJGA 2H61A 1JBAA 3IF7A 1PRWA 3DF0A 1W7IB 3RLZA 1TN4A 1WRKA 5I2QA 4WRIA 3PLFB 4HRGA 1A75B 3DVKA 2WORA 3NSIA 4C0KA 2MLFC 1CFPA 2F3ZA 1BR4B 1LVCD 2QACA 5I8NA 1NX3A 5D69A 1XK4A 4ORCB 2JPTA 3LL8B 1CFCA 3AAJA 1XFZO 1NIWA 1NUBA 5AFPA 1K9PA 1K8UA 1OMDA 1UUSA 3KF9A 4I5NB 2MBXA 3SG5A 2EC6C 2L98A 3E3RA 3O78A 3KHEA 4GUKA 5AERA 1U5IB 2KAVA 5D7FA 1J7PA 2EC6B 2HQWA 1DTLA 1CFDA 4BY5A 3CLNA 1IH0A 1HT9A 4ZCUA 1SYMA 1OMRA 1S26D 1S5GZ 2WCEA 3ZNIA 2JRFA 4YGEB 1AHRA 5DKQA 1IGVA 1TRFA 2JTTA 4OVNF 2JULA 2F33A 1YUTA 1QX5B 2CBLA 2M1UA 1TNXA 1XFWO 3AKAA 3CZTX 4OCIA 1U5IA 5KU1A 3JTDC 5B8IB 1SPYA 4GPLB 1BLQA 3FWCA 3ZWHA 3JTDB 3O2PA 1QVIY 3CR5X 1KQMC 4I5LB 2EHBA 1OQPA 4DIRA 2JOJA 4JPZB 4DRWA 5FYXA 1ZFSA 2LMTA 1H8BA 2KI6D 4GNKB 1SNLA 4NDBA 3TUYC 2NXQA 2VRGA 1MXLC 5JOLA 1CLLA 2Y1NA 1EG3A 1DVIA 4DCKA 1SL9A 2HF5A 4M2QA 3EK8A 5F6TA 4U8DA 1M39A 3PN7C 2LHLA 3SIAA 4MVFA 1RFJA 3EK4A 1N2DA 5DKNA 1BG1A 4WQ2A 3PSRA 1OZOA 2NLNA 3PN7B 2BCXA 1HQVA 2KHNA 3CGAA 1CTRA 2LUXA 1S36A 4JWQA 1XFXO 2KYFA 2PRUA 3KPXA 1KSMA 3HX4A 2M8UA 1WDCC 3GOFA 1F55A 1RJVA 1CLBA 4R1EA 4YI9A 2I7AA 5DKRA 3TDUA 3BQ3A 2WOSA 2F3YA 3KEVA 1MHOA 2M3WA 2SCPA 3OX5A 2G9BA 3MSEB 3EVUA 3O4YA 1NCZA 2L50A 1C7WA 1MR8A 4F0ZB 1CB1A 1EL4A 2BCAA 1YX8A 2ZNEA 1BJFA 4FTGA 1BF5A 2MAZA 2LVKA 2NCPA 2KAYA 4N5XA 1DT7B 1CLMA 2WCFA 1QV1A 1G4YR 2CT9A 1K9KA 2KI4B 2KFGA 3GK2A 1G8IA 1QS7A 2FCDA 1LA3A 2JWWA 1MF8B 2D8NA 1B47A 1ZUZA 2PSRA 3NSLA 4GFTA 2JT3A 1B8CA 4MZKA 2BE6A 3BUOB 4M2PA 1TNPA 5CSIA 1KFUS 4N1FA 1CDMA 3I5GC 1QLKA 2K7CA 1XO5A 1KFXL 2F2PA 1E8AA 4XJKB 1J7QA 3I5GB 5HKWA 1VRKA 1PULA 2M9GA 2PASA 4ICBA 5CSNA 2LE9B 1AVSA 1B1GA 1A4PA 1CFFA 2Q4UA 1SY9A 2ZRTA 1CDPA 1CM4A 1RROA 1GGZA 1SL8A 1IQ5A 3A4UB 3DVJA 2L51A 1FI5A 1WLMA 1GJYA 1QV0A 1BT6A 1YURA 3BYAA 1H4BA 1ZMZA 1QATA 2K0JA 2GGMA 3WNXB 1ALVA 1V1FA 4PE4A 1DGUA 1X02A 3EK7A 2K2AA 2JXLA 5AEQA 1QASA 1J1EA 2ZRSA 1NPQA 2CTNA 1QVIZ 1QX7A 4PE0A 4ZCVA 4XJKA 2KFFA 1RWYA 3SG6A 1UURA 2ZN8A 1PSRA 1J55A 1F4QA 3K21A 1R6PA 3IQQA 1W7JB 5HKYA 1NCXA 5AANA 1K94A 4OKHA 2AUCA 3SG7A 1JF0A 1C07A 1M45A 3AKBA 1KQVA 1MUXA 3A8RA 2LVJA 4HSZA 4PE1A 2IS9A 1B7TY 1RTP1 1WLZA 2M7LA 1OSAA 2I94A 1XVJA 4MRYA 1TNWA 5HYDA 1B9AA 1K9UA 1SCMC 1AK8A 1DJHA 1GQMA 4HREE 1Y1AA 1UHIA 4ORBB 2LLUA 3PALA 5GQQC 1A03A 1SCMB 2FCEA 2M49B 1UHKA 4E68A 1NX0A 5K89A 2ZNDA 5KSZA 1ODBA 2NZ0A 3BUMB 3FS7A 3SIBA 1F4OA 1F54A 2AMIA 2PALA 5IBWA 1PSBA 1NX1A 1A29A 5CSJA 1DJWA 2CNPA 5I2OA 1KCYA 2BKIB 1SBJA 1IRJA 4YI8A 3D10A 1NYAA 3DD4A 2JXCA 1KQMB 2B1UA 3GK1A 4HRHA 2I18A 4GGNA 2RGIA 4ETOA 3O6BA 5HLVA 2MJWB 3NXAA 1BR1B 5HLOA 3TUYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BBM A;  3SG4 A;  1EXR A;  4MLW A;  3TS5 C;  1QIV A;  1PK0 D;  5PAL A;  1UHJ A;  3EVV A;  2O5G A;  4OV2 A;  3TZ1 A;  4AQI A;  1MXE A;  3TS5 B;  2TN4 A;  3VRQ A;  2QPT A;  2NCO A;  2GV5 A;  2Y5I A;  1NCY A;  1YR5 A;  5J3X A;  3EKJ A;  1YVH A;  1EH2 A;  2L0P A;  1K95 A;  4QJ5 B;  2FOT A;  3H4S E;  4NQG A;  5G08 A;  2LVV A;  3OHM B;  2G2B A;  4YBH B;  2LNK A;  1M63 B;  3BUX B;  3OX6 A;  2GGZ A;  2JNX A;  2WND A;  2BE4 A;  1F8H A;  1M46 A;  1IG5 A;  1DMO A;  2R2I A;  1WDC B;  3TDZ A;  4CFR A;  4DS7 A;  1DGV A;  2LMV A;  3NSK A;  2LLT A;  4L9M A;  1SL7 A;  2LHI A;  3LK0 A;  1DJG A;  1IQ3 A;  1K2H A;  1SMG A;  1SRA A;  1IWQ A;  1DJY A;  1LIN A;  1YTZ C;  1J7O A;  3BUW B;  4GAO A;  2KSP A;  2CXJ A;  5HKZ A;  3JVT C;  3I5I C;  2K2F A;  2SAS A;  1DJX A;  3BUN B;  1MWN A;  3JVT B;  3I5I B;  2BBN A;  2KQ6 A;  4CPV A;  1C7V A;  3QRX A;  3BOW B;  1AJ5 A;  4CFQ A;  3FWB A;  4QJ4 B;  4FQO A;  2Q91 A;  4JQ0 D;  1IJ6 A;  1SK6 D;  3WHU B;  3OB1 B;  3PFV A;  1Y1U A;  1B8R A;  3VRP A;  1N0Y A;  4GGF C;  1QLS A;  1KK8 C;  1OOJ A;  1KK7 Z;  2KDH A;  2H61 C;  1YVL A;  1A2X A;  2MA2 A;  1KK8 B;  1IKU A;  1ALW A;  1LA0 A;  4C0J A;  4CID A;  1JFK A;  2LAN A;  3IQO A;  1B7T Z;  2AAO A;  1SCV A;  2EGD A;  1JFJ A;  1DF0 B;  1OMV A;  5BPJ A;  3VRO A;  4N1G A;  1DJZ A;  1KWO C;  2WCB A;  1XFU O;  2KBI A;  1XK4 C;  1KWO B;  2ZFD A;  3BOW A;  3EKH A;  2KBM A;  4MN0 A;  3FIA A;  4QJ3 B;  1QXP A;  1TNQ A;  1K90 D;  1XA5 A;  2OPO A;  2V53 A;  2JT0 A;  2M7N A;  2BKH B;  2JNF A;  3CS1 A;  1UP5 A;  2M1K B;  4CLN A;  1QJT A;  2DOQ A;  3VRN A;  4C0L A;  1M31 A;  2JC2 A;  2LC5 A;  1PAL A;  2FJU B;  1D1O A;  3BXK A;  2M29 A;  3D0Y B;  2LUC A;  4ORA B;  1CKK A;  1NX2 A;  3TDI A;  1Y1X A;  4PAL A;  1DF0 A;  4I5K A;  2KOT A;  5CSF A;  1KK7 Y;  3SJS A;  3SG2 A;  2P6B B;  1JSA A;  2KFH A;  1V1G A;  1GGW A;  1FBV A;  1S1E A;  1YRT B;  1JUO A;  4AOM A;  1FI6 A;  1CNP A;  4PHM A;  1SKT A;  4MZL A;  3VGO A;  4D1E A;  3C1V A;  1TTX A;  2LP3 A;  1TCF A;  2MLE C;  3VRR A;  1KFX S;  1JWD A;  1NWD A;  1XFV O;  2LM5 A;  1WY9 A;  1SR6 C;  1XFY O;  3D0Y A;  1NP8 A;  5ER5 A;  4TNC A;  1AJ4 A;  3DVE A;  1SR6 B;  1S3P A;  3M0W A;  1A75 A;  2LCP A;  1Q80 A;  3WXA A;  4YGC B;  1G33 A;  2KQY A;  2L4H A;  2LP2 A;  4MSP A;  4PHN A;  1FF1 A;  3I5H C;  1S6I A;  3CWG A;  1WRL A;  1LXF C;  4M2O A;  1BU3 A;  2CCM A;  3I5H B;  4MEW A;  2JZI A;  4YGA A;  5ER4 X;  2L2E A;  3RM1 A;  1KSO A;  1CMF A;  4AQJ A;  2F2O A;  1B8L A;  4YGD B;  1OE9 B;  3HCM A;  1RK9 A;  1L2O C;  2Y1M A;  2K8M B;  1ZOT B;  1S6J A;  4PCW A;  3OB2 B;  2K7O A;  4DUQ A;  1L2O B;  1N65 A;  1F70 A;  2I2R E;  1F71 A;  2E30 A;  1UWO A;  3I5F C;  4USL A;  4A4C A;  2HET A;  1JF2 A;  1BMO A;  1XYD A;  3I5F B;  3CTN A;  1PVA A;  1QIW A;  2KYC A;  2ZN9 A;  2BL0 C;  2JQ6 A;  4YRU A;  4I5J A;  3EVR A;  2K7B A;  3LK1 A;  1DJI A;  1KFU L;  2BL0 B;  2LLS A;  1EJ3 A;  3NSO A;  2WC8 A;  1TIZ A;  3LLE A;  1REC A;  3DVM A;  4IL1 A;  3ICB A;  4BY4 A;  4OR9 B;  3GK4 X;  5CPV A;  2HQ8 A;  1K93 D;  2A4J A;  1S5G Y;  1L7Z A;  1BOC A;  1Y6W A;  2JTZ A;  3AAK A;  1K96 A;  2BCB A;  1NSH A;  4NDC A;  2HPS A;  2ISD A;  1FW4 A;  2JT8 A;  4MRX A;  1B4C A;  1R2U A;  2COL B;  4P5O E;  1CMG A;  2ZKM X;  4NDD A;  2L5X B;  1FPW A;  1PVB A;  1YX7 A;  2KNE A;  3OP0 A;  4XYN A;  3SG3 A;  1UHH A;  2LMU A;  3WHT B;  1YUU A;  2M0R A;  2BEC A;  3LCP C;  4GBA A;  5TNC A;  1ZAC A;  1SW8 A;  2PMY A;  2Y4Q A;  4MBE A;  1QTX A;  3CR4 X;  2KGB C;  1Y0V H;  2OTG C;  3PM8 A;  1YUS A;  3CR2 A;  2OS8 C;  1S6C A;  2OTG B;  4WQ3 A;  1MQ1 A;  3DF0 B;  2K7D A;  2KI6 C;  2OS8 B;  4Q04 A;  1JC2 A;  1IJ5 A;  1TCO B;  2KI4 C;  2LVI A;  1J1D A;  5KTY A;  4MZJ A;  1TOP A;  4P2Y B;  1CM1 A;  1YRU B;  5I2L A;  1AUI B;  4UPG A;  2L4I A;  1WRZ A;  1CDN A;  4A4B A;  2M97 A;  1LKJ A;  2H2K A;  1OZS A;  1AP4 A;  2E6W A;  2KAX A;  2MRD A;  4YGB B;  2PVB A;  4PDZ A;  1UHN A;  5AXI A;  4PHK A;  2K61 A;  1CDL A;  1QX2 A;  2LV7 A;  2O60 A;  3F45 A;  1BOD A;  2KGR A;  3KO0 A;  1EG4 A;  1J7R A;  2LAP A;  2MHH A;  2F8P A;  4PHJ A;  3PAT A;  4GGF A;  2JU0 A;  4PE7 A;  5JJG A;  2H61 A;  1JBA A;  3IF7 A;  1PRW A;  3DF0 A;  1W7I B;  3RLZ A;  1TN4 A;  1WRK A;  5I2Q A;  4WRI A;  3PLF B;  4HRG A;  1A75 B;  3DVK A;  2WOR A;  3NSI A;  4C0K A;  2MLF C;  1CFP A;  2F3Z A;  1BR4 B;  1LVC D;  2QAC A;  5I8N A;  1NX3 A;  5D69 A;  1XK4 A;  4ORC B;  2JPT A;  3LL8 B;  1CFC A;  3AAJ A;  1XFZ O;  1NIW A;  1NUB A;  5AFP A;  1K9P A;  1K8U A;  1OMD A;  1UUS A;  3KF9 A;  4I5N B;  2MBX A;  3SG5 A;  2EC6 C;  2L98 A;  3E3R A;  3O78 A;  3KHE A;  4GUK A;  5AER A;  1U5I B;  2KAV A;  5D7F A;  1J7P A;  2EC6 B;  2HQW A;  1DTL A;  1CFD A;  4BY5 A;  3CLN A;  1IH0 A;  1HT9 A;  4ZCU A;  1SYM A;  1OMR A;  1S26 D;  1S5G Z;  2WCE A;  3ZNI A;  2JRF A;  4YGE B;  1AHR A;  5DKQ A;  1IGV A;  1TRF A;  2JTT A;  4OVN F;  2JUL A;  2F33 A;  1YUT A;  1QX5 B;  2CBL A;  2M1U A;  1TNX A;  1XFW O;  3AKA A;  3CZT X;  4OCI A;  1U5I A;  5KU1 A;  3JTD C;  5B8I B;  1SPY A;  4GPL B;  1BLQ A;  3FWC A;  3ZWH A;  3JTD B;  3O2P A;  1QVI Y;  3CR5 X;  1KQM C;  4I5L B;  2EHB A;  1OQP A;  4DIR A;  2JOJ A;  4JPZ B;  4DRW A;  5FYX A;  1ZFS A;  2LMT A;  1H8B A;  2KI6 D;  4GNK B;  1SNL A;  4NDB A;  3TUY C;  2NXQ A;  2VRG A;  1MXL C;  5JOL A;  1CLL A;  2Y1N A;  1EG3 A;  1DVI A;  4DCK A;  1SL9 A;  2HF5 A;  4M2Q A;  3EK8 A;  5F6T A;  4U8D A;  1M39 A;  3PN7 C;  2LHL A;  3SIA A;  4MVF A;  1RFJ A;  3EK4 A;  1N2D A;  5DKN A;  1BG1 A;  4WQ2 A;  3PSR A;  1OZO A;  2NLN A;  3PN7 B;  2BCX A;  1HQV A;  2KHN A;  3CGA A;  1CTR A;  2LUX A;  1S36 A;  4JWQ A;  1XFX O;  2KYF A;  2PRU A;  3KPX A;  1KSM A;  3HX4 A;  2M8U A;  1WDC C;  3GOF A;  1F55 A;  1RJV A;  1CLB A;  4R1E A;  4YI9 A;  2I7A A;  5DKR A;  3TDU A;  3BQ3 A;  2WOS A;  2F3Y A;  3KEV A;  1MHO A;  2M3W A;  2SCP A;  3OX5 A;  2G9B A;  3MSE B;  3EVU A;  3O4Y A;  1NCZ A;  2L50 A;  1C7W A;  1MR8 A;  4F0Z B;  1CB1 A;  1EL4 A;  2BCA A;  1YX8 A;  2ZNE A;  1BJF A;  4FTG A;  1BF5 A;  2MAZ A;  2LVK A;  2NCP A;  2KAY A;  4N5X A;  1DT7 B;  1CLM A;  2WCF A;  1QV1 A;  1G4Y R;  2CT9 A;  1K9K A;  2KI4 B;  2KFG A;  3GK2 A;  1G8I A;  1QS7 A;  2FCD A;  1LA3 A;  2JWW A;  1MF8 B;  2D8N A;  1B47 A;  1ZUZ A;  2PSR A;  3NSL A;  4GFT A;  2JT3 A;  1B8C A;  4MZK A;  2BE6 A;  3BUO B;  4M2P A;  1TNP A;  5CSI A;  1KFU S;  4N1F A;  1CDM A;  3I5G C;  1QLK A;  2K7C A;  1XO5 A;  1KFX L;  2F2P A;  1E8A A;  4XJK B;  1J7Q A;  3I5G B;  5HKW A;  1VRK A;  1PUL A;  2M9G A;  2PAS A;  4ICB A;  5CSN A;  2LE9 B;  1AVS A;  1B1G A;  1A4P A;  1CFF A;  2Q4U A;  1SY9 A;  2ZRT A;  1CDP A;  1CM4 A;  1RRO A;  1GGZ A;  1SL8 A;  1IQ5 A;  3A4U B;  3DVJ A;  2L51 A;  1FI5 A;  1WLM A;  1GJY A;  1QV0 A;  1BT6 A;  1YUR A;  3BYA A;  1H4B A;  1ZMZ A;  1QAT A;  2K0J A;  2GGM A;  3WNX B;  1ALV A;  1V1F A;  4PE4 A;  1DGU A;  1X02 A;  3EK7 A;  2K2A A;  2JXL A;  5AEQ A;  1QAS A;  1J1E A;  2ZRS A;  1NPQ A;  2CTN A;  1QVI Z;  1QX7 A;  4PE0 A;  4ZCV A;  4XJK A;  2KFF A;  1RWY A;  3SG6 A;  1UUR A;  2ZN8 A;  1PSR A;  1J55 A;  1F4Q A;  3K21 A;  1R6P A;  3IQQ A;  1W7J B;  5HKY A;  1NCX A;  5AAN A;  1K94 A;  4OKH A;  2AUC A;  3SG7 A;  1JF0 A;  1C07 A;  1M45 A;  3AKB A;  1KQV A;  1MUX A;  3A8R A;  2LVJ A;  4HSZ A;  4PE1 A;  2IS9 A;  1B7T Y;  1RTP 1;  1WLZ A;  2M7L A;  1OSA A;  2I94 A;  1XVJ A;  4MRY A;  1TNW A;  5HYD A;  1B9A A;  1K9U A;  1SCM C;  1AK8 A;  1DJH A;  1GQM A;  4HRE E;  1Y1A A;  1UHI A;  4ORB B;  2LLU A;  3PAL A;  5GQQ C;  1A03 A;  1SCM B;  2FCE A;  2M49 B;  1UHK A;  4E68 A;  1NX0 A;  5K89 A;  2ZND A;  5KSZ A;  1ODB A;  2NZ0 A;  3BUM B;  3FS7 A;  3SIB A;  1F4O A;  1F54 A;  2AMI A;  2PAL A;  5IBW A;  1PSB A;  1NX1 A;  1A29 A;  5CSJ A;  1DJW A;  2CNP A;  5I2O A;  1KCY A;  2BKI B;  1SBJ A;  1IRJ A;  4YI8 A;  3D10 A;  1NYA A;  3DD4 A;  2JXC A;  1KQM B;  2B1U A;  3GK1 A;  4HRH A;  2I18 A;  4GGN A;  2RGI A;  4ETO A;  3O6B A;  5HLV A;  2MJW B;  3NXA A;  1BR1 B;  5HLO A;  3TUY B; 
#chains in the Genus database with same CATH topology
 2BBM A;  3SG4 A;  1EXR A;  2WC5 A;  4MLW A;  3TS5 C;  1QIV A;  1PK0 D;  5PAL A;  1UHJ A;  3EVV A;  2O5G A;  3D74 A;  4OV2 A;  3TZ1 A;  1MXE A;  3TS5 B;  4AQI A;  2TN4 A;  3VRQ A;  3L4L A;  2QPT A;  2NCO A;  2GV5 A;  2Y5I A;  1NCY A;  1YR5 A;  5J3X A;  3EKJ A;  1YVH A;  1EH2 A;  2L0P A;  1K95 A;  4QJ5 B;  2FOT A;  3H4S E;  4NQG A;  5G08 A;  2LVV A;  3OHM B;  2G2B A;  4YBH B;  2LNK A;  1M63 B;  3BUX B;  3OX6 A;  2GGZ A;  2JNX A;  2WND A;  2BE4 A;  2BAP A;  1F8H A;  1M46 A;  1IG5 A;  1DMO A;  2R2I A;  1WDC B;  3TDZ A;  4CFR A;  4DS7 A;  1DGV A;  2LMV A;  3NSK A;  2LLT A;  3DYE A;  1SL7 A;  4L9M A;  3SG3 A;  2LHI A;  3LK0 A;  1DJG A;  1IQ3 A;  1K2H A;  1SMG A;  1SRA A;  2H8V A;  1IWQ A;  1DJY A;  1LIN A;  1YTZ C;  1J7O A;  3BUW B;  4GAO A;  1OOI X;  1SSE B;  2CXJ A;  2KSP A;  5HKZ A;  3JVT C;  2KPH A;  2K2F A;  3I5I C;  2SAS A;  1DJX A;  3BUN B;  1TUJ A;  1MWN A;  3JVT B;  3I5I B;  2BBN A;  2KQ6 A;  2GTE A;  4CPV A;  1C7V A;  3DXL A;  3QRX A;  3BOW B;  1AJ5 A;  4CFQ A;  3FWB A;  4QJ4 B;  4FQO A;  2Q91 A;  4JQ0 D;  1IJ6 A;  4JKT A;  1SK6 D;  3WHU B;  3OB1 B;  3PFV A;  5D3O A;  3WHT B;  1Y1U A;  1B8R A;  3VRP A;  1N0Y A;  4GGF C;  1QLS A;  1KK8 C;  1OOJ A;  1KK7 Z;  2KDH A;  2H61 C;  1YVL A;  1A2X A;  2MA2 A;  1KK8 B;  1IKU A;  1ALW A;  1LA0 A;  4C0J A;  4CID A;  1JFK A;  2LAN A;  3IQO A;  1B7T Z;  2AAO A;  1SCV A;  2EGD A;  1JFJ A;  1DF0 B;  1OMV A;  5BPJ A;  3VRO A;  4N1G A;  1DJZ A;  1KWO C;  2WCB A;  1XFU O;  2KBI A;  1XK4 C;  1KWO B;  2ZFD A;  3BOW A;  3EKH A;  2KBM A;  4MN0 A;  3B87 A;  3FIA A;  4QJ3 B;  3EG5 B;  1QXP A;  1TNQ A;  1K90 D;  1XA5 A;  2OPO A;  3S0B A;  2V53 A;  2JT0 A;  2M7N A;  2BKH B;  2JNF A;  3CS1 A;  1UP5 A;  2M1K B;  4CLN A;  1QJT A;  3UO9 A;  2DOQ A;  3VRN A;  4C0L A;  1M31 A;  2JC2 A;  2LC5 A;  3CZ2 A;  1PAL A;  2FJU B;  1D1O A;  3BXK A;  2M29 A;  3D0Y B;  2LUC A;  4ORA B;  1CKK A;  1NX2 A;  3TDI A;  1Y1X A;  1C3Y A;  4PAL A;  1DF0 A;  2KLE A;  4I5K A;  2KOT A;  5CSF A;  1KK7 Y;  3SJS A;  3SG2 A;  2P6B B;  1JSA A;  2KFH A;  1V1G A;  2P70 A;  1GGW A;  1FBV A;  1S1E A;  1YRT B;  1JUO A;  4AOM A;  5HL1 A;  1FI6 A;  1CNP A;  4PHM A;  5FI6 A;  1SKT A;  4MZL A;  3VGO A;  1ORG A;  4D1E A;  3C1V A;  1TTX A;  3R1P A;  3B88 A;  2LP3 A;  1TCF A;  2MLE C;  3VRR A;  1KFX S;  1JWD A;  1NWD A;  1XFV O;  2LM5 A;  3FE8 A;  1Z2C B;  1WY9 A;  2QEH A;  1SR6 C;  1XFY O;  3D0Y A;  1NP8 A;  5ER5 A;  4TNC A;  1AJ4 A;  3BFA A;  3DVE A;  1SR6 B;  1S3P A;  5I94 A;  3M0W A;  1A75 A;  2LCP A;  1Q80 A;  3WXA A;  4YGC B;  1G33 A;  2KQY A;  2L4H A;  2LP2 A;  4MSP A;  4PHN A;  1FF1 A;  3I5H C;  1DQE A;  1S6I A;  3CWG A;  1WRL A;  1LXF C;  4M2O A;  1BU3 A;  2CCM A;  3I5H B;  4MEW A;  3CZ1 A;  2JZI A;  4YGA A;  3FE6 A;  5ER4 X;  1OOG A;  2L2E A;  2P71 A;  3B7A A;  3O4X A;  1KSO A;  3RM1 A;  1CMF A;  4AQJ A;  2F2O A;  1B8L A;  4YGD B;  1OE9 B;  3HCM A;  1RK9 A;  1L2O C;  2Y1M A;  2K8M B;  1ZOT B;  1S6J A;  4PCW A;  3OB2 B;  2K7O A;  4DUQ A;  1L2O B;  1N65 A;  1F70 A;  2I2R E;  1F71 A;  2E30 A;  1UWO A;  3I5F C;  4USL A;  4A4C A;  2HET A;  1JF2 A;  1BMO A;  1XYD A;  2QDI A;  3I5F B;  3CTN A;  1PVA A;  1QIW A;  2KYC A;  2ZN9 A;  2BL0 C;  3SS4 A;  2JQ6 A;  4YRU A;  4I5J A;  3EVR A;  2K7B A;  3LK1 A;  1DJI A;  1KFU L;  2BL0 B;  2LLS A;  1EJ3 A;  3NSO A;  2WC8 A;  1TIZ A;  3LLE A;  1REC A;  3DVM A;  4IL1 A;  3ICB A;  4BY4 A;  4OR9 B;  3GK4 X;  2ERB A;  5CPV A;  2HQ8 A;  1K93 D;  2A4J A;  1S5G Y;  1L7Z A;  1BOC A;  1Y6W A;  2JTZ A;  3AAK A;  1K96 A;  2BCB A;  1NSH A;  4NDC A;  2HPS A;  2ISD A;  1FW4 A;  2JT8 A;  3S0F A;  4MRX A;  1B4C A;  1R2U A;  2COL B;  4P5O E;  1CMG A;  1T14 A;  2ZKM X;  4NDD A;  2L5X B;  1OOF A;  1FPW A;  1PVB A;  1YX7 A;  2KNE A;  3OP0 A;  2WCM A;  4XYN A;  1UHH A;  1LS8 A;  2LMU A;  1YUU A;  3CAB A;  4KYN A;  2M0R A;  3S0D A;  2BEC A;  3S0G A;  2PYQ A;  3LCP C;  4GBA A;  5TNC A;  1ZAC A;  1QWV A;  3R72 A;  1SW8 A;  2PMY A;  3K1E A;  2Y4Q A;  4MBE A;  1QTX A;  3CR4 X;  2KGB C;  3DY9 A;  1Y0V H;  2OTG C;  3PM8 A;  1YUS A;  3CR2 A;  2OS8 C;  1S6C A;  2OTG B;  4WQ3 A;  1MQ1 A;  3DF0 B;  2K7D A;  2KI6 C;  2OS8 B;  4Q04 A;  1JC2 A;  1IJ5 A;  1TCO B;  4INX A;  2KI4 C;  2LVI A;  1J1D A;  3Q8I A;  5KTY A;  4MZJ A;  1TOP A;  4P2Y B;  1CM1 A;  1YRU B;  5I2L A;  1AUI B;  4UPG A;  2L4I A;  2WC6 A;  1WRZ A;  3R1V A;  1CDN A;  4A4B A;  2M97 A;  1LKJ A;  2PQL A;  3RZS A;  2H2K A;  1OZS A;  2L2C A;  1AP4 A;  2E6W A;  2KAX A;  2MRD A;  3BFH A;  4YGB B;  2PVB A;  4PDZ A;  1UHN A;  5AXI A;  4PHK A;  2K61 A;  1CDL A;  1QX2 A;  2LV7 A;  2O60 A;  3F45 A;  1BOD A;  2KGR A;  3KO0 A;  1EG4 A;  1J7R A;  3OBV A;  2LAP A;  2MHH A;  2F8P A;  4PHJ A;  2L5Y A;  3PAT A;  4GGF A;  2JU0 A;  4PE7 A;  5JJG A;  1Z4H A;  2H61 A;  1JBA A;  3IF7 A;  1PRW A;  3DF0 A;  1W7I B;  3RLZ A;  1TN4 A;  1WRK A;  5I2Q A;  3S0A A;  4WRI A;  3PLF B;  4HRG A;  1A75 B;  3DVK A;  2WOR A;  3NSI A;  1XFR A;  4C0K A;  2MLF C;  3DZT A;  1CFP A;  2F3Z A;  1BR4 B;  1LVC D;  2QAC A;  5I8N A;  1NX3 A;  5D69 A;  4JD9 A;  1XK4 A;  3NHI A;  1OOH A;  4ORC B;  2JPT A;  3LL8 B;  1CFC A;  3AAJ A;  1XFZ O;  1NIW A;  1NUB A;  5AFP A;  1K9P A;  1K8U A;  1OMD A;  5FI2 A;  1UUS A;  3D75 A;  3V2L A;  3KF9 A;  4I5N B;  2MBX A;  1BG1 A;  3SG5 A;  2EC6 C;  2L98 A;  3E3R A;  3O78 A;  3KHE A;  4GUK A;  5AER A;  1U5I B;  3OGN A;  2KAV A;  5D7F A;  1J7P A;  2EC6 B;  2HQW A;  1DTL A;  1CFD A;  4BY5 A;  3CYZ A;  3CLN A;  3CZ0 A;  1IH0 A;  1HT9 A;  3D73 A;  4ZCU A;  1SYM A;  1OMR A;  1S26 D;  1S5G Z;  2WCE A;  3ZNI A;  2JRF A;  4YGE B;  1AHR A;  5DKQ A;  1W9Z A;  1IGV A;  1TRF A;  2JTT A;  3NHT A;  4OVN F;  2JUL A;  3IVT A;  2F33 A;  1YUT A;  5DIC A;  1QX5 B;  2CBL A;  2M1U A;  1TNX A;  1XFW O;  3AKA A;  3CZT X;  4OCI A;  4OZD A;  1U5I A;  5KU1 A;  3JTD C;  5B8I B;  1SPY A;  2WCH A;  4GPL B;  1BLQ A;  3FWC A;  3ZWH A;  3JTD B;  3O2P A;  1QVI Y;  3CR5 X;  1KQM C;  4I5L B;  2EHB A;  1OQP A;  4DIR A;  2JOJ A;  4JPZ B;  4DRW A;  5FYX A;  1ZFS A;  2LMT A;  2YGU A;  1H8B A;  2KI6 D;  4GNK B;  1SNL A;  4NDB A;  3TUY C;  2NXQ A;  2VRG A;  1MXL C;  5JOL A;  1CLL A;  2Y1N A;  1EG3 A;  1DVI A;  4DCK A;  1SL9 A;  2HF5 A;  4M2Q A;  3PJI A;  3EK8 A;  5F6T A;  4U8D A;  1M39 A;  3PN7 C;  2LHL A;  3SIA A;  4MVF A;  1RFJ A;  3EK4 A;  1N2D A;  2JPO A;  4IJ7 A;  4WQ2 A;  5DKN A;  3PSR A;  3SS5 A;  1OZO A;  2FJY A;  2NLN A;  3PN7 B;  2BCX A;  1HQV A;  2KHN A;  3CGA A;  1CTR A;  1TUZ A;  2LUX A;  3NGV A;  1S36 A;  1P28 A;  4JWQ A;  1XFX O;  4F7F A;  2KYF A;  2PRU A;  3KPX A;  1KSM A;  3HX4 A;  2M8U A;  1WDC C;  3L4A A;  3GOF A;  1TWO A;  2WCK A;  1F55 A;  1RJV A;  1CLB A;  4R1E A;  4YI9 A;  2I7A A;  3R1O A;  5DKR A;  3TDU A;  3BQ3 A;  2WOS A;  2F3Y A;  3KEV A;  1MHO A;  2M3W A;  2SCP A;  3OX5 A;  2G9B A;  3MSE B;  3EVU A;  3O4Y A;  1NCZ A;  2L50 A;  3FE9 A;  4INW A;  1C7W A;  1MR8 A;  4F0Z B;  1CB1 A;  1EL4 A;  2BCA A;  1YX8 A;  2KLD A;  2ZNE A;  5EL2 A;  1GM0 A;  3B6X A;  1BJF A;  4FTG A;  1BF5 A;  2MAZ A;  3N7H A;  2LVK A;  2NCP A;  2KAY A;  4N5X A;  1DT7 B;  1CLM A;  2WCF A;  3SS3 A;  1QV1 A;  1G4Y R;  2CT9 A;  3BJH A;  1K9K A;  2KI4 B;  2KFG A;  3GK2 A;  1DC1 A;  1G8I A;  1QS7 A;  2FCD A;  1LA3 A;  2JWW A;  1MF8 B;  2D8N A;  2BNX A;  1B47 A;  1ZUZ A;  2PSR A;  3NSL A;  4GFT A;  2JT3 A;  3PM2 A;  1B8C A;  4MZK A;  2BE6 A;  3BUO B;  1OW4 A;  1IIO A;  4M2P A;  1TNP A;  5CSI A;  1KFU S;  4N1F A;  1CDM A;  3I5G C;  1QLK A;  2K7C A;  1XO5 A;  1KFX L;  2F2P A;  1E8A A;  4XJK B;  2QEO A;  1J7Q A;  3I5G B;  5HKW A;  1VRK A;  1PUL A;  2M9G A;  3L47 A;  2PAS A;  4ICB A;  5CSN A;  2LE9 B;  1AVS A;  1B1G A;  3BFB A;  1A4P A;  4FQT A;  1CFF A;  3CDN A;  2Q4U A;  1SY9 A;  2ZRT A;  1CDP A;  1CM4 A;  1RRO A;  1GGZ A;  2WCJ A;  1SL8 A;  1IQ5 A;  2QEV A;  3A4U B;  3DVJ A;  2L51 A;  1FI5 A;  1WLM A;  1GJY A;  1QV0 A;  3B86 A;  1BT6 A;  1YUR A;  3BYA A;  1H4B A;  1ZMZ A;  1QAT A;  2K0J A;  2GGM A;  3WNX B;  1ALV A;  1V1F A;  4PE4 A;  1DGU A;  1X02 A;  3EK7 A;  2K2A A;  2JXL A;  5AEQ A;  1QAS A;  1J1E A;  2ZRS A;  1NPQ A;  2CTN A;  1QVI Z;  1QX7 A;  4PE0 A;  4ZCV A;  4XJK A;  2KFF A;  1RWY A;  3SG6 A;  1UUR A;  2ZN8 A;  1PSR A;  1J55 A;  1F4Q A;  3K21 A;  2QEB A;  1R6P A;  3IQQ A;  3D77 A;  1W7J B;  5HKY A;  1NCX A;  5AAN A;  1K94 A;  4OKH A;  2AUC A;  3SG7 A;  1JF0 A;  1C07 A;  1M45 A;  3AKB A;  1KQV A;  1MUX A;  3A8R A;  2LVJ A;  4HSZ A;  4PE1 A;  2IS9 A;  1B7T Y;  3QME A;  1RTP 1;  1WLZ A;  2M7L A;  1OSA A;  2I94 A;  1XVJ A;  4MRY A;  3UNW A;  1TNW A;  2WCL A;  5HYD A;  1B9A A;  1K9U A;  1SCM C;  1AK8 A;  1DJH A;  1GQM A;  4HRE E;  1Y1A A;  1UHI A;  4ORB B;  2LLU A;  3PAL A;  5GQQ C;  1A03 A;  1SCM B;  3VB1 A;  2FCE A;  2M49 B;  1UHK A;  4E68 A;  1NX0 A;  5K89 A;  2ZND A;  5KSZ A;  1ODB A;  1C3Z A;  2NZ0 A;  3BUM B;  5FI7 A;  3FS7 A;  3SIB A;  1F4O A;  1F54 A;  2AMI A;  2PAL A;  4PT1 A;  1PSB A;  3S0E A;  1NX1 A;  2K60 A;  5IBW A;  1A29 A;  5CSJ A;  3D78 A;  1DJW A;  2CNP A;  5I2O A;  1KCY A;  2BKI B;  1SBJ A;  1IRJ A;  4YI8 A;  3D10 A;  1NYA A;  3DD4 A;  2JXC A;  1KQM B;  2B1U A;  3GK1 A;  1DEL A;  4HRH A;  2I18 A;  4GGN A;  2RGI A;  4ETO A;  3O6B A;  1DEK A;  5HLV A;  2MJW B;  3NXA A;  1BR1 B;  5HLO A;  3TUY B;  3D76 A; 
#chains in the Genus database with same CATH homology
 2BBM A;  3SG4 A;  1EXR A;  4MLW A;  3TS5 C;  1QIV A;  1PK0 D;  5PAL A;  1UHJ A;  3EVV A;  2O5G A;  4OV2 A;  3TZ1 A;  4AQI A;  1MXE A;  3TS5 B;  2TN4 A;  3VRQ A;  2QPT A;  2NCO A;  2GV5 A;  2Y5I A;  1NCY A;  1YR5 A;  5J3X A;  3EKJ A;  1YVH A;  1EH2 A;  2L0P A;  1K95 A;  4QJ5 B;  2FOT A;  3H4S E;  4NQG A;  5G08 A;  2LVV A;  3OHM B;  2G2B A;  4YBH B;  2LNK A;  1M63 B;  3BUX B;  3OX6 A;  2GGZ A;  2JNX A;  2WND A;  2BE4 A;  1F8H A;  1M46 A;  1IG5 A;  1DMO A;  2R2I A;  1WDC B;  3TDZ A;  4CFR A;  4DS7 A;  1DGV A;  2LMV A;  3NSK A;  2LLT A;  4L9M A;  1SL7 A;  2LHI A;  3LK0 A;  1DJG A;  1IQ3 A;  1K2H A;  1SMG A;  1SRA A;  1IWQ A;  1DJY A;  1LIN A;  1YTZ C;  1J7O A;  3BUW B;  4GAO A;  2KSP A;  2CXJ A;  5HKZ A;  3JVT C;  3I5I C;  2K2F A;  2SAS A;  1DJX A;  3BUN B;  1MWN A;  3JVT B;  3I5I B;  2BBN A;  2KQ6 A;  4CPV A;  1C7V A;  3QRX A;  3BOW B;  1AJ5 A;  4CFQ A;  3FWB A;  4QJ4 B;  4FQO A;  2Q91 A;  4JQ0 D;  1IJ6 A;  1SK6 D;  3WHU B;  3OB1 B;  3PFV A;  1Y1U A;  1B8R A;  3VRP A;  1N0Y A;  4GGF C;  1QLS A;  1KK8 C;  1OOJ A;  1KK7 Z;  2KDH A;  2H61 C;  1YVL A;  1A2X A;  2MA2 A;  1KK8 B;  1IKU A;  1ALW A;  1LA0 A;  4C0J A;  4CID A;  1JFK A;  2LAN A;  3IQO A;  1B7T Z;  2AAO A;  1SCV A;  2EGD A;  1JFJ A;  1DF0 B;  1OMV A;  5BPJ A;  3VRO A;  4N1G A;  1DJZ A;  1KWO C;  2WCB A;  1XFU O;  2KBI A;  1XK4 C;  1KWO B;  2ZFD A;  3BOW A;  3EKH A;  2KBM A;  4MN0 A;  3FIA A;  4QJ3 B;  1QXP A;  1TNQ A;  1K90 D;  1XA5 A;  2OPO A;  2V53 A;  2JT0 A;  2M7N A;  2BKH B;  2JNF A;  3CS1 A;  1UP5 A;  2M1K B;  4CLN A;  1QJT A;  2DOQ A;  3VRN A;  4C0L A;  1M31 A;  2JC2 A;  2LC5 A;  1PAL A;  2FJU B;  1D1O A;  3BXK A;  2M29 A;  3D0Y B;  2LUC A;  4ORA B;  1CKK A;  1NX2 A;  3TDI A;  1Y1X A;  4PAL A;  1DF0 A;  4I5K A;  2KOT A;  5CSF A;  1KK7 Y;  3SJS A;  3SG2 A;  2P6B B;  1JSA A;  2KFH A;  1V1G A;  1GGW A;  1FBV A;  1S1E A;  1YRT B;  1JUO A;  4AOM A;  1FI6 A;  1CNP A;  4PHM A;  1SKT A;  4MZL A;  3VGO A;  4D1E A;  3C1V A;  1TTX A;  2LP3 A;  1TCF A;  2MLE C;  3VRR A;  1KFX S;  1JWD A;  1NWD A;  1XFV O;  2LM5 A;  1WY9 A;  1SR6 C;  1XFY O;  3D0Y A;  1NP8 A;  5ER5 A;  4TNC A;  1AJ4 A;  3DVE A;  1SR6 B;  1S3P A;  3M0W A;  1A75 A;  2LCP A;  1Q80 A;  3WXA A;  4YGC B;  1G33 A;  2KQY A;  2L4H A;  2LP2 A;  4MSP A;  4PHN A;  1FF1 A;  3I5H C;  1S6I A;  3CWG A;  1WRL A;  1LXF C;  4M2O A;  1BU3 A;  2CCM A;  3I5H B;  4MEW A;  2JZI A;  4YGA A;  5ER4 X;  2L2E A;  3RM1 A;  1KSO A;  1CMF A;  4AQJ A;  2F2O A;  1B8L A;  4YGD B;  1OE9 B;  3HCM A;  1RK9 A;  1L2O C;  2Y1M A;  2K8M B;  1ZOT B;  1S6J A;  4PCW A;  3OB2 B;  2K7O A;  4DUQ A;  1L2O B;  1N65 A;  1F70 A;  2I2R E;  1F71 A;  2E30 A;  1UWO A;  3I5F C;  4USL A;  4A4C A;  2HET A;  1JF2 A;  1BMO A;  1XYD A;  3I5F B;  3CTN A;  1PVA A;  1QIW A;  2KYC A;  2ZN9 A;  2BL0 C;  2JQ6 A;  4YRU A;  4I5J A;  3EVR A;  2K7B A;  3LK1 A;  1DJI A;  1KFU L;  2BL0 B;  2LLS A;  1EJ3 A;  3NSO A;  2WC8 A;  1TIZ A;  3LLE A;  1REC A;  3DVM A;  4IL1 A;  3ICB A;  4BY4 A;  4OR9 B;  3GK4 X;  5CPV A;  2HQ8 A;  1K93 D;  2A4J A;  1S5G Y;  1L7Z A;  1BOC A;  1Y6W A;  2JTZ A;  3AAK A;  1K96 A;  2BCB A;  1NSH A;  4NDC A;  2HPS A;  2ISD A;  1FW4 A;  2JT8 A;  4MRX A;  1B4C A;  1R2U A;  2COL B;  4P5O E;  1CMG A;  2ZKM X;  4NDD A;  2L5X B;  1FPW A;  1PVB A;  1YX7 A;  2KNE A;  3OP0 A;  4XYN A;  3SG3 A;  1UHH A;  2LMU A;  3WHT B;  1YUU A;  2M0R A;  2BEC A;  3LCP C;  4GBA A;  5TNC A;  1ZAC A;  1SW8 A;  2PMY A;  2Y4Q A;  4MBE A;  1QTX A;  3CR4 X;  2KGB C;  1Y0V H;  2OTG C;  3PM8 A;  1YUS A;  3CR2 A;  2OS8 C;  1S6C A;  2OTG B;  4WQ3 A;  1MQ1 A;  3DF0 B;  2K7D A;  2KI6 C;  2OS8 B;  4Q04 A;  1JC2 A;  1IJ5 A;  1TCO B;  2KI4 C;  2LVI A;  1J1D A;  5KTY A;  4MZJ A;  1TOP A;  4P2Y B;  1CM1 A;  1YRU B;  5I2L A;  1AUI B;  4UPG A;  2L4I A;  1WRZ A;  1CDN A;  4A4B A;  2M97 A;  1LKJ A;  2H2K A;  1OZS A;  1AP4 A;  2E6W A;  2KAX A;  2MRD A;  4YGB B;  2PVB A;  4PDZ A;  1UHN A;  5AXI A;  4PHK A;  2K61 A;  1CDL A;  1QX2 A;  2LV7 A;  2O60 A;  3F45 A;  1BOD A;  2KGR A;  3KO0 A;  1EG4 A;  1J7R A;  2LAP A;  2MHH A;  2F8P A;  4PHJ A;  3PAT A;  4GGF A;  2JU0 A;  4PE7 A;  5JJG A;  2H61 A;  1JBA A;  3IF7 A;  1PRW A;  3DF0 A;  1W7I B;  3RLZ A;  1TN4 A;  1WRK A;  5I2Q A;  4WRI A;  3PLF B;  4HRG A;  1A75 B;  3DVK A;  2WOR A;  3NSI A;  4C0K A;  2MLF C;  1CFP A;  2F3Z A;  1BR4 B;  1LVC D;  2QAC A;  5I8N A;  1NX3 A;  5D69 A;  1XK4 A;  4ORC B;  2JPT A;  3LL8 B;  1CFC A;  3AAJ A;  1XFZ O;  1NIW A;  1NUB A;  5AFP A;  1K9P A;  1K8U A;  1OMD A;  1UUS A;  3KF9 A;  4I5N B;  2MBX A;  3SG5 A;  2EC6 C;  2L98 A;  3E3R A;  3O78 A;  3KHE A;  4GUK A;  5AER A;  1U5I B;  2KAV A;  5D7F A;  1J7P A;  2EC6 B;  2HQW A;  1DTL A;  1CFD A;  4BY5 A;  3CLN A;  1IH0 A;  1HT9 A;  4ZCU A;  1SYM A;  1OMR A;  1S26 D;  1S5G Z;  2WCE A;  3ZNI A;  2JRF A;  4YGE B;  1AHR A;  5DKQ A;  1IGV A;  1TRF A;  2JTT A;  4OVN F;  2JUL A;  2F33 A;  1YUT A;  1QX5 B;  2CBL A;  2M1U A;  1TNX A;  1XFW O;  3AKA A;  3CZT X;  4OCI A;  1U5I A;  5KU1 A;  3JTD C;  5B8I B;  1SPY A;  4GPL B;  1BLQ A;  3FWC A;  3ZWH A;  3JTD B;  3O2P A;  1QVI Y;  3CR5 X;  1KQM C;  4I5L B;  2EHB A;  1OQP A;  4DIR A;  2JOJ A;  4JPZ B;  4DRW A;  5FYX A;  1ZFS A;  2LMT A;  1H8B A;  2KI6 D;  4GNK B;  1SNL A;  4NDB A;  3TUY C;  2NXQ A;  2VRG A;  1MXL C;  5JOL A;  1CLL A;  2Y1N A;  1EG3 A;  1DVI A;  4DCK A;  1SL9 A;  2HF5 A;  4M2Q A;  3EK8 A;  5F6T A;  4U8D A;  1M39 A;  3PN7 C;  2LHL A;  3SIA A;  4MVF A;  1RFJ A;  3EK4 A;  1N2D A;  5DKN A;  1BG1 A;  4WQ2 A;  3PSR A;  1OZO A;  2NLN A;  3PN7 B;  2BCX A;  1HQV A;  2KHN A;  3CGA A;  1CTR A;  2LUX A;  1S36 A;  4JWQ A;  1XFX O;  2KYF A;  2PRU A;  3KPX A;  1KSM A;  3HX4 A;  2M8U A;  1WDC C;  3GOF A;  1F55 A;  1RJV A;  1CLB A;  4R1E A;  4YI9 A;  2I7A A;  5DKR A;  3TDU A;  3BQ3 A;  2WOS A;  2F3Y A;  3KEV A;  1MHO A;  2M3W A;  2SCP A;  3OX5 A;  2G9B A;  3MSE B;  3EVU A;  3O4Y A;  1NCZ A;  2L50 A;  1C7W A;  1MR8 A;  4F0Z B;  1CB1 A;  1EL4 A;  2BCA A;  1YX8 A;  2ZNE A;  1BJF A;  4FTG A;  1BF5 A;  2MAZ A;  2LVK A;  2NCP A;  2KAY A;  4N5X A;  1DT7 B;  1CLM A;  2WCF A;  1QV1 A;  1G4Y R;  2CT9 A;  1K9K A;  2KI4 B;  2KFG A;  3GK2 A;  1G8I A;  1QS7 A;  2FCD A;  1LA3 A;  2JWW A;  1MF8 B;  2D8N A;  1B47 A;  1ZUZ A;  2PSR A;  3NSL A;  4GFT A;  2JT3 A;  1B8C A;  4MZK A;  2BE6 A;  3BUO B;  4M2P A;  1TNP A;  5CSI A;  1KFU S;  4N1F A;  1CDM A;  3I5G C;  1QLK A;  2K7C A;  1XO5 A;  1KFX L;  2F2P A;  1E8A A;  4XJK B;  1J7Q A;  3I5G B;  5HKW A;  1VRK A;  1PUL A;  2M9G A;  2PAS A;  4ICB A;  5CSN A;  2LE9 B;  1AVS A;  1B1G A;  1A4P A;  1CFF A;  2Q4U A;  1SY9 A;  2ZRT A;  1CDP A;  1CM4 A;  1RRO A;  1GGZ A;  1SL8 A;  1IQ5 A;  3A4U B;  3DVJ A;  2L51 A;  1FI5 A;  1WLM A;  1GJY A;  1QV0 A;  1BT6 A;  1YUR A;  3BYA A;  1H4B A;  1ZMZ A;  1QAT A;  2K0J A;  2GGM A;  3WNX B;  1ALV A;  1V1F A;  4PE4 A;  1DGU A;  1X02 A;  3EK7 A;  2K2A A;  2JXL A;  5AEQ A;  1QAS A;  1J1E A;  2ZRS A;  1NPQ A;  2CTN A;  1QVI Z;  1QX7 A;  4PE0 A;  4ZCV A;  4XJK A;  2KFF A;  1RWY A;  3SG6 A;  1UUR A;  2ZN8 A;  1PSR A;  1J55 A;  1F4Q A;  3K21 A;  1R6P A;  3IQQ A;  1W7J B;  5HKY A;  1NCX A;  5AAN A;  1K94 A;  4OKH A;  2AUC A;  3SG7 A;  1JF0 A;  1C07 A;  1M45 A;  3AKB A;  1KQV A;  1MUX A;  3A8R A;  2LVJ A;  4HSZ A;  4PE1 A;  2IS9 A;  1B7T Y;  1RTP 1;  1WLZ A;  2M7L A;  1OSA A;  2I94 A;  1XVJ A;  4MRY A;  1TNW A;  5HYD A;  1B9A A;  1K9U A;  1SCM C;  1AK8 A;  1DJH A;  1GQM A;  4HRE E;  1Y1A A;  1UHI A;  4ORB B;  2LLU A;  3PAL A;  5GQQ C;  1A03 A;  1SCM B;  2FCE A;  2M49 B;  1UHK A;  4E68 A;  1NX0 A;  5K89 A;  2ZND A;  5KSZ A;  1ODB A;  2NZ0 A;  3BUM B;  3FS7 A;  3SIB A;  1F4O A;  1F54 A;  2AMI A;  2PAL A;  5IBW A;  1PSB A;  1NX1 A;  1A29 A;  5CSJ A;  1DJW A;  2CNP A;  5I2O A;  1KCY A;  2BKI B;  1SBJ A;  1IRJ A;  4YI8 A;  3D10 A;  1NYA A;  3DD4 A;  2JXC A;  1KQM B;  2B1U A;  3GK1 A;  4HRH A;  2I18 A;  4GGN A;  2RGI A;  4ETO A;  3O6B A;  5HLV A;  2MJW B;  3NXA A;  1BR1 B;  5HLO A;  3TUY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...