1YRUB

Crystal structure analysis of the adenylyl cyclaes catalytic domain of adenylyl cyclase toxin of bordetella pertussis in presence of c-terminal calmodulin and 1mm calcium chloride
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
69
structure length
69
Chain Sequence
TDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional hemolysin-adenylate cyclase
publication title Structural basis for the interaction of Bordetella pertussis adenylyl cyclase toxin with calmodulin
pubmed doi rcsb
source organism Bordetella pertussis
molecule tags Layse, toxin
total genus 20
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2005-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1yruB00
1RTP1 4P5OE 5PALA 1YURA 2NXQA 4PALA 2JQ6A 1PSRA 1SCMC 1OZOA 4OCIA 1DF0A 2M1KB 4YI9A 1L2OB 1XFZO 1WY9A 1DJWA 1MUXA 1XA5A 1K95A 1YTZC 2LNKA 3NSKA 3I5GC 3PATA 3LK1A 1WRLA 4OR9B 1KK7Y 3BXKA 4GNKB 1F70A 1K9UA 1CKKA 1KK8B 2ISDA 1Y1AA 2OS8B 2JT8A 4I5LB 3FWCA 1ALVA 5CSJA 5ER4X 1KFUL 1TTXA 3DVKA 3JTDC 3SG2A 1R6PA 3K21A 3SIBA 2H61A 3PALA 4YGAA 1JSAA 1S6JA 2LLSA 3A8RA 3RLZA 1PVBA 1B9AA 2KFGA 4PHNA 1VRKA 3WNXB 1KQVA 5HYDA 1CDNA 1UHKA 1FI6A 5AXIA 1SCVA 1MXLC 5I2LA 1CTRA 2JOJA 1JBAA 2TN4A 2KBMA 1KFXS 1NCYA 1S6CA 2AUCA 3CWGA 4OVNF 2ZNEA 5FYXA 3BYAA 4HRGA 1KCYA 3D0YA 1TOPA 2QACA 3WXAA 2M49B 4PE1A 4XYNA 1MF8B 3KPXA 2AMIA 2JWWA 1WRKA 4ICBA 2K7BA 1BJFA 4I5KA 5I2OA 1QIVA 2O60A 1CLLA 5F6TA 2IS9A 1BOCA 1IQ5A 1PULA 4HREE 4BY5A 4E68A 2MBXA 1NWDA 1QTXA 1XK4C 2L50A 1OMRA 2H2KA 1BR4B 1QASA 2E30A 1K93D 1NX0A 3HX4A 2H61C 2L98A 1G4YR 1NCZA 2JNXA 4WQ3A 2SCPA 1ZFSA 4YBHB 2EC6C 3SG7A 1OZSA 2G9BA 3IQQA 2BL0C 2M7NA 2ZKMX 1SMGA 2L4HA 2MA2A 2BKHB 1LVCD 1YUTA 5G08A 3TDZA 4CLNA 2FCDA 5ER5A 1AP4A 3TS5C 1UHIA 4OKHA 2LMUA 5J3XA 1A4PA 1J7PA 4NDBA 1IJ5A 3HCMA 4GBAA 2WCEA 2Y1MA 4GUKA 3FS7A 1RJVA 4MZLA 1SL9A 2LP3A 2JU0A 1CFPA 2ZN9A 4GGFC 1NX3A 2BCAA 5K89A 3LL8B 4DUQA 1IJ6A 1QLSA 2ZRSA 1SCMB 2K0JA 1PSBA 2NCPA 3NXAA 4WQ2A 1LKJA 1GQMA 3JVTC 4MRXA 1AK8A 3AKAA 1N65A 1BR1B 2KBIA 4OV2A 1Y6WA 1ZUZA 3I5GB 1FF1A 3O2PA 2JNFA 1CMFA 3I5FC 1NX1A 1B47A 1QATA 3BUXB 1B1GA 2LLUA 1RK9A 2LC5A 3O6BA 1UP5A 3TUYC 1A03A 2F33A 1JC2A 1F4QA 2HETA 2M1UA 3PFVA 1YUUA 4NDCA 1SK6D 1DJGA 2ZN8A 4ZCUA 3D10A 1JUOA 3CR2A 2Y1NA 1W7JB 1EG4A 4YGCB 4A4BA 1QX5B 2KAXA 1EL4A 1H4BA 1BMOA 2JT0A 2M8UA 2ZNDA 2KQ6A 2F3YA 3DF0A 1H8BA 1E8AA 2F2PA 1ZACA 5JOLA 1CNPA 1SL8A 1GGWA 2L51A 4CIDA 2Y5IA 1SBJA 1OE9B 2LP2A 1SNLA 1Y1XA 4PHJA 1RWYA 1JFKA 1A2XA 2WOSA 4IL1A 1DF0B 3TDIA 3O78A 1KWOC 1MXEA 1M31A 3RM1A 1V1GA 2KI6C 3PSRA 3WHTB 4HSZA 5I2QA 2WCFA 1QV0A 1XK4A 1QIWA 2KAYA 1B8LA 1NX2A 2LLTA 1QV1A 1SYMA 2NCOA 1AJ5A 1FW4A 2JRFA 2WNDA 3GOFA 1PRWA 2EC6B 2PMYA 2QPTA 1BU3A 1CDMA 1DT7B 2D8NA 1Y1UA 3EK4A 2SASA 3I5IC 1QXPA 2KI4B 2I7AA 1MR8A 3KHEA 5KTYA 2BE4A 1QVIZ 1F55A 3CS1A 1CB1A 3TS5B 1J1EA 1NPQA 2MLEC 2LANA 1IG5A 2I2RE 2I18A 1WDCC 2KGBC 2L0PA 4YGEB 4C0LA 1J7OA 1Q80A 1F4OA 2WC8A 1UHHA 3ICBA 3LLEA 3E3RA 2L4IA 4GGFA 3D0YB 4M2OA 2GV5A 4NQGA 2KSPA 3VRPA 1UHNA 3MSEB 5HKWA 1F71A 1BODA 1GGZA 1SPYA 1EH2A 4NDDA 2FCEA 4AQJA 1R2UA 1ZOTB 1XFUO 1J1DA 3JVTB 4QJ5B 3CR4X 2JULA 1EJ3A 3CLNA 1OOJA 1IQ3A 2HF5A 1UURA 2F8PA 2KDHA 5CSIA 1LA0A 1DJIA 2JPTA 4DIRA 1X02A 2NZ0A 3I5FB 1DVIA 3ZWHA 5D69A 1TNPA 4YGDB 5CSNA 1J55A 5GQQC 3TUYB 2LMTA 3EVUA 4MN0A 5HKYA 2LVKA 1LXFC 5DKNA 1B8CA 5TNCA 2A4JA 3CTNA 3VROA 2KOTA 3H4SE 2OS8C 2BBMA 2OTGB 3BOWA 3EK8A 3NSLA 3DVJA 1YVLA 3PLFB 1C7VA 3OX6A 3LK0A 1JFJA 4PDZA 1PALA 2PVBA 1M39A 1SL7A 2MJWB 1YUSA 3EK7A 2M29A 1KQMB 1KFXL 1CMGA 2KYCA 2GGMA 3OB1B 1QLKA 4PE0A 2KI6D 1MWNA 2LMVA 4MEWA 4GAOA 1QX2A 2HQ8A 1M45A 1SR6C 2PRUA 1MHOA 4Q04A 2BE6A 2LUCA 1GJYA 1ALWA 1HQVA 5HKZA 1JF2A 4M2PA 1YX8A 2HPSA 2LHIA 4M2QA 4QJ3B 3SG5A 1S5GZ 2COLB 1B8RA 3BUNB 2EHBA 1TNXA 3DD4A 3GK4X 1CFCA 5KSZA 1KSOA 2KFHA 3FWBA 4UPGA 1RFJA 2WCBA 1YVHA 3DVMA 3TZ1A 1CFFA 4ETOA 1K90D 3JTDB 1NYAA 1TNQA 1A75A 1K9PA 2CBLA 3CR5X 2L5XB 5B8IB 1G33A 4MLWA 1TNWA 1RROA 2FJUB 1DGUA 2MHHA 3GK1A 1B7TZ 1IKUA 1OQPA 1K94A 1QX7A 2KHNA 2Q4UA 5HLVA 1JF0A 4GFTA 2M7LA 1MQ1A 1KFUS 2KFFA 1AUIB 1IGVA 3F45A 2ZFDA 1FI5A 1NCXA 3OP0A 3AKBA 3VGOA 1DJYA 2WORA 3BUMB 2Y4QA 4N1GA 1OMDA 1N2DA 3DF0B 3FIAA 3WHUB 2O5GA 4YRUA 1KK7Z 1C07A 1K2HA 1M63B 4PCWA 1YX7A 1NUBA 1DJXA 1OMVA 1XFXO 4CFRA 1ODBA 5CPVA 1U5IA 3A4UB 1NSHA 1SW8A 4FTGA 4DS7A 3EKHA 4XJKA 4ZCVA 1TRFA 1ZMZA 1IH0A 4MSPA 4YI8A 5BPJA 2MRDA 4XJKB 1WRZA 1SY9A 3PM8A 1B7TY 5IBWA 1XFVO 3OB2B 1CDPA 1S1EA 1S36A 2KQYA 3SG4A 5I8NA 2K2FA 1CFDA 2JTTA 3KO0A 1IRJA 2FOTA 2M3WA 1N0YA 1M46A 4AQIA 4DCKA 4R1EA 4DRWA 4D1EA 2BL0B 4GGNA 2K2AA 2OPOA 2M0RA 4BY4A 2K7CA 2MAZA 2CCMA 2BECA 4PE4A 3VRRA 5AERA 3SJSA 1TCFA 3AAKA 1J7RA 1XO5A 2LCPA 1CM1A 2V53A 3PN7C 2LVJA 3OX5A 5JJGA 2EGDA 1YR5A 2P6BB 1KSMA 1G8IA 2LHLA 2LM5A 4PE7A 1AJ4A 1DJZA 4L9MA 4JPZB 1K8UA 3BUWB 1AHRA 3I5HC 2PALA 3CZTX 2K7OA 1DJHA 3KEVA 3BQ3A 1SR6B 1HT9A 2R2IA 1BG1A 1AVSA 4AOMA 1UUSA 3QRXA 4A4CA 1V1FA 1TIZA 4JWQA 1K96A 2Q91A 1WLMA 4C0JA 4MZJA 1XFWO 4YGBB 2NLNA 1L2OC 1QVIY 1XVJA 2VRGA 3NSIA 3EVVA 1EG3A 4MBEA 4PHMA 2K8MB 1B4CA 1IWQA 1LINA 1PVAA 2K61A 1SKTA 4GPLB 2BCXA 2JXLA 4MVFA 4PHKA 3SG6A 1KK8C 2CT9A 5AEQA 4I5JA 2LVIA 1D1OA 1DMOA 4HRHA 1OSAA 2KGRA 4WRIA 3BOWB 4TNCA 5AFPA 1TCOB 4I5NB 4FQOA 4QJ4B 1CM4A 1XFYO 2LV7A 1WLZA 1JWDA 5DKQA 2HQWA 3EVRA 4JQ0D 1CLBA 2DOQA 2M9GA 1SRAA 1UHJA 2G2BA 2KI4C 5D7FA 1S26D 1DTLA 1L7ZA 3DVEA 3SIAA 4F0ZB 1CLMA 1KWOB 1QS7A 1LA3A 4C0KA 4ORAB 1K9KA 2GGZA 2BBNA 3GK2A 3IF7A 3OHMB 2E6WA 4CPVA 1RECA 2PSRA 5CSFA 1A29A 1S6IA 1YRTB 2JZIA 4U8DA 4N1FA 1A75B 1BT6A 2AAOA 2BCBA 1F54A 3IQOA 2RGIA 1YRUB 3KF9A 2F3ZA 3ZNIA 4ORBB 1BF5A 1S3PA 1NP8A 1UWOA 4MRYA 2LAPA 3AAJA 3I5IB 5HLOA 1XYDA 1TN4A 1EXRA 2M97A 2LE9B 2PASA 3PN7B 2F2OA 1FPWA 1QJTA 1C7WA 5DKRA 3NSOA 3BUOB 1W7IB 2B1UA 1WDCB 1Y0VH 2JXCA 3EKJA 3VRQA 4N5XA 1S5GY 4USLA 5AANA 3SG3A 1DGVA 3O4YA 5KU1A 2I94A 3LCPC 2OTGC 2CNPA 2JC2A 2ZRTA 2JTZA 2KAVA 1NIWA 2MLFC 3I5HB 2KNEA 3VRNA 2K7DA 2LUXA 4CFQA 3TDUA 1PK0D 1U5IB 2LVVA 1BLQA 2CTNA 2CXJA 1J7QA 1FBVA 3M0WA 2BKIB 2L2EA 4MZKA 1F8HA 3C1VA 3CGAA 2KYFA 4ORCB 4P2YB 1KQMC 2JT3A 1CDLA
chains in the Genus database with same CATH superfamily
1RTP1 4P5OE 5PALA 1YURA 2NXQA 4PALA 2JQ6A 2YGUA 1PSRA 1SCMC 1OZOA 4OCIA 1DF0A 2BAPA 2M1KB 4YI9A 1L2OB 1XFZO 1WY9A 1DJWA 1MUXA 1XA5A 1K95A 1YTZC 2LNKA 3NSKA 3I5GC 3D78A 3LK1A 3PATA 1WRLA 4OR9B 1KK7Y 3BXKA 2P71A 4GNKB 4F7FA 1F70A 2H8VA 1K9UA 1CKKA 1KK8B 2ISDA 1Y1AA 2OS8B 1DELA 2JT8A 1OOIX 3FWCA 1ALVA 4I5LB 5CSJA 5ER4X 1KFUL 1TTXA 3DVKA 3JTDC 3SG2A 1R6PA 3K21A 3SIBA 2H61A 3PALA 3NHTA 4YGAA 1JSAA 1S6JA 2LLSA 3A8RA 3RLZA 1PVBA 3PM2A 1B9AA 2KFGA 4PHNA 1VRKA 3WNXB 3PJIA 1KQVA 5HYDA 1CDNA 1UHKA 2WCLA 5AXIA 1FI6A 1SCVA 1MXLC 5I2LA 1CTRA 2JOJA 1JBAA 2TN4A 2KBMA 1KFXS 1NCYA 2K60A 1S6CA 2AUCA 3CWGA 4OVNF 2ZNEA 5FYXA 3BYAA 4HRGA 1KCYA 3D0YA 1TOPA 2QACA 4JKTA 3WXAA 2M49B 4PE1A 4XYNA 3IVTA 1MF8B 3CABA 3KPXA 2AMIA 2JWWA 1WRKA 4ICBA 2K7BA 2WCMA 1BJFA 4I5KA 5I2OA 1IIOA 1QIVA 2O60A 1CLLA 5F6TA 2IS9A 1BOCA 1IQ5A 1PULA 4HREE 4BY5A 2QEHA 4E68A 2MBXA 1NWDA 1QTXA 1XK4C 2L50A 3NHIA 1OMRA 2H2KA 1BR4B 1QASA 2E30A 1K93D 1NX0A 3HX4A 2H61C 2L98A 1G4YR 1NCZA 2JNXA 4WQ3A 2SCPA 1ZFSA 4YBHB 2EC6C 3SG7A 1OZSA 2G9BA 3IQQA 2BL0C 2M7NA 2ZKMX 1OW4A 1SMGA 2L4HA 2MA2A 2BKHB 3R1PA 1LVCD 1YUTA 5G08A 3TDZA 4CLNA 4JD9A 2FCDA 5ER5A 1AP4A 3TS5C 1UHIA 1SSEB 1OOHA 1P28A 4OKHA 2LMUA 5J3XA 1A4PA 1J7PA 4NDBA 1OOGA 1IJ5A 3HCMA 4GBAA 2WCEA 2Y1MA 4GUKA 3FS7A 1RJVA 4MZLA 1SL9A 2LP3A 2JU0A 1CFPA 2ZN9A 4GGFC 1NX3A 2BCAA 5K89A 3LL8B 4DUQA 1IJ6A 1QLSA 2ZRSA 3UO9A 1SCMB 3D74A 2K0JA 1PSBA 2NCPA 3NXAA 4OZDA 1LKJA 1GQMA 3JVTC 4MRXA 4WQ2A 1AK8A 3AKAA 1N65A 1BR1B 2KBIA 4OV2A 1Y6WA 1ZUZA 3I5GB 1FF1A 2KLEA 3O2PA 2JNFA 3R72A 3B87A 1CMFA 3I5FC 1NX1A 1B47A 1QATA 3BUXB 1B1GA 2LLUA 1RK9A 2LC5A 3O6BA 1UP5A 3TUYC 1A03A 3BJHA 2F33A 1JC2A 1F4QA 3R1OA 2HETA 2M1UA 3PFVA 1YUUA 4NDCA 1SK6D 1DJGA 2ZN8A 4ZCUA 3D10A 2WCHA 1JUOA 3CR2A 2Y1NA 1LS8A 1W7JB 1EG4A 3B86A 4YGCB 4A4BA 1QX5B 3SS5A 2KAXA 1EL4A 1H4BA 3S0GA 1BMOA 2JT0A 2M8UA 2ZNDA 2KQ6A 2F3YA 3DF0A 1H8BA 1E8AA 2F2PA 1ZACA 5JOLA 1CNPA 1SL8A 1GGWA 2L51A 4CIDA 2Y5IA 1SBJA 1OE9B 2LP2A 1SNLA 1Y1XA 4PHJA 1RWYA 1JFKA 1A2XA 2WOSA 5D3OA 4IL1A 1DF0B 3TDIA 3O78A 1KWOC 3BFAA 1MXEA 1M31A 3EG5B 3RM1A 2FJYA 1V1GA 2KI6C 3PSRA 3WHTB 4HSZA 5I2QA 2WCFA 1QV0A 1XK4A 1QIWA 2KAYA 3CZ1A 3D75A 1B8LA 1NX2A 4INXA 2LLTA 1W9ZA 1QV1A 1SYMA 2JPOA 2NCOA 1AJ5A 1FW4A 2JRFA 3OBVA 2WNDA 3GOFA 1TWOA 1PRWA 2EC6B 2PMYA 2QPTA 1BU3A 1CDMA 1T14A 1DT7B 2D8NA 1Y1UA 3EK4A 1ORGA 2WCJA 2SASA 2L5YA 3I5IC 1QXPA 3WHUB 2KI4B 2I7AA 1MR8A 3KHEA 5KTYA 2BE4A 1QVIZ 1F55A 3CS1A 1CB1A 3TS5B 1J1EA 1NPQA 2MLEC 2LANA 1IG5A 2I2RE 2I18A 1WDCC 2KGBC 2L0PA 4YGEB 4C0LA 1J7OA 1Q80A 1F4OA 2WC8A 1UHHA 3ICBA 3LLEA 3E3RA 2L4IA 4GGFA 3D0YB 4M2OA 2GV5A 4NQGA 2KSPA 3VRPA 1C3ZA 1UHNA 3MSEB 5HKWA 1F71A 1BODA 5DICA 1GGZA 1SPYA 4INWA 1OOFA 4NDDA 1EH2A 2FCEA 3CZ2A 1TUJA 4AQJA 1R2UA 1ZOTB 1XFUO 1J1DA 3K1EA 3JVTB 4QJ5B 3CR4X 2JULA 1EJ3A 3CLNA 1OOJA 3D73A 1IQ3A 2HF5A 1UURA 2F8PA 2KDHA 5CSIA 1LA0A 1DJIA 1Z4HA 2JPTA 3FE9A 4DIRA 3RZSA 1X02A 2NZ0A 3I5FB 1DVIA 3ZWHA 5D69A 1TNPA 3CYZA 4YGDB 3DYEA 5CSNA 1J55A 5GQQC 3TUYB 2LMTA 2KLDA 2WC6A 3EVUA 2LVKA 1LXFC 3BFHA 4MN0A 5DKNA 1B8CA 5HKYA 4KYNA 2GTEA 5TNCA 2A4JA 2ERBA 3CTNA 3VROA 2KOTA 3H4SE 2OS8C 2BBMA 2OTGB 3BOWA 3EK8A 3NSLA 3DVJA 1YVLA 3PLFB 1C7VA 3OX6A 3LK0A 1JFJA 4PDZA 2PQLA 1PALA 2PVBA 2PYQA 1M39A 1SL7A 2MJWB 1YUSA 3EK7A 2M29A 1KQMB 1KFXL 1CMGA 2KYCA 2GGMA 3OB1B 1QLKA 4PE0A 2KI6D 1MWNA 2LMVA 4MEWA 4GAOA 1QX2A 2HQ8A 1M45A 1SR6C 2PRUA 3Q8IA 3VGOA 1MHOA 4Q04A 2BE6A 2LUCA 1GJYA 1ALWA 1HQVA 5HKZA 1JF2A 4M2PA 1YX8A 3SS3A 2HPSA 2LHIA 4M2QA 4QJ3B 3S0EA 3SG5A 5I94A 1S5GZ 2COLB 1B8RA 4IJ7A 3BUNB 2EHBA 1TNXA 3DD4A 3GK4X 1CFCA 5KSZA 1KSOA 2KFHA 3FE6A 3FWBA 1RFJA 2WCBA 1YVHA 3DVMA 3TZ1A 4UPGA 1CFFA 4ETOA 1K90D 3JTDB 1NYAA 1TNQA 1A75A 1K9PA 2CBLA 3CR5X 2L5XB 5B8IB 1G33A 4MLWA 2WC5A 1TNWA 1RROA 2FJUB 3DY9A 1DGUA 2MHHA 3GK1A 1B7TZ 2BNXA 5HL1A 3VB1A 1OQPA 1IKUA 1K94A 1QX7A 2KHNA 1QWVA 2Q4UA 5HLVA 1JF0A 4GFTA 2M7LA 1MQ1A 1KFUS 2KFFA 2QDIA 1AUIB 1IGVA 3F45A 2ZFDA 1DC1A 1FI5A 1NCXA 3OP0A 3AKBA 1Z2CB 1DJYA 2WORA 3BUMB 2Y4QA 4N1GA 1OMDA 1N2DA 3CDNA 3DF0B 3FIAA 2O5GA 4YRUA 1KK7Z 1C07A 1K2HA 1M63B 4PCWA 1YX7A 1NUBA 4FQTA 3UNWA 2QEBA 1DJXA 1OMVA 1XFXO 4CFRA 1ODBA 5CPVA 1U5IA 3A4UB 1NSHA 1SW8A 4FTGA 4DS7A 3S0FA 3EKHA 3L4LA 4XJKA 1TRFA 1ZMZA 3OGNA 4ZCVA 1IH0A 4MSPA 4YI8A 5BPJA 2MRDA 4XJKB 1WRZA 1SY9A 1C3YA 3PM8A 1B7TY 5IBWA 1XFVO 3OB2B 1CDPA 1S1EA 1S36A 2KQYA 3SG4A 5I8NA 2K2FA 1CFDA 2JTTA 3KO0A 1IRJA 2FOTA 2M3WA 1N0YA 1M46A 3B88A 3L47A 4AQIA 4DCKA 4R1EA 4DRWA 4D1EA 2BL0B 4GGNA 2K2AA 2OPOA 2M0RA 4BY4A 2K7CA 2MAZA 2CCMA 2BECA 4PE4A 3VRRA 5AERA 3SJSA 1TCFA 3AAKA 1J7RA 1XO5A 2LCPA 1CM1A 2V53A 3PN7C 2LVJA 3OX5A 5JJGA 2EGDA 1YR5A 2QEVA 2WCKA 2P6BB 1KSMA 1G8IA 2LHLA 2LM5A 4PE7A 1AJ4A 1DJZA 4L9MA 4JPZB 5FI7A 1K8UA 3BUWB 1AHRA 3I5HC 2PALA 3CZTX 2K7OA 3D76A 1DJHA 3KEVA 3BQ3A 1SR6B 1HT9A 2R2IA 5FI2A 1BG1A 1AVSA 4AOMA 1UUSA 3QRXA 4A4CA 1V1FA 3B6XA 2P70A 1TIZA 4JWQA 1K96A 5FI6A 2Q91A 1WLMA 4C0JA 4MZJA 1XFWO 4YGBB 1DQEA 2NLNA 1L2OC 1QVIY 1XVJA 2VRGA 3NSIA 3EVVA 1EG3A 4MBEA 4PHMA 3S0DA 2K8MB 1B4CA 1IWQA 1LINA 1PVAA 2K61A 1SKTA 4GPLB 2BCXA 2JXLA 4MVFA 4PHKA 3SG6A 1KK8C 2CT9A 5AEQA 4I5JA 2LVIA 1D1OA 1DMOA 3DXLA 4HRHA 1OSAA 2KGRA 4WRIA 3BOWB 4TNCA 5AFPA 1TCOB 4I5NB 4FQOA 3R1VA 1CM4A 3BFBA 4QJ4B 1XFYO 2LV7A 1WLZA 1JWDA 3NGVA 5DKQA 2HQWA 3EVRA 4JQ0D 3O4XA 1CLBA 2DOQA 2M9GA 1SRAA 1UHJA 3SS4A 2G2BA 2KI4C 5D7FA 1S26D 1DTLA 5EL2A 1L7ZA 3DVEA 3SIAA 4F0ZB 1CLMA 1KWOB 1QS7A 3L4AA 3S0BA 1LA3A 4C0KA 4ORAB 1K9KA 1TUZA 2GGZA 2L2CA 4PT1A 2BBNA 3GK2A 3IF7A 3OHMB 1GM0A 2E6WA 4CPVA 1RECA 2PSRA 2QEOA 5CSFA 1A29A 1S6IA 1YRTB 2JZIA 4U8DA 4N1FA 3V2LA 1A75B 1BT6A 2AAOA 2BCBA 1F54A 3IQOA 2RGIA 1YRUB 2KPHA 1DEKA 3KF9A 2F3ZA 3ZNIA 4ORBB 1BF5A 1S3PA 1NP8A 1UWOA 4MRYA 2LAPA 3AAJA 3I5IB 5HLOA 1XYDA 1TN4A 1EXRA 2M97A 2LE9B 2PASA 3PN7B 2F2OA 1FPWA 1QJTA 1C7WA 5DKRA 3NSOA 3BUOB 1W7IB 3B7AA 2B1UA 1WDCB 1Y0VH 2JXCA 3EKJA 3VRQA 4N5XA 1S5GY 4USLA 5AANA 3FE8A 3SG3A 1DGVA 3N7HA 3O4YA 2I94A 3LCPC 5KU1A 2OTGC 2CNPA 2JC2A 2ZRTA 3CZ0A 2JTZA 2KAVA 1NIWA 2MLFC 3I5HB 2KNEA 3VRNA 2K7DA 2LUXA 4CFQA 3TDUA 1PK0D 1U5IB 2LVVA 1BLQA 2CTNA 2CXJA 1J7QA 1FBVA 3M0WA 2BKIB 2L2EA 4MZKA 1F8HA 3C1VA 3CGAA 3QMEA 3DZTA 2KYFA 4ORCB 4P2YB 1KQMC 1XFRA 3D77A 2JT3A 3S0AA 1CDLA
chains in the Genus database with same CATH topology
1RTP1 4P5OE 5PALA 1YURA 2NXQA 4PALA 2JQ6A 1PSRA 1SCMC 1OZOA 4OCIA 1DF0A 2M1KB 4YI9A 1L2OB 1XFZO 1WY9A 1DJWA 1MUXA 1XA5A 1K95A 1YTZC 2LNKA 3NSKA 3I5GC 3PATA 3LK1A 1WRLA 4OR9B 1KK7Y 3BXKA 4GNKB 1F70A 1K9UA 1CKKA 1KK8B 2ISDA 1Y1AA 2OS8B 2JT8A 4I5LB 3FWCA 1ALVA 5CSJA 5ER4X 1KFUL 1TTXA 3DVKA 3JTDC 3SG2A 1R6PA 3K21A 3SIBA 2H61A 3PALA 4YGAA 1JSAA 1S6JA 2LLSA 3A8RA 3RLZA 1PVBA 1B9AA 2KFGA 4PHNA 1VRKA 3WNXB 1KQVA 5HYDA 1CDNA 1UHKA 1FI6A 5AXIA 1SCVA 1MXLC 5I2LA 1CTRA 2JOJA 1JBAA 2TN4A 2KBMA 1KFXS 1NCYA 1S6CA 2AUCA 3CWGA 4OVNF 2ZNEA 5FYXA 3BYAA 4HRGA 1KCYA 3D0YA 1TOPA 2QACA 3WXAA 2M49B 4PE1A 4XYNA 1MF8B 3KPXA 2AMIA 2JWWA 1WRKA 4ICBA 2K7BA 1BJFA 4I5KA 5I2OA 1QIVA 2O60A 1CLLA 5F6TA 2IS9A 1BOCA 1IQ5A 1PULA 4HREE 4BY5A 4E68A 2MBXA 1NWDA 1QTXA 1XK4C 2L50A 1OMRA 2H2KA 1BR4B 1QASA 2E30A 1K93D 1NX0A 3HX4A 2H61C 2L98A 1G4YR 1NCZA 2JNXA 4WQ3A 2SCPA 1ZFSA 4YBHB 2EC6C 3SG7A 1OZSA 2G9BA 3IQQA 2BL0C 2M7NA 2ZKMX 1SMGA 2L4HA 2MA2A 2BKHB 1LVCD 1YUTA 5G08A 3TDZA 4CLNA 2FCDA 5ER5A 1AP4A 3TS5C 1UHIA 4OKHA 2LMUA 5J3XA 1A4PA 1J7PA 4NDBA 1IJ5A 3HCMA 4GBAA 2WCEA 2Y1MA 4GUKA 3FS7A 1RJVA 4MZLA 1SL9A 2LP3A 2JU0A 1CFPA 2ZN9A 4GGFC 1NX3A 2BCAA 5K89A 3LL8B 4DUQA 1IJ6A 1QLSA 2ZRSA 1SCMB 2K0JA 1PSBA 2NCPA 3NXAA 4WQ2A 1LKJA 1GQMA 3JVTC 4MRXA 1AK8A 3AKAA 1N65A 1BR1B 2KBIA 4OV2A 1Y6WA 1ZUZA 3I5GB 1FF1A 3O2PA 2JNFA 1CMFA 3I5FC 1NX1A 1B47A 1QATA 3BUXB 1B1GA 2LLUA 1RK9A 2LC5A 3O6BA 1UP5A 3TUYC 1A03A 2F33A 1JC2A 1F4QA 2HETA 2M1UA 3PFVA 1YUUA 4NDCA 1SK6D 1DJGA 2ZN8A 4ZCUA 3D10A 1JUOA 3CR2A 2Y1NA 1W7JB 1EG4A 4YGCB 4A4BA 1QX5B 2KAXA 1EL4A 1H4BA 1BMOA 2JT0A 2M8UA 2ZNDA 2KQ6A 2F3YA 3DF0A 1H8BA 1E8AA 2F2PA 1ZACA 5JOLA 1CNPA 1SL8A 1GGWA 2L51A 4CIDA 2Y5IA 1SBJA 1OE9B 2LP2A 1SNLA 1Y1XA 4PHJA 1RWYA 1JFKA 1A2XA 2WOSA 4IL1A 1DF0B 3TDIA 3O78A 1KWOC 1MXEA 1M31A 3RM1A 1V1GA 2KI6C 3PSRA 3WHTB 4HSZA 5I2QA 2WCFA 1QV0A 1XK4A 1QIWA 2KAYA 1B8LA 1NX2A 2LLTA 1QV1A 1SYMA 2NCOA 1AJ5A 1FW4A 2JRFA 2WNDA 3GOFA 1PRWA 2EC6B 2PMYA 2QPTA 1BU3A 1CDMA 1DT7B 2D8NA 1Y1UA 3EK4A 2SASA 3I5IC 1QXPA 2KI4B 2I7AA 1MR8A 3KHEA 5KTYA 2BE4A 1QVIZ 1F55A 3CS1A 1CB1A 3TS5B 1J1EA 1NPQA 2MLEC 2LANA 1IG5A 2I2RE 2I18A 1WDCC 2KGBC 2L0PA 4YGEB 4C0LA 1J7OA 1Q80A 1F4OA 2WC8A 1UHHA 3ICBA 3LLEA 3E3RA 2L4IA 4GGFA 3D0YB 4M2OA 2GV5A 4NQGA 2KSPA 3VRPA 1UHNA 3MSEB 5HKWA 1F71A 1BODA 1GGZA 1SPYA 1EH2A 4NDDA 2FCEA 4AQJA 1R2UA 1ZOTB 1XFUO 1J1DA 3JVTB 4QJ5B 3CR4X 2JULA 1EJ3A 3CLNA 1OOJA 1IQ3A 2HF5A 1UURA 2F8PA 2KDHA 5CSIA 1LA0A 1DJIA 2JPTA 4DIRA 1X02A 2NZ0A 3I5FB 1DVIA 3ZWHA 5D69A 1TNPA 4YGDB 5CSNA 1J55A 5GQQC 3TUYB 2LMTA 3EVUA 4MN0A 5HKYA 2LVKA 1LXFC 5DKNA 1B8CA 5TNCA 2A4JA 3CTNA 3VROA 2KOTA 3H4SE 2OS8C 2BBMA 2OTGB 3BOWA 3EK8A 3NSLA 3DVJA 1YVLA 3PLFB 1C7VA 3OX6A 3LK0A 1JFJA 4PDZA 1PALA 2PVBA 1M39A 1SL7A 2MJWB 1YUSA 3EK7A 2M29A 1KQMB 1KFXL 1CMGA 2KYCA 2GGMA 3OB1B 1QLKA 4PE0A 2KI6D 1MWNA 2LMVA 4MEWA 4GAOA 1QX2A 2HQ8A 1M45A 1SR6C 2PRUA 1MHOA 4Q04A 2BE6A 2LUCA 1GJYA 1ALWA 1HQVA 5HKZA 1JF2A 4M2PA 1YX8A 2HPSA 2LHIA 4M2QA 4QJ3B 3SG5A 1S5GZ 2COLB 1B8RA 3BUNB 2EHBA 1TNXA 3DD4A 3GK4X 1CFCA 5KSZA 1KSOA 2KFHA 3FWBA 4UPGA 1RFJA 2WCBA 1YVHA 3DVMA 3TZ1A 1CFFA 4ETOA 1K90D 3JTDB 1NYAA 1TNQA 1A75A 1K9PA 2CBLA 3CR5X 2L5XB 5B8IB 1G33A 4MLWA 1TNWA 1RROA 2FJUB 1DGUA 2MHHA 3GK1A 1B7TZ 1IKUA 1OQPA 1K94A 1QX7A 2KHNA 2Q4UA 5HLVA 1JF0A 4GFTA 2M7LA 1MQ1A 1KFUS 2KFFA 1AUIB 1IGVA 3F45A 2ZFDA 1FI5A 1NCXA 3OP0A 3AKBA 3VGOA 1DJYA 2WORA 3BUMB 2Y4QA 4N1GA 1OMDA 1N2DA 3DF0B 3FIAA 3WHUB 2O5GA 4YRUA 1KK7Z 1C07A 1K2HA 1M63B 4PCWA 1YX7A 1NUBA 1DJXA 1OMVA 1XFXO 4CFRA 1ODBA 5CPVA 1U5IA 3A4UB 1NSHA 1SW8A 4FTGA 4DS7A 3EKHA 4XJKA 4ZCVA 1TRFA 1ZMZA 1IH0A 4MSPA 4YI8A 5BPJA 2MRDA 4XJKB 1WRZA 1SY9A 3PM8A 1B7TY 5IBWA 1XFVO 3OB2B 1CDPA 1S1EA 1S36A 2KQYA 3SG4A 5I8NA 2K2FA 1CFDA 2JTTA 3KO0A 1IRJA 2FOTA 2M3WA 1N0YA 1M46A 4AQIA 4DCKA 4R1EA 4DRWA 4D1EA 2BL0B 4GGNA 2K2AA 2OPOA 2M0RA 4BY4A 2K7CA 2MAZA 2CCMA 2BECA 4PE4A 3VRRA 5AERA 3SJSA 1TCFA 3AAKA 1J7RA 1XO5A 2LCPA 1CM1A 2V53A 3PN7C 2LVJA 3OX5A 5JJGA 2EGDA 1YR5A 2P6BB 1KSMA 1G8IA 2LHLA 2LM5A 4PE7A 1AJ4A 1DJZA 4L9MA 4JPZB 1K8UA 3BUWB 1AHRA 3I5HC 2PALA 3CZTX 2K7OA 1DJHA 3KEVA 3BQ3A 1SR6B 1HT9A 2R2IA 1BG1A 1AVSA 4AOMA 1UUSA 3QRXA 4A4CA 1V1FA 1TIZA 4JWQA 1K96A 2Q91A 1WLMA 4C0JA 4MZJA 1XFWO 4YGBB 2NLNA 1L2OC 1QVIY 1XVJA 2VRGA 3NSIA 3EVVA 1EG3A 4MBEA 4PHMA 2K8MB 1B4CA 1IWQA 1LINA 1PVAA 2K61A 1SKTA 4GPLB 2BCXA 2JXLA 4MVFA 4PHKA 3SG6A 1KK8C 2CT9A 5AEQA 4I5JA 2LVIA 1D1OA 1DMOA 4HRHA 1OSAA 2KGRA 4WRIA 3BOWB 4TNCA 5AFPA 1TCOB 4I5NB 4FQOA 4QJ4B 1CM4A 1XFYO 2LV7A 1WLZA 1JWDA 5DKQA 2HQWA 3EVRA 4JQ0D 1CLBA 2DOQA 2M9GA 1SRAA 1UHJA 2G2BA 2KI4C 5D7FA 1S26D 1DTLA 1L7ZA 3DVEA 3SIAA 4F0ZB 1CLMA 1KWOB 1QS7A 1LA3A 4C0KA 4ORAB 1K9KA 2GGZA 2BBNA 3GK2A 3IF7A 3OHMB 2E6WA 4CPVA 1RECA 2PSRA 5CSFA 1A29A 1S6IA 1YRTB 2JZIA 4U8DA 4N1FA 1A75B 1BT6A 2AAOA 2BCBA 1F54A 3IQOA 2RGIA 1YRUB 3KF9A 2F3ZA 3ZNIA 4ORBB 1BF5A 1S3PA 1NP8A 1UWOA 4MRYA 2LAPA 3AAJA 3I5IB 5HLOA 1XYDA 1TN4A 1EXRA 2M97A 2LE9B 2PASA 3PN7B 2F2OA 1FPWA 1QJTA 1C7WA 5DKRA 3NSOA 3BUOB 1W7IB 2B1UA 1WDCB 1Y0VH 2JXCA 3EKJA 3VRQA 4N5XA 1S5GY 4USLA 5AANA 3SG3A 1DGVA 3O4YA 5KU1A 2I94A 3LCPC 2OTGC 2CNPA 2JC2A 2ZRTA 2JTZA 2KAVA 1NIWA 2MLFC 3I5HB 2KNEA 3VRNA 2K7DA 2LUXA 4CFQA 3TDUA 1PK0D 1U5IB 2LVVA 1BLQA 2CTNA 2CXJA 1J7QA 1FBVA 3M0WA 2BKIB 2L2EA 4MZKA 1F8HA 3C1VA 3CGAA 2KYFA 4ORCB 4P2YB 1KQMC 2JT3A 1CDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RTP 1;  4P5O E;  5PAL A;  1YUR A;  2NXQ A;  4PAL A;  2JQ6 A;  1PSR A;  1SCM C;  1OZO A;  4OCI A;  1DF0 A;  2M1K B;  4YI9 A;  1L2O B;  1XFZ O;  1WY9 A;  1DJW A;  1MUX A;  1XA5 A;  1K95 A;  1YTZ C;  2LNK A;  3NSK A;  3I5G C;  3PAT A;  3LK1 A;  1WRL A;  4OR9 B;  1KK7 Y;  3BXK A;  4GNK B;  1F70 A;  1K9U A;  1CKK A;  1KK8 B;  2ISD A;  1Y1A A;  2OS8 B;  2JT8 A;  4I5L B;  3FWC A;  1ALV A;  5CSJ A;  5ER4 X;  1KFU L;  1TTX A;  3DVK A;  3JTD C;  3SG2 A;  1R6P A;  3K21 A;  3SIB A;  2H61 A;  3PAL A;  4YGA A;  1JSA A;  1S6J A;  2LLS A;  3A8R A;  3RLZ A;  1PVB A;  1B9A A;  2KFG A;  4PHN A;  1VRK A;  3WNX B;  1KQV A;  5HYD A;  1CDN A;  1UHK A;  1FI6 A;  5AXI A;  1SCV A;  1MXL C;  5I2L A;  1CTR A;  2JOJ A;  1JBA A;  2TN4 A;  2KBM A;  1KFX S;  1NCY A;  1S6C A;  2AUC A;  3CWG A;  4OVN F;  2ZNE A;  5FYX A;  3BYA A;  4HRG A;  1KCY A;  3D0Y A;  1TOP A;  2QAC A;  3WXA A;  2M49 B;  4PE1 A;  4XYN A;  1MF8 B;  3KPX A;  2AMI A;  2JWW A;  1WRK A;  4ICB A;  2K7B A;  1BJF A;  4I5K A;  5I2O A;  1QIV A;  2O60 A;  1CLL A;  5F6T A;  2IS9 A;  1BOC A;  1IQ5 A;  1PUL A;  4HRE E;  4BY5 A;  4E68 A;  2MBX A;  1NWD A;  1QTX A;  1XK4 C;  2L50 A;  1OMR A;  2H2K A;  1BR4 B;  1QAS A;  2E30 A;  1K93 D;  1NX0 A;  3HX4 A;  2H61 C;  2L98 A;  1G4Y R;  1NCZ A;  2JNX A;  4WQ3 A;  2SCP A;  1ZFS A;  4YBH B;  2EC6 C;  3SG7 A;  1OZS A;  2G9B A;  3IQQ A;  2BL0 C;  2M7N A;  2ZKM X;  1SMG A;  2L4H A;  2MA2 A;  2BKH B;  1LVC D;  1YUT A;  5G08 A;  3TDZ A;  4CLN A;  2FCD A;  5ER5 A;  1AP4 A;  3TS5 C;  1UHI A;  4OKH A;  2LMU A;  5J3X A;  1A4P A;  1J7P A;  4NDB A;  1IJ5 A;  3HCM A;  4GBA A;  2WCE A;  2Y1M A;  4GUK A;  3FS7 A;  1RJV A;  4MZL A;  1SL9 A;  2LP3 A;  2JU0 A;  1CFP A;  2ZN9 A;  4GGF C;  1NX3 A;  2BCA A;  5K89 A;  3LL8 B;  4DUQ A;  1IJ6 A;  1QLS A;  2ZRS A;  1SCM B;  2K0J A;  1PSB A;  2NCP A;  3NXA A;  4WQ2 A;  1LKJ A;  1GQM A;  3JVT C;  4MRX A;  1AK8 A;  3AKA A;  1N65 A;  1BR1 B;  2KBI A;  4OV2 A;  1Y6W A;  1ZUZ A;  3I5G B;  1FF1 A;  3O2P A;  2JNF A;  1CMF A;  3I5F C;  1NX1 A;  1B47 A;  1QAT A;  3BUX B;  1B1G A;  2LLU A;  1RK9 A;  2LC5 A;  3O6B A;  1UP5 A;  3TUY C;  1A03 A;  2F33 A;  1JC2 A;  1F4Q A;  2HET A;  2M1U A;  3PFV A;  1YUU A;  4NDC A;  1SK6 D;  1DJG A;  2ZN8 A;  4ZCU A;  3D10 A;  1JUO A;  3CR2 A;  2Y1N A;  1W7J B;  1EG4 A;  4YGC B;  4A4B A;  1QX5 B;  2KAX A;  1EL4 A;  1H4B A;  1BMO A;  2JT0 A;  2M8U A;  2ZND A;  2KQ6 A;  2F3Y A;  3DF0 A;  1H8B A;  1E8A A;  2F2P A;  1ZAC A;  5JOL A;  1CNP A;  1SL8 A;  1GGW A;  2L51 A;  4CID A;  2Y5I A;  1SBJ A;  1OE9 B;  2LP2 A;  1SNL A;  1Y1X A;  4PHJ A;  1RWY A;  1JFK A;  1A2X A;  2WOS A;  4IL1 A;  1DF0 B;  3TDI A;  3O78 A;  1KWO C;  1MXE A;  1M31 A;  3RM1 A;  1V1G A;  2KI6 C;  3PSR A;  3WHT B;  4HSZ A;  5I2Q A;  2WCF A;  1QV0 A;  1XK4 A;  1QIW A;  2KAY A;  1B8L A;  1NX2 A;  2LLT A;  1QV1 A;  1SYM A;  2NCO A;  1AJ5 A;  1FW4 A;  2JRF A;  2WND A;  3GOF A;  1PRW A;  2EC6 B;  2PMY A;  2QPT A;  1BU3 A;  1CDM A;  1DT7 B;  2D8N A;  1Y1U A;  3EK4 A;  2SAS A;  3I5I C;  1QXP A;  2KI4 B;  2I7A A;  1MR8 A;  3KHE A;  5KTY A;  2BE4 A;  1QVI Z;  1F55 A;  3CS1 A;  1CB1 A;  3TS5 B;  1J1E A;  1NPQ A;  2MLE C;  2LAN A;  1IG5 A;  2I2R E;  2I18 A;  1WDC C;  2KGB C;  2L0P A;  4YGE B;  4C0L A;  1J7O A;  1Q80 A;  1F4O A;  2WC8 A;  1UHH A;  3ICB A;  3LLE A;  3E3R A;  2L4I A;  4GGF A;  3D0Y B;  4M2O A;  2GV5 A;  4NQG A;  2KSP A;  3VRP A;  1UHN A;  3MSE B;  5HKW A;  1F71 A;  1BOD A;  1GGZ A;  1SPY A;  1EH2 A;  4NDD A;  2FCE A;  4AQJ A;  1R2U A;  1ZOT B;  1XFU O;  1J1D A;  3JVT B;  4QJ5 B;  3CR4 X;  2JUL A;  1EJ3 A;  3CLN A;  1OOJ A;  1IQ3 A;  2HF5 A;  1UUR A;  2F8P A;  2KDH A;  5CSI A;  1LA0 A;  1DJI A;  2JPT A;  4DIR A;  1X02 A;  2NZ0 A;  3I5F B;  1DVI A;  3ZWH A;  5D69 A;  1TNP A;  4YGD B;  5CSN A;  1J55 A;  5GQQ C;  3TUY B;  2LMT A;  3EVU A;  4MN0 A;  5HKY A;  2LVK A;  1LXF C;  5DKN A;  1B8C A;  5TNC A;  2A4J A;  3CTN A;  3VRO A;  2KOT A;  3H4S E;  2OS8 C;  2BBM A;  2OTG B;  3BOW A;  3EK8 A;  3NSL A;  3DVJ A;  1YVL A;  3PLF B;  1C7V A;  3OX6 A;  3LK0 A;  1JFJ A;  4PDZ A;  1PAL A;  2PVB A;  1M39 A;  1SL7 A;  2MJW B;  1YUS A;  3EK7 A;  2M29 A;  1KQM B;  1KFX L;  1CMG A;  2KYC A;  2GGM A;  3OB1 B;  1QLK A;  4PE0 A;  2KI6 D;  1MWN A;  2LMV A;  4MEW A;  4GAO A;  1QX2 A;  2HQ8 A;  1M45 A;  1SR6 C;  2PRU A;  1MHO A;  4Q04 A;  2BE6 A;  2LUC A;  1GJY A;  1ALW A;  1HQV A;  5HKZ A;  1JF2 A;  4M2P A;  1YX8 A;  2HPS A;  2LHI A;  4M2Q A;  4QJ3 B;  3SG5 A;  1S5G Z;  2COL B;  1B8R A;  3BUN B;  2EHB A;  1TNX A;  3DD4 A;  3GK4 X;  1CFC A;  5KSZ A;  1KSO A;  2KFH A;  3FWB A;  4UPG A;  1RFJ A;  2WCB A;  1YVH A;  3DVM A;  3TZ1 A;  1CFF A;  4ETO A;  1K90 D;  3JTD B;  1NYA A;  1TNQ A;  1A75 A;  1K9P A;  2CBL A;  3CR5 X;  2L5X B;  5B8I B;  1G33 A;  4MLW A;  1TNW A;  1RRO A;  2FJU B;  1DGU A;  2MHH A;  3GK1 A;  1B7T Z;  1IKU A;  1OQP A;  1K94 A;  1QX7 A;  2KHN A;  2Q4U A;  5HLV A;  1JF0 A;  4GFT A;  2M7L A;  1MQ1 A;  1KFU S;  2KFF A;  1AUI B;  1IGV A;  3F45 A;  2ZFD A;  1FI5 A;  1NCX A;  3OP0 A;  3AKB A;  3VGO A;  1DJY A;  2WOR A;  3BUM B;  2Y4Q A;  4N1G A;  1OMD A;  1N2D A;  3DF0 B;  3FIA A;  3WHU B;  2O5G A;  4YRU A;  1KK7 Z;  1C07 A;  1K2H A;  1M63 B;  4PCW A;  1YX7 A;  1NUB A;  1DJX A;  1OMV A;  1XFX O;  4CFR A;  1ODB A;  5CPV A;  1U5I A;  3A4U B;  1NSH A;  1SW8 A;  4FTG A;  4DS7 A;  3EKH A;  4XJK A;  4ZCV A;  1TRF A;  1ZMZ A;  1IH0 A;  4MSP A;  4YI8 A;  5BPJ A;  2MRD A;  4XJK B;  1WRZ A;  1SY9 A;  3PM8 A;  1B7T Y;  5IBW A;  1XFV O;  3OB2 B;  1CDP A;  1S1E A;  1S36 A;  2KQY A;  3SG4 A;  5I8N A;  2K2F A;  1CFD A;  2JTT A;  3KO0 A;  1IRJ A;  2FOT A;  2M3W A;  1N0Y A;  1M46 A;  4AQI A;  4DCK A;  4R1E A;  4DRW A;  4D1E A;  2BL0 B;  4GGN A;  2K2A A;  2OPO A;  2M0R A;  4BY4 A;  2K7C A;  2MAZ A;  2CCM A;  2BEC A;  4PE4 A;  3VRR A;  5AER A;  3SJS A;  1TCF A;  3AAK A;  1J7R A;  1XO5 A;  2LCP A;  1CM1 A;  2V53 A;  3PN7 C;  2LVJ A;  3OX5 A;  5JJG A;  2EGD A;  1YR5 A;  2P6B B;  1KSM A;  1G8I A;  2LHL A;  2LM5 A;  4PE7 A;  1AJ4 A;  1DJZ A;  4L9M A;  4JPZ B;  1K8U A;  3BUW B;  1AHR A;  3I5H C;  2PAL A;  3CZT X;  2K7O A;  1DJH A;  3KEV A;  3BQ3 A;  1SR6 B;  1HT9 A;  2R2I A;  1BG1 A;  1AVS A;  4AOM A;  1UUS A;  3QRX A;  4A4C A;  1V1F A;  1TIZ A;  4JWQ A;  1K96 A;  2Q91 A;  1WLM A;  4C0J A;  4MZJ A;  1XFW O;  4YGB B;  2NLN A;  1L2O C;  1QVI Y;  1XVJ A;  2VRG A;  3NSI A;  3EVV A;  1EG3 A;  4MBE A;  4PHM A;  2K8M B;  1B4C A;  1IWQ A;  1LIN A;  1PVA A;  2K61 A;  1SKT A;  4GPL B;  2BCX A;  2JXL A;  4MVF A;  4PHK A;  3SG6 A;  1KK8 C;  2CT9 A;  5AEQ A;  4I5J A;  2LVI A;  1D1O A;  1DMO A;  4HRH A;  1OSA A;  2KGR A;  4WRI A;  3BOW B;  4TNC A;  5AFP A;  1TCO B;  4I5N B;  4FQO A;  4QJ4 B;  1CM4 A;  1XFY O;  2LV7 A;  1WLZ A;  1JWD A;  5DKQ A;  2HQW A;  3EVR A;  4JQ0 D;  1CLB A;  2DOQ A;  2M9G A;  1SRA A;  1UHJ A;  2G2B A;  2KI4 C;  5D7F A;  1S26 D;  1DTL A;  1L7Z A;  3DVE A;  3SIA A;  4F0Z B;  1CLM A;  1KWO B;  1QS7 A;  1LA3 A;  4C0K A;  4ORA B;  1K9K A;  2GGZ A;  2BBN A;  3GK2 A;  3IF7 A;  3OHM B;  2E6W A;  4CPV A;  1REC A;  2PSR A;  5CSF A;  1A29 A;  1S6I A;  1YRT B;  2JZI A;  4U8D A;  4N1F A;  1A75 B;  1BT6 A;  2AAO A;  2BCB A;  1F54 A;  3IQO A;  2RGI A;  1YRU B;  3KF9 A;  2F3Z A;  3ZNI A;  4ORB B;  1BF5 A;  1S3P A;  1NP8 A;  1UWO A;  4MRY A;  2LAP A;  3AAJ A;  3I5I B;  5HLO A;  1XYD A;  1TN4 A;  1EXR A;  2M97 A;  2LE9 B;  2PAS A;  3PN7 B;  2F2O A;  1FPW A;  1QJT A;  1C7W A;  5DKR A;  3NSO A;  3BUO B;  1W7I B;  2B1U A;  1WDC B;  1Y0V H;  2JXC A;  3EKJ A;  3VRQ A;  4N5X A;  1S5G Y;  4USL A;  5AAN A;  3SG3 A;  1DGV A;  3O4Y A;  5KU1 A;  2I94 A;  3LCP C;  2OTG C;  2CNP A;  2JC2 A;  2ZRT A;  2JTZ A;  2KAV A;  1NIW A;  2MLF C;  3I5H B;  2KNE A;  3VRN A;  2K7D A;  2LUX A;  4CFQ A;  3TDU A;  1PK0 D;  1U5I B;  2LVV A;  1BLQ A;  2CTN A;  2CXJ A;  1J7Q A;  1FBV A;  3M0W A;  2BKI B;  2L2E A;  4MZK A;  1F8H A;  3C1V A;  3CGA A;  2KYF A;  4ORC B;  4P2Y B;  1KQM C;  2JT3 A;  1CDL A; 
#chains in the Genus database with same CATH topology
 1RTP 1;  4P5O E;  5PAL A;  1YUR A;  2NXQ A;  4PAL A;  2JQ6 A;  2YGU A;  1PSR A;  1SCM C;  1OZO A;  4OCI A;  1DF0 A;  2BAP A;  2M1K B;  4YI9 A;  1L2O B;  1XFZ O;  1WY9 A;  1DJW A;  1MUX A;  1XA5 A;  1K95 A;  1YTZ C;  2LNK A;  3NSK A;  3I5G C;  3D78 A;  3LK1 A;  3PAT A;  1WRL A;  4OR9 B;  1KK7 Y;  3BXK A;  2P71 A;  4GNK B;  4F7F A;  1F70 A;  2H8V A;  1K9U A;  1CKK A;  1KK8 B;  2ISD A;  1Y1A A;  2OS8 B;  1DEL A;  2JT8 A;  1OOI X;  3FWC A;  1ALV A;  4I5L B;  5CSJ A;  5ER4 X;  1KFU L;  1TTX A;  3DVK A;  3JTD C;  3SG2 A;  1R6P A;  3K21 A;  3SIB A;  2H61 A;  3PAL A;  3NHT A;  4YGA A;  1JSA A;  1S6J A;  2LLS A;  3A8R A;  3RLZ A;  1PVB A;  3PM2 A;  1B9A A;  2KFG A;  4PHN A;  1VRK A;  3WNX B;  3PJI A;  1KQV A;  5HYD A;  1CDN A;  1UHK A;  2WCL A;  5AXI A;  1FI6 A;  1SCV A;  1MXL C;  5I2L A;  1CTR A;  2JOJ A;  1JBA A;  2TN4 A;  2KBM A;  1KFX S;  1NCY A;  2K60 A;  1S6C A;  2AUC A;  3CWG A;  4OVN F;  2ZNE A;  5FYX A;  3BYA A;  4HRG A;  1KCY A;  3D0Y A;  1TOP A;  2QAC A;  4JKT A;  3WXA A;  2M49 B;  4PE1 A;  4XYN A;  3IVT A;  1MF8 B;  3CAB A;  3KPX A;  2AMI A;  2JWW A;  1WRK A;  4ICB A;  2K7B A;  2WCM A;  1BJF A;  4I5K A;  5I2O A;  1IIO A;  1QIV A;  2O60 A;  1CLL A;  5F6T A;  2IS9 A;  1BOC A;  1IQ5 A;  1PUL A;  4HRE E;  4BY5 A;  2QEH A;  4E68 A;  2MBX A;  1NWD A;  1QTX A;  1XK4 C;  2L50 A;  3NHI A;  1OMR A;  2H2K A;  1BR4 B;  1QAS A;  2E30 A;  1K93 D;  1NX0 A;  3HX4 A;  2H61 C;  2L98 A;  1G4Y R;  1NCZ A;  2JNX A;  4WQ3 A;  2SCP A;  1ZFS A;  4YBH B;  2EC6 C;  3SG7 A;  1OZS A;  2G9B A;  3IQQ A;  2BL0 C;  2M7N A;  2ZKM X;  1OW4 A;  1SMG A;  2L4H A;  2MA2 A;  2BKH B;  3R1P A;  1LVC D;  1YUT A;  5G08 A;  3TDZ A;  4CLN A;  4JD9 A;  2FCD A;  5ER5 A;  1AP4 A;  3TS5 C;  1UHI A;  1SSE B;  1OOH A;  1P28 A;  4OKH A;  2LMU A;  5J3X A;  1A4P A;  1J7P A;  4NDB A;  1OOG A;  1IJ5 A;  3HCM A;  4GBA A;  2WCE A;  2Y1M A;  4GUK A;  3FS7 A;  1RJV A;  4MZL A;  1SL9 A;  2LP3 A;  2JU0 A;  1CFP A;  2ZN9 A;  4GGF C;  1NX3 A;  2BCA A;  5K89 A;  3LL8 B;  4DUQ A;  1IJ6 A;  1QLS A;  2ZRS A;  3UO9 A;  1SCM B;  3D74 A;  2K0J A;  1PSB A;  2NCP A;  3NXA A;  4OZD A;  1LKJ A;  1GQM A;  3JVT C;  4MRX A;  4WQ2 A;  1AK8 A;  3AKA A;  1N65 A;  1BR1 B;  2KBI A;  4OV2 A;  1Y6W A;  1ZUZ A;  3I5G B;  1FF1 A;  2KLE A;  3O2P A;  2JNF A;  3R72 A;  3B87 A;  1CMF A;  3I5F C;  1NX1 A;  1B47 A;  1QAT A;  3BUX B;  1B1G A;  2LLU A;  1RK9 A;  2LC5 A;  3O6B A;  1UP5 A;  3TUY C;  1A03 A;  3BJH A;  2F33 A;  1JC2 A;  1F4Q A;  3R1O A;  2HET A;  2M1U A;  3PFV A;  1YUU A;  4NDC A;  1SK6 D;  1DJG A;  2ZN8 A;  4ZCU A;  3D10 A;  2WCH A;  1JUO A;  3CR2 A;  2Y1N A;  1LS8 A;  1W7J B;  1EG4 A;  3B86 A;  4YGC B;  4A4B A;  1QX5 B;  3SS5 A;  2KAX A;  1EL4 A;  1H4B A;  3S0G A;  1BMO A;  2JT0 A;  2M8U A;  2ZND A;  2KQ6 A;  2F3Y A;  3DF0 A;  1H8B A;  1E8A A;  2F2P A;  1ZAC A;  5JOL A;  1CNP A;  1SL8 A;  1GGW A;  2L51 A;  4CID A;  2Y5I A;  1SBJ A;  1OE9 B;  2LP2 A;  1SNL A;  1Y1X A;  4PHJ A;  1RWY A;  1JFK A;  1A2X A;  2WOS A;  5D3O A;  4IL1 A;  1DF0 B;  3TDI A;  3O78 A;  1KWO C;  3BFA A;  1MXE A;  1M31 A;  3EG5 B;  3RM1 A;  2FJY A;  1V1G A;  2KI6 C;  3PSR A;  3WHT B;  4HSZ A;  5I2Q A;  2WCF A;  1QV0 A;  1XK4 A;  1QIW A;  2KAY A;  3CZ1 A;  3D75 A;  1B8L A;  1NX2 A;  4INX A;  2LLT A;  1W9Z A;  1QV1 A;  1SYM A;  2JPO A;  2NCO A;  1AJ5 A;  1FW4 A;  2JRF A;  3OBV A;  2WND A;  3GOF A;  1TWO A;  1PRW A;  2EC6 B;  2PMY A;  2QPT A;  1BU3 A;  1CDM A;  1T14 A;  1DT7 B;  2D8N A;  1Y1U A;  3EK4 A;  1ORG A;  2WCJ A;  2SAS A;  2L5Y A;  3I5I C;  1QXP A;  3WHU B;  2KI4 B;  2I7A A;  1MR8 A;  3KHE A;  5KTY A;  2BE4 A;  1QVI Z;  1F55 A;  3CS1 A;  1CB1 A;  3TS5 B;  1J1E A;  1NPQ A;  2MLE C;  2LAN A;  1IG5 A;  2I2R E;  2I18 A;  1WDC C;  2KGB C;  2L0P A;  4YGE B;  4C0L A;  1J7O A;  1Q80 A;  1F4O A;  2WC8 A;  1UHH A;  3ICB A;  3LLE A;  3E3R A;  2L4I A;  4GGF A;  3D0Y B;  4M2O A;  2GV5 A;  4NQG A;  2KSP A;  3VRP A;  1C3Z A;  1UHN A;  3MSE B;  5HKW A;  1F71 A;  1BOD A;  5DIC A;  1GGZ A;  1SPY A;  4INW A;  1OOF A;  4NDD A;  1EH2 A;  2FCE A;  3CZ2 A;  1TUJ A;  4AQJ A;  1R2U A;  1ZOT B;  1XFU O;  1J1D A;  3K1E A;  3JVT B;  4QJ5 B;  3CR4 X;  2JUL A;  1EJ3 A;  3CLN A;  1OOJ A;  3D73 A;  1IQ3 A;  2HF5 A;  1UUR A;  2F8P A;  2KDH A;  5CSI A;  1LA0 A;  1DJI A;  1Z4H A;  2JPT A;  3FE9 A;  4DIR A;  3RZS A;  1X02 A;  2NZ0 A;  3I5F B;  1DVI A;  3ZWH A;  5D69 A;  1TNP A;  3CYZ A;  4YGD B;  3DYE A;  5CSN A;  1J55 A;  5GQQ C;  3TUY B;  2LMT A;  2KLD A;  2WC6 A;  3EVU A;  2LVK A;  1LXF C;  3BFH A;  4MN0 A;  5DKN A;  1B8C A;  5HKY A;  4KYN A;  2GTE A;  5TNC A;  2A4J A;  2ERB A;  3CTN A;  3VRO A;  2KOT A;  3H4S E;  2OS8 C;  2BBM A;  2OTG B;  3BOW A;  3EK8 A;  3NSL A;  3DVJ A;  1YVL A;  3PLF B;  1C7V A;  3OX6 A;  3LK0 A;  1JFJ A;  4PDZ A;  2PQL A;  1PAL A;  2PVB A;  2PYQ A;  1M39 A;  1SL7 A;  2MJW B;  1YUS A;  3EK7 A;  2M29 A;  1KQM B;  1KFX L;  1CMG A;  2KYC A;  2GGM A;  3OB1 B;  1QLK A;  4PE0 A;  2KI6 D;  1MWN A;  2LMV A;  4MEW A;  4GAO A;  1QX2 A;  2HQ8 A;  1M45 A;  1SR6 C;  2PRU A;  3Q8I A;  3VGO A;  1MHO A;  4Q04 A;  2BE6 A;  2LUC A;  1GJY A;  1ALW A;  1HQV A;  5HKZ A;  1JF2 A;  4M2P A;  1YX8 A;  3SS3 A;  2HPS A;  2LHI A;  4M2Q A;  4QJ3 B;  3S0E A;  3SG5 A;  5I94 A;  1S5G Z;  2COL B;  1B8R A;  4IJ7 A;  3BUN B;  2EHB A;  1TNX A;  3DD4 A;  3GK4 X;  1CFC A;  5KSZ A;  1KSO A;  2KFH A;  3FE6 A;  3FWB A;  1RFJ A;  2WCB A;  1YVH A;  3DVM A;  3TZ1 A;  4UPG A;  1CFF A;  4ETO A;  1K90 D;  3JTD B;  1NYA A;  1TNQ A;  1A75 A;  1K9P A;  2CBL A;  3CR5 X;  2L5X B;  5B8I B;  1G33 A;  4MLW A;  2WC5 A;  1TNW A;  1RRO A;  2FJU B;  3DY9 A;  1DGU A;  2MHH A;  3GK1 A;  1B7T Z;  2BNX A;  5HL1 A;  3VB1 A;  1OQP A;  1IKU A;  1K94 A;  1QX7 A;  2KHN A;  1QWV A;  2Q4U A;  5HLV A;  1JF0 A;  4GFT A;  2M7L A;  1MQ1 A;  1KFU S;  2KFF A;  2QDI A;  1AUI B;  1IGV A;  3F45 A;  2ZFD A;  1DC1 A;  1FI5 A;  1NCX A;  3OP0 A;  3AKB A;  1Z2C B;  1DJY A;  2WOR A;  3BUM B;  2Y4Q A;  4N1G A;  1OMD A;  1N2D A;  3CDN A;  3DF0 B;  3FIA A;  2O5G A;  4YRU A;  1KK7 Z;  1C07 A;  1K2H A;  1M63 B;  4PCW A;  1YX7 A;  1NUB A;  4FQT A;  3UNW A;  2QEB A;  1DJX A;  1OMV A;  1XFX O;  4CFR A;  1ODB A;  5CPV A;  1U5I A;  3A4U B;  1NSH A;  1SW8 A;  4FTG A;  4DS7 A;  3S0F A;  3EKH A;  3L4L A;  4XJK A;  1TRF A;  1ZMZ A;  3OGN A;  4ZCV A;  1IH0 A;  4MSP A;  4YI8 A;  5BPJ A;  2MRD A;  4XJK B;  1WRZ A;  1SY9 A;  1C3Y A;  3PM8 A;  1B7T Y;  5IBW A;  1XFV O;  3OB2 B;  1CDP A;  1S1E A;  1S36 A;  2KQY A;  3SG4 A;  5I8N A;  2K2F A;  1CFD A;  2JTT A;  3KO0 A;  1IRJ A;  2FOT A;  2M3W A;  1N0Y A;  1M46 A;  3B88 A;  3L47 A;  4AQI A;  4DCK A;  4R1E A;  4DRW A;  4D1E A;  2BL0 B;  4GGN A;  2K2A A;  2OPO A;  2M0R A;  4BY4 A;  2K7C A;  2MAZ A;  2CCM A;  2BEC A;  4PE4 A;  3VRR A;  5AER A;  3SJS A;  1TCF A;  3AAK A;  1J7R A;  1XO5 A;  2LCP A;  1CM1 A;  2V53 A;  3PN7 C;  2LVJ A;  3OX5 A;  5JJG A;  2EGD A;  1YR5 A;  2QEV A;  2WCK A;  2P6B B;  1KSM A;  1G8I A;  2LHL A;  2LM5 A;  4PE7 A;  1AJ4 A;  1DJZ A;  4L9M A;  4JPZ B;  5FI7 A;  1K8U A;  3BUW B;  1AHR A;  3I5H C;  2PAL A;  3CZT X;  2K7O A;  3D76 A;  1DJH A;  3KEV A;  3BQ3 A;  1SR6 B;  1HT9 A;  2R2I A;  5FI2 A;  1BG1 A;  1AVS A;  4AOM A;  1UUS A;  3QRX A;  4A4C A;  1V1F A;  3B6X A;  2P70 A;  1TIZ A;  4JWQ A;  1K96 A;  5FI6 A;  2Q91 A;  1WLM A;  4C0J A;  4MZJ A;  1XFW O;  4YGB B;  1DQE A;  2NLN A;  1L2O C;  1QVI Y;  1XVJ A;  2VRG A;  3NSI A;  3EVV A;  1EG3 A;  4MBE A;  4PHM A;  3S0D A;  2K8M B;  1B4C A;  1IWQ A;  1LIN A;  1PVA A;  2K61 A;  1SKT A;  4GPL B;  2BCX A;  2JXL A;  4MVF A;  4PHK A;  3SG6 A;  1KK8 C;  2CT9 A;  5AEQ A;  4I5J A;  2LVI A;  1D1O A;  1DMO A;  3DXL A;  4HRH A;  1OSA A;  2KGR A;  4WRI A;  3BOW B;  4TNC A;  5AFP A;  1TCO B;  4I5N B;  4FQO A;  3R1V A;  1CM4 A;  3BFB A;  4QJ4 B;  1XFY O;  2LV7 A;  1WLZ A;  1JWD A;  3NGV A;  5DKQ A;  2HQW A;  3EVR A;  4JQ0 D;  3O4X A;  1CLB A;  2DOQ A;  2M9G A;  1SRA A;  1UHJ A;  3SS4 A;  2G2B A;  2KI4 C;  5D7F A;  1S26 D;  1DTL A;  5EL2 A;  1L7Z A;  3DVE A;  3SIA A;  4F0Z B;  1CLM A;  1KWO B;  1QS7 A;  3L4A A;  3S0B A;  1LA3 A;  4C0K A;  4ORA B;  1K9K A;  1TUZ A;  2GGZ A;  2L2C A;  4PT1 A;  2BBN A;  3GK2 A;  3IF7 A;  3OHM B;  1GM0 A;  2E6W A;  4CPV A;  1REC A;  2PSR A;  2QEO A;  5CSF A;  1A29 A;  1S6I A;  1YRT B;  2JZI A;  4U8D A;  4N1F A;  3V2L A;  1A75 B;  1BT6 A;  2AAO A;  2BCB A;  1F54 A;  3IQO A;  2RGI A;  1YRU B;  2KPH A;  1DEK A;  3KF9 A;  2F3Z A;  3ZNI A;  4ORB B;  1BF5 A;  1S3P A;  1NP8 A;  1UWO A;  4MRY A;  2LAP A;  3AAJ A;  3I5I B;  5HLO A;  1XYD A;  1TN4 A;  1EXR A;  2M97 A;  2LE9 B;  2PAS A;  3PN7 B;  2F2O A;  1FPW A;  1QJT A;  1C7W A;  5DKR A;  3NSO A;  3BUO B;  1W7I B;  3B7A A;  2B1U A;  1WDC B;  1Y0V H;  2JXC A;  3EKJ A;  3VRQ A;  4N5X A;  1S5G Y;  4USL A;  5AAN A;  3FE8 A;  3SG3 A;  1DGV A;  3N7H A;  3O4Y A;  2I94 A;  3LCP C;  5KU1 A;  2OTG C;  2CNP A;  2JC2 A;  2ZRT A;  3CZ0 A;  2JTZ A;  2KAV A;  1NIW A;  2MLF C;  3I5H B;  2KNE A;  3VRN A;  2K7D A;  2LUX A;  4CFQ A;  3TDU A;  1PK0 D;  1U5I B;  2LVV A;  1BLQ A;  2CTN A;  2CXJ A;  1J7Q A;  1FBV A;  3M0W A;  2BKI B;  2L2E A;  4MZK A;  1F8H A;  3C1V A;  3CGA A;  3QME A;  3DZT A;  2KYF A;  4ORC B;  4P2Y B;  1KQM C;  1XFR A;  3D77 A;  2JT3 A;  3S0A A;  1CDL A; 
#chains in the Genus database with same CATH homology
 1RTP 1;  4P5O E;  5PAL A;  1YUR A;  2NXQ A;  4PAL A;  2JQ6 A;  1PSR A;  1SCM C;  1OZO A;  4OCI A;  1DF0 A;  2M1K B;  4YI9 A;  1L2O B;  1XFZ O;  1WY9 A;  1DJW A;  1MUX A;  1XA5 A;  1K95 A;  1YTZ C;  2LNK A;  3NSK A;  3I5G C;  3PAT A;  3LK1 A;  1WRL A;  4OR9 B;  1KK7 Y;  3BXK A;  4GNK B;  1F70 A;  1K9U A;  1CKK A;  1KK8 B;  2ISD A;  1Y1A A;  2OS8 B;  2JT8 A;  4I5L B;  3FWC A;  1ALV A;  5CSJ A;  5ER4 X;  1KFU L;  1TTX A;  3DVK A;  3JTD C;  3SG2 A;  1R6P A;  3K21 A;  3SIB A;  2H61 A;  3PAL A;  4YGA A;  1JSA A;  1S6J A;  2LLS A;  3A8R A;  3RLZ A;  1PVB A;  1B9A A;  2KFG A;  4PHN A;  1VRK A;  3WNX B;  1KQV A;  5HYD A;  1CDN A;  1UHK A;  1FI6 A;  5AXI A;  1SCV A;  1MXL C;  5I2L A;  1CTR A;  2JOJ A;  1JBA A;  2TN4 A;  2KBM A;  1KFX S;  1NCY A;  1S6C A;  2AUC A;  3CWG A;  4OVN F;  2ZNE A;  5FYX A;  3BYA A;  4HRG A;  1KCY A;  3D0Y A;  1TOP A;  2QAC A;  3WXA A;  2M49 B;  4PE1 A;  4XYN A;  1MF8 B;  3KPX A;  2AMI A;  2JWW A;  1WRK A;  4ICB A;  2K7B A;  1BJF A;  4I5K A;  5I2O A;  1QIV A;  2O60 A;  1CLL A;  5F6T A;  2IS9 A;  1BOC A;  1IQ5 A;  1PUL A;  4HRE E;  4BY5 A;  4E68 A;  2MBX A;  1NWD A;  1QTX A;  1XK4 C;  2L50 A;  1OMR A;  2H2K A;  1BR4 B;  1QAS A;  2E30 A;  1K93 D;  1NX0 A;  3HX4 A;  2H61 C;  2L98 A;  1G4Y R;  1NCZ A;  2JNX A;  4WQ3 A;  2SCP A;  1ZFS A;  4YBH B;  2EC6 C;  3SG7 A;  1OZS A;  2G9B A;  3IQQ A;  2BL0 C;  2M7N A;  2ZKM X;  1SMG A;  2L4H A;  2MA2 A;  2BKH B;  1LVC D;  1YUT A;  5G08 A;  3TDZ A;  4CLN A;  2FCD A;  5ER5 A;  1AP4 A;  3TS5 C;  1UHI A;  4OKH A;  2LMU A;  5J3X A;  1A4P A;  1J7P A;  4NDB A;  1IJ5 A;  3HCM A;  4GBA A;  2WCE A;  2Y1M A;  4GUK A;  3FS7 A;  1RJV A;  4MZL A;  1SL9 A;  2LP3 A;  2JU0 A;  1CFP A;  2ZN9 A;  4GGF C;  1NX3 A;  2BCA A;  5K89 A;  3LL8 B;  4DUQ A;  1IJ6 A;  1QLS A;  2ZRS A;  1SCM B;  2K0J A;  1PSB A;  2NCP A;  3NXA A;  4WQ2 A;  1LKJ A;  1GQM A;  3JVT C;  4MRX A;  1AK8 A;  3AKA A;  1N65 A;  1BR1 B;  2KBI A;  4OV2 A;  1Y6W A;  1ZUZ A;  3I5G B;  1FF1 A;  3O2P A;  2JNF A;  1CMF A;  3I5F C;  1NX1 A;  1B47 A;  1QAT A;  3BUX B;  1B1G A;  2LLU A;  1RK9 A;  2LC5 A;  3O6B A;  1UP5 A;  3TUY C;  1A03 A;  2F33 A;  1JC2 A;  1F4Q A;  2HET A;  2M1U A;  3PFV A;  1YUU A;  4NDC A;  1SK6 D;  1DJG A;  2ZN8 A;  4ZCU A;  3D10 A;  1JUO A;  3CR2 A;  2Y1N A;  1W7J B;  1EG4 A;  4YGC B;  4A4B A;  1QX5 B;  2KAX A;  1EL4 A;  1H4B A;  1BMO A;  2JT0 A;  2M8U A;  2ZND A;  2KQ6 A;  2F3Y A;  3DF0 A;  1H8B A;  1E8A A;  2F2P A;  1ZAC A;  5JOL A;  1CNP A;  1SL8 A;  1GGW A;  2L51 A;  4CID A;  2Y5I A;  1SBJ A;  1OE9 B;  2LP2 A;  1SNL A;  1Y1X A;  4PHJ A;  1RWY A;  1JFK A;  1A2X A;  2WOS A;  4IL1 A;  1DF0 B;  3TDI A;  3O78 A;  1KWO C;  1MXE A;  1M31 A;  3RM1 A;  1V1G A;  2KI6 C;  3PSR A;  3WHT B;  4HSZ A;  5I2Q A;  2WCF A;  1QV0 A;  1XK4 A;  1QIW A;  2KAY A;  1B8L A;  1NX2 A;  2LLT A;  1QV1 A;  1SYM A;  2NCO A;  1AJ5 A;  1FW4 A;  2JRF A;  2WND A;  3GOF A;  1PRW A;  2EC6 B;  2PMY A;  2QPT A;  1BU3 A;  1CDM A;  1DT7 B;  2D8N A;  1Y1U A;  3EK4 A;  2SAS A;  3I5I C;  1QXP A;  2KI4 B;  2I7A A;  1MR8 A;  3KHE A;  5KTY A;  2BE4 A;  1QVI Z;  1F55 A;  3CS1 A;  1CB1 A;  3TS5 B;  1J1E A;  1NPQ A;  2MLE C;  2LAN A;  1IG5 A;  2I2R E;  2I18 A;  1WDC C;  2KGB C;  2L0P A;  4YGE B;  4C0L A;  1J7O A;  1Q80 A;  1F4O A;  2WC8 A;  1UHH A;  3ICB A;  3LLE A;  3E3R A;  2L4I A;  4GGF A;  3D0Y B;  4M2O A;  2GV5 A;  4NQG A;  2KSP A;  3VRP A;  1UHN A;  3MSE B;  5HKW A;  1F71 A;  1BOD A;  1GGZ A;  1SPY A;  1EH2 A;  4NDD A;  2FCE A;  4AQJ A;  1R2U A;  1ZOT B;  1XFU O;  1J1D A;  3JVT B;  4QJ5 B;  3CR4 X;  2JUL A;  1EJ3 A;  3CLN A;  1OOJ A;  1IQ3 A;  2HF5 A;  1UUR A;  2F8P A;  2KDH A;  5CSI A;  1LA0 A;  1DJI A;  2JPT A;  4DIR A;  1X02 A;  2NZ0 A;  3I5F B;  1DVI A;  3ZWH A;  5D69 A;  1TNP A;  4YGD B;  5CSN A;  1J55 A;  5GQQ C;  3TUY B;  2LMT A;  3EVU A;  4MN0 A;  5HKY A;  2LVK A;  1LXF C;  5DKN A;  1B8C A;  5TNC A;  2A4J A;  3CTN A;  3VRO A;  2KOT A;  3H4S E;  2OS8 C;  2BBM A;  2OTG B;  3BOW A;  3EK8 A;  3NSL A;  3DVJ A;  1YVL A;  3PLF B;  1C7V A;  3OX6 A;  3LK0 A;  1JFJ A;  4PDZ A;  1PAL A;  2PVB A;  1M39 A;  1SL7 A;  2MJW B;  1YUS A;  3EK7 A;  2M29 A;  1KQM B;  1KFX L;  1CMG A;  2KYC A;  2GGM A;  3OB1 B;  1QLK A;  4PE0 A;  2KI6 D;  1MWN A;  2LMV A;  4MEW A;  4GAO A;  1QX2 A;  2HQ8 A;  1M45 A;  1SR6 C;  2PRU A;  1MHO A;  4Q04 A;  2BE6 A;  2LUC A;  1GJY A;  1ALW A;  1HQV A;  5HKZ A;  1JF2 A;  4M2P A;  1YX8 A;  2HPS A;  2LHI A;  4M2Q A;  4QJ3 B;  3SG5 A;  1S5G Z;  2COL B;  1B8R A;  3BUN B;  2EHB A;  1TNX A;  3DD4 A;  3GK4 X;  1CFC A;  5KSZ A;  1KSO A;  2KFH A;  3FWB A;  4UPG A;  1RFJ A;  2WCB A;  1YVH A;  3DVM A;  3TZ1 A;  1CFF A;  4ETO A;  1K90 D;  3JTD B;  1NYA A;  1TNQ A;  1A75 A;  1K9P A;  2CBL A;  3CR5 X;  2L5X B;  5B8I B;  1G33 A;  4MLW A;  1TNW A;  1RRO A;  2FJU B;  1DGU A;  2MHH A;  3GK1 A;  1B7T Z;  1IKU A;  1OQP A;  1K94 A;  1QX7 A;  2KHN A;  2Q4U A;  5HLV A;  1JF0 A;  4GFT A;  2M7L A;  1MQ1 A;  1KFU S;  2KFF A;  1AUI B;  1IGV A;  3F45 A;  2ZFD A;  1FI5 A;  1NCX A;  3OP0 A;  3AKB A;  3VGO A;  1DJY A;  2WOR A;  3BUM B;  2Y4Q A;  4N1G A;  1OMD A;  1N2D A;  3DF0 B;  3FIA A;  3WHU B;  2O5G A;  4YRU A;  1KK7 Z;  1C07 A;  1K2H A;  1M63 B;  4PCW A;  1YX7 A;  1NUB A;  1DJX A;  1OMV A;  1XFX O;  4CFR A;  1ODB A;  5CPV A;  1U5I A;  3A4U B;  1NSH A;  1SW8 A;  4FTG A;  4DS7 A;  3EKH A;  4XJK A;  4ZCV A;  1TRF A;  1ZMZ A;  1IH0 A;  4MSP A;  4YI8 A;  5BPJ A;  2MRD A;  4XJK B;  1WRZ A;  1SY9 A;  3PM8 A;  1B7T Y;  5IBW A;  1XFV O;  3OB2 B;  1CDP A;  1S1E A;  1S36 A;  2KQY A;  3SG4 A;  5I8N A;  2K2F A;  1CFD A;  2JTT A;  3KO0 A;  1IRJ A;  2FOT A;  2M3W A;  1N0Y A;  1M46 A;  4AQI A;  4DCK A;  4R1E A;  4DRW A;  4D1E A;  2BL0 B;  4GGN A;  2K2A A;  2OPO A;  2M0R A;  4BY4 A;  2K7C A;  2MAZ A;  2CCM A;  2BEC A;  4PE4 A;  3VRR A;  5AER A;  3SJS A;  1TCF A;  3AAK A;  1J7R A;  1XO5 A;  2LCP A;  1CM1 A;  2V53 A;  3PN7 C;  2LVJ A;  3OX5 A;  5JJG A;  2EGD A;  1YR5 A;  2P6B B;  1KSM A;  1G8I A;  2LHL A;  2LM5 A;  4PE7 A;  1AJ4 A;  1DJZ A;  4L9M A;  4JPZ B;  1K8U A;  3BUW B;  1AHR A;  3I5H C;  2PAL A;  3CZT X;  2K7O A;  1DJH A;  3KEV A;  3BQ3 A;  1SR6 B;  1HT9 A;  2R2I A;  1BG1 A;  1AVS A;  4AOM A;  1UUS A;  3QRX A;  4A4C A;  1V1F A;  1TIZ A;  4JWQ A;  1K96 A;  2Q91 A;  1WLM A;  4C0J A;  4MZJ A;  1XFW O;  4YGB B;  2NLN A;  1L2O C;  1QVI Y;  1XVJ A;  2VRG A;  3NSI A;  3EVV A;  1EG3 A;  4MBE A;  4PHM A;  2K8M B;  1B4C A;  1IWQ A;  1LIN A;  1PVA A;  2K61 A;  1SKT A;  4GPL B;  2BCX A;  2JXL A;  4MVF A;  4PHK A;  3SG6 A;  1KK8 C;  2CT9 A;  5AEQ A;  4I5J A;  2LVI A;  1D1O A;  1DMO A;  4HRH A;  1OSA A;  2KGR A;  4WRI A;  3BOW B;  4TNC A;  5AFP A;  1TCO B;  4I5N B;  4FQO A;  4QJ4 B;  1CM4 A;  1XFY O;  2LV7 A;  1WLZ A;  1JWD A;  5DKQ A;  2HQW A;  3EVR A;  4JQ0 D;  1CLB A;  2DOQ A;  2M9G A;  1SRA A;  1UHJ A;  2G2B A;  2KI4 C;  5D7F A;  1S26 D;  1DTL A;  1L7Z A;  3DVE A;  3SIA A;  4F0Z B;  1CLM A;  1KWO B;  1QS7 A;  1LA3 A;  4C0K A;  4ORA B;  1K9K A;  2GGZ A;  2BBN A;  3GK2 A;  3IF7 A;  3OHM B;  2E6W A;  4CPV A;  1REC A;  2PSR A;  5CSF A;  1A29 A;  1S6I A;  1YRT B;  2JZI A;  4U8D A;  4N1F A;  1A75 B;  1BT6 A;  2AAO A;  2BCB A;  1F54 A;  3IQO A;  2RGI A;  1YRU B;  3KF9 A;  2F3Z A;  3ZNI A;  4ORB B;  1BF5 A;  1S3P A;  1NP8 A;  1UWO A;  4MRY A;  2LAP A;  3AAJ A;  3I5I B;  5HLO A;  1XYD A;  1TN4 A;  1EXR A;  2M97 A;  2LE9 B;  2PAS A;  3PN7 B;  2F2O A;  1FPW A;  1QJT A;  1C7W A;  5DKR A;  3NSO A;  3BUO B;  1W7I B;  2B1U A;  1WDC B;  1Y0V H;  2JXC A;  3EKJ A;  3VRQ A;  4N5X A;  1S5G Y;  4USL A;  5AAN A;  3SG3 A;  1DGV A;  3O4Y A;  5KU1 A;  2I94 A;  3LCP C;  2OTG C;  2CNP A;  2JC2 A;  2ZRT A;  2JTZ A;  2KAV A;  1NIW A;  2MLF C;  3I5H B;  2KNE A;  3VRN A;  2K7D A;  2LUX A;  4CFQ A;  3TDU A;  1PK0 D;  1U5I B;  2LVV A;  1BLQ A;  2CTN A;  2CXJ A;  1J7Q A;  1FBV A;  3M0W A;  2BKI B;  2L2E A;  4MZK A;  1F8H A;  3C1V A;  3CGA A;  2KYF A;  4ORC B;  4P2Y B;  1KQM C;  2JT3 A;  1CDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...