4GGNA

Malaria invasion machinery protein complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
127
structure length
125
Chain Sequence
b'KDMFNTKSSKLRIEDASHNARKLGLAPSSTDEKKIRDLYGDSLTYEQYLEYLTMCVHDRDNMEELIKMFSHFDNNSSGFLTKNQMKNILTTWGDALTEQEANDALNAFSSEDRINYKLFCEDILS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin A tail domain interacting protein MTIP
publication title The structure of the D3 domain of Plasmodium falciparum myosin tail interacting protein MTIP in complex with a nanobody.
pubmed doi rcsb
source organism Plasmodium knowlesi
molecule tags Protein binding
total genus 38
structure length 125
sequence length 127
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ggnA02
1K9KA 3CR2A 1NX2A 1CFFA 4GBAA 5CSNA 1DVIA 1XVJA 1QATA 1UHNA 2WCEA 2H2KA 4YGDB 2KDHA 1CFCA 3OX6A 2L4IA 1TNPA 2M1UA 1VRKA 4BY4A 1F70A 2MJWB 1NPQA 4PE4A 3SG4A 2KHNA 5I8NA 3EVVA 4DCKA 5K89A 1OZOA 1SW8A 2KAXA 1QIVA 2LLUA 1CDLA 1MXEA 2CBLA 4MZKA 4XYNA 2KI6D 4Q04A 2KNEA 2BBMA 1S1EA 1NIWA 1IJ6A 4P5OE 2M7LA 1OE9B 4PHJA 1TCFA 1Y1UA 3LK0A 1SR6B 1F4OA 1E8AA 3OP0A 4ETOA 3OX5A 1XO5A 1AJ4A 1QTXA 1JFJA 2L5XB 1EG3A 2WOSA 1RTP1 2L2EA 3O6BA 1UHJA 3GK2A 4C0LA 2JNXA 2LHIA 1R6PA 2NXQA 3WXAA 1XA5A 2M29A 2K7DA 2L0PA 5D7FA 1TNQA 1JF2A 5BPJA 2F3ZA 4C0JA 1IG5A 1J7QA 1BR1B 1J1EA 3GK4X 2ZFDA 2MHHA 1QJTA 2F2OA 2MAZA 2BCXA 2I94A 1WDCB 3EVRA 4NDCA 3VRNA 1DJWA 4NDBA 2LVJA 2JTTA 1K93D 1GQMA 4P2YB 1RROA 3LLEA 1YVHA 1EG4A 3FIAA 4PHMA 1LINA 4BY5A 3BQ3A 4QJ3B 1SL8A 2BCBA 4MSPA 1F4QA 2CXJA 2M8UA 3PLFB 1B4CA 5HKWA 1CLBA 3IQQA 5D69A 1KQMB 1EL4A 1S3PA 1A03A 1UP5A 1AP4A 1JBAA 3BUXB 4GUKA 2ZKMX 1EXRA 1ZACA 3JVTB 3KO0A 2F2PA 2AMIA 5DKQA 1N65A 2AUCA 2LP2A 4OCIA 1WLMA 3BUWB 3SG5A 1MHOA 5I2LA 4CPVA 1WDCC 2LLTA 4NQGA 2OPOA 1KFUS 5AXIA 3OB2B 1B8RA 1BG1A 1OZSA 2ISDA 1RWYA 2KSPA 2LC5A 4MLWA 4GFTA 2LMTA 3FWCA 3A8RA 4GGNA 1WLZA 1GGWA 1PRWA 1QLKA 1PULA 4MN0A 1IQ5A 5CPVA 2KYFA 1DGUA 2FCEA 1KQMC 3CS1A 1SCVA 2BCAA 3OHMB 3DVJA 1CM4A 2L4HA 3JVTC 3LL8B 5HLVA 1TNWA 1XFYO 3I5FB 4I5NB 2K8MB 1B1GA 2HQ8A 1FBVA 1FF1A 1CFDA 1DT7B 1JC2A 3SG6A 2LVVA 1RK9A 3KHEA 2M7NA 1JF0A 1J7PA 2V53A 1PVBA 1XFVO 3BYAA 1N2DA 1KWOB 1MF8B 4DS7A 2JT3A 2KYCA 1SMGA 3RM1A 4GGFA 3LK1A 3PFVA 1M31A 1IQ3A 3E3RA 2COLB 3TUYB 1QV0A 2MLEC 4CLNA 2O60A 2KQYA 4MRXA 5ER5A 1SY9A 1MR8A 2EGDA 1TCOB 2M9GA 2Q91A 1DTLA 2K2AA 1QS7A 1BLQA 1CDNA 1JFKA 1G33A 1QX2A 2ZRSA 1TRFA 2BKIB 1U5IB 1KFXS 1CMGA 4I5JA 3CR5X 4MVFA 1J7RA 2PMYA 1DMOA 1F8HA 3I5FC 3NSKA 3D10A 2KI4B 2GGZA 3ZNIA 1UHKA 1F55A 4WRIA 1S5GY 3MSEB 4GGFC 4ZCVA 1QVIY 1U5IA 5FYXA 1YURA 1QASA 4YGCB 4YRUA 3BUNB 1KWOC 2CNPA 3CWGA 3AKAA 2OS8B 4GPLB 2JU0A 1SPYA 4XJKB 2JC2A 1L7ZA 1A75B 2WORA 1G8IA 3JTDB 1C07A 1RJVA 1QIWA 2QPTA 1YX8A 1KK7Y 1D1OA 3TUYC 2LMVA 1CKKA 4PHNA 2LANA 3SIAA 3AKBA 1PSRA 2Y1MA 5IBWA 5KTYA 3EK8A 1FW4A 2JTZA 4XJKA 3CZTX 1A75A 1DGVA 1TN4A 4JWQA 3EKJA 3WHTB 3NSOA 1PK0D 1QXPA 4YI8A 4C0KA 1DJXA 2JNFA 4UPGA 3EK7A 1KQVA 1ODBA 3I5GC 1FI5A 1WY9A 1S36A 2KI4C 3H4SE 1TIZA 3DVKA 5ER4X 1A2XA 5AEQA 1XFZO 1AVSA 1SBJA 1Y1AA 3C1VA 1QV1A 1YUUA 4MEWA 1YRTB 2LM5A 4R1EA 3TDIA 1RECA 3GOFA 1B7TY 2OS8C 4AQJA 3WNXB 3JTDC 4DUQA 1YUTA 2FJUB 2HF5A 1YTZC 2LP3A 2KQ6A 2WCFA 5KU1A 2I7AA 2K7OA 2JWWA 2PRUA 1EH2A 1CMFA 1K9UA 2Y4QA 1DJHA 3IF7A 2L98A 5CSJA 2M3WA 1B8CA 1QVIZ 2BKHB 1WRKA 2IS9A 3CTNA 4WQ2A 1UHIA 4MZLA 1ALVA 1HT9A 2NCPA 1NUBA 4ORBB 1MXLC 1N0YA 4YGEB 2LUCA 1SK6D 1SL7A 1DF0B 1SCMB 3BXKA 2JT0A 4DRWA 1OSAA 2LVIA 1ZUZA 1CB1A 1OQPA 3HCMA 3LCPC 2BE4A 2DOQA 2LNKA 1LA0A 1AHRA 2LVKA 3VRRA 2E6WA 3HX4A 2JRFA 3ICBA 4MRYA 1H4BA 2PSRA 3IQOA 1K95A 5AANA 1DF0A 3RLZA 2LE9B 5GQQC 1TNXA 4IL1A 2WNDA 4I5KA 2JXLA 2P6BB 1K8UA 1NX1A 2H61A 2BECA 2EHBA 1NX3A 1S6JA 2KGBC 1A29A 1ZOTB 4CFRA 2Y5IA 3AAKA 5HLOA 2NLNA 3DVMA 3PALA 2LHLA 1YR5A 4FQOA 1DJGA 3DVEA 2BL0B 3F45A 1A4PA 1NCXA 1AUIB 1J55A 1DJZA 1Y0VH 4YI9A 2ZNDA 3KF9A 1WRLA 4MZJA 1B9AA 1SCMC 2L50A 1BT6A 2HPSA 1IGVA 1CTRA 2FOTA 1Q80A 1DJYA 3AAJA 1ZFSA 2EC6B 3PSRA 5HKYA 2H61C 1FI6A 1B8LA 4YBHB 5F6TA 2MRDA 2NCOA 2AAOA 1B47A 3TZ1A 3I5HB 4DIRA 1XFUO 1F71A 1C7VA 4HRHA 2CTNA 1M46A 2KFHA 5DKRA 3PN7B 4PALA 2KFGA 1UHHA 1UWOA 2ZRTA 1JSAA 1ALWA 3BUOB 1W7IB 4PE7A 3CLNA 3KPXA 2SASA 3CGAA 3NSIA 1QLSA 1XFWO 1CM1A 1YX7A 2O5GA 1JUOA 1XFXO 3TS5B 3I5GB 3SJSA 2BL0C 1NSHA 2M1KB 3EKHA 2JPTA 4USLA 1L2OC 1XYDA 2KOTA 1K2HA 2LLSA 1NX0A 2PALA 3FS7A 1BMOA 2CT9A 1BF5A 2EC6C 1GJYA 1KSMA 5DKNA 3WHUB 1NYAA 2KBIA 2JOJA 2JULA 3I5HC 3VGOA 2WC8A 2K2FA 1XK4A 4CFQA 1K90D 5AERA 4FTGA 3PN7C 2JZIA 2I18A 2F33A 3DD4A 3DF0B 1C7WA 1TOPA 3SG2A 5KSZA 1DJIA 3BUMB 4AQIA 2A4JA 3NSLA 4QJ5B 1LXFC 1OMVA 4F0ZB 1OMDA 4JPZB 1NP8A 5J3XA 4A4CA 3DF0A 3TS5C 1S6IA 1M45A 1SRAA 3O2PA 3A4UB 3SIBA 2HETA 1PALA 1KFUL 5TNCA 1S26D 2M0RA 3OB1B 4OVNF 1GGZA 2K7CA 2KAVA 2K0JA 1JWDA 1NCYA 1XK4C 4M2PA 2LCPA 2Y1NA 4PE1A 3EVUA 3TDUA 2MLFC 4HSZA 1SL9A 2M97A 3NXAA 2OTGB 3O4YA 1BOCA 1IRJA 1KK8B 4U8DA 4CIDA 3FWBA 2K7BA 4MBEA 1FPWA 4N5XA 2LV7A 3SG3A 1UURA 1R2UA 3BOWB 1S6CA 1SKTA 1CNPA 1PSBA 2BBNA 2BE6A 1CLMA 3VROA 4OR9B 1MWNA 1Y6WA 2R2IA 4YGAA 1WRZA 1S5GZ 1V1FA 2KBMA 4GAOA 4D1EA 1NCZA 4PE0A 3BOWA 1CDPA 4ORAB 1Y1XA 2HQWA 1AK8A 1V1GA 3GK1A 2F8PA 2FCDA 1K94A 1UUSA 1SR6C 3CR4X 1BU3A 1LKJA 1K9PA 1YVLA 3I5IB 4WQ3A 1KK7Z 2JQ6A 1KCYA 2F3YA 1YUSA 2B1UA 1BODA 2PVBA 2ZNEA 4E68A 4OV2A 3VRPA 4ZCUA 1M39A 2KFFA 2RGIA 1TTXA 5CSIA 3D0YB 1IH0A 2OTGC 4A4BA 5PALA 1LA3A 1KK8C 1BJFA 2PASA 1IJ5A 4I5LB 4OKHA 2I2RE 5I2OA 1SNLA 2QACA 3PATA 2KGRA 2E30A 1PVAA 2LMUA 1EJ3A 3QRXA 2JT8A 1KFXL 1CLLA 3D0YA 2WCBA 5B8IB 4QJ4B 2JXCA 2CCMA 4NDDA 2GGMA 4TNCA 2MBXA 5I2QA 4N1GA 3VRQA 4GNKB 2LUXA 2ZN9A 2TN4A 4N1FA 2G9BA 1IKUA 1J7OA 1X02A 5G08A 1IWQA 1YRUB 2D8NA 1B7TZ 1QX7A 2M49B 1KSOA 2SCPA 4JQ0D 4ORCB 1G4YR 5HYDA 1SYMA 1BR4B 1MQ1A 5HKZA 1QX5B 2NZ0A 3I5IC 4HREE 4ICBA 1W7JB 1RFJA 4L9MA 4PHKA 1M63B 3TDZA 1L2OB 1CFPA 1ZMZA 3PM8A 2GV5A 2L51A 1AJ5A 2MA2A 3K21A 1J1DA 4AOMA 4M2OA 1OMRA 1OOJA 4HRGA 2VRGA 1HQVA 1NWDA 4PCWA 4PDZA 1K96A 3O78A 1LVCD 3SG7A 2G2BA 2K61A 3ZWHA 5JOLA 1MUXA 2LAPA 5JJGA 2KI6C 2Q4UA 4M2QA 5CSFA 1H8BA 1CDMA 2KAYA 3KEVA 4YGBB 2ZN8A 5AFPA 3EK4A 3M0WA 1F54A
chains in the Genus database with same CATH superfamily
1K9KA 3CR2A 1NX2A 1CFFA 4GBAA 5CSNA 1DVIA 1XVJA 1QATA 1UHNA 1DC1A 2WCEA 3FE6A 2H2KA 4YGDB 2KDHA 1CFCA 3OX6A 2L4IA 1TNPA 2M1UA 1VRKA 4BY4A 1F70A 2MJWB 1NPQA 4PE4A 3L4LA 3B6XA 3SG4A 2KHNA 5I8NA 3EVVA 4DCKA 5K89A 1OZOA 1SW8A 2KAXA 1QIVA 2LLUA 1CDLA 1MXEA 2CBLA 4MZKA 4XYNA 2KI6D 4Q04A 2KNEA 4OZDA 2BBMA 1S1EA 1NIWA 3R1PA 1IJ6A 4P5OE 2M7LA 1OE9B 4PHJA 1TCFA 1Y1UA 3LK0A 1IIOA 1SR6B 3D78A 1F4OA 1E8AA 3OP0A 4ETOA 3OX5A 1XO5A 3NHTA 1AJ4A 1QTXA 1JFJA 2L5XB 1EG3A 2WOSA 1RTP1 2L2EA 3B7AA 3O6BA 1UHJA 1OOIX 4KYNA 3GK2A 4C0LA 2JNXA 2LHIA 1R6PA 1ORGA 2NXQA 3WXAA 1XA5A 2M29A 2K7DA 2L0PA 3D75A 5D7FA 1TNQA 1JF2A 1TUZA 2F3ZA 5BPJA 1T14A 4C0JA 1IG5A 1J7QA 1BR1B 1J1EA 3GK4X 5FI2A 2ZFDA 2MHHA 1QJTA 1C3YA 2F2OA 2MAZA 2BCXA 2I94A 1P28A 1WDCB 3EVRA 4NDCA 3VRNA 3CDNA 1DJWA 3OBVA 2LVJA 4NDBA 2JTTA 1K93D 1GQMA 4P2YB 1RROA 2P71A 3FE9A 3LLEA 1YVHA 1EG4A 3FIAA 2GTEA 1LINA 3DZTA 4PHMA 3BQ3A 4QJ3B 1SL8A 4PT1A 2BCBA 4MSPA 1F4QA 5I94A 2CXJA 2M8UA 3PLFB 3B86A 1B4CA 5HKWA 1CLBA 3IQQA 5D69A 1KQMB 1EL4A 1OOHA 1S3PA 3EG5B 1A03A 1UP5A 1AP4A 1JBAA 3BUXB 4GUKA 2ZKMX 1EXRA 1ZACA 3JVTB 3KO0A 2F2PA 2PQLA 2AMIA 5DKQA 1N65A 5FI7A 2AUCA 2LP2A 2WC6A 4OCIA 1WLMA 3BUWB 3SG5A 1MHOA 5I2LA 4CPVA 1WDCC 2LLTA 3QMEA 4NQGA 3S0AA 2OPOA 1KFUS 5AXIA 3OB2B 1B8RA 1BG1A 1OZSA 2KPHA 5FI6A 1RWYA 2JPOA 1DQEA 2KSPA 2LC5A 4MLWA 2ISDA 4GFTA 2LMTA 3FWCA 3A8RA 4GGNA 1TWOA 4BY5A 1WLZA 1GGWA 1PRWA 1QLKA 1PULA 4MN0A 1IQ5A 3CABA 5CPVA 2KYFA 1DGUA 3BFHA 2FCEA 1KQMC 3CS1A 1SCVA 2BCAA 3OHMB 3BFBA 3DVJA 1CM4A 2L4HA 3B87A 3JVTC 3LL8B 5HLVA 1TNWA 1XFYO 3I5FB 4I5NB 2K8MB 1B1GA 2HQ8A 1FBVA 1FF1A 1CFDA 1DT7B 1JC2A 3SG6A 1Z4HA 2LVVA 1RK9A 3KHEA 2M7NA 1JF0A 1J7PA 2V53A 1PVBA 1XFVO 1OOFA 1N2DA 3BYAA 1KWOB 1MF8B 2BAPA 2JT3A 4DS7A 3CYZA 2KYCA 1SMGA 3RM1A 4GGFA 3LK1A 3PFVA 1M31A 1IQ3A 3E3RA 2QEVA 2COLB 3TUYB 1QV0A 2MLEC 4CLNA 2O60A 1QWVA 2KQYA 4MRXA 5ER5A 1SY9A 1MR8A 2EGDA 1TCOB 2M9GA 2Q91A 1DTLA 2K2AA 1QS7A 1DEKA 4INXA 1BLQA 1CDNA 1JFKA 1G33A 1QX2A 2ZRSA 1TRFA 2BKIB 1U5IB 1KFXS 1CMGA 4I5JA 3CR5X 4MVFA 1J7RA 2PMYA 1DMOA 3K1EA 1F8HA 3VB1A 3S0FA 2P70A 2ERBA 3I5FC 3NSKA 3D10A 2KI4B 2GGZA 2PYQA 3L47A 3ZNIA 1UHKA 1F55A 4WRIA 1S5GY 3MSEB 4GGFC 4ZCVA 3R1OA 1QVIY 1U5IA 5FYXA 1YURA 1QASA 4INWA 4YGCB 4YRUA 3BUNB 3S0GA 1KWOC 2CNPA 3CWGA 3AKAA 2OS8B 4GPLB 2JU0A 1SPYA 5HKZA 4XJKB 2JC2A 1L7ZA 1A75B 2WORA 1G8IA 3JTDB 1C07A 1RJVA 1QIWA 2QPTA 1YX8A 1KK7Y 1D1OA 3TUYC 2LMVA 1CKKA 4PHNA 2LANA 3SIAA 3AKBA 1PSRA 2Y1MA 5IBWA 5KTYA 3EK8A 1FW4A 2QEBA 2H8VA 2JTZA 3CZTX 4XJKA 1A75A 1DGVA 2QDIA 1TN4A 1LS8A 4JKTA 4JWQA 5EL2A 3D76A 3EKJA 3WHTB 3NSOA 1PK0D 1QXPA 4YI8A 4C0KA 3Q8IA 1DJXA 2JNFA 4UPGA 3EK7A 1KQVA 1ODBA 3I5GC 1FI5A 1WY9A 1S36A 2KI4C 3H4SE 3NGVA 3CZ2A 1TIZA 3DVKA 5ER4X 1A2XA 5AEQA 1XFZO 1AVSA 1SBJA 1Y1AA 2KLDA 3C1VA 1QV1A 1YUUA 4MEWA 1YRTB 2LM5A 4R1EA 3TDIA 1RECA 3GOFA 1B7TY 2OS8C 4AQJA 3WNXB 3JTDC 4DUQA 1YUTA 2FJUB 2HF5A 1YTZC 2LP3A 2KQ6A 2WCFA 5KU1A 2I7AA 2K7OA 2JWWA 3S0BA 2PRUA 1EH2A 1CMFA 1K9UA 2Y4QA 1DJHA 3SS5A 3IF7A 2L98A 5CSJA 2M3WA 3R1VA 1B8CA 1QVIZ 2BKHB 2K60A 1WRKA 2IS9A 3BFAA 3CTNA 4WQ2A 1UHIA 3DXLA 4MZLA 1ALVA 1HT9A 2NCPA 1NUBA 4ORBB 1MXLC 1N0YA 4YGEB 2LUCA 1SK6D 1SL7A 1DF0B 1SCMB 3BXKA 2JT0A 4FQTA 1OSAA 2LVIA 1ZUZA 3S0DA 4DRWA 1CB1A 1OQPA 3HCMA 3LCPC 2BE4A 2DOQA 2LNKA 1LA0A 1AHRA 2LVKA 3VRRA 2E6WA 3HX4A 2JRFA 3ICBA 4MRYA 1H4BA 2PSRA 3IQOA 1K95A 5AANA 1DF0A 3RLZA 1OOGA 2LE9B 5GQQC 3D77A 1TNXA 4IL1A 2WNDA 4I5KA 2JXLA 2P6BB 1K8UA 1NX1A 2H61A 2BECA 2EHBA 1NX3A 1S6JA 2KGBC 1A29A 3BJHA 1ZOTB 4CFRA 2Y5IA 3AAKA 5HLOA 2NLNA 3S0EA 3DVMA 3PALA 2LHLA 1YR5A 4FQOA 1DJGA 3O4XA 3DVEA 2BL0B 3F45A 1A4PA 1NCXA 1AUIB 1J55A 1DJZA 1Y0VH 4YI9A 2ZNDA 3KF9A 1WRLA 4MZJA 1B9AA 1SCMC 2L50A 1BT6A 2HPSA 1IGVA 1CTRA 2FOTA 1Q80A 1DJYA 3AAJA 1ZFSA 2EC6B 3PSRA 2WCJA 5HKYA 2H61C 1FI6A 1B8LA 4YBHB 5F6TA 2MRDA 2NCOA 2AAOA 1B47A 3TZ1A 3I5HB 4DIRA 1XFUO 1F71A 1C7VA 4HRHA 2CTNA 1M46A 2KFHA 5DKRA 3PN7B 4PALA 2KFGA 1UHHA 1UWOA 4IJ7A 2ZRTA 1JSAA 1ALWA 3BUOB 1W7IB 3OGNA 4PE7A 3CLNA 3KPXA 2WCKA 2SASA 3CGAA 3NSIA 1QLSA 1XFWO 1YX7A 1CM1A 2O5GA 1JUOA 1XFXO 3TS5B 1TUJA 2KLEA 3I5GB 3SJSA 2QEOA 2BL0C 1NSHA 2M1KB 3EKHA 2JPTA 4USLA 1L2OC 1XYDA 2KOTA 3PJIA 1K2HA 2LLSA 1NX0A 2PALA 3DY9A 3FS7A 1BMOA 2CT9A 1BF5A 2EC6C 1GJYA 1KSMA 5DKNA 3N7HA 3WHUB 3PM2A 1NYAA 5DICA 2KBIA 2JOJA 2JULA 3RZSA 3I5HC 3VGOA 2WC8A 2K2FA 1XK4A 4CFQA 1K90D 5AERA 4FTGA 3PN7C 2JZIA 2I18A 2F33A 3DD4A 3DF0B 3SS4A 1C7WA 1TOPA 3SG2A 5KSZA 1DJIA 3BUMB 4AQIA 2A4JA 3NSLA 4QJ5B 1LXFC 1OMVA 4F0ZB 1OMDA 4JPZB 1NP8A 5J3XA 4A4CA 3DF0A 2WCLA 3TS5C 1S6IA 1M45A 1SRAA 1W9ZA 3A4UB 3O2PA 3SIBA 2HETA 1PALA 1KFUL 5TNCA 1S26D 2M0RA 3FE8A 3OB1B 4OVNF 1GGZA 2K7CA 2KAVA 2K0JA 3NHIA 1NCYA 2YGUA 1JWDA 1XK4C 4M2PA 2LCPA 2Y1NA 4PE1A 3EVUA 3TDUA 2MLFC 3UO9A 4HSZA 1SL9A 1Z2CB 2M97A 3NXAA 3UNWA 2OTGB 3O4YA 1BOCA 1IRJA 1KK8B 4U8DA 4CIDA 3FWBA 2K7BA 4MBEA 1FPWA 4N5XA 2LV7A 3SG3A 1UURA 1R2UA 3BOWB 1S6CA 1SKTA 1CNPA 1PSBA 2BBNA 2BE6A 1CLMA 2L2CA 4OR9B 3VROA 1MWNA 3CZ1A 1Y6WA 3L4AA 2R2IA 3SS3A 4YGAA 1WRZA 1S5GZ 1V1FA 2KBMA 4GAOA 4D1EA 1NCZA 4PE0A 2FJYA 1CDPA 3BOWA 4ORAB 1C3ZA 1Y1XA 2HQWA 1AK8A 1V1GA 3GK1A 2F8PA 2FCDA 1K94A 1UUSA 1SR6C 2WCHA 3CR4X 1BU3A 1LKJA 1K9PA 1YVLA 3I5IB 3R72A 4WQ3A 1KK7Z 2JQ6A 1KCYA 2F3YA 1YUSA 2B1UA 1BODA 2PVBA 2ZNEA 4E68A 4OV2A 3VRPA 4ZCUA 1M39A 2KFFA 2RGIA 1TTXA 1DELA 5CSIA 3D0YB 1IH0A 2OTGC 4A4BA 5PALA 1LA3A 1KK8C 1BJFA 2PASA 1IJ5A 2WCMA 4I5LB 4OKHA 2I2RE 4F7FA 5I2OA 1SNLA 2QACA 2L5YA 3PATA 2KGRA 1GM0A 2E30A 5D3OA 1PVAA 2LMUA 1EJ3A 3QRXA 2JT8A 5HL1A 1KFXL 1CLLA 3D0YA 2WCBA 3CZ0A 4QJ4B 2JXCA 3D73A 2BNXA 2CCMA 4NDDA 2GGMA 5B8IB 4TNCA 2MBXA 5I2QA 4N1GA 3VRQA 4GNKB 2LUXA 2ZN9A 2TN4A 4N1FA 2G9BA 1IKUA 4JD9A 1OW4A 2QEHA 1J7OA 1X02A 5G08A 1IWQA 1YRUB 2D8NA 1B7TZ 1QX7A 2M49B 1KSOA 2SCPA 4JQ0D 4ORCB 1G4YR 3V2LA 5HYDA 1SYMA 1BR4B 1XFRA 1MQ1A 3B88A 1QX5B 2NZ0A 3I5IC 4HREE 4ICBA 1W7JB 1RFJA 4L9MA 4PHKA 1M63B 3D74A 3TDZA 1L2OB 1CFPA 3DYEA 1ZMZA 3PM8A 2GV5A 2L51A 1AJ5A 2MA2A 3K21A 1J1DA 4AOMA 4M2OA 1OMRA 1OOJA 4HRGA 2VRGA 1HQVA 1NWDA 4PCWA 4PDZA 1K96A 3O78A 1LVCD 3SG7A 2G2BA 2K61A 3ZWHA 5JOLA 1MUXA 2LAPA 5JJGA 2KI6C 2Q4UA 4M2QA 5CSFA 1H8BA 1CDMA 2KAYA 1SSEB 3KEVA 4YGBB 2ZN8A 3IVTA 5AFPA 3EK4A 3M0WA 2WC5A 1F54A
chains in the Genus database with same CATH topology
1K9KA 3CR2A 1NX2A 1CFFA 4GBAA 5CSNA 1DVIA 1XVJA 1QATA 1UHNA 2WCEA 2H2KA 4YGDB 2KDHA 1CFCA 3OX6A 2L4IA 1TNPA 2M1UA 1VRKA 4BY4A 1F70A 2MJWB 1NPQA 4PE4A 3SG4A 2KHNA 5I8NA 3EVVA 4DCKA 5K89A 1OZOA 1SW8A 2KAXA 1QIVA 2LLUA 1CDLA 1MXEA 2CBLA 4MZKA 4XYNA 2KI6D 4Q04A 2KNEA 2BBMA 1S1EA 1NIWA 1IJ6A 4P5OE 2M7LA 1OE9B 4PHJA 1TCFA 1Y1UA 3LK0A 1SR6B 1F4OA 1E8AA 3OP0A 4ETOA 3OX5A 1XO5A 1AJ4A 1QTXA 1JFJA 2L5XB 1EG3A 2WOSA 1RTP1 2L2EA 3O6BA 1UHJA 3GK2A 4C0LA 2JNXA 2LHIA 1R6PA 2NXQA 3WXAA 1XA5A 2M29A 2K7DA 2L0PA 5D7FA 1TNQA 1JF2A 5BPJA 2F3ZA 4C0JA 1IG5A 1J7QA 1BR1B 1J1EA 3GK4X 2ZFDA 2MHHA 1QJTA 2F2OA 2MAZA 2BCXA 2I94A 1WDCB 3EVRA 4NDCA 3VRNA 1DJWA 4NDBA 2LVJA 2JTTA 1K93D 1GQMA 4P2YB 1RROA 3LLEA 1YVHA 1EG4A 3FIAA 4PHMA 1LINA 4BY5A 3BQ3A 4QJ3B 1SL8A 2BCBA 4MSPA 1F4QA 2CXJA 2M8UA 3PLFB 1B4CA 5HKWA 1CLBA 3IQQA 5D69A 1KQMB 1EL4A 1S3PA 1A03A 1UP5A 1AP4A 1JBAA 3BUXB 4GUKA 2ZKMX 1EXRA 1ZACA 3JVTB 3KO0A 2F2PA 2AMIA 5DKQA 1N65A 2AUCA 2LP2A 4OCIA 1WLMA 3BUWB 3SG5A 1MHOA 5I2LA 4CPVA 1WDCC 2LLTA 4NQGA 2OPOA 1KFUS 5AXIA 3OB2B 1B8RA 1BG1A 1OZSA 2ISDA 1RWYA 2KSPA 2LC5A 4MLWA 4GFTA 2LMTA 3FWCA 3A8RA 4GGNA 1WLZA 1GGWA 1PRWA 1QLKA 1PULA 4MN0A 1IQ5A 5CPVA 2KYFA 1DGUA 2FCEA 1KQMC 3CS1A 1SCVA 2BCAA 3OHMB 3DVJA 1CM4A 2L4HA 3JVTC 3LL8B 5HLVA 1TNWA 1XFYO 3I5FB 4I5NB 2K8MB 1B1GA 2HQ8A 1FBVA 1FF1A 1CFDA 1DT7B 1JC2A 3SG6A 2LVVA 1RK9A 3KHEA 2M7NA 1JF0A 1J7PA 2V53A 1PVBA 1XFVO 3BYAA 1N2DA 1KWOB 1MF8B 4DS7A 2JT3A 2KYCA 1SMGA 3RM1A 4GGFA 3LK1A 3PFVA 1M31A 1IQ3A 3E3RA 2COLB 3TUYB 1QV0A 2MLEC 4CLNA 2O60A 2KQYA 4MRXA 5ER5A 1SY9A 1MR8A 2EGDA 1TCOB 2M9GA 2Q91A 1DTLA 2K2AA 1QS7A 1BLQA 1CDNA 1JFKA 1G33A 1QX2A 2ZRSA 1TRFA 2BKIB 1U5IB 1KFXS 1CMGA 4I5JA 3CR5X 4MVFA 1J7RA 2PMYA 1DMOA 1F8HA 3I5FC 3NSKA 3D10A 2KI4B 2GGZA 3ZNIA 1UHKA 1F55A 4WRIA 1S5GY 3MSEB 4GGFC 4ZCVA 1QVIY 1U5IA 5FYXA 1YURA 1QASA 4YGCB 4YRUA 3BUNB 1KWOC 2CNPA 3CWGA 3AKAA 2OS8B 4GPLB 2JU0A 1SPYA 4XJKB 2JC2A 1L7ZA 1A75B 2WORA 1G8IA 3JTDB 1C07A 1RJVA 1QIWA 2QPTA 1YX8A 1KK7Y 1D1OA 3TUYC 2LMVA 1CKKA 4PHNA 2LANA 3SIAA 3AKBA 1PSRA 2Y1MA 5IBWA 5KTYA 3EK8A 1FW4A 2JTZA 4XJKA 3CZTX 1A75A 1DGVA 1TN4A 4JWQA 3EKJA 3WHTB 3NSOA 1PK0D 1QXPA 4YI8A 4C0KA 1DJXA 2JNFA 4UPGA 3EK7A 1KQVA 1ODBA 3I5GC 1FI5A 1WY9A 1S36A 2KI4C 3H4SE 1TIZA 3DVKA 5ER4X 1A2XA 5AEQA 1XFZO 1AVSA 1SBJA 1Y1AA 3C1VA 1QV1A 1YUUA 4MEWA 1YRTB 2LM5A 4R1EA 3TDIA 1RECA 3GOFA 1B7TY 2OS8C 4AQJA 3WNXB 3JTDC 4DUQA 1YUTA 2FJUB 2HF5A 1YTZC 2LP3A 2KQ6A 2WCFA 5KU1A 2I7AA 2K7OA 2JWWA 2PRUA 1EH2A 1CMFA 1K9UA 2Y4QA 1DJHA 3IF7A 2L98A 5CSJA 2M3WA 1B8CA 1QVIZ 2BKHB 1WRKA 2IS9A 3CTNA 4WQ2A 1UHIA 4MZLA 1ALVA 1HT9A 2NCPA 1NUBA 4ORBB 1MXLC 1N0YA 4YGEB 2LUCA 1SK6D 1SL7A 1DF0B 1SCMB 3BXKA 2JT0A 4DRWA 1OSAA 2LVIA 1ZUZA 1CB1A 1OQPA 3HCMA 3LCPC 2BE4A 2DOQA 2LNKA 1LA0A 1AHRA 2LVKA 3VRRA 2E6WA 3HX4A 2JRFA 3ICBA 4MRYA 1H4BA 2PSRA 3IQOA 1K95A 5AANA 1DF0A 3RLZA 2LE9B 5GQQC 1TNXA 4IL1A 2WNDA 4I5KA 2JXLA 2P6BB 1K8UA 1NX1A 2H61A 2BECA 2EHBA 1NX3A 1S6JA 2KGBC 1A29A 1ZOTB 4CFRA 2Y5IA 3AAKA 5HLOA 2NLNA 3DVMA 3PALA 2LHLA 1YR5A 4FQOA 1DJGA 3DVEA 2BL0B 3F45A 1A4PA 1NCXA 1AUIB 1J55A 1DJZA 1Y0VH 4YI9A 2ZNDA 3KF9A 1WRLA 4MZJA 1B9AA 1SCMC 2L50A 1BT6A 2HPSA 1IGVA 1CTRA 2FOTA 1Q80A 1DJYA 3AAJA 1ZFSA 2EC6B 3PSRA 5HKYA 2H61C 1FI6A 1B8LA 4YBHB 5F6TA 2MRDA 2NCOA 2AAOA 1B47A 3TZ1A 3I5HB 4DIRA 1XFUO 1F71A 1C7VA 4HRHA 2CTNA 1M46A 2KFHA 5DKRA 3PN7B 4PALA 2KFGA 1UHHA 1UWOA 2ZRTA 1JSAA 1ALWA 3BUOB 1W7IB 4PE7A 3CLNA 3KPXA 2SASA 3CGAA 3NSIA 1QLSA 1XFWO 1CM1A 1YX7A 2O5GA 1JUOA 1XFXO 3TS5B 3I5GB 3SJSA 2BL0C 1NSHA 2M1KB 3EKHA 2JPTA 4USLA 1L2OC 1XYDA 2KOTA 1K2HA 2LLSA 1NX0A 2PALA 3FS7A 1BMOA 2CT9A 1BF5A 2EC6C 1GJYA 1KSMA 5DKNA 3WHUB 1NYAA 2KBIA 2JOJA 2JULA 3I5HC 3VGOA 2WC8A 2K2FA 1XK4A 4CFQA 1K90D 5AERA 4FTGA 3PN7C 2JZIA 2I18A 2F33A 3DD4A 3DF0B 1C7WA 1TOPA 3SG2A 5KSZA 1DJIA 3BUMB 4AQIA 2A4JA 3NSLA 4QJ5B 1LXFC 1OMVA 4F0ZB 1OMDA 4JPZB 1NP8A 5J3XA 4A4CA 3DF0A 3TS5C 1S6IA 1M45A 1SRAA 3O2PA 3A4UB 3SIBA 2HETA 1PALA 1KFUL 5TNCA 1S26D 2M0RA 3OB1B 4OVNF 1GGZA 2K7CA 2KAVA 2K0JA 1JWDA 1NCYA 1XK4C 4M2PA 2LCPA 2Y1NA 4PE1A 3EVUA 3TDUA 2MLFC 4HSZA 1SL9A 2M97A 3NXAA 2OTGB 3O4YA 1BOCA 1IRJA 1KK8B 4U8DA 4CIDA 3FWBA 2K7BA 4MBEA 1FPWA 4N5XA 2LV7A 3SG3A 1UURA 1R2UA 3BOWB 1S6CA 1SKTA 1CNPA 1PSBA 2BBNA 2BE6A 1CLMA 3VROA 4OR9B 1MWNA 1Y6WA 2R2IA 4YGAA 1WRZA 1S5GZ 1V1FA 2KBMA 4GAOA 4D1EA 1NCZA 4PE0A 3BOWA 1CDPA 4ORAB 1Y1XA 2HQWA 1AK8A 1V1GA 3GK1A 2F8PA 2FCDA 1K94A 1UUSA 1SR6C 3CR4X 1BU3A 1LKJA 1K9PA 1YVLA 3I5IB 4WQ3A 1KK7Z 2JQ6A 1KCYA 2F3YA 1YUSA 2B1UA 1BODA 2PVBA 2ZNEA 4E68A 4OV2A 3VRPA 4ZCUA 1M39A 2KFFA 2RGIA 1TTXA 5CSIA 3D0YB 1IH0A 2OTGC 4A4BA 5PALA 1LA3A 1KK8C 1BJFA 2PASA 1IJ5A 4I5LB 4OKHA 2I2RE 5I2OA 1SNLA 2QACA 3PATA 2KGRA 2E30A 1PVAA 2LMUA 1EJ3A 3QRXA 2JT8A 1KFXL 1CLLA 3D0YA 2WCBA 5B8IB 4QJ4B 2JXCA 2CCMA 4NDDA 2GGMA 4TNCA 2MBXA 5I2QA 4N1GA 3VRQA 4GNKB 2LUXA 2ZN9A 2TN4A 4N1FA 2G9BA 1IKUA 1J7OA 1X02A 5G08A 1IWQA 1YRUB 2D8NA 1B7TZ 1QX7A 2M49B 1KSOA 2SCPA 4JQ0D 4ORCB 1G4YR 5HYDA 1SYMA 1BR4B 1MQ1A 5HKZA 1QX5B 2NZ0A 3I5IC 4HREE 4ICBA 1W7JB 1RFJA 4L9MA 4PHKA 1M63B 3TDZA 1L2OB 1CFPA 1ZMZA 3PM8A 2GV5A 2L51A 1AJ5A 2MA2A 3K21A 1J1DA 4AOMA 4M2OA 1OMRA 1OOJA 4HRGA 2VRGA 1HQVA 1NWDA 4PCWA 4PDZA 1K96A 3O78A 1LVCD 3SG7A 2G2BA 2K61A 3ZWHA 5JOLA 1MUXA 2LAPA 5JJGA 2KI6C 2Q4UA 4M2QA 5CSFA 1H8BA 1CDMA 2KAYA 3KEVA 4YGBB 2ZN8A 5AFPA 3EK4A 3M0WA 1F54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9K A;  3CR2 A;  1NX2 A;  1CFF A;  4GBA A;  5CSN A;  1DVI A;  1XVJ A;  1QAT A;  1UHN A;  2WCE A;  2H2K A;  4YGD B;  2KDH A;  1CFC A;  3OX6 A;  2L4I A;  1TNP A;  2M1U A;  1VRK A;  4BY4 A;  1F70 A;  2MJW B;  1NPQ A;  4PE4 A;  3SG4 A;  2KHN A;  5I8N A;  3EVV A;  4DCK A;  5K89 A;  1OZO A;  1SW8 A;  2KAX A;  1QIV A;  2LLU A;  1CDL A;  1MXE A;  2CBL A;  4MZK A;  4XYN A;  2KI6 D;  4Q04 A;  2KNE A;  2BBM A;  1S1E A;  1NIW A;  1IJ6 A;  4P5O E;  2M7L A;  1OE9 B;  4PHJ A;  1TCF A;  1Y1U A;  3LK0 A;  1SR6 B;  1F4O A;  1E8A A;  3OP0 A;  4ETO A;  3OX5 A;  1XO5 A;  1AJ4 A;  1QTX A;  1JFJ A;  2L5X B;  1EG3 A;  2WOS A;  1RTP 1;  2L2E A;  3O6B A;  1UHJ A;  3GK2 A;  4C0L A;  2JNX A;  2LHI A;  1R6P A;  2NXQ A;  3WXA A;  1XA5 A;  2M29 A;  2K7D A;  2L0P A;  5D7F A;  1TNQ A;  1JF2 A;  5BPJ A;  2F3Z A;  4C0J A;  1IG5 A;  1J7Q A;  1BR1 B;  1J1E A;  3GK4 X;  2ZFD A;  2MHH A;  1QJT A;  2F2O A;  2MAZ A;  2BCX A;  2I94 A;  1WDC B;  3EVR A;  4NDC A;  3VRN A;  1DJW A;  4NDB A;  2LVJ A;  2JTT A;  1K93 D;  1GQM A;  4P2Y B;  1RRO A;  3LLE A;  1YVH A;  1EG4 A;  3FIA A;  4PHM A;  1LIN A;  4BY5 A;  3BQ3 A;  4QJ3 B;  1SL8 A;  2BCB A;  4MSP A;  1F4Q A;  2CXJ A;  2M8U A;  3PLF B;  1B4C A;  5HKW A;  1CLB A;  3IQQ A;  5D69 A;  1KQM B;  1EL4 A;  1S3P A;  1A03 A;  1UP5 A;  1AP4 A;  1JBA A;  3BUX B;  4GUK A;  2ZKM X;  1EXR A;  1ZAC A;  3JVT B;  3KO0 A;  2F2P A;  2AMI A;  5DKQ A;  1N65 A;  2AUC A;  2LP2 A;  4OCI A;  1WLM A;  3BUW B;  3SG5 A;  1MHO A;  5I2L A;  4CPV A;  1WDC C;  2LLT A;  4NQG A;  2OPO A;  1KFU S;  5AXI A;  3OB2 B;  1B8R A;  1BG1 A;  1OZS A;  2ISD A;  1RWY A;  2KSP A;  2LC5 A;  4MLW A;  4GFT A;  2LMT A;  3FWC A;  3A8R A;  4GGN A;  1WLZ A;  1GGW A;  1PRW A;  1QLK A;  1PUL A;  4MN0 A;  1IQ5 A;  5CPV A;  2KYF A;  1DGU A;  2FCE A;  1KQM C;  3CS1 A;  1SCV A;  2BCA A;  3OHM B;  3DVJ A;  1CM4 A;  2L4H A;  3JVT C;  3LL8 B;  5HLV A;  1TNW A;  1XFY O;  3I5F B;  4I5N B;  2K8M B;  1B1G A;  2HQ8 A;  1FBV A;  1FF1 A;  1CFD A;  1DT7 B;  1JC2 A;  3SG6 A;  2LVV A;  1RK9 A;  3KHE A;  2M7N A;  1JF0 A;  1J7P A;  2V53 A;  1PVB A;  1XFV O;  3BYA A;  1N2D A;  1KWO B;  1MF8 B;  4DS7 A;  2JT3 A;  2KYC A;  1SMG A;  3RM1 A;  4GGF A;  3LK1 A;  3PFV A;  1M31 A;  1IQ3 A;  3E3R A;  2COL B;  3TUY B;  1QV0 A;  2MLE C;  4CLN A;  2O60 A;  2KQY A;  4MRX A;  5ER5 A;  1SY9 A;  1MR8 A;  2EGD A;  1TCO B;  2M9G A;  2Q91 A;  1DTL A;  2K2A A;  1QS7 A;  1BLQ A;  1CDN A;  1JFK A;  1G33 A;  1QX2 A;  2ZRS A;  1TRF A;  2BKI B;  1U5I B;  1KFX S;  1CMG A;  4I5J A;  3CR5 X;  4MVF A;  1J7R A;  2PMY A;  1DMO A;  1F8H A;  3I5F C;  3NSK A;  3D10 A;  2KI4 B;  2GGZ A;  3ZNI A;  1UHK A;  1F55 A;  4WRI A;  1S5G Y;  3MSE B;  4GGF C;  4ZCV A;  1QVI Y;  1U5I A;  5FYX A;  1YUR A;  1QAS A;  4YGC B;  4YRU A;  3BUN B;  1KWO C;  2CNP A;  3CWG A;  3AKA A;  2OS8 B;  4GPL B;  2JU0 A;  1SPY A;  4XJK B;  2JC2 A;  1L7Z A;  1A75 B;  2WOR A;  1G8I A;  3JTD B;  1C07 A;  1RJV A;  1QIW A;  2QPT A;  1YX8 A;  1KK7 Y;  1D1O A;  3TUY C;  2LMV A;  1CKK A;  4PHN A;  2LAN A;  3SIA A;  3AKB A;  1PSR A;  2Y1M A;  5IBW A;  5KTY A;  3EK8 A;  1FW4 A;  2JTZ A;  4XJK A;  3CZT X;  1A75 A;  1DGV A;  1TN4 A;  4JWQ A;  3EKJ A;  3WHT B;  3NSO A;  1PK0 D;  1QXP A;  4YI8 A;  4C0K A;  1DJX A;  2JNF A;  4UPG A;  3EK7 A;  1KQV A;  1ODB A;  3I5G C;  1FI5 A;  1WY9 A;  1S36 A;  2KI4 C;  3H4S E;  1TIZ A;  3DVK A;  5ER4 X;  1A2X A;  5AEQ A;  1XFZ O;  1AVS A;  1SBJ A;  1Y1A A;  3C1V A;  1QV1 A;  1YUU A;  4MEW A;  1YRT B;  2LM5 A;  4R1E A;  3TDI A;  1REC A;  3GOF A;  1B7T Y;  2OS8 C;  4AQJ A;  3WNX B;  3JTD C;  4DUQ A;  1YUT A;  2FJU B;  2HF5 A;  1YTZ C;  2LP3 A;  2KQ6 A;  2WCF A;  5KU1 A;  2I7A A;  2K7O A;  2JWW A;  2PRU A;  1EH2 A;  1CMF A;  1K9U A;  2Y4Q A;  1DJH A;  3IF7 A;  2L98 A;  5CSJ A;  2M3W A;  1B8C A;  1QVI Z;  2BKH B;  1WRK A;  2IS9 A;  3CTN A;  4WQ2 A;  1UHI A;  4MZL A;  1ALV A;  1HT9 A;  2NCP A;  1NUB A;  4ORB B;  1MXL C;  1N0Y A;  4YGE B;  2LUC A;  1SK6 D;  1SL7 A;  1DF0 B;  1SCM B;  3BXK A;  2JT0 A;  4DRW A;  1OSA A;  2LVI A;  1ZUZ A;  1CB1 A;  1OQP A;  3HCM A;  3LCP C;  2BE4 A;  2DOQ A;  2LNK A;  1LA0 A;  1AHR A;  2LVK A;  3VRR A;  2E6W A;  3HX4 A;  2JRF A;  3ICB A;  4MRY A;  1H4B A;  2PSR A;  3IQO A;  1K95 A;  5AAN A;  1DF0 A;  3RLZ A;  2LE9 B;  5GQQ C;  1TNX A;  4IL1 A;  2WND A;  4I5K A;  2JXL A;  2P6B B;  1K8U A;  1NX1 A;  2H61 A;  2BEC A;  2EHB A;  1NX3 A;  1S6J A;  2KGB C;  1A29 A;  1ZOT B;  4CFR A;  2Y5I A;  3AAK A;  5HLO A;  2NLN A;  3DVM A;  3PAL A;  2LHL A;  1YR5 A;  4FQO A;  1DJG A;  3DVE A;  2BL0 B;  3F45 A;  1A4P A;  1NCX A;  1AUI B;  1J55 A;  1DJZ A;  1Y0V H;  4YI9 A;  2ZND A;  3KF9 A;  1WRL A;  4MZJ A;  1B9A A;  1SCM C;  2L50 A;  1BT6 A;  2HPS A;  1IGV A;  1CTR A;  2FOT A;  1Q80 A;  1DJY A;  3AAJ A;  1ZFS A;  2EC6 B;  3PSR A;  5HKY A;  2H61 C;  1FI6 A;  1B8L A;  4YBH B;  5F6T A;  2MRD A;  2NCO A;  2AAO A;  1B47 A;  3TZ1 A;  3I5H B;  4DIR A;  1XFU O;  1F71 A;  1C7V A;  4HRH A;  2CTN A;  1M46 A;  2KFH A;  5DKR A;  3PN7 B;  4PAL A;  2KFG A;  1UHH A;  1UWO A;  2ZRT A;  1JSA A;  1ALW A;  3BUO B;  1W7I B;  4PE7 A;  3CLN A;  3KPX A;  2SAS A;  3CGA A;  3NSI A;  1QLS A;  1XFW O;  1CM1 A;  1YX7 A;  2O5G A;  1JUO A;  1XFX O;  3TS5 B;  3I5G B;  3SJS A;  2BL0 C;  1NSH A;  2M1K B;  3EKH A;  2JPT A;  4USL A;  1L2O C;  1XYD A;  2KOT A;  1K2H A;  2LLS A;  1NX0 A;  2PAL A;  3FS7 A;  1BMO A;  2CT9 A;  1BF5 A;  2EC6 C;  1GJY A;  1KSM A;  5DKN A;  3WHU B;  1NYA A;  2KBI A;  2JOJ A;  2JUL A;  3I5H C;  3VGO A;  2WC8 A;  2K2F A;  1XK4 A;  4CFQ A;  1K90 D;  5AER A;  4FTG A;  3PN7 C;  2JZI A;  2I18 A;  2F33 A;  3DD4 A;  3DF0 B;  1C7W A;  1TOP A;  3SG2 A;  5KSZ A;  1DJI A;  3BUM B;  4AQI A;  2A4J A;  3NSL A;  4QJ5 B;  1LXF C;  1OMV A;  4F0Z B;  1OMD A;  4JPZ B;  1NP8 A;  5J3X A;  4A4C A;  3DF0 A;  3TS5 C;  1S6I A;  1M45 A;  1SRA A;  3O2P A;  3A4U B;  3SIB A;  2HET A;  1PAL A;  1KFU L;  5TNC A;  1S26 D;  2M0R A;  3OB1 B;  4OVN F;  1GGZ A;  2K7C A;  2KAV A;  2K0J A;  1JWD A;  1NCY A;  1XK4 C;  4M2P A;  2LCP A;  2Y1N A;  4PE1 A;  3EVU A;  3TDU A;  2MLF C;  4HSZ A;  1SL9 A;  2M97 A;  3NXA A;  2OTG B;  3O4Y A;  1BOC A;  1IRJ A;  1KK8 B;  4U8D A;  4CID A;  3FWB A;  2K7B A;  4MBE A;  1FPW A;  4N5X A;  2LV7 A;  3SG3 A;  1UUR A;  1R2U A;  3BOW B;  1S6C A;  1SKT A;  1CNP A;  1PSB A;  2BBN A;  2BE6 A;  1CLM A;  3VRO A;  4OR9 B;  1MWN A;  1Y6W A;  2R2I A;  4YGA A;  1WRZ A;  1S5G Z;  1V1F A;  2KBM A;  4GAO A;  4D1E A;  1NCZ A;  4PE0 A;  3BOW A;  1CDP A;  4ORA B;  1Y1X A;  2HQW A;  1AK8 A;  1V1G A;  3GK1 A;  2F8P A;  2FCD A;  1K94 A;  1UUS A;  1SR6 C;  3CR4 X;  1BU3 A;  1LKJ A;  1K9P A;  1YVL A;  3I5I B;  4WQ3 A;  1KK7 Z;  2JQ6 A;  1KCY A;  2F3Y A;  1YUS A;  2B1U A;  1BOD A;  2PVB A;  2ZNE A;  4E68 A;  4OV2 A;  3VRP A;  4ZCU A;  1M39 A;  2KFF A;  2RGI A;  1TTX A;  5CSI A;  3D0Y B;  1IH0 A;  2OTG C;  4A4B A;  5PAL A;  1LA3 A;  1KK8 C;  1BJF A;  2PAS A;  1IJ5 A;  4I5L B;  4OKH A;  2I2R E;  5I2O A;  1SNL A;  2QAC A;  3PAT A;  2KGR A;  2E30 A;  1PVA A;  2LMU A;  1EJ3 A;  3QRX A;  2JT8 A;  1KFX L;  1CLL A;  3D0Y A;  2WCB A;  5B8I B;  4QJ4 B;  2JXC A;  2CCM A;  4NDD A;  2GGM A;  4TNC A;  2MBX A;  5I2Q A;  4N1G A;  3VRQ A;  4GNK B;  2LUX A;  2ZN9 A;  2TN4 A;  4N1F A;  2G9B A;  1IKU A;  1J7O A;  1X02 A;  5G08 A;  1IWQ A;  1YRU B;  2D8N A;  1B7T Z;  1QX7 A;  2M49 B;  1KSO A;  2SCP A;  4JQ0 D;  4ORC B;  1G4Y R;  5HYD A;  1SYM A;  1BR4 B;  1MQ1 A;  5HKZ A;  1QX5 B;  2NZ0 A;  3I5I C;  4HRE E;  4ICB A;  1W7J B;  1RFJ A;  4L9M A;  4PHK A;  1M63 B;  3TDZ A;  1L2O B;  1CFP A;  1ZMZ A;  3PM8 A;  2GV5 A;  2L51 A;  1AJ5 A;  2MA2 A;  3K21 A;  1J1D A;  4AOM A;  4M2O A;  1OMR A;  1OOJ A;  4HRG A;  2VRG A;  1HQV A;  1NWD A;  4PCW A;  4PDZ A;  1K96 A;  3O78 A;  1LVC D;  3SG7 A;  2G2B A;  2K61 A;  3ZWH A;  5JOL A;  1MUX A;  2LAP A;  5JJG A;  2KI6 C;  2Q4U A;  4M2Q A;  5CSF A;  1H8B A;  1CDM A;  2KAY A;  3KEV A;  4YGB B;  2ZN8 A;  5AFP A;  3EK4 A;  3M0W A;  1F54 A; 
#chains in the Genus database with same CATH topology
 1K9K A;  3CR2 A;  1NX2 A;  1CFF A;  4GBA A;  5CSN A;  1DVI A;  1XVJ A;  1QAT A;  1UHN A;  1DC1 A;  2WCE A;  3FE6 A;  2H2K A;  4YGD B;  2KDH A;  1CFC A;  3OX6 A;  2L4I A;  1TNP A;  2M1U A;  1VRK A;  4BY4 A;  1F70 A;  2MJW B;  1NPQ A;  4PE4 A;  3L4L A;  3B6X A;  3SG4 A;  2KHN A;  5I8N A;  3EVV A;  4DCK A;  5K89 A;  1OZO A;  1SW8 A;  2KAX A;  1QIV A;  2LLU A;  1CDL A;  1MXE A;  2CBL A;  4MZK A;  4XYN A;  2KI6 D;  4Q04 A;  2KNE A;  4OZD A;  2BBM A;  1S1E A;  1NIW A;  3R1P A;  1IJ6 A;  4P5O E;  2M7L A;  1OE9 B;  4PHJ A;  1TCF A;  1Y1U A;  3LK0 A;  1IIO A;  1SR6 B;  3D78 A;  1F4O A;  1E8A A;  3OP0 A;  4ETO A;  3OX5 A;  1XO5 A;  3NHT A;  1AJ4 A;  1QTX A;  1JFJ A;  2L5X B;  1EG3 A;  2WOS A;  1RTP 1;  2L2E A;  3B7A A;  3O6B A;  1UHJ A;  1OOI X;  4KYN A;  3GK2 A;  4C0L A;  2JNX A;  2LHI A;  1R6P A;  1ORG A;  2NXQ A;  3WXA A;  1XA5 A;  2M29 A;  2K7D A;  2L0P A;  3D75 A;  5D7F A;  1TNQ A;  1JF2 A;  1TUZ A;  2F3Z A;  5BPJ A;  1T14 A;  4C0J A;  1IG5 A;  1J7Q A;  1BR1 B;  1J1E A;  3GK4 X;  5FI2 A;  2ZFD A;  2MHH A;  1QJT A;  1C3Y A;  2F2O A;  2MAZ A;  2BCX A;  2I94 A;  1P28 A;  1WDC B;  3EVR A;  4NDC A;  3VRN A;  3CDN A;  1DJW A;  3OBV A;  2LVJ A;  4NDB A;  2JTT A;  1K93 D;  1GQM A;  4P2Y B;  1RRO A;  2P71 A;  3FE9 A;  3LLE A;  1YVH A;  1EG4 A;  3FIA A;  2GTE A;  1LIN A;  3DZT A;  4PHM A;  3BQ3 A;  4QJ3 B;  1SL8 A;  4PT1 A;  2BCB A;  4MSP A;  1F4Q A;  5I94 A;  2CXJ A;  2M8U A;  3PLF B;  3B86 A;  1B4C A;  5HKW A;  1CLB A;  3IQQ A;  5D69 A;  1KQM B;  1EL4 A;  1OOH A;  1S3P A;  3EG5 B;  1A03 A;  1UP5 A;  1AP4 A;  1JBA A;  3BUX B;  4GUK A;  2ZKM X;  1EXR A;  1ZAC A;  3JVT B;  3KO0 A;  2F2P A;  2PQL A;  2AMI A;  5DKQ A;  1N65 A;  5FI7 A;  2AUC A;  2LP2 A;  2WC6 A;  4OCI A;  1WLM A;  3BUW B;  3SG5 A;  1MHO A;  5I2L A;  4CPV A;  1WDC C;  2LLT A;  3QME A;  4NQG A;  3S0A A;  2OPO A;  1KFU S;  5AXI A;  3OB2 B;  1B8R A;  1BG1 A;  1OZS A;  2KPH A;  5FI6 A;  1RWY A;  2JPO A;  1DQE A;  2KSP A;  2LC5 A;  4MLW A;  2ISD A;  4GFT A;  2LMT A;  3FWC A;  3A8R A;  4GGN A;  1TWO A;  4BY5 A;  1WLZ A;  1GGW A;  1PRW A;  1QLK A;  1PUL A;  4MN0 A;  1IQ5 A;  3CAB A;  5CPV A;  2KYF A;  1DGU A;  3BFH A;  2FCE A;  1KQM C;  3CS1 A;  1SCV A;  2BCA A;  3OHM B;  3BFB A;  3DVJ A;  1CM4 A;  2L4H A;  3B87 A;  3JVT C;  3LL8 B;  5HLV A;  1TNW A;  1XFY O;  3I5F B;  4I5N B;  2K8M B;  1B1G A;  2HQ8 A;  1FBV A;  1FF1 A;  1CFD A;  1DT7 B;  1JC2 A;  3SG6 A;  1Z4H A;  2LVV A;  1RK9 A;  3KHE A;  2M7N A;  1JF0 A;  1J7P A;  2V53 A;  1PVB A;  1XFV O;  1OOF A;  1N2D A;  3BYA A;  1KWO B;  1MF8 B;  2BAP A;  2JT3 A;  4DS7 A;  3CYZ A;  2KYC A;  1SMG A;  3RM1 A;  4GGF A;  3LK1 A;  3PFV A;  1M31 A;  1IQ3 A;  3E3R A;  2QEV A;  2COL B;  3TUY B;  1QV0 A;  2MLE C;  4CLN A;  2O60 A;  1QWV A;  2KQY A;  4MRX A;  5ER5 A;  1SY9 A;  1MR8 A;  2EGD A;  1TCO B;  2M9G A;  2Q91 A;  1DTL A;  2K2A A;  1QS7 A;  1DEK A;  4INX A;  1BLQ A;  1CDN A;  1JFK A;  1G33 A;  1QX2 A;  2ZRS A;  1TRF A;  2BKI B;  1U5I B;  1KFX S;  1CMG A;  4I5J A;  3CR5 X;  4MVF A;  1J7R A;  2PMY A;  1DMO A;  3K1E A;  1F8H A;  3VB1 A;  3S0F A;  2P70 A;  2ERB A;  3I5F C;  3NSK A;  3D10 A;  2KI4 B;  2GGZ A;  2PYQ A;  3L47 A;  3ZNI A;  1UHK A;  1F55 A;  4WRI A;  1S5G Y;  3MSE B;  4GGF C;  4ZCV A;  3R1O A;  1QVI Y;  1U5I A;  5FYX A;  1YUR A;  1QAS A;  4INW A;  4YGC B;  4YRU A;  3BUN B;  3S0G A;  1KWO C;  2CNP A;  3CWG A;  3AKA A;  2OS8 B;  4GPL B;  2JU0 A;  1SPY A;  5HKZ A;  4XJK B;  2JC2 A;  1L7Z A;  1A75 B;  2WOR A;  1G8I A;  3JTD B;  1C07 A;  1RJV A;  1QIW A;  2QPT A;  1YX8 A;  1KK7 Y;  1D1O A;  3TUY C;  2LMV A;  1CKK A;  4PHN A;  2LAN A;  3SIA A;  3AKB A;  1PSR A;  2Y1M A;  5IBW A;  5KTY A;  3EK8 A;  1FW4 A;  2QEB A;  2H8V A;  2JTZ A;  3CZT X;  4XJK A;  1A75 A;  1DGV A;  2QDI A;  1TN4 A;  1LS8 A;  4JKT A;  4JWQ A;  5EL2 A;  3D76 A;  3EKJ A;  3WHT B;  3NSO A;  1PK0 D;  1QXP A;  4YI8 A;  4C0K A;  3Q8I A;  1DJX A;  2JNF A;  4UPG A;  3EK7 A;  1KQV A;  1ODB A;  3I5G C;  1FI5 A;  1WY9 A;  1S36 A;  2KI4 C;  3H4S E;  3NGV A;  3CZ2 A;  1TIZ A;  3DVK A;  5ER4 X;  1A2X A;  5AEQ A;  1XFZ O;  1AVS A;  1SBJ A;  1Y1A A;  2KLD A;  3C1V A;  1QV1 A;  1YUU A;  4MEW A;  1YRT B;  2LM5 A;  4R1E A;  3TDI A;  1REC A;  3GOF A;  1B7T Y;  2OS8 C;  4AQJ A;  3WNX B;  3JTD C;  4DUQ A;  1YUT A;  2FJU B;  2HF5 A;  1YTZ C;  2LP3 A;  2KQ6 A;  2WCF A;  5KU1 A;  2I7A A;  2K7O A;  2JWW A;  3S0B A;  2PRU A;  1EH2 A;  1CMF A;  1K9U A;  2Y4Q A;  1DJH A;  3SS5 A;  3IF7 A;  2L98 A;  5CSJ A;  2M3W A;  3R1V A;  1B8C A;  1QVI Z;  2BKH B;  2K60 A;  1WRK A;  2IS9 A;  3BFA A;  3CTN A;  4WQ2 A;  1UHI A;  3DXL A;  4MZL A;  1ALV A;  1HT9 A;  2NCP A;  1NUB A;  4ORB B;  1MXL C;  1N0Y A;  4YGE B;  2LUC A;  1SK6 D;  1SL7 A;  1DF0 B;  1SCM B;  3BXK A;  2JT0 A;  4FQT A;  1OSA A;  2LVI A;  1ZUZ A;  3S0D A;  4DRW A;  1CB1 A;  1OQP A;  3HCM A;  3LCP C;  2BE4 A;  2DOQ A;  2LNK A;  1LA0 A;  1AHR A;  2LVK A;  3VRR A;  2E6W A;  3HX4 A;  2JRF A;  3ICB A;  4MRY A;  1H4B A;  2PSR A;  3IQO A;  1K95 A;  5AAN A;  1DF0 A;  3RLZ A;  1OOG A;  2LE9 B;  5GQQ C;  3D77 A;  1TNX A;  4IL1 A;  2WND A;  4I5K A;  2JXL A;  2P6B B;  1K8U A;  1NX1 A;  2H61 A;  2BEC A;  2EHB A;  1NX3 A;  1S6J A;  2KGB C;  1A29 A;  3BJH A;  1ZOT B;  4CFR A;  2Y5I A;  3AAK A;  5HLO A;  2NLN A;  3S0E A;  3DVM A;  3PAL A;  2LHL A;  1YR5 A;  4FQO A;  1DJG A;  3O4X A;  3DVE A;  2BL0 B;  3F45 A;  1A4P A;  1NCX A;  1AUI B;  1J55 A;  1DJZ A;  1Y0V H;  4YI9 A;  2ZND A;  3KF9 A;  1WRL A;  4MZJ A;  1B9A A;  1SCM C;  2L50 A;  1BT6 A;  2HPS A;  1IGV A;  1CTR A;  2FOT A;  1Q80 A;  1DJY A;  3AAJ A;  1ZFS A;  2EC6 B;  3PSR A;  2WCJ A;  5HKY A;  2H61 C;  1FI6 A;  1B8L A;  4YBH B;  5F6T A;  2MRD A;  2NCO A;  2AAO A;  1B47 A;  3TZ1 A;  3I5H B;  4DIR A;  1XFU O;  1F71 A;  1C7V A;  4HRH A;  2CTN A;  1M46 A;  2KFH A;  5DKR A;  3PN7 B;  4PAL A;  2KFG A;  1UHH A;  1UWO A;  4IJ7 A;  2ZRT A;  1JSA A;  1ALW A;  3BUO B;  1W7I B;  3OGN A;  4PE7 A;  3CLN A;  3KPX A;  2WCK A;  2SAS A;  3CGA A;  3NSI A;  1QLS A;  1XFW O;  1YX7 A;  1CM1 A;  2O5G A;  1JUO A;  1XFX O;  3TS5 B;  1TUJ A;  2KLE A;  3I5G B;  3SJS A;  2QEO A;  2BL0 C;  1NSH A;  2M1K B;  3EKH A;  2JPT A;  4USL A;  1L2O C;  1XYD A;  2KOT A;  3PJI A;  1K2H A;  2LLS A;  1NX0 A;  2PAL A;  3DY9 A;  3FS7 A;  1BMO A;  2CT9 A;  1BF5 A;  2EC6 C;  1GJY A;  1KSM A;  5DKN A;  3N7H A;  3WHU B;  3PM2 A;  1NYA A;  5DIC A;  2KBI A;  2JOJ A;  2JUL A;  3RZS A;  3I5H C;  3VGO A;  2WC8 A;  2K2F A;  1XK4 A;  4CFQ A;  1K90 D;  5AER A;  4FTG A;  3PN7 C;  2JZI A;  2I18 A;  2F33 A;  3DD4 A;  3DF0 B;  3SS4 A;  1C7W A;  1TOP A;  3SG2 A;  5KSZ A;  1DJI A;  3BUM B;  4AQI A;  2A4J A;  3NSL A;  4QJ5 B;  1LXF C;  1OMV A;  4F0Z B;  1OMD A;  4JPZ B;  1NP8 A;  5J3X A;  4A4C A;  3DF0 A;  2WCL A;  3TS5 C;  1S6I A;  1M45 A;  1SRA A;  1W9Z A;  3A4U B;  3O2P A;  3SIB A;  2HET A;  1PAL A;  1KFU L;  5TNC A;  1S26 D;  2M0R A;  3FE8 A;  3OB1 B;  4OVN F;  1GGZ A;  2K7C A;  2KAV A;  2K0J A;  3NHI A;  1NCY A;  2YGU A;  1JWD A;  1XK4 C;  4M2P A;  2LCP A;  2Y1N A;  4PE1 A;  3EVU A;  3TDU A;  2MLF C;  3UO9 A;  4HSZ A;  1SL9 A;  1Z2C B;  2M97 A;  3NXA A;  3UNW A;  2OTG B;  3O4Y A;  1BOC A;  1IRJ A;  1KK8 B;  4U8D A;  4CID A;  3FWB A;  2K7B A;  4MBE A;  1FPW A;  4N5X A;  2LV7 A;  3SG3 A;  1UUR A;  1R2U A;  3BOW B;  1S6C A;  1SKT A;  1CNP A;  1PSB A;  2BBN A;  2BE6 A;  1CLM A;  2L2C A;  4OR9 B;  3VRO A;  1MWN A;  3CZ1 A;  1Y6W A;  3L4A A;  2R2I A;  3SS3 A;  4YGA A;  1WRZ A;  1S5G Z;  1V1F A;  2KBM A;  4GAO A;  4D1E A;  1NCZ A;  4PE0 A;  2FJY A;  1CDP A;  3BOW A;  4ORA B;  1C3Z A;  1Y1X A;  2HQW A;  1AK8 A;  1V1G A;  3GK1 A;  2F8P A;  2FCD A;  1K94 A;  1UUS A;  1SR6 C;  2WCH A;  3CR4 X;  1BU3 A;  1LKJ A;  1K9P A;  1YVL A;  3I5I B;  3R72 A;  4WQ3 A;  1KK7 Z;  2JQ6 A;  1KCY A;  2F3Y A;  1YUS A;  2B1U A;  1BOD A;  2PVB A;  2ZNE A;  4E68 A;  4OV2 A;  3VRP A;  4ZCU A;  1M39 A;  2KFF A;  2RGI A;  1TTX A;  1DEL A;  5CSI A;  3D0Y B;  1IH0 A;  2OTG C;  4A4B A;  5PAL A;  1LA3 A;  1KK8 C;  1BJF A;  2PAS A;  1IJ5 A;  2WCM A;  4I5L B;  4OKH A;  2I2R E;  4F7F A;  5I2O A;  1SNL A;  2QAC A;  2L5Y A;  3PAT A;  2KGR A;  1GM0 A;  2E30 A;  5D3O A;  1PVA A;  2LMU A;  1EJ3 A;  3QRX A;  2JT8 A;  5HL1 A;  1KFX L;  1CLL A;  3D0Y A;  2WCB A;  3CZ0 A;  4QJ4 B;  2JXC A;  3D73 A;  2BNX A;  2CCM A;  4NDD A;  2GGM A;  5B8I B;  4TNC A;  2MBX A;  5I2Q A;  4N1G A;  3VRQ A;  4GNK B;  2LUX A;  2ZN9 A;  2TN4 A;  4N1F A;  2G9B A;  1IKU A;  4JD9 A;  1OW4 A;  2QEH A;  1J7O A;  1X02 A;  5G08 A;  1IWQ A;  1YRU B;  2D8N A;  1B7T Z;  1QX7 A;  2M49 B;  1KSO A;  2SCP A;  4JQ0 D;  4ORC B;  1G4Y R;  3V2L A;  5HYD A;  1SYM A;  1BR4 B;  1XFR A;  1MQ1 A;  3B88 A;  1QX5 B;  2NZ0 A;  3I5I C;  4HRE E;  4ICB A;  1W7J B;  1RFJ A;  4L9M A;  4PHK A;  1M63 B;  3D74 A;  3TDZ A;  1L2O B;  1CFP A;  3DYE A;  1ZMZ A;  3PM8 A;  2GV5 A;  2L51 A;  1AJ5 A;  2MA2 A;  3K21 A;  1J1D A;  4AOM A;  4M2O A;  1OMR A;  1OOJ A;  4HRG A;  2VRG A;  1HQV A;  1NWD A;  4PCW A;  4PDZ A;  1K96 A;  3O78 A;  1LVC D;  3SG7 A;  2G2B A;  2K61 A;  3ZWH A;  5JOL A;  1MUX A;  2LAP A;  5JJG A;  2KI6 C;  2Q4U A;  4M2Q A;  5CSF A;  1H8B A;  1CDM A;  2KAY A;  1SSE B;  3KEV A;  4YGB B;  2ZN8 A;  3IVT A;  5AFP A;  3EK4 A;  3M0W A;  2WC5 A;  1F54 A; 
#chains in the Genus database with same CATH homology
 1K9K A;  3CR2 A;  1NX2 A;  1CFF A;  4GBA A;  5CSN A;  1DVI A;  1XVJ A;  1QAT A;  1UHN A;  2WCE A;  2H2K A;  4YGD B;  2KDH A;  1CFC A;  3OX6 A;  2L4I A;  1TNP A;  2M1U A;  1VRK A;  4BY4 A;  1F70 A;  2MJW B;  1NPQ A;  4PE4 A;  3SG4 A;  2KHN A;  5I8N A;  3EVV A;  4DCK A;  5K89 A;  1OZO A;  1SW8 A;  2KAX A;  1QIV A;  2LLU A;  1CDL A;  1MXE A;  2CBL A;  4MZK A;  4XYN A;  2KI6 D;  4Q04 A;  2KNE A;  2BBM A;  1S1E A;  1NIW A;  1IJ6 A;  4P5O E;  2M7L A;  1OE9 B;  4PHJ A;  1TCF A;  1Y1U A;  3LK0 A;  1SR6 B;  1F4O A;  1E8A A;  3OP0 A;  4ETO A;  3OX5 A;  1XO5 A;  1AJ4 A;  1QTX A;  1JFJ A;  2L5X B;  1EG3 A;  2WOS A;  1RTP 1;  2L2E A;  3O6B A;  1UHJ A;  3GK2 A;  4C0L A;  2JNX A;  2LHI A;  1R6P A;  2NXQ A;  3WXA A;  1XA5 A;  2M29 A;  2K7D A;  2L0P A;  5D7F A;  1TNQ A;  1JF2 A;  5BPJ A;  2F3Z A;  4C0J A;  1IG5 A;  1J7Q A;  1BR1 B;  1J1E A;  3GK4 X;  2ZFD A;  2MHH A;  1QJT A;  2F2O A;  2MAZ A;  2BCX A;  2I94 A;  1WDC B;  3EVR A;  4NDC A;  3VRN A;  1DJW A;  4NDB A;  2LVJ A;  2JTT A;  1K93 D;  1GQM A;  4P2Y B;  1RRO A;  3LLE A;  1YVH A;  1EG4 A;  3FIA A;  4PHM A;  1LIN A;  4BY5 A;  3BQ3 A;  4QJ3 B;  1SL8 A;  2BCB A;  4MSP A;  1F4Q A;  2CXJ A;  2M8U A;  3PLF B;  1B4C A;  5HKW A;  1CLB A;  3IQQ A;  5D69 A;  1KQM B;  1EL4 A;  1S3P A;  1A03 A;  1UP5 A;  1AP4 A;  1JBA A;  3BUX B;  4GUK A;  2ZKM X;  1EXR A;  1ZAC A;  3JVT B;  3KO0 A;  2F2P A;  2AMI A;  5DKQ A;  1N65 A;  2AUC A;  2LP2 A;  4OCI A;  1WLM A;  3BUW B;  3SG5 A;  1MHO A;  5I2L A;  4CPV A;  1WDC C;  2LLT A;  4NQG A;  2OPO A;  1KFU S;  5AXI A;  3OB2 B;  1B8R A;  1BG1 A;  1OZS A;  2ISD A;  1RWY A;  2KSP A;  2LC5 A;  4MLW A;  4GFT A;  2LMT A;  3FWC A;  3A8R A;  4GGN A;  1WLZ A;  1GGW A;  1PRW A;  1QLK A;  1PUL A;  4MN0 A;  1IQ5 A;  5CPV A;  2KYF A;  1DGU A;  2FCE A;  1KQM C;  3CS1 A;  1SCV A;  2BCA A;  3OHM B;  3DVJ A;  1CM4 A;  2L4H A;  3JVT C;  3LL8 B;  5HLV A;  1TNW A;  1XFY O;  3I5F B;  4I5N B;  2K8M B;  1B1G A;  2HQ8 A;  1FBV A;  1FF1 A;  1CFD A;  1DT7 B;  1JC2 A;  3SG6 A;  2LVV A;  1RK9 A;  3KHE A;  2M7N A;  1JF0 A;  1J7P A;  2V53 A;  1PVB A;  1XFV O;  3BYA A;  1N2D A;  1KWO B;  1MF8 B;  4DS7 A;  2JT3 A;  2KYC A;  1SMG A;  3RM1 A;  4GGF A;  3LK1 A;  3PFV A;  1M31 A;  1IQ3 A;  3E3R A;  2COL B;  3TUY B;  1QV0 A;  2MLE C;  4CLN A;  2O60 A;  2KQY A;  4MRX A;  5ER5 A;  1SY9 A;  1MR8 A;  2EGD A;  1TCO B;  2M9G A;  2Q91 A;  1DTL A;  2K2A A;  1QS7 A;  1BLQ A;  1CDN A;  1JFK A;  1G33 A;  1QX2 A;  2ZRS A;  1TRF A;  2BKI B;  1U5I B;  1KFX S;  1CMG A;  4I5J A;  3CR5 X;  4MVF A;  1J7R A;  2PMY A;  1DMO A;  1F8H A;  3I5F C;  3NSK A;  3D10 A;  2KI4 B;  2GGZ A;  3ZNI A;  1UHK A;  1F55 A;  4WRI A;  1S5G Y;  3MSE B;  4GGF C;  4ZCV A;  1QVI Y;  1U5I A;  5FYX A;  1YUR A;  1QAS A;  4YGC B;  4YRU A;  3BUN B;  1KWO C;  2CNP A;  3CWG A;  3AKA A;  2OS8 B;  4GPL B;  2JU0 A;  1SPY A;  4XJK B;  2JC2 A;  1L7Z A;  1A75 B;  2WOR A;  1G8I A;  3JTD B;  1C07 A;  1RJV A;  1QIW A;  2QPT A;  1YX8 A;  1KK7 Y;  1D1O A;  3TUY C;  2LMV A;  1CKK A;  4PHN A;  2LAN A;  3SIA A;  3AKB A;  1PSR A;  2Y1M A;  5IBW A;  5KTY A;  3EK8 A;  1FW4 A;  2JTZ A;  4XJK A;  3CZT X;  1A75 A;  1DGV A;  1TN4 A;  4JWQ A;  3EKJ A;  3WHT B;  3NSO A;  1PK0 D;  1QXP A;  4YI8 A;  4C0K A;  1DJX A;  2JNF A;  4UPG A;  3EK7 A;  1KQV A;  1ODB A;  3I5G C;  1FI5 A;  1WY9 A;  1S36 A;  2KI4 C;  3H4S E;  1TIZ A;  3DVK A;  5ER4 X;  1A2X A;  5AEQ A;  1XFZ O;  1AVS A;  1SBJ A;  1Y1A A;  3C1V A;  1QV1 A;  1YUU A;  4MEW A;  1YRT B;  2LM5 A;  4R1E A;  3TDI A;  1REC A;  3GOF A;  1B7T Y;  2OS8 C;  4AQJ A;  3WNX B;  3JTD C;  4DUQ A;  1YUT A;  2FJU B;  2HF5 A;  1YTZ C;  2LP3 A;  2KQ6 A;  2WCF A;  5KU1 A;  2I7A A;  2K7O A;  2JWW A;  2PRU A;  1EH2 A;  1CMF A;  1K9U A;  2Y4Q A;  1DJH A;  3IF7 A;  2L98 A;  5CSJ A;  2M3W A;  1B8C A;  1QVI Z;  2BKH B;  1WRK A;  2IS9 A;  3CTN A;  4WQ2 A;  1UHI A;  4MZL A;  1ALV A;  1HT9 A;  2NCP A;  1NUB A;  4ORB B;  1MXL C;  1N0Y A;  4YGE B;  2LUC A;  1SK6 D;  1SL7 A;  1DF0 B;  1SCM B;  3BXK A;  2JT0 A;  4DRW A;  1OSA A;  2LVI A;  1ZUZ A;  1CB1 A;  1OQP A;  3HCM A;  3LCP C;  2BE4 A;  2DOQ A;  2LNK A;  1LA0 A;  1AHR A;  2LVK A;  3VRR A;  2E6W A;  3HX4 A;  2JRF A;  3ICB A;  4MRY A;  1H4B A;  2PSR A;  3IQO A;  1K95 A;  5AAN A;  1DF0 A;  3RLZ A;  2LE9 B;  5GQQ C;  1TNX A;  4IL1 A;  2WND A;  4I5K A;  2JXL A;  2P6B B;  1K8U A;  1NX1 A;  2H61 A;  2BEC A;  2EHB A;  1NX3 A;  1S6J A;  2KGB C;  1A29 A;  1ZOT B;  4CFR A;  2Y5I A;  3AAK A;  5HLO A;  2NLN A;  3DVM A;  3PAL A;  2LHL A;  1YR5 A;  4FQO A;  1DJG A;  3DVE A;  2BL0 B;  3F45 A;  1A4P A;  1NCX A;  1AUI B;  1J55 A;  1DJZ A;  1Y0V H;  4YI9 A;  2ZND A;  3KF9 A;  1WRL A;  4MZJ A;  1B9A A;  1SCM C;  2L50 A;  1BT6 A;  2HPS A;  1IGV A;  1CTR A;  2FOT A;  1Q80 A;  1DJY A;  3AAJ A;  1ZFS A;  2EC6 B;  3PSR A;  5HKY A;  2H61 C;  1FI6 A;  1B8L A;  4YBH B;  5F6T A;  2MRD A;  2NCO A;  2AAO A;  1B47 A;  3TZ1 A;  3I5H B;  4DIR A;  1XFU O;  1F71 A;  1C7V A;  4HRH A;  2CTN A;  1M46 A;  2KFH A;  5DKR A;  3PN7 B;  4PAL A;  2KFG A;  1UHH A;  1UWO A;  2ZRT A;  1JSA A;  1ALW A;  3BUO B;  1W7I B;  4PE7 A;  3CLN A;  3KPX A;  2SAS A;  3CGA A;  3NSI A;  1QLS A;  1XFW O;  1CM1 A;  1YX7 A;  2O5G A;  1JUO A;  1XFX O;  3TS5 B;  3I5G B;  3SJS A;  2BL0 C;  1NSH A;  2M1K B;  3EKH A;  2JPT A;  4USL A;  1L2O C;  1XYD A;  2KOT A;  1K2H A;  2LLS A;  1NX0 A;  2PAL A;  3FS7 A;  1BMO A;  2CT9 A;  1BF5 A;  2EC6 C;  1GJY A;  1KSM A;  5DKN A;  3WHU B;  1NYA A;  2KBI A;  2JOJ A;  2JUL A;  3I5H C;  3VGO A;  2WC8 A;  2K2F A;  1XK4 A;  4CFQ A;  1K90 D;  5AER A;  4FTG A;  3PN7 C;  2JZI A;  2I18 A;  2F33 A;  3DD4 A;  3DF0 B;  1C7W A;  1TOP A;  3SG2 A;  5KSZ A;  1DJI A;  3BUM B;  4AQI A;  2A4J A;  3NSL A;  4QJ5 B;  1LXF C;  1OMV A;  4F0Z B;  1OMD A;  4JPZ B;  1NP8 A;  5J3X A;  4A4C A;  3DF0 A;  3TS5 C;  1S6I A;  1M45 A;  1SRA A;  3O2P A;  3A4U B;  3SIB A;  2HET A;  1PAL A;  1KFU L;  5TNC A;  1S26 D;  2M0R A;  3OB1 B;  4OVN F;  1GGZ A;  2K7C A;  2KAV A;  2K0J A;  1JWD A;  1NCY A;  1XK4 C;  4M2P A;  2LCP A;  2Y1N A;  4PE1 A;  3EVU A;  3TDU A;  2MLF C;  4HSZ A;  1SL9 A;  2M97 A;  3NXA A;  2OTG B;  3O4Y A;  1BOC A;  1IRJ A;  1KK8 B;  4U8D A;  4CID A;  3FWB A;  2K7B A;  4MBE A;  1FPW A;  4N5X A;  2LV7 A;  3SG3 A;  1UUR A;  1R2U A;  3BOW B;  1S6C A;  1SKT A;  1CNP A;  1PSB A;  2BBN A;  2BE6 A;  1CLM A;  3VRO A;  4OR9 B;  1MWN A;  1Y6W A;  2R2I A;  4YGA A;  1WRZ A;  1S5G Z;  1V1F A;  2KBM A;  4GAO A;  4D1E A;  1NCZ A;  4PE0 A;  3BOW A;  1CDP A;  4ORA B;  1Y1X A;  2HQW A;  1AK8 A;  1V1G A;  3GK1 A;  2F8P A;  2FCD A;  1K94 A;  1UUS A;  1SR6 C;  3CR4 X;  1BU3 A;  1LKJ A;  1K9P A;  1YVL A;  3I5I B;  4WQ3 A;  1KK7 Z;  2JQ6 A;  1KCY A;  2F3Y A;  1YUS A;  2B1U A;  1BOD A;  2PVB A;  2ZNE A;  4E68 A;  4OV2 A;  3VRP A;  4ZCU A;  1M39 A;  2KFF A;  2RGI A;  1TTX A;  5CSI A;  3D0Y B;  1IH0 A;  2OTG C;  4A4B A;  5PAL A;  1LA3 A;  1KK8 C;  1BJF A;  2PAS A;  1IJ5 A;  4I5L B;  4OKH A;  2I2R E;  5I2O A;  1SNL A;  2QAC A;  3PAT A;  2KGR A;  2E30 A;  1PVA A;  2LMU A;  1EJ3 A;  3QRX A;  2JT8 A;  1KFX L;  1CLL A;  3D0Y A;  2WCB A;  5B8I B;  4QJ4 B;  2JXC A;  2CCM A;  4NDD A;  2GGM A;  4TNC A;  2MBX A;  5I2Q A;  4N1G A;  3VRQ A;  4GNK B;  2LUX A;  2ZN9 A;  2TN4 A;  4N1F A;  2G9B A;  1IKU A;  1J7O A;  1X02 A;  5G08 A;  1IWQ A;  1YRU B;  2D8N A;  1B7T Z;  1QX7 A;  2M49 B;  1KSO A;  2SCP A;  4JQ0 D;  4ORC B;  1G4Y R;  5HYD A;  1SYM A;  1BR4 B;  1MQ1 A;  5HKZ A;  1QX5 B;  2NZ0 A;  3I5I C;  4HRE E;  4ICB A;  1W7J B;  1RFJ A;  4L9M A;  4PHK A;  1M63 B;  3TDZ A;  1L2O B;  1CFP A;  1ZMZ A;  3PM8 A;  2GV5 A;  2L51 A;  1AJ5 A;  2MA2 A;  3K21 A;  1J1D A;  4AOM A;  4M2O A;  1OMR A;  1OOJ A;  4HRG A;  2VRG A;  1HQV A;  1NWD A;  4PCW A;  4PDZ A;  1K96 A;  3O78 A;  1LVC D;  3SG7 A;  2G2B A;  2K61 A;  3ZWH A;  5JOL A;  1MUX A;  2LAP A;  5JJG A;  2KI6 C;  2Q4U A;  4M2Q A;  5CSF A;  1H8B A;  1CDM A;  2KAY A;  3KEV A;  4YGB B;  2ZN8 A;  5AFP A;  3EK4 A;  3M0W A;  1F54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...