4GGNA

Malaria invasion machinery protein complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
127
structure length
125
Chain Sequence
KDMFNTKSSKLRIEDASHNARKLGLAPSSTDEKKIRDLYGDSLTYEQYLEYLTMCVHDRDNMEELIKMFSHFDNNSSGFLTKNQMKNILTTWGDALTEQEANDALNAFSSEDRINYKLFCEDILS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin A tail domain interacting protein MTIP
publication title The structure of the D3 domain of Plasmodium falciparum myosin tail interacting protein MTIP in complex with a nanobody.
pubmed doi rcsb
source organism Plasmodium knowlesi
molecule tags Protein binding
total genus 38
structure length 125
sequence length 127
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ggnA02
2F8PA 1K95A 1KFUL 1XFYO 1XFUO 2LLSA 1BLQA 1TNQA 4MLWA 4XJKA 1OE9B 2BCBA 3SIBA 3EVRA 4NDDA 2MHHA 1OMVA 4I5NB 1K90D 2I2RE 1B9AA 2G2BA 1DTLA 2K61A 2NCPA 1WRZA 3K21A 2NCOA 1NYAA 1BOCA 4M2QA 2LP2A 1FI5A 4CPVA 1ZFSA 1WDCC 1XVJA 4ZCVA 2O60A 3D10A 3VGOA 1CB1A 2K2AA 1TIZA 1XFZO 4YGEB 3BQ3A 3BYAA 1B7TY 1NCXA 1PSRA 3M0WA 4YI8A 4GFTA 1CTRA 3FIAA 1TN4A 2MBXA 2BBMA 3OB2B 3CGAA 1B8LA 1NWDA 1YVHA 2L5XB 4XJKB 1SW8A 5J3XA 2KBMA 4L9MA 1KFXL 1Q80A 1IQ3A 1UHJA 3TS5B 2PALA 2L2EA 5DKQA 2Y1MA 5HKZA 5TNCA 3PALA 2KYFA 1IG5A 1H4BA 1KWOB 1QVIY 3DVKA 4MRYA 1OMDA 1XYDA 2HQ8A 3D0YA 2L4IA 2KI4B 3VRRA 1OZSA 2MLEC 5PALA 1G8IA 1A4PA 1NPQA 1F4QA 4ORAB 3SJSA 2EHBA 1DF0A 2JTTA 1GGWA 1SBJA 2BCXA 3DVJA 1M31A 1F8HA 1QS7A 1M39A 4MZKA 4YI9A 4IL1A 5KU1A 1PULA 5G08A 4M2OA 1S26D 3I5HB 5AERA 1K9KA 4OKHA 3HX4A 2SCPA 3KF9A 2LMTA 1LKJA 1SK6D 1U5IB 2NLNA 2Q91A 2R2IA 2QPTA 4YRUA 1CKKA 2HPSA 1NX0A 2E6WA 1DJZA 1CLBA 3GK2A 1LA3A 2LE9B 1DGUA 1FPWA 2EGDA 2LHIA 1CMGA 5BPJA 4Q04A 3WHUB 1M46A 2JT8A 2COLB 3NSOA 1KFUS 4GGFA 4PE1A 2NZ0A 1YX7A 1KK8B 1CDNA 4HRGA 5AANA 2M7LA 3O78A 1WRKA 2M0RA 1AVSA 1CFDA 3KPXA 4NDBA 2CCMA 3ZNIA 2JXLA 1YUTA 2LVIA 3I5FC 1SCVA 1XO5A 2LNKA 3SG7A 1TNWA 2M1UA 3NXAA 3SIAA 3E3RA 4MN0A 4ORBB 3SG4A 3IF7A 2AMIA 1V1GA 4MSPA 1SPYA 2IS9A 2JC2A 4GPLB 1S5GZ 5DKNA 1FBVA 1YUUA 3WHTB 5K89A 2LMUA 2M97A 3KEVA 2JXCA 5HLVA 1SR6C 1R2UA 4GGNA 1Y6WA 2LMVA 4QJ4B 2MA2A 2LV7A 2M3WA 5HYDA 1AJ5A 1OMRA 3JVTB 1MR8A 4YGCB 2CTNA 1C7VA 2CBLA 1TNXA 1IJ5A 4F0ZB 3SG5A 1YUSA 2KBIA 3EVUA 4OVNF 1YTZC 2FCDA 1YR5A 1KFXS 3CWGA 1UWOA 1CDLA 1QLKA 1SNLA 1Y1XA 1F4OA 2JTZA 2BECA 3FWCA 2LANA 4HSZA 1JUOA 2QACA 1QLSA 1ZMZA 2ZKMX 3I5IB 1OQPA 1UHIA 3RM1A 1DJYA 2DOQA 2HETA 5AXIA 3PATA 1DJHA 1Y1AA 2E30A 1J7OA 1MF8B 1MWNA 1C07A 3VROA 4HRHA 1SCMB 5F6TA 1EG3A 2JNFA 1A75A 2KFFA 1KCYA 2F2OA 1QTXA 4C0JA 1S6IA 1MXLC 3BUXB 2KYCA 1SL9A 3FWBA 1OSAA 1YURA 3LLEA 3CLNA 2BKHB 1YVLA 1BG1A 2LVKA 2M1KB 3AAKA 2JOJA 2WCEA 1WLMA 3OHMB 5D69A 1NSHA 1N65A 2JQ6A 3TS5C 3A8RA 1CM4A 3PN7B 4M2PA 4AQJA 1KWOC 1CM1A 3NSKA 2L50A 3RLZA 1Y0VH 3VRQA 1DMOA 4PHJA 1XA5A 2KI4C 2KAYA 3AKBA 2JPTA 3IQOA 1YRUB 1RFJA 5D7FA 1EL4A 2A4JA 1SY9A 2Q4UA 2M8UA 4PDZA 5AFPA 1PSBA 1EXRA 4WQ2A 1K9PA 1A29A 2K7CA 1PVBA 4N1GA 1UHNA 3H4SE 1H8BA 1F55A 2BKIB 2WOSA 1NP8A 2CT9A 2G9BA 2BL0B 3ZWHA 1XFVO 1WY9A 2HQWA 1TTXA 2AUCA 2FJUB 3EVVA 1MHOA 2I7AA 2JT3A 4MZJA 1QX7A 1KK8C 4PE7A 2LVJA 3I5GB 4YGBB 1S6CA 1QASA 4FTGA 1A2XA 1QVIZ 2KI6D 4JPZB 4TNCA 3OB1B 2PMYA 2I94A 2OTGB 1WDCB 1JF2A 2JT0A 2OS8B 4NDCA 1Y1UA 2K8MB 1UP5A 1UURA 2WCBA 4OCIA 2KGRA 2LCPA 3MSEB 5ER4X 1RJVA 2AAOA 1CFPA 1M45A 5I8NA 1WLZA 2Y5IA 2VRGA 3ICBA 3JVTC 3HCMA 2ZRTA 1IJ6A 3D0YB 5KTYA 2HF5A 2Y1NA 4MZLA 2CNPA 2KHNA 4PE0A 2ZN9A 2L98A 1BF5A 1B1GA 1DF0B 2D8NA 3OP0A 1AK8A 1SRAA 1IRJA 4C0LA 1BODA 3SG2A 1J55A 4A4BA 3EK4A 1FI6A 4P5OE 1DGVA 4JQ0D 3I5IC 2KNEA 3PLFB 1QXPA 4ETOA 1KQMB 1BR4B 2KDHA 1DJIA 2M49B 2BE4A 1EH2A 3KHEA 1J1EA 3GOFA 5B8IB 1RTP1 1QATA 1IKUA 3CR2A 1K2HA 5AEQA 2F3YA 5IBWA 4N5XA 4GUKA 1AHRA 2BCAA 2JZIA 1KK7Y 3SG3A 3BXKA 4PHNA 2CXJA 1GGZA 2KI6C 2RGIA 5JJGA 3GK4X 3DF0A 5CSNA 4C0KA 2MJWB 1KSOA 1SMGA 3WNXB 2H61C 1XK4C 5CPVA 4CFRA 1X02A 1RWYA 2BE6A 2EC6B 1ZOTB 1JFKA 1WRLA 1B47A 1FF1A 1K8UA 4DIRA 1BR1B 1TCFA 1HT9A 3O4YA 1JFJA 2LM5A 1LA0A 1G33A 1A03A 1AP4A 3AAJA 1YX8A 4GNKB 4AQIA 4E68A 1NCYA 1J1DA 2KAVA 4BY5A 5ER5A 2ZRSA 5I2LA 3EKHA 2ISDA 3TUYB 2LUCA 4DUQA 3WXAA 1TRFA 5HLOA 1IWQA 3TZ1A 1JBAA 1QIVA 1RK9A 1SR6B 2GV5A 3BUOB 1S6JA 4I5KA 4OR9B 4WQ3A 4YBHB 1FW4A 5DKRA 4QJ5B 4P2YB 1AJ4A 1GQMA 3NSLA 4CFQA 1N2DA 1F54A 2PVBA 2BL0C 3BOWA 3VRPA 3F45A 1DJXA 1L2OB 1S1EA 4MVFA 1OZOA 2NXQA 4PALA 2KQ6A 1K93D 2JNXA 1QX5B 4CIDA 2F2PA 1QX2A 1B8RA 2MAZA 2LAPA 4OV2A 2GGMA 1SKTA 3I5GC 5HKWA 2LLUA 1JWDA 2JWWA 3BUNB 3JTDB 1A75B 5I2QA 2JRFA 4JWQA 1NUBA 4R1EA 1ALVA 2K0JA 1LXFC 4YGDB 4XYNA 1K9UA 1B7TZ 2OTGC 2WCFA 1CNPA 3I5HC 1LVCD 2OS8C 1K94A 3LK0A 3CR5X 1XFXO 1M63B 3C1VA 2PRUA 5FYXA 4D1EA 2F3ZA 2JU0A 1PVAA 1AUIB 2K7OA 2KQYA 3EK8A 4UPGA 1JSAA 1IGVA 3OX5A 3BUMB 1K96A 5CSJA 2MLFC 2K7DA 2ZNEA 1QV0A 3BOWB 2KGBC 1NX3A 2M7NA 2PSRA 4MRXA 4MBEA 2PASA 1DJGA 2LUXA 3CS1A 1ALWA 2KFHA 1NX1A 1SL7A 1U5IA 4GAOA 1V1FA 4ORCB 3FS7A 2B1UA 1HQVA 4I5JA 1RROA 1CMFA 4I5LB 1CLMA 4MEWA 2KOTA 1BT6A 1EJ3A 3IQQA 1YRTB 4BY4A 1RECA 1W7JB 4WRIA 3VRNA 1KQMC 3O6BA 3OX6A 1F70A 3TDIA 1XFWO 1NIWA 1SYMA 3TDUA 1ODBA 3LK1A 1PRWA 4DS7A 3LL8B 1DVIA 4AOMA 1J7QA 1SL8A 3PSRA 3QRXA 4GGFC 3EK7A 2TN4A 2LHLA 1CDPA 1W7IB 3DVMA 1R6PA 1JC2A 2LP3A 3CR4X 2LC5A 1TOPA 1MUXA 3CTNA 4DRWA 1BU3A 1DJWA 1NCZA 1GJYA 2MRDA 3NSIA 1JF0A 1NX2A 1S36A 4PHMA 1DT7B 3PM8A 2EC6C 1QV1A 2I18A 4PHKA 1S5GY 1UUSA 1BMOA 3GK1A 1QJTA 2M9GA 3A4UB 2BBNA 1MQ1A 1VRKA 3EKJA 4ZCUA 1EG4A 2LLTA 1KQVA 1ZUZA 1SCMC 4N1FA 2L0PA 4PCWA 4NQGA 4DCKA 1CFFA 2ZNDA 2F33A 1OOJA 2P6BB 4FQOA 4HREE 4CLNA 5I2OA 4PE4A 2ZFDA 4QJ3B 3TDZA 5CSIA 1CDMA 3DD4A 3TUYC 1PK0D 1CFCA 3DVEA 2FOTA 2OPOA 1N0YA 2H2KA 1KSMA 2KAXA 1PALA 4YGAA 1S3PA 2M29A 5HKYA 1L7ZA 2ZN8A 3O2PA 2KSPA 2L51A 4USLA 1D1OA 3PN7C 3SG6A 4ICBA 1TNPA 1E8AA 1TCOB 1KK7Z 5GQQC 4A4CA 1L2OC 2FCEA 1CLLA 1LINA 2SASA 3KO0A 3PFVA 1C7WA 2O5GA 1IQ5A 2Y4QA 2GGZA 3I5FB 1UHKA 2WNDA 1J7RA 1G4YR 2JULA 2KFGA 3AKAA 5CSFA 1QIWA 4GBAA 2H61A 1XK4A 2WORA 3JTDC 4U8DA 1F71A 2K7BA 2L4HA 1B8CA 3CZTX 1ZACA 5JOLA 1J7PA 1BJFA 1B4CA 5KSZA 2K2FA 3BUWB 1UHHA 2WC8A 2LVVA 3DF0B 2V53A 1MXEA 1IH0A 3LCPC
chains in the Genus database with same CATH superfamily
2F8PA 1K95A 1KFUL 1XFYO 1XFUO 2LLSA 2KLDA 1BLQA 1TNQA 4MLWA 4XJKA 1OE9B 2BCBA 2WC6A 3SIBA 3EVRA 4NDDA 2MHHA 1OMVA 4I5NB 1K90D 2I2RE 1B9AA 2G2BA 1DTLA 2K61A 2NCPA 1WRZA 3K21A 2NCOA 1NYAA 1BOCA 4M2QA 2LP2A 1FI5A 4CPVA 1ZFSA 1WDCC 1XVJA 4ZCVA 2O60A 3D10A 3VGOA 1CB1A 2BNXA 2K2AA 1TIZA 1XFZO 4YGEB 3BQ3A 3BYAA 1B7TY 1NCXA 1PSRA 3M0WA 4KYNA 4YI8A 5FI6A 4GFTA 1CTRA 2L5YA 1OW4A 3FIAA 1TN4A 2MBXA 2BBMA 3NHTA 4OZDA 3OB2B 3CGAA 1B8LA 1NWDA 1YVHA 3B7AA 2L5XB 1IH0A 4XJKB 1SW8A 5J3XA 2KBMA 4L9MA 3D76A 1KFXL 3NHIA 1Q80A 1IQ3A 1UHJA 3TS5B 2PALA 2L2EA 5DKQA 1P28A 2Y1MA 5HKZA 5TNCA 3PALA 2KYFA 1IG5A 1H4BA 1KWOB 1QVIY 2ERBA 3DVKA 4MRYA 1GM0A 1LS8A 1OMDA 1XYDA 2HQ8A 3D0YA 2L4IA 2KI4B 3VRRA 1OZSA 2MLEC 5PALA 1G8IA 1A4PA 1NPQA 1F4QA 4ORAB 3SJSA 2EHBA 3UO9A 1DF0A 2JTTA 1GGWA 1SBJA 2BCXA 3DVJA 1M31A 1F8HA 1QS7A 2QDIA 3SS4A 3R1VA 1M39A 4MZKA 4YI9A 4IL1A 5KU1A 1PULA 5G08A 4M2OA 1S26D 3FE8A 3I5HB 5AERA 1K9KA 4OKHA 3HX4A 2SCPA 3KF9A 2LMTA 1LKJA 1SK6D 1U5IB 2NLNA 2Q91A 2R2IA 2QPTA 4YRUA 1CKKA 2HPSA 1NX0A 2E6WA 1DJZA 1CLBA 3GK2A 1LA3A 2LE9B 1DGUA 3Q8IA 1FPWA 2L2CA 2EGDA 2LHIA 1CMGA 5BPJA 4Q04A 3WHUB 1M46A 2JT8A 2COLB 3NSOA 1KFUS 4INXA 4GGFA 4PE1A 2NZ0A 1YX7A 1KK8B 1CDNA 4HRGA 5AANA 2M7LA 3O78A 1WRKA 2M0RA 1AVSA 1CFDA 3KPXA 4NDBA 2CCMA 3S0EA 2JXLA 1YUTA 2LVIA 3I5FC 1SCVA 1XO5A 2LNKA 3SG7A 1TNWA 1TWOA 2M1UA 3NXAA 3SIAA 3E3RA 4MN0A 5EL2A 4ORBB 3SG4A 3IF7A 2AMIA 1V1GA 4MSPA 1SPYA 2IS9A 2JC2A 4GPLB 1S5GZ 5DKNA 1FBVA 1YUUA 3V2LA 3WHTB 1DELA 5K89A 2LMUA 2M97A 3KEVA 2JXCA 5HLVA 1SR6C 1R2UA 2QEOA 4GGNA 1Y6WA 1DQEA 2LMVA 4QJ4B 2MA2A 2LV7A 2M3WA 2PYQA 5HYDA 1AJ5A 1OMRA 3JVTB 1MR8A 4YGCB 2CTNA 1C7VA 2CBLA 1TNXA 1IJ5A 4F0ZB 3SG5A 1YUSA 2KBIA 3EVUA 4OVNF 1YTZC 2FCDA 3S0GA 1YR5A 1KFXS 3CWGA 1UWOA 1CDLA 1QLKA 1ORGA 1SNLA 1Y1XA 1F4OA 2JTZA 2BECA 3FWCA 2LANA 4HSZA 1JUOA 2QACA 1QLSA 1ZMZA 2ZKMX 3I5IB 1OQPA 1UHIA 3RM1A 1DJYA 2DOQA 2HETA 5AXIA 3PATA 1DJHA 1Y1AA 2E30A 1J7OA 1MF8B 1MWNA 1C07A 3NGVA 3VROA 4HRHA 4INWA 2QEHA 1SCMB 5F6TA 1EG3A 2JNFA 1A75A 2KFFA 1KCYA 2F2OA 5I94A 1QTXA 4C0JA 1S6IA 1MXLC 3BUXB 2KYCA 1IIOA 1SL9A 3FWBA 1OSAA 1YURA 3LLEA 3CLNA 2BKHB 1YVLA 3D77A 1BG1A 2LVKA 2M1KB 3AAKA 2JOJA 2WCEA 1WLMA 3B86A 3OHMB 3CDNA 5D69A 1NSHA 1N65A 2JQ6A 3TS5C 3A8RA 1CM4A 3RZSA 3PN7B 3CZ2A 4M2PA 3SS3A 4AQJA 1KWOC 1CM1A 3NSKA 3BFBA 2L50A 3RLZA 1Y0VH 3VRQA 1DMOA 4PHJA 1XA5A 2KI4C 2KAYA 3AKBA 3VB1A 2JPTA 3IQOA 3DXLA 3L4AA 1YRUB 1RFJA 5D7FA 1EL4A 2A4JA 2PQLA 1SY9A 2Q4UA 2M8UA 4PDZA 5AFPA 3DYEA 1PSBA 1C3YA 1EXRA 4WQ2A 1K9PA 1A29A 2K7CA 1PVBA 4N1GA 1UHNA 3B6XA 3H4SE 1H8BA 3BFHA 4PT1A 2BKIB 2WOSA 3D73A 1F55A 1NP8A 2CT9A 2G9BA 4JD9A 2BL0B 3ZWHA 1XFVO 1WY9A 2HQWA 1TTXA 2AUCA 2FJUB 3EVVA 1MHOA 2I7AA 2JT3A 4MZJA 1QX7A 1KK8C 2KLEA 4PE7A 2LVJA 3I5GB 4YGBB 1S6CA 1QASA 4FTGA 1A2XA 3S0AA 1QVIZ 2KI6D 4JPZB 4TNCA 3OB1B 1DEKA 2PMYA 2I94A 2OTGB 1WDCB 1JF2A 2JT0A 2OS8B 4NDCA 1Y1UA 2K8MB 1UP5A 1UURA 2WCBA 4OCIA 2KGRA 2LCPA 3MSEB 5ER4X 1RJVA 2AAOA 1CFPA 1M45A 5I8NA 3CZ1A 3R1PA 1WLZA 2Y5IA 2VRGA 3ICBA 3JVTC 3HCMA 2ZRTA 1IJ6A 3D0YB 5KTYA 2KPHA 2HF5A 2Y1NA 4MZLA 2CNPA 2KHNA 4PE0A 2ZN9A 2L98A 1BF5A 1XFRA 3DY9A 3S0BA 1B1GA 1DF0B 2D8NA 3OP0A 1AK8A 1SRAA 1IRJA 4C0LA 1BODA 3SG2A 1J55A 4A4BA 3EK4A 1FI6A 4P5OE 1C3ZA 1DGVA 4JQ0D 3I5IC 2KNEA 2QEVA 1QXPA 3PLFB 1KQMB 4ETOA 1BR4B 2KDHA 1DJIA 2M49B 2BE4A 1EH2A 3KHEA 3L47A 1J1EA 1Z2CB 3GOFA 5B8IB 1RTP1 1QATA 1IKUA 3CR2A 1K2HA 5AEQA 2F3YA 5IBWA 4N5XA 4GUKA 1AHRA 2BCAA 2JZIA 1KK7Y 3QMEA 1TUZA 3SG3A 3O4XA 3BXKA 3ZNIA 4PHNA 2CXJA 1GGZA 2KI6C 2RGIA 5JJGA 3GK4X 3DF0A 5CSNA 4C0KA 2WCKA 2MJWB 1KSOA 1SMGA 3WNXB 2H61C 1XK4C 5CPVA 4CFRA 1X02A 1RWYA 2BE6A 2EC6B 1ZOTB 1JFKA 5D3OA 1WRLA 1B47A 1FF1A 1K8UA 4DIRA 1BR1B 1TCFA 1HT9A 3O4YA 1JFJA 2LM5A 1LA0A 1G33A 1A03A 1AP4A 3AAJA 1YX8A 4GNKB 4AQIA 4E68A 2WCMA 1NCYA 1J1DA 2KAVA 4BY5A 1OOFA 5ER5A 2ZRSA 5I2LA 3EKHA 2ISDA 3TUYB 3S0FA 2LUCA 4DUQA 3WXAA 1TRFA 5HLOA 1IWQA 2YGUA 3TZ1A 1JBAA 1QIVA 3EG5B 1RK9A 1SR6B 2GV5A 3BUOB 1S6JA 4I5KA 4OR9B 4WQ3A 4YBHB 1FW4A 5DKRA 2WCJA 4QJ5B 4P2YB 1AJ4A 1GQMA 3NSLA 4CFQA 1N2DA 1F54A 2PVBA 2BL0C 3CYZA 3BOWA 3VRPA 5DICA 3R1OA 3F45A 3BJHA 1DJXA 1L2OB 1S1EA 4MVFA 1OZOA 2NXQA 4PALA 2KQ6A 1K93D 1TUJA 5FI2A 2JNXA 1QX5B 4CIDA 2F2PA 1QX2A 1B8RA 2MAZA 2LAPA 4OV2A 2GGMA 1SKTA 3I5GC 5HKWA 2LLUA 1JWDA 2JWWA 3BUNB 3JTDB 1A75B 5I2QA 2JRFA 4JWQA 1NUBA 1Z4HA 4R1EA 1ALVA 2K0JA 1LXFC 4YGDB 2P71A 2WCLA 4XYNA 1SSEB 1K9UA 1B7TZ 2OTGC 2WCFA 1CNPA 3I5HC 1LVCD 1T14A 2OS8C 1K94A 3LK0A 3CR5X 1OOIX 1XFXO 1M63B 3C1VA 2PRUA 5FYXA 4D1EA 2F3ZA 2JU0A 1PVAA 1AUIB 2K7OA 3K1EA 2KQYA 3EK8A 4UPGA 2K60A 3UNWA 1IGVA 1JSAA 3OX5A 3BUMB 1K96A 5CSJA 2MLFC 2K7DA 2ZNEA 1QV0A 3BOWB 5FI7A 2KGBC 1NX3A 3IVTA 1QWVA 2M7NA 2PSRA 4MRXA 4MBEA 2PASA 1DJGA 2LUXA 3CS1A 3DZTA 1ALWA 2KFHA 4JKTA 1NX1A 1SL7A 1U5IA 4GAOA 1V1FA 4ORCB 2WC5A 3FS7A 2B1UA 1HQVA 3D78A 1RROA 4I5JA 1CMFA 4I5LB 1W9ZA 1DC1A 1CLMA 3D75A 3D74A 4MEWA 2KOTA 1BT6A 1EJ3A 3B87A 1YRTB 3IQQA 3N7HA 4BY4A 1RECA 1W7JB 4WRIA 3VRNA 1KQMC 3O6BA 2QEBA 3OX6A 4IJ7A 1F70A 3TDIA 3BFAA 1XFWO 1NIWA 1SYMA 3TDUA 1ODBA 3B88A 3LK1A 1PRWA 2JPOA 4DS7A 3LL8B 1DVIA 4AOMA 1J7QA 1SL8A 3PSRA 3QRXA 2H8VA 4GGFC 3EK7A 4F7FA 2TN4A 2LHLA 1CDPA 1W7IB 3CABA 3DVMA 1R6PA 1JC2A 2LP3A 3CR4X 2LC5A 2P70A 1TOPA 1MUXA 3CTNA 4DRWA 1BU3A 3FE9A 1DJWA 1NCZA 1GJYA 2MRDA 3NSIA 1JF0A 1NX2A 1S36A 4PHMA 3SS5A 1DT7B 3OBVA 3PM8A 2EC6C 1QV1A 2I18A 4PHKA 1S5GY 1UUSA 1BMOA 3GK1A 1QJTA 2M9GA 3A4UB 4FQTA 2BBNA 1MQ1A 1VRKA 3EKJA 4ZCUA 1EG4A 2LLTA 1OOGA 1KQVA 1ZUZA 1SCMC 4N1FA 2L0PA 4PCWA 2BAPA 4NQGA 4DCKA 2ZNDA 2F33A 1CFFA 1OOJA 2P6BB 2FJYA 4FQOA 4HREE 4CLNA 5I2OA 4PE4A 2ZFDA 4QJ3B 5HL1A 3TDZA 5CSIA 1CDMA 3DD4A 3TUYC 1PK0D 1OOHA 1CFCA 3DVEA 2FOTA 2OPOA 1N0YA 2H2KA 1KSMA 2KAXA 1PALA 4YGAA 1S3PA 2M29A 5HKYA 1L7ZA 2ZN8A 3PM2A 2GTEA 3O2PA 2KSPA 2L51A 4USLA 1D1OA 3PN7C 3SG6A 4ICBA 1TNPA 1E8AA 2WCHA 1TCOB 1KK7Z 5GQQC 4A4CA 3R72A 1L2OC 3FE6A 2FCEA 1CLLA 1LINA 2SASA 3KO0A 3PFVA 1C7WA 2O5GA 1IQ5A 2Y4QA 2GGZA 3I5FB 3PJIA 1UHKA 2WNDA 1J7RA 1G4YR 2JULA 2KFGA 3AKAA 5CSFA 1QIWA 3OGNA 4GBAA 2H61A 1XK4A 2WORA 3JTDC 4U8DA 1F71A 2K7BA 2L4HA 1B8CA 3CZ0A 3CZTX 1ZACA 5JOLA 1J7PA 1BJFA 1B4CA 5KSZA 3S0DA 2K2FA 3BUWB 1UHHA 2WC8A 2LVVA 3DF0B 2V53A 1MXEA 3L4LA 3LCPC
chains in the Genus database with same CATH topology
2F8PA 1K95A 1KFUL 1XFYO 1XFUO 2LLSA 1BLQA 1TNQA 4MLWA 4XJKA 1OE9B 2BCBA 3SIBA 3EVRA 4NDDA 2MHHA 1OMVA 4I5NB 1K90D 2I2RE 1B9AA 2G2BA 1DTLA 2K61A 2NCPA 1WRZA 3K21A 2NCOA 1NYAA 1BOCA 4M2QA 2LP2A 1FI5A 4CPVA 1ZFSA 1WDCC 1XVJA 4ZCVA 2O60A 3D10A 3VGOA 1CB1A 2K2AA 1TIZA 1XFZO 4YGEB 3BQ3A 3BYAA 1B7TY 1NCXA 1PSRA 3M0WA 4YI8A 4GFTA 1CTRA 3FIAA 1TN4A 2MBXA 2BBMA 3OB2B 3CGAA 1B8LA 1NWDA 1YVHA 2L5XB 4XJKB 1SW8A 5J3XA 2KBMA 4L9MA 1KFXL 1Q80A 1IQ3A 1UHJA 3TS5B 2PALA 2L2EA 5DKQA 2Y1MA 5HKZA 5TNCA 3PALA 2KYFA 1IG5A 1H4BA 1KWOB 1QVIY 3DVKA 4MRYA 1OMDA 1XYDA 2HQ8A 3D0YA 2L4IA 2KI4B 3VRRA 1OZSA 2MLEC 5PALA 1G8IA 1A4PA 1NPQA 1F4QA 4ORAB 3SJSA 2EHBA 1DF0A 2JTTA 1GGWA 1SBJA 2BCXA 3DVJA 1M31A 1F8HA 1QS7A 1M39A 4MZKA 4YI9A 4IL1A 5KU1A 1PULA 5G08A 4M2OA 1S26D 3I5HB 5AERA 1K9KA 4OKHA 3HX4A 2SCPA 3KF9A 2LMTA 1LKJA 1SK6D 1U5IB 2NLNA 2Q91A 2R2IA 2QPTA 4YRUA 1CKKA 2HPSA 1NX0A 2E6WA 1DJZA 1CLBA 3GK2A 1LA3A 2LE9B 1DGUA 1FPWA 2EGDA 2LHIA 1CMGA 5BPJA 4Q04A 3WHUB 1M46A 2JT8A 2COLB 3NSOA 1KFUS 4GGFA 4PE1A 2NZ0A 1YX7A 1KK8B 1CDNA 4HRGA 5AANA 2M7LA 3O78A 1WRKA 2M0RA 1AVSA 1CFDA 3KPXA 4NDBA 2CCMA 3ZNIA 2JXLA 1YUTA 2LVIA 3I5FC 1SCVA 1XO5A 2LNKA 3SG7A 1TNWA 2M1UA 3NXAA 3SIAA 3E3RA 4MN0A 4ORBB 3SG4A 3IF7A 2AMIA 1V1GA 4MSPA 1SPYA 2IS9A 2JC2A 4GPLB 1S5GZ 5DKNA 1FBVA 1YUUA 3WHTB 5K89A 2LMUA 2M97A 3KEVA 2JXCA 5HLVA 1SR6C 1R2UA 4GGNA 1Y6WA 2LMVA 4QJ4B 2MA2A 2LV7A 2M3WA 5HYDA 1AJ5A 1OMRA 3JVTB 1MR8A 4YGCB 2CTNA 1C7VA 2CBLA 1TNXA 1IJ5A 4F0ZB 3SG5A 1YUSA 2KBIA 3EVUA 4OVNF 1YTZC 2FCDA 1YR5A 1KFXS 3CWGA 1UWOA 1CDLA 1QLKA 1SNLA 1Y1XA 1F4OA 2JTZA 2BECA 3FWCA 2LANA 4HSZA 1JUOA 2QACA 1QLSA 1ZMZA 2ZKMX 3I5IB 1OQPA 1UHIA 3RM1A 1DJYA 2DOQA 2HETA 5AXIA 3PATA 1DJHA 1Y1AA 2E30A 1J7OA 1MF8B 1MWNA 1C07A 3VROA 4HRHA 1SCMB 5F6TA 1EG3A 2JNFA 1A75A 2KFFA 1KCYA 2F2OA 1QTXA 4C0JA 1S6IA 1MXLC 3BUXB 2KYCA 1SL9A 3FWBA 1OSAA 1YURA 3LLEA 3CLNA 2BKHB 1YVLA 1BG1A 2LVKA 2M1KB 3AAKA 2JOJA 2WCEA 1WLMA 3OHMB 5D69A 1NSHA 1N65A 2JQ6A 3TS5C 3A8RA 1CM4A 3PN7B 4M2PA 4AQJA 1KWOC 1CM1A 3NSKA 2L50A 3RLZA 1Y0VH 3VRQA 1DMOA 4PHJA 1XA5A 2KI4C 2KAYA 3AKBA 2JPTA 3IQOA 1YRUB 1RFJA 5D7FA 1EL4A 2A4JA 1SY9A 2Q4UA 2M8UA 4PDZA 5AFPA 1PSBA 1EXRA 4WQ2A 1K9PA 1A29A 2K7CA 1PVBA 4N1GA 1UHNA 3H4SE 1H8BA 1F55A 2BKIB 2WOSA 1NP8A 2CT9A 2G9BA 2BL0B 3ZWHA 1XFVO 1WY9A 2HQWA 1TTXA 2AUCA 2FJUB 3EVVA 1MHOA 2I7AA 2JT3A 4MZJA 1QX7A 1KK8C 4PE7A 2LVJA 3I5GB 4YGBB 1S6CA 1QASA 4FTGA 1A2XA 1QVIZ 2KI6D 4JPZB 4TNCA 3OB1B 2PMYA 2I94A 2OTGB 1WDCB 1JF2A 2JT0A 2OS8B 4NDCA 1Y1UA 2K8MB 1UP5A 1UURA 2WCBA 4OCIA 2KGRA 2LCPA 3MSEB 5ER4X 1RJVA 2AAOA 1CFPA 1M45A 5I8NA 1WLZA 2Y5IA 2VRGA 3ICBA 3JVTC 3HCMA 2ZRTA 1IJ6A 3D0YB 5KTYA 2HF5A 2Y1NA 4MZLA 2CNPA 2KHNA 4PE0A 2ZN9A 2L98A 1BF5A 1B1GA 1DF0B 2D8NA 3OP0A 1AK8A 1SRAA 1IRJA 4C0LA 1BODA 3SG2A 1J55A 4A4BA 3EK4A 1FI6A 4P5OE 1DGVA 4JQ0D 3I5IC 2KNEA 3PLFB 1QXPA 4ETOA 1KQMB 1BR4B 2KDHA 1DJIA 2M49B 2BE4A 1EH2A 3KHEA 1J1EA 3GOFA 5B8IB 1RTP1 1QATA 1IKUA 3CR2A 1K2HA 5AEQA 2F3YA 5IBWA 4N5XA 4GUKA 1AHRA 2BCAA 2JZIA 1KK7Y 3SG3A 3BXKA 4PHNA 2CXJA 1GGZA 2KI6C 2RGIA 5JJGA 3GK4X 3DF0A 5CSNA 4C0KA 2MJWB 1KSOA 1SMGA 3WNXB 2H61C 1XK4C 5CPVA 4CFRA 1X02A 1RWYA 2BE6A 2EC6B 1ZOTB 1JFKA 1WRLA 1B47A 1FF1A 1K8UA 4DIRA 1BR1B 1TCFA 1HT9A 3O4YA 1JFJA 2LM5A 1LA0A 1G33A 1A03A 1AP4A 3AAJA 1YX8A 4GNKB 4AQIA 4E68A 1NCYA 1J1DA 2KAVA 4BY5A 5ER5A 2ZRSA 5I2LA 3EKHA 2ISDA 3TUYB 2LUCA 4DUQA 3WXAA 1TRFA 5HLOA 1IWQA 3TZ1A 1JBAA 1QIVA 1RK9A 1SR6B 2GV5A 3BUOB 1S6JA 4I5KA 4OR9B 4WQ3A 4YBHB 1FW4A 5DKRA 4QJ5B 4P2YB 1AJ4A 1GQMA 3NSLA 4CFQA 1N2DA 1F54A 2PVBA 2BL0C 3BOWA 3VRPA 3F45A 1DJXA 1L2OB 1S1EA 4MVFA 1OZOA 2NXQA 4PALA 2KQ6A 1K93D 2JNXA 1QX5B 4CIDA 2F2PA 1QX2A 1B8RA 2MAZA 2LAPA 4OV2A 2GGMA 1SKTA 3I5GC 5HKWA 2LLUA 1JWDA 2JWWA 3BUNB 3JTDB 1A75B 5I2QA 2JRFA 4JWQA 1NUBA 4R1EA 1ALVA 2K0JA 1LXFC 4YGDB 4XYNA 1K9UA 1B7TZ 2OTGC 2WCFA 1CNPA 3I5HC 1LVCD 2OS8C 1K94A 3LK0A 3CR5X 1XFXO 1M63B 3C1VA 2PRUA 5FYXA 4D1EA 2F3ZA 2JU0A 1PVAA 1AUIB 2K7OA 2KQYA 3EK8A 4UPGA 1JSAA 1IGVA 3OX5A 3BUMB 1K96A 5CSJA 2MLFC 2K7DA 2ZNEA 1QV0A 3BOWB 2KGBC 1NX3A 2M7NA 2PSRA 4MRXA 4MBEA 2PASA 1DJGA 2LUXA 3CS1A 1ALWA 2KFHA 1NX1A 1SL7A 1U5IA 4GAOA 1V1FA 4ORCB 3FS7A 2B1UA 1HQVA 4I5JA 1RROA 1CMFA 4I5LB 1CLMA 4MEWA 2KOTA 1BT6A 1EJ3A 3IQQA 1YRTB 4BY4A 1RECA 1W7JB 4WRIA 3VRNA 1KQMC 3O6BA 3OX6A 1F70A 3TDIA 1XFWO 1NIWA 1SYMA 3TDUA 1ODBA 3LK1A 1PRWA 4DS7A 3LL8B 1DVIA 4AOMA 1J7QA 1SL8A 3PSRA 3QRXA 4GGFC 3EK7A 2TN4A 2LHLA 1CDPA 1W7IB 3DVMA 1R6PA 1JC2A 2LP3A 3CR4X 2LC5A 1TOPA 1MUXA 3CTNA 4DRWA 1BU3A 1DJWA 1NCZA 1GJYA 2MRDA 3NSIA 1JF0A 1NX2A 1S36A 4PHMA 1DT7B 3PM8A 2EC6C 1QV1A 2I18A 4PHKA 1S5GY 1UUSA 1BMOA 3GK1A 1QJTA 2M9GA 3A4UB 2BBNA 1MQ1A 1VRKA 3EKJA 4ZCUA 1EG4A 2LLTA 1KQVA 1ZUZA 1SCMC 4N1FA 2L0PA 4PCWA 4NQGA 4DCKA 1CFFA 2ZNDA 2F33A 1OOJA 2P6BB 4FQOA 4HREE 4CLNA 5I2OA 4PE4A 2ZFDA 4QJ3B 3TDZA 5CSIA 1CDMA 3DD4A 3TUYC 1PK0D 1CFCA 3DVEA 2FOTA 2OPOA 1N0YA 2H2KA 1KSMA 2KAXA 1PALA 4YGAA 1S3PA 2M29A 5HKYA 1L7ZA 2ZN8A 3O2PA 2KSPA 2L51A 4USLA 1D1OA 3PN7C 3SG6A 4ICBA 1TNPA 1E8AA 1TCOB 1KK7Z 5GQQC 4A4CA 1L2OC 2FCEA 1CLLA 1LINA 2SASA 3KO0A 3PFVA 1C7WA 2O5GA 1IQ5A 2Y4QA 2GGZA 3I5FB 1UHKA 2WNDA 1J7RA 1G4YR 2JULA 2KFGA 3AKAA 5CSFA 1QIWA 4GBAA 2H61A 1XK4A 2WORA 3JTDC 4U8DA 1F71A 2K7BA 2L4HA 1B8CA 3CZTX 1ZACA 5JOLA 1J7PA 1BJFA 1B4CA 5KSZA 2K2FA 3BUWB 1UHHA 2WC8A 2LVVA 3DF0B 2V53A 1MXEA 1IH0A 3LCPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F8P A;  1K95 A;  1KFU L;  1XFY O;  1XFU O;  2LLS A;  1BLQ A;  1TNQ A;  4MLW A;  4XJK A;  1OE9 B;  2BCB A;  3SIB A;  3EVR A;  4NDD A;  2MHH A;  1OMV A;  4I5N B;  1K90 D;  2I2R E;  1B9A A;  2G2B A;  1DTL A;  2K61 A;  2NCP A;  1WRZ A;  3K21 A;  2NCO A;  1NYA A;  1BOC A;  4M2Q A;  2LP2 A;  1FI5 A;  4CPV A;  1ZFS A;  1WDC C;  1XVJ A;  4ZCV A;  2O60 A;  3D10 A;  3VGO A;  1CB1 A;  2K2A A;  1TIZ A;  1XFZ O;  4YGE B;  3BQ3 A;  3BYA A;  1B7T Y;  1NCX A;  1PSR A;  3M0W A;  4YI8 A;  4GFT A;  1CTR A;  3FIA A;  1TN4 A;  2MBX A;  2BBM A;  3OB2 B;  3CGA A;  1B8L A;  1NWD A;  1YVH A;  2L5X B;  4XJK B;  1SW8 A;  5J3X A;  2KBM A;  4L9M A;  1KFX L;  1Q80 A;  1IQ3 A;  1UHJ A;  3TS5 B;  2PAL A;  2L2E A;  5DKQ A;  2Y1M A;  5HKZ A;  5TNC A;  3PAL A;  2KYF A;  1IG5 A;  1H4B A;  1KWO B;  1QVI Y;  3DVK A;  4MRY A;  1OMD A;  1XYD A;  2HQ8 A;  3D0Y A;  2L4I A;  2KI4 B;  3VRR A;  1OZS A;  2MLE C;  5PAL A;  1G8I A;  1A4P A;  1NPQ A;  1F4Q A;  4ORA B;  3SJS A;  2EHB A;  1DF0 A;  2JTT A;  1GGW A;  1SBJ A;  2BCX A;  3DVJ A;  1M31 A;  1F8H A;  1QS7 A;  1M39 A;  4MZK A;  4YI9 A;  4IL1 A;  5KU1 A;  1PUL A;  5G08 A;  4M2O A;  1S26 D;  3I5H B;  5AER A;  1K9K A;  4OKH A;  3HX4 A;  2SCP A;  3KF9 A;  2LMT A;  1LKJ A;  1SK6 D;  1U5I B;  2NLN A;  2Q91 A;  2R2I A;  2QPT A;  4YRU A;  1CKK A;  2HPS A;  1NX0 A;  2E6W A;  1DJZ A;  1CLB A;  3GK2 A;  1LA3 A;  2LE9 B;  1DGU A;  1FPW A;  2EGD A;  2LHI A;  1CMG A;  5BPJ A;  4Q04 A;  3WHU B;  1M46 A;  2JT8 A;  2COL B;  3NSO A;  1KFU S;  4GGF A;  4PE1 A;  2NZ0 A;  1YX7 A;  1KK8 B;  1CDN A;  4HRG A;  5AAN A;  2M7L A;  3O78 A;  1WRK A;  2M0R A;  1AVS A;  1CFD A;  3KPX A;  4NDB A;  2CCM A;  3ZNI A;  2JXL A;  1YUT A;  2LVI A;  3I5F C;  1SCV A;  1XO5 A;  2LNK A;  3SG7 A;  1TNW A;  2M1U A;  3NXA A;  3SIA A;  3E3R A;  4MN0 A;  4ORB B;  3SG4 A;  3IF7 A;  2AMI A;  1V1G A;  4MSP A;  1SPY A;  2IS9 A;  2JC2 A;  4GPL B;  1S5G Z;  5DKN A;  1FBV A;  1YUU A;  3WHT B;  5K89 A;  2LMU A;  2M97 A;  3KEV A;  2JXC A;  5HLV A;  1SR6 C;  1R2U A;  4GGN A;  1Y6W A;  2LMV A;  4QJ4 B;  2MA2 A;  2LV7 A;  2M3W A;  5HYD A;  1AJ5 A;  1OMR A;  3JVT B;  1MR8 A;  4YGC B;  2CTN A;  1C7V A;  2CBL A;  1TNX A;  1IJ5 A;  4F0Z B;  3SG5 A;  1YUS A;  2KBI A;  3EVU A;  4OVN F;  1YTZ C;  2FCD A;  1YR5 A;  1KFX S;  3CWG A;  1UWO A;  1CDL A;  1QLK A;  1SNL A;  1Y1X A;  1F4O A;  2JTZ A;  2BEC A;  3FWC A;  2LAN A;  4HSZ A;  1JUO A;  2QAC A;  1QLS A;  1ZMZ A;  2ZKM X;  3I5I B;  1OQP A;  1UHI A;  3RM1 A;  1DJY A;  2DOQ A;  2HET A;  5AXI A;  3PAT A;  1DJH A;  1Y1A A;  2E30 A;  1J7O A;  1MF8 B;  1MWN A;  1C07 A;  3VRO A;  4HRH A;  1SCM B;  5F6T A;  1EG3 A;  2JNF A;  1A75 A;  2KFF A;  1KCY A;  2F2O A;  1QTX A;  4C0J A;  1S6I A;  1MXL C;  3BUX B;  2KYC A;  1SL9 A;  3FWB A;  1OSA A;  1YUR A;  3LLE A;  3CLN A;  2BKH B;  1YVL A;  1BG1 A;  2LVK A;  2M1K B;  3AAK A;  2JOJ A;  2WCE A;  1WLM A;  3OHM B;  5D69 A;  1NSH A;  1N65 A;  2JQ6 A;  3TS5 C;  3A8R A;  1CM4 A;  3PN7 B;  4M2P A;  4AQJ A;  1KWO C;  1CM1 A;  3NSK A;  2L50 A;  3RLZ A;  1Y0V H;  3VRQ A;  1DMO A;  4PHJ A;  1XA5 A;  2KI4 C;  2KAY A;  3AKB A;  2JPT A;  3IQO A;  1YRU B;  1RFJ A;  5D7F A;  1EL4 A;  2A4J A;  1SY9 A;  2Q4U A;  2M8U A;  4PDZ A;  5AFP A;  1PSB A;  1EXR A;  4WQ2 A;  1K9P A;  1A29 A;  2K7C A;  1PVB A;  4N1G A;  1UHN A;  3H4S E;  1H8B A;  1F55 A;  2BKI B;  2WOS A;  1NP8 A;  2CT9 A;  2G9B A;  2BL0 B;  3ZWH A;  1XFV O;  1WY9 A;  2HQW A;  1TTX A;  2AUC A;  2FJU B;  3EVV A;  1MHO A;  2I7A A;  2JT3 A;  4MZJ A;  1QX7 A;  1KK8 C;  4PE7 A;  2LVJ A;  3I5G B;  4YGB B;  1S6C A;  1QAS A;  4FTG A;  1A2X A;  1QVI Z;  2KI6 D;  4JPZ B;  4TNC A;  3OB1 B;  2PMY A;  2I94 A;  2OTG B;  1WDC B;  1JF2 A;  2JT0 A;  2OS8 B;  4NDC A;  1Y1U A;  2K8M B;  1UP5 A;  1UUR A;  2WCB A;  4OCI A;  2KGR A;  2LCP A;  3MSE B;  5ER4 X;  1RJV A;  2AAO A;  1CFP A;  1M45 A;  5I8N A;  1WLZ A;  2Y5I A;  2VRG A;  3ICB A;  3JVT C;  3HCM A;  2ZRT A;  1IJ6 A;  3D0Y B;  5KTY A;  2HF5 A;  2Y1N A;  4MZL A;  2CNP A;  2KHN A;  4PE0 A;  2ZN9 A;  2L98 A;  1BF5 A;  1B1G A;  1DF0 B;  2D8N A;  3OP0 A;  1AK8 A;  1SRA A;  1IRJ A;  4C0L A;  1BOD A;  3SG2 A;  1J55 A;  4A4B A;  3EK4 A;  1FI6 A;  4P5O E;  1DGV A;  4JQ0 D;  3I5I C;  2KNE A;  3PLF B;  1QXP A;  4ETO A;  1KQM B;  1BR4 B;  2KDH A;  1DJI A;  2M49 B;  2BE4 A;  1EH2 A;  3KHE A;  1J1E A;  3GOF A;  5B8I B;  1RTP 1;  1QAT A;  1IKU A;  3CR2 A;  1K2H A;  5AEQ A;  2F3Y A;  5IBW A;  4N5X A;  4GUK A;  1AHR A;  2BCA A;  2JZI A;  1KK7 Y;  3SG3 A;  3BXK A;  4PHN A;  2CXJ A;  1GGZ A;  2KI6 C;  2RGI A;  5JJG A;  3GK4 X;  3DF0 A;  5CSN A;  4C0K A;  2MJW B;  1KSO A;  1SMG A;  3WNX B;  2H61 C;  1XK4 C;  5CPV A;  4CFR A;  1X02 A;  1RWY A;  2BE6 A;  2EC6 B;  1ZOT B;  1JFK A;  1WRL A;  1B47 A;  1FF1 A;  1K8U A;  4DIR A;  1BR1 B;  1TCF A;  1HT9 A;  3O4Y A;  1JFJ A;  2LM5 A;  1LA0 A;  1G33 A;  1A03 A;  1AP4 A;  3AAJ A;  1YX8 A;  4GNK B;  4AQI A;  4E68 A;  1NCY A;  1J1D A;  2KAV A;  4BY5 A;  5ER5 A;  2ZRS A;  5I2L A;  3EKH A;  2ISD A;  3TUY B;  2LUC A;  4DUQ A;  3WXA A;  1TRF A;  5HLO A;  1IWQ A;  3TZ1 A;  1JBA A;  1QIV A;  1RK9 A;  1SR6 B;  2GV5 A;  3BUO B;  1S6J A;  4I5K A;  4OR9 B;  4WQ3 A;  4YBH B;  1FW4 A;  5DKR A;  4QJ5 B;  4P2Y B;  1AJ4 A;  1GQM A;  3NSL A;  4CFQ A;  1N2D A;  1F54 A;  2PVB A;  2BL0 C;  3BOW A;  3VRP A;  3F45 A;  1DJX A;  1L2O B;  1S1E A;  4MVF A;  1OZO A;  2NXQ A;  4PAL A;  2KQ6 A;  1K93 D;  2JNX A;  1QX5 B;  4CID A;  2F2P A;  1QX2 A;  1B8R A;  2MAZ A;  2LAP A;  4OV2 A;  2GGM A;  1SKT A;  3I5G C;  5HKW A;  2LLU A;  1JWD A;  2JWW A;  3BUN B;  3JTD B;  1A75 B;  5I2Q A;  2JRF A;  4JWQ A;  1NUB A;  4R1E A;  1ALV A;  2K0J A;  1LXF C;  4YGD B;  4XYN A;  1K9U A;  1B7T Z;  2OTG C;  2WCF A;  1CNP A;  3I5H C;  1LVC D;  2OS8 C;  1K94 A;  3LK0 A;  3CR5 X;  1XFX O;  1M63 B;  3C1V A;  2PRU A;  5FYX A;  4D1E A;  2F3Z A;  2JU0 A;  1PVA A;  1AUI B;  2K7O A;  2KQY A;  3EK8 A;  4UPG A;  1JSA A;  1IGV A;  3OX5 A;  3BUM B;  1K96 A;  5CSJ A;  2MLF C;  2K7D A;  2ZNE A;  1QV0 A;  3BOW B;  2KGB C;  1NX3 A;  2M7N A;  2PSR A;  4MRX A;  4MBE A;  2PAS A;  1DJG A;  2LUX A;  3CS1 A;  1ALW A;  2KFH A;  1NX1 A;  1SL7 A;  1U5I A;  4GAO A;  1V1F A;  4ORC B;  3FS7 A;  2B1U A;  1HQV A;  4I5J A;  1RRO A;  1CMF A;  4I5L B;  1CLM A;  4MEW A;  2KOT A;  1BT6 A;  1EJ3 A;  3IQQ A;  1YRT B;  4BY4 A;  1REC A;  1W7J B;  4WRI A;  3VRN A;  1KQM C;  3O6B A;  3OX6 A;  1F70 A;  3TDI A;  1XFW O;  1NIW A;  1SYM A;  3TDU A;  1ODB A;  3LK1 A;  1PRW A;  4DS7 A;  3LL8 B;  1DVI A;  4AOM A;  1J7Q A;  1SL8 A;  3PSR A;  3QRX A;  4GGF C;  3EK7 A;  2TN4 A;  2LHL A;  1CDP A;  1W7I B;  3DVM A;  1R6P A;  1JC2 A;  2LP3 A;  3CR4 X;  2LC5 A;  1TOP A;  1MUX A;  3CTN A;  4DRW A;  1BU3 A;  1DJW A;  1NCZ A;  1GJY A;  2MRD A;  3NSI A;  1JF0 A;  1NX2 A;  1S36 A;  4PHM A;  1DT7 B;  3PM8 A;  2EC6 C;  1QV1 A;  2I18 A;  4PHK A;  1S5G Y;  1UUS A;  1BMO A;  3GK1 A;  1QJT A;  2M9G A;  3A4U B;  2BBN A;  1MQ1 A;  1VRK A;  3EKJ A;  4ZCU A;  1EG4 A;  2LLT A;  1KQV A;  1ZUZ A;  1SCM C;  4N1F A;  2L0P A;  4PCW A;  4NQG A;  4DCK A;  1CFF A;  2ZND A;  2F33 A;  1OOJ A;  2P6B B;  4FQO A;  4HRE E;  4CLN A;  5I2O A;  4PE4 A;  2ZFD A;  4QJ3 B;  3TDZ A;  5CSI A;  1CDM A;  3DD4 A;  3TUY C;  1PK0 D;  1CFC A;  3DVE A;  2FOT A;  2OPO A;  1N0Y A;  2H2K A;  1KSM A;  2KAX A;  1PAL A;  4YGA A;  1S3P A;  2M29 A;  5HKY A;  1L7Z A;  2ZN8 A;  3O2P A;  2KSP A;  2L51 A;  4USL A;  1D1O A;  3PN7 C;  3SG6 A;  4ICB A;  1TNP A;  1E8A A;  1TCO B;  1KK7 Z;  5GQQ C;  4A4C A;  1L2O C;  2FCE A;  1CLL A;  1LIN A;  2SAS A;  3KO0 A;  3PFV A;  1C7W A;  2O5G A;  1IQ5 A;  2Y4Q A;  2GGZ A;  3I5F B;  1UHK A;  2WND A;  1J7R A;  1G4Y R;  2JUL A;  2KFG A;  3AKA A;  5CSF A;  1QIW A;  4GBA A;  2H61 A;  1XK4 A;  2WOR A;  3JTD C;  4U8D A;  1F71 A;  2K7B A;  2L4H A;  1B8C A;  3CZT X;  1ZAC A;  5JOL A;  1J7P A;  1BJF A;  1B4C A;  5KSZ A;  2K2F A;  3BUW B;  1UHH A;  2WC8 A;  2LVV A;  3DF0 B;  2V53 A;  1MXE A;  1IH0 A;  3LCP C; 
#chains in the Genus database with same CATH topology
 2F8P A;  1K95 A;  1KFU L;  1XFY O;  1XFU O;  2LLS A;  2KLD A;  1BLQ A;  1TNQ A;  4MLW A;  4XJK A;  1OE9 B;  2BCB A;  2WC6 A;  3SIB A;  3EVR A;  4NDD A;  2MHH A;  1OMV A;  4I5N B;  1K90 D;  2I2R E;  1B9A A;  2G2B A;  1DTL A;  2K61 A;  2NCP A;  1WRZ A;  3K21 A;  2NCO A;  1NYA A;  1BOC A;  4M2Q A;  2LP2 A;  1FI5 A;  4CPV A;  1ZFS A;  1WDC C;  1XVJ A;  4ZCV A;  2O60 A;  3D10 A;  3VGO A;  1CB1 A;  2BNX A;  2K2A A;  1TIZ A;  1XFZ O;  4YGE B;  3BQ3 A;  3BYA A;  1B7T Y;  1NCX A;  1PSR A;  3M0W A;  4KYN A;  4YI8 A;  5FI6 A;  4GFT A;  1CTR A;  2L5Y A;  1OW4 A;  3FIA A;  1TN4 A;  2MBX A;  2BBM A;  3NHT A;  4OZD A;  3OB2 B;  3CGA A;  1B8L A;  1NWD A;  1YVH A;  3B7A A;  2L5X B;  1IH0 A;  4XJK B;  1SW8 A;  5J3X A;  2KBM A;  4L9M A;  3D76 A;  1KFX L;  3NHI A;  1Q80 A;  1IQ3 A;  1UHJ A;  3TS5 B;  2PAL A;  2L2E A;  5DKQ A;  1P28 A;  2Y1M A;  5HKZ A;  5TNC A;  3PAL A;  2KYF A;  1IG5 A;  1H4B A;  1KWO B;  1QVI Y;  2ERB A;  3DVK A;  4MRY A;  1GM0 A;  1LS8 A;  1OMD A;  1XYD A;  2HQ8 A;  3D0Y A;  2L4I A;  2KI4 B;  3VRR A;  1OZS A;  2MLE C;  5PAL A;  1G8I A;  1A4P A;  1NPQ A;  1F4Q A;  4ORA B;  3SJS A;  2EHB A;  3UO9 A;  1DF0 A;  2JTT A;  1GGW A;  1SBJ A;  2BCX A;  3DVJ A;  1M31 A;  1F8H A;  1QS7 A;  2QDI A;  3SS4 A;  3R1V A;  1M39 A;  4MZK A;  4YI9 A;  4IL1 A;  5KU1 A;  1PUL A;  5G08 A;  4M2O A;  1S26 D;  3FE8 A;  3I5H B;  5AER A;  1K9K A;  4OKH A;  3HX4 A;  2SCP A;  3KF9 A;  2LMT A;  1LKJ A;  1SK6 D;  1U5I B;  2NLN A;  2Q91 A;  2R2I A;  2QPT A;  4YRU A;  1CKK A;  2HPS A;  1NX0 A;  2E6W A;  1DJZ A;  1CLB A;  3GK2 A;  1LA3 A;  2LE9 B;  1DGU A;  3Q8I A;  1FPW A;  2L2C A;  2EGD A;  2LHI A;  1CMG A;  5BPJ A;  4Q04 A;  3WHU B;  1M46 A;  2JT8 A;  2COL B;  3NSO A;  1KFU S;  4INX A;  4GGF A;  4PE1 A;  2NZ0 A;  1YX7 A;  1KK8 B;  1CDN A;  4HRG A;  5AAN A;  2M7L A;  3O78 A;  1WRK A;  2M0R A;  1AVS A;  1CFD A;  3KPX A;  4NDB A;  2CCM A;  3S0E A;  2JXL A;  1YUT A;  2LVI A;  3I5F C;  1SCV A;  1XO5 A;  2LNK A;  3SG7 A;  1TNW A;  1TWO A;  2M1U A;  3NXA A;  3SIA A;  3E3R A;  4MN0 A;  5EL2 A;  4ORB B;  3SG4 A;  3IF7 A;  2AMI A;  1V1G A;  4MSP A;  1SPY A;  2IS9 A;  2JC2 A;  4GPL B;  1S5G Z;  5DKN A;  1FBV A;  1YUU A;  3V2L A;  3WHT B;  1DEL A;  5K89 A;  2LMU A;  2M97 A;  3KEV A;  2JXC A;  5HLV A;  1SR6 C;  1R2U A;  2QEO A;  4GGN A;  1Y6W A;  1DQE A;  2LMV A;  4QJ4 B;  2MA2 A;  2LV7 A;  2M3W A;  2PYQ A;  5HYD A;  1AJ5 A;  1OMR A;  3JVT B;  1MR8 A;  4YGC B;  2CTN A;  1C7V A;  2CBL A;  1TNX A;  1IJ5 A;  4F0Z B;  3SG5 A;  1YUS A;  2KBI A;  3EVU A;  4OVN F;  1YTZ C;  2FCD A;  3S0G A;  1YR5 A;  1KFX S;  3CWG A;  1UWO A;  1CDL A;  1QLK A;  1ORG A;  1SNL A;  1Y1X A;  1F4O A;  2JTZ A;  2BEC A;  3FWC A;  2LAN A;  4HSZ A;  1JUO A;  2QAC A;  1QLS A;  1ZMZ A;  2ZKM X;  3I5I B;  1OQP A;  1UHI A;  3RM1 A;  1DJY A;  2DOQ A;  2HET A;  5AXI A;  3PAT A;  1DJH A;  1Y1A A;  2E30 A;  1J7O A;  1MF8 B;  1MWN A;  1C07 A;  3NGV A;  3VRO A;  4HRH A;  4INW A;  2QEH A;  1SCM B;  5F6T A;  1EG3 A;  2JNF A;  1A75 A;  2KFF A;  1KCY A;  2F2O A;  5I94 A;  1QTX A;  4C0J A;  1S6I A;  1MXL C;  3BUX B;  2KYC A;  1IIO A;  1SL9 A;  3FWB A;  1OSA A;  1YUR A;  3LLE A;  3CLN A;  2BKH B;  1YVL A;  3D77 A;  1BG1 A;  2LVK A;  2M1K B;  3AAK A;  2JOJ A;  2WCE A;  1WLM A;  3B86 A;  3OHM B;  3CDN A;  5D69 A;  1NSH A;  1N65 A;  2JQ6 A;  3TS5 C;  3A8R A;  1CM4 A;  3RZS A;  3PN7 B;  3CZ2 A;  4M2P A;  3SS3 A;  4AQJ A;  1KWO C;  1CM1 A;  3NSK A;  3BFB A;  2L50 A;  3RLZ A;  1Y0V H;  3VRQ A;  1DMO A;  4PHJ A;  1XA5 A;  2KI4 C;  2KAY A;  3AKB A;  3VB1 A;  2JPT A;  3IQO A;  3DXL A;  3L4A A;  1YRU B;  1RFJ A;  5D7F A;  1EL4 A;  2A4J A;  2PQL A;  1SY9 A;  2Q4U A;  2M8U A;  4PDZ A;  5AFP A;  3DYE A;  1PSB A;  1C3Y A;  1EXR A;  4WQ2 A;  1K9P A;  1A29 A;  2K7C A;  1PVB A;  4N1G A;  1UHN A;  3B6X A;  3H4S E;  1H8B A;  3BFH A;  4PT1 A;  2BKI B;  2WOS A;  3D73 A;  1F55 A;  1NP8 A;  2CT9 A;  2G9B A;  4JD9 A;  2BL0 B;  3ZWH A;  1XFV O;  1WY9 A;  2HQW A;  1TTX A;  2AUC A;  2FJU B;  3EVV A;  1MHO A;  2I7A A;  2JT3 A;  4MZJ A;  1QX7 A;  1KK8 C;  2KLE A;  4PE7 A;  2LVJ A;  3I5G B;  4YGB B;  1S6C A;  1QAS A;  4FTG A;  1A2X A;  3S0A A;  1QVI Z;  2KI6 D;  4JPZ B;  4TNC A;  3OB1 B;  1DEK A;  2PMY A;  2I94 A;  2OTG B;  1WDC B;  1JF2 A;  2JT0 A;  2OS8 B;  4NDC A;  1Y1U A;  2K8M B;  1UP5 A;  1UUR A;  2WCB A;  4OCI A;  2KGR A;  2LCP A;  3MSE B;  5ER4 X;  1RJV A;  2AAO A;  1CFP A;  1M45 A;  5I8N A;  3CZ1 A;  3R1P A;  1WLZ A;  2Y5I A;  2VRG A;  3ICB A;  3JVT C;  3HCM A;  2ZRT A;  1IJ6 A;  3D0Y B;  5KTY A;  2KPH A;  2HF5 A;  2Y1N A;  4MZL A;  2CNP A;  2KHN A;  4PE0 A;  2ZN9 A;  2L98 A;  1BF5 A;  1XFR A;  3DY9 A;  3S0B A;  1B1G A;  1DF0 B;  2D8N A;  3OP0 A;  1AK8 A;  1SRA A;  1IRJ A;  4C0L A;  1BOD A;  3SG2 A;  1J55 A;  4A4B A;  3EK4 A;  1FI6 A;  4P5O E;  1C3Z A;  1DGV A;  4JQ0 D;  3I5I C;  2KNE A;  2QEV A;  1QXP A;  3PLF B;  1KQM B;  4ETO A;  1BR4 B;  2KDH A;  1DJI A;  2M49 B;  2BE4 A;  1EH2 A;  3KHE A;  3L47 A;  1J1E A;  1Z2C B;  3GOF A;  5B8I B;  1RTP 1;  1QAT A;  1IKU A;  3CR2 A;  1K2H A;  5AEQ A;  2F3Y A;  5IBW A;  4N5X A;  4GUK A;  1AHR A;  2BCA A;  2JZI A;  1KK7 Y;  3QME A;  1TUZ A;  3SG3 A;  3O4X A;  3BXK A;  3ZNI A;  4PHN A;  2CXJ A;  1GGZ A;  2KI6 C;  2RGI A;  5JJG A;  3GK4 X;  3DF0 A;  5CSN A;  4C0K A;  2WCK A;  2MJW B;  1KSO A;  1SMG A;  3WNX B;  2H61 C;  1XK4 C;  5CPV A;  4CFR A;  1X02 A;  1RWY A;  2BE6 A;  2EC6 B;  1ZOT B;  1JFK A;  5D3O A;  1WRL A;  1B47 A;  1FF1 A;  1K8U A;  4DIR A;  1BR1 B;  1TCF A;  1HT9 A;  3O4Y A;  1JFJ A;  2LM5 A;  1LA0 A;  1G33 A;  1A03 A;  1AP4 A;  3AAJ A;  1YX8 A;  4GNK B;  4AQI A;  4E68 A;  2WCM A;  1NCY A;  1J1D A;  2KAV A;  4BY5 A;  1OOF A;  5ER5 A;  2ZRS A;  5I2L A;  3EKH A;  2ISD A;  3TUY B;  3S0F A;  2LUC A;  4DUQ A;  3WXA A;  1TRF A;  5HLO A;  1IWQ A;  2YGU A;  3TZ1 A;  1JBA A;  1QIV A;  3EG5 B;  1RK9 A;  1SR6 B;  2GV5 A;  3BUO B;  1S6J A;  4I5K A;  4OR9 B;  4WQ3 A;  4YBH B;  1FW4 A;  5DKR A;  2WCJ A;  4QJ5 B;  4P2Y B;  1AJ4 A;  1GQM A;  3NSL A;  4CFQ A;  1N2D A;  1F54 A;  2PVB A;  2BL0 C;  3CYZ A;  3BOW A;  3VRP A;  5DIC A;  3R1O A;  3F45 A;  3BJH A;  1DJX A;  1L2O B;  1S1E A;  4MVF A;  1OZO A;  2NXQ A;  4PAL A;  2KQ6 A;  1K93 D;  1TUJ A;  5FI2 A;  2JNX A;  1QX5 B;  4CID A;  2F2P A;  1QX2 A;  1B8R A;  2MAZ A;  2LAP A;  4OV2 A;  2GGM A;  1SKT A;  3I5G C;  5HKW A;  2LLU A;  1JWD A;  2JWW A;  3BUN B;  3JTD B;  1A75 B;  5I2Q A;  2JRF A;  4JWQ A;  1NUB A;  1Z4H A;  4R1E A;  1ALV A;  2K0J A;  1LXF C;  4YGD B;  2P71 A;  2WCL A;  4XYN A;  1SSE B;  1K9U A;  1B7T Z;  2OTG C;  2WCF A;  1CNP A;  3I5H C;  1LVC D;  1T14 A;  2OS8 C;  1K94 A;  3LK0 A;  3CR5 X;  1OOI X;  1XFX O;  1M63 B;  3C1V A;  2PRU A;  5FYX A;  4D1E A;  2F3Z A;  2JU0 A;  1PVA A;  1AUI B;  2K7O A;  3K1E A;  2KQY A;  3EK8 A;  4UPG A;  2K60 A;  3UNW A;  1IGV A;  1JSA A;  3OX5 A;  3BUM B;  1K96 A;  5CSJ A;  2MLF C;  2K7D A;  2ZNE A;  1QV0 A;  3BOW B;  5FI7 A;  2KGB C;  1NX3 A;  3IVT A;  1QWV A;  2M7N A;  2PSR A;  4MRX A;  4MBE A;  2PAS A;  1DJG A;  2LUX A;  3CS1 A;  3DZT A;  1ALW A;  2KFH A;  4JKT A;  1NX1 A;  1SL7 A;  1U5I A;  4GAO A;  1V1F A;  4ORC B;  2WC5 A;  3FS7 A;  2B1U A;  1HQV A;  3D78 A;  1RRO A;  4I5J A;  1CMF A;  4I5L B;  1W9Z A;  1DC1 A;  1CLM A;  3D75 A;  3D74 A;  4MEW A;  2KOT A;  1BT6 A;  1EJ3 A;  3B87 A;  1YRT B;  3IQQ A;  3N7H A;  4BY4 A;  1REC A;  1W7J B;  4WRI A;  3VRN A;  1KQM C;  3O6B A;  2QEB A;  3OX6 A;  4IJ7 A;  1F70 A;  3TDI A;  3BFA A;  1XFW O;  1NIW A;  1SYM A;  3TDU A;  1ODB A;  3B88 A;  3LK1 A;  1PRW A;  2JPO A;  4DS7 A;  3LL8 B;  1DVI A;  4AOM A;  1J7Q A;  1SL8 A;  3PSR A;  3QRX A;  2H8V A;  4GGF C;  3EK7 A;  4F7F A;  2TN4 A;  2LHL A;  1CDP A;  1W7I B;  3CAB A;  3DVM A;  1R6P A;  1JC2 A;  2LP3 A;  3CR4 X;  2LC5 A;  2P70 A;  1TOP A;  1MUX A;  3CTN A;  4DRW A;  1BU3 A;  3FE9 A;  1DJW A;  1NCZ A;  1GJY A;  2MRD A;  3NSI A;  1JF0 A;  1NX2 A;  1S36 A;  4PHM A;  3SS5 A;  1DT7 B;  3OBV A;  3PM8 A;  2EC6 C;  1QV1 A;  2I18 A;  4PHK A;  1S5G Y;  1UUS A;  1BMO A;  3GK1 A;  1QJT A;  2M9G A;  3A4U B;  4FQT A;  2BBN A;  1MQ1 A;  1VRK A;  3EKJ A;  4ZCU A;  1EG4 A;  2LLT A;  1OOG A;  1KQV A;  1ZUZ A;  1SCM C;  4N1F A;  2L0P A;  4PCW A;  2BAP A;  4NQG A;  4DCK A;  2ZND A;  2F33 A;  1CFF A;  1OOJ A;  2P6B B;  2FJY A;  4FQO A;  4HRE E;  4CLN A;  5I2O A;  4PE4 A;  2ZFD A;  4QJ3 B;  5HL1 A;  3TDZ A;  5CSI A;  1CDM A;  3DD4 A;  3TUY C;  1PK0 D;  1OOH A;  1CFC A;  3DVE A;  2FOT A;  2OPO A;  1N0Y A;  2H2K A;  1KSM A;  2KAX A;  1PAL A;  4YGA A;  1S3P A;  2M29 A;  5HKY A;  1L7Z A;  2ZN8 A;  3PM2 A;  2GTE A;  3O2P A;  2KSP A;  2L51 A;  4USL A;  1D1O A;  3PN7 C;  3SG6 A;  4ICB A;  1TNP A;  1E8A A;  2WCH A;  1TCO B;  1KK7 Z;  5GQQ C;  4A4C A;  3R72 A;  1L2O C;  3FE6 A;  2FCE A;  1CLL A;  1LIN A;  2SAS A;  3KO0 A;  3PFV A;  1C7W A;  2O5G A;  1IQ5 A;  2Y4Q A;  2GGZ A;  3I5F B;  3PJI A;  1UHK A;  2WND A;  1J7R A;  1G4Y R;  2JUL A;  2KFG A;  3AKA A;  5CSF A;  1QIW A;  3OGN A;  4GBA A;  2H61 A;  1XK4 A;  2WOR A;  3JTD C;  4U8D A;  1F71 A;  2K7B A;  2L4H A;  1B8C A;  3CZ0 A;  3CZT X;  1ZAC A;  5JOL A;  1J7P A;  1BJF A;  1B4C A;  5KSZ A;  3S0D A;  2K2F A;  3BUW B;  1UHH A;  2WC8 A;  2LVV A;  3DF0 B;  2V53 A;  1MXE A;  3L4L A;  3LCP C; 
#chains in the Genus database with same CATH homology
 2F8P A;  1K95 A;  1KFU L;  1XFY O;  1XFU O;  2LLS A;  1BLQ A;  1TNQ A;  4MLW A;  4XJK A;  1OE9 B;  2BCB A;  3SIB A;  3EVR A;  4NDD A;  2MHH A;  1OMV A;  4I5N B;  1K90 D;  2I2R E;  1B9A A;  2G2B A;  1DTL A;  2K61 A;  2NCP A;  1WRZ A;  3K21 A;  2NCO A;  1NYA A;  1BOC A;  4M2Q A;  2LP2 A;  1FI5 A;  4CPV A;  1ZFS A;  1WDC C;  1XVJ A;  4ZCV A;  2O60 A;  3D10 A;  3VGO A;  1CB1 A;  2K2A A;  1TIZ A;  1XFZ O;  4YGE B;  3BQ3 A;  3BYA A;  1B7T Y;  1NCX A;  1PSR A;  3M0W A;  4YI8 A;  4GFT A;  1CTR A;  3FIA A;  1TN4 A;  2MBX A;  2BBM A;  3OB2 B;  3CGA A;  1B8L A;  1NWD A;  1YVH A;  2L5X B;  4XJK B;  1SW8 A;  5J3X A;  2KBM A;  4L9M A;  1KFX L;  1Q80 A;  1IQ3 A;  1UHJ A;  3TS5 B;  2PAL A;  2L2E A;  5DKQ A;  2Y1M A;  5HKZ A;  5TNC A;  3PAL A;  2KYF A;  1IG5 A;  1H4B A;  1KWO B;  1QVI Y;  3DVK A;  4MRY A;  1OMD A;  1XYD A;  2HQ8 A;  3D0Y A;  2L4I A;  2KI4 B;  3VRR A;  1OZS A;  2MLE C;  5PAL A;  1G8I A;  1A4P A;  1NPQ A;  1F4Q A;  4ORA B;  3SJS A;  2EHB A;  1DF0 A;  2JTT A;  1GGW A;  1SBJ A;  2BCX A;  3DVJ A;  1M31 A;  1F8H A;  1QS7 A;  1M39 A;  4MZK A;  4YI9 A;  4IL1 A;  5KU1 A;  1PUL A;  5G08 A;  4M2O A;  1S26 D;  3I5H B;  5AER A;  1K9K A;  4OKH A;  3HX4 A;  2SCP A;  3KF9 A;  2LMT A;  1LKJ A;  1SK6 D;  1U5I B;  2NLN A;  2Q91 A;  2R2I A;  2QPT A;  4YRU A;  1CKK A;  2HPS A;  1NX0 A;  2E6W A;  1DJZ A;  1CLB A;  3GK2 A;  1LA3 A;  2LE9 B;  1DGU A;  1FPW A;  2EGD A;  2LHI A;  1CMG A;  5BPJ A;  4Q04 A;  3WHU B;  1M46 A;  2JT8 A;  2COL B;  3NSO A;  1KFU S;  4GGF A;  4PE1 A;  2NZ0 A;  1YX7 A;  1KK8 B;  1CDN A;  4HRG A;  5AAN A;  2M7L A;  3O78 A;  1WRK A;  2M0R A;  1AVS A;  1CFD A;  3KPX A;  4NDB A;  2CCM A;  3ZNI A;  2JXL A;  1YUT A;  2LVI A;  3I5F C;  1SCV A;  1XO5 A;  2LNK A;  3SG7 A;  1TNW A;  2M1U A;  3NXA A;  3SIA A;  3E3R A;  4MN0 A;  4ORB B;  3SG4 A;  3IF7 A;  2AMI A;  1V1G A;  4MSP A;  1SPY A;  2IS9 A;  2JC2 A;  4GPL B;  1S5G Z;  5DKN A;  1FBV A;  1YUU A;  3WHT B;  5K89 A;  2LMU A;  2M97 A;  3KEV A;  2JXC A;  5HLV A;  1SR6 C;  1R2U A;  4GGN A;  1Y6W A;  2LMV A;  4QJ4 B;  2MA2 A;  2LV7 A;  2M3W A;  5HYD A;  1AJ5 A;  1OMR A;  3JVT B;  1MR8 A;  4YGC B;  2CTN A;  1C7V A;  2CBL A;  1TNX A;  1IJ5 A;  4F0Z B;  3SG5 A;  1YUS A;  2KBI A;  3EVU A;  4OVN F;  1YTZ C;  2FCD A;  1YR5 A;  1KFX S;  3CWG A;  1UWO A;  1CDL A;  1QLK A;  1SNL A;  1Y1X A;  1F4O A;  2JTZ A;  2BEC A;  3FWC A;  2LAN A;  4HSZ A;  1JUO A;  2QAC A;  1QLS A;  1ZMZ A;  2ZKM X;  3I5I B;  1OQP A;  1UHI A;  3RM1 A;  1DJY A;  2DOQ A;  2HET A;  5AXI A;  3PAT A;  1DJH A;  1Y1A A;  2E30 A;  1J7O A;  1MF8 B;  1MWN A;  1C07 A;  3VRO A;  4HRH A;  1SCM B;  5F6T A;  1EG3 A;  2JNF A;  1A75 A;  2KFF A;  1KCY A;  2F2O A;  1QTX A;  4C0J A;  1S6I A;  1MXL C;  3BUX B;  2KYC A;  1SL9 A;  3FWB A;  1OSA A;  1YUR A;  3LLE A;  3CLN A;  2BKH B;  1YVL A;  1BG1 A;  2LVK A;  2M1K B;  3AAK A;  2JOJ A;  2WCE A;  1WLM A;  3OHM B;  5D69 A;  1NSH A;  1N65 A;  2JQ6 A;  3TS5 C;  3A8R A;  1CM4 A;  3PN7 B;  4M2P A;  4AQJ A;  1KWO C;  1CM1 A;  3NSK A;  2L50 A;  3RLZ A;  1Y0V H;  3VRQ A;  1DMO A;  4PHJ A;  1XA5 A;  2KI4 C;  2KAY A;  3AKB A;  2JPT A;  3IQO A;  1YRU B;  1RFJ A;  5D7F A;  1EL4 A;  2A4J A;  1SY9 A;  2Q4U A;  2M8U A;  4PDZ A;  5AFP A;  1PSB A;  1EXR A;  4WQ2 A;  1K9P A;  1A29 A;  2K7C A;  1PVB A;  4N1G A;  1UHN A;  3H4S E;  1H8B A;  1F55 A;  2BKI B;  2WOS A;  1NP8 A;  2CT9 A;  2G9B A;  2BL0 B;  3ZWH A;  1XFV O;  1WY9 A;  2HQW A;  1TTX A;  2AUC A;  2FJU B;  3EVV A;  1MHO A;  2I7A A;  2JT3 A;  4MZJ A;  1QX7 A;  1KK8 C;  4PE7 A;  2LVJ A;  3I5G B;  4YGB B;  1S6C A;  1QAS A;  4FTG A;  1A2X A;  1QVI Z;  2KI6 D;  4JPZ B;  4TNC A;  3OB1 B;  2PMY A;  2I94 A;  2OTG B;  1WDC B;  1JF2 A;  2JT0 A;  2OS8 B;  4NDC A;  1Y1U A;  2K8M B;  1UP5 A;  1UUR A;  2WCB A;  4OCI A;  2KGR A;  2LCP A;  3MSE B;  5ER4 X;  1RJV A;  2AAO A;  1CFP A;  1M45 A;  5I8N A;  1WLZ A;  2Y5I A;  2VRG A;  3ICB A;  3JVT C;  3HCM A;  2ZRT A;  1IJ6 A;  3D0Y B;  5KTY A;  2HF5 A;  2Y1N A;  4MZL A;  2CNP A;  2KHN A;  4PE0 A;  2ZN9 A;  2L98 A;  1BF5 A;  1B1G A;  1DF0 B;  2D8N A;  3OP0 A;  1AK8 A;  1SRA A;  1IRJ A;  4C0L A;  1BOD A;  3SG2 A;  1J55 A;  4A4B A;  3EK4 A;  1FI6 A;  4P5O E;  1DGV A;  4JQ0 D;  3I5I C;  2KNE A;  3PLF B;  1QXP A;  4ETO A;  1KQM B;  1BR4 B;  2KDH A;  1DJI A;  2M49 B;  2BE4 A;  1EH2 A;  3KHE A;  1J1E A;  3GOF A;  5B8I B;  1RTP 1;  1QAT A;  1IKU A;  3CR2 A;  1K2H A;  5AEQ A;  2F3Y A;  5IBW A;  4N5X A;  4GUK A;  1AHR A;  2BCA A;  2JZI A;  1KK7 Y;  3SG3 A;  3BXK A;  4PHN A;  2CXJ A;  1GGZ A;  2KI6 C;  2RGI A;  5JJG A;  3GK4 X;  3DF0 A;  5CSN A;  4C0K A;  2MJW B;  1KSO A;  1SMG A;  3WNX B;  2H61 C;  1XK4 C;  5CPV A;  4CFR A;  1X02 A;  1RWY A;  2BE6 A;  2EC6 B;  1ZOT B;  1JFK A;  1WRL A;  1B47 A;  1FF1 A;  1K8U A;  4DIR A;  1BR1 B;  1TCF A;  1HT9 A;  3O4Y A;  1JFJ A;  2LM5 A;  1LA0 A;  1G33 A;  1A03 A;  1AP4 A;  3AAJ A;  1YX8 A;  4GNK B;  4AQI A;  4E68 A;  1NCY A;  1J1D A;  2KAV A;  4BY5 A;  5ER5 A;  2ZRS A;  5I2L A;  3EKH A;  2ISD A;  3TUY B;  2LUC A;  4DUQ A;  3WXA A;  1TRF A;  5HLO A;  1IWQ A;  3TZ1 A;  1JBA A;  1QIV A;  1RK9 A;  1SR6 B;  2GV5 A;  3BUO B;  1S6J A;  4I5K A;  4OR9 B;  4WQ3 A;  4YBH B;  1FW4 A;  5DKR A;  4QJ5 B;  4P2Y B;  1AJ4 A;  1GQM A;  3NSL A;  4CFQ A;  1N2D A;  1F54 A;  2PVB A;  2BL0 C;  3BOW A;  3VRP A;  3F45 A;  1DJX A;  1L2O B;  1S1E A;  4MVF A;  1OZO A;  2NXQ A;  4PAL A;  2KQ6 A;  1K93 D;  2JNX A;  1QX5 B;  4CID A;  2F2P A;  1QX2 A;  1B8R A;  2MAZ A;  2LAP A;  4OV2 A;  2GGM A;  1SKT A;  3I5G C;  5HKW A;  2LLU A;  1JWD A;  2JWW A;  3BUN B;  3JTD B;  1A75 B;  5I2Q A;  2JRF A;  4JWQ A;  1NUB A;  4R1E A;  1ALV A;  2K0J A;  1LXF C;  4YGD B;  4XYN A;  1K9U A;  1B7T Z;  2OTG C;  2WCF A;  1CNP A;  3I5H C;  1LVC D;  2OS8 C;  1K94 A;  3LK0 A;  3CR5 X;  1XFX O;  1M63 B;  3C1V A;  2PRU A;  5FYX A;  4D1E A;  2F3Z A;  2JU0 A;  1PVA A;  1AUI B;  2K7O A;  2KQY A;  3EK8 A;  4UPG A;  1JSA A;  1IGV A;  3OX5 A;  3BUM B;  1K96 A;  5CSJ A;  2MLF C;  2K7D A;  2ZNE A;  1QV0 A;  3BOW B;  2KGB C;  1NX3 A;  2M7N A;  2PSR A;  4MRX A;  4MBE A;  2PAS A;  1DJG A;  2LUX A;  3CS1 A;  1ALW A;  2KFH A;  1NX1 A;  1SL7 A;  1U5I A;  4GAO A;  1V1F A;  4ORC B;  3FS7 A;  2B1U A;  1HQV A;  4I5J A;  1RRO A;  1CMF A;  4I5L B;  1CLM A;  4MEW A;  2KOT A;  1BT6 A;  1EJ3 A;  3IQQ A;  1YRT B;  4BY4 A;  1REC A;  1W7J B;  4WRI A;  3VRN A;  1KQM C;  3O6B A;  3OX6 A;  1F70 A;  3TDI A;  1XFW O;  1NIW A;  1SYM A;  3TDU A;  1ODB A;  3LK1 A;  1PRW A;  4DS7 A;  3LL8 B;  1DVI A;  4AOM A;  1J7Q A;  1SL8 A;  3PSR A;  3QRX A;  4GGF C;  3EK7 A;  2TN4 A;  2LHL A;  1CDP A;  1W7I B;  3DVM A;  1R6P A;  1JC2 A;  2LP3 A;  3CR4 X;  2LC5 A;  1TOP A;  1MUX A;  3CTN A;  4DRW A;  1BU3 A;  1DJW A;  1NCZ A;  1GJY A;  2MRD A;  3NSI A;  1JF0 A;  1NX2 A;  1S36 A;  4PHM A;  1DT7 B;  3PM8 A;  2EC6 C;  1QV1 A;  2I18 A;  4PHK A;  1S5G Y;  1UUS A;  1BMO A;  3GK1 A;  1QJT A;  2M9G A;  3A4U B;  2BBN A;  1MQ1 A;  1VRK A;  3EKJ A;  4ZCU A;  1EG4 A;  2LLT A;  1KQV A;  1ZUZ A;  1SCM C;  4N1F A;  2L0P A;  4PCW A;  4NQG A;  4DCK A;  1CFF A;  2ZND A;  2F33 A;  1OOJ A;  2P6B B;  4FQO A;  4HRE E;  4CLN A;  5I2O A;  4PE4 A;  2ZFD A;  4QJ3 B;  3TDZ A;  5CSI A;  1CDM A;  3DD4 A;  3TUY C;  1PK0 D;  1CFC A;  3DVE A;  2FOT A;  2OPO A;  1N0Y A;  2H2K A;  1KSM A;  2KAX A;  1PAL A;  4YGA A;  1S3P A;  2M29 A;  5HKY A;  1L7Z A;  2ZN8 A;  3O2P A;  2KSP A;  2L51 A;  4USL A;  1D1O A;  3PN7 C;  3SG6 A;  4ICB A;  1TNP A;  1E8A A;  1TCO B;  1KK7 Z;  5GQQ C;  4A4C A;  1L2O C;  2FCE A;  1CLL A;  1LIN A;  2SAS A;  3KO0 A;  3PFV A;  1C7W A;  2O5G A;  1IQ5 A;  2Y4Q A;  2GGZ A;  3I5F B;  1UHK A;  2WND A;  1J7R A;  1G4Y R;  2JUL A;  2KFG A;  3AKA A;  5CSF A;  1QIW A;  4GBA A;  2H61 A;  1XK4 A;  2WOR A;  3JTD C;  4U8D A;  1F71 A;  2K7B A;  2L4H A;  1B8C A;  3CZT X;  1ZAC A;  5JOL A;  1J7P A;  1BJF A;  1B4C A;  5KSZ A;  2K2F A;  3BUW B;  1UHH A;  2WC8 A;  2LVV A;  3DF0 B;  2V53 A;  1MXE A;  1IH0 A;  3LCP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...