4JWQA

Crystal structure of the calcium binding domain of cdpk3 from plasmodium berghei, pb000947.00
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
74
structure length
69
Chain Sequence
b'KHLSKKLIYCAFRVFDVDNDGEITTAELAHILYNSITQKDVNQVKKMIQEVDKNNDGKIDFYEFCEMMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Calcium-dependent protein kinase
publication title Crystal Structure of the Calcium Binding Domain of CDPK3 from Plasmodium Berghei, PB000947.00
rcsb
source organism Plasmodium berghei
molecule tags Transferase
total genus 23
structure length 69
sequence length 74
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4jwqA00
2JT8A 3ICBA 2ZN8A 1CFDA 3FS7A 2F2OA 4L9MA 5J3XA 3MSEB 3IQQA 1KFUL 2BE4A 1KK8B 4ORAB 3WHTB 1QX7A 1CDMA 1S6JA 2G2BA 2NZ0A 1CLBA 2Y1NA 2JTZA 3PATA 1U5IB 5KTYA 1FBVA 2QPTA 2FCDA 1KQVA 3LLEA 2M9GA 1KCYA 1FI5A 1EJ3A 4NQGA 1K95A 2NCPA 2F3YA 1ZMZA 2ISDA 2K0JA 2PALA 2Y4QA 3NSKA 1A03A 3KPXA 3SIBA 4C0JA 2ZNDA 2M3WA 1PSRA 4YGBB 1X02A 1DJYA 1NCZA 1MHOA 2D8NA 2PVBA 2LCPA 3NSIA 5ER4X 2JXLA 2QACA 4DCKA 1UHHA 1GQMA 1CDNA 3FWBA 1XYDA 5HKWA 4U8DA 2JPTA 1QASA 1ZUZA 2SCPA 4ORBB 2KSPA 3CR2A 2LVVA 5I2OA 2K7DA 1ZOTB 1J7QA 3VRPA 1QIVA 2KI6C 1AUIB 4WRIA 2JT0A 3EVUA 3QRXA 1TIZA 4I5LB 1MUXA 1AJ5A 1FPWA 2MAZA 2KHNA 2M49B 1TCFA 1G8IA 2NCOA 2LVIA 3PN7C 1Y1XA 5I2LA 2H2KA 1ALVA 1OQPA 1YUTA 4PHKA 1YURA 2HQ8A 4OCIA 1IG5A 2F8PA 5DKRA 3BUWB 4DIRA 3DF0B 1R6PA 1UHIA 2JTTA 2SASA 1S26D 2MLFC 5JJGA 3ZWHA 2R2IA 2VRGA 1JUOA 3BUOB 4HSZA 1HT9A 3BUMB 1KFXS 4HRGA 1PSBA 1D1OA 1SCMC 4GFTA 2BBMA 4GPLB 2BECA 3SJSA 1BF5A 1TNXA 2NXQA 1SR6B 2KI4C 2IS9A 2KAXA 3SG3A 1B7TY 5B8IB 3AAKA 3TUYC 2K61A 4QJ4B 2K2AA 2RGIA 4I5JA 1QV1A 4JPZB 2JNXA 4M2OA 4A4BA 2Y1MA 3LK1A 1K9PA 4PE4A 2KFFA 1ALWA 1B8LA 2O5GA 1JWDA 2L0PA 1J55A 2Q91A 2WCFA 3O78A 2HETA 3I5GC 5BPJA 1SCMB 2AMIA 5GQQC 1N0YA 4MBEA 3WXAA 1QVIY 4FTGA 4I5KA 1C07A 3A8RA 2JU0A 1WY9A 1TN4A 1YTZC 2KDHA 2OTGC 3PLFB 2MRDA 1DF0B 1BMOA 1SCVA 1YX7A 2KFGA 1CM1A 2CXJA 5CSNA 3FIAA 1TNWA 1EH2A 1CTRA 3GK4X 1WRLA 3E3RA 1B8RA 1H8BA 1L7ZA 1SNLA 3VRQA 1LA3A 2FCEA 2JT3A 2L4IA 1QX2A 4YGCB 4CPVA 1WLZA 3I5GB 5HYDA 1XFWO 1JF0A 4C0KA 1Q80A 4Q04A 1CB1A 3GK1A 3NSOA 1B9AA 1S5GY 1WDCB 2F33A 2K2FA 2LMVA 3KHEA 2BL0B 4YGEB 1BLQA 1OMDA 4PHNA 1S3PA 5AANA 1UHNA 1M46A 1FW4A 1QATA 2HF5A 3BXKA 3I5FB 3BQ3A 2G9BA 2LLTA 1CLMA 4OV2A 4MEWA 1F8HA 1B8CA 5KSZA 1PALA 1U5IA 5AXIA 1C7VA 2LHIA 1WLMA 1QLKA 2CNPA 3EK7A 1YX8A 1BT6A 2KBMA 3SG6A 1NCYA 1RJVA 1J1EA 1JSAA 1UP5A 3CZTX 1Y0VH 4MRYA 1JFJA 1SW8A 1TRFA 1HQVA 1RROA 1SMGA 1SY9A 1K93D 2GGZA 2KNEA 1EL4A 2I94A 1G4YR 1SL9A 1NX0A 4CLNA 2LNKA 1RFJA 1QTXA 2HPSA 4PALA 1G33A 1QJTA 1K9KA 1K94A 1SKTA 1DJWA 4N5XA 3PALA 1MXLC 1F70A 1DGUA 2L50A 3JTDC 1V1FA 1B4CA 4IL1A 1F71A 1QLSA 1QV0A 1IWQA 2F3ZA 3EK4A 4ORCB 2O60A 1C7WA 3CTNA 1MF8B 1B1GA 1K2HA 2ZN9A 1NX3A 1NX1A 3H4SE 2PASA 1TNQA 3DF0A 3DD4A 5HKZA 1V1GA 3TDIA 1QX5B 4M2PA 2BBNA 1SR6C 4OVNF 1A75A 2JWWA 3JTDB 3I5IB 2H61C 2L5XB 1JC2A 1B7TZ 4TNCA 5CPVA 2GV5A 4DS7A 1IH0A 1ZFSA 5FYXA 3SG4A 2DOQA 1AJ4A 3TS5B 1DGVA 2MHHA 3DVKA 3D10A 1XFXO 3PFVA 2JULA 4ICBA 1QXPA 3TZ1A 2H61A 4MZJA 1W7IB 1A75B 4QJ5B 4I5NB 5I2QA 3O4YA 3KF9A 3DVJA 3HX4A 1CDPA 4BY4A 4NDBA 2E30A 2ZRSA 3FWCA 3VROA 1OMRA 3EVVA 1LA0A 1QVIZ 2AUCA 4OR9B 1SBJA 2JC2A 4P2YB 4PHMA 1W7JB 2EC6C 4MN0A 1OZSA 2KQYA 1KSMA 2WC8A 1DJHA 1M39A 4M2QA 4ZCVA 1DMOA 1BODA 3C1VA 1OSAA 2PRUA 1IJ5A 1YVHA 2Q4UA 1Y1AA 3K21A 1EXRA 1PVAA 1N65A 1XVJA 2JXCA 1S36A 5AEQA 4CFRA 1LXFC 3EVRA 4GBAA 1WRKA 1YUSA 2KBIA 1DF0A 4YBHB 3IF7A 3I5HC 2AAOA 1GJYA 1KFUS 1BR4B 1NSHA 1YRUB 1SRAA 2K7CA 3IQOA 2GGMA 1BOCA 1GGWA 4CFQA 1WDCC 2BKHB 2BL0C 1NUBA 2TN4A 1BU3A 1AP4A 2EC6B 1S5GZ 5D7FA 5K89A 1YRTB 1K96A 1JBAA 2KAVA 4MVFA 4PE1A 3I5FC 1ODBA 3NSLA 4GNKB 2PMYA 1TCOB 5IBWA 3TDUA 2V53A 5DKNA 4HREE 4PDZA 4D1EA 3BYAA 1BJFA 1UURA 1K9UA 4MZKA 2LP2A 3I5HB 2BCXA 3SIAA 3WNXB 1K8UA 2LE9B 2OS8B 2CTNA 2ZFDA 3SG7A 1SPYA 4QJ3B 1CKKA 2KGRA 3PM8A 2KFHA 2MJWB 5HLVA 2BKIB 3OHMB 1AK8A 1M45A 1CMFA 1UWOA 2BCBA 4R1EA 2LM5A 4PE0A 3AKAA 2JZIA 1QIWA 1CFFA 3VRNA 2CCMA 1GGZA 1DVIA 3DVMA 5JOLA 2M29A 1IJ6A 1UHJA 3EKJA 2L2EA 4AOMA 5CSFA 2LC5A 1NYAA 2LHLA 2L98A 1F4QA 1F4OA 4F0ZB 2B1UA 3BUXB 3KEVA 1CFCA 2KQ6A 3WHUB 2CBLA 1FI6A 1J1DA 3M0WA 3JVTB 4ZCUA 1J7OA 1F55A 2LMUA 3EK8A 4UPGA 2M1UA 1L2OC 1CFPA 5HKYA 1M63B 2JRFA 3VRRA 4BY5A 2CT9A 2LV7A 2WCEA 2KI6D 3I5IC 4GAOA 4JWQA 1AHRA 1A29A 1LKJA 2FOTA 3ZNIA 1PRWA 1TOPA 1XA5A 1BR1B 2LVJA 1OZOA 1YVLA 2E6WA 3TS5C 1J7PA 4XJKB 3BOWA 1PVBA 1IKUA 1XFZO 4DRWA 1MWNA 4YRUA 2I7AA 1L2OB 1KQMC 1DJIA 1KWOC 5DKQA 1S1EA 3LCPC 3AKBA 1EG4A 2LLSA 3OB1B 4GGNA 3BOWB 4GGFC 2HQWA 1A4PA 1N2DA 1VRKA 5I8NA 2LAPA 1XK4C 2LUCA 1RK9A 2KYCA 3VGOA 1CNPA 2JNFA 1NPQA 4MSPA 1WRZA 2WCBA 1B47A 1CMGA 1E8AA 2BE6A 3CS1A 4GGFA 3HCMA 2M7LA 1YUUA 3OP0A 1XK4A 2P6BB 1KQMB 1PULA 1KWOB 3OB2B 3BUNB 2LUXA 3A4UB 3SG2A 2LP3A 2EHBA 2KYFA 1ZACA 3GK2A 4YI8A 4YGDB 1KK7Z 1OOJA 2LLUA 1RWYA 3TDZA 4MRXA 1S6IA 4N1FA 2JOJA 1CLLA 1NWDA 1Y6WA 1Y1UA 1PK0D 1K90D 2ZNEA 2WORA 1XO5A 2ZKMX 3CGAA 4AQIA 4WQ3A 1MQ1A 5CSJA 2MBXA 1DJGA 2KGBC 2M97A 2WNDA 3CWGA 1DJZA 2MLEC 4HRHA 1SK6D 4PCWA 2M7NA 1JFKA 2K8MB 1IQ5A 4PHJA 1KK7Y 4XYNA 3PN7B 4AQJA 1XFYO 2JQ6A 2OS8C 3PSRA 3SG5A 3OX6A 1A2XA 5AFPA 5ER5A 1DTLA 1LVCD 5HLOA 4USLA 2EGDA 4MZLA 5AERA 3LL8B 3F45A 1RTP1 4NDCA 1AVSA 1LINA 4YI9A 2M0RA 2L51A 2K7OA 4WQ2A 1H4BA 3O2PA 2LANA 1XFVO 2LMTA 3RLZA 1MXEA 1MR8A 5G08A 2WOSA 3D0YA 3CR4X 2ZRTA 4JQ0D 4C0LA 2KI4B 3DVEA 2OPOA 2NLNA 1CDLA 1NIWA 2M8UA 3LK0A 3TUYB 3NXAA 4N1GA 1NCXA 2A4JA 2FJUB 1SL7A 3D0YB 3JVTC 1DJXA 3O6BA 1J7RA 1NP8A 3EKHA 4PE7A 4YGAA 5CSIA 1UUSA 4DUQA 3GOFA 2K7BA 5TNCA 4CIDA 1IGVA 1DT7B 1OE9B 3AAJA 5PALA 1F54A 2PSRA 5KU1A 3CR5X 5F6TA 2M1KB 4GUKA 1KFXL 2I2RE 1EG3A 1JF2A 1R2UA 3KO0A 1KK8C 3OX5A 4ETOA 1BG1A 2I18A 4MLWA 2BCAA 1S6CA 2OTGB 1SYMA 1QS7A 3RM1A 2MA2A 1UHKA 4P5OE 1NX2A 2KOTA 4NDDA 2COLB 2L4HA 1IQ3A 1CM4A 1TNPA 5D69A 1XFUO 2Y5IA 4FQOA 1IRJA 4A4CA 1FF1A 1M31A 1RECA 4OKHA 2F2PA 2LVKA 1OMVA 1TTXA 2KAYA 1SL8A 4XJKA 3CLNA 1KSOA 1YR5A 4E68A
chains in the Genus database with same CATH superfamily
2JT8A 3ICBA 2ZN8A 1CFDA 3FS7A 2F2OA 4L9MA 5J3XA 3MSEB 3IQQA 1KFUL 2BE4A 1KK8B 2QDIA 4ORAB 3WHTB 1QX7A 1CDMA 1S6JA 2G2BA 2NZ0A 1CLBA 2Y1NA 3R1PA 2JTZA 3PATA 1U5IB 5KTYA 1FBVA 1W9ZA 3L4LA 2QPTA 2FCDA 2WC5A 1KQVA 3LLEA 2M9GA 1OW4A 1KCYA 1DC1A 2PQLA 1EJ3A 4NQGA 1K95A 2NCPA 2F3YA 1TUZA 1ZMZA 2ISDA 2K0JA 2PALA 2Y4QA 3NSKA 1A03A 3KPXA 3SIBA 4C0JA 2ZNDA 2M3WA 1PSRA 4YGBB 1X02A 1DJYA 1NCZA 1MHOA 2D8NA 2PVBA 2LCPA 3NSIA 5ER4X 2JXLA 2QACA 4DCKA 1UHHA 1GQMA 1CDNA 3FWBA 1XYDA 5HKWA 4U8DA 2JPTA 1QASA 1ZUZA 2SCPA 4ORBB 2KSPA 3CR2A 2LVVA 5I2OA 2K7DA 3CZ1A 1ZOTB 1J7QA 3VRPA 1QIVA 2KI6C 1AUIB 4WRIA 2JT0A 3D75A 3EVUA 3QRXA 1TIZA 4I5LB 1MUXA 1AJ5A 1FPWA 2MAZA 2PYQA 2KHNA 2M49B 3S0AA 1TCFA 2P71A 1G8IA 1TWOA 2NCOA 2LVIA 3PN7C 1Y1XA 5I2LA 2H2KA 1ALVA 1OQPA 1YUTA 4PHKA 1YURA 2HQ8A 4OCIA 1IG5A 2F8PA 5DKRA 3BUWB 4DIRA 3DF0B 3OGNA 1R6PA 1UHIA 2JTTA 2L2CA 2SASA 1S26D 2MLFC 5JJGA 3ZWHA 3NHIA 2R2IA 2VRGA 1JUOA 2QEHA 3BUOB 4HSZA 3PJIA 1HT9A 3BUMB 1KFXS 4HRGA 1PSBA 1D1OA 1SCMC 4GFTA 2BBMA 1Z2CB 2BECA 4GPLB 3SJSA 2GTEA 1BF5A 3UO9A 1TNXA 3R72A 2NXQA 1SR6B 2KI4C 2IS9A 2KAXA 4KYNA 3SG3A 1B7TY 5B8IB 3AAKA 3TUYC 2K61A 4QJ4B 2K2AA 1C3YA 2RGIA 4I5JA 1QV1A 4JPZB 3NGVA 2JNXA 4M2OA 4A4BA 2Y1MA 3LK1A 1K9PA 4PE4A 2KFFA 1ALWA 1B8LA 2O5GA 1JWDA 2ERBA 2L0PA 2H8VA 1J55A 2Q91A 2WCFA 3O78A 2HETA 3I5GC 5BPJA 1SCMB 2AMIA 5GQQC 1N0YA 4MBEA 3WXAA 1QVIY 4FTGA 4I5KA 1C07A 3A8RA 3OBVA 2JU0A 1WY9A 1TN4A 1YTZC 2KDHA 2OTGC 3PLFB 2MRDA 1DF0B 1BMOA 1SCVA 1YX7A 2KFGA 1CM1A 2CXJA 3CZ2A 5CSNA 3FIAA 1TNWA 1EH2A 1P28A 1CTRA 2KLDA 3Q8IA 3GK4X 1WRLA 3E3RA 1B8RA 1H8BA 1L7ZA 1SNLA 3VB1A 3VRQA 2BNXA 1LA3A 2FCEA 2JT3A 2L4IA 1QX2A 4YGCB 4CPVA 1WLZA 3I5GB 5HYDA 1XFWO 1JF0A 4C0KA 3RZSA 1Q80A 4Q04A 1CB1A 3GK1A 3NSOA 1B9AA 1S5GY 1WDCB 2F33A 2K2FA 2LMVA 3BFHA 2BL0B 3KHEA 4YGEB 1BLQA 1OMDA 4PHNA 1S3PA 5AANA 1UHNA 1M46A 1FW4A 1QATA 2HF5A 3BXKA 3I5FB 3BQ3A 2G9BA 2LLTA 1CLMA 4OV2A 4MEWA 1F8HA 1B8CA 5KSZA 1PALA 1U5IA 5AXIA 1C7VA 2LHIA 1WLMA 1QLKA 2CNPA 3EK7A 1YX8A 1BT6A 2KBMA 3SG6A 1NCYA 1RJVA 1J1EA 1JSAA 1UP5A 3CZTX 1DEKA 1Y0VH 4MRYA 5FI6A 3SS3A 1SW8A 1TRFA 1JFJA 1HQVA 1RROA 1SMGA 1SY9A 1K93D 4FQTA 2GGZA 2KNEA 1EL4A 2I94A 1G4YR 1C3ZA 1SL9A 1NX0A 4CLNA 2LNKA 1RFJA 4JKTA 3D77A 1QTXA 2HPSA 4PALA 1G33A 1QJTA 1K9KA 1K94A 3D78A 3O4XA 1SKTA 1DJWA 4PT1A 4N5XA 3PALA 1MXLC 1F70A 3N7HA 1DGUA 2YGUA 2L50A 3JTDC 2P70A 1V1FA 1B4CA 4IL1A 1F71A 1QLSA 1QV0A 1IWQA 2F3ZA 3EK4A 4ORCB 2O60A 1C7WA 3CTNA 1MF8B 3PM2A 1B1GA 1GM0A 3CDNA 3BFBA 1K2HA 2ZN9A 1NX3A 1NX1A 1IIOA 3H4SE 2PASA 1TNQA 3DF0A 3DD4A 5HKZA 1V1GA 3TDIA 1QX5B 4M2PA 2BBNA 1SR6C 4OVNF 1FI5A 1A75A 2JWWA 2QEBA 3JTDB 3I5IB 2H61C 2L5XB 1JC2A 1B7TZ 4TNCA 5CPVA 2GV5A 4DS7A 3S0EA 1IH0A 1ZFSA 3K1EA 5FYXA 3SG4A 2DOQA 1AJ4A 3TS5B 1DGVA 2MHHA 3DVKA 3D10A 1XFXO 3PFVA 2JULA 1Z4HA 4ICBA 1QXPA 1ORGA 3TZ1A 2H61A 4MZJA 1W7IB 1A75B 4QJ5B 4I5NB 5I2QA 3O4YA 3KF9A 3DVJA 2WCLA 3HX4A 3NHTA 1CDPA 4BY4A 4NDBA 2E30A 2ZRSA 3FWCA 3VROA 3B86A 1OMRA 3EVVA 1QWVA 1LA0A 1QVIZ 2AUCA 4OR9B 1SBJA 2JC2A 4P2YB 4PHMA 1W7JB 2EC6C 4MN0A 1OZSA 2KQYA 1KSMA 2WC8A 1DJHA 1M39A 4M2QA 4ZCVA 5HL1A 3B7AA 1DMOA 1BODA 3C1VA 1OSAA 2PRUA 1IJ5A 1YVHA 2Q4UA 1Y1AA 3K21A 1EXRA 1PVAA 1N65A 1XVJA 2JXCA 1S36A 3CYZA 5FI2A 1LS8A 1LXFC 3EVRA 1WRKA 1YUSA 2KBIA 4GBAA 4CFRA 1DF0A 3CZ0A 4YBHB 3UNWA 3IF7A 3I5HC 3L4AA 2AAOA 1GJYA 1KFUS 1BR4B 1NSHA 1YRUB 1SRAA 2K7CA 3IQOA 2GGMA 1BOCA 1GGWA 4CFQA 1WDCC 2BKHB 3R1OA 2BL0C 1NUBA 2TN4A 1BU3A 1AP4A 2EC6B 1S5GZ 5D7FA 5K89A 1YRTB 1K96A 1JBAA 2KAVA 1XFRA 4MVFA 4PE1A 3I5FC 1ODBA 3NSLA 4GNKB 2PMYA 1OOFA 1SSEB 1TCOB 3S0GA 5IBWA 3TDUA 2V53A 3CABA 2WCJA 4HREE 4PDZA 5DKNA 4D1EA 4INWA 3BYAA 1BJFA 1UURA 1K9UA 4MZKA 3S0FA 2LP2A 3I5HB 2BCXA 3SIAA 3WNXB 1K8UA 2LE9B 2OS8B 2CTNA 2ZFDA 3SG7A 1SPYA 4QJ3B 1CKKA 2KGRA 3PM8A 2KFHA 3D73A 3S0BA 2MJWB 5HLVA 2BKIB 3OHMB 1AK8A 1M45A 1CMFA 1UWOA 2BCBA 4R1EA 2LM5A 4PE0A 3BFAA 3AKAA 2JZIA 1QIWA 3FE9A 1CFFA 3VRNA 2CCMA 1GGZA 1DVIA 3DVMA 5JOLA 2M29A 1IJ6A 1UHJA 3EKJA 2L2EA 3L47A 4AOMA 5CSFA 2LC5A 1NYAA 1T14A 2LHLA 2L98A 1F4QA 1F4OA 4F0ZB 2B1UA 3BUXB 3KEVA 3DXLA 1CFCA 2KQ6A 1OOGA 3WHUB 2CBLA 1FI6A 1J1DA 3M0WA 3JVTB 4ZCUA 1J7OA 5FI7A 1F55A 2LMUA 3EK8A 4UPGA 2M1UA 2WCHA 1L2OC 1CFPA 1OOHA 3QMEA 5HKYA 1M63B 2JRFA 2K60A 3VRRA 4BY5A 2CT9A 2LV7A 2WCEA 2KI6D 3B6XA 3I5IC 4GAOA 4JWQA 1AHRA 1A29A 1LKJA 2FOTA 3BJHA 3ZNIA 1PRWA 1TOPA 1XA5A 1BR1B 2LVJA 3V2LA 1OZOA 1YVLA 2E6WA 3TS5C 1J7PA 2WCMA 4XJKB 3BOWA 1PVBA 1IKUA 4INXA 1XFZO 4DRWA 1OOIX 1MWNA 2L5YA 4YRUA 2I7AA 1L2OB 1KQMC 1DJIA 1KWOC 3DYEA 5DKQA 1S1EA 3LCPC 3AKBA 1EG4A 2LLSA 3OB1B 4GGNA 3BOWB 4GGFC 2HQWA 1A4PA 1N2DA 1VRKA 5I8NA 2LAPA 1XK4C 2LUCA 1RK9A 2KYCA 3VGOA 1CNPA 2JNFA 1NPQA 4MSPA 1WRZA 2WCBA 1B47A 1CMGA 1E8AA 2BE6A 3CS1A 4GGFA 3HCMA 2M7LA 1YUUA 3OP0A 1XK4A 3EG5B 1DELA 2P6BB 1KQMB 3IVTA 1PULA 1KWOB 3OB2B 3S0DA 3BUNB 2LUXA 3A4UB 3SG2A 2LP3A 2EHBA 2KYFA 1ZACA 3GK2A 4YI8A 4YGDB 2FJYA 1KK7Z 1OOJA 2LLUA 1RWYA 3TDZA 4MRXA 1S6IA 2WC6A 2WCKA 4N1FA 2JOJA 5DICA 1CLLA 1NWDA 1Y6WA 2BAPA 5I94A 1Y1UA 1PK0D 1K90D 2ZNEA 2WORA 1XO5A 2ZKMX 3CGAA 4AQIA 4WQ3A 1MQ1A 5CSJA 2MBXA 1DJGA 2KGBC 2M97A 2WNDA 3CWGA 1DJZA 2MLEC 4HRHA 2JPOA 1SK6D 3FE8A 4PCWA 2M7NA 1JFKA 2K8MB 1IQ5A 4PHJA 1KK7Y 3R1VA 3PN7B 4XYNA 1XFYO 2JQ6A 2OS8C 3PSRA 3SG5A 4AQJA 3DZTA 3OX6A 2QEOA 1A2XA 5AFPA 2KPHA 5ER5A 1DTLA 1LVCD 5D3OA 5HLOA 2KLEA 2EGDA 4USLA 4MZLA 5AERA 3LL8B 3F45A 1RTP1 4NDCA 1AVSA 1LINA 4YI9A 3D74A 2M0RA 2L51A 2K7OA 4WQ2A 1H4BA 5AEQA 3O2PA 2LANA 1XFVO 2LMTA 3RLZA 3SS5A 1MXEA 1MR8A 2QEVA 5G08A 2WOSA 3D0YA 3CR4X 2ZRTA 4JQ0D 4C0LA 2KI4B 3DVEA 2OPOA 2NLNA 1CDLA 1NIWA 2M8UA 3D76A 3B87A 3LK0A 3NXAA 3TUYB 4N1GA 1NCXA 2A4JA 2FJUB 3FE6A 1SL7A 3D0YB 3JVTC 1DJXA 3O6BA 1J7RA 1NP8A 3EKHA 4JD9A 4PE7A 4YGAA 5CSIA 1UUSA 4DUQA 3GOFA 2K7BA 5TNCA 3SS4A 1IGVA 4CIDA 1DT7B 1OE9B 3AAJA 5PALA 1F54A 2PSRA 4OZDA 5KU1A 3CR5X 5F6TA 2M1KB 4GUKA 1KFXL 2I2RE 1EG3A 1JF2A 1R2UA 3KO0A 1KK8C 3OX5A 4ETOA 1BG1A 3DY9A 2I18A 4MLWA 2BCAA 1S6CA 2OTGB 1SYMA 1QS7A 3RM1A 1TUJA 2MA2A 1UHKA 4P5OE 1NX2A 2KOTA 1DQEA 4NDDA 2COLB 2L4HA 1IQ3A 1CM4A 1TNPA 5D69A 1XFUO 2Y5IA 4FQOA 1IRJA 4IJ7A 4A4CA 1M31A 1RECA 4OKHA 2F2PA 1FF1A 2LVKA 1OMVA 1TTXA 4F7FA 2KAYA 1SL8A 3B88A 4XJKA 3CLNA 1KSOA 5EL2A 1YR5A 4E68A
chains in the Genus database with same CATH topology
2JT8A 3ICBA 2ZN8A 1CFDA 3FS7A 2F2OA 4L9MA 5J3XA 3MSEB 3IQQA 1KFUL 2BE4A 1KK8B 4ORAB 3WHTB 1QX7A 1CDMA 1S6JA 2G2BA 2NZ0A 1CLBA 2Y1NA 2JTZA 3PATA 1U5IB 5KTYA 1FBVA 2QPTA 2FCDA 1KQVA 3LLEA 2M9GA 1KCYA 1FI5A 1EJ3A 4NQGA 1K95A 2NCPA 2F3YA 1ZMZA 2ISDA 2K0JA 2PALA 2Y4QA 3NSKA 1A03A 3KPXA 3SIBA 4C0JA 2ZNDA 2M3WA 1PSRA 4YGBB 1X02A 1DJYA 1NCZA 1MHOA 2D8NA 2PVBA 2LCPA 3NSIA 5ER4X 2JXLA 2QACA 4DCKA 1UHHA 1GQMA 1CDNA 3FWBA 1XYDA 5HKWA 4U8DA 2JPTA 1QASA 1ZUZA 2SCPA 4ORBB 2KSPA 3CR2A 2LVVA 5I2OA 2K7DA 1ZOTB 1J7QA 3VRPA 1QIVA 2KI6C 1AUIB 4WRIA 2JT0A 3EVUA 3QRXA 1TIZA 4I5LB 1MUXA 1AJ5A 1FPWA 2MAZA 2KHNA 2M49B 1TCFA 1G8IA 2NCOA 2LVIA 3PN7C 1Y1XA 5I2LA 2H2KA 1ALVA 1OQPA 1YUTA 4PHKA 1YURA 2HQ8A 4OCIA 1IG5A 2F8PA 5DKRA 3BUWB 4DIRA 3DF0B 1R6PA 1UHIA 2JTTA 2SASA 1S26D 2MLFC 5JJGA 3ZWHA 2R2IA 2VRGA 1JUOA 3BUOB 4HSZA 1HT9A 3BUMB 1KFXS 4HRGA 1PSBA 1D1OA 1SCMC 4GFTA 2BBMA 4GPLB 2BECA 3SJSA 1BF5A 1TNXA 2NXQA 1SR6B 2KI4C 2IS9A 2KAXA 3SG3A 1B7TY 5B8IB 3AAKA 3TUYC 2K61A 4QJ4B 2K2AA 2RGIA 4I5JA 1QV1A 4JPZB 2JNXA 4M2OA 4A4BA 2Y1MA 3LK1A 1K9PA 4PE4A 2KFFA 1ALWA 1B8LA 2O5GA 1JWDA 2L0PA 1J55A 2Q91A 2WCFA 3O78A 2HETA 3I5GC 5BPJA 1SCMB 2AMIA 5GQQC 1N0YA 4MBEA 3WXAA 1QVIY 4FTGA 4I5KA 1C07A 3A8RA 2JU0A 1WY9A 1TN4A 1YTZC 2KDHA 2OTGC 3PLFB 2MRDA 1DF0B 1BMOA 1SCVA 1YX7A 2KFGA 1CM1A 2CXJA 5CSNA 3FIAA 1TNWA 1EH2A 1CTRA 3GK4X 1WRLA 3E3RA 1B8RA 1H8BA 1L7ZA 1SNLA 3VRQA 1LA3A 2FCEA 2JT3A 2L4IA 1QX2A 4YGCB 4CPVA 1WLZA 3I5GB 5HYDA 1XFWO 1JF0A 4C0KA 1Q80A 4Q04A 1CB1A 3GK1A 3NSOA 1B9AA 1S5GY 1WDCB 2F33A 2K2FA 2LMVA 3KHEA 2BL0B 4YGEB 1BLQA 1OMDA 4PHNA 1S3PA 5AANA 1UHNA 1M46A 1FW4A 1QATA 2HF5A 3BXKA 3I5FB 3BQ3A 2G9BA 2LLTA 1CLMA 4OV2A 4MEWA 1F8HA 1B8CA 5KSZA 1PALA 1U5IA 5AXIA 1C7VA 2LHIA 1WLMA 1QLKA 2CNPA 3EK7A 1YX8A 1BT6A 2KBMA 3SG6A 1NCYA 1RJVA 1J1EA 1JSAA 1UP5A 3CZTX 1Y0VH 4MRYA 1JFJA 1SW8A 1TRFA 1HQVA 1RROA 1SMGA 1SY9A 1K93D 2GGZA 2KNEA 1EL4A 2I94A 1G4YR 1SL9A 1NX0A 4CLNA 2LNKA 1RFJA 1QTXA 2HPSA 4PALA 1G33A 1QJTA 1K9KA 1K94A 1SKTA 1DJWA 4N5XA 3PALA 1MXLC 1F70A 1DGUA 2L50A 3JTDC 1V1FA 1B4CA 4IL1A 1F71A 1QLSA 1QV0A 1IWQA 2F3ZA 3EK4A 4ORCB 2O60A 1C7WA 3CTNA 1MF8B 1B1GA 1K2HA 2ZN9A 1NX3A 1NX1A 3H4SE 2PASA 1TNQA 3DF0A 3DD4A 5HKZA 1V1GA 3TDIA 1QX5B 4M2PA 2BBNA 1SR6C 4OVNF 1A75A 2JWWA 3JTDB 3I5IB 2H61C 2L5XB 1JC2A 1B7TZ 4TNCA 5CPVA 2GV5A 4DS7A 1IH0A 1ZFSA 5FYXA 3SG4A 2DOQA 1AJ4A 3TS5B 1DGVA 2MHHA 3DVKA 3D10A 1XFXO 3PFVA 2JULA 4ICBA 1QXPA 3TZ1A 2H61A 4MZJA 1W7IB 1A75B 4QJ5B 4I5NB 5I2QA 3O4YA 3KF9A 3DVJA 3HX4A 1CDPA 4BY4A 4NDBA 2E30A 2ZRSA 3FWCA 3VROA 1OMRA 3EVVA 1LA0A 1QVIZ 2AUCA 4OR9B 1SBJA 2JC2A 4P2YB 4PHMA 1W7JB 2EC6C 4MN0A 1OZSA 2KQYA 1KSMA 2WC8A 1DJHA 1M39A 4M2QA 4ZCVA 1DMOA 1BODA 3C1VA 1OSAA 2PRUA 1IJ5A 1YVHA 2Q4UA 1Y1AA 3K21A 1EXRA 1PVAA 1N65A 1XVJA 2JXCA 1S36A 5AEQA 4CFRA 1LXFC 3EVRA 4GBAA 1WRKA 1YUSA 2KBIA 1DF0A 4YBHB 3IF7A 3I5HC 2AAOA 1GJYA 1KFUS 1BR4B 1NSHA 1YRUB 1SRAA 2K7CA 3IQOA 2GGMA 1BOCA 1GGWA 4CFQA 1WDCC 2BKHB 2BL0C 1NUBA 2TN4A 1BU3A 1AP4A 2EC6B 1S5GZ 5D7FA 5K89A 1YRTB 1K96A 1JBAA 2KAVA 4MVFA 4PE1A 3I5FC 1ODBA 3NSLA 4GNKB 2PMYA 1TCOB 5IBWA 3TDUA 2V53A 5DKNA 4HREE 4PDZA 4D1EA 3BYAA 1BJFA 1UURA 1K9UA 4MZKA 2LP2A 3I5HB 2BCXA 3SIAA 3WNXB 1K8UA 2LE9B 2OS8B 2CTNA 2ZFDA 3SG7A 1SPYA 4QJ3B 1CKKA 2KGRA 3PM8A 2KFHA 2MJWB 5HLVA 2BKIB 3OHMB 1AK8A 1M45A 1CMFA 1UWOA 2BCBA 4R1EA 2LM5A 4PE0A 3AKAA 2JZIA 1QIWA 1CFFA 3VRNA 2CCMA 1GGZA 1DVIA 3DVMA 5JOLA 2M29A 1IJ6A 1UHJA 3EKJA 2L2EA 4AOMA 5CSFA 2LC5A 1NYAA 2LHLA 2L98A 1F4QA 1F4OA 4F0ZB 2B1UA 3BUXB 3KEVA 1CFCA 2KQ6A 3WHUB 2CBLA 1FI6A 1J1DA 3M0WA 3JVTB 4ZCUA 1J7OA 1F55A 2LMUA 3EK8A 4UPGA 2M1UA 1L2OC 1CFPA 5HKYA 1M63B 2JRFA 3VRRA 4BY5A 2CT9A 2LV7A 2WCEA 2KI6D 3I5IC 4GAOA 4JWQA 1AHRA 1A29A 1LKJA 2FOTA 3ZNIA 1PRWA 1TOPA 1XA5A 1BR1B 2LVJA 1OZOA 1YVLA 2E6WA 3TS5C 1J7PA 4XJKB 3BOWA 1PVBA 1IKUA 1XFZO 4DRWA 1MWNA 4YRUA 2I7AA 1L2OB 1KQMC 1DJIA 1KWOC 5DKQA 1S1EA 3LCPC 3AKBA 1EG4A 2LLSA 3OB1B 4GGNA 3BOWB 4GGFC 2HQWA 1A4PA 1N2DA 1VRKA 5I8NA 2LAPA 1XK4C 2LUCA 1RK9A 2KYCA 3VGOA 1CNPA 2JNFA 1NPQA 4MSPA 1WRZA 2WCBA 1B47A 1CMGA 1E8AA 2BE6A 3CS1A 4GGFA 3HCMA 2M7LA 1YUUA 3OP0A 1XK4A 2P6BB 1KQMB 1PULA 1KWOB 3OB2B 3BUNB 2LUXA 3A4UB 3SG2A 2LP3A 2EHBA 2KYFA 1ZACA 3GK2A 4YI8A 4YGDB 1KK7Z 1OOJA 2LLUA 1RWYA 3TDZA 4MRXA 1S6IA 4N1FA 2JOJA 1CLLA 1NWDA 1Y6WA 1Y1UA 1PK0D 1K90D 2ZNEA 2WORA 1XO5A 2ZKMX 3CGAA 4AQIA 4WQ3A 1MQ1A 5CSJA 2MBXA 1DJGA 2KGBC 2M97A 2WNDA 3CWGA 1DJZA 2MLEC 4HRHA 1SK6D 4PCWA 2M7NA 1JFKA 2K8MB 1IQ5A 4PHJA 1KK7Y 4XYNA 3PN7B 4AQJA 1XFYO 2JQ6A 2OS8C 3PSRA 3SG5A 3OX6A 1A2XA 5AFPA 5ER5A 1DTLA 1LVCD 5HLOA 4USLA 2EGDA 4MZLA 5AERA 3LL8B 3F45A 1RTP1 4NDCA 1AVSA 1LINA 4YI9A 2M0RA 2L51A 2K7OA 4WQ2A 1H4BA 3O2PA 2LANA 1XFVO 2LMTA 3RLZA 1MXEA 1MR8A 5G08A 2WOSA 3D0YA 3CR4X 2ZRTA 4JQ0D 4C0LA 2KI4B 3DVEA 2OPOA 2NLNA 1CDLA 1NIWA 2M8UA 3LK0A 3TUYB 3NXAA 4N1GA 1NCXA 2A4JA 2FJUB 1SL7A 3D0YB 3JVTC 1DJXA 3O6BA 1J7RA 1NP8A 3EKHA 4PE7A 4YGAA 5CSIA 1UUSA 4DUQA 3GOFA 2K7BA 5TNCA 4CIDA 1IGVA 1DT7B 1OE9B 3AAJA 5PALA 1F54A 2PSRA 5KU1A 3CR5X 5F6TA 2M1KB 4GUKA 1KFXL 2I2RE 1EG3A 1JF2A 1R2UA 3KO0A 1KK8C 3OX5A 4ETOA 1BG1A 2I18A 4MLWA 2BCAA 1S6CA 2OTGB 1SYMA 1QS7A 3RM1A 2MA2A 1UHKA 4P5OE 1NX2A 2KOTA 4NDDA 2COLB 2L4HA 1IQ3A 1CM4A 1TNPA 5D69A 1XFUO 2Y5IA 4FQOA 1IRJA 4A4CA 1FF1A 1M31A 1RECA 4OKHA 2F2PA 2LVKA 1OMVA 1TTXA 2KAYA 1SL8A 4XJKA 3CLNA 1KSOA 1YR5A 4E68A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JT8 A;  3ICB A;  2ZN8 A;  1CFD A;  3FS7 A;  2F2O A;  4L9M A;  5J3X A;  3MSE B;  3IQQ A;  1KFU L;  2BE4 A;  1KK8 B;  4ORA B;  3WHT B;  1QX7 A;  1CDM A;  1S6J A;  2G2B A;  2NZ0 A;  1CLB A;  2Y1N A;  2JTZ A;  3PAT A;  1U5I B;  5KTY A;  1FBV A;  2QPT A;  2FCD A;  1KQV A;  3LLE A;  2M9G A;  1KCY A;  1FI5 A;  1EJ3 A;  4NQG A;  1K95 A;  2NCP A;  2F3Y A;  1ZMZ A;  2ISD A;  2K0J A;  2PAL A;  2Y4Q A;  3NSK A;  1A03 A;  3KPX A;  3SIB A;  4C0J A;  2ZND A;  2M3W A;  1PSR A;  4YGB B;  1X02 A;  1DJY A;  1NCZ A;  1MHO A;  2D8N A;  2PVB A;  2LCP A;  3NSI A;  5ER4 X;  2JXL A;  2QAC A;  4DCK A;  1UHH A;  1GQM A;  1CDN A;  3FWB A;  1XYD A;  5HKW A;  4U8D A;  2JPT A;  1QAS A;  1ZUZ A;  2SCP A;  4ORB B;  2KSP A;  3CR2 A;  2LVV A;  5I2O A;  2K7D A;  1ZOT B;  1J7Q A;  3VRP A;  1QIV A;  2KI6 C;  1AUI B;  4WRI A;  2JT0 A;  3EVU A;  3QRX A;  1TIZ A;  4I5L B;  1MUX A;  1AJ5 A;  1FPW A;  2MAZ A;  2KHN A;  2M49 B;  1TCF A;  1G8I A;  2NCO A;  2LVI A;  3PN7 C;  1Y1X A;  5I2L A;  2H2K A;  1ALV A;  1OQP A;  1YUT A;  4PHK A;  1YUR A;  2HQ8 A;  4OCI A;  1IG5 A;  2F8P A;  5DKR A;  3BUW B;  4DIR A;  3DF0 B;  1R6P A;  1UHI A;  2JTT A;  2SAS A;  1S26 D;  2MLF C;  5JJG A;  3ZWH A;  2R2I A;  2VRG A;  1JUO A;  3BUO B;  4HSZ A;  1HT9 A;  3BUM B;  1KFX S;  4HRG A;  1PSB A;  1D1O A;  1SCM C;  4GFT A;  2BBM A;  4GPL B;  2BEC A;  3SJS A;  1BF5 A;  1TNX A;  2NXQ A;  1SR6 B;  2KI4 C;  2IS9 A;  2KAX A;  3SG3 A;  1B7T Y;  5B8I B;  3AAK A;  3TUY C;  2K61 A;  4QJ4 B;  2K2A A;  2RGI A;  4I5J A;  1QV1 A;  4JPZ B;  2JNX A;  4M2O A;  4A4B A;  2Y1M A;  3LK1 A;  1K9P A;  4PE4 A;  2KFF A;  1ALW A;  1B8L A;  2O5G A;  1JWD A;  2L0P A;  1J55 A;  2Q91 A;  2WCF A;  3O78 A;  2HET A;  3I5G C;  5BPJ A;  1SCM B;  2AMI A;  5GQQ C;  1N0Y A;  4MBE A;  3WXA A;  1QVI Y;  4FTG A;  4I5K A;  1C07 A;  3A8R A;  2JU0 A;  1WY9 A;  1TN4 A;  1YTZ C;  2KDH A;  2OTG C;  3PLF B;  2MRD A;  1DF0 B;  1BMO A;  1SCV A;  1YX7 A;  2KFG A;  1CM1 A;  2CXJ A;  5CSN A;  3FIA A;  1TNW A;  1EH2 A;  1CTR A;  3GK4 X;  1WRL A;  3E3R A;  1B8R A;  1H8B A;  1L7Z A;  1SNL A;  3VRQ A;  1LA3 A;  2FCE A;  2JT3 A;  2L4I A;  1QX2 A;  4YGC B;  4CPV A;  1WLZ A;  3I5G B;  5HYD A;  1XFW O;  1JF0 A;  4C0K A;  1Q80 A;  4Q04 A;  1CB1 A;  3GK1 A;  3NSO A;  1B9A A;  1S5G Y;  1WDC B;  2F33 A;  2K2F A;  2LMV A;  3KHE A;  2BL0 B;  4YGE B;  1BLQ A;  1OMD A;  4PHN A;  1S3P A;  5AAN A;  1UHN A;  1M46 A;  1FW4 A;  1QAT A;  2HF5 A;  3BXK A;  3I5F B;  3BQ3 A;  2G9B A;  2LLT A;  1CLM A;  4OV2 A;  4MEW A;  1F8H A;  1B8C A;  5KSZ A;  1PAL A;  1U5I A;  5AXI A;  1C7V A;  2LHI A;  1WLM A;  1QLK A;  2CNP A;  3EK7 A;  1YX8 A;  1BT6 A;  2KBM A;  3SG6 A;  1NCY A;  1RJV A;  1J1E A;  1JSA A;  1UP5 A;  3CZT X;  1Y0V H;  4MRY A;  1JFJ A;  1SW8 A;  1TRF A;  1HQV A;  1RRO A;  1SMG A;  1SY9 A;  1K93 D;  2GGZ A;  2KNE A;  1EL4 A;  2I94 A;  1G4Y R;  1SL9 A;  1NX0 A;  4CLN A;  2LNK A;  1RFJ A;  1QTX A;  2HPS A;  4PAL A;  1G33 A;  1QJT A;  1K9K A;  1K94 A;  1SKT A;  1DJW A;  4N5X A;  3PAL A;  1MXL C;  1F70 A;  1DGU A;  2L50 A;  3JTD C;  1V1F A;  1B4C A;  4IL1 A;  1F71 A;  1QLS A;  1QV0 A;  1IWQ A;  2F3Z A;  3EK4 A;  4ORC B;  2O60 A;  1C7W A;  3CTN A;  1MF8 B;  1B1G A;  1K2H A;  2ZN9 A;  1NX3 A;  1NX1 A;  3H4S E;  2PAS A;  1TNQ A;  3DF0 A;  3DD4 A;  5HKZ A;  1V1G A;  3TDI A;  1QX5 B;  4M2P A;  2BBN A;  1SR6 C;  4OVN F;  1A75 A;  2JWW A;  3JTD B;  3I5I B;  2H61 C;  2L5X B;  1JC2 A;  1B7T Z;  4TNC A;  5CPV A;  2GV5 A;  4DS7 A;  1IH0 A;  1ZFS A;  5FYX A;  3SG4 A;  2DOQ A;  1AJ4 A;  3TS5 B;  1DGV A;  2MHH A;  3DVK A;  3D10 A;  1XFX O;  3PFV A;  2JUL A;  4ICB A;  1QXP A;  3TZ1 A;  2H61 A;  4MZJ A;  1W7I B;  1A75 B;  4QJ5 B;  4I5N B;  5I2Q A;  3O4Y A;  3KF9 A;  3DVJ A;  3HX4 A;  1CDP A;  4BY4 A;  4NDB A;  2E30 A;  2ZRS A;  3FWC A;  3VRO A;  1OMR A;  3EVV A;  1LA0 A;  1QVI Z;  2AUC A;  4OR9 B;  1SBJ A;  2JC2 A;  4P2Y B;  4PHM A;  1W7J B;  2EC6 C;  4MN0 A;  1OZS A;  2KQY A;  1KSM A;  2WC8 A;  1DJH A;  1M39 A;  4M2Q A;  4ZCV A;  1DMO A;  1BOD A;  3C1V A;  1OSA A;  2PRU A;  1IJ5 A;  1YVH A;  2Q4U A;  1Y1A A;  3K21 A;  1EXR A;  1PVA A;  1N65 A;  1XVJ A;  2JXC A;  1S36 A;  5AEQ A;  4CFR A;  1LXF C;  3EVR A;  4GBA A;  1WRK A;  1YUS A;  2KBI A;  1DF0 A;  4YBH B;  3IF7 A;  3I5H C;  2AAO A;  1GJY A;  1KFU S;  1BR4 B;  1NSH A;  1YRU B;  1SRA A;  2K7C A;  3IQO A;  2GGM A;  1BOC A;  1GGW A;  4CFQ A;  1WDC C;  2BKH B;  2BL0 C;  1NUB A;  2TN4 A;  1BU3 A;  1AP4 A;  2EC6 B;  1S5G Z;  5D7F A;  5K89 A;  1YRT B;  1K96 A;  1JBA A;  2KAV A;  4MVF A;  4PE1 A;  3I5F C;  1ODB A;  3NSL A;  4GNK B;  2PMY A;  1TCO B;  5IBW A;  3TDU A;  2V53 A;  5DKN A;  4HRE E;  4PDZ A;  4D1E A;  3BYA A;  1BJF A;  1UUR A;  1K9U A;  4MZK A;  2LP2 A;  3I5H B;  2BCX A;  3SIA A;  3WNX B;  1K8U A;  2LE9 B;  2OS8 B;  2CTN A;  2ZFD A;  3SG7 A;  1SPY A;  4QJ3 B;  1CKK A;  2KGR A;  3PM8 A;  2KFH A;  2MJW B;  5HLV A;  2BKI B;  3OHM B;  1AK8 A;  1M45 A;  1CMF A;  1UWO A;  2BCB A;  4R1E A;  2LM5 A;  4PE0 A;  3AKA A;  2JZI A;  1QIW A;  1CFF A;  3VRN A;  2CCM A;  1GGZ A;  1DVI A;  3DVM A;  5JOL A;  2M29 A;  1IJ6 A;  1UHJ A;  3EKJ A;  2L2E A;  4AOM A;  5CSF A;  2LC5 A;  1NYA A;  2LHL A;  2L98 A;  1F4Q A;  1F4O A;  4F0Z B;  2B1U A;  3BUX B;  3KEV A;  1CFC A;  2KQ6 A;  3WHU B;  2CBL A;  1FI6 A;  1J1D A;  3M0W A;  3JVT B;  4ZCU A;  1J7O A;  1F55 A;  2LMU A;  3EK8 A;  4UPG A;  2M1U A;  1L2O C;  1CFP A;  5HKY A;  1M63 B;  2JRF A;  3VRR A;  4BY5 A;  2CT9 A;  2LV7 A;  2WCE A;  2KI6 D;  3I5I C;  4GAO A;  4JWQ A;  1AHR A;  1A29 A;  1LKJ A;  2FOT A;  3ZNI A;  1PRW A;  1TOP A;  1XA5 A;  1BR1 B;  2LVJ A;  1OZO A;  1YVL A;  2E6W A;  3TS5 C;  1J7P A;  4XJK B;  3BOW A;  1PVB A;  1IKU A;  1XFZ O;  4DRW A;  1MWN A;  4YRU A;  2I7A A;  1L2O B;  1KQM C;  1DJI A;  1KWO C;  5DKQ A;  1S1E A;  3LCP C;  3AKB A;  1EG4 A;  2LLS A;  3OB1 B;  4GGN A;  3BOW B;  4GGF C;  2HQW A;  1A4P A;  1N2D A;  1VRK A;  5I8N A;  2LAP A;  1XK4 C;  2LUC A;  1RK9 A;  2KYC A;  3VGO A;  1CNP A;  2JNF A;  1NPQ A;  4MSP A;  1WRZ A;  2WCB A;  1B47 A;  1CMG A;  1E8A A;  2BE6 A;  3CS1 A;  4GGF A;  3HCM A;  2M7L A;  1YUU A;  3OP0 A;  1XK4 A;  2P6B B;  1KQM B;  1PUL A;  1KWO B;  3OB2 B;  3BUN B;  2LUX A;  3A4U B;  3SG2 A;  2LP3 A;  2EHB A;  2KYF A;  1ZAC A;  3GK2 A;  4YI8 A;  4YGD B;  1KK7 Z;  1OOJ A;  2LLU A;  1RWY A;  3TDZ A;  4MRX A;  1S6I A;  4N1F A;  2JOJ A;  1CLL A;  1NWD A;  1Y6W A;  1Y1U A;  1PK0 D;  1K90 D;  2ZNE A;  2WOR A;  1XO5 A;  2ZKM X;  3CGA A;  4AQI A;  4WQ3 A;  1MQ1 A;  5CSJ A;  2MBX A;  1DJG A;  2KGB C;  2M97 A;  2WND A;  3CWG A;  1DJZ A;  2MLE C;  4HRH A;  1SK6 D;  4PCW A;  2M7N A;  1JFK A;  2K8M B;  1IQ5 A;  4PHJ A;  1KK7 Y;  4XYN A;  3PN7 B;  4AQJ A;  1XFY O;  2JQ6 A;  2OS8 C;  3PSR A;  3SG5 A;  3OX6 A;  1A2X A;  5AFP A;  5ER5 A;  1DTL A;  1LVC D;  5HLO A;  4USL A;  2EGD A;  4MZL A;  5AER A;  3LL8 B;  3F45 A;  1RTP 1;  4NDC A;  1AVS A;  1LIN A;  4YI9 A;  2M0R A;  2L51 A;  2K7O A;  4WQ2 A;  1H4B A;  3O2P A;  2LAN A;  1XFV O;  2LMT A;  3RLZ A;  1MXE A;  1MR8 A;  5G08 A;  2WOS A;  3D0Y A;  3CR4 X;  2ZRT A;  4JQ0 D;  4C0L A;  2KI4 B;  3DVE A;  2OPO A;  2NLN A;  1CDL A;  1NIW A;  2M8U A;  3LK0 A;  3TUY B;  3NXA A;  4N1G A;  1NCX A;  2A4J A;  2FJU B;  1SL7 A;  3D0Y B;  3JVT C;  1DJX A;  3O6B A;  1J7R A;  1NP8 A;  3EKH A;  4PE7 A;  4YGA A;  5CSI A;  1UUS A;  4DUQ A;  3GOF A;  2K7B A;  5TNC A;  4CID A;  1IGV A;  1DT7 B;  1OE9 B;  3AAJ A;  5PAL A;  1F54 A;  2PSR A;  5KU1 A;  3CR5 X;  5F6T A;  2M1K B;  4GUK A;  1KFX L;  2I2R E;  1EG3 A;  1JF2 A;  1R2U A;  3KO0 A;  1KK8 C;  3OX5 A;  4ETO A;  1BG1 A;  2I18 A;  4MLW A;  2BCA A;  1S6C A;  2OTG B;  1SYM A;  1QS7 A;  3RM1 A;  2MA2 A;  1UHK A;  4P5O E;  1NX2 A;  2KOT A;  4NDD A;  2COL B;  2L4H A;  1IQ3 A;  1CM4 A;  1TNP A;  5D69 A;  1XFU O;  2Y5I A;  4FQO A;  1IRJ A;  4A4C A;  1FF1 A;  1M31 A;  1REC A;  4OKH A;  2F2P A;  2LVK A;  1OMV A;  1TTX A;  2KAY A;  1SL8 A;  4XJK A;  3CLN A;  1KSO A;  1YR5 A;  4E68 A; 
#chains in the Genus database with same CATH topology
 2JT8 A;  3ICB A;  2ZN8 A;  1CFD A;  3FS7 A;  2F2O A;  4L9M A;  5J3X A;  3MSE B;  3IQQ A;  1KFU L;  2BE4 A;  1KK8 B;  2QDI A;  4ORA B;  3WHT B;  1QX7 A;  1CDM A;  1S6J A;  2G2B A;  2NZ0 A;  1CLB A;  2Y1N A;  3R1P A;  2JTZ A;  3PAT A;  1U5I B;  5KTY A;  1FBV A;  1W9Z A;  3L4L A;  2QPT A;  2FCD A;  2WC5 A;  1KQV A;  3LLE A;  2M9G A;  1OW4 A;  1KCY A;  1DC1 A;  2PQL A;  1EJ3 A;  4NQG A;  1K95 A;  2NCP A;  2F3Y A;  1TUZ A;  1ZMZ A;  2ISD A;  2K0J A;  2PAL A;  2Y4Q A;  3NSK A;  1A03 A;  3KPX A;  3SIB A;  4C0J A;  2ZND A;  2M3W A;  1PSR A;  4YGB B;  1X02 A;  1DJY A;  1NCZ A;  1MHO A;  2D8N A;  2PVB A;  2LCP A;  3NSI A;  5ER4 X;  2JXL A;  2QAC A;  4DCK A;  1UHH A;  1GQM A;  1CDN A;  3FWB A;  1XYD A;  5HKW A;  4U8D A;  2JPT A;  1QAS A;  1ZUZ A;  2SCP A;  4ORB B;  2KSP A;  3CR2 A;  2LVV A;  5I2O A;  2K7D A;  3CZ1 A;  1ZOT B;  1J7Q A;  3VRP A;  1QIV A;  2KI6 C;  1AUI B;  4WRI A;  2JT0 A;  3D75 A;  3EVU A;  3QRX A;  1TIZ A;  4I5L B;  1MUX A;  1AJ5 A;  1FPW A;  2MAZ A;  2PYQ A;  2KHN A;  2M49 B;  3S0A A;  1TCF A;  2P71 A;  1G8I A;  1TWO A;  2NCO A;  2LVI A;  3PN7 C;  1Y1X A;  5I2L A;  2H2K A;  1ALV A;  1OQP A;  1YUT A;  4PHK A;  1YUR A;  2HQ8 A;  4OCI A;  1IG5 A;  2F8P A;  5DKR A;  3BUW B;  4DIR A;  3DF0 B;  3OGN A;  1R6P A;  1UHI A;  2JTT A;  2L2C A;  2SAS A;  1S26 D;  2MLF C;  5JJG A;  3ZWH A;  3NHI A;  2R2I A;  2VRG A;  1JUO A;  2QEH A;  3BUO B;  4HSZ A;  3PJI A;  1HT9 A;  3BUM B;  1KFX S;  4HRG A;  1PSB A;  1D1O A;  1SCM C;  4GFT A;  2BBM A;  1Z2C B;  2BEC A;  4GPL B;  3SJS A;  2GTE A;  1BF5 A;  3UO9 A;  1TNX A;  3R72 A;  2NXQ A;  1SR6 B;  2KI4 C;  2IS9 A;  2KAX A;  4KYN A;  3SG3 A;  1B7T Y;  5B8I B;  3AAK A;  3TUY C;  2K61 A;  4QJ4 B;  2K2A A;  1C3Y A;  2RGI A;  4I5J A;  1QV1 A;  4JPZ B;  3NGV A;  2JNX A;  4M2O A;  4A4B A;  2Y1M A;  3LK1 A;  1K9P A;  4PE4 A;  2KFF A;  1ALW A;  1B8L A;  2O5G A;  1JWD A;  2ERB A;  2L0P A;  2H8V A;  1J55 A;  2Q91 A;  2WCF A;  3O78 A;  2HET A;  3I5G C;  5BPJ A;  1SCM B;  2AMI A;  5GQQ C;  1N0Y A;  4MBE A;  3WXA A;  1QVI Y;  4FTG A;  4I5K A;  1C07 A;  3A8R A;  3OBV A;  2JU0 A;  1WY9 A;  1TN4 A;  1YTZ C;  2KDH A;  2OTG C;  3PLF B;  2MRD A;  1DF0 B;  1BMO A;  1SCV A;  1YX7 A;  2KFG A;  1CM1 A;  2CXJ A;  3CZ2 A;  5CSN A;  3FIA A;  1TNW A;  1EH2 A;  1P28 A;  1CTR A;  2KLD A;  3Q8I A;  3GK4 X;  1WRL A;  3E3R A;  1B8R A;  1H8B A;  1L7Z A;  1SNL A;  3VB1 A;  3VRQ A;  2BNX A;  1LA3 A;  2FCE A;  2JT3 A;  2L4I A;  1QX2 A;  4YGC B;  4CPV A;  1WLZ A;  3I5G B;  5HYD A;  1XFW O;  1JF0 A;  4C0K A;  3RZS A;  1Q80 A;  4Q04 A;  1CB1 A;  3GK1 A;  3NSO A;  1B9A A;  1S5G Y;  1WDC B;  2F33 A;  2K2F A;  2LMV A;  3BFH A;  2BL0 B;  3KHE A;  4YGE B;  1BLQ A;  1OMD A;  4PHN A;  1S3P A;  5AAN A;  1UHN A;  1M46 A;  1FW4 A;  1QAT A;  2HF5 A;  3BXK A;  3I5F B;  3BQ3 A;  2G9B A;  2LLT A;  1CLM A;  4OV2 A;  4MEW A;  1F8H A;  1B8C A;  5KSZ A;  1PAL A;  1U5I A;  5AXI A;  1C7V A;  2LHI A;  1WLM A;  1QLK A;  2CNP A;  3EK7 A;  1YX8 A;  1BT6 A;  2KBM A;  3SG6 A;  1NCY A;  1RJV A;  1J1E A;  1JSA A;  1UP5 A;  3CZT X;  1DEK A;  1Y0V H;  4MRY A;  5FI6 A;  3SS3 A;  1SW8 A;  1TRF A;  1JFJ A;  1HQV A;  1RRO A;  1SMG A;  1SY9 A;  1K93 D;  4FQT A;  2GGZ A;  2KNE A;  1EL4 A;  2I94 A;  1G4Y R;  1C3Z A;  1SL9 A;  1NX0 A;  4CLN A;  2LNK A;  1RFJ A;  4JKT A;  3D77 A;  1QTX A;  2HPS A;  4PAL A;  1G33 A;  1QJT A;  1K9K A;  1K94 A;  3D78 A;  3O4X A;  1SKT A;  1DJW A;  4PT1 A;  4N5X A;  3PAL A;  1MXL C;  1F70 A;  3N7H A;  1DGU A;  2YGU A;  2L50 A;  3JTD C;  2P70 A;  1V1F A;  1B4C A;  4IL1 A;  1F71 A;  1QLS A;  1QV0 A;  1IWQ A;  2F3Z A;  3EK4 A;  4ORC B;  2O60 A;  1C7W A;  3CTN A;  1MF8 B;  3PM2 A;  1B1G A;  1GM0 A;  3CDN A;  3BFB A;  1K2H A;  2ZN9 A;  1NX3 A;  1NX1 A;  1IIO A;  3H4S E;  2PAS A;  1TNQ A;  3DF0 A;  3DD4 A;  5HKZ A;  1V1G A;  3TDI A;  1QX5 B;  4M2P A;  2BBN A;  1SR6 C;  4OVN F;  1FI5 A;  1A75 A;  2JWW A;  2QEB A;  3JTD B;  3I5I B;  2H61 C;  2L5X B;  1JC2 A;  1B7T Z;  4TNC A;  5CPV A;  2GV5 A;  4DS7 A;  3S0E A;  1IH0 A;  1ZFS A;  3K1E A;  5FYX A;  3SG4 A;  2DOQ A;  1AJ4 A;  3TS5 B;  1DGV A;  2MHH A;  3DVK A;  3D10 A;  1XFX O;  3PFV A;  2JUL A;  1Z4H A;  4ICB A;  1QXP A;  1ORG A;  3TZ1 A;  2H61 A;  4MZJ A;  1W7I B;  1A75 B;  4QJ5 B;  4I5N B;  5I2Q A;  3O4Y A;  3KF9 A;  3DVJ A;  2WCL A;  3HX4 A;  3NHT A;  1CDP A;  4BY4 A;  4NDB A;  2E30 A;  2ZRS A;  3FWC A;  3VRO A;  3B86 A;  1OMR A;  3EVV A;  1QWV A;  1LA0 A;  1QVI Z;  2AUC A;  4OR9 B;  1SBJ A;  2JC2 A;  4P2Y B;  4PHM A;  1W7J B;  2EC6 C;  4MN0 A;  1OZS A;  2KQY A;  1KSM A;  2WC8 A;  1DJH A;  1M39 A;  4M2Q A;  4ZCV A;  5HL1 A;  3B7A A;  1DMO A;  1BOD A;  3C1V A;  1OSA A;  2PRU A;  1IJ5 A;  1YVH A;  2Q4U A;  1Y1A A;  3K21 A;  1EXR A;  1PVA A;  1N65 A;  1XVJ A;  2JXC A;  1S36 A;  3CYZ A;  5FI2 A;  1LS8 A;  1LXF C;  3EVR A;  1WRK A;  1YUS A;  2KBI A;  4GBA A;  4CFR A;  1DF0 A;  3CZ0 A;  4YBH B;  3UNW A;  3IF7 A;  3I5H C;  3L4A A;  2AAO A;  1GJY A;  1KFU S;  1BR4 B;  1NSH A;  1YRU B;  1SRA A;  2K7C A;  3IQO A;  2GGM A;  1BOC A;  1GGW A;  4CFQ A;  1WDC C;  2BKH B;  3R1O A;  2BL0 C;  1NUB A;  2TN4 A;  1BU3 A;  1AP4 A;  2EC6 B;  1S5G Z;  5D7F A;  5K89 A;  1YRT B;  1K96 A;  1JBA A;  2KAV A;  1XFR A;  4MVF A;  4PE1 A;  3I5F C;  1ODB A;  3NSL A;  4GNK B;  2PMY A;  1OOF A;  1SSE B;  1TCO B;  3S0G A;  5IBW A;  3TDU A;  2V53 A;  3CAB A;  2WCJ A;  4HRE E;  4PDZ A;  5DKN A;  4D1E A;  4INW A;  3BYA A;  1BJF A;  1UUR A;  1K9U A;  4MZK A;  3S0F A;  2LP2 A;  3I5H B;  2BCX A;  3SIA A;  3WNX B;  1K8U A;  2LE9 B;  2OS8 B;  2CTN A;  2ZFD A;  3SG7 A;  1SPY A;  4QJ3 B;  1CKK A;  2KGR A;  3PM8 A;  2KFH A;  3D73 A;  3S0B A;  2MJW B;  5HLV A;  2BKI B;  3OHM B;  1AK8 A;  1M45 A;  1CMF A;  1UWO A;  2BCB A;  4R1E A;  2LM5 A;  4PE0 A;  3BFA A;  3AKA A;  2JZI A;  1QIW A;  3FE9 A;  1CFF A;  3VRN A;  2CCM A;  1GGZ A;  1DVI A;  3DVM A;  5JOL A;  2M29 A;  1IJ6 A;  1UHJ A;  3EKJ A;  2L2E A;  3L47 A;  4AOM A;  5CSF A;  2LC5 A;  1NYA A;  1T14 A;  2LHL A;  2L98 A;  1F4Q A;  1F4O A;  4F0Z B;  2B1U A;  3BUX B;  3KEV A;  3DXL A;  1CFC A;  2KQ6 A;  1OOG A;  3WHU B;  2CBL A;  1FI6 A;  1J1D A;  3M0W A;  3JVT B;  4ZCU A;  1J7O A;  5FI7 A;  1F55 A;  2LMU A;  3EK8 A;  4UPG A;  2M1U A;  2WCH A;  1L2O C;  1CFP A;  1OOH A;  3QME A;  5HKY A;  1M63 B;  2JRF A;  2K60 A;  3VRR A;  4BY5 A;  2CT9 A;  2LV7 A;  2WCE A;  2KI6 D;  3B6X A;  3I5I C;  4GAO A;  4JWQ A;  1AHR A;  1A29 A;  1LKJ A;  2FOT A;  3BJH A;  3ZNI A;  1PRW A;  1TOP A;  1XA5 A;  1BR1 B;  2LVJ A;  3V2L A;  1OZO A;  1YVL A;  2E6W A;  3TS5 C;  1J7P A;  2WCM A;  4XJK B;  3BOW A;  1PVB A;  1IKU A;  4INX A;  1XFZ O;  4DRW A;  1OOI X;  1MWN A;  2L5Y A;  4YRU A;  2I7A A;  1L2O B;  1KQM C;  1DJI A;  1KWO C;  3DYE A;  5DKQ A;  1S1E A;  3LCP C;  3AKB A;  1EG4 A;  2LLS A;  3OB1 B;  4GGN A;  3BOW B;  4GGF C;  2HQW A;  1A4P A;  1N2D A;  1VRK A;  5I8N A;  2LAP A;  1XK4 C;  2LUC A;  1RK9 A;  2KYC A;  3VGO A;  1CNP A;  2JNF A;  1NPQ A;  4MSP A;  1WRZ A;  2WCB A;  1B47 A;  1CMG A;  1E8A A;  2BE6 A;  3CS1 A;  4GGF A;  3HCM A;  2M7L A;  1YUU A;  3OP0 A;  1XK4 A;  3EG5 B;  1DEL A;  2P6B B;  1KQM B;  3IVT A;  1PUL A;  1KWO B;  3OB2 B;  3S0D A;  3BUN B;  2LUX A;  3A4U B;  3SG2 A;  2LP3 A;  2EHB A;  2KYF A;  1ZAC A;  3GK2 A;  4YI8 A;  4YGD B;  2FJY A;  1KK7 Z;  1OOJ A;  2LLU A;  1RWY A;  3TDZ A;  4MRX A;  1S6I A;  2WC6 A;  2WCK A;  4N1F A;  2JOJ A;  5DIC A;  1CLL A;  1NWD A;  1Y6W A;  2BAP A;  5I94 A;  1Y1U A;  1PK0 D;  1K90 D;  2ZNE A;  2WOR A;  1XO5 A;  2ZKM X;  3CGA A;  4AQI A;  4WQ3 A;  1MQ1 A;  5CSJ A;  2MBX A;  1DJG A;  2KGB C;  2M97 A;  2WND A;  3CWG A;  1DJZ A;  2MLE C;  4HRH A;  2JPO A;  1SK6 D;  3FE8 A;  4PCW A;  2M7N A;  1JFK A;  2K8M B;  1IQ5 A;  4PHJ A;  1KK7 Y;  3R1V A;  3PN7 B;  4XYN A;  1XFY O;  2JQ6 A;  2OS8 C;  3PSR A;  3SG5 A;  4AQJ A;  3DZT A;  3OX6 A;  2QEO A;  1A2X A;  5AFP A;  2KPH A;  5ER5 A;  1DTL A;  1LVC D;  5D3O A;  5HLO A;  2KLE A;  2EGD A;  4USL A;  4MZL A;  5AER A;  3LL8 B;  3F45 A;  1RTP 1;  4NDC A;  1AVS A;  1LIN A;  4YI9 A;  3D74 A;  2M0R A;  2L51 A;  2K7O A;  4WQ2 A;  1H4B A;  5AEQ A;  3O2P A;  2LAN A;  1XFV O;  2LMT A;  3RLZ A;  3SS5 A;  1MXE A;  1MR8 A;  2QEV A;  5G08 A;  2WOS A;  3D0Y A;  3CR4 X;  2ZRT A;  4JQ0 D;  4C0L A;  2KI4 B;  3DVE A;  2OPO A;  2NLN A;  1CDL A;  1NIW A;  2M8U A;  3D76 A;  3B87 A;  3LK0 A;  3NXA A;  3TUY B;  4N1G A;  1NCX A;  2A4J A;  2FJU B;  3FE6 A;  1SL7 A;  3D0Y B;  3JVT C;  1DJX A;  3O6B A;  1J7R A;  1NP8 A;  3EKH A;  4JD9 A;  4PE7 A;  4YGA A;  5CSI A;  1UUS A;  4DUQ A;  3GOF A;  2K7B A;  5TNC A;  3SS4 A;  1IGV A;  4CID A;  1DT7 B;  1OE9 B;  3AAJ A;  5PAL A;  1F54 A;  2PSR A;  4OZD A;  5KU1 A;  3CR5 X;  5F6T A;  2M1K B;  4GUK A;  1KFX L;  2I2R E;  1EG3 A;  1JF2 A;  1R2U A;  3KO0 A;  1KK8 C;  3OX5 A;  4ETO A;  1BG1 A;  3DY9 A;  2I18 A;  4MLW A;  2BCA A;  1S6C A;  2OTG B;  1SYM A;  1QS7 A;  3RM1 A;  1TUJ A;  2MA2 A;  1UHK A;  4P5O E;  1NX2 A;  2KOT A;  1DQE A;  4NDD A;  2COL B;  2L4H A;  1IQ3 A;  1CM4 A;  1TNP A;  5D69 A;  1XFU O;  2Y5I A;  4FQO A;  1IRJ A;  4IJ7 A;  4A4C A;  1M31 A;  1REC A;  4OKH A;  2F2P A;  1FF1 A;  2LVK A;  1OMV A;  1TTX A;  4F7F A;  2KAY A;  1SL8 A;  3B88 A;  4XJK A;  3CLN A;  1KSO A;  5EL2 A;  1YR5 A;  4E68 A; 
#chains in the Genus database with same CATH homology
 2JT8 A;  3ICB A;  2ZN8 A;  1CFD A;  3FS7 A;  2F2O A;  4L9M A;  5J3X A;  3MSE B;  3IQQ A;  1KFU L;  2BE4 A;  1KK8 B;  4ORA B;  3WHT B;  1QX7 A;  1CDM A;  1S6J A;  2G2B A;  2NZ0 A;  1CLB A;  2Y1N A;  2JTZ A;  3PAT A;  1U5I B;  5KTY A;  1FBV A;  2QPT A;  2FCD A;  1KQV A;  3LLE A;  2M9G A;  1KCY A;  1FI5 A;  1EJ3 A;  4NQG A;  1K95 A;  2NCP A;  2F3Y A;  1ZMZ A;  2ISD A;  2K0J A;  2PAL A;  2Y4Q A;  3NSK A;  1A03 A;  3KPX A;  3SIB A;  4C0J A;  2ZND A;  2M3W A;  1PSR A;  4YGB B;  1X02 A;  1DJY A;  1NCZ A;  1MHO A;  2D8N A;  2PVB A;  2LCP A;  3NSI A;  5ER4 X;  2JXL A;  2QAC A;  4DCK A;  1UHH A;  1GQM A;  1CDN A;  3FWB A;  1XYD A;  5HKW A;  4U8D A;  2JPT A;  1QAS A;  1ZUZ A;  2SCP A;  4ORB B;  2KSP A;  3CR2 A;  2LVV A;  5I2O A;  2K7D A;  1ZOT B;  1J7Q A;  3VRP A;  1QIV A;  2KI6 C;  1AUI B;  4WRI A;  2JT0 A;  3EVU A;  3QRX A;  1TIZ A;  4I5L B;  1MUX A;  1AJ5 A;  1FPW A;  2MAZ A;  2KHN A;  2M49 B;  1TCF A;  1G8I A;  2NCO A;  2LVI A;  3PN7 C;  1Y1X A;  5I2L A;  2H2K A;  1ALV A;  1OQP A;  1YUT A;  4PHK A;  1YUR A;  2HQ8 A;  4OCI A;  1IG5 A;  2F8P A;  5DKR A;  3BUW B;  4DIR A;  3DF0 B;  1R6P A;  1UHI A;  2JTT A;  2SAS A;  1S26 D;  2MLF C;  5JJG A;  3ZWH A;  2R2I A;  2VRG A;  1JUO A;  3BUO B;  4HSZ A;  1HT9 A;  3BUM B;  1KFX S;  4HRG A;  1PSB A;  1D1O A;  1SCM C;  4GFT A;  2BBM A;  4GPL B;  2BEC A;  3SJS A;  1BF5 A;  1TNX A;  2NXQ A;  1SR6 B;  2KI4 C;  2IS9 A;  2KAX A;  3SG3 A;  1B7T Y;  5B8I B;  3AAK A;  3TUY C;  2K61 A;  4QJ4 B;  2K2A A;  2RGI A;  4I5J A;  1QV1 A;  4JPZ B;  2JNX A;  4M2O A;  4A4B A;  2Y1M A;  3LK1 A;  1K9P A;  4PE4 A;  2KFF A;  1ALW A;  1B8L A;  2O5G A;  1JWD A;  2L0P A;  1J55 A;  2Q91 A;  2WCF A;  3O78 A;  2HET A;  3I5G C;  5BPJ A;  1SCM B;  2AMI A;  5GQQ C;  1N0Y A;  4MBE A;  3WXA A;  1QVI Y;  4FTG A;  4I5K A;  1C07 A;  3A8R A;  2JU0 A;  1WY9 A;  1TN4 A;  1YTZ C;  2KDH A;  2OTG C;  3PLF B;  2MRD A;  1DF0 B;  1BMO A;  1SCV A;  1YX7 A;  2KFG A;  1CM1 A;  2CXJ A;  5CSN A;  3FIA A;  1TNW A;  1EH2 A;  1CTR A;  3GK4 X;  1WRL A;  3E3R A;  1B8R A;  1H8B A;  1L7Z A;  1SNL A;  3VRQ A;  1LA3 A;  2FCE A;  2JT3 A;  2L4I A;  1QX2 A;  4YGC B;  4CPV A;  1WLZ A;  3I5G B;  5HYD A;  1XFW O;  1JF0 A;  4C0K A;  1Q80 A;  4Q04 A;  1CB1 A;  3GK1 A;  3NSO A;  1B9A A;  1S5G Y;  1WDC B;  2F33 A;  2K2F A;  2LMV A;  3KHE A;  2BL0 B;  4YGE B;  1BLQ A;  1OMD A;  4PHN A;  1S3P A;  5AAN A;  1UHN A;  1M46 A;  1FW4 A;  1QAT A;  2HF5 A;  3BXK A;  3I5F B;  3BQ3 A;  2G9B A;  2LLT A;  1CLM A;  4OV2 A;  4MEW A;  1F8H A;  1B8C A;  5KSZ A;  1PAL A;  1U5I A;  5AXI A;  1C7V A;  2LHI A;  1WLM A;  1QLK A;  2CNP A;  3EK7 A;  1YX8 A;  1BT6 A;  2KBM A;  3SG6 A;  1NCY A;  1RJV A;  1J1E A;  1JSA A;  1UP5 A;  3CZT X;  1Y0V H;  4MRY A;  1JFJ A;  1SW8 A;  1TRF A;  1HQV A;  1RRO A;  1SMG A;  1SY9 A;  1K93 D;  2GGZ A;  2KNE A;  1EL4 A;  2I94 A;  1G4Y R;  1SL9 A;  1NX0 A;  4CLN A;  2LNK A;  1RFJ A;  1QTX A;  2HPS A;  4PAL A;  1G33 A;  1QJT A;  1K9K A;  1K94 A;  1SKT A;  1DJW A;  4N5X A;  3PAL A;  1MXL C;  1F70 A;  1DGU A;  2L50 A;  3JTD C;  1V1F A;  1B4C A;  4IL1 A;  1F71 A;  1QLS A;  1QV0 A;  1IWQ A;  2F3Z A;  3EK4 A;  4ORC B;  2O60 A;  1C7W A;  3CTN A;  1MF8 B;  1B1G A;  1K2H A;  2ZN9 A;  1NX3 A;  1NX1 A;  3H4S E;  2PAS A;  1TNQ A;  3DF0 A;  3DD4 A;  5HKZ A;  1V1G A;  3TDI A;  1QX5 B;  4M2P A;  2BBN A;  1SR6 C;  4OVN F;  1A75 A;  2JWW A;  3JTD B;  3I5I B;  2H61 C;  2L5X B;  1JC2 A;  1B7T Z;  4TNC A;  5CPV A;  2GV5 A;  4DS7 A;  1IH0 A;  1ZFS A;  5FYX A;  3SG4 A;  2DOQ A;  1AJ4 A;  3TS5 B;  1DGV A;  2MHH A;  3DVK A;  3D10 A;  1XFX O;  3PFV A;  2JUL A;  4ICB A;  1QXP A;  3TZ1 A;  2H61 A;  4MZJ A;  1W7I B;  1A75 B;  4QJ5 B;  4I5N B;  5I2Q A;  3O4Y A;  3KF9 A;  3DVJ A;  3HX4 A;  1CDP A;  4BY4 A;  4NDB A;  2E30 A;  2ZRS A;  3FWC A;  3VRO A;  1OMR A;  3EVV A;  1LA0 A;  1QVI Z;  2AUC A;  4OR9 B;  1SBJ A;  2JC2 A;  4P2Y B;  4PHM A;  1W7J B;  2EC6 C;  4MN0 A;  1OZS A;  2KQY A;  1KSM A;  2WC8 A;  1DJH A;  1M39 A;  4M2Q A;  4ZCV A;  1DMO A;  1BOD A;  3C1V A;  1OSA A;  2PRU A;  1IJ5 A;  1YVH A;  2Q4U A;  1Y1A A;  3K21 A;  1EXR A;  1PVA A;  1N65 A;  1XVJ A;  2JXC A;  1S36 A;  5AEQ A;  4CFR A;  1LXF C;  3EVR A;  4GBA A;  1WRK A;  1YUS A;  2KBI A;  1DF0 A;  4YBH B;  3IF7 A;  3I5H C;  2AAO A;  1GJY A;  1KFU S;  1BR4 B;  1NSH A;  1YRU B;  1SRA A;  2K7C A;  3IQO A;  2GGM A;  1BOC A;  1GGW A;  4CFQ A;  1WDC C;  2BKH B;  2BL0 C;  1NUB A;  2TN4 A;  1BU3 A;  1AP4 A;  2EC6 B;  1S5G Z;  5D7F A;  5K89 A;  1YRT B;  1K96 A;  1JBA A;  2KAV A;  4MVF A;  4PE1 A;  3I5F C;  1ODB A;  3NSL A;  4GNK B;  2PMY A;  1TCO B;  5IBW A;  3TDU A;  2V53 A;  5DKN A;  4HRE E;  4PDZ A;  4D1E A;  3BYA A;  1BJF A;  1UUR A;  1K9U A;  4MZK A;  2LP2 A;  3I5H B;  2BCX A;  3SIA A;  3WNX B;  1K8U A;  2LE9 B;  2OS8 B;  2CTN A;  2ZFD A;  3SG7 A;  1SPY A;  4QJ3 B;  1CKK A;  2KGR A;  3PM8 A;  2KFH A;  2MJW B;  5HLV A;  2BKI B;  3OHM B;  1AK8 A;  1M45 A;  1CMF A;  1UWO A;  2BCB A;  4R1E A;  2LM5 A;  4PE0 A;  3AKA A;  2JZI A;  1QIW A;  1CFF A;  3VRN A;  2CCM A;  1GGZ A;  1DVI A;  3DVM A;  5JOL A;  2M29 A;  1IJ6 A;  1UHJ A;  3EKJ A;  2L2E A;  4AOM A;  5CSF A;  2LC5 A;  1NYA A;  2LHL A;  2L98 A;  1F4Q A;  1F4O A;  4F0Z B;  2B1U A;  3BUX B;  3KEV A;  1CFC A;  2KQ6 A;  3WHU B;  2CBL A;  1FI6 A;  1J1D A;  3M0W A;  3JVT B;  4ZCU A;  1J7O A;  1F55 A;  2LMU A;  3EK8 A;  4UPG A;  2M1U A;  1L2O C;  1CFP A;  5HKY A;  1M63 B;  2JRF A;  3VRR A;  4BY5 A;  2CT9 A;  2LV7 A;  2WCE A;  2KI6 D;  3I5I C;  4GAO A;  4JWQ A;  1AHR A;  1A29 A;  1LKJ A;  2FOT A;  3ZNI A;  1PRW A;  1TOP A;  1XA5 A;  1BR1 B;  2LVJ A;  1OZO A;  1YVL A;  2E6W A;  3TS5 C;  1J7P A;  4XJK B;  3BOW A;  1PVB A;  1IKU A;  1XFZ O;  4DRW A;  1MWN A;  4YRU A;  2I7A A;  1L2O B;  1KQM C;  1DJI A;  1KWO C;  5DKQ A;  1S1E A;  3LCP C;  3AKB A;  1EG4 A;  2LLS A;  3OB1 B;  4GGN A;  3BOW B;  4GGF C;  2HQW A;  1A4P A;  1N2D A;  1VRK A;  5I8N A;  2LAP A;  1XK4 C;  2LUC A;  1RK9 A;  2KYC A;  3VGO A;  1CNP A;  2JNF A;  1NPQ A;  4MSP A;  1WRZ A;  2WCB A;  1B47 A;  1CMG A;  1E8A A;  2BE6 A;  3CS1 A;  4GGF A;  3HCM A;  2M7L A;  1YUU A;  3OP0 A;  1XK4 A;  2P6B B;  1KQM B;  1PUL A;  1KWO B;  3OB2 B;  3BUN B;  2LUX A;  3A4U B;  3SG2 A;  2LP3 A;  2EHB A;  2KYF A;  1ZAC A;  3GK2 A;  4YI8 A;  4YGD B;  1KK7 Z;  1OOJ A;  2LLU A;  1RWY A;  3TDZ A;  4MRX A;  1S6I A;  4N1F A;  2JOJ A;  1CLL A;  1NWD A;  1Y6W A;  1Y1U A;  1PK0 D;  1K90 D;  2ZNE A;  2WOR A;  1XO5 A;  2ZKM X;  3CGA A;  4AQI A;  4WQ3 A;  1MQ1 A;  5CSJ A;  2MBX A;  1DJG A;  2KGB C;  2M97 A;  2WND A;  3CWG A;  1DJZ A;  2MLE C;  4HRH A;  1SK6 D;  4PCW A;  2M7N A;  1JFK A;  2K8M B;  1IQ5 A;  4PHJ A;  1KK7 Y;  4XYN A;  3PN7 B;  4AQJ A;  1XFY O;  2JQ6 A;  2OS8 C;  3PSR A;  3SG5 A;  3OX6 A;  1A2X A;  5AFP A;  5ER5 A;  1DTL A;  1LVC D;  5HLO A;  4USL A;  2EGD A;  4MZL A;  5AER A;  3LL8 B;  3F45 A;  1RTP 1;  4NDC A;  1AVS A;  1LIN A;  4YI9 A;  2M0R A;  2L51 A;  2K7O A;  4WQ2 A;  1H4B A;  3O2P A;  2LAN A;  1XFV O;  2LMT A;  3RLZ A;  1MXE A;  1MR8 A;  5G08 A;  2WOS A;  3D0Y A;  3CR4 X;  2ZRT A;  4JQ0 D;  4C0L A;  2KI4 B;  3DVE A;  2OPO A;  2NLN A;  1CDL A;  1NIW A;  2M8U A;  3LK0 A;  3TUY B;  3NXA A;  4N1G A;  1NCX A;  2A4J A;  2FJU B;  1SL7 A;  3D0Y B;  3JVT C;  1DJX A;  3O6B A;  1J7R A;  1NP8 A;  3EKH A;  4PE7 A;  4YGA A;  5CSI A;  1UUS A;  4DUQ A;  3GOF A;  2K7B A;  5TNC A;  4CID A;  1IGV A;  1DT7 B;  1OE9 B;  3AAJ A;  5PAL A;  1F54 A;  2PSR A;  5KU1 A;  3CR5 X;  5F6T A;  2M1K B;  4GUK A;  1KFX L;  2I2R E;  1EG3 A;  1JF2 A;  1R2U A;  3KO0 A;  1KK8 C;  3OX5 A;  4ETO A;  1BG1 A;  2I18 A;  4MLW A;  2BCA A;  1S6C A;  2OTG B;  1SYM A;  1QS7 A;  3RM1 A;  2MA2 A;  1UHK A;  4P5O E;  1NX2 A;  2KOT A;  4NDD A;  2COL B;  2L4H A;  1IQ3 A;  1CM4 A;  1TNP A;  5D69 A;  1XFU O;  2Y5I A;  4FQO A;  1IRJ A;  4A4C A;  1FF1 A;  1M31 A;  1REC A;  4OKH A;  2F2P A;  2LVK A;  1OMV A;  1TTX A;  2KAY A;  1SL8 A;  4XJK A;  3CLN A;  1KSO A;  1YR5 A;  4E68 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...