4JWQA

Crystal structure of the calcium binding domain of cdpk3 from plasmodium berghei, pb000947.00
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
74
structure length
69
Chain Sequence
KHLSKKLIYCAFRVFDVDNDGEITTAELAHILYNSITQKDVNQVKKMIQEVDKNNDGKIDFYEFCEMMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Calcium-dependent protein kinase
publication title Crystal Structure of the Calcium Binding Domain of CDPK3 from Plasmodium Berghei, PB000947.00
rcsb
source organism Plasmodium berghei
molecule tags Transferase
total genus 23
structure length 69
sequence length 74
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4jwqA00
2PRUA 1KK8C 4N1FA 1DJZA 2PASA 1A2XA 3NSOA 1M31A 1YUUA 2BBMA 1XK4C 2Y4QA 1U5IB 1CFCA 1RJVA 1ZMZA 2KDHA 2KHNA 2LM5A 2M0RA 3AKBA 5HKWA 4PE0A 2K7DA 1YVHA 1PK0D 3NSKA 3BUXB 1UUSA 1ALWA 4CFRA 1QATA 2JWWA 4NDBA 4YBHB 4C0KA 5AEQA 2I18A 4GGNA 3HX4A 4AQIA 4CPVA 1CFFA 1WRZA 1YVLA 2L4HA 2AMIA 1XA5A 1LA0A 1TCOB 1V1GA 2K61A 4YGAA 1M45A 1A4PA 2A4JA 1OQPA 1Y1UA 2BCXA 1M39A 5JJGA 3BUMB 2M8UA 2AUCA 1K2HA 1QV1A 2Y1MA 2KAYA 4L9MA 4NDCA 1OE9B 3FIAA 1LKJA 2BE6A 2M29A 3TDIA 1UHIA 2JNFA 1Y1AA 2MRDA 3PM8A 1LINA 2NCPA 2L5XB 4M2QA 2GGMA 1BR1B 1TIZA 1SMGA 1DJXA 2OPOA 4OVNF 3WNXB 1AP4A 1NP8A 3GOFA 1J7PA 1JBAA 2WCFA 1K94A 4ZCUA 4HSZA 1MWNA 1CDNA 2GV5A 2E6WA 4E68A 4HRGA 1H8BA 3ZNIA 2HPSA 2ZN9A 2M3WA 2JT8A 2KFHA 2O5GA 2F8PA 2KI6D 2K7OA 1KQVA 3OB2B 3FWBA 2BKHB 2KBMA 1XFXO 1BMOA 5CSJA 1W7JB 4MBEA 1KFUS 1C07A 1VRKA 1UHJA 2PALA 4PE7A 2LE9B 2KGBC 2PSRA 1RWYA 1QLKA 4Q04A 2LP2A 4WQ2A 2CNPA 1SKTA 1GQMA 3H4SE 1XK4A 4CFQA 3CLNA 3PALA 3TDZA 3TUYB 2BL0B 4QJ4B 2ZNEA 3SG6A 1U5IA 3DVMA 2ZNDA 4PCWA 1DF0B 3TUYC 2ZKMX 3GK4X 4YGBB 3D0YB 2BL0C 2CBLA 1SBJA 3O78A 1D1OA 2K2AA 3AKAA 1KSMA 4NQGA 1KFXL 2FOTA 2JQ6A 1F71A 4UPGA 1NUBA 3SG7A 1SCMB 1B4CA 1QIVA 2KFGA 3I5IB 1YR5A 5HKYA 1ZUZA 1MHOA 1BOCA 1SCMC 4YI8A 1Y0VH 4DRWA 3I5IC 4MZLA 1DVIA 4MEWA 5AANA 4PHMA 4XJKB 2HF5A 1L7ZA 4PDZA 2B1UA 3ICBA 2RGIA 1TCFA 4M2PA 2LHLA 1E8AA 1IWQA 1J7RA 4MZKA 5KSZA 1YURA 2AAOA 2HETA 1QIWA 5TNCA 1SK6D 3A4UB 2K2FA 4FTGA 1C7VA 1MF8B 4JWQA 1JUOA 3CTNA 3DF0B 1CB1A 1B7TZ 1QJTA 2NCOA 1YRTB 2GGZA 3AAJA 1YX7A 3FS7A 1DT7B 2CT9A 2L51A 4GPLB 1QS7A 4GFTA 3VROA 2WC8A 5KU1A 1PRWA 1ZFSA 1MR8A 1CDMA 5I2OA 2BECA 1NX3A 2MAZA 2L4IA 4GBAA 1TTXA 1NX2A 1L2OB 2JZIA 2BE4A 1BLQA 2SCPA 1QV0A 2WCEA 2F2OA 1PVAA 2LMVA 2MLEC 3KO0A 1L2OC 3BXKA 3LLEA 1SNLA 2CXJA 1Y1XA 1B9AA 1AHRA 1DGVA 1FBVA 3EK7A 3EK8A 2OS8B 2M97A 3GK2A 5AFPA 3VRRA 1GJYA 1K96A 2OS8C 2L0PA 4I5NB 5CSFA 4ICBA 1FPWA 2Y1NA 1IGVA 2BBNA 1IKUA 4N5XA 1DF0A 3D0YA 1KK7Z 2JXCA 1BR4B 1CTRA 3VRNA 1TNPA 1NPQA 2M7NA 2JPTA 1J1EA 2K7CA 4IL1A 1QX7A 2KYCA 1EL4A 1IJ5A 3CZTX 2KYFA 3NXAA 2WORA 2LMUA 3O6BA 2JOJA 2G2BA 2I94A 3OHMB 1S3PA 2D8NA 4ORCB 2M7LA 1CDPA 2KAVA 4MRXA 1NCYA 4MVFA 1JF2A 1OZSA 4XJKA 5IBWA 1EG4A 2Q4UA 1EG3A 2LCPA 3A8RA 4ETOA 2BCAA 1N65A 1SL9A 3KHEA 1CM4A 5HYDA 4C0JA 2KAXA 1HT9A 2LHIA 3C1VA 2ZRSA 1RK9A 5I2LA 3DD4A 5DKNA 1BF5A 5HKZA 4D1EA 1B8LA 1RECA 1JWDA 1X02A 3LK1A 5FYXA 4WRIA 3DF0A 2COLB 5G08A 2ISDA 3EVRA 3KEVA 3GK1A 1NIWA 3VGOA 4PE4A 1KFXS 2JNXA 1WLZA 3I5FB 3SJSA 2NLNA 3IF7A 4BY4A 2QPTA 1IQ3A 1OMRA 2LLUA 3SG5A 1QLSA 1OMVA 3I5FC 3NSLA 4R1EA 1NSHA 4CIDA 1SL7A 1JC2A 1ODBA 1ZOTB 5CSIA 3OP0A 4I5JA 3OX5A 1B1GA 5KTYA 3EVUA 2WNDA 1MUXA 4OKHA 5DKRA 1S1EA 2JU0A 4AQJA 1G33A 1SL8A 1SW8A 1TOPA 2PVBA 2LVIA 1QVIZ 4YI9A 1QX5B 1K95A 1YUTA 2O60A 1TNWA 3NSIA 1S5GZ 2LUXA 4M2OA 2KQYA 2KOTA 1BU3A 4A4CA 1PALA 1B47A 2M49B 1OSAA 1SYMA 1XFUO 3IQQA 1CKKA 4PHKA 3K21A 3SIBA 1J7OA 1F55A 1CNPA 1MQ1A 1OMDA 1CLBA 2FJUB 3PLFB 1TRFA 2KQ6A 5AXIA 1A75B 1J55A 2L98A 1S26D 2IS9A 2L50A 2WOSA 4MRYA 4QJ5B 1JF0A 1N0YA 1NWDA 1WDCB 3JVTB 4YGDB 1A29A 2EC6B 2KI6C 2JTTA 1FI6A 1JFKA 3BUOB 1UHNA 5F6TA 1WDCC 2KI4B 4OR9B 2OTGB 3JVTC 1V1FA 2EHBA 4QJ3B 2PMYA 4I5KA 1KSOA 1QX2A 2EC6C 1M63B 1KQMB 1IRJA 2KI4C 1Q80A 2OTGC 5HLVA 3BOWA 3BQ3A 1RTP1 1YRUB 3CWGA 1AK8A 1KQMC 3OB1B 4P5OE 1PVBA 1XFYO 2KFFA 3RLZA 2JXLA 2LUCA 3CGAA 2M1KB 5CSNA 1LVCD 1BG1A 5I8NA 2FCDA 3PFVA 1CLLA 4NDDA 3CR5X 4MN0A 2BCBA 1WY9A 1IG5A 3CR2A 4PE1A 1C7WA 4PHNA 1XO5A 4YRUA 2JRFA 3SG4A 4MZJA 1TNQA 4A4BA 2JT0A 1B7TY 3HCMA 2MJWB 1WRKA 3BYAA 1AJ4A 1CFDA 3EVVA 1XVJA 3O4YA 3E3RA 4U8DA 4XYNA 2I2RE 4FQOA 4USLA 4F0ZB 5JOLA 2JT3A 1PSBA 1NCZA 4GNKB 1LXFC 3PATA 1F70A 4YGCB 2LP3A 1K9PA 5D69A 1YUSA 1RFJA 2JTZA 1AUIB 2KNEA 2H61A 2L2EA 4YGEB 5DKQA 4C0LA 4PALA 4GGFA 2P6BB 3D10A 1KWOB 1IH0A 1UP5A 1S6IA 1UWOA 1R2UA 1Y6WA 2G9BA 1XFZO 2LLTA 1KWOC 3WXAA 1J1DA 1CFPA 1DJYA 3QRXA 2LANA 5K89A 3LL8B 3JTDB 2I7AA 2FCEA 3VRPA 3DVEA 1OZOA 2V53A 3JTDC 1EJ3A 2LAPA 1GGWA 1KK7Y 1A75A 2ZN8A 5PALA 4ORBB 4ZCVA 1DJGA 2EGDA 1DJHA 3CR4X 3TZ1A 1F8HA 1XFVO 2LNKA 3EKHA 2NZ0A 1N2DA 2LVJA 1DJWA 3BOWB 3SIAA 1OOJA 1KCYA 3RM1A 2MA2A 1F54A 4PHJA 1MXLC 1SPYA 1TN4A 4BY5A 1IJ6A 3FWCA 1CM1A 1LA3A 2LVKA 5J3XA 3F45A 1UURA 1DTLA 4P2YB 1QTXA 4DCKA 1AJ5A 2NXQA 2HQ8A 3M0WA 3KF9A 3LK0A 1YX8A 3EKJA 1EH2A 3TS5B 3OX6A 4AOMA 3KPXA 4HRHA 2H2KA 1M46A 3PSRA 1BODA 1PSRA 1G4YR 1K9UA 4MLWA 4N1GA 3TS5C 1FI5A 1SRAA 2Q91A 3BUNB 4GAOA 1NX0A 1K9KA 2LLSA 2KSPA 2F2PA 1WRLA 2KGRA 5CPVA 4DUQA 1H4BA 5AERA 4JQ0D 1QASA 1A03A 4OCIA 5HLOA 2H61C 1K8UA 4GGFC 1UHKA 1K90D 1S6JA 1IQ5A 1W7IB 1SCVA 2VRGA 2ZRTA 1YTZC 2LMTA 3CS1A 1XFWO 1DJIA 2MBXA 1ALVA 1JFJA 2JULA 3WHUB 1UHHA 3DVKA 1R6PA 4TNCA 3ZWHA 1B8RA 2JC2A 5ER5A 3WHTB 1MXEA 1CMGA 4OV2A 3VRQA 1KFUL 5GQQC 2SASA 1QVIY 1BT6A 2MLFC 1GGZA 3I5GB 1FF1A 3MSEB 3SG2A 1JSAA 1S5GY 5D7FA 1J7QA 1ZACA 1SY9A 3I5GC 1S36A 2QACA 1HQVA 2LV7A 4DS7A 1CLMA 4CLNA 3TDUA 2K7BA 1CDLA 2R2IA 2BKIB 3I5HB 2KBIA 2M9GA 5B8IB 1SR6B 1NCXA 2ZFDA 2HQWA 3BUWB 2WCBA 3LCPC 1TNXA 2K8MB 3I5HC 2M1UA 1WLMA 2DOQA 1XYDA 1SR6C 3AAKA 2TN4A 2LC5A 1DMOA 1FW4A 2MHHA 4GUKA 2K0JA 3IQOA 1CMFA 2F3YA 4DIRA 4MSPA 4HREE 5ER4X 1BJFA 4I5LB 3O2PA 2E30A 1AVSA 1DGUA 2F3ZA 1RROA 1NYAA 1G8IA 1F4QA 2CCMA 2Y5IA 1QXPA 1K93D 1S6CA 2F33A 4WQ3A 1NX1A 3SG3A 1F4OA 3PN7B 5I2QA 4JPZB 1EXRA 3DVJA 1B8CA 1KK8B 3EK4A 1PULA 2CTNA 4ORAB 5BPJA 3PN7C 2LVVA
chains in the Genus database with same CATH superfamily
2WC5A 2PRUA 1KK8C 2P70A 4N1FA 1DJZA 2PASA 1A2XA 3L4LA 3V2LA 3NSOA 1M31A 1YUUA 2BBMA 1XK4C 2QEOA 1U5IB 2Y4QA 1RJVA 1ZMZA 2KDHA 2KHNA 2LM5A 2M0RA 3AKBA 5HKWA 4PE0A 2K7DA 1YVHA 1PK0D 3NSKA 3BUXB 1UUSA 1W9ZA 1ALWA 4CFRA 1QATA 3RZSA 2JWWA 4NDBA 4YBHB 4C0KA 5AEQA 2I18A 4GGNA 3HX4A 4AQIA 4CPVA 1CFFA 1WRZA 1YVLA 2L4HA 2AMIA 1XA5A 3Q8IA 1LA0A 1TCOB 1V1GA 2K61A 4YGAA 1M45A 1A4PA 2A4JA 1OQPA 1Y1UA 2BCXA 1M39A 1T14A 5JJGA 3BUMB 1C3ZA 2AUCA 2M8UA 1K2HA 1QV1A 2Y1MA 2KAYA 4L9MA 4NDCA 1OE9B 3FIAA 1LKJA 2BE6A 2M29A 3TDIA 1UHIA 2JNFA 1Y1AA 2MRDA 3PM8A 4F7FA 1LINA 2NCPA 2L5XB 4M2QA 2GGMA 1BR1B 1TIZA 1SMGA 1DJXA 2OPOA 4OVNF 3WNXB 1AP4A 1NP8A 3GOFA 1J7PA 1JBAA 2WCFA 1K94A 4ZCUA 2QEBA 4HSZA 4INXA 1MWNA 1CDNA 1DEKA 2PYQA 2GV5A 2E6WA 4E68A 4HRGA 1H8BA 3ZNIA 2HPSA 2ZN9A 2M3WA 2JT8A 1OW4A 2KFHA 2O5GA 2F8PA 2KI6D 2K7OA 1KQVA 3OB2B 3NGVA 3FWBA 2BKHB 1DQEA 3R1VA 2KBMA 1XFXO 1BMOA 5CSJA 1W7JB 4MBEA 1KFUS 1C07A 1VRKA 2L2CA 1UHJA 2PALA 4PE7A 2LE9B 2KGBC 2PSRA 1RWYA 3OGNA 1QLKA 4Q04A 2LP2A 2YGUA 2CNPA 1SKTA 4WQ2A 1GQMA 3H4SE 1XK4A 3UNWA 3CLNA 4CFQA 3PALA 3SS3A 3TDZA 3TUYB 2BL0B 4QJ4B 2ZNEA 3SG6A 1U5IA 1ORGA 3DVMA 3R1OA 2ZNDA 4PCWA 1DF0B 3D76A 3TUYC 2ZKMX 3GK4X 4YGBB 3D0YB 2BL0C 2CBLA 1SBJA 2WCJA 3O78A 1D1OA 2K2AA 3AKAA 1KSMA 2QEHA 2QEVA 4NQGA 1KFXL 3UO9A 2FOTA 2JQ6A 1F71A 4UPGA 3S0AA 5FI7A 1NUBA 3SG7A 1SCMB 1B4CA 1QIVA 2KFGA 3I5IB 1YR5A 3PM2A 5HKYA 1TWOA 1ZUZA 1MHOA 1BOCA 1SCMC 4YI8A 1Y0VH 4DRWA 3I5IC 3IVTA 4MZLA 1DVIA 4MEWA 5AANA 4PHMA 4XJKB 2HF5A 1L7ZA 4PDZA 2B1UA 3ICBA 2RGIA 1TCFA 3S0EA 3R1PA 4M2PA 2LHLA 1E8AA 1IWQA 1J7RA 3N7HA 4MZKA 5KSZA 1YURA 2AAOA 2HETA 1QIWA 5TNCA 4JD9A 1SK6D 3A4UB 2K2FA 4FTGA 1C7VA 5D3OA 1MF8B 4JWQA 1JUOA 3CTNA 3D78A 3DF0B 1CB1A 1B7TZ 1QJTA 2NCOA 1YRTB 2GGZA 3AAJA 1YX7A 3FS7A 1DT7B 2CT9A 2L51A 4GPLB 1QS7A 4GFTA 3VROA 2WC8A 3FE9A 1PRWA 5KU1A 1ZFSA 1MR8A 1CDMA 5I2OA 2BECA 1NX3A 2MAZA 2L4IA 4GBAA 1TTXA 1NX2A 1L2OB 2JZIA 3BFHA 2BE4A 2PQLA 1BLQA 2SCPA 1QV0A 2WCEA 2F2OA 1PVAA 2LMVA 2BAPA 2MLEC 3KO0A 1L2OC 3BXKA 3LLEA 1SNLA 2CXJA 1Y1XA 1B9AA 1AHRA 1DGVA 1FBVA 3EK7A 3EK8A 3D77A 2OS8B 2M97A 3GK2A 5AFPA 3BJHA 3VRRA 1GJYA 1K96A 2OS8C 2L0PA 4I5NB 5CSFA 3VB1A 4ICBA 1FPWA 2Y1NA 1IGVA 2BBNA 1IKUA 4N5XA 1DF0A 2KLDA 3D0YA 1KK7Z 2JXCA 1BR4B 3SS4A 1CTRA 3VRNA 3DYEA 1LS8A 1TNPA 1DELA 1NPQA 2M7NA 2JPTA 1J1EA 1OOHA 2K7CA 4IL1A 1QX7A 2KYCA 1EL4A 1IJ5A 3CZTX 2KYFA 3PJIA 3NXAA 1Z2CB 2WORA 2LMUA 3O6BA 2JOJA 2G2BA 2I94A 3OHMB 1S3PA 2D8NA 4ORCB 2M7LA 1CDPA 2KAVA 4IJ7A 1NCYA 2FJYA 1JF2A 1OZSA 4MRXA 4MVFA 4XJKA 1EG4A 3SS5A 5IBWA 2Q4UA 1EG3A 2LCPA 3A8RA 4ETOA 2BCAA 1N65A 1SL9A 3KHEA 1CM4A 5HYDA 3CYZA 4C0JA 2KAXA 2WCHA 1HT9A 2LHIA 5FI6A 3C1VA 2ZRSA 3D75A 1RK9A 5I2LA 3FE8A 3DD4A 5DKNA 1BF5A 5HKZA 4D1EA 1B8LA 1RECA 1JWDA 1X02A 3LK1A 5FYXA 4WRIA 3DF0A 2COLB 5G08A 2ISDA 3EVRA 3KEVA 3GK1A 1NIWA 3VGOA 4PE4A 4FQTA 1KFXS 2KLEA 1DC1A 2JNXA 1WLZA 3I5FB 3SJSA 2NLNA 3IF7A 3K1EA 2QPTA 4BY4A 1IQ3A 3OBVA 1OMRA 3D74A 2LLUA 3SG5A 3BFBA 1QLSA 1OMVA 3I5FC 3NSLA 4R1EA 1NSHA 4CIDA 1SL7A 1JC2A 1ODBA 3S0DA 1ZOTB 5CSIA 3OP0A 4I5JA 3OX5A 1B1GA 5KTYA 3EVUA 2WNDA 1MUXA 4OKHA 5DKRA 1S1EA 2JU0A 4AQJA 1G33A 1SL8A 1SW8A 1TOPA 2PVBA 2LVIA 1QVIZ 4YI9A 1QX5B 1K95A 1SSEB 1YUTA 2O60A 1TNWA 3NSIA 1S5GZ 2LUXA 4M2OA 2KQYA 2KOTA 1BU3A 4A4CA 1PALA 1QWVA 1B47A 2M49B 1OSAA 1SYMA 1XFUO 3IQQA 1CKKA 4PHKA 3K21A 3SIBA 1J7OA 1F55A 3CABA 1CNPA 1MQ1A 1OMDA 1CLBA 2FJUB 3PLFB 1TRFA 2KQ6A 5AXIA 2BNXA 1A75B 1J55A 2L98A 1S26D 2IS9A 2L50A 2WOSA 4MRYA 4QJ5B 1JF0A 1N0YA 1NWDA 1WDCB 3JVTB 3L4AA 4YGDB 1A29A 2EC6B 2KI6C 2JTTA 1FI6A 1JFKA 3BUOB 1UHNA 5F6TA 1WDCC 2KI4B 4OR9B 2OTGB 3JVTC 4KYNA 1V1FA 2EHBA 4QJ3B 2PMYA 4I5KA 1KSOA 1QX2A 2EC6C 1Z4HA 3EG5B 1M63B 1KQMB 1IRJA 2KI4C 1Q80A 2OTGC 5HLVA 3BOWA 3BQ3A 1RTP1 1YRUB 3CWGA 1AK8A 1KQMC 3OB1B 3NHIA 3B7AA 3O4XA 2WCMA 4P5OE 1PVBA 1XFYO 2KFFA 3RLZA 2JXLA 2LUCA 2P71A 2M1KB 3CGAA 5CSNA 1LVCD 1BG1A 3B6XA 5I8NA 2FCDA 3CDNA 3PFVA 1CLLA 4NDDA 3CR5X 4MN0A 2BCBA 1WY9A 1IG5A 3CR2A 4PE1A 1C7WA 4PHNA 1XO5A 4YRUA 2JRFA 3SG4A 4MZJA 1TNQA 4A4BA 2JT0A 1B7TY 3S0GA 3HCMA 2MJWB 1WRKA 3BYAA 1AJ4A 1CFDA 3EVVA 1XVJA 3O4YA 3E3RA 4PT1A 4U8DA 4XYNA 2I2RE 4FQOA 1GM0A 4USLA 4F0ZB 5JOLA 2WC6A 2JT3A 1PSBA 1NCZA 4GNKB 1LXFC 3PATA 1F70A 3S0BA 1TUZA 4YGCB 2WCKA 2H8VA 2LP3A 1K9PA 5D69A 1YUSA 1RFJA 2JTZA 1AUIB 2ERBA 2KNEA 2H61A 2L2EA 3BFAA 4YGEB 5DKQA 4C0LA 4PALA 4GGFA 2P6BB 3D10A 1KWOB 1IH0A 5FI2A 1UP5A 1S6IA 3QMEA 3S0FA 1UWOA 1OOGA 1R2UA 1Y6WA 2G9BA 1XFZO 2LLTA 1KWOC 3WXAA 1J1DA 1CFPA 1DJYA 3QRXA 2LANA 5K89A 3LL8B 3JTDB 2I7AA 2FCEA 3FE6A 3VRPA 3DVEA 1OZOA 1OOFA 2V53A 3JTDC 1EJ3A 2LAPA 3CZ1A 1KK7Y 1GGWA 1A75A 2ZN8A 5PALA 4ORBB 4ZCVA 1DJGA 2EGDA 1DJHA 3CR4X 3TZ1A 4INWA 5I94A 1F8HA 1XFVO 1IIOA 2LNKA 3EKHA 2NZ0A 1N2DA 2LVJA 1DJWA 3BOWB 3SIAA 1OOJA 2L5YA 1KCYA 1P28A 3DXLA 2MA2A 3RM1A 1F54A 3NHTA 4PHJA 1MXLC 1SPYA 2K60A 1TN4A 4BY5A 1IJ6A 3FWCA 5EL2A 3R72A 1CM1A 1LA3A 2LVKA 5J3XA 3F45A 1UURA 1DTLA 4P2YB 1QTXA 4DCKA 1AJ5A 2NXQA 2HQ8A 3M0WA 3KF9A 3LK0A 1YX8A 3EKJA 1EH2A 3TS5B 3OX6A 4AOMA 3KPXA 4HRHA 2H2KA 1M46A 3PSRA 1BODA 1PSRA 1G4YR 1K9UA 4MLWA 4N1GA 3TS5C 1FI5A 1SRAA 2KPHA 3CZ0A 2Q91A 3BUNB 4GAOA 1NX0A 1K9KA 5HL1A 2LLSA 2KSPA 2F2PA 1WRLA 2KGRA 5CPVA 4DUQA 1H4BA 1TUJA 3B86A 5AERA 4JQ0D 1QASA 1A03A 4OCIA 5HLOA 2H61C 1K8UA 4GGFC 1UHKA 1K90D 1S6JA 1IQ5A 1W7IB 1SCVA 2VRGA 2ZRTA 1YTZC 2LMTA 2GTEA 3CZ2A 3CS1A 1CFCA 1XFWO 1DJIA 2MBXA 1ALVA 1JFJA 2JULA 3WHUB 1UHHA 3DVKA 1R6PA 4TNCA 3ZWHA 1B8RA 2JC2A 5ER5A 3WHTB 1MXEA 1CMGA 4OV2A 3VRQA 1KFUL 5GQQC 2SASA 1QVIY 1BT6A 2MLFC 1GGZA 2WCLA 3I5GB 1FF1A 3MSEB 3SG2A 1JSAA 3B87A 1S5GY 3L47A 5D7FA 1J7QA 1ZACA 1SY9A 3I5GC 3DY9A 1S36A 2QACA 1HQVA 2LV7A 4DS7A 1CLMA 4CLNA 3TDUA 2K7BA 1CDLA 2JPOA 2BKIB 2R2IA 3I5HB 2KBIA 2M9GA 5B8IB 1SR6B 1NCXA 2ZFDA 2HQWA 3BUWB 2WCBA 3B88A 3LCPC 1TNXA 2K8MB 3I5HC 2M1UA 1WLMA 2DOQA 1XYDA 1XFRA 1SR6C 3AAKA 2QDIA 2TN4A 2LC5A 1DMOA 1FW4A 2MHHA 4GUKA 2K0JA 3IQOA 1CMFA 2F3YA 4DIRA 4MSPA 4HREE 5ER4X 1BJFA 4I5LB 3O2PA 2E30A 1AVSA 1DGUA 2F3ZA 1RROA 1NYAA 1G8IA 1F4QA 1OOIX 2CCMA 2Y5IA 1QXPA 1K93D 1S6CA 3DZTA 2F33A 4WQ3A 1NX1A 3SG3A 1F4OA 3D73A 3PN7B 5I2QA 4JPZB 4JKTA 1EXRA 3DVJA 1B8CA 1KK8B 4OZDA 3EK4A 5DICA 1PULA 2CTNA 4ORAB 5BPJA 1C3YA 3PN7C 2LVVA
chains in the Genus database with same CATH topology
2PRUA 1KK8C 4N1FA 1DJZA 2PASA 1A2XA 3NSOA 1M31A 1YUUA 2BBMA 1XK4C 2Y4QA 1U5IB 1CFCA 1RJVA 1ZMZA 2KDHA 2KHNA 2LM5A 2M0RA 3AKBA 5HKWA 4PE0A 2K7DA 1YVHA 1PK0D 3NSKA 3BUXB 1UUSA 1ALWA 4CFRA 1QATA 2JWWA 4NDBA 4YBHB 4C0KA 5AEQA 2I18A 4GGNA 3HX4A 4AQIA 4CPVA 1CFFA 1WRZA 1YVLA 2L4HA 2AMIA 1XA5A 1LA0A 1TCOB 1V1GA 2K61A 4YGAA 1M45A 1A4PA 2A4JA 1OQPA 1Y1UA 2BCXA 1M39A 5JJGA 3BUMB 2M8UA 2AUCA 1K2HA 1QV1A 2Y1MA 2KAYA 4L9MA 4NDCA 1OE9B 3FIAA 1LKJA 2BE6A 2M29A 3TDIA 1UHIA 2JNFA 1Y1AA 2MRDA 3PM8A 1LINA 2NCPA 2L5XB 4M2QA 2GGMA 1BR1B 1TIZA 1SMGA 1DJXA 2OPOA 4OVNF 3WNXB 1AP4A 1NP8A 3GOFA 1J7PA 1JBAA 2WCFA 1K94A 4ZCUA 4HSZA 1MWNA 1CDNA 2GV5A 2E6WA 4E68A 4HRGA 1H8BA 3ZNIA 2HPSA 2ZN9A 2M3WA 2JT8A 2KFHA 2O5GA 2F8PA 2KI6D 2K7OA 1KQVA 3OB2B 3FWBA 2BKHB 2KBMA 1XFXO 1BMOA 5CSJA 1W7JB 4MBEA 1KFUS 1C07A 1VRKA 1UHJA 2PALA 4PE7A 2LE9B 2KGBC 2PSRA 1RWYA 1QLKA 4Q04A 2LP2A 4WQ2A 2CNPA 1SKTA 1GQMA 3H4SE 1XK4A 4CFQA 3CLNA 3PALA 3TDZA 3TUYB 2BL0B 4QJ4B 2ZNEA 3SG6A 1U5IA 3DVMA 2ZNDA 4PCWA 1DF0B 3TUYC 2ZKMX 3GK4X 4YGBB 3D0YB 2BL0C 2CBLA 1SBJA 3O78A 1D1OA 2K2AA 3AKAA 1KSMA 4NQGA 1KFXL 2FOTA 2JQ6A 1F71A 4UPGA 1NUBA 3SG7A 1SCMB 1B4CA 1QIVA 2KFGA 3I5IB 1YR5A 5HKYA 1ZUZA 1MHOA 1BOCA 1SCMC 4YI8A 1Y0VH 4DRWA 3I5IC 4MZLA 1DVIA 4MEWA 5AANA 4PHMA 4XJKB 2HF5A 1L7ZA 4PDZA 2B1UA 3ICBA 2RGIA 1TCFA 4M2PA 2LHLA 1E8AA 1IWQA 1J7RA 4MZKA 5KSZA 1YURA 2AAOA 2HETA 1QIWA 5TNCA 1SK6D 3A4UB 2K2FA 4FTGA 1C7VA 1MF8B 4JWQA 1JUOA 3CTNA 3DF0B 1CB1A 1B7TZ 1QJTA 2NCOA 1YRTB 2GGZA 3AAJA 1YX7A 3FS7A 1DT7B 2CT9A 2L51A 4GPLB 1QS7A 4GFTA 3VROA 2WC8A 5KU1A 1PRWA 1ZFSA 1MR8A 1CDMA 5I2OA 2BECA 1NX3A 2MAZA 2L4IA 4GBAA 1TTXA 1NX2A 1L2OB 2JZIA 2BE4A 1BLQA 2SCPA 1QV0A 2WCEA 2F2OA 1PVAA 2LMVA 2MLEC 3KO0A 1L2OC 3BXKA 3LLEA 1SNLA 2CXJA 1Y1XA 1B9AA 1AHRA 1DGVA 1FBVA 3EK7A 3EK8A 2OS8B 2M97A 3GK2A 5AFPA 3VRRA 1GJYA 1K96A 2OS8C 2L0PA 4I5NB 5CSFA 4ICBA 1FPWA 2Y1NA 1IGVA 2BBNA 1IKUA 4N5XA 1DF0A 3D0YA 1KK7Z 2JXCA 1BR4B 1CTRA 3VRNA 1TNPA 1NPQA 2M7NA 2JPTA 1J1EA 2K7CA 4IL1A 1QX7A 2KYCA 1EL4A 1IJ5A 3CZTX 2KYFA 3NXAA 2WORA 2LMUA 3O6BA 2JOJA 2G2BA 2I94A 3OHMB 1S3PA 2D8NA 4ORCB 2M7LA 1CDPA 2KAVA 4MRXA 1NCYA 4MVFA 1JF2A 1OZSA 4XJKA 5IBWA 1EG4A 2Q4UA 1EG3A 2LCPA 3A8RA 4ETOA 2BCAA 1N65A 1SL9A 3KHEA 1CM4A 5HYDA 4C0JA 2KAXA 1HT9A 2LHIA 3C1VA 2ZRSA 1RK9A 5I2LA 3DD4A 5DKNA 1BF5A 5HKZA 4D1EA 1B8LA 1RECA 1JWDA 1X02A 3LK1A 5FYXA 4WRIA 3DF0A 2COLB 5G08A 2ISDA 3EVRA 3KEVA 3GK1A 1NIWA 3VGOA 4PE4A 1KFXS 2JNXA 1WLZA 3I5FB 3SJSA 2NLNA 3IF7A 4BY4A 2QPTA 1IQ3A 1OMRA 2LLUA 3SG5A 1QLSA 1OMVA 3I5FC 3NSLA 4R1EA 1NSHA 4CIDA 1SL7A 1JC2A 1ODBA 1ZOTB 5CSIA 3OP0A 4I5JA 3OX5A 1B1GA 5KTYA 3EVUA 2WNDA 1MUXA 4OKHA 5DKRA 1S1EA 2JU0A 4AQJA 1G33A 1SL8A 1SW8A 1TOPA 2PVBA 2LVIA 1QVIZ 4YI9A 1QX5B 1K95A 1YUTA 2O60A 1TNWA 3NSIA 1S5GZ 2LUXA 4M2OA 2KQYA 2KOTA 1BU3A 4A4CA 1PALA 1B47A 2M49B 1OSAA 1SYMA 1XFUO 3IQQA 1CKKA 4PHKA 3K21A 3SIBA 1J7OA 1F55A 1CNPA 1MQ1A 1OMDA 1CLBA 2FJUB 3PLFB 1TRFA 2KQ6A 5AXIA 1A75B 1J55A 2L98A 1S26D 2IS9A 2L50A 2WOSA 4MRYA 4QJ5B 1JF0A 1N0YA 1NWDA 1WDCB 3JVTB 4YGDB 1A29A 2EC6B 2KI6C 2JTTA 1FI6A 1JFKA 3BUOB 1UHNA 5F6TA 1WDCC 2KI4B 4OR9B 2OTGB 3JVTC 1V1FA 2EHBA 4QJ3B 2PMYA 4I5KA 1KSOA 1QX2A 2EC6C 1M63B 1KQMB 1IRJA 2KI4C 1Q80A 2OTGC 5HLVA 3BOWA 3BQ3A 1RTP1 1YRUB 3CWGA 1AK8A 1KQMC 3OB1B 4P5OE 1PVBA 1XFYO 2KFFA 3RLZA 2JXLA 2LUCA 3CGAA 2M1KB 5CSNA 1LVCD 1BG1A 5I8NA 2FCDA 3PFVA 1CLLA 4NDDA 3CR5X 4MN0A 2BCBA 1WY9A 1IG5A 3CR2A 4PE1A 1C7WA 4PHNA 1XO5A 4YRUA 2JRFA 3SG4A 4MZJA 1TNQA 4A4BA 2JT0A 1B7TY 3HCMA 2MJWB 1WRKA 3BYAA 1AJ4A 1CFDA 3EVVA 1XVJA 3O4YA 3E3RA 4U8DA 4XYNA 2I2RE 4FQOA 4USLA 4F0ZB 5JOLA 2JT3A 1PSBA 1NCZA 4GNKB 1LXFC 3PATA 1F70A 4YGCB 2LP3A 1K9PA 5D69A 1YUSA 1RFJA 2JTZA 1AUIB 2KNEA 2H61A 2L2EA 4YGEB 5DKQA 4C0LA 4PALA 4GGFA 2P6BB 3D10A 1KWOB 1IH0A 1UP5A 1S6IA 1UWOA 1R2UA 1Y6WA 2G9BA 1XFZO 2LLTA 1KWOC 3WXAA 1J1DA 1CFPA 1DJYA 3QRXA 2LANA 5K89A 3LL8B 3JTDB 2I7AA 2FCEA 3VRPA 3DVEA 1OZOA 2V53A 3JTDC 1EJ3A 2LAPA 1GGWA 1KK7Y 1A75A 2ZN8A 5PALA 4ORBB 4ZCVA 1DJGA 2EGDA 1DJHA 3CR4X 3TZ1A 1F8HA 1XFVO 2LNKA 3EKHA 2NZ0A 1N2DA 2LVJA 1DJWA 3BOWB 3SIAA 1OOJA 1KCYA 3RM1A 2MA2A 1F54A 4PHJA 1MXLC 1SPYA 1TN4A 4BY5A 1IJ6A 3FWCA 1CM1A 1LA3A 2LVKA 5J3XA 3F45A 1UURA 1DTLA 4P2YB 1QTXA 4DCKA 1AJ5A 2NXQA 2HQ8A 3M0WA 3KF9A 3LK0A 1YX8A 3EKJA 1EH2A 3TS5B 3OX6A 4AOMA 3KPXA 4HRHA 2H2KA 1M46A 3PSRA 1BODA 1PSRA 1G4YR 1K9UA 4MLWA 4N1GA 3TS5C 1FI5A 1SRAA 2Q91A 3BUNB 4GAOA 1NX0A 1K9KA 2LLSA 2KSPA 2F2PA 1WRLA 2KGRA 5CPVA 4DUQA 1H4BA 5AERA 4JQ0D 1QASA 1A03A 4OCIA 5HLOA 2H61C 1K8UA 4GGFC 1UHKA 1K90D 1S6JA 1IQ5A 1W7IB 1SCVA 2VRGA 2ZRTA 1YTZC 2LMTA 3CS1A 1XFWO 1DJIA 2MBXA 1ALVA 1JFJA 2JULA 3WHUB 1UHHA 3DVKA 1R6PA 4TNCA 3ZWHA 1B8RA 2JC2A 5ER5A 3WHTB 1MXEA 1CMGA 4OV2A 3VRQA 1KFUL 5GQQC 2SASA 1QVIY 1BT6A 2MLFC 1GGZA 3I5GB 1FF1A 3MSEB 3SG2A 1JSAA 1S5GY 5D7FA 1J7QA 1ZACA 1SY9A 3I5GC 1S36A 2QACA 1HQVA 2LV7A 4DS7A 1CLMA 4CLNA 3TDUA 2K7BA 1CDLA 2R2IA 2BKIB 3I5HB 2KBIA 2M9GA 5B8IB 1SR6B 1NCXA 2ZFDA 2HQWA 3BUWB 2WCBA 3LCPC 1TNXA 2K8MB 3I5HC 2M1UA 1WLMA 2DOQA 1XYDA 1SR6C 3AAKA 2TN4A 2LC5A 1DMOA 1FW4A 2MHHA 4GUKA 2K0JA 3IQOA 1CMFA 2F3YA 4DIRA 4MSPA 4HREE 5ER4X 1BJFA 4I5LB 3O2PA 2E30A 1AVSA 1DGUA 2F3ZA 1RROA 1NYAA 1G8IA 1F4QA 2CCMA 2Y5IA 1QXPA 1K93D 1S6CA 2F33A 4WQ3A 1NX1A 3SG3A 1F4OA 3PN7B 5I2QA 4JPZB 1EXRA 3DVJA 1B8CA 1KK8B 3EK4A 1PULA 2CTNA 4ORAB 5BPJA 3PN7C 2LVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PRU A;  1KK8 C;  4N1F A;  1DJZ A;  2PAS A;  1A2X A;  3NSO A;  1M31 A;  1YUU A;  2BBM A;  1XK4 C;  2Y4Q A;  1U5I B;  1CFC A;  1RJV A;  1ZMZ A;  2KDH A;  2KHN A;  2LM5 A;  2M0R A;  3AKB A;  5HKW A;  4PE0 A;  2K7D A;  1YVH A;  1PK0 D;  3NSK A;  3BUX B;  1UUS A;  1ALW A;  4CFR A;  1QAT A;  2JWW A;  4NDB A;  4YBH B;  4C0K A;  5AEQ A;  2I18 A;  4GGN A;  3HX4 A;  4AQI A;  4CPV A;  1CFF A;  1WRZ A;  1YVL A;  2L4H A;  2AMI A;  1XA5 A;  1LA0 A;  1TCO B;  1V1G A;  2K61 A;  4YGA A;  1M45 A;  1A4P A;  2A4J A;  1OQP A;  1Y1U A;  2BCX A;  1M39 A;  5JJG A;  3BUM B;  2M8U A;  2AUC A;  1K2H A;  1QV1 A;  2Y1M A;  2KAY A;  4L9M A;  4NDC A;  1OE9 B;  3FIA A;  1LKJ A;  2BE6 A;  2M29 A;  3TDI A;  1UHI A;  2JNF A;  1Y1A A;  2MRD A;  3PM8 A;  1LIN A;  2NCP A;  2L5X B;  4M2Q A;  2GGM A;  1BR1 B;  1TIZ A;  1SMG A;  1DJX A;  2OPO A;  4OVN F;  3WNX B;  1AP4 A;  1NP8 A;  3GOF A;  1J7P A;  1JBA A;  2WCF A;  1K94 A;  4ZCU A;  4HSZ A;  1MWN A;  1CDN A;  2GV5 A;  2E6W A;  4E68 A;  4HRG A;  1H8B A;  3ZNI A;  2HPS A;  2ZN9 A;  2M3W A;  2JT8 A;  2KFH A;  2O5G A;  2F8P A;  2KI6 D;  2K7O A;  1KQV A;  3OB2 B;  3FWB A;  2BKH B;  2KBM A;  1XFX O;  1BMO A;  5CSJ A;  1W7J B;  4MBE A;  1KFU S;  1C07 A;  1VRK A;  1UHJ A;  2PAL A;  4PE7 A;  2LE9 B;  2KGB C;  2PSR A;  1RWY A;  1QLK A;  4Q04 A;  2LP2 A;  4WQ2 A;  2CNP A;  1SKT A;  1GQM A;  3H4S E;  1XK4 A;  4CFQ A;  3CLN A;  3PAL A;  3TDZ A;  3TUY B;  2BL0 B;  4QJ4 B;  2ZNE A;  3SG6 A;  1U5I A;  3DVM A;  2ZND A;  4PCW A;  1DF0 B;  3TUY C;  2ZKM X;  3GK4 X;  4YGB B;  3D0Y B;  2BL0 C;  2CBL A;  1SBJ A;  3O78 A;  1D1O A;  2K2A A;  3AKA A;  1KSM A;  4NQG A;  1KFX L;  2FOT A;  2JQ6 A;  1F71 A;  4UPG A;  1NUB A;  3SG7 A;  1SCM B;  1B4C A;  1QIV A;  2KFG A;  3I5I B;  1YR5 A;  5HKY A;  1ZUZ A;  1MHO A;  1BOC A;  1SCM C;  4YI8 A;  1Y0V H;  4DRW A;  3I5I C;  4MZL A;  1DVI A;  4MEW A;  5AAN A;  4PHM A;  4XJK B;  2HF5 A;  1L7Z A;  4PDZ A;  2B1U A;  3ICB A;  2RGI A;  1TCF A;  4M2P A;  2LHL A;  1E8A A;  1IWQ A;  1J7R A;  4MZK A;  5KSZ A;  1YUR A;  2AAO A;  2HET A;  1QIW A;  5TNC A;  1SK6 D;  3A4U B;  2K2F A;  4FTG A;  1C7V A;  1MF8 B;  4JWQ A;  1JUO A;  3CTN A;  3DF0 B;  1CB1 A;  1B7T Z;  1QJT A;  2NCO A;  1YRT B;  2GGZ A;  3AAJ A;  1YX7 A;  3FS7 A;  1DT7 B;  2CT9 A;  2L51 A;  4GPL B;  1QS7 A;  4GFT A;  3VRO A;  2WC8 A;  5KU1 A;  1PRW A;  1ZFS A;  1MR8 A;  1CDM A;  5I2O A;  2BEC A;  1NX3 A;  2MAZ A;  2L4I A;  4GBA A;  1TTX A;  1NX2 A;  1L2O B;  2JZI A;  2BE4 A;  1BLQ A;  2SCP A;  1QV0 A;  2WCE A;  2F2O A;  1PVA A;  2LMV A;  2MLE C;  3KO0 A;  1L2O C;  3BXK A;  3LLE A;  1SNL A;  2CXJ A;  1Y1X A;  1B9A A;  1AHR A;  1DGV A;  1FBV A;  3EK7 A;  3EK8 A;  2OS8 B;  2M97 A;  3GK2 A;  5AFP A;  3VRR A;  1GJY A;  1K96 A;  2OS8 C;  2L0P A;  4I5N B;  5CSF A;  4ICB A;  1FPW A;  2Y1N A;  1IGV A;  2BBN A;  1IKU A;  4N5X A;  1DF0 A;  3D0Y A;  1KK7 Z;  2JXC A;  1BR4 B;  1CTR A;  3VRN A;  1TNP A;  1NPQ A;  2M7N A;  2JPT A;  1J1E A;  2K7C A;  4IL1 A;  1QX7 A;  2KYC A;  1EL4 A;  1IJ5 A;  3CZT X;  2KYF A;  3NXA A;  2WOR A;  2LMU A;  3O6B A;  2JOJ A;  2G2B A;  2I94 A;  3OHM B;  1S3P A;  2D8N A;  4ORC B;  2M7L A;  1CDP A;  2KAV A;  4MRX A;  1NCY A;  4MVF A;  1JF2 A;  1OZS A;  4XJK A;  5IBW A;  1EG4 A;  2Q4U A;  1EG3 A;  2LCP A;  3A8R A;  4ETO A;  2BCA A;  1N65 A;  1SL9 A;  3KHE A;  1CM4 A;  5HYD A;  4C0J A;  2KAX A;  1HT9 A;  2LHI A;  3C1V A;  2ZRS A;  1RK9 A;  5I2L A;  3DD4 A;  5DKN A;  1BF5 A;  5HKZ A;  4D1E A;  1B8L A;  1REC A;  1JWD A;  1X02 A;  3LK1 A;  5FYX A;  4WRI A;  3DF0 A;  2COL B;  5G08 A;  2ISD A;  3EVR A;  3KEV A;  3GK1 A;  1NIW A;  3VGO A;  4PE4 A;  1KFX S;  2JNX A;  1WLZ A;  3I5F B;  3SJS A;  2NLN A;  3IF7 A;  4BY4 A;  2QPT A;  1IQ3 A;  1OMR A;  2LLU A;  3SG5 A;  1QLS A;  1OMV A;  3I5F C;  3NSL A;  4R1E A;  1NSH A;  4CID A;  1SL7 A;  1JC2 A;  1ODB A;  1ZOT B;  5CSI A;  3OP0 A;  4I5J A;  3OX5 A;  1B1G A;  5KTY A;  3EVU A;  2WND A;  1MUX A;  4OKH A;  5DKR A;  1S1E A;  2JU0 A;  4AQJ A;  1G33 A;  1SL8 A;  1SW8 A;  1TOP A;  2PVB A;  2LVI A;  1QVI Z;  4YI9 A;  1QX5 B;  1K95 A;  1YUT A;  2O60 A;  1TNW A;  3NSI A;  1S5G Z;  2LUX A;  4M2O A;  2KQY A;  2KOT A;  1BU3 A;  4A4C A;  1PAL A;  1B47 A;  2M49 B;  1OSA A;  1SYM A;  1XFU O;  3IQQ A;  1CKK A;  4PHK A;  3K21 A;  3SIB A;  1J7O A;  1F55 A;  1CNP A;  1MQ1 A;  1OMD A;  1CLB A;  2FJU B;  3PLF B;  1TRF A;  2KQ6 A;  5AXI A;  1A75 B;  1J55 A;  2L98 A;  1S26 D;  2IS9 A;  2L50 A;  2WOS A;  4MRY A;  4QJ5 B;  1JF0 A;  1N0Y A;  1NWD A;  1WDC B;  3JVT B;  4YGD B;  1A29 A;  2EC6 B;  2KI6 C;  2JTT A;  1FI6 A;  1JFK A;  3BUO B;  1UHN A;  5F6T A;  1WDC C;  2KI4 B;  4OR9 B;  2OTG B;  3JVT C;  1V1F A;  2EHB A;  4QJ3 B;  2PMY A;  4I5K A;  1KSO A;  1QX2 A;  2EC6 C;  1M63 B;  1KQM B;  1IRJ A;  2KI4 C;  1Q80 A;  2OTG C;  5HLV A;  3BOW A;  3BQ3 A;  1RTP 1;  1YRU B;  3CWG A;  1AK8 A;  1KQM C;  3OB1 B;  4P5O E;  1PVB A;  1XFY O;  2KFF A;  3RLZ A;  2JXL A;  2LUC A;  3CGA A;  2M1K B;  5CSN A;  1LVC D;  1BG1 A;  5I8N A;  2FCD A;  3PFV A;  1CLL A;  4NDD A;  3CR5 X;  4MN0 A;  2BCB A;  1WY9 A;  1IG5 A;  3CR2 A;  4PE1 A;  1C7W A;  4PHN A;  1XO5 A;  4YRU A;  2JRF A;  3SG4 A;  4MZJ A;  1TNQ A;  4A4B A;  2JT0 A;  1B7T Y;  3HCM A;  2MJW B;  1WRK A;  3BYA A;  1AJ4 A;  1CFD A;  3EVV A;  1XVJ A;  3O4Y A;  3E3R A;  4U8D A;  4XYN A;  2I2R E;  4FQO A;  4USL A;  4F0Z B;  5JOL A;  2JT3 A;  1PSB A;  1NCZ A;  4GNK B;  1LXF C;  3PAT A;  1F70 A;  4YGC B;  2LP3 A;  1K9P A;  5D69 A;  1YUS A;  1RFJ A;  2JTZ A;  1AUI B;  2KNE A;  2H61 A;  2L2E A;  4YGE B;  5DKQ A;  4C0L A;  4PAL A;  4GGF A;  2P6B B;  3D10 A;  1KWO B;  1IH0 A;  1UP5 A;  1S6I A;  1UWO A;  1R2U A;  1Y6W A;  2G9B A;  1XFZ O;  2LLT A;  1KWO C;  3WXA A;  1J1D A;  1CFP A;  1DJY A;  3QRX A;  2LAN A;  5K89 A;  3LL8 B;  3JTD B;  2I7A A;  2FCE A;  3VRP A;  3DVE A;  1OZO A;  2V53 A;  3JTD C;  1EJ3 A;  2LAP A;  1GGW A;  1KK7 Y;  1A75 A;  2ZN8 A;  5PAL A;  4ORB B;  4ZCV A;  1DJG A;  2EGD A;  1DJH A;  3CR4 X;  3TZ1 A;  1F8H A;  1XFV O;  2LNK A;  3EKH A;  2NZ0 A;  1N2D A;  2LVJ A;  1DJW A;  3BOW B;  3SIA A;  1OOJ A;  1KCY A;  3RM1 A;  2MA2 A;  1F54 A;  4PHJ A;  1MXL C;  1SPY A;  1TN4 A;  4BY5 A;  1IJ6 A;  3FWC A;  1CM1 A;  1LA3 A;  2LVK A;  5J3X A;  3F45 A;  1UUR A;  1DTL A;  4P2Y B;  1QTX A;  4DCK A;  1AJ5 A;  2NXQ A;  2HQ8 A;  3M0W A;  3KF9 A;  3LK0 A;  1YX8 A;  3EKJ A;  1EH2 A;  3TS5 B;  3OX6 A;  4AOM A;  3KPX A;  4HRH A;  2H2K A;  1M46 A;  3PSR A;  1BOD A;  1PSR A;  1G4Y R;  1K9U A;  4MLW A;  4N1G A;  3TS5 C;  1FI5 A;  1SRA A;  2Q91 A;  3BUN B;  4GAO A;  1NX0 A;  1K9K A;  2LLS A;  2KSP A;  2F2P A;  1WRL A;  2KGR A;  5CPV A;  4DUQ A;  1H4B A;  5AER A;  4JQ0 D;  1QAS A;  1A03 A;  4OCI A;  5HLO A;  2H61 C;  1K8U A;  4GGF C;  1UHK A;  1K90 D;  1S6J A;  1IQ5 A;  1W7I B;  1SCV A;  2VRG A;  2ZRT A;  1YTZ C;  2LMT A;  3CS1 A;  1XFW O;  1DJI A;  2MBX A;  1ALV A;  1JFJ A;  2JUL A;  3WHU B;  1UHH A;  3DVK A;  1R6P A;  4TNC A;  3ZWH A;  1B8R A;  2JC2 A;  5ER5 A;  3WHT B;  1MXE A;  1CMG A;  4OV2 A;  3VRQ A;  1KFU L;  5GQQ C;  2SAS A;  1QVI Y;  1BT6 A;  2MLF C;  1GGZ A;  3I5G B;  1FF1 A;  3MSE B;  3SG2 A;  1JSA A;  1S5G Y;  5D7F A;  1J7Q A;  1ZAC A;  1SY9 A;  3I5G C;  1S36 A;  2QAC A;  1HQV A;  2LV7 A;  4DS7 A;  1CLM A;  4CLN A;  3TDU A;  2K7B A;  1CDL A;  2R2I A;  2BKI B;  3I5H B;  2KBI A;  2M9G A;  5B8I B;  1SR6 B;  1NCX A;  2ZFD A;  2HQW A;  3BUW B;  2WCB A;  3LCP C;  1TNX A;  2K8M B;  3I5H C;  2M1U A;  1WLM A;  2DOQ A;  1XYD A;  1SR6 C;  3AAK A;  2TN4 A;  2LC5 A;  1DMO A;  1FW4 A;  2MHH A;  4GUK A;  2K0J A;  3IQO A;  1CMF A;  2F3Y A;  4DIR A;  4MSP A;  4HRE E;  5ER4 X;  1BJF A;  4I5L B;  3O2P A;  2E30 A;  1AVS A;  1DGU A;  2F3Z A;  1RRO A;  1NYA A;  1G8I A;  1F4Q A;  2CCM A;  2Y5I A;  1QXP A;  1K93 D;  1S6C A;  2F33 A;  4WQ3 A;  1NX1 A;  3SG3 A;  1F4O A;  3PN7 B;  5I2Q A;  4JPZ B;  1EXR A;  3DVJ A;  1B8C A;  1KK8 B;  3EK4 A;  1PUL A;  2CTN A;  4ORA B;  5BPJ A;  3PN7 C;  2LVV A; 
#chains in the Genus database with same CATH topology
 2WC5 A;  2PRU A;  1KK8 C;  2P70 A;  4N1F A;  1DJZ A;  2PAS A;  1A2X A;  3L4L A;  3V2L A;  3NSO A;  1M31 A;  1YUU A;  2BBM A;  1XK4 C;  2QEO A;  1U5I B;  2Y4Q A;  1RJV A;  1ZMZ A;  2KDH A;  2KHN A;  2LM5 A;  2M0R A;  3AKB A;  5HKW A;  4PE0 A;  2K7D A;  1YVH A;  1PK0 D;  3NSK A;  3BUX B;  1UUS A;  1W9Z A;  1ALW A;  4CFR A;  1QAT A;  3RZS A;  2JWW A;  4NDB A;  4YBH B;  4C0K A;  5AEQ A;  2I18 A;  4GGN A;  3HX4 A;  4AQI A;  4CPV A;  1CFF A;  1WRZ A;  1YVL A;  2L4H A;  2AMI A;  1XA5 A;  3Q8I A;  1LA0 A;  1TCO B;  1V1G A;  2K61 A;  4YGA A;  1M45 A;  1A4P A;  2A4J A;  1OQP A;  1Y1U A;  2BCX A;  1M39 A;  1T14 A;  5JJG A;  3BUM B;  1C3Z A;  2AUC A;  2M8U A;  1K2H A;  1QV1 A;  2Y1M A;  2KAY A;  4L9M A;  4NDC A;  1OE9 B;  3FIA A;  1LKJ A;  2BE6 A;  2M29 A;  3TDI A;  1UHI A;  2JNF A;  1Y1A A;  2MRD A;  3PM8 A;  4F7F A;  1LIN A;  2NCP A;  2L5X B;  4M2Q A;  2GGM A;  1BR1 B;  1TIZ A;  1SMG A;  1DJX A;  2OPO A;  4OVN F;  3WNX B;  1AP4 A;  1NP8 A;  3GOF A;  1J7P A;  1JBA A;  2WCF A;  1K94 A;  4ZCU A;  2QEB A;  4HSZ A;  4INX A;  1MWN A;  1CDN A;  1DEK A;  2PYQ A;  2GV5 A;  2E6W A;  4E68 A;  4HRG A;  1H8B A;  3ZNI A;  2HPS A;  2ZN9 A;  2M3W A;  2JT8 A;  1OW4 A;  2KFH A;  2O5G A;  2F8P A;  2KI6 D;  2K7O A;  1KQV A;  3OB2 B;  3NGV A;  3FWB A;  2BKH B;  1DQE A;  3R1V A;  2KBM A;  1XFX O;  1BMO A;  5CSJ A;  1W7J B;  4MBE A;  1KFU S;  1C07 A;  1VRK A;  2L2C A;  1UHJ A;  2PAL A;  4PE7 A;  2LE9 B;  2KGB C;  2PSR A;  1RWY A;  3OGN A;  1QLK A;  4Q04 A;  2LP2 A;  2YGU A;  2CNP A;  1SKT A;  4WQ2 A;  1GQM A;  3H4S E;  1XK4 A;  3UNW A;  3CLN A;  4CFQ A;  3PAL A;  3SS3 A;  3TDZ A;  3TUY B;  2BL0 B;  4QJ4 B;  2ZNE A;  3SG6 A;  1U5I A;  1ORG A;  3DVM A;  3R1O A;  2ZND A;  4PCW A;  1DF0 B;  3D76 A;  3TUY C;  2ZKM X;  3GK4 X;  4YGB B;  3D0Y B;  2BL0 C;  2CBL A;  1SBJ A;  2WCJ A;  3O78 A;  1D1O A;  2K2A A;  3AKA A;  1KSM A;  2QEH A;  2QEV A;  4NQG A;  1KFX L;  3UO9 A;  2FOT A;  2JQ6 A;  1F71 A;  4UPG A;  3S0A A;  5FI7 A;  1NUB A;  3SG7 A;  1SCM B;  1B4C A;  1QIV A;  2KFG A;  3I5I B;  1YR5 A;  3PM2 A;  5HKY A;  1TWO A;  1ZUZ A;  1MHO A;  1BOC A;  1SCM C;  4YI8 A;  1Y0V H;  4DRW A;  3I5I C;  3IVT A;  4MZL A;  1DVI A;  4MEW A;  5AAN A;  4PHM A;  4XJK B;  2HF5 A;  1L7Z A;  4PDZ A;  2B1U A;  3ICB A;  2RGI A;  1TCF A;  3S0E A;  3R1P A;  4M2P A;  2LHL A;  1E8A A;  1IWQ A;  1J7R A;  3N7H A;  4MZK A;  5KSZ A;  1YUR A;  2AAO A;  2HET A;  1QIW A;  5TNC A;  4JD9 A;  1SK6 D;  3A4U B;  2K2F A;  4FTG A;  1C7V A;  5D3O A;  1MF8 B;  4JWQ A;  1JUO A;  3CTN A;  3D78 A;  3DF0 B;  1CB1 A;  1B7T Z;  1QJT A;  2NCO A;  1YRT B;  2GGZ A;  3AAJ A;  1YX7 A;  3FS7 A;  1DT7 B;  2CT9 A;  2L51 A;  4GPL B;  1QS7 A;  4GFT A;  3VRO A;  2WC8 A;  3FE9 A;  1PRW A;  5KU1 A;  1ZFS A;  1MR8 A;  1CDM A;  5I2O A;  2BEC A;  1NX3 A;  2MAZ A;  2L4I A;  4GBA A;  1TTX A;  1NX2 A;  1L2O B;  2JZI A;  3BFH A;  2BE4 A;  2PQL A;  1BLQ A;  2SCP A;  1QV0 A;  2WCE A;  2F2O A;  1PVA A;  2LMV A;  2BAP A;  2MLE C;  3KO0 A;  1L2O C;  3BXK A;  3LLE A;  1SNL A;  2CXJ A;  1Y1X A;  1B9A A;  1AHR A;  1DGV A;  1FBV A;  3EK7 A;  3EK8 A;  3D77 A;  2OS8 B;  2M97 A;  3GK2 A;  5AFP A;  3BJH A;  3VRR A;  1GJY A;  1K96 A;  2OS8 C;  2L0P A;  4I5N B;  5CSF A;  3VB1 A;  4ICB A;  1FPW A;  2Y1N A;  1IGV A;  2BBN A;  1IKU A;  4N5X A;  1DF0 A;  2KLD A;  3D0Y A;  1KK7 Z;  2JXC A;  1BR4 B;  3SS4 A;  1CTR A;  3VRN A;  3DYE A;  1LS8 A;  1TNP A;  1DEL A;  1NPQ A;  2M7N A;  2JPT A;  1J1E A;  1OOH A;  2K7C A;  4IL1 A;  1QX7 A;  2KYC A;  1EL4 A;  1IJ5 A;  3CZT X;  2KYF A;  3PJI A;  3NXA A;  1Z2C B;  2WOR A;  2LMU A;  3O6B A;  2JOJ A;  2G2B A;  2I94 A;  3OHM B;  1S3P A;  2D8N A;  4ORC B;  2M7L A;  1CDP A;  2KAV A;  4IJ7 A;  1NCY A;  2FJY A;  1JF2 A;  1OZS A;  4MRX A;  4MVF A;  4XJK A;  1EG4 A;  3SS5 A;  5IBW A;  2Q4U A;  1EG3 A;  2LCP A;  3A8R A;  4ETO A;  2BCA A;  1N65 A;  1SL9 A;  3KHE A;  1CM4 A;  5HYD A;  3CYZ A;  4C0J A;  2KAX A;  2WCH A;  1HT9 A;  2LHI A;  5FI6 A;  3C1V A;  2ZRS A;  3D75 A;  1RK9 A;  5I2L A;  3FE8 A;  3DD4 A;  5DKN A;  1BF5 A;  5HKZ A;  4D1E A;  1B8L A;  1REC A;  1JWD A;  1X02 A;  3LK1 A;  5FYX A;  4WRI A;  3DF0 A;  2COL B;  5G08 A;  2ISD A;  3EVR A;  3KEV A;  3GK1 A;  1NIW A;  3VGO A;  4PE4 A;  4FQT A;  1KFX S;  2KLE A;  1DC1 A;  2JNX A;  1WLZ A;  3I5F B;  3SJS A;  2NLN A;  3IF7 A;  3K1E A;  2QPT A;  4BY4 A;  1IQ3 A;  3OBV A;  1OMR A;  3D74 A;  2LLU A;  3SG5 A;  3BFB A;  1QLS A;  1OMV A;  3I5F C;  3NSL A;  4R1E A;  1NSH A;  4CID A;  1SL7 A;  1JC2 A;  1ODB A;  3S0D A;  1ZOT B;  5CSI A;  3OP0 A;  4I5J A;  3OX5 A;  1B1G A;  5KTY A;  3EVU A;  2WND A;  1MUX A;  4OKH A;  5DKR A;  1S1E A;  2JU0 A;  4AQJ A;  1G33 A;  1SL8 A;  1SW8 A;  1TOP A;  2PVB A;  2LVI A;  1QVI Z;  4YI9 A;  1QX5 B;  1K95 A;  1SSE B;  1YUT A;  2O60 A;  1TNW A;  3NSI A;  1S5G Z;  2LUX A;  4M2O A;  2KQY A;  2KOT A;  1BU3 A;  4A4C A;  1PAL A;  1QWV A;  1B47 A;  2M49 B;  1OSA A;  1SYM A;  1XFU O;  3IQQ A;  1CKK A;  4PHK A;  3K21 A;  3SIB A;  1J7O A;  1F55 A;  3CAB A;  1CNP A;  1MQ1 A;  1OMD A;  1CLB A;  2FJU B;  3PLF B;  1TRF A;  2KQ6 A;  5AXI A;  2BNX A;  1A75 B;  1J55 A;  2L98 A;  1S26 D;  2IS9 A;  2L50 A;  2WOS A;  4MRY A;  4QJ5 B;  1JF0 A;  1N0Y A;  1NWD A;  1WDC B;  3JVT B;  3L4A A;  4YGD B;  1A29 A;  2EC6 B;  2KI6 C;  2JTT A;  1FI6 A;  1JFK A;  3BUO B;  1UHN A;  5F6T A;  1WDC C;  2KI4 B;  4OR9 B;  2OTG B;  3JVT C;  4KYN A;  1V1F A;  2EHB A;  4QJ3 B;  2PMY A;  4I5K A;  1KSO A;  1QX2 A;  2EC6 C;  1Z4H A;  3EG5 B;  1M63 B;  1KQM B;  1IRJ A;  2KI4 C;  1Q80 A;  2OTG C;  5HLV A;  3BOW A;  3BQ3 A;  1RTP 1;  1YRU B;  3CWG A;  1AK8 A;  1KQM C;  3OB1 B;  3NHI A;  3B7A A;  3O4X A;  2WCM A;  4P5O E;  1PVB A;  1XFY O;  2KFF A;  3RLZ A;  2JXL A;  2LUC A;  2P71 A;  2M1K B;  3CGA A;  5CSN A;  1LVC D;  1BG1 A;  3B6X A;  5I8N A;  2FCD A;  3CDN A;  3PFV A;  1CLL A;  4NDD A;  3CR5 X;  4MN0 A;  2BCB A;  1WY9 A;  1IG5 A;  3CR2 A;  4PE1 A;  1C7W A;  4PHN A;  1XO5 A;  4YRU A;  2JRF A;  3SG4 A;  4MZJ A;  1TNQ A;  4A4B A;  2JT0 A;  1B7T Y;  3S0G A;  3HCM A;  2MJW B;  1WRK A;  3BYA A;  1AJ4 A;  1CFD A;  3EVV A;  1XVJ A;  3O4Y A;  3E3R A;  4PT1 A;  4U8D A;  4XYN A;  2I2R E;  4FQO A;  1GM0 A;  4USL A;  4F0Z B;  5JOL A;  2WC6 A;  2JT3 A;  1PSB A;  1NCZ A;  4GNK B;  1LXF C;  3PAT A;  1F70 A;  3S0B A;  1TUZ A;  4YGC B;  2WCK A;  2H8V A;  2LP3 A;  1K9P A;  5D69 A;  1YUS A;  1RFJ A;  2JTZ A;  1AUI B;  2ERB A;  2KNE A;  2H61 A;  2L2E A;  3BFA A;  4YGE B;  5DKQ A;  4C0L A;  4PAL A;  4GGF A;  2P6B B;  3D10 A;  1KWO B;  1IH0 A;  5FI2 A;  1UP5 A;  1S6I A;  3QME A;  3S0F A;  1UWO A;  1OOG A;  1R2U A;  1Y6W A;  2G9B A;  1XFZ O;  2LLT A;  1KWO C;  3WXA A;  1J1D A;  1CFP A;  1DJY A;  3QRX A;  2LAN A;  5K89 A;  3LL8 B;  3JTD B;  2I7A A;  2FCE A;  3FE6 A;  3VRP A;  3DVE A;  1OZO A;  1OOF A;  2V53 A;  3JTD C;  1EJ3 A;  2LAP A;  3CZ1 A;  1KK7 Y;  1GGW A;  1A75 A;  2ZN8 A;  5PAL A;  4ORB B;  4ZCV A;  1DJG A;  2EGD A;  1DJH A;  3CR4 X;  3TZ1 A;  4INW A;  5I94 A;  1F8H A;  1XFV O;  1IIO A;  2LNK A;  3EKH A;  2NZ0 A;  1N2D A;  2LVJ A;  1DJW A;  3BOW B;  3SIA A;  1OOJ A;  2L5Y A;  1KCY A;  1P28 A;  3DXL A;  2MA2 A;  3RM1 A;  1F54 A;  3NHT A;  4PHJ A;  1MXL C;  1SPY A;  2K60 A;  1TN4 A;  4BY5 A;  1IJ6 A;  3FWC A;  5EL2 A;  3R72 A;  1CM1 A;  1LA3 A;  2LVK A;  5J3X A;  3F45 A;  1UUR A;  1DTL A;  4P2Y B;  1QTX A;  4DCK A;  1AJ5 A;  2NXQ A;  2HQ8 A;  3M0W A;  3KF9 A;  3LK0 A;  1YX8 A;  3EKJ A;  1EH2 A;  3TS5 B;  3OX6 A;  4AOM A;  3KPX A;  4HRH A;  2H2K A;  1M46 A;  3PSR A;  1BOD A;  1PSR A;  1G4Y R;  1K9U A;  4MLW A;  4N1G A;  3TS5 C;  1FI5 A;  1SRA A;  2KPH A;  3CZ0 A;  2Q91 A;  3BUN B;  4GAO A;  1NX0 A;  1K9K A;  5HL1 A;  2LLS A;  2KSP A;  2F2P A;  1WRL A;  2KGR A;  5CPV A;  4DUQ A;  1H4B A;  1TUJ A;  3B86 A;  5AER A;  4JQ0 D;  1QAS A;  1A03 A;  4OCI A;  5HLO A;  2H61 C;  1K8U A;  4GGF C;  1UHK A;  1K90 D;  1S6J A;  1IQ5 A;  1W7I B;  1SCV A;  2VRG A;  2ZRT A;  1YTZ C;  2LMT A;  2GTE A;  3CZ2 A;  3CS1 A;  1CFC A;  1XFW O;  1DJI A;  2MBX A;  1ALV A;  1JFJ A;  2JUL A;  3WHU B;  1UHH A;  3DVK A;  1R6P A;  4TNC A;  3ZWH A;  1B8R A;  2JC2 A;  5ER5 A;  3WHT B;  1MXE A;  1CMG A;  4OV2 A;  3VRQ A;  1KFU L;  5GQQ C;  2SAS A;  1QVI Y;  1BT6 A;  2MLF C;  1GGZ A;  2WCL A;  3I5G B;  1FF1 A;  3MSE B;  3SG2 A;  1JSA A;  3B87 A;  1S5G Y;  3L47 A;  5D7F A;  1J7Q A;  1ZAC A;  1SY9 A;  3I5G C;  3DY9 A;  1S36 A;  2QAC A;  1HQV A;  2LV7 A;  4DS7 A;  1CLM A;  4CLN A;  3TDU A;  2K7B A;  1CDL A;  2JPO A;  2BKI B;  2R2I A;  3I5H B;  2KBI A;  2M9G A;  5B8I B;  1SR6 B;  1NCX A;  2ZFD A;  2HQW A;  3BUW B;  2WCB A;  3B88 A;  3LCP C;  1TNX A;  2K8M B;  3I5H C;  2M1U A;  1WLM A;  2DOQ A;  1XYD A;  1XFR A;  1SR6 C;  3AAK A;  2QDI A;  2TN4 A;  2LC5 A;  1DMO A;  1FW4 A;  2MHH A;  4GUK A;  2K0J A;  3IQO A;  1CMF A;  2F3Y A;  4DIR A;  4MSP A;  4HRE E;  5ER4 X;  1BJF A;  4I5L B;  3O2P A;  2E30 A;  1AVS A;  1DGU A;  2F3Z A;  1RRO A;  1NYA A;  1G8I A;  1F4Q A;  1OOI X;  2CCM A;  2Y5I A;  1QXP A;  1K93 D;  1S6C A;  3DZT A;  2F33 A;  4WQ3 A;  1NX1 A;  3SG3 A;  1F4O A;  3D73 A;  3PN7 B;  5I2Q A;  4JPZ B;  4JKT A;  1EXR A;  3DVJ A;  1B8C A;  1KK8 B;  4OZD A;  3EK4 A;  5DIC A;  1PUL A;  2CTN A;  4ORA B;  5BPJ A;  1C3Y A;  3PN7 C;  2LVV A; 
#chains in the Genus database with same CATH homology
 2PRU A;  1KK8 C;  4N1F A;  1DJZ A;  2PAS A;  1A2X A;  3NSO A;  1M31 A;  1YUU A;  2BBM A;  1XK4 C;  2Y4Q A;  1U5I B;  1CFC A;  1RJV A;  1ZMZ A;  2KDH A;  2KHN A;  2LM5 A;  2M0R A;  3AKB A;  5HKW A;  4PE0 A;  2K7D A;  1YVH A;  1PK0 D;  3NSK A;  3BUX B;  1UUS A;  1ALW A;  4CFR A;  1QAT A;  2JWW A;  4NDB A;  4YBH B;  4C0K A;  5AEQ A;  2I18 A;  4GGN A;  3HX4 A;  4AQI A;  4CPV A;  1CFF A;  1WRZ A;  1YVL A;  2L4H A;  2AMI A;  1XA5 A;  1LA0 A;  1TCO B;  1V1G A;  2K61 A;  4YGA A;  1M45 A;  1A4P A;  2A4J A;  1OQP A;  1Y1U A;  2BCX A;  1M39 A;  5JJG A;  3BUM B;  2M8U A;  2AUC A;  1K2H A;  1QV1 A;  2Y1M A;  2KAY A;  4L9M A;  4NDC A;  1OE9 B;  3FIA A;  1LKJ A;  2BE6 A;  2M29 A;  3TDI A;  1UHI A;  2JNF A;  1Y1A A;  2MRD A;  3PM8 A;  1LIN A;  2NCP A;  2L5X B;  4M2Q A;  2GGM A;  1BR1 B;  1TIZ A;  1SMG A;  1DJX A;  2OPO A;  4OVN F;  3WNX B;  1AP4 A;  1NP8 A;  3GOF A;  1J7P A;  1JBA A;  2WCF A;  1K94 A;  4ZCU A;  4HSZ A;  1MWN A;  1CDN A;  2GV5 A;  2E6W A;  4E68 A;  4HRG A;  1H8B A;  3ZNI A;  2HPS A;  2ZN9 A;  2M3W A;  2JT8 A;  2KFH A;  2O5G A;  2F8P A;  2KI6 D;  2K7O A;  1KQV A;  3OB2 B;  3FWB A;  2BKH B;  2KBM A;  1XFX O;  1BMO A;  5CSJ A;  1W7J B;  4MBE A;  1KFU S;  1C07 A;  1VRK A;  1UHJ A;  2PAL A;  4PE7 A;  2LE9 B;  2KGB C;  2PSR A;  1RWY A;  1QLK A;  4Q04 A;  2LP2 A;  4WQ2 A;  2CNP A;  1SKT A;  1GQM A;  3H4S E;  1XK4 A;  4CFQ A;  3CLN A;  3PAL A;  3TDZ A;  3TUY B;  2BL0 B;  4QJ4 B;  2ZNE A;  3SG6 A;  1U5I A;  3DVM A;  2ZND A;  4PCW A;  1DF0 B;  3TUY C;  2ZKM X;  3GK4 X;  4YGB B;  3D0Y B;  2BL0 C;  2CBL A;  1SBJ A;  3O78 A;  1D1O A;  2K2A A;  3AKA A;  1KSM A;  4NQG A;  1KFX L;  2FOT A;  2JQ6 A;  1F71 A;  4UPG A;  1NUB A;  3SG7 A;  1SCM B;  1B4C A;  1QIV A;  2KFG A;  3I5I B;  1YR5 A;  5HKY A;  1ZUZ A;  1MHO A;  1BOC A;  1SCM C;  4YI8 A;  1Y0V H;  4DRW A;  3I5I C;  4MZL A;  1DVI A;  4MEW A;  5AAN A;  4PHM A;  4XJK B;  2HF5 A;  1L7Z A;  4PDZ A;  2B1U A;  3ICB A;  2RGI A;  1TCF A;  4M2P A;  2LHL A;  1E8A A;  1IWQ A;  1J7R A;  4MZK A;  5KSZ A;  1YUR A;  2AAO A;  2HET A;  1QIW A;  5TNC A;  1SK6 D;  3A4U B;  2K2F A;  4FTG A;  1C7V A;  1MF8 B;  4JWQ A;  1JUO A;  3CTN A;  3DF0 B;  1CB1 A;  1B7T Z;  1QJT A;  2NCO A;  1YRT B;  2GGZ A;  3AAJ A;  1YX7 A;  3FS7 A;  1DT7 B;  2CT9 A;  2L51 A;  4GPL B;  1QS7 A;  4GFT A;  3VRO A;  2WC8 A;  5KU1 A;  1PRW A;  1ZFS A;  1MR8 A;  1CDM A;  5I2O A;  2BEC A;  1NX3 A;  2MAZ A;  2L4I A;  4GBA A;  1TTX A;  1NX2 A;  1L2O B;  2JZI A;  2BE4 A;  1BLQ A;  2SCP A;  1QV0 A;  2WCE A;  2F2O A;  1PVA A;  2LMV A;  2MLE C;  3KO0 A;  1L2O C;  3BXK A;  3LLE A;  1SNL A;  2CXJ A;  1Y1X A;  1B9A A;  1AHR A;  1DGV A;  1FBV A;  3EK7 A;  3EK8 A;  2OS8 B;  2M97 A;  3GK2 A;  5AFP A;  3VRR A;  1GJY A;  1K96 A;  2OS8 C;  2L0P A;  4I5N B;  5CSF A;  4ICB A;  1FPW A;  2Y1N A;  1IGV A;  2BBN A;  1IKU A;  4N5X A;  1DF0 A;  3D0Y A;  1KK7 Z;  2JXC A;  1BR4 B;  1CTR A;  3VRN A;  1TNP A;  1NPQ A;  2M7N A;  2JPT A;  1J1E A;  2K7C A;  4IL1 A;  1QX7 A;  2KYC A;  1EL4 A;  1IJ5 A;  3CZT X;  2KYF A;  3NXA A;  2WOR A;  2LMU A;  3O6B A;  2JOJ A;  2G2B A;  2I94 A;  3OHM B;  1S3P A;  2D8N A;  4ORC B;  2M7L A;  1CDP A;  2KAV A;  4MRX A;  1NCY A;  4MVF A;  1JF2 A;  1OZS A;  4XJK A;  5IBW A;  1EG4 A;  2Q4U A;  1EG3 A;  2LCP A;  3A8R A;  4ETO A;  2BCA A;  1N65 A;  1SL9 A;  3KHE A;  1CM4 A;  5HYD A;  4C0J A;  2KAX A;  1HT9 A;  2LHI A;  3C1V A;  2ZRS A;  1RK9 A;  5I2L A;  3DD4 A;  5DKN A;  1BF5 A;  5HKZ A;  4D1E A;  1B8L A;  1REC A;  1JWD A;  1X02 A;  3LK1 A;  5FYX A;  4WRI A;  3DF0 A;  2COL B;  5G08 A;  2ISD A;  3EVR A;  3KEV A;  3GK1 A;  1NIW A;  3VGO A;  4PE4 A;  1KFX S;  2JNX A;  1WLZ A;  3I5F B;  3SJS A;  2NLN A;  3IF7 A;  4BY4 A;  2QPT A;  1IQ3 A;  1OMR A;  2LLU A;  3SG5 A;  1QLS A;  1OMV A;  3I5F C;  3NSL A;  4R1E A;  1NSH A;  4CID A;  1SL7 A;  1JC2 A;  1ODB A;  1ZOT B;  5CSI A;  3OP0 A;  4I5J A;  3OX5 A;  1B1G A;  5KTY A;  3EVU A;  2WND A;  1MUX A;  4OKH A;  5DKR A;  1S1E A;  2JU0 A;  4AQJ A;  1G33 A;  1SL8 A;  1SW8 A;  1TOP A;  2PVB A;  2LVI A;  1QVI Z;  4YI9 A;  1QX5 B;  1K95 A;  1YUT A;  2O60 A;  1TNW A;  3NSI A;  1S5G Z;  2LUX A;  4M2O A;  2KQY A;  2KOT A;  1BU3 A;  4A4C A;  1PAL A;  1B47 A;  2M49 B;  1OSA A;  1SYM A;  1XFU O;  3IQQ A;  1CKK A;  4PHK A;  3K21 A;  3SIB A;  1J7O A;  1F55 A;  1CNP A;  1MQ1 A;  1OMD A;  1CLB A;  2FJU B;  3PLF B;  1TRF A;  2KQ6 A;  5AXI A;  1A75 B;  1J55 A;  2L98 A;  1S26 D;  2IS9 A;  2L50 A;  2WOS A;  4MRY A;  4QJ5 B;  1JF0 A;  1N0Y A;  1NWD A;  1WDC B;  3JVT B;  4YGD B;  1A29 A;  2EC6 B;  2KI6 C;  2JTT A;  1FI6 A;  1JFK A;  3BUO B;  1UHN A;  5F6T A;  1WDC C;  2KI4 B;  4OR9 B;  2OTG B;  3JVT C;  1V1F A;  2EHB A;  4QJ3 B;  2PMY A;  4I5K A;  1KSO A;  1QX2 A;  2EC6 C;  1M63 B;  1KQM B;  1IRJ A;  2KI4 C;  1Q80 A;  2OTG C;  5HLV A;  3BOW A;  3BQ3 A;  1RTP 1;  1YRU B;  3CWG A;  1AK8 A;  1KQM C;  3OB1 B;  4P5O E;  1PVB A;  1XFY O;  2KFF A;  3RLZ A;  2JXL A;  2LUC A;  3CGA A;  2M1K B;  5CSN A;  1LVC D;  1BG1 A;  5I8N A;  2FCD A;  3PFV A;  1CLL A;  4NDD A;  3CR5 X;  4MN0 A;  2BCB A;  1WY9 A;  1IG5 A;  3CR2 A;  4PE1 A;  1C7W A;  4PHN A;  1XO5 A;  4YRU A;  2JRF A;  3SG4 A;  4MZJ A;  1TNQ A;  4A4B A;  2JT0 A;  1B7T Y;  3HCM A;  2MJW B;  1WRK A;  3BYA A;  1AJ4 A;  1CFD A;  3EVV A;  1XVJ A;  3O4Y A;  3E3R A;  4U8D A;  4XYN A;  2I2R E;  4FQO A;  4USL A;  4F0Z B;  5JOL A;  2JT3 A;  1PSB A;  1NCZ A;  4GNK B;  1LXF C;  3PAT A;  1F70 A;  4YGC B;  2LP3 A;  1K9P A;  5D69 A;  1YUS A;  1RFJ A;  2JTZ A;  1AUI B;  2KNE A;  2H61 A;  2L2E A;  4YGE B;  5DKQ A;  4C0L A;  4PAL A;  4GGF A;  2P6B B;  3D10 A;  1KWO B;  1IH0 A;  1UP5 A;  1S6I A;  1UWO A;  1R2U A;  1Y6W A;  2G9B A;  1XFZ O;  2LLT A;  1KWO C;  3WXA A;  1J1D A;  1CFP A;  1DJY A;  3QRX A;  2LAN A;  5K89 A;  3LL8 B;  3JTD B;  2I7A A;  2FCE A;  3VRP A;  3DVE A;  1OZO A;  2V53 A;  3JTD C;  1EJ3 A;  2LAP A;  1GGW A;  1KK7 Y;  1A75 A;  2ZN8 A;  5PAL A;  4ORB B;  4ZCV A;  1DJG A;  2EGD A;  1DJH A;  3CR4 X;  3TZ1 A;  1F8H A;  1XFV O;  2LNK A;  3EKH A;  2NZ0 A;  1N2D A;  2LVJ A;  1DJW A;  3BOW B;  3SIA A;  1OOJ A;  1KCY A;  3RM1 A;  2MA2 A;  1F54 A;  4PHJ A;  1MXL C;  1SPY A;  1TN4 A;  4BY5 A;  1IJ6 A;  3FWC A;  1CM1 A;  1LA3 A;  2LVK A;  5J3X A;  3F45 A;  1UUR A;  1DTL A;  4P2Y B;  1QTX A;  4DCK A;  1AJ5 A;  2NXQ A;  2HQ8 A;  3M0W A;  3KF9 A;  3LK0 A;  1YX8 A;  3EKJ A;  1EH2 A;  3TS5 B;  3OX6 A;  4AOM A;  3KPX A;  4HRH A;  2H2K A;  1M46 A;  3PSR A;  1BOD A;  1PSR A;  1G4Y R;  1K9U A;  4MLW A;  4N1G A;  3TS5 C;  1FI5 A;  1SRA A;  2Q91 A;  3BUN B;  4GAO A;  1NX0 A;  1K9K A;  2LLS A;  2KSP A;  2F2P A;  1WRL A;  2KGR A;  5CPV A;  4DUQ A;  1H4B A;  5AER A;  4JQ0 D;  1QAS A;  1A03 A;  4OCI A;  5HLO A;  2H61 C;  1K8U A;  4GGF C;  1UHK A;  1K90 D;  1S6J A;  1IQ5 A;  1W7I B;  1SCV A;  2VRG A;  2ZRT A;  1YTZ C;  2LMT A;  3CS1 A;  1XFW O;  1DJI A;  2MBX A;  1ALV A;  1JFJ A;  2JUL A;  3WHU B;  1UHH A;  3DVK A;  1R6P A;  4TNC A;  3ZWH A;  1B8R A;  2JC2 A;  5ER5 A;  3WHT B;  1MXE A;  1CMG A;  4OV2 A;  3VRQ A;  1KFU L;  5GQQ C;  2SAS A;  1QVI Y;  1BT6 A;  2MLF C;  1GGZ A;  3I5G B;  1FF1 A;  3MSE B;  3SG2 A;  1JSA A;  1S5G Y;  5D7F A;  1J7Q A;  1ZAC A;  1SY9 A;  3I5G C;  1S36 A;  2QAC A;  1HQV A;  2LV7 A;  4DS7 A;  1CLM A;  4CLN A;  3TDU A;  2K7B A;  1CDL A;  2R2I A;  2BKI B;  3I5H B;  2KBI A;  2M9G A;  5B8I B;  1SR6 B;  1NCX A;  2ZFD A;  2HQW A;  3BUW B;  2WCB A;  3LCP C;  1TNX A;  2K8M B;  3I5H C;  2M1U A;  1WLM A;  2DOQ A;  1XYD A;  1SR6 C;  3AAK A;  2TN4 A;  2LC5 A;  1DMO A;  1FW4 A;  2MHH A;  4GUK A;  2K0J A;  3IQO A;  1CMF A;  2F3Y A;  4DIR A;  4MSP A;  4HRE E;  5ER4 X;  1BJF A;  4I5L B;  3O2P A;  2E30 A;  1AVS A;  1DGU A;  2F3Z A;  1RRO A;  1NYA A;  1G8I A;  1F4Q A;  2CCM A;  2Y5I A;  1QXP A;  1K93 D;  1S6C A;  2F33 A;  4WQ3 A;  1NX1 A;  3SG3 A;  1F4O A;  3PN7 B;  5I2Q A;  4JPZ B;  1EXR A;  3DVJ A;  1B8C A;  1KK8 B;  3EK4 A;  1PUL A;  2CTN A;  4ORA B;  5BPJ A;  3PN7 C;  2LVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...