4GGNA

Malaria invasion machinery protein complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
127
structure length
125
Chain Sequence
KDMFNTKSSKLRIEDASHNARKLGLAPSSTDEKKIRDLYGDSLTYEQYLEYLTMCVHDRDNMEELIKMFSHFDNNSSGFLTKNQMKNILTTWGDALTEQEANDALNAFSSEDRINYKLFCEDILS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Myosin A tail domain interacting protein MTIP
publication title The structure of the D3 domain of Plasmodium falciparum myosin tail interacting protein MTIP in complex with a nanobody.
pubmed doi rcsb
source organism Plasmodium knowlesi
total genus 38
structure length 125
sequence length 127
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ggnA02
4YGCB 3JVTB 1F54A 4N1FA 2MBXA 1UP5A 2I94A 3PALA 3WNXB 1KFUL 2KAXA 2QPTA 1DGUA 3DF0B 3AKAA 4DIRA 4PHMA 1Y1UA 1MWNA 4JPZB 3IF7A 1YR5A 2WCFA 1B4CA 3GOFA 1QVIY 2BBNA 1CLBA 2LVIA 5JOLA 4AQIA 1RWYA 1S6CA 1EJ3A 2K0JA 2Q91A 2BCXA 2HQWA 2WCEA 3KO0A 2JULA 1WDCB 4L9MA 1IKUA 3JTDC 1DMOA 3I5IB 1UWOA 2NXQA 1PVAA 1K95A 2LM5A 3BUNB 1TNXA 1IJ6A 1M31A 1G4YR 1PVBA 2L2EA 3DVMA 1B47A 1N0YA 4PE4A 3KF9A 1A03A 3CS1A 1CMGA 5HYDA 5KSZA 2HETA 1SCMB 4GBAA 2F2OA 2JNXA 3DF0A 4DS7A 4UPGA 1CLLA 4HSZA 4CPVA 3JVTC 4HRGA 1B9AA 4CLNA 2K7CA 2KBIA 4ETOA 1DGVA 3GK1A 3MSEB 2WOSA 4N1GA 1TNQA 1SL9A 2OTGB 2JTTA 2E6WA 1JF0A 1J7RA 1JFJA 4HRHA 1L7ZA 1MF8B 2ZNDA 1KSOA 2LVJA 1M46A 2D8NA 3SIBA 2F3YA 1CDLA 1RROA 1NP8A 1Y6WA 3ZWHA 1JSAA 3TUYC 4OVNF 1K93D 2HPSA 1M45A 2JTZA 3OB2B 1AP4A 2PSRA 1Q80A 1HT9A 1WDCC 2LCPA 1W7JB 1YURA 3I5IC 2JXLA 1XK4C 5FYXA 2L0PA 2HF5A 1G8IA 4D1EA 2K61A 1L2OB 1QIWA 5GQQC 1G33A 4PCWA 4N5XA 1E8AA 1TOPA 3BOWB 2H61A 2KYFA 2LMVA 2I2RE 2KQ6A 1CDMA 4R1EA 3WHUB 2R2IA 1ALVA 3EKJA 4I5JA 1UHJA 2JXCA 1A75B 2MLEC 5ER4X 1N65A 1F4QA 1NX0A 1NX2A 5HLOA 4OCIA 2HQ8A 1BLQA 2CCMA 5AEQA 3BQ3A 1UHHA 4DCKA 5ER5A 2KNEA 1EG4A 3PLFB 3VGOA 1UHKA 2JC2A 1RFJA 3AKBA 1QVIZ 3SJSA 1TNPA 5DKNA 1K9PA 1KFXS 5JJGA 1JBAA 1OMVA 2QACA 1MXLC 1YVLA 1UHNA 2KGRA 1S3PA 3NSOA 1YVHA 3H4SE 2V53A 4U8DA 2LC5A 3EK7A 2F3ZA 3WXAA 1DJIA 3JTDB 1A29A 2BECA 4GPLB 1MR8A 1OQPA 3BOWA 3NSIA 5AERA 5HKWA 3FS7A 1H8BA 2FJUB 3PSRA 2AMIA 2KYCA 2MRDA 1A75A 1MXEA 1F4OA 1NYAA 3BUMB 5AXIA 1TN4A 2L4IA 1AVSA 4I5NB 5PALA 4USLA 1NWDA 3TS5C 2BCAA 2IS9A 1CMFA 1KK7Z 1DJWA 1ZACA 5CSNA 3BUOB 2KI4C 2L4HA 2ZKMX 2FCEA 1SR6B 1KFUS 2LMUA 2M1KB 4CIDA 1K94A 2O5GA 3EVRA 4FTGA 1FPWA 2BBMA 5AFPA 2JT0A 1KQMC 1J55A 4PDZA 1J1EA 5D69A 1WRKA 4ZCUA 1CM1A 2M1UA 4I5LB 5I8NA 1BMOA 2LV7A 1JF2A 2K7OA 3OX5A 4MRXA 4P5OE 2Y4QA 3VROA 1LINA 2LHIA 2M7NA 2ZRTA 4XJKB 4IL1A 4M2OA 2KI6D 4YRUA 1F8HA 2KSPA 1RK9A 2BKIB 1YX8A 1QX5B 2DOQA 3EVUA 2M8UA 3TUYB 4MVFA 3FIAA 1IGVA 4ORCB 2M49B 1DT7B 1BG1A 2P6BB 1CFCA 1R6PA 2PRUA 4BY5A 1RJVA 3KHEA 1A4PA 1NPQA 1V1FA 2F2PA 2Y5IA 2ZFDA 1ZOTB 3BUXB 2I7AA 1CFDA 2KQYA 2EHBA 2TN4A 1QXPA 2LUCA 1GQMA 1AJ4A 1SK6D 1SKTA 2OS8B 2NCOA 5I2QA 1KQVA 1KWOB 2M29A 3BYAA 2H2KA 4GGNA 1F55A 1SR6C 2JQ6A 3IQQA 2KDHA 3GK2A 1J7OA 1SW8A 4YGAA 2JT3A 4MLWA 4XJKA 1GJYA 1C7VA 1SMGA 2JRFA 2LE9B 2ZNEA 3AAJA 4MSPA 3RLZA 1LVCD 3CR5X 1QS7A 1PSRA 2KFGA 3OX6A 4NDDA 1XYDA 1CNPA 1H4BA 3LK1A 3ICBA 4MEWA 1K8UA 2F33A 3CLNA 1DJHA 2JT8A 1QJTA 2L50A 1PK0D 3EK8A 1XK4A 3PN7B 2K7DA 2KOTA 1BR1B 1WRZA 4C0JA 3D0YB 5AANA 1LXFC 3A4UB 3IQOA 4FQOA 4PHKA 1IJ5A 3EKHA 2KFFA 4PHNA 2O60A 4CFRA 1W7IB 1R2UA 1XFUO 2BCBA 1IG5A 1OZOA 4JQ0D 3LL8B 1CTRA 2L5XB 4MN0A 2K2FA 3TS5B 1NIWA 2B1UA 3HX4A 1CKKA 2ZN9A 4YGDB 2KI4B 5J3XA 2OS8C 3F45A 3OHMB 3ZNIA 1FBVA 2LAPA 2SCPA 1KWOC 3C1VA 5HKZA 1Y1AA 1V1GA 1KQMB 3SG2A 2JWWA 2EGDA 2LHLA 3VRPA 1CFPA 1S1EA 3I5HB 5D7FA 1QLSA 1FW4A 1RECA 1UHIA 4F0ZB 2M9GA 1SL7A 2F8PA 1J7QA 2PASA 2LLTA 2M97A 3SG5A 5B8IB 3LCPC 3D0YA 4ORBB 4M2QA 2PMYA 2Q4UA 1XO5A 2L98A 2LVVA 2M7LA 3FWBA 1AUIB 3WHTB 1NSHA 4MZJA 1SL8A 1TCOB 1TRFA 1HQVA 4AOMA 3PN7C 2BE6A 3EVVA 1Y1XA 1UURA 2LUXA 1WRLA 1K9UA 1TIZA 2LANA 2KAYA 4GUKA 2BE4A 1SCVA 1TNWA 1JFKA 3NSKA 1FI5A 1DJXA 2LNKA 1S36A 2COLB 3PM8A 5K89A 1ODBA 5HLVA 2MA2A 4JWQA 3CZTX 4WQ3A 1J7PA 1AJ5A 1JWDA 2GGMA 1PSBA 2Y1NA 2BL0C 3M0WA 1KSMA 1BF5A 2KI6C 2KFHA 2LP2A 3EK4A 1MQ1A 1DVIA 2VRGA 1ZUZA 3NXAA 1NUBA 1BOCA 2CXJA 1KCYA 4OV2A 1IQ5A 2EC6C 2NLNA 3CR4X 3CWGA 1PULA 2JPTA 1S5GY 3CR2A 1B8LA 3SG3A 4YGEB 2LMTA 3I5HC 1IQ3A 4I5KA 2LLUA 5DKQA 1OZSA 2G2BA 1D1OA 4MZKA 4DUQA 1DTLA 3GK4X 1XFYO 1XFWO 3A8RA 5CSJA 1CFFA 3FWCA 2FOTA 2GV5A 4TNCA 2CNPA 4PHJA 3LK0A 4OKHA 2MJWB 4GFTA 5I2OA 2KGBC 3KPXA 4NQGA 1LA3A 1UUSA 3OB1B 1FF1A 1YRTB 2NZ0A 2WCBA 1QATA 2GGZA 3I5FC 5BPJA 2OPOA 4P2YB 2L51A 2G9BA 3AAKA 1GGZA 1JC2A 3TDUA 1WLMA 1CDPA 5IBWA 1CLMA 1SRAA 5KU1A 2JNFA 3I5GC 3TDIA 1SNLA 4QJ5B 1M63B 1XFVO 1K96A 3KEVA 2JOJA 1K90D 1M39A 3RM1A 1ZMZA 3CTNA 1AK8A 1YUSA 1BODA 1OOJA 1YTZC 2LP3A 4GNKB 1EXRA 1F71A 4PE0A 3NSLA 4HREE 4GGFA 5TNCA 1BR4B 4YI9A 1U5IB 1WY9A 3CGAA 1QX7A 3BXKA 3DD4A 5F6TA 1B7TY 1PALA 1YUTA 3LLEA 1DJZA 3O4YA 2MHHA 4GGFC 4C0KA 1XA5A 5CSIA 4QJ4B 1SYMA 3DVJA 2SASA 1KK7Y 5DKRA 1KK8C 1SY9A 2PVBA 2M0RA 4Q04A 1QTXA 1OMRA 1X02A 4A4CA 4PE1A 4OR9B 1DF0B 2AAOA 1QIVA 1QLKA 3DVEA 3BUWB 3SG6A 1GGWA 4ZCVA 3O2PA 4A4BA 1FI6A 3DVKA 5G08A 4M2PA 2BL0B 3QRXA 3PATA 2WC8A 2K2AA 5CPVA 1IH0A 4YGBB 1N2DA 1BU3A 1CB1A 1RTP1 5CSFA 1YX7A 4ORAB 1OMDA 4QJ3B 1BT6A 1SBJA 2ISDA 1U5IA 1IWQA 1EG3A 2CBLA 3K21A 4YI8A 1QX2A 3O78A 1OSAA 2EC6B 1XFXO 2AUCA 4WQ2A 1JUOA 4BY4A 2A4JA 2RGIA 2LLSA 2FCDA 2MAZA 1S5GZ 2JU0A 1DJYA 1YRUB 1NX3A 1TCFA 4DRWA 4AQJA 1ZFSA 1XVJA 4PALA 1AHRA 1DJGA 1NCYA 1ALWA 1F70A 3VRNA 5KTYA 1S6IA 1SCMC 2WNDA 1DF0A 1LA0A 4NDCA 1A2XA 4CFQA 1C7WA 1EH2A 1IRJA 2H61C 1B8RA 3I5FB 2ZN8A 1XFZO 2LVKA 1VRKA 4XYNA 3SG7A 2KBMA 1J1DA 2KAVA 3HCMA 1NX1A 1CDNA 1OE9B 1MHOA 4YBHB 2M3WA 2JZIA 1NCXA 3D10A 3I5GB 2OTGC 4PE7A 1C07A 1B8CA 4NDBA 1K2HA 2CT9A 1S26D 2PALA 2Y1MA 3VRRA 4C0LA 3VRQA 3TZ1A 2K8MB 3TDZA 2NCPA 4E68A 1KFXL 1SPYA 5I2LA 2KHNA 3SIAA 4GAOA 2CTNA 1QV1A 4MRYA 4MBEA 1K9KA 1BJFA 2WORA 1LKJA 1CM4A 3O6BA 3SG4A 1QASA 2BKHB 2ZRSA 1B7TZ 1PRWA 1L2OC 1YUUA 1Y0VH 3PFVA 2K7BA 1TTXA 3OP0A 2I18A 2E30A 4WRIA 4MZLA 1B1GA 1MUXA 1QV0A 1S6JA 1WLZA 2MLFC 4ICBA 5HKYA 3E3RA 1KK8B 1EL4A 1NCZA
chains in the Genus database with same CATH superfamily
2WCHA 4YGCB 3JVTB 1F54A 4N1FA 2MBXA 1UP5A 2I94A 3PALA 3WNXB 1KFUL 2KAXA 2QPTA 1DGUA 3DF0B 3S0FA 3AKAA 4DIRA 4PHMA 1Y1UA 1MWNA 4JPZB 3IF7A 1YR5A 2WCFA 1B4CA 3GOFA 1QVIY 2BBNA 1CLBA 2LVIA 3CABA 5JOLA 4AQIA 1RWYA 1S6CA 3B87A 3RZSA 1EJ3A 2K0JA 1OOGA 2KPHA 2Q91A 2BCXA 2HQWA 2WCEA 3KO0A 2JULA 1WDCB 4L9MA 1IKUA 3D75A 3JTDC 1DMOA 3I5IB 1UWOA 2NXQA 1PVAA 3D74A 1K95A 2LM5A 3BUNB 1TNXA 1IJ6A 1M31A 1G4YR 1PVBA 2L2EA 3DVMA 1B47A 1N0YA 3B88A 4PE4A 3KF9A 5FI6A 1A03A 2QEBA 3CS1A 2K60A 1CMGA 5HYDA 5KSZA 2HETA 1SCMB 1OOIX 4GBAA 2F2OA 2JNXA 3DF0A 4DS7A 4UPGA 1CLLA 4HSZA 1TUJA 4CPVA 3JVTC 4HRGA 3DXLA 1B9AA 4CLNA 2K7CA 2KBIA 4ETOA 1DGVA 3NGVA 3GK1A 3MSEB 2WOSA 4N1GA 1TNQA 1SL9A 2OTGB 2JTTA 2E6WA 1JF0A 1J7RA 3UO9A 1JFJA 4HRHA 1L7ZA 1MF8B 2ZNDA 1KSOA 2LVJA 1M46A 2D8NA 3CYZA 3SIBA 2F3YA 1CDLA 1RROA 1NP8A 1Y6WA 3DYEA 3ZWHA 1JSAA 3TUYC 4OVNF 1K93D 2HPSA 1M45A 3CDNA 2JTZA 3OB2B 1AP4A 2PSRA 3CZ2A 1Q80A 1HT9A 1WDCC 2LCPA 1W7JB 3FE6A 1YURA 3I5IC 1OOFA 2JXLA 1XK4C 3R1OA 5FYXA 4INWA 2L0PA 2HF5A 1G8IA 4D1EA 2K61A 1L2OB 1QIWA 2BNXA 5GQQC 1G33A 4PCWA 4N5XA 1E8AA 1TOPA 3BOWB 2H61A 3EG5B 2KYFA 2LMVA 2I2RE 2KQ6A 1CDMA 4R1EA 3WHUB 2R2IA 1ALVA 3EKJA 4I5JA 1UHJA 2JXCA 1A75B 2MLEC 5ER4X 4PT1A 1N65A 1F4QA 1NX0A 1NX2A 5HLOA 4OCIA 2HQ8A 1BLQA 2CCMA 3BFHA 5AEQA 3BQ3A 1UHHA 4DCKA 5ER5A 2KNEA 1EG4A 3PLFB 3VGOA 1UHKA 2JC2A 1RFJA 4OZDA 5DICA 3AKBA 1QVIZ 2L5YA 2WCMA 3SJSA 1TNPA 5DKNA 1K9PA 1KFXS 5JJGA 1JBAA 1OMVA 2QACA 1MXLC 3L4LA 1YVLA 1UHNA 2KGRA 1S3PA 3NSOA 1YVHA 3FE8A 2V53A 3H4SE 2LC5A 3EK7A 2F3ZA 4U8DA 1DJIA 3JTDB 3WXAA 1A29A 2BECA 3S0AA 1IIOA 4GPLB 1MR8A 1OQPA 3BOWA 3NSIA 5AERA 5HKWA 3FS7A 1H8BA 3OBVA 2FJUB 3PSRA 1W9ZA 2AMIA 3DZTA 5D3OA 2KYCA 2MRDA 1A75A 1MXEA 1F4OA 1NYAA 3BUMB 5AXIA 3S0DA 1QWVA 1TN4A 2L4IA 1AVSA 4I5NB 5PALA 4USLA 1NWDA 3TS5C 5FI2A 2BCAA 2IS9A 1CMFA 3S0EA 1KK7Z 1DJWA 1ZACA 5CSNA 3BUOB 2KI4C 2L4HA 2ZKMX 2ERBA 1SR6B 1KFUS 2FCEA 2LMUA 2M1KB 3V2LA 4CIDA 1K94A 2O5GA 3EVRA 4FTGA 1FPWA 2BBMA 5AFPA 2JT0A 1KQMC 1J55A 3D73A 1J1EA 4PDZA 1WRKA 5D69A 1CM1A 2M1UA 4I5LB 4ZCUA 5I8NA 1BMOA 2LV7A 2WCKA 1JF2A 2K7OA 3OX5A 4MRXA 4P5OE 3SS4A 2Y4QA 3BJHA 4F7FA 3VROA 1LINA 2LHIA 2M7NA 2ZRTA 4XJKB 4IL1A 4M2OA 2KI6D 4YRUA 1F8HA 2KSPA 1RK9A 2BKIB 1YX8A 1QX5B 2DOQA 3EVUA 5I94A 2M8UA 3TUYB 3BFAA 4MVFA 3FIAA 1IGVA 4ORCB 2M49B 1DT7B 1BG1A 2P6BB 1CFCA 1R6PA 2PRUA 4BY5A 3L47A 1RJVA 3KHEA 4IJ7A 1A4PA 1NPQA 1V1FA 2F2PA 2Y5IA 2ZFDA 1ZOTB 3BUXB 2I7AA 1CFDA 3D77A 2KQYA 2EHBA 2TN4A 1QXPA 1C3YA 2LUCA 3S0GA 1GQMA 1AJ4A 2JPOA 1SK6D 1SKTA 2OS8B 2NCOA 5I2QA 1KQVA 3K1EA 3VB1A 1KWOB 2FJYA 2M29A 3BYAA 2H2KA 4GGNA 3SS5A 1F55A 1SR6C 2JQ6A 3IQQA 2KDHA 3GK2A 1J7OA 1OW4A 1SW8A 4YGAA 2JT3A 4MLWA 4XJKA 1GJYA 1DELA 1OOHA 1C7VA 1SMGA 2JRFA 2LE9B 2ZNEA 3AAJA 4MSPA 3RLZA 1LVCD 3CR5X 1QS7A 1PSRA 2KFGA 3OX6A 4NDDA 1XYDA 1CNPA 1H4BA 3LK1A 3ICBA 4MEWA 1K8UA 2F33A 3CLNA 1DJHA 2JT8A 1QJTA 2L50A 1PK0D 3EK8A 1XK4A 3PN7B 2K7DA 2KOTA 1BR1B 1WRZA 4C0JA 3D0YB 5AANA 1LXFC 3A4UB 1GM0A 5HL1A 3IQOA 4FQOA 4PHKA 1IJ5A 3EKHA 2KFFA 2WCLA 4PHNA 2O60A 4CFRA 3CZ0A 1W7IB 1R2UA 1XFUO 2BCBA 1IG5A 1OZOA 4JQ0D 3LL8B 5FI7A 1CTRA 2L5XB 4MN0A 2K2FA 3TS5B 1NIWA 2B1UA 3HX4A 5EL2A 1CKKA 1P28A 2ZN9A 4YGDB 2KI4B 3IVTA 5J3XA 2OS8C 3F45A 3OHMB 3ZNIA 1FBVA 2LAPA 2SCPA 3R1PA 1KWOC 3C1VA 5HKZA 1Y1AA 1V1GA 2WC5A 2PYQA 1KQMB 3SG2A 2JWWA 2EGDA 2LHLA 3VRPA 3NHIA 1CFPA 1S1EA 3I5HB 5D7FA 1QLSA 1FW4A 1RECA 1UHIA 4F0ZB 2M9GA 1SL7A 2F8PA 3D76A 1J7QA 2PASA 1LS8A 2LLTA 2M97A 3SG5A 3LCPC 2H8VA 2KLEA 5B8IB 3D0YA 4ORBB 4M2QA 2PMYA 2Q4UA 1XO5A 2L98A 2LVVA 2M7LA 3FWBA 1AUIB 3WHTB 3O4XA 1NSHA 4MZJA 1SL8A 1TCOB 1TRFA 1HQVA 4AOMA 3PN7C 2BE6A 3B7AA 3EVVA 1Y1XA 1UURA 2LUXA 1WRLA 4JD9A 1K9UA 1TIZA 2LANA 2KAYA 4GUKA 2BE4A 1SCVA 1TNWA 1JFKA 3NSKA 1FI5A 1DJXA 2LNKA 1S36A 2COLB 3PM8A 5K89A 1ODBA 5HLVA 2MA2A 4JWQA 3CZTX 4WQ3A 1J7PA 1AJ5A 1JWDA 2GGMA 1PSBA 1TUZA 2Y1NA 2BL0C 3M0WA 1KSMA 1BF5A 2KI6C 2KFHA 2LP2A 3EK4A 1MQ1A 1DVIA 2VRGA 1ZUZA 3NXAA 1NUBA 1BOCA 4FQTA 2CXJA 1KCYA 4OV2A 1IQ5A 2EC6C 2NLNA 3CR4X 3QMEA 2P70A 1PULA 3CWGA 2L2CA 2JPTA 1S5GY 3CR2A 1B8LA 3SG3A 4YGEB 2LMTA 3I5HC 1IQ3A 1ORGA 4I5KA 2LLUA 4JKTA 5DKQA 1OZSA 2KLDA 2G2BA 1D1OA 4MZKA 4DUQA 1DTLA 3GK4X 1XFYO 1XFWO 3A8RA 5CSJA 1CFFA 3FWCA 1Z2CB 2FOTA 2GV5A 4TNCA 2QEVA 2CNPA 4PHJA 3LK0A 1DC1A 4OKHA 2MJWB 3N7HA 4GFTA 2KGBC 5I2OA 3KPXA 4NQGA 1LA3A 1UUSA 3OB1B 1FF1A 1YRTB 2NZ0A 2WCBA 1QATA 2GGZA 3I5FC 2GTEA 2OPOA 5BPJA 4P2YB 2L51A 2G9BA 3AAKA 1GGZA 1JC2A 3TDUA 1WLMA 1CDPA 5IBWA 1CLMA 1SRAA 5KU1A 2JNFA 3I5GC 3TDIA 1SNLA 4QJ5B 1M63B 1XFVO 1K96A 3B6XA 3KEVA 2JOJA 1K90D 1M39A 3RM1A 1ZMZA 3CTNA 1AK8A 1YUSA 4KYNA 2QDIA 1OOJA 1BODA 4INXA 1YTZC 2LP3A 4GNKB 1EXRA 1F71A 4PE0A 3NSLA 4HREE 4GGFA 5TNCA 1BR4B 4YI9A 1U5IB 1WY9A 3CGAA 1QX7A 3BXKA 3DD4A 3L4AA 5F6TA 1B7TY 1PALA 1YUTA 3LLEA 1DJZA 3O4YA 2MHHA 4GGFC 4C0KA 1XA5A 5CSIA 4QJ4B 1SYMA 3DVJA 2SASA 1KK7Y 5DKRA 3FE9A 1KK8C 1SSEB 1SY9A 2PVBA 2M0RA 4Q04A 1QTXA 1OMRA 1X02A 4A4CA 4PE1A 3OGNA 4OR9B 1DF0B 2AAOA 1QIVA 1QLKA 3DVEA 3BUWB 3SG6A 1GGWA 4ZCVA 3NHTA 1XFRA 3O2PA 4A4BA 1FI6A 3DVKA 2P71A 3CZ1A 5G08A 4M2PA 2BL0B 3QRXA 3PATA 2WC8A 2K2AA 1TWOA 5CPVA 3R1VA 4YGBB 1N2DA 1IH0A 1BU3A 1CB1A 1RTP1 5CSFA 1YX7A 4ORAB 1OMDA 4QJ3B 1BT6A 1SBJA 2QEHA 3D78A 2ISDA 1U5IA 1IWQA 1EG3A 2CBLA 3K21A 4YI8A 1QX2A 3O78A 2QEOA 1OSAA 2EC6B 1XFXO 2AUCA 4WQ2A 1JUOA 4BY4A 2A4JA 2RGIA 2LLSA 2FCDA 2MAZA 1S5GZ 2JU0A 1DJYA 3PM2A 2WCJA 1YRUB 1NX3A 1TCFA 4DRWA 4AQJA 1ZFSA 1XVJA 4PALA 1AHRA 1DJGA 1NCYA 1ALWA 3SS3A 1F70A 3VRNA 5KTYA 1S6IA 1SCMC 2WNDA 1DF0A 1LA0A 4NDCA 1A2XA 4CFQA 1C7WA 1EH2A 1IRJA 2H61C 1B8RA 3I5FB 2BAPA 3PJIA 2ZN8A 1XFZO 2LVKA 1VRKA 4XYNA 1DQEA 3R72A 2KBMA 1J1DA 3SG7A 2KAVA 3HCMA 1NX1A 1CDNA 1OE9B 1MHOA 4YBHB 2M3WA 2JZIA 1NCXA 3D10A 3I5GB 2OTGC 4PE7A 1C07A 1B8CA 4NDBA 1K2HA 2CT9A 3DY9A 3BFBA 1S26D 2PALA 2Y1MA 3VRRA 4C0LA 3VRQA 3TZ1A 2K8MB 3TDZA 2NCPA 1C3ZA 1KFXL 4E68A 1SPYA 5I2LA 2WC6A 2KHNA 3SIAA 4GAOA 2CTNA 1QV1A 4MRYA 4MBEA 1K9KA 1BJFA 2WORA 1LKJA 1CM4A 3B86A 3O6BA 3SG4A 1QASA 2BKHB 2PQLA 2ZRSA 1Z4HA 3Q8IA 3UNWA 2YGUA 1B7TZ 1PRWA 1L2OC 1YUUA 1Y0VH 3PFVA 2K7BA 3S0BA 1TTXA 3OP0A 2I18A 1T14A 2E30A 4WRIA 4MZLA 1B1GA 1MUXA 1DEKA 1QV0A 1S6JA 1WLZA 2MLFC 4ICBA 5HKYA 3E3RA 1KK8B 1EL4A 1NCZA
chains in the Genus database with same CATH topology
4YGCB 3JVTB 1F54A 4N1FA 2MBXA 1UP5A 2I94A 3PALA 3WNXB 1KFUL 2KAXA 2QPTA 1DGUA 3DF0B 3AKAA 4DIRA 4PHMA 1Y1UA 1MWNA 4JPZB 3IF7A 1YR5A 2WCFA 1B4CA 3GOFA 1QVIY 2BBNA 1CLBA 2LVIA 5JOLA 4AQIA 1RWYA 1S6CA 1EJ3A 2K0JA 2Q91A 2BCXA 2HQWA 2WCEA 3KO0A 2JULA 1WDCB 4L9MA 1IKUA 3JTDC 1DMOA 3I5IB 1UWOA 2NXQA 1PVAA 1K95A 2LM5A 3BUNB 1TNXA 1IJ6A 1M31A 1G4YR 1PVBA 2L2EA 3DVMA 1B47A 1N0YA 4PE4A 3KF9A 1A03A 3CS1A 1CMGA 5HYDA 5KSZA 2HETA 1SCMB 4GBAA 2F2OA 2JNXA 3DF0A 4DS7A 4UPGA 1CLLA 4HSZA 4CPVA 3JVTC 4HRGA 1B9AA 4CLNA 2K7CA 2KBIA 4ETOA 1DGVA 3GK1A 3MSEB 2WOSA 4N1GA 1TNQA 1SL9A 2OTGB 2JTTA 2E6WA 1JF0A 1J7RA 1JFJA 4HRHA 1L7ZA 1MF8B 2ZNDA 1KSOA 2LVJA 1M46A 2D8NA 3SIBA 2F3YA 1CDLA 1RROA 1NP8A 1Y6WA 3ZWHA 1JSAA 3TUYC 4OVNF 1K93D 2HPSA 1M45A 2JTZA 3OB2B 1AP4A 2PSRA 1Q80A 1HT9A 1WDCC 2LCPA 1W7JB 1YURA 3I5IC 2JXLA 1XK4C 5FYXA 2L0PA 2HF5A 1G8IA 4D1EA 2K61A 1L2OB 1QIWA 5GQQC 1G33A 4PCWA 4N5XA 1E8AA 1TOPA 3BOWB 2H61A 2KYFA 2LMVA 2I2RE 2KQ6A 1CDMA 4R1EA 3WHUB 2R2IA 1ALVA 3EKJA 4I5JA 1UHJA 2JXCA 1A75B 2MLEC 5ER4X 1N65A 1F4QA 1NX0A 1NX2A 5HLOA 4OCIA 2HQ8A 1BLQA 2CCMA 5AEQA 3BQ3A 1UHHA 4DCKA 5ER5A 2KNEA 1EG4A 3PLFB 3VGOA 1UHKA 2JC2A 1RFJA 3AKBA 1QVIZ 3SJSA 1TNPA 5DKNA 1K9PA 1KFXS 5JJGA 1JBAA 1OMVA 2QACA 1MXLC 1YVLA 1UHNA 2KGRA 1S3PA 3NSOA 1YVHA 3H4SE 2V53A 4U8DA 2LC5A 3EK7A 2F3ZA 3WXAA 1DJIA 3JTDB 1A29A 2BECA 4GPLB 1MR8A 1OQPA 3BOWA 3NSIA 5AERA 5HKWA 3FS7A 1H8BA 2FJUB 3PSRA 2AMIA 2KYCA 2MRDA 1A75A 1MXEA 1F4OA 1NYAA 3BUMB 5AXIA 1TN4A 2L4IA 1AVSA 4I5NB 5PALA 4USLA 1NWDA 3TS5C 2BCAA 2IS9A 1CMFA 1KK7Z 1DJWA 1ZACA 5CSNA 3BUOB 2KI4C 2L4HA 2ZKMX 2FCEA 1SR6B 1KFUS 2LMUA 2M1KB 4CIDA 1K94A 2O5GA 3EVRA 4FTGA 1FPWA 2BBMA 5AFPA 2JT0A 1KQMC 1J55A 4PDZA 1J1EA 5D69A 1WRKA 4ZCUA 1CM1A 2M1UA 4I5LB 5I8NA 1BMOA 2LV7A 1JF2A 2K7OA 3OX5A 4MRXA 4P5OE 2Y4QA 3VROA 1LINA 2LHIA 2M7NA 2ZRTA 4XJKB 4IL1A 4M2OA 2KI6D 4YRUA 1F8HA 2KSPA 1RK9A 2BKIB 1YX8A 1QX5B 2DOQA 3EVUA 2M8UA 3TUYB 4MVFA 3FIAA 1IGVA 4ORCB 2M49B 1DT7B 1BG1A 2P6BB 1CFCA 1R6PA 2PRUA 4BY5A 1RJVA 3KHEA 1A4PA 1NPQA 1V1FA 2F2PA 2Y5IA 2ZFDA 1ZOTB 3BUXB 2I7AA 1CFDA 2KQYA 2EHBA 2TN4A 1QXPA 2LUCA 1GQMA 1AJ4A 1SK6D 1SKTA 2OS8B 2NCOA 5I2QA 1KQVA 1KWOB 2M29A 3BYAA 2H2KA 4GGNA 1F55A 1SR6C 2JQ6A 3IQQA 2KDHA 3GK2A 1J7OA 1SW8A 4YGAA 2JT3A 4MLWA 4XJKA 1GJYA 1C7VA 1SMGA 2JRFA 2LE9B 2ZNEA 3AAJA 4MSPA 3RLZA 1LVCD 3CR5X 1QS7A 1PSRA 2KFGA 3OX6A 4NDDA 1XYDA 1CNPA 1H4BA 3LK1A 3ICBA 4MEWA 1K8UA 2F33A 3CLNA 1DJHA 2JT8A 1QJTA 2L50A 1PK0D 3EK8A 1XK4A 3PN7B 2K7DA 2KOTA 1BR1B 1WRZA 4C0JA 3D0YB 5AANA 1LXFC 3A4UB 3IQOA 4FQOA 4PHKA 1IJ5A 3EKHA 2KFFA 4PHNA 2O60A 4CFRA 1W7IB 1R2UA 1XFUO 2BCBA 1IG5A 1OZOA 4JQ0D 3LL8B 1CTRA 2L5XB 4MN0A 2K2FA 3TS5B 1NIWA 2B1UA 3HX4A 1CKKA 2ZN9A 4YGDB 2KI4B 5J3XA 2OS8C 3F45A 3OHMB 3ZNIA 1FBVA 2LAPA 2SCPA 1KWOC 3C1VA 5HKZA 1Y1AA 1V1GA 1KQMB 3SG2A 2JWWA 2EGDA 2LHLA 3VRPA 1CFPA 1S1EA 3I5HB 5D7FA 1QLSA 1FW4A 1RECA 1UHIA 4F0ZB 2M9GA 1SL7A 2F8PA 1J7QA 2PASA 2LLTA 2M97A 3SG5A 5B8IB 3LCPC 3D0YA 4ORBB 4M2QA 2PMYA 2Q4UA 1XO5A 2L98A 2LVVA 2M7LA 3FWBA 1AUIB 3WHTB 1NSHA 4MZJA 1SL8A 1TCOB 1TRFA 1HQVA 4AOMA 3PN7C 2BE6A 3EVVA 1Y1XA 1UURA 2LUXA 1WRLA 1K9UA 1TIZA 2LANA 2KAYA 4GUKA 2BE4A 1SCVA 1TNWA 1JFKA 3NSKA 1FI5A 1DJXA 2LNKA 1S36A 2COLB 3PM8A 5K89A 1ODBA 5HLVA 2MA2A 4JWQA 3CZTX 4WQ3A 1J7PA 1AJ5A 1JWDA 2GGMA 1PSBA 2Y1NA 2BL0C 3M0WA 1KSMA 1BF5A 2KI6C 2KFHA 2LP2A 3EK4A 1MQ1A 1DVIA 2VRGA 1ZUZA 3NXAA 1NUBA 1BOCA 2CXJA 1KCYA 4OV2A 1IQ5A 2EC6C 2NLNA 3CR4X 3CWGA 1PULA 2JPTA 1S5GY 3CR2A 1B8LA 3SG3A 4YGEB 2LMTA 3I5HC 1IQ3A 4I5KA 2LLUA 5DKQA 1OZSA 2G2BA 1D1OA 4MZKA 4DUQA 1DTLA 3GK4X 1XFYO 1XFWO 3A8RA 5CSJA 1CFFA 3FWCA 2FOTA 2GV5A 4TNCA 2CNPA 4PHJA 3LK0A 4OKHA 2MJWB 4GFTA 5I2OA 2KGBC 3KPXA 4NQGA 1LA3A 1UUSA 3OB1B 1FF1A 1YRTB 2NZ0A 2WCBA 1QATA 2GGZA 3I5FC 5BPJA 2OPOA 4P2YB 2L51A 2G9BA 3AAKA 1GGZA 1JC2A 3TDUA 1WLMA 1CDPA 5IBWA 1CLMA 1SRAA 5KU1A 2JNFA 3I5GC 3TDIA 1SNLA 4QJ5B 1M63B 1XFVO 1K96A 3KEVA 2JOJA 1K90D 1M39A 3RM1A 1ZMZA 3CTNA 1AK8A 1YUSA 1BODA 1OOJA 1YTZC 2LP3A 4GNKB 1EXRA 1F71A 4PE0A 3NSLA 4HREE 4GGFA 5TNCA 1BR4B 4YI9A 1U5IB 1WY9A 3CGAA 1QX7A 3BXKA 3DD4A 5F6TA 1B7TY 1PALA 1YUTA 3LLEA 1DJZA 3O4YA 2MHHA 4GGFC 4C0KA 1XA5A 5CSIA 4QJ4B 1SYMA 3DVJA 2SASA 1KK7Y 5DKRA 1KK8C 1SY9A 2PVBA 2M0RA 4Q04A 1QTXA 1OMRA 1X02A 4A4CA 4PE1A 4OR9B 1DF0B 2AAOA 1QIVA 1QLKA 3DVEA 3BUWB 3SG6A 1GGWA 4ZCVA 3O2PA 4A4BA 1FI6A 3DVKA 5G08A 4M2PA 2BL0B 3QRXA 3PATA 2WC8A 2K2AA 5CPVA 1IH0A 4YGBB 1N2DA 1BU3A 1CB1A 1RTP1 5CSFA 1YX7A 4ORAB 1OMDA 4QJ3B 1BT6A 1SBJA 2ISDA 1U5IA 1IWQA 1EG3A 2CBLA 3K21A 4YI8A 1QX2A 3O78A 1OSAA 2EC6B 1XFXO 2AUCA 4WQ2A 1JUOA 4BY4A 2A4JA 2RGIA 2LLSA 2FCDA 2MAZA 1S5GZ 2JU0A 1DJYA 1YRUB 1NX3A 1TCFA 4DRWA 4AQJA 1ZFSA 1XVJA 4PALA 1AHRA 1DJGA 1NCYA 1ALWA 1F70A 3VRNA 5KTYA 1S6IA 1SCMC 2WNDA 1DF0A 1LA0A 4NDCA 1A2XA 4CFQA 1C7WA 1EH2A 1IRJA 2H61C 1B8RA 3I5FB 2ZN8A 1XFZO 2LVKA 1VRKA 4XYNA 3SG7A 2KBMA 1J1DA 2KAVA 3HCMA 1NX1A 1CDNA 1OE9B 1MHOA 4YBHB 2M3WA 2JZIA 1NCXA 3D10A 3I5GB 2OTGC 4PE7A 1C07A 1B8CA 4NDBA 1K2HA 2CT9A 1S26D 2PALA 2Y1MA 3VRRA 4C0LA 3VRQA 3TZ1A 2K8MB 3TDZA 2NCPA 4E68A 1KFXL 1SPYA 5I2LA 2KHNA 3SIAA 4GAOA 2CTNA 1QV1A 4MRYA 4MBEA 1K9KA 1BJFA 2WORA 1LKJA 1CM4A 3O6BA 3SG4A 1QASA 2BKHB 2ZRSA 1B7TZ 1PRWA 1L2OC 1YUUA 1Y0VH 3PFVA 2K7BA 1TTXA 3OP0A 2I18A 2E30A 4WRIA 4MZLA 1B1GA 1MUXA 1QV0A 1S6JA 1WLZA 2MLFC 4ICBA 5HKYA 3E3RA 1KK8B 1EL4A 1NCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YGC B;  3JVT B;  1F54 A;  4N1F A;  2MBX A;  1UP5 A;  2I94 A;  3PAL A;  3WNX B;  1KFU L;  2KAX A;  2QPT A;  1DGU A;  3DF0 B;  3AKA A;  4DIR A;  4PHM A;  1Y1U A;  1MWN A;  4JPZ B;  3IF7 A;  1YR5 A;  2WCF A;  1B4C A;  3GOF A;  1QVI Y;  2BBN A;  1CLB A;  2LVI A;  5JOL A;  4AQI A;  1RWY A;  1S6C A;  1EJ3 A;  2K0J A;  2Q91 A;  2BCX A;  2HQW A;  2WCE A;  3KO0 A;  2JUL A;  1WDC B;  4L9M A;  1IKU A;  3JTD C;  1DMO A;  3I5I B;  1UWO A;  2NXQ A;  1PVA A;  1K95 A;  2LM5 A;  3BUN B;  1TNX A;  1IJ6 A;  1M31 A;  1G4Y R;  1PVB A;  2L2E A;  3DVM A;  1B47 A;  1N0Y A;  4PE4 A;  3KF9 A;  1A03 A;  3CS1 A;  1CMG A;  5HYD A;  5KSZ A;  2HET A;  1SCM B;  4GBA A;  2F2O A;  2JNX A;  3DF0 A;  4DS7 A;  4UPG A;  1CLL A;  4HSZ A;  4CPV A;  3JVT C;  4HRG A;  1B9A A;  4CLN A;  2K7C A;  2KBI A;  4ETO A;  1DGV A;  3GK1 A;  3MSE B;  2WOS A;  4N1G A;  1TNQ A;  1SL9 A;  2OTG B;  2JTT A;  2E6W A;  1JF0 A;  1J7R A;  1JFJ A;  4HRH A;  1L7Z A;  1MF8 B;  2ZND A;  1KSO A;  2LVJ A;  1M46 A;  2D8N A;  3SIB A;  2F3Y A;  1CDL A;  1RRO A;  1NP8 A;  1Y6W A;  3ZWH A;  1JSA A;  3TUY C;  4OVN F;  1K93 D;  2HPS A;  1M45 A;  2JTZ A;  3OB2 B;  1AP4 A;  2PSR A;  1Q80 A;  1HT9 A;  1WDC C;  2LCP A;  1W7J B;  1YUR A;  3I5I C;  2JXL A;  1XK4 C;  5FYX A;  2L0P A;  2HF5 A;  1G8I A;  4D1E A;  2K61 A;  1L2O B;  1QIW A;  5GQQ C;  1G33 A;  4PCW A;  4N5X A;  1E8A A;  1TOP A;  3BOW B;  2H61 A;  2KYF A;  2LMV A;  2I2R E;  2KQ6 A;  1CDM A;  4R1E A;  3WHU B;  2R2I A;  1ALV A;  3EKJ A;  4I5J A;  1UHJ A;  2JXC A;  1A75 B;  2MLE C;  5ER4 X;  1N65 A;  1F4Q A;  1NX0 A;  1NX2 A;  5HLO A;  4OCI A;  2HQ8 A;  1BLQ A;  2CCM A;  5AEQ A;  3BQ3 A;  1UHH A;  4DCK A;  5ER5 A;  2KNE A;  1EG4 A;  3PLF B;  3VGO A;  1UHK A;  2JC2 A;  1RFJ A;  3AKB A;  1QVI Z;  3SJS A;  1TNP A;  5DKN A;  1K9P A;  1KFX S;  5JJG A;  1JBA A;  1OMV A;  2QAC A;  1MXL C;  1YVL A;  1UHN A;  2KGR A;  1S3P A;  3NSO A;  1YVH A;  3H4S E;  2V53 A;  4U8D A;  2LC5 A;  3EK7 A;  2F3Z A;  3WXA A;  1DJI A;  3JTD B;  1A29 A;  2BEC A;  4GPL B;  1MR8 A;  1OQP A;  3BOW A;  3NSI A;  5AER A;  5HKW A;  3FS7 A;  1H8B A;  2FJU B;  3PSR A;  2AMI A;  2KYC A;  2MRD A;  1A75 A;  1MXE A;  1F4O A;  1NYA A;  3BUM B;  5AXI A;  1TN4 A;  2L4I A;  1AVS A;  4I5N B;  5PAL A;  4USL A;  1NWD A;  3TS5 C;  2BCA A;  2IS9 A;  1CMF A;  1KK7 Z;  1DJW A;  1ZAC A;  5CSN A;  3BUO B;  2KI4 C;  2L4H A;  2ZKM X;  2FCE A;  1SR6 B;  1KFU S;  2LMU A;  2M1K B;  4CID A;  1K94 A;  2O5G A;  3EVR A;  4FTG A;  1FPW A;  2BBM A;  5AFP A;  2JT0 A;  1KQM C;  1J55 A;  4PDZ A;  1J1E A;  5D69 A;  1WRK A;  4ZCU A;  1CM1 A;  2M1U A;  4I5L B;  5I8N A;  1BMO A;  2LV7 A;  1JF2 A;  2K7O A;  3OX5 A;  4MRX A;  4P5O E;  2Y4Q A;  3VRO A;  1LIN A;  2LHI A;  2M7N A;  2ZRT A;  4XJK B;  4IL1 A;  4M2O A;  2KI6 D;  4YRU A;  1F8H A;  2KSP A;  1RK9 A;  2BKI B;  1YX8 A;  1QX5 B;  2DOQ A;  3EVU A;  2M8U A;  3TUY B;  4MVF A;  3FIA A;  1IGV A;  4ORC B;  2M49 B;  1DT7 B;  1BG1 A;  2P6B B;  1CFC A;  1R6P A;  2PRU A;  4BY5 A;  1RJV A;  3KHE A;  1A4P A;  1NPQ A;  1V1F A;  2F2P A;  2Y5I A;  2ZFD A;  1ZOT B;  3BUX B;  2I7A A;  1CFD A;  2KQY A;  2EHB A;  2TN4 A;  1QXP A;  2LUC A;  1GQM A;  1AJ4 A;  1SK6 D;  1SKT A;  2OS8 B;  2NCO A;  5I2Q A;  1KQV A;  1KWO B;  2M29 A;  3BYA A;  2H2K A;  4GGN A;  1F55 A;  1SR6 C;  2JQ6 A;  3IQQ A;  2KDH A;  3GK2 A;  1J7O A;  1SW8 A;  4YGA A;  2JT3 A;  4MLW A;  4XJK A;  1GJY A;  1C7V A;  1SMG A;  2JRF A;  2LE9 B;  2ZNE A;  3AAJ A;  4MSP A;  3RLZ A;  1LVC D;  3CR5 X;  1QS7 A;  1PSR A;  2KFG A;  3OX6 A;  4NDD A;  1XYD A;  1CNP A;  1H4B A;  3LK1 A;  3ICB A;  4MEW A;  1K8U A;  2F33 A;  3CLN A;  1DJH A;  2JT8 A;  1QJT A;  2L50 A;  1PK0 D;  3EK8 A;  1XK4 A;  3PN7 B;  2K7D A;  2KOT A;  1BR1 B;  1WRZ A;  4C0J A;  3D0Y B;  5AAN A;  1LXF C;  3A4U B;  3IQO A;  4FQO A;  4PHK A;  1IJ5 A;  3EKH A;  2KFF A;  4PHN A;  2O60 A;  4CFR A;  1W7I B;  1R2U A;  1XFU O;  2BCB A;  1IG5 A;  1OZO A;  4JQ0 D;  3LL8 B;  1CTR A;  2L5X B;  4MN0 A;  2K2F A;  3TS5 B;  1NIW A;  2B1U A;  3HX4 A;  1CKK A;  2ZN9 A;  4YGD B;  2KI4 B;  5J3X A;  2OS8 C;  3F45 A;  3OHM B;  3ZNI A;  1FBV A;  2LAP A;  2SCP A;  1KWO C;  3C1V A;  5HKZ A;  1Y1A A;  1V1G A;  1KQM B;  3SG2 A;  2JWW A;  2EGD A;  2LHL A;  3VRP A;  1CFP A;  1S1E A;  3I5H B;  5D7F A;  1QLS A;  1FW4 A;  1REC A;  1UHI A;  4F0Z B;  2M9G A;  1SL7 A;  2F8P A;  1J7Q A;  2PAS A;  2LLT A;  2M97 A;  3SG5 A;  5B8I B;  3LCP C;  3D0Y A;  4ORB B;  4M2Q A;  2PMY A;  2Q4U A;  1XO5 A;  2L98 A;  2LVV A;  2M7L A;  3FWB A;  1AUI B;  3WHT B;  1NSH A;  4MZJ A;  1SL8 A;  1TCO B;  1TRF A;  1HQV A;  4AOM A;  3PN7 C;  2BE6 A;  3EVV A;  1Y1X A;  1UUR A;  2LUX A;  1WRL A;  1K9U A;  1TIZ A;  2LAN A;  2KAY A;  4GUK A;  2BE4 A;  1SCV A;  1TNW A;  1JFK A;  3NSK A;  1FI5 A;  1DJX A;  2LNK A;  1S36 A;  2COL B;  3PM8 A;  5K89 A;  1ODB A;  5HLV A;  2MA2 A;  4JWQ A;  3CZT X;  4WQ3 A;  1J7P A;  1AJ5 A;  1JWD A;  2GGM A;  1PSB A;  2Y1N A;  2BL0 C;  3M0W A;  1KSM A;  1BF5 A;  2KI6 C;  2KFH A;  2LP2 A;  3EK4 A;  1MQ1 A;  1DVI A;  2VRG A;  1ZUZ A;  3NXA A;  1NUB A;  1BOC A;  2CXJ A;  1KCY A;  4OV2 A;  1IQ5 A;  2EC6 C;  2NLN A;  3CR4 X;  3CWG A;  1PUL A;  2JPT A;  1S5G Y;  3CR2 A;  1B8L A;  3SG3 A;  4YGE B;  2LMT A;  3I5H C;  1IQ3 A;  4I5K A;  2LLU A;  5DKQ A;  1OZS A;  2G2B A;  1D1O A;  4MZK A;  4DUQ A;  1DTL A;  3GK4 X;  1XFY O;  1XFW O;  3A8R A;  5CSJ A;  1CFF A;  3FWC A;  2FOT A;  2GV5 A;  4TNC A;  2CNP A;  4PHJ A;  3LK0 A;  4OKH A;  2MJW B;  4GFT A;  5I2O A;  2KGB C;  3KPX A;  4NQG A;  1LA3 A;  1UUS A;  3OB1 B;  1FF1 A;  1YRT B;  2NZ0 A;  2WCB A;  1QAT A;  2GGZ A;  3I5F C;  5BPJ A;  2OPO A;  4P2Y B;  2L51 A;  2G9B A;  3AAK A;  1GGZ A;  1JC2 A;  3TDU A;  1WLM A;  1CDP A;  5IBW A;  1CLM A;  1SRA A;  5KU1 A;  2JNF A;  3I5G C;  3TDI A;  1SNL A;  4QJ5 B;  1M63 B;  1XFV O;  1K96 A;  3KEV A;  2JOJ A;  1K90 D;  1M39 A;  3RM1 A;  1ZMZ A;  3CTN A;  1AK8 A;  1YUS A;  1BOD A;  1OOJ A;  1YTZ C;  2LP3 A;  4GNK B;  1EXR A;  1F71 A;  4PE0 A;  3NSL A;  4HRE E;  4GGF A;  5TNC A;  1BR4 B;  4YI9 A;  1U5I B;  1WY9 A;  3CGA A;  1QX7 A;  3BXK A;  3DD4 A;  5F6T A;  1B7T Y;  1PAL A;  1YUT A;  3LLE A;  1DJZ A;  3O4Y A;  2MHH A;  4GGF C;  4C0K A;  1XA5 A;  5CSI A;  4QJ4 B;  1SYM A;  3DVJ A;  2SAS A;  1KK7 Y;  5DKR A;  1KK8 C;  1SY9 A;  2PVB A;  2M0R A;  4Q04 A;  1QTX A;  1OMR A;  1X02 A;  4A4C A;  4PE1 A;  4OR9 B;  1DF0 B;  2AAO A;  1QIV A;  1QLK A;  3DVE A;  3BUW B;  3SG6 A;  1GGW A;  4ZCV A;  3O2P A;  4A4B A;  1FI6 A;  3DVK A;  5G08 A;  4M2P A;  2BL0 B;  3QRX A;  3PAT A;  2WC8 A;  2K2A A;  5CPV A;  1IH0 A;  4YGB B;  1N2D A;  1BU3 A;  1CB1 A;  1RTP 1;  5CSF A;  1YX7 A;  4ORA B;  1OMD A;  4QJ3 B;  1BT6 A;  1SBJ A;  2ISD A;  1U5I A;  1IWQ A;  1EG3 A;  2CBL A;  3K21 A;  4YI8 A;  1QX2 A;  3O78 A;  1OSA A;  2EC6 B;  1XFX O;  2AUC A;  4WQ2 A;  1JUO A;  4BY4 A;  2A4J A;  2RGI A;  2LLS A;  2FCD A;  2MAZ A;  1S5G Z;  2JU0 A;  1DJY A;  1YRU B;  1NX3 A;  1TCF A;  4DRW A;  4AQJ A;  1ZFS A;  1XVJ A;  4PAL A;  1AHR A;  1DJG A;  1NCY A;  1ALW A;  1F70 A;  3VRN A;  5KTY A;  1S6I A;  1SCM C;  2WND A;  1DF0 A;  1LA0 A;  4NDC A;  1A2X A;  4CFQ A;  1C7W A;  1EH2 A;  1IRJ A;  2H61 C;  1B8R A;  3I5F B;  2ZN8 A;  1XFZ O;  2LVK A;  1VRK A;  4XYN A;  3SG7 A;  2KBM A;  1J1D A;  2KAV A;  3HCM A;  1NX1 A;  1CDN A;  1OE9 B;  1MHO A;  4YBH B;  2M3W A;  2JZI A;  1NCX A;  3D10 A;  3I5G B;  2OTG C;  4PE7 A;  1C07 A;  1B8C A;  4NDB A;  1K2H A;  2CT9 A;  1S26 D;  2PAL A;  2Y1M A;  3VRR A;  4C0L A;  3VRQ A;  3TZ1 A;  2K8M B;  3TDZ A;  2NCP A;  4E68 A;  1KFX L;  1SPY A;  5I2L A;  2KHN A;  3SIA A;  4GAO A;  2CTN A;  1QV1 A;  4MRY A;  4MBE A;  1K9K A;  1BJF A;  2WOR A;  1LKJ A;  1CM4 A;  3O6B A;  3SG4 A;  1QAS A;  2BKH B;  2ZRS A;  1B7T Z;  1PRW A;  1L2O C;  1YUU A;  1Y0V H;  3PFV A;  2K7B A;  1TTX A;  3OP0 A;  2I18 A;  2E30 A;  4WRI A;  4MZL A;  1B1G A;  1MUX A;  1QV0 A;  1S6J A;  1WLZ A;  2MLF C;  4ICB A;  5HKY A;  3E3R A;  1KK8 B;  1EL4 A;  1NCZ A; 
#chains in the Genus database with same CATH topology
 2WCH A;  4YGC B;  3JVT B;  1F54 A;  4N1F A;  2MBX A;  1UP5 A;  2I94 A;  3PAL A;  3WNX B;  1KFU L;  2KAX A;  2QPT A;  1DGU A;  3DF0 B;  3S0F A;  3AKA A;  4DIR A;  4PHM A;  1Y1U A;  1MWN A;  4JPZ B;  3IF7 A;  1YR5 A;  2WCF A;  1B4C A;  3GOF A;  1QVI Y;  2BBN A;  1CLB A;  2LVI A;  3CAB A;  5JOL A;  4AQI A;  1RWY A;  1S6C A;  3B87 A;  3RZS A;  1EJ3 A;  2K0J A;  1OOG A;  2KPH A;  2Q91 A;  2BCX A;  2HQW A;  2WCE A;  3KO0 A;  2JUL A;  1WDC B;  4L9M A;  1IKU A;  3D75 A;  3JTD C;  1DMO A;  3I5I B;  1UWO A;  2NXQ A;  1PVA A;  3D74 A;  1K95 A;  2LM5 A;  3BUN B;  1TNX A;  1IJ6 A;  1M31 A;  1G4Y R;  1PVB A;  2L2E A;  3DVM A;  1B47 A;  1N0Y A;  3B88 A;  4PE4 A;  3KF9 A;  5FI6 A;  1A03 A;  2QEB A;  3CS1 A;  2K60 A;  1CMG A;  5HYD A;  5KSZ A;  2HET A;  1SCM B;  1OOI X;  4GBA A;  2F2O A;  2JNX A;  3DF0 A;  4DS7 A;  4UPG A;  1CLL A;  4HSZ A;  1TUJ A;  4CPV A;  3JVT C;  4HRG A;  3DXL A;  1B9A A;  4CLN A;  2K7C A;  2KBI A;  4ETO A;  1DGV A;  3NGV A;  3GK1 A;  3MSE B;  2WOS A;  4N1G A;  1TNQ A;  1SL9 A;  2OTG B;  2JTT A;  2E6W A;  1JF0 A;  1J7R A;  3UO9 A;  1JFJ A;  4HRH A;  1L7Z A;  1MF8 B;  2ZND A;  1KSO A;  2LVJ A;  1M46 A;  2D8N A;  3CYZ A;  3SIB A;  2F3Y A;  1CDL A;  1RRO A;  1NP8 A;  1Y6W A;  3DYE A;  3ZWH A;  1JSA A;  3TUY C;  4OVN F;  1K93 D;  2HPS A;  1M45 A;  3CDN A;  2JTZ A;  3OB2 B;  1AP4 A;  2PSR A;  3CZ2 A;  1Q80 A;  1HT9 A;  1WDC C;  2LCP A;  1W7J B;  3FE6 A;  1YUR A;  3I5I C;  1OOF A;  2JXL A;  1XK4 C;  3R1O A;  5FYX A;  4INW A;  2L0P A;  2HF5 A;  1G8I A;  4D1E A;  2K61 A;  1L2O B;  1QIW A;  2BNX A;  5GQQ C;  1G33 A;  4PCW A;  4N5X A;  1E8A A;  1TOP A;  3BOW B;  2H61 A;  3EG5 B;  2KYF A;  2LMV A;  2I2R E;  2KQ6 A;  1CDM A;  4R1E A;  3WHU B;  2R2I A;  1ALV A;  3EKJ A;  4I5J A;  1UHJ A;  2JXC A;  1A75 B;  2MLE C;  5ER4 X;  4PT1 A;  1N65 A;  1F4Q A;  1NX0 A;  1NX2 A;  5HLO A;  4OCI A;  2HQ8 A;  1BLQ A;  2CCM A;  3BFH A;  5AEQ A;  3BQ3 A;  1UHH A;  4DCK A;  5ER5 A;  2KNE A;  1EG4 A;  3PLF B;  3VGO A;  1UHK A;  2JC2 A;  1RFJ A;  4OZD A;  5DIC A;  3AKB A;  1QVI Z;  2L5Y A;  2WCM A;  3SJS A;  1TNP A;  5DKN A;  1K9P A;  1KFX S;  5JJG A;  1JBA A;  1OMV A;  2QAC A;  1MXL C;  3L4L A;  1YVL A;  1UHN A;  2KGR A;  1S3P A;  3NSO A;  1YVH A;  3FE8 A;  2V53 A;  3H4S E;  2LC5 A;  3EK7 A;  2F3Z A;  4U8D A;  1DJI A;  3JTD B;  3WXA A;  1A29 A;  2BEC A;  3S0A A;  1IIO A;  4GPL B;  1MR8 A;  1OQP A;  3BOW A;  3NSI A;  5AER A;  5HKW A;  3FS7 A;  1H8B A;  3OBV A;  2FJU B;  3PSR A;  1W9Z A;  2AMI A;  3DZT A;  5D3O A;  2KYC A;  2MRD A;  1A75 A;  1MXE A;  1F4O A;  1NYA A;  3BUM B;  5AXI A;  3S0D A;  1QWV A;  1TN4 A;  2L4I A;  1AVS A;  4I5N B;  5PAL A;  4USL A;  1NWD A;  3TS5 C;  5FI2 A;  2BCA A;  2IS9 A;  1CMF A;  3S0E A;  1KK7 Z;  1DJW A;  1ZAC A;  5CSN A;  3BUO B;  2KI4 C;  2L4H A;  2ZKM X;  2ERB A;  1SR6 B;  1KFU S;  2FCE A;  2LMU A;  2M1K B;  3V2L A;  4CID A;  1K94 A;  2O5G A;  3EVR A;  4FTG A;  1FPW A;  2BBM A;  5AFP A;  2JT0 A;  1KQM C;  1J55 A;  3D73 A;  1J1E A;  4PDZ A;  1WRK A;  5D69 A;  1CM1 A;  2M1U A;  4I5L B;  4ZCU A;  5I8N A;  1BMO A;  2LV7 A;  2WCK A;  1JF2 A;  2K7O A;  3OX5 A;  4MRX A;  4P5O E;  3SS4 A;  2Y4Q A;  3BJH A;  4F7F A;  3VRO A;  1LIN A;  2LHI A;  2M7N A;  2ZRT A;  4XJK B;  4IL1 A;  4M2O A;  2KI6 D;  4YRU A;  1F8H A;  2KSP A;  1RK9 A;  2BKI B;  1YX8 A;  1QX5 B;  2DOQ A;  3EVU A;  5I94 A;  2M8U A;  3TUY B;  3BFA A;  4MVF A;  3FIA A;  1IGV A;  4ORC B;  2M49 B;  1DT7 B;  1BG1 A;  2P6B B;  1CFC A;  1R6P A;  2PRU A;  4BY5 A;  3L47 A;  1RJV A;  3KHE A;  4IJ7 A;  1A4P A;  1NPQ A;  1V1F A;  2F2P A;  2Y5I A;  2ZFD A;  1ZOT B;  3BUX B;  2I7A A;  1CFD A;  3D77 A;  2KQY A;  2EHB A;  2TN4 A;  1QXP A;  1C3Y A;  2LUC A;  3S0G A;  1GQM A;  1AJ4 A;  2JPO A;  1SK6 D;  1SKT A;  2OS8 B;  2NCO A;  5I2Q A;  1KQV A;  3K1E A;  3VB1 A;  1KWO B;  2FJY A;  2M29 A;  3BYA A;  2H2K A;  4GGN A;  3SS5 A;  1F55 A;  1SR6 C;  2JQ6 A;  3IQQ A;  2KDH A;  3GK2 A;  1J7O A;  1OW4 A;  1SW8 A;  4YGA A;  2JT3 A;  4MLW A;  4XJK A;  1GJY A;  1DEL A;  1OOH A;  1C7V A;  1SMG A;  2JRF A;  2LE9 B;  2ZNE A;  3AAJ A;  4MSP A;  3RLZ A;  1LVC D;  3CR5 X;  1QS7 A;  1PSR A;  2KFG A;  3OX6 A;  4NDD A;  1XYD A;  1CNP A;  1H4B A;  3LK1 A;  3ICB A;  4MEW A;  1K8U A;  2F33 A;  3CLN A;  1DJH A;  2JT8 A;  1QJT A;  2L50 A;  1PK0 D;  3EK8 A;  1XK4 A;  3PN7 B;  2K7D A;  2KOT A;  1BR1 B;  1WRZ A;  4C0J A;  3D0Y B;  5AAN A;  1LXF C;  3A4U B;  1GM0 A;  5HL1 A;  3IQO A;  4FQO A;  4PHK A;  1IJ5 A;  3EKH A;  2KFF A;  2WCL A;  4PHN A;  2O60 A;  4CFR A;  3CZ0 A;  1W7I B;  1R2U A;  1XFU O;  2BCB A;  1IG5 A;  1OZO A;  4JQ0 D;  3LL8 B;  5FI7 A;  1CTR A;  2L5X B;  4MN0 A;  2K2F A;  3TS5 B;  1NIW A;  2B1U A;  3HX4 A;  5EL2 A;  1CKK A;  1P28 A;  2ZN9 A;  4YGD B;  2KI4 B;  3IVT A;  5J3X A;  2OS8 C;  3F45 A;  3OHM B;  3ZNI A;  1FBV A;  2LAP A;  2SCP A;  3R1P A;  1KWO C;  3C1V A;  5HKZ A;  1Y1A A;  1V1G A;  2WC5 A;  2PYQ A;  1KQM B;  3SG2 A;  2JWW A;  2EGD A;  2LHL A;  3VRP A;  3NHI A;  1CFP A;  1S1E A;  3I5H B;  5D7F A;  1QLS A;  1FW4 A;  1REC A;  1UHI A;  4F0Z B;  2M9G A;  1SL7 A;  2F8P A;  3D76 A;  1J7Q A;  2PAS A;  1LS8 A;  2LLT A;  2M97 A;  3SG5 A;  3LCP C;  2H8V A;  2KLE A;  5B8I B;  3D0Y A;  4ORB B;  4M2Q A;  2PMY A;  2Q4U A;  1XO5 A;  2L98 A;  2LVV A;  2M7L A;  3FWB A;  1AUI B;  3WHT B;  3O4X A;  1NSH A;  4MZJ A;  1SL8 A;  1TCO B;  1TRF A;  1HQV A;  4AOM A;  3PN7 C;  2BE6 A;  3B7A A;  3EVV A;  1Y1X A;  1UUR A;  2LUX A;  1WRL A;  4JD9 A;  1K9U A;  1TIZ A;  2LAN A;  2KAY A;  4GUK A;  2BE4 A;  1SCV A;  1TNW A;  1JFK A;  3NSK A;  1FI5 A;  1DJX A;  2LNK A;  1S36 A;  2COL B;  3PM8 A;  5K89 A;  1ODB A;  5HLV A;  2MA2 A;  4JWQ A;  3CZT X;  4WQ3 A;  1J7P A;  1AJ5 A;  1JWD A;  2GGM A;  1PSB A;  1TUZ A;  2Y1N A;  2BL0 C;  3M0W A;  1KSM A;  1BF5 A;  2KI6 C;  2KFH A;  2LP2 A;  3EK4 A;  1MQ1 A;  1DVI A;  2VRG A;  1ZUZ A;  3NXA A;  1NUB A;  1BOC A;  4FQT A;  2CXJ A;  1KCY A;  4OV2 A;  1IQ5 A;  2EC6 C;  2NLN A;  3CR4 X;  3QME A;  2P70 A;  1PUL A;  3CWG A;  2L2C A;  2JPT A;  1S5G Y;  3CR2 A;  1B8L A;  3SG3 A;  4YGE B;  2LMT A;  3I5H C;  1IQ3 A;  1ORG A;  4I5K A;  2LLU A;  4JKT A;  5DKQ A;  1OZS A;  2KLD A;  2G2B A;  1D1O A;  4MZK A;  4DUQ A;  1DTL A;  3GK4 X;  1XFY O;  1XFW O;  3A8R A;  5CSJ A;  1CFF A;  3FWC A;  1Z2C B;  2FOT A;  2GV5 A;  4TNC A;  2QEV A;  2CNP A;  4PHJ A;  3LK0 A;  1DC1 A;  4OKH A;  2MJW B;  3N7H A;  4GFT A;  2KGB C;  5I2O A;  3KPX A;  4NQG A;  1LA3 A;  1UUS A;  3OB1 B;  1FF1 A;  1YRT B;  2NZ0 A;  2WCB A;  1QAT A;  2GGZ A;  3I5F C;  2GTE A;  2OPO A;  5BPJ A;  4P2Y B;  2L51 A;  2G9B A;  3AAK A;  1GGZ A;  1JC2 A;  3TDU A;  1WLM A;  1CDP A;  5IBW A;  1CLM A;  1SRA A;  5KU1 A;  2JNF A;  3I5G C;  3TDI A;  1SNL A;  4QJ5 B;  1M63 B;  1XFV O;  1K96 A;  3B6X A;  3KEV A;  2JOJ A;  1K90 D;  1M39 A;  3RM1 A;  1ZMZ A;  3CTN A;  1AK8 A;  1YUS A;  4KYN A;  2QDI A;  1OOJ A;  1BOD A;  4INX A;  1YTZ C;  2LP3 A;  4GNK B;  1EXR A;  1F71 A;  4PE0 A;  3NSL A;  4HRE E;  4GGF A;  5TNC A;  1BR4 B;  4YI9 A;  1U5I B;  1WY9 A;  3CGA A;  1QX7 A;  3BXK A;  3DD4 A;  3L4A A;  5F6T A;  1B7T Y;  1PAL A;  1YUT A;  3LLE A;  1DJZ A;  3O4Y A;  2MHH A;  4GGF C;  4C0K A;  1XA5 A;  5CSI A;  4QJ4 B;  1SYM A;  3DVJ A;  2SAS A;  1KK7 Y;  5DKR A;  3FE9 A;  1KK8 C;  1SSE B;  1SY9 A;  2PVB A;  2M0R A;  4Q04 A;  1QTX A;  1OMR A;  1X02 A;  4A4C A;  4PE1 A;  3OGN A;  4OR9 B;  1DF0 B;  2AAO A;  1QIV A;  1QLK A;  3DVE A;  3BUW B;  3SG6 A;  1GGW A;  4ZCV A;  3NHT A;  1XFR A;  3O2P A;  4A4B A;  1FI6 A;  3DVK A;  2P71 A;  3CZ1 A;  5G08 A;  4M2P A;  2BL0 B;  3QRX A;  3PAT A;  2WC8 A;  2K2A A;  1TWO A;  5CPV A;  3R1V A;  4YGB B;  1N2D A;  1IH0 A;  1BU3 A;  1CB1 A;  1RTP 1;  5CSF A;  1YX7 A;  4ORA B;  1OMD A;  4QJ3 B;  1BT6 A;  1SBJ A;  2QEH A;  3D78 A;  2ISD A;  1U5I A;  1IWQ A;  1EG3 A;  2CBL A;  3K21 A;  4YI8 A;  1QX2 A;  3O78 A;  2QEO A;  1OSA A;  2EC6 B;  1XFX O;  2AUC A;  4WQ2 A;  1JUO A;  4BY4 A;  2A4J A;  2RGI A;  2LLS A;  2FCD A;  2MAZ A;  1S5G Z;  2JU0 A;  1DJY A;  3PM2 A;  2WCJ A;  1YRU B;  1NX3 A;  1TCF A;  4DRW A;  4AQJ A;  1ZFS A;  1XVJ A;  4PAL A;  1AHR A;  1DJG A;  1NCY A;  1ALW A;  3SS3 A;  1F70 A;  3VRN A;  5KTY A;  1S6I A;  1SCM C;  2WND A;  1DF0 A;  1LA0 A;  4NDC A;  1A2X A;  4CFQ A;  1C7W A;  1EH2 A;  1IRJ A;  2H61 C;  1B8R A;  3I5F B;  2BAP A;  3PJI A;  2ZN8 A;  1XFZ O;  2LVK A;  1VRK A;  4XYN A;  1DQE A;  3R72 A;  2KBM A;  1J1D A;  3SG7 A;  2KAV A;  3HCM A;  1NX1 A;  1CDN A;  1OE9 B;  1MHO A;  4YBH B;  2M3W A;  2JZI A;  1NCX A;  3D10 A;  3I5G B;  2OTG C;  4PE7 A;  1C07 A;  1B8C A;  4NDB A;  1K2H A;  2CT9 A;  3DY9 A;  3BFB A;  1S26 D;  2PAL A;  2Y1M A;  3VRR A;  4C0L A;  3VRQ A;  3TZ1 A;  2K8M B;  3TDZ A;  2NCP A;  1C3Z A;  1KFX L;  4E68 A;  1SPY A;  5I2L A;  2WC6 A;  2KHN A;  3SIA A;  4GAO A;  2CTN A;  1QV1 A;  4MRY A;  4MBE A;  1K9K A;  1BJF A;  2WOR A;  1LKJ A;  1CM4 A;  3B86 A;  3O6B A;  3SG4 A;  1QAS A;  2BKH B;  2PQL A;  2ZRS A;  1Z4H A;  3Q8I A;  3UNW A;  2YGU A;  1B7T Z;  1PRW A;  1L2O C;  1YUU A;  1Y0V H;  3PFV A;  2K7B A;  3S0B A;  1TTX A;  3OP0 A;  2I18 A;  1T14 A;  2E30 A;  4WRI A;  4MZL A;  1B1G A;  1MUX A;  1DEK A;  1QV0 A;  1S6J A;  1WLZ A;  2MLF C;  4ICB A;  5HKY A;  3E3R A;  1KK8 B;  1EL4 A;  1NCZ A; 
#chains in the Genus database with same CATH homology
 4YGC B;  3JVT B;  1F54 A;  4N1F A;  2MBX A;  1UP5 A;  2I94 A;  3PAL A;  3WNX B;  1KFU L;  2KAX A;  2QPT A;  1DGU A;  3DF0 B;  3AKA A;  4DIR A;  4PHM A;  1Y1U A;  1MWN A;  4JPZ B;  3IF7 A;  1YR5 A;  2WCF A;  1B4C A;  3GOF A;  1QVI Y;  2BBN A;  1CLB A;  2LVI A;  5JOL A;  4AQI A;  1RWY A;  1S6C A;  1EJ3 A;  2K0J A;  2Q91 A;  2BCX A;  2HQW A;  2WCE A;  3KO0 A;  2JUL A;  1WDC B;  4L9M A;  1IKU A;  3JTD C;  1DMO A;  3I5I B;  1UWO A;  2NXQ A;  1PVA A;  1K95 A;  2LM5 A;  3BUN B;  1TNX A;  1IJ6 A;  1M31 A;  1G4Y R;  1PVB A;  2L2E A;  3DVM A;  1B47 A;  1N0Y A;  4PE4 A;  3KF9 A;  1A03 A;  3CS1 A;  1CMG A;  5HYD A;  5KSZ A;  2HET A;  1SCM B;  4GBA A;  2F2O A;  2JNX A;  3DF0 A;  4DS7 A;  4UPG A;  1CLL A;  4HSZ A;  4CPV A;  3JVT C;  4HRG A;  1B9A A;  4CLN A;  2K7C A;  2KBI A;  4ETO A;  1DGV A;  3GK1 A;  3MSE B;  2WOS A;  4N1G A;  1TNQ A;  1SL9 A;  2OTG B;  2JTT A;  2E6W A;  1JF0 A;  1J7R A;  1JFJ A;  4HRH A;  1L7Z A;  1MF8 B;  2ZND A;  1KSO A;  2LVJ A;  1M46 A;  2D8N A;  3SIB A;  2F3Y A;  1CDL A;  1RRO A;  1NP8 A;  1Y6W A;  3ZWH A;  1JSA A;  3TUY C;  4OVN F;  1K93 D;  2HPS A;  1M45 A;  2JTZ A;  3OB2 B;  1AP4 A;  2PSR A;  1Q80 A;  1HT9 A;  1WDC C;  2LCP A;  1W7J B;  1YUR A;  3I5I C;  2JXL A;  1XK4 C;  5FYX A;  2L0P A;  2HF5 A;  1G8I A;  4D1E A;  2K61 A;  1L2O B;  1QIW A;  5GQQ C;  1G33 A;  4PCW A;  4N5X A;  1E8A A;  1TOP A;  3BOW B;  2H61 A;  2KYF A;  2LMV A;  2I2R E;  2KQ6 A;  1CDM A;  4R1E A;  3WHU B;  2R2I A;  1ALV A;  3EKJ A;  4I5J A;  1UHJ A;  2JXC A;  1A75 B;  2MLE C;  5ER4 X;  1N65 A;  1F4Q A;  1NX0 A;  1NX2 A;  5HLO A;  4OCI A;  2HQ8 A;  1BLQ A;  2CCM A;  5AEQ A;  3BQ3 A;  1UHH A;  4DCK A;  5ER5 A;  2KNE A;  1EG4 A;  3PLF B;  3VGO A;  1UHK A;  2JC2 A;  1RFJ A;  3AKB A;  1QVI Z;  3SJS A;  1TNP A;  5DKN A;  1K9P A;  1KFX S;  5JJG A;  1JBA A;  1OMV A;  2QAC A;  1MXL C;  1YVL A;  1UHN A;  2KGR A;  1S3P A;  3NSO A;  1YVH A;  3H4S E;  2V53 A;  4U8D A;  2LC5 A;  3EK7 A;  2F3Z A;  3WXA A;  1DJI A;  3JTD B;  1A29 A;  2BEC A;  4GPL B;  1MR8 A;  1OQP A;  3BOW A;  3NSI A;  5AER A;  5HKW A;  3FS7 A;  1H8B A;  2FJU B;  3PSR A;  2AMI A;  2KYC A;  2MRD A;  1A75 A;  1MXE A;  1F4O A;  1NYA A;  3BUM B;  5AXI A;  1TN4 A;  2L4I A;  1AVS A;  4I5N B;  5PAL A;  4USL A;  1NWD A;  3TS5 C;  2BCA A;  2IS9 A;  1CMF A;  1KK7 Z;  1DJW A;  1ZAC A;  5CSN A;  3BUO B;  2KI4 C;  2L4H A;  2ZKM X;  2FCE A;  1SR6 B;  1KFU S;  2LMU A;  2M1K B;  4CID A;  1K94 A;  2O5G A;  3EVR A;  4FTG A;  1FPW A;  2BBM A;  5AFP A;  2JT0 A;  1KQM C;  1J55 A;  4PDZ A;  1J1E A;  5D69 A;  1WRK A;  4ZCU A;  1CM1 A;  2M1U A;  4I5L B;  5I8N A;  1BMO A;  2LV7 A;  1JF2 A;  2K7O A;  3OX5 A;  4MRX A;  4P5O E;  2Y4Q A;  3VRO A;  1LIN A;  2LHI A;  2M7N A;  2ZRT A;  4XJK B;  4IL1 A;  4M2O A;  2KI6 D;  4YRU A;  1F8H A;  2KSP A;  1RK9 A;  2BKI B;  1YX8 A;  1QX5 B;  2DOQ A;  3EVU A;  2M8U A;  3TUY B;  4MVF A;  3FIA A;  1IGV A;  4ORC B;  2M49 B;  1DT7 B;  1BG1 A;  2P6B B;  1CFC A;  1R6P A;  2PRU A;  4BY5 A;  1RJV A;  3KHE A;  1A4P A;  1NPQ A;  1V1F A;  2F2P A;  2Y5I A;  2ZFD A;  1ZOT B;  3BUX B;  2I7A A;  1CFD A;  2KQY A;  2EHB A;  2TN4 A;  1QXP A;  2LUC A;  1GQM A;  1AJ4 A;  1SK6 D;  1SKT A;  2OS8 B;  2NCO A;  5I2Q A;  1KQV A;  1KWO B;  2M29 A;  3BYA A;  2H2K A;  4GGN A;  1F55 A;  1SR6 C;  2JQ6 A;  3IQQ A;  2KDH A;  3GK2 A;  1J7O A;  1SW8 A;  4YGA A;  2JT3 A;  4MLW A;  4XJK A;  1GJY A;  1C7V A;  1SMG A;  2JRF A;  2LE9 B;  2ZNE A;  3AAJ A;  4MSP A;  3RLZ A;  1LVC D;  3CR5 X;  1QS7 A;  1PSR A;  2KFG A;  3OX6 A;  4NDD A;  1XYD A;  1CNP A;  1H4B A;  3LK1 A;  3ICB A;  4MEW A;  1K8U A;  2F33 A;  3CLN A;  1DJH A;  2JT8 A;  1QJT A;  2L50 A;  1PK0 D;  3EK8 A;  1XK4 A;  3PN7 B;  2K7D A;  2KOT A;  1BR1 B;  1WRZ A;  4C0J A;  3D0Y B;  5AAN A;  1LXF C;  3A4U B;  3IQO A;  4FQO A;  4PHK A;  1IJ5 A;  3EKH A;  2KFF A;  4PHN A;  2O60 A;  4CFR A;  1W7I B;  1R2U A;  1XFU O;  2BCB A;  1IG5 A;  1OZO A;  4JQ0 D;  3LL8 B;  1CTR A;  2L5X B;  4MN0 A;  2K2F A;  3TS5 B;  1NIW A;  2B1U A;  3HX4 A;  1CKK A;  2ZN9 A;  4YGD B;  2KI4 B;  5J3X A;  2OS8 C;  3F45 A;  3OHM B;  3ZNI A;  1FBV A;  2LAP A;  2SCP A;  1KWO C;  3C1V A;  5HKZ A;  1Y1A A;  1V1G A;  1KQM B;  3SG2 A;  2JWW A;  2EGD A;  2LHL A;  3VRP A;  1CFP A;  1S1E A;  3I5H B;  5D7F A;  1QLS A;  1FW4 A;  1REC A;  1UHI A;  4F0Z B;  2M9G A;  1SL7 A;  2F8P A;  1J7Q A;  2PAS A;  2LLT A;  2M97 A;  3SG5 A;  5B8I B;  3LCP C;  3D0Y A;  4ORB B;  4M2Q A;  2PMY A;  2Q4U A;  1XO5 A;  2L98 A;  2LVV A;  2M7L A;  3FWB A;  1AUI B;  3WHT B;  1NSH A;  4MZJ A;  1SL8 A;  1TCO B;  1TRF A;  1HQV A;  4AOM A;  3PN7 C;  2BE6 A;  3EVV A;  1Y1X A;  1UUR A;  2LUX A;  1WRL A;  1K9U A;  1TIZ A;  2LAN A;  2KAY A;  4GUK A;  2BE4 A;  1SCV A;  1TNW A;  1JFK A;  3NSK A;  1FI5 A;  1DJX A;  2LNK A;  1S36 A;  2COL B;  3PM8 A;  5K89 A;  1ODB A;  5HLV A;  2MA2 A;  4JWQ A;  3CZT X;  4WQ3 A;  1J7P A;  1AJ5 A;  1JWD A;  2GGM A;  1PSB A;  2Y1N A;  2BL0 C;  3M0W A;  1KSM A;  1BF5 A;  2KI6 C;  2KFH A;  2LP2 A;  3EK4 A;  1MQ1 A;  1DVI A;  2VRG A;  1ZUZ A;  3NXA A;  1NUB A;  1BOC A;  2CXJ A;  1KCY A;  4OV2 A;  1IQ5 A;  2EC6 C;  2NLN A;  3CR4 X;  3CWG A;  1PUL A;  2JPT A;  1S5G Y;  3CR2 A;  1B8L A;  3SG3 A;  4YGE B;  2LMT A;  3I5H C;  1IQ3 A;  4I5K A;  2LLU A;  5DKQ A;  1OZS A;  2G2B A;  1D1O A;  4MZK A;  4DUQ A;  1DTL A;  3GK4 X;  1XFY O;  1XFW O;  3A8R A;  5CSJ A;  1CFF A;  3FWC A;  2FOT A;  2GV5 A;  4TNC A;  2CNP A;  4PHJ A;  3LK0 A;  4OKH A;  2MJW B;  4GFT A;  5I2O A;  2KGB C;  3KPX A;  4NQG A;  1LA3 A;  1UUS A;  3OB1 B;  1FF1 A;  1YRT B;  2NZ0 A;  2WCB A;  1QAT A;  2GGZ A;  3I5F C;  5BPJ A;  2OPO A;  4P2Y B;  2L51 A;  2G9B A;  3AAK A;  1GGZ A;  1JC2 A;  3TDU A;  1WLM A;  1CDP A;  5IBW A;  1CLM A;  1SRA A;  5KU1 A;  2JNF A;  3I5G C;  3TDI A;  1SNL A;  4QJ5 B;  1M63 B;  1XFV O;  1K96 A;  3KEV A;  2JOJ A;  1K90 D;  1M39 A;  3RM1 A;  1ZMZ A;  3CTN A;  1AK8 A;  1YUS A;  1BOD A;  1OOJ A;  1YTZ C;  2LP3 A;  4GNK B;  1EXR A;  1F71 A;  4PE0 A;  3NSL A;  4HRE E;  4GGF A;  5TNC A;  1BR4 B;  4YI9 A;  1U5I B;  1WY9 A;  3CGA A;  1QX7 A;  3BXK A;  3DD4 A;  5F6T A;  1B7T Y;  1PAL A;  1YUT A;  3LLE A;  1DJZ A;  3O4Y A;  2MHH A;  4GGF C;  4C0K A;  1XA5 A;  5CSI A;  4QJ4 B;  1SYM A;  3DVJ A;  2SAS A;  1KK7 Y;  5DKR A;  1KK8 C;  1SY9 A;  2PVB A;  2M0R A;  4Q04 A;  1QTX A;  1OMR A;  1X02 A;  4A4C A;  4PE1 A;  4OR9 B;  1DF0 B;  2AAO A;  1QIV A;  1QLK A;  3DVE A;  3BUW B;  3SG6 A;  1GGW A;  4ZCV A;  3O2P A;  4A4B A;  1FI6 A;  3DVK A;  5G08 A;  4M2P A;  2BL0 B;  3QRX A;  3PAT A;  2WC8 A;  2K2A A;  5CPV A;  1IH0 A;  4YGB B;  1N2D A;  1BU3 A;  1CB1 A;  1RTP 1;  5CSF A;  1YX7 A;  4ORA B;  1OMD A;  4QJ3 B;  1BT6 A;  1SBJ A;  2ISD A;  1U5I A;  1IWQ A;  1EG3 A;  2CBL A;  3K21 A;  4YI8 A;  1QX2 A;  3O78 A;  1OSA A;  2EC6 B;  1XFX O;  2AUC A;  4WQ2 A;  1JUO A;  4BY4 A;  2A4J A;  2RGI A;  2LLS A;  2FCD A;  2MAZ A;  1S5G Z;  2JU0 A;  1DJY A;  1YRU B;  1NX3 A;  1TCF A;  4DRW A;  4AQJ A;  1ZFS A;  1XVJ A;  4PAL A;  1AHR A;  1DJG A;  1NCY A;  1ALW A;  1F70 A;  3VRN A;  5KTY A;  1S6I A;  1SCM C;  2WND A;  1DF0 A;  1LA0 A;  4NDC A;  1A2X A;  4CFQ A;  1C7W A;  1EH2 A;  1IRJ A;  2H61 C;  1B8R A;  3I5F B;  2ZN8 A;  1XFZ O;  2LVK A;  1VRK A;  4XYN A;  3SG7 A;  2KBM A;  1J1D A;  2KAV A;  3HCM A;  1NX1 A;  1CDN A;  1OE9 B;  1MHO A;  4YBH B;  2M3W A;  2JZI A;  1NCX A;  3D10 A;  3I5G B;  2OTG C;  4PE7 A;  1C07 A;  1B8C A;  4NDB A;  1K2H A;  2CT9 A;  1S26 D;  2PAL A;  2Y1M A;  3VRR A;  4C0L A;  3VRQ A;  3TZ1 A;  2K8M B;  3TDZ A;  2NCP A;  4E68 A;  1KFX L;  1SPY A;  5I2L A;  2KHN A;  3SIA A;  4GAO A;  2CTN A;  1QV1 A;  4MRY A;  4MBE A;  1K9K A;  1BJF A;  2WOR A;  1LKJ A;  1CM4 A;  3O6B A;  3SG4 A;  1QAS A;  2BKH B;  2ZRS A;  1B7T Z;  1PRW A;  1L2O C;  1YUU A;  1Y0V H;  3PFV A;  2K7B A;  1TTX A;  3OP0 A;  2I18 A;  2E30 A;  4WRI A;  4MZL A;  1B1G A;  1MUX A;  1QV0 A;  1S6J A;  1WLZ A;  2MLF C;  4ICB A;  5HKY A;  3E3R A;  1KK8 B;  1EL4 A;  1NCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...