2F2OA

Structure of calmodulin bound to a calcineurin peptide: a new way of making an old binding mode
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
171
structure length
156
Chain Sequence
b'TEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAIRNKIRAIGKMARVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin fused with calmodulin-binding domain of calcineur
publication title Structure of calmodulin bound to a calcineurin Peptide: a new way of making an old binding mode.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 60
structure length 156
sequence length 171
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2005-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2f2oA01
3PFVA 5I2OA 3EVRA 5CPVA 1SR6B 1IWQA 1KFUL 3DVKA 5CSIA 2CT9A 1DT7B 1YUUA 1LKJA 1SBJA 4MLWA 1KFXL 2M29A 3GK2A 1CB1A 1JSAA 3TDZA 4OV2A 4WQ3A 3NSOA 2JOJA 3DVEA 4PE1A 2KQYA 1DVIA 2F3ZA 1XFVO 4PDZA 2KFHA 1ZFSA 3IQQA 1SPYA 1BLQA 2L0PA 3FWBA 1V1FA 4MSPA 2DOQA 1QLKA 2MLFC 2LE9B 1ZACA 1B1GA 1XFYO 1SCMC 2K7OA 4OVNF 3GK1A 2JXCA 1YVHA 1OMRA 4WRIA 1DGUA 2ZFDA 5J3XA 1A75B 4OCIA 5JOLA 1NCYA 5AXIA 2KBIA 3BOWB 2JULA 2LCPA 2O5GA 2HQWA 1KWOB 1CDLA 3AAJA 4GBAA 4HRHA 1J7QA 2Y4QA 2JC2A 4A4BA 3NXAA 2P6BB 1TRFA 3A8RA 1B8RA 3VRPA 3BUWB 1S1EA 2JT3A 2K61A 2JNFA 1KQMB 3I5HC 4R1EA 1AHRA 1SKTA 1DTLA 4ORCB 1AJ5A 2EHBA 1D1OA 1QX7A 2LVIA 3WXAA 2B1UA 1G4YR 1DJYA 1M39A 1TCOB 1CM4A 1K95A 1QASA 2NLNA 1JWDA 1OSAA 5I2QA 2MHHA 2Q91A 1WLMA 1TIZA 5IBWA 2JPTA 3SG6A 3EVUA 4YGBB 1A4PA 4ICBA 3I5IC 1F4OA 1IGVA 3E3RA 2LC5A 4YGAA 5GQQC 1LA3A 2LAPA 3AKBA 5JJGA 2LMTA 2EGDA 1BMOA 4A4CA 1FF1A 1CFPA 2F2PA 1KK7Z 3C1VA 1NUBA 1KFUS 5DKRA 3JVTB 4GPLB 3O78A 5D69A 1QX2A 2JXLA 1MHOA 1NX3A 2L2EA 1CKKA 1QS7A 1B4CA 1WRZA 1A75A 2PVBA 3BOWA 2KI6D 2L5XB 2OS8C 1NP8A 3BUMB 3RLZA 4GGFC 3OB1B 1BG1A 1CMGA 5ER4X 2JQ6A 5G08A 1OMVA 1Y1UA 1YRUB 3PN7C 4CLNA 2JRFA 4CFQA 1AUIB 2HF5A 2SASA 2NCOA 4ORBB 1NPQA 2I18A 1F8HA 3AKAA 2D8NA 1MF8B 2H61A 2NCPA 2LMVA 1DJHA 1JF2A 1F70A 4N1FA 2LVKA 3CTNA 3D10A 1JC2A 1BOCA 1CDMA 1BT6A 2KGRA 4USLA 1WLZA 2BL0B 2JWWA 2PASA 1EH2A 1H4BA 1EL4A 1DF0A 1S26D 3MSEB 2FOTA 2HQ8A 2LUCA 1IG5A 4D1EA 4ZCVA 4QJ4B 3EKJA 1BR4B 1MQ1A 2MLEC 1OMDA 4JQ0D 3VRNA 2K7BA 4L9MA 3CGAA 4AQJA 1FPWA 4MBEA 5AEQA 2BCAA 4CFRA 5KSZA 1S5GZ 2HETA 2WCBA 1F54A 1U5IB 2LP3A 2BKIB 2M9GA 3ZWHA 1SK6D 4I5NB 3EK7A 4MVFA 1KK8B 5AERA 1KCYA 2LMUA 3TUYC 2LVVA 3SG3A 1OZOA 1XFUO 1OOJA 1Y1XA 2KFFA 2G9BA 1NCXA 2BE4A 1G8IA 1J1EA 3KO0A 2GGMA 1BF5A 2QACA 1RROA 2LV7A 4HRGA 1ZMZA 2ZN8A 1HT9A 1DJGA 3CWGA 1IH0A 1A29A 1V1GA 2WOSA 3I5FC 1AP4A 1NIWA 2ZRTA 1SW8A 1CTRA 1AK8A 1LXFC 4DCKA 1PK0D 1WDCC 4YI9A 1YX8A 4DUQA 4MZKA 1GGWA 1WY9A 2NXQA 4M2QA 1TOPA 1CFCA 1CLMA 2KYFA 4YBHB 2ZN9A 1TNPA 2LNKA 3LK1A 1J7PA 1SRAA 3TS5C 1M46A 1GJYA 3AAKA 4CPVA 2JTZA 3ICBA 1QX5B 2BKHB 1NX1A 1KK7Y 1SL9A 1JFKA 5B8IB 1Y6WA 1UHKA 5CSNA 2KAXA 2E6WA 2M1UA 2KI4C 1NX0A 1X02A 1BU3A 2MBXA 1RJVA 1IJ6A 5ER5A 4DIRA 1U5IA 4YGCB 2KYCA 3F45A 1S6JA 3JTDC 1OE9B 4C0LA 1E8AA 2OTGB 2FJUB 2KI6C 2VRGA 4PE7A 2L51A 2MAZA 1L7ZA 1PVBA 4GGNA 2OPOA 4NDCA 5CSFA 3TUYB 1Y1AA 3DVMA 3SIAA 1QV1A 3GK4X 4CIDA 4QJ5B 4UPGA 4MRXA 2M3WA 4HREE 1R2UA 2ZRSA 1C07A 1JBAA 4YGDB 4BY4A 3H4SE 5HYDA 3I5GC 1XK4A 3LL8B 4GNKB 4I5KA 2H2KA 1NYAA 1FI5A 2CCMA 1EG3A 3GOFA 1QJTA 2NZ0A 1VRKA 1WDCB 2L4HA 3TDIA 4YI8A 2KHNA 1RK9A 2CBLA 1F55A 3BYAA 1ZOTB 1J1DA 3O2PA 1L2OC 4GUKA 1F4QA 1S5GY 3OX6A 4HSZA 3DF0B 1PRWA 1GQMA 1C7VA 1RTP1 1S3PA 5KU1A 1YRTB 1SCMB 3HCMA 2JNXA 4ORAB 1FBVA 1B47A 4BY5A 3IQOA 1N0YA 2RGIA 2EC6C 4GFTA 3O6BA 1DMOA 1SNLA 1JF0A 1SCVA 2K0JA 4P5OE 1PALA 2F3YA 1YUSA 3I5HB 4OR9B 4PHMA 1J7RA 1XFXO 3KPXA 2I94A 1TTXA 2BBNA 5CSJA 1K90D 2BE6A 2BECA 1SR6C 2K2FA 2JT0A 3NSKA 4FTGA 4F0ZB 2AUCA 2M0RA 3QRXA 2LLTA 3LCPC 1DGVA 1PSRA 5BPJA 1B8LA 3BQ3A 1JUOA 1SY9A 1SMGA 2LLUA 1IQ5A 3I5IB 2KSPA 3CR4X 2ZKMX 5DKQA 2BCXA 2A4JA 2G2BA 1CLLA 5HLVA 2M7LA 3WNXB 4FQOA 1QATA 5FYXA 1TNWA 1TCFA 3DF0A 1S6IA 3VRRA 1TNXA 3SJSA 3TDUA 1XA5A 2AMIA 1QIVA 1SYMA 4I5LB 1IJ5A 2LM5A 4TNCA 1UP5A 3FIAA 4NDBA 1G33A 2F2OA 4PE4A 3SG5A 1PULA 1S36A 1HQVA 1S6CA 5PALA 2OS8B 1UHHA 1TN4A 1ZUZA 2I7AA 2Y1NA 2ZNEA 2L98A 4PCWA 4AQIA 5KTYA 2K7DA 2TN4A 2ZNDA 1N2DA 1KWOC 1B7TY 1CDPA 4M2OA 1CFDA 3PN7B 2Y5IA 2LLSA 2CTNA 3A4UB 1K9PA 1EJ3A 1MXLC 3EK8A 1KQMC 1MUXA 4MZLA 3D0YB 4E68A 4PALA 1Y0VH 2WORA 3OX5A 4MEWA 1FW4A 1B9AA 2H61C 1R6PA 2JTTA 2KDHA 3NSIA 5AFPA 3PLFB 1FI6A 4MRYA 1IKUA 2I2RE 2KGBC 2LP2A 3RM1A 3NSLA 4N5XA 3O4YA 2K2AA 3VRQA 4AOMA 1A2XA 3IF7A 3DVJA 4MN0A 3SG7A 2Q4UA 1NX2A 4M2PA 3KEVA 1JFJA 2Y1MA 5K89A 1K8UA 2F8PA 2KBMA 1UHIA 3VROA 1WRLA 3BUOB 2K7CA 2L4IA 3PATA 1NCZA 1SL7A 1QVIZ 3EKHA 3SIBA 2M97A 3CZTX 3JVTC 4PHJA 4XYNA 2QPTA 1K9UA 1MWNA 3PSRA 2LUXA 4GGFA 1B7TZ 4XJKB 1RFJA 1YX7A 4I5JA 2AAOA 2MA2A 2V53A 1IQ3A 1W7JB 5DKNA 1YVLA 2KFGA 1H8BA 2KOTA 2K8MB 1CMFA 1UHNA 3I5FB 5I2LA 4YRUA 2JT8A 1K93D 4GAOA 3FS7A 3D0YA 2JZIA 1MR8A 1CDNA 2WCEA 1XYDA 1RWYA 1GGZA 3SG4A 3FWCA 2SCPA 1K94A 4P2YB 1BODA 3KHEA 2FCDA 4IL1A 1DJXA 3VGOA 1YTZC 2PSRA 3EVVA 1XFWO 4NDDA 2BL0C 1BJFA 4YGEB 3TS5B 1OZSA 4C0JA 1K2HA 2CXJA 2PMYA 2IS9A 3BXKA 1PSBA 2M49B 3OB2B 1DJWA 1UUSA 2KAVA 1WRKA 2KI4B 4N1GA 4PHKA 1YURA 2GV5A 1DF0B 2CNPA 1QXPA 3WHTB 1C7WA 1UURA 2WCFA 4C0KA 1AJ4A 3JTDB 3OHMB 4ETOA 2M1KB 1ODBA 2HPSA 3CR5X 1DJZA 1XVJA 1A03A 3OP0A 1KK8C 2GGZA 4WQ2A 1CFFA 3EK4A 4PHNA 2MRDA 4XJKA 1CNPA 1UWOA 1CLBA 1IRJA 3TZ1A 2R2IA 2LANA 4ZCUA 1KFXS 4JPZB 3KF9A 3PALA 2PRUA 1XFZO 5TNCA 2FCEA 3DD4A 2WC8A 3CS1A 5D7FA 1J7OA 2O60A 3BUXB 1M31A 1YUTA 1QIWA 2WNDA 3WHUB 5HKWA 2PALA 3I5GB 2KNEA 1CM1A 1ALVA 3PM8A 1RECA 2LHIA 1M63B 4Q04A 3LK0A 1XK4C 5I8NA 3M0WA 5HKZA 2E30A 1EXRA 1M45A 2LVJA 1SL8A 5HLOA 3SG2A 1QV0A 2LHLA 1K9KA 2M8UA 1AVSA 1W7IB 3HX4A 2ISDA 3LLEA 5AANA 2BBMA 2KAYA 1K96A 1F71A 2MJWB 1L2OB 1DJIA 5F6TA 3K21A 1BR1B 1QVIY 1NWDA 1NSHA 3CLNA 5HKYA 1PVAA 1MXEA 1KSMA 1UHJA 4QJ3B 1J55A 2BCBA 4JWQA 2M7NA 1LA0A 1TNQA 2JU0A 4NQGA 2EC6B 4MZJA 4PE0A 1ALWA 1B8CA 4OKHA 3CR2A 1N65A 1YR5A 1KSOA 2OTGC 2L50A 1Q80A 2COLB 1LINA 3BUNB 4DS7A 2KQ6A 1XO5A 1QLSA 4DRWA 2F33A 3ZNIA 1EG4A 1LVCD 1QTXA 4U8DA 1KQVA 1OQPA
chains in the Genus database with same CATH superfamily
3PFVA 5I2OA 3S0BA 3EVRA 5CPVA 1SR6B 1IWQA 1KFUL 3DVKA 5CSIA 2CT9A 1DT7B 1YUUA 1LKJA 3IVTA 3B86A 1SBJA 4MLWA 1KFXL 2M29A 3GK2A 1CB1A 1JSAA 3TDZA 4OV2A 4WQ3A 3NSOA 1C3YA 2JOJA 3DVEA 4PE1A 2KQYA 1DVIA 2F3ZA 1XFVO 3O4XA 4PDZA 2KFHA 1ZFSA 3IQQA 1SPYA 1BLQA 2L0PA 3CDNA 3FWBA 1V1FA 4MSPA 2DOQA 3PM2A 1QLKA 3L4AA 2MLFC 2LE9B 2WCKA 1ZACA 1B1GA 1XFYO 1SCMC 2K7OA 4OVNF 3FE6A 3GK1A 2JXCA 1YVHA 1OMRA 3NGVA 1DGUA 2ZFDA 4WRIA 5J3XA 1A75B 4OCIA 5JOLA 1NCYA 5AXIA 2KBIA 3BOWB 2JULA 2LCPA 2O5GA 2HQWA 1KWOB 1CDLA 3AAJA 4GBAA 4HRHA 1J7QA 2Y4QA 2JC2A 4A4BA 3NXAA 2P6BB 1TRFA 3A8RA 1B8RA 3VRPA 3BUWB 1S1EA 2JT3A 2K61A 3CZ1A 2JNFA 1KQMB 3I5HC 4R1EA 1AHRA 1SKTA 1DTLA 4ORCB 1AJ5A 2EHBA 1D1OA 1QX7A 1TWOA 2LVIA 3WXAA 5I94A 2WCHA 2B1UA 1G4YR 1DJYA 3L47A 1M39A 1TCOB 1CM4A 1K95A 1QASA 2NLNA 1JWDA 1OSAA 5I2QA 2MHHA 2Q91A 1WLMA 1TIZA 2QEBA 3B6XA 5IBWA 2JPTA 3SG6A 3EVUA 4YGBB 1A4PA 4ICBA 3I5IC 1F4OA 1IGVA 1OOHA 1TUZA 2LC5A 3E3RA 4YGAA 5GQQC 2QDIA 1LA3A 2LAPA 3AKBA 5JJGA 2LMTA 3K1EA 2EGDA 1BMOA 4A4CA 1FF1A 1CFPA 2F2PA 1KK7Z 2BAPA 3C1VA 1NUBA 1KFUS 2L5YA 5DKRA 2WCMA 3JVTB 3RZSA 4GPLB 3R1PA 3O78A 5D69A 1QX2A 2KPHA 2JXLA 1MHOA 1NX3A 2L2EA 1CKKA 1QS7A 1B4CA 1WRZA 1A75A 2JPOA 2PVBA 3BOWA 2KI6D 2L5XB 2OS8C 1NP8A 3BUMB 3RLZA 4GGFC 3OB1B 1BG1A 1CMGA 5ER4X 2QEOA 2JQ6A 5G08A 1OMVA 1Y1UA 1YRUB 3PN7C 2PYQA 4CLNA 2JRFA 4CFQA 1AUIB 2K60A 2HF5A 3S0AA 2SASA 2NCOA 4ORBB 2WC6A 2P70A 1NPQA 2I18A 1F8HA 1OOGA 3AKAA 2D8NA 1MF8B 2H61A 2NCPA 2LMVA 2QEVA 1DJHA 1JF2A 1F70A 4N1FA 2LVKA 3CTNA 3D10A 1JC2A 2YGUA 1BOCA 1CDMA 1BT6A 2KGRA 4USLA 1WLZA 4KYNA 2BL0B 2JWWA 2PASA 3Q8IA 1EH2A 1H4BA 1EL4A 1DF0A 1S26D 3MSEB 2PQLA 2FOTA 2HQ8A 2LUCA 1IG5A 4D1EA 4ZCVA 3S0DA 4QJ4B 3EKJA 1BR4B 1MQ1A 2MLEC 1OMDA 3DZTA 4JQ0D 3VRNA 4OZDA 2K7BA 4L9MA 3CGAA 4AQJA 3BFHA 4MBEA 5AEQA 2BCAA 4CFRA 5KSZA 3CABA 1FPWA 1S5GZ 1IIOA 2HETA 2WCBA 1F54A 1U5IB 2LP3A 2BKIB 2M9GA 3ZWHA 3DY9A 1DC1A 1SK6D 4I5NB 3EK7A 4MVFA 1KK8B 5AERA 1KCYA 2LMUA 3TUYC 2LVVA 3SG3A 1OZOA 1XFUO 1OOJA 1Y1XA 2KFFA 2G9BA 1NCXA 2BE4A 5D3OA 1G8IA 1J1EA 3KO0A 1DEKA 2GGMA 1BF5A 2QACA 1RROA 2LV7A 4HRGA 1ZMZA 2ZN8A 1HT9A 1DJGA 3CWGA 1IH0A 1A29A 5FI7A 1V1GA 2WOSA 3I5FC 3PJIA 1AP4A 1NIWA 2ZRTA 1SW8A 1CTRA 1AK8A 1LXFC 4DCKA 1PK0D 1WDCC 4YI9A 1YX8A 4DUQA 4MZKA 1GGWA 5DICA 1WY9A 1W9ZA 2NXQA 4M2QA 1TOPA 1CFCA 1CLMA 2KYFA 4YBHB 2ZN9A 1TNPA 2LNKA 3LK1A 1J7PA 1SRAA 3TS5C 1M46A 1GJYA 3AAKA 5FI2A 4CPVA 2JTZA 3ICBA 1QX5B 2BKHB 1NX1A 1KK7Y 1SL9A 1JFKA 5B8IB 1Y6WA 1UHKA 5CSNA 2KAXA 2E6WA 2M1UA 2KI4C 1NX0A 1X02A 1BU3A 2MBXA 1RJVA 1IJ6A 5ER5A 4DIRA 1U5IA 4YGCB 2KYCA 3F45A 1S6JA 3JTDC 1OE9B 4C0LA 1E8AA 2OTGB 2FJUB 2KI6C 2VRGA 4PE7A 2L51A 2MAZA 3QMEA 1L7ZA 1PVBA 4GGNA 2OPOA 4NDCA 5CSFA 3TUYB 1Y1AA 3DVMA 3SIAA 3D74A 1QV1A 3GK4X 4CIDA 4QJ5B 4UPGA 4MRXA 2M3WA 4HREE 1R2UA 2ZRSA 4JD9A 1C07A 1JBAA 4YGDB 4BY4A 3H4SE 5HYDA 3I5GC 1XK4A 3LL8B 4GNKB 4I5KA 2H2KA 1NYAA 3B87A 1FI5A 2CCMA 1EG3A 3GOFA 1QJTA 2NZ0A 1VRKA 1WDCB 2L4HA 3TDIA 3SS4A 4YI8A 2KHNA 1DELA 1RK9A 2CBLA 1F55A 3BYAA 1ZOTB 1J1DA 3O2PA 1L2OC 4GUKA 1F4QA 1S5GY 3L4LA 3OX6A 3DF0B 4HSZA 1PRWA 1GQMA 3BFBA 1C7VA 1RTP1 1S3PA 5KU1A 1YRTB 3R1OA 1SCMB 3HCMA 2JNXA 4ORAB 1FBVA 2WCLA 3EG5B 1B47A 4BY5A 1OOFA 3IQOA 1N0YA 2RGIA 2EC6C 4GFTA 3O6BA 1DMOA 1SNLA 1JF0A 1SCVA 2K0JA 4P5OE 1PALA 2F3YA 3OBVA 1YUSA 3I5HB 4OR9B 4PHMA 3SS3A 1J7RA 1XFXO 3KPXA 2I94A 2FJYA 1TTXA 3B88A 2BBNA 5CSJA 1K90D 2BE6A 2BECA 1SR6C 2K2FA 2JT0A 3NSKA 3R72A 4FTGA 4F0ZB 2AUCA 2M0RA 3QRXA 2LLTA 3DYEA 1DGVA 3LCPC 1PSRA 5BPJA 1B8LA 3BQ3A 1JUOA 1SY9A 3SS5A 1SMGA 2LLUA 1IQ5A 3I5IB 2KSPA 3CR4X 2ZKMX 5DKQA 2BCXA 2A4JA 2G2BA 1CLLA 3S0FA 5HLVA 2M7LA 3WNXB 3D78A 4FQOA 1QATA 5FYXA 1TNWA 1TCFA 3DF0A 1S6IA 3VRRA 3D75A 1TNXA 3SJSA 3TDUA 1XA5A 3UNWA 1Z4HA 2AMIA 1QIVA 1SYMA 4I5LB 1IJ5A 2LM5A 4TNCA 1UP5A 3FIAA 1QWVA 4NDBA 1G33A 2F2OA 4PE4A 3SG5A 4JKTA 1PULA 1S36A 1HQVA 1S6CA 2WC5A 2OS8B 5PALA 1UHHA 1TN4A 1ZUZA 2I7AA 2Y1NA 2ZNEA 2L98A 4PCWA 5EL2A 4AQIA 1TUJA 5KTYA 2K7DA 2TN4A 2ZNDA 1N2DA 1KWOC 1Z2CB 1B7TY 1CDPA 4M2OA 1CFDA 3PN7B 2Y5IA 2LLSA 2CTNA 2GTEA 3A4UB 1K9PA 4F7FA 5FI6A 3V2LA 1EJ3A 1MXLC 3EK8A 1KQMC 1MUXA 4MZLA 3D0YB 4E68A 4PALA 1Y0VH 2WORA 3OX5A 4MEWA 1FW4A 1B9AA 2H61C 4IJ7A 1R6PA 2JTTA 2KDHA 3NSIA 2QEHA 5AFPA 3PLFB 2H8VA 1FI6A 3BFAA 4MRYA 1IKUA 3R1VA 2I2RE 4PT1A 2KGBC 2LP2A 3RM1A 3NSLA 4N5XA 3O4YA 4FQTA 2K2AA 3VB1A 3VRQA 4AOMA 1A2XA 3IF7A 3DVJA 4MN0A 3SG7A 1SSEB 2Q4UA 1NX2A 4M2PA 3KEVA 1JFJA 2Y1MA 5K89A 1OOIX 2P71A 3UO9A 1K8UA 2F8PA 2KBMA 1UHIA 3OGNA 3VROA 5HL1A 1WRLA 3BUOB 2K7CA 2L4IA 3PATA 1NCZA 1SL7A 1QVIZ 3EKHA 3SIBA 2M97A 3CZTX 3JVTC 4PHJA 4XYNA 2QPTA 1K9UA 1C3ZA 1MWNA 3PSRA 2LUXA 4GGFA 1B7TZ 4XJKB 1RFJA 1YX7A 4I5JA 2AAOA 2MA2A 2V53A 1IQ3A 1W7JB 5DKNA 1YVLA 2KFGA 1H8BA 2KOTA 2K8MB 3DXLA 1CMFA 3FE9A 1UHNA 3I5FB 5I2LA 4YRUA 2JT8A 2L2CA 1K93D 4GAOA 3D76A 3D0YA 3FS7A 2JZIA 1MR8A 1CDNA 2WCEA 1XYDA 1RWYA 1GGZA 3SG4A 3FWCA 2SCPA 1K94A 4P2YB 1BODA 3KHEA 2FCDA 4IL1A 1DJXA 3VGOA 1YTZC 2PSRA 3EVVA 1XFWO 4NDDA 2BL0C 1BJFA 4YGEB 3CZ0A 3TS5B 1OZSA 4C0JA 1K2HA 2CXJA 2PMYA 2IS9A 2KLEA 1PSBA 1ORGA 1OW4A 2M49B 3BXKA 3OB2B 1DJWA 1UUSA 2KAVA 3B7AA 1WRKA 2KI4B 4N1GA 4PHKA 1YURA 2GV5A 1DF0B 2CNPA 1QXPA 3D77A 3WHTB 1C7WA 3CZ2A 1UURA 2WCFA 4C0KA 1AJ4A 3JTDB 3OHMB 4ETOA 2M1KB 1ODBA 2HPSA 1T14A 3CR5X 1DJZA 1XVJA 1A03A 3OP0A 1KK8C 2GGZA 4WQ2A 1CFFA 2WCJA 3EK4A 4PHNA 2MRDA 4XJKA 1CNPA 1UWOA 1CLBA 1IRJA 3S0EA 2R2IA 3TZ1A 2LANA 4ZCUA 1KFXS 4JPZB 3KF9A 3BJHA 2PRUA 1XFZO 3PALA 5TNCA 2FCEA 3DD4A 2WC8A 3CS1A 5D7FA 1J7OA 4INXA 2O60A 3BUXB 1M31A 1YUTA 1QIWA 2WNDA 3WHUB 5HKWA 2PALA 3I5GB 2KNEA 1CM1A 1ALVA 3PM8A 1RECA 2LHIA 1DQEA 1M63B 4Q04A 3LK0A 1XK4C 2KLDA 3M0WA 5I8NA 5HKZA 2E30A 1XFRA 1EXRA 1M45A 2LVJA 4INWA 1SL8A 5HLOA 3SG2A 1QV0A 2LHLA 1K9KA 2M8UA 1AVSA 1W7IB 3FE8A 3HX4A 2ISDA 1GM0A 3LLEA 5AANA 2BBMA 2KAYA 1K96A 1F71A 2MJWB 1L2OB 3N7HA 3D73A 1DJIA 5F6TA 3K21A 3S0GA 2BNXA 1BR1B 1QVIY 1NWDA 1NSHA 3CLNA 5HKYA 1PVAA 1MXEA 1KSMA 1UHJA 3NHTA 4QJ3B 1J55A 2BCBA 4JWQA 2M7NA 1LA0A 1TNQA 2JU0A 4NQGA 2ERBA 2EC6B 4MZJA 4PE0A 1ALWA 1B8CA 4OKHA 3CR2A 1N65A 1P28A 1YR5A 1KSOA 2OTGC 3CYZA 2L50A 1Q80A 2COLB 1LINA 3BUNB 4DS7A 2KQ6A 1XO5A 1QLSA 4DRWA 2F33A 3ZNIA 1LS8A 1EG4A 1LVCD 1QTXA 4U8DA 3NHIA 1KQVA 1OQPA
chains in the Genus database with same CATH topology
3PFVA 5I2OA 3EVRA 5CPVA 1SR6B 1IWQA 1KFUL 3DVKA 5CSIA 2CT9A 1DT7B 1YUUA 1LKJA 1SBJA 4MLWA 1KFXL 2M29A 3GK2A 1CB1A 1JSAA 3TDZA 4OV2A 4WQ3A 3NSOA 2JOJA 3DVEA 4PE1A 2KQYA 1DVIA 2F3ZA 1XFVO 4PDZA 2KFHA 1ZFSA 3IQQA 1SPYA 1BLQA 2L0PA 3FWBA 1V1FA 4MSPA 2DOQA 1QLKA 2MLFC 2LE9B 1ZACA 1B1GA 1XFYO 1SCMC 2K7OA 4OVNF 3GK1A 2JXCA 1YVHA 1OMRA 4WRIA 1DGUA 2ZFDA 5J3XA 1A75B 4OCIA 5JOLA 1NCYA 5AXIA 2KBIA 3BOWB 2JULA 2LCPA 2O5GA 2HQWA 1KWOB 1CDLA 3AAJA 4GBAA 4HRHA 1J7QA 2Y4QA 2JC2A 4A4BA 3NXAA 2P6BB 1TRFA 3A8RA 1B8RA 3VRPA 3BUWB 1S1EA 2JT3A 2K61A 2JNFA 1KQMB 3I5HC 4R1EA 1AHRA 1SKTA 1DTLA 4ORCB 1AJ5A 2EHBA 1D1OA 1QX7A 2LVIA 3WXAA 2B1UA 1G4YR 1DJYA 1M39A 1TCOB 1CM4A 1K95A 1QASA 2NLNA 1JWDA 1OSAA 5I2QA 2MHHA 2Q91A 1WLMA 1TIZA 5IBWA 2JPTA 3SG6A 3EVUA 4YGBB 1A4PA 4ICBA 3I5IC 1F4OA 1IGVA 3E3RA 2LC5A 4YGAA 5GQQC 1LA3A 2LAPA 3AKBA 5JJGA 2LMTA 2EGDA 1BMOA 4A4CA 1FF1A 1CFPA 2F2PA 1KK7Z 3C1VA 1NUBA 1KFUS 5DKRA 3JVTB 4GPLB 3O78A 5D69A 1QX2A 2JXLA 1MHOA 1NX3A 2L2EA 1CKKA 1QS7A 1B4CA 1WRZA 1A75A 2PVBA 3BOWA 2KI6D 2L5XB 2OS8C 1NP8A 3BUMB 3RLZA 4GGFC 3OB1B 1BG1A 1CMGA 5ER4X 2JQ6A 5G08A 1OMVA 1Y1UA 1YRUB 3PN7C 4CLNA 2JRFA 4CFQA 1AUIB 2HF5A 2SASA 2NCOA 4ORBB 1NPQA 2I18A 1F8HA 3AKAA 2D8NA 1MF8B 2H61A 2NCPA 2LMVA 1DJHA 1JF2A 1F70A 4N1FA 2LVKA 3CTNA 3D10A 1JC2A 1BOCA 1CDMA 1BT6A 2KGRA 4USLA 1WLZA 2BL0B 2JWWA 2PASA 1EH2A 1H4BA 1EL4A 1DF0A 1S26D 3MSEB 2FOTA 2HQ8A 2LUCA 1IG5A 4D1EA 4ZCVA 4QJ4B 3EKJA 1BR4B 1MQ1A 2MLEC 1OMDA 4JQ0D 3VRNA 2K7BA 4L9MA 3CGAA 4AQJA 1FPWA 4MBEA 5AEQA 2BCAA 4CFRA 5KSZA 1S5GZ 2HETA 2WCBA 1F54A 1U5IB 2LP3A 2BKIB 2M9GA 3ZWHA 1SK6D 4I5NB 3EK7A 4MVFA 1KK8B 5AERA 1KCYA 2LMUA 3TUYC 2LVVA 3SG3A 1OZOA 1XFUO 1OOJA 1Y1XA 2KFFA 2G9BA 1NCXA 2BE4A 1G8IA 1J1EA 3KO0A 2GGMA 1BF5A 2QACA 1RROA 2LV7A 4HRGA 1ZMZA 2ZN8A 1HT9A 1DJGA 3CWGA 1IH0A 1A29A 1V1GA 2WOSA 3I5FC 1AP4A 1NIWA 2ZRTA 1SW8A 1CTRA 1AK8A 1LXFC 4DCKA 1PK0D 1WDCC 4YI9A 1YX8A 4DUQA 4MZKA 1GGWA 1WY9A 2NXQA 4M2QA 1TOPA 1CFCA 1CLMA 2KYFA 4YBHB 2ZN9A 1TNPA 2LNKA 3LK1A 1J7PA 1SRAA 3TS5C 1M46A 1GJYA 3AAKA 4CPVA 2JTZA 3ICBA 1QX5B 2BKHB 1NX1A 1KK7Y 1SL9A 1JFKA 5B8IB 1Y6WA 1UHKA 5CSNA 2KAXA 2E6WA 2M1UA 2KI4C 1NX0A 1X02A 1BU3A 2MBXA 1RJVA 1IJ6A 5ER5A 4DIRA 1U5IA 4YGCB 2KYCA 3F45A 1S6JA 3JTDC 1OE9B 4C0LA 1E8AA 2OTGB 2FJUB 2KI6C 2VRGA 4PE7A 2L51A 2MAZA 1L7ZA 1PVBA 4GGNA 2OPOA 4NDCA 5CSFA 3TUYB 1Y1AA 3DVMA 3SIAA 1QV1A 3GK4X 4CIDA 4QJ5B 4UPGA 4MRXA 2M3WA 4HREE 1R2UA 2ZRSA 1C07A 1JBAA 4YGDB 4BY4A 3H4SE 5HYDA 3I5GC 1XK4A 3LL8B 4GNKB 4I5KA 2H2KA 1NYAA 1FI5A 2CCMA 1EG3A 3GOFA 1QJTA 2NZ0A 1VRKA 1WDCB 2L4HA 3TDIA 4YI8A 2KHNA 1RK9A 2CBLA 1F55A 3BYAA 1ZOTB 1J1DA 3O2PA 1L2OC 4GUKA 1F4QA 1S5GY 3OX6A 4HSZA 3DF0B 1PRWA 1GQMA 1C7VA 1RTP1 1S3PA 5KU1A 1YRTB 1SCMB 3HCMA 2JNXA 4ORAB 1FBVA 1B47A 4BY5A 3IQOA 1N0YA 2RGIA 2EC6C 4GFTA 3O6BA 1DMOA 1SNLA 1JF0A 1SCVA 2K0JA 4P5OE 1PALA 2F3YA 1YUSA 3I5HB 4OR9B 4PHMA 1J7RA 1XFXO 3KPXA 2I94A 1TTXA 2BBNA 5CSJA 1K90D 2BE6A 2BECA 1SR6C 2K2FA 2JT0A 3NSKA 4FTGA 4F0ZB 2AUCA 2M0RA 3QRXA 2LLTA 3LCPC 1DGVA 1PSRA 5BPJA 1B8LA 3BQ3A 1JUOA 1SY9A 1SMGA 2LLUA 1IQ5A 3I5IB 2KSPA 3CR4X 2ZKMX 5DKQA 2BCXA 2A4JA 2G2BA 1CLLA 5HLVA 2M7LA 3WNXB 4FQOA 1QATA 5FYXA 1TNWA 1TCFA 3DF0A 1S6IA 3VRRA 1TNXA 3SJSA 3TDUA 1XA5A 2AMIA 1QIVA 1SYMA 4I5LB 1IJ5A 2LM5A 4TNCA 1UP5A 3FIAA 4NDBA 1G33A 2F2OA 4PE4A 3SG5A 1PULA 1S36A 1HQVA 1S6CA 5PALA 2OS8B 1UHHA 1TN4A 1ZUZA 2I7AA 2Y1NA 2ZNEA 2L98A 4PCWA 4AQIA 5KTYA 2K7DA 2TN4A 2ZNDA 1N2DA 1KWOC 1B7TY 1CDPA 4M2OA 1CFDA 3PN7B 2Y5IA 2LLSA 2CTNA 3A4UB 1K9PA 1EJ3A 1MXLC 3EK8A 1KQMC 1MUXA 4MZLA 3D0YB 4E68A 4PALA 1Y0VH 2WORA 3OX5A 4MEWA 1FW4A 1B9AA 2H61C 1R6PA 2JTTA 2KDHA 3NSIA 5AFPA 3PLFB 1FI6A 4MRYA 1IKUA 2I2RE 2KGBC 2LP2A 3RM1A 3NSLA 4N5XA 3O4YA 2K2AA 3VRQA 4AOMA 1A2XA 3IF7A 3DVJA 4MN0A 3SG7A 2Q4UA 1NX2A 4M2PA 3KEVA 1JFJA 2Y1MA 5K89A 1K8UA 2F8PA 2KBMA 1UHIA 3VROA 1WRLA 3BUOB 2K7CA 2L4IA 3PATA 1NCZA 1SL7A 1QVIZ 3EKHA 3SIBA 2M97A 3CZTX 3JVTC 4PHJA 4XYNA 2QPTA 1K9UA 1MWNA 3PSRA 2LUXA 4GGFA 1B7TZ 4XJKB 1RFJA 1YX7A 4I5JA 2AAOA 2MA2A 2V53A 1IQ3A 1W7JB 5DKNA 1YVLA 2KFGA 1H8BA 2KOTA 2K8MB 1CMFA 1UHNA 3I5FB 5I2LA 4YRUA 2JT8A 1K93D 4GAOA 3FS7A 3D0YA 2JZIA 1MR8A 1CDNA 2WCEA 1XYDA 1RWYA 1GGZA 3SG4A 3FWCA 2SCPA 1K94A 4P2YB 1BODA 3KHEA 2FCDA 4IL1A 1DJXA 3VGOA 1YTZC 2PSRA 3EVVA 1XFWO 4NDDA 2BL0C 1BJFA 4YGEB 3TS5B 1OZSA 4C0JA 1K2HA 2CXJA 2PMYA 2IS9A 3BXKA 1PSBA 2M49B 3OB2B 1DJWA 1UUSA 2KAVA 1WRKA 2KI4B 4N1GA 4PHKA 1YURA 2GV5A 1DF0B 2CNPA 1QXPA 3WHTB 1C7WA 1UURA 2WCFA 4C0KA 1AJ4A 3JTDB 3OHMB 4ETOA 2M1KB 1ODBA 2HPSA 3CR5X 1DJZA 1XVJA 1A03A 3OP0A 1KK8C 2GGZA 4WQ2A 1CFFA 3EK4A 4PHNA 2MRDA 4XJKA 1CNPA 1UWOA 1CLBA 1IRJA 3TZ1A 2R2IA 2LANA 4ZCUA 1KFXS 4JPZB 3KF9A 3PALA 2PRUA 1XFZO 5TNCA 2FCEA 3DD4A 2WC8A 3CS1A 5D7FA 1J7OA 2O60A 3BUXB 1M31A 1YUTA 1QIWA 2WNDA 3WHUB 5HKWA 2PALA 3I5GB 2KNEA 1CM1A 1ALVA 3PM8A 1RECA 2LHIA 1M63B 4Q04A 3LK0A 1XK4C 5I8NA 3M0WA 5HKZA 2E30A 1EXRA 1M45A 2LVJA 1SL8A 5HLOA 3SG2A 1QV0A 2LHLA 1K9KA 2M8UA 1AVSA 1W7IB 3HX4A 2ISDA 3LLEA 5AANA 2BBMA 2KAYA 1K96A 1F71A 2MJWB 1L2OB 1DJIA 5F6TA 3K21A 1BR1B 1QVIY 1NWDA 1NSHA 3CLNA 5HKYA 1PVAA 1MXEA 1KSMA 1UHJA 4QJ3B 1J55A 2BCBA 4JWQA 2M7NA 1LA0A 1TNQA 2JU0A 4NQGA 2EC6B 4MZJA 4PE0A 1ALWA 1B8CA 4OKHA 3CR2A 1N65A 1YR5A 1KSOA 2OTGC 2L50A 1Q80A 2COLB 1LINA 3BUNB 4DS7A 2KQ6A 1XO5A 1QLSA 4DRWA 2F33A 3ZNIA 1EG4A 1LVCD 1QTXA 4U8DA 1KQVA 1OQPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PFV A;  5I2O A;  3EVR A;  5CPV A;  1SR6 B;  1IWQ A;  1KFU L;  3DVK A;  5CSI A;  2CT9 A;  1DT7 B;  1YUU A;  1LKJ A;  1SBJ A;  4MLW A;  1KFX L;  2M29 A;  3GK2 A;  1CB1 A;  1JSA A;  3TDZ A;  4OV2 A;  4WQ3 A;  3NSO A;  2JOJ A;  3DVE A;  4PE1 A;  2KQY A;  1DVI A;  2F3Z A;  1XFV O;  4PDZ A;  2KFH A;  1ZFS A;  3IQQ A;  1SPY A;  1BLQ A;  2L0P A;  3FWB A;  1V1F A;  4MSP A;  2DOQ A;  1QLK A;  2MLF C;  2LE9 B;  1ZAC A;  1B1G A;  1XFY O;  1SCM C;  2K7O A;  4OVN F;  3GK1 A;  2JXC A;  1YVH A;  1OMR A;  4WRI A;  1DGU A;  2ZFD A;  5J3X A;  1A75 B;  4OCI A;  5JOL A;  1NCY A;  5AXI A;  2KBI A;  3BOW B;  2JUL A;  2LCP A;  2O5G A;  2HQW A;  1KWO B;  1CDL A;  3AAJ A;  4GBA A;  4HRH A;  1J7Q A;  2Y4Q A;  2JC2 A;  4A4B A;  3NXA A;  2P6B B;  1TRF A;  3A8R A;  1B8R A;  3VRP A;  3BUW B;  1S1E A;  2JT3 A;  2K61 A;  2JNF A;  1KQM B;  3I5H C;  4R1E A;  1AHR A;  1SKT A;  1DTL A;  4ORC B;  1AJ5 A;  2EHB A;  1D1O A;  1QX7 A;  2LVI A;  3WXA A;  2B1U A;  1G4Y R;  1DJY A;  1M39 A;  1TCO B;  1CM4 A;  1K95 A;  1QAS A;  2NLN A;  1JWD A;  1OSA A;  5I2Q A;  2MHH A;  2Q91 A;  1WLM A;  1TIZ A;  5IBW A;  2JPT A;  3SG6 A;  3EVU A;  4YGB B;  1A4P A;  4ICB A;  3I5I C;  1F4O A;  1IGV A;  3E3R A;  2LC5 A;  4YGA A;  5GQQ C;  1LA3 A;  2LAP A;  3AKB A;  5JJG A;  2LMT A;  2EGD A;  1BMO A;  4A4C A;  1FF1 A;  1CFP A;  2F2P A;  1KK7 Z;  3C1V A;  1NUB A;  1KFU S;  5DKR A;  3JVT B;  4GPL B;  3O78 A;  5D69 A;  1QX2 A;  2JXL A;  1MHO A;  1NX3 A;  2L2E A;  1CKK A;  1QS7 A;  1B4C A;  1WRZ A;  1A75 A;  2PVB A;  3BOW A;  2KI6 D;  2L5X B;  2OS8 C;  1NP8 A;  3BUM B;  3RLZ A;  4GGF C;  3OB1 B;  1BG1 A;  1CMG A;  5ER4 X;  2JQ6 A;  5G08 A;  1OMV A;  1Y1U A;  1YRU B;  3PN7 C;  4CLN A;  2JRF A;  4CFQ A;  1AUI B;  2HF5 A;  2SAS A;  2NCO A;  4ORB B;  1NPQ A;  2I18 A;  1F8H A;  3AKA A;  2D8N A;  1MF8 B;  2H61 A;  2NCP A;  2LMV A;  1DJH A;  1JF2 A;  1F70 A;  4N1F A;  2LVK A;  3CTN A;  3D10 A;  1JC2 A;  1BOC A;  1CDM A;  1BT6 A;  2KGR A;  4USL A;  1WLZ A;  2BL0 B;  2JWW A;  2PAS A;  1EH2 A;  1H4B A;  1EL4 A;  1DF0 A;  1S26 D;  3MSE B;  2FOT A;  2HQ8 A;  2LUC A;  1IG5 A;  4D1E A;  4ZCV A;  4QJ4 B;  3EKJ A;  1BR4 B;  1MQ1 A;  2MLE C;  1OMD A;  4JQ0 D;  3VRN A;  2K7B A;  4L9M A;  3CGA A;  4AQJ A;  1FPW A;  4MBE A;  5AEQ A;  2BCA A;  4CFR A;  5KSZ A;  1S5G Z;  2HET A;  2WCB A;  1F54 A;  1U5I B;  2LP3 A;  2BKI B;  2M9G A;  3ZWH A;  1SK6 D;  4I5N B;  3EK7 A;  4MVF A;  1KK8 B;  5AER A;  1KCY A;  2LMU A;  3TUY C;  2LVV A;  3SG3 A;  1OZO A;  1XFU O;  1OOJ A;  1Y1X A;  2KFF A;  2G9B A;  1NCX A;  2BE4 A;  1G8I A;  1J1E A;  3KO0 A;  2GGM A;  1BF5 A;  2QAC A;  1RRO A;  2LV7 A;  4HRG A;  1ZMZ A;  2ZN8 A;  1HT9 A;  1DJG A;  3CWG A;  1IH0 A;  1A29 A;  1V1G A;  2WOS A;  3I5F C;  1AP4 A;  1NIW A;  2ZRT A;  1SW8 A;  1CTR A;  1AK8 A;  1LXF C;  4DCK A;  1PK0 D;  1WDC C;  4YI9 A;  1YX8 A;  4DUQ A;  4MZK A;  1GGW A;  1WY9 A;  2NXQ A;  4M2Q A;  1TOP A;  1CFC A;  1CLM A;  2KYF A;  4YBH B;  2ZN9 A;  1TNP A;  2LNK A;  3LK1 A;  1J7P A;  1SRA A;  3TS5 C;  1M46 A;  1GJY A;  3AAK A;  4CPV A;  2JTZ A;  3ICB A;  1QX5 B;  2BKH B;  1NX1 A;  1KK7 Y;  1SL9 A;  1JFK A;  5B8I B;  1Y6W A;  1UHK A;  5CSN A;  2KAX A;  2E6W A;  2M1U A;  2KI4 C;  1NX0 A;  1X02 A;  1BU3 A;  2MBX A;  1RJV A;  1IJ6 A;  5ER5 A;  4DIR A;  1U5I A;  4YGC B;  2KYC A;  3F45 A;  1S6J A;  3JTD C;  1OE9 B;  4C0L A;  1E8A A;  2OTG B;  2FJU B;  2KI6 C;  2VRG A;  4PE7 A;  2L51 A;  2MAZ A;  1L7Z A;  1PVB A;  4GGN A;  2OPO A;  4NDC A;  5CSF A;  3TUY B;  1Y1A A;  3DVM A;  3SIA A;  1QV1 A;  3GK4 X;  4CID A;  4QJ5 B;  4UPG A;  4MRX A;  2M3W A;  4HRE E;  1R2U A;  2ZRS A;  1C07 A;  1JBA A;  4YGD B;  4BY4 A;  3H4S E;  5HYD A;  3I5G C;  1XK4 A;  3LL8 B;  4GNK B;  4I5K A;  2H2K A;  1NYA A;  1FI5 A;  2CCM A;  1EG3 A;  3GOF A;  1QJT A;  2NZ0 A;  1VRK A;  1WDC B;  2L4H A;  3TDI A;  4YI8 A;  2KHN A;  1RK9 A;  2CBL A;  1F55 A;  3BYA A;  1ZOT B;  1J1D A;  3O2P A;  1L2O C;  4GUK A;  1F4Q A;  1S5G Y;  3OX6 A;  4HSZ A;  3DF0 B;  1PRW A;  1GQM A;  1C7V A;  1RTP 1;  1S3P A;  5KU1 A;  1YRT B;  1SCM B;  3HCM A;  2JNX A;  4ORA B;  1FBV A;  1B47 A;  4BY5 A;  3IQO A;  1N0Y A;  2RGI A;  2EC6 C;  4GFT A;  3O6B A;  1DMO A;  1SNL A;  1JF0 A;  1SCV A;  2K0J A;  4P5O E;  1PAL A;  2F3Y A;  1YUS A;  3I5H B;  4OR9 B;  4PHM A;  1J7R A;  1XFX O;  3KPX A;  2I94 A;  1TTX A;  2BBN A;  5CSJ A;  1K90 D;  2BE6 A;  2BEC A;  1SR6 C;  2K2F A;  2JT0 A;  3NSK A;  4FTG A;  4F0Z B;  2AUC A;  2M0R A;  3QRX A;  2LLT A;  3LCP C;  1DGV A;  1PSR A;  5BPJ A;  1B8L A;  3BQ3 A;  1JUO A;  1SY9 A;  1SMG A;  2LLU A;  1IQ5 A;  3I5I B;  2KSP A;  3CR4 X;  2ZKM X;  5DKQ A;  2BCX A;  2A4J A;  2G2B A;  1CLL A;  5HLV A;  2M7L A;  3WNX B;  4FQO A;  1QAT A;  5FYX A;  1TNW A;  1TCF A;  3DF0 A;  1S6I A;  3VRR A;  1TNX A;  3SJS A;  3TDU A;  1XA5 A;  2AMI A;  1QIV A;  1SYM A;  4I5L B;  1IJ5 A;  2LM5 A;  4TNC A;  1UP5 A;  3FIA A;  4NDB A;  1G33 A;  2F2O A;  4PE4 A;  3SG5 A;  1PUL A;  1S36 A;  1HQV A;  1S6C A;  5PAL A;  2OS8 B;  1UHH A;  1TN4 A;  1ZUZ A;  2I7A A;  2Y1N A;  2ZNE A;  2L98 A;  4PCW A;  4AQI A;  5KTY A;  2K7D A;  2TN4 A;  2ZND A;  1N2D A;  1KWO C;  1B7T Y;  1CDP A;  4M2O A;  1CFD A;  3PN7 B;  2Y5I A;  2LLS A;  2CTN A;  3A4U B;  1K9P A;  1EJ3 A;  1MXL C;  3EK8 A;  1KQM C;  1MUX A;  4MZL A;  3D0Y B;  4E68 A;  4PAL A;  1Y0V H;  2WOR A;  3OX5 A;  4MEW A;  1FW4 A;  1B9A A;  2H61 C;  1R6P A;  2JTT A;  2KDH A;  3NSI A;  5AFP A;  3PLF B;  1FI6 A;  4MRY A;  1IKU A;  2I2R E;  2KGB C;  2LP2 A;  3RM1 A;  3NSL A;  4N5X A;  3O4Y A;  2K2A A;  3VRQ A;  4AOM A;  1A2X A;  3IF7 A;  3DVJ A;  4MN0 A;  3SG7 A;  2Q4U A;  1NX2 A;  4M2P A;  3KEV A;  1JFJ A;  2Y1M A;  5K89 A;  1K8U A;  2F8P A;  2KBM A;  1UHI A;  3VRO A;  1WRL A;  3BUO B;  2K7C A;  2L4I A;  3PAT A;  1NCZ A;  1SL7 A;  1QVI Z;  3EKH A;  3SIB A;  2M97 A;  3CZT X;  3JVT C;  4PHJ A;  4XYN A;  2QPT A;  1K9U A;  1MWN A;  3PSR A;  2LUX A;  4GGF A;  1B7T Z;  4XJK B;  1RFJ A;  1YX7 A;  4I5J A;  2AAO A;  2MA2 A;  2V53 A;  1IQ3 A;  1W7J B;  5DKN A;  1YVL A;  2KFG A;  1H8B A;  2KOT A;  2K8M B;  1CMF A;  1UHN A;  3I5F B;  5I2L A;  4YRU A;  2JT8 A;  1K93 D;  4GAO A;  3FS7 A;  3D0Y A;  2JZI A;  1MR8 A;  1CDN A;  2WCE A;  1XYD A;  1RWY A;  1GGZ A;  3SG4 A;  3FWC A;  2SCP A;  1K94 A;  4P2Y B;  1BOD A;  3KHE A;  2FCD A;  4IL1 A;  1DJX A;  3VGO A;  1YTZ C;  2PSR A;  3EVV A;  1XFW O;  4NDD A;  2BL0 C;  1BJF A;  4YGE B;  3TS5 B;  1OZS A;  4C0J A;  1K2H A;  2CXJ A;  2PMY A;  2IS9 A;  3BXK A;  1PSB A;  2M49 B;  3OB2 B;  1DJW A;  1UUS A;  2KAV A;  1WRK A;  2KI4 B;  4N1G A;  4PHK A;  1YUR A;  2GV5 A;  1DF0 B;  2CNP A;  1QXP A;  3WHT B;  1C7W A;  1UUR A;  2WCF A;  4C0K A;  1AJ4 A;  3JTD B;  3OHM B;  4ETO A;  2M1K B;  1ODB A;  2HPS A;  3CR5 X;  1DJZ A;  1XVJ A;  1A03 A;  3OP0 A;  1KK8 C;  2GGZ A;  4WQ2 A;  1CFF A;  3EK4 A;  4PHN A;  2MRD A;  4XJK A;  1CNP A;  1UWO A;  1CLB A;  1IRJ A;  3TZ1 A;  2R2I A;  2LAN A;  4ZCU A;  1KFX S;  4JPZ B;  3KF9 A;  3PAL A;  2PRU A;  1XFZ O;  5TNC A;  2FCE A;  3DD4 A;  2WC8 A;  3CS1 A;  5D7F A;  1J7O A;  2O60 A;  3BUX B;  1M31 A;  1YUT A;  1QIW A;  2WND A;  3WHU B;  5HKW A;  2PAL A;  3I5G B;  2KNE A;  1CM1 A;  1ALV A;  3PM8 A;  1REC A;  2LHI A;  1M63 B;  4Q04 A;  3LK0 A;  1XK4 C;  5I8N A;  3M0W A;  5HKZ A;  2E30 A;  1EXR A;  1M45 A;  2LVJ A;  1SL8 A;  5HLO A;  3SG2 A;  1QV0 A;  2LHL A;  1K9K A;  2M8U A;  1AVS A;  1W7I B;  3HX4 A;  2ISD A;  3LLE A;  5AAN A;  2BBM A;  2KAY A;  1K96 A;  1F71 A;  2MJW B;  1L2O B;  1DJI A;  5F6T A;  3K21 A;  1BR1 B;  1QVI Y;  1NWD A;  1NSH A;  3CLN A;  5HKY A;  1PVA A;  1MXE A;  1KSM A;  1UHJ A;  4QJ3 B;  1J55 A;  2BCB A;  4JWQ A;  2M7N A;  1LA0 A;  1TNQ A;  2JU0 A;  4NQG A;  2EC6 B;  4MZJ A;  4PE0 A;  1ALW A;  1B8C A;  4OKH A;  3CR2 A;  1N65 A;  1YR5 A;  1KSO A;  2OTG C;  2L50 A;  1Q80 A;  2COL B;  1LIN A;  3BUN B;  4DS7 A;  2KQ6 A;  1XO5 A;  1QLS A;  4DRW A;  2F33 A;  3ZNI A;  1EG4 A;  1LVC D;  1QTX A;  4U8D A;  1KQV A;  1OQP A; 
#chains in the Genus database with same CATH topology
 3PFV A;  5I2O A;  3S0B A;  3EVR A;  5CPV A;  1SR6 B;  1IWQ A;  1KFU L;  3DVK A;  5CSI A;  2CT9 A;  1DT7 B;  1YUU A;  1LKJ A;  3IVT A;  3B86 A;  1SBJ A;  4MLW A;  1KFX L;  2M29 A;  3GK2 A;  1CB1 A;  1JSA A;  3TDZ A;  4OV2 A;  4WQ3 A;  3NSO A;  1C3Y A;  2JOJ A;  3DVE A;  4PE1 A;  2KQY A;  1DVI A;  2F3Z A;  1XFV O;  3O4X A;  4PDZ A;  2KFH A;  1ZFS A;  3IQQ A;  1SPY A;  1BLQ A;  2L0P A;  3CDN A;  3FWB A;  1V1F A;  4MSP A;  2DOQ A;  3PM2 A;  1QLK A;  3L4A A;  2MLF C;  2LE9 B;  2WCK A;  1ZAC A;  1B1G A;  1XFY O;  1SCM C;  2K7O A;  4OVN F;  3FE6 A;  3GK1 A;  2JXC A;  1YVH A;  1OMR A;  3NGV A;  1DGU A;  2ZFD A;  4WRI A;  5J3X A;  1A75 B;  4OCI A;  5JOL A;  1NCY A;  5AXI A;  2KBI A;  3BOW B;  2JUL A;  2LCP A;  2O5G A;  2HQW A;  1KWO B;  1CDL A;  3AAJ A;  4GBA A;  4HRH A;  1J7Q A;  2Y4Q A;  2JC2 A;  4A4B A;  3NXA A;  2P6B B;  1TRF A;  3A8R A;  1B8R A;  3VRP A;  3BUW B;  1S1E A;  2JT3 A;  2K61 A;  3CZ1 A;  2JNF A;  1KQM B;  3I5H C;  4R1E A;  1AHR A;  1SKT A;  1DTL A;  4ORC B;  1AJ5 A;  2EHB A;  1D1O A;  1QX7 A;  1TWO A;  2LVI A;  3WXA A;  5I94 A;  2WCH A;  2B1U A;  1G4Y R;  1DJY A;  3L47 A;  1M39 A;  1TCO B;  1CM4 A;  1K95 A;  1QAS A;  2NLN A;  1JWD A;  1OSA A;  5I2Q A;  2MHH A;  2Q91 A;  1WLM A;  1TIZ A;  2QEB A;  3B6X A;  5IBW A;  2JPT A;  3SG6 A;  3EVU A;  4YGB B;  1A4P A;  4ICB A;  3I5I C;  1F4O A;  1IGV A;  1OOH A;  1TUZ A;  2LC5 A;  3E3R A;  4YGA A;  5GQQ C;  2QDI A;  1LA3 A;  2LAP A;  3AKB A;  5JJG A;  2LMT A;  3K1E A;  2EGD A;  1BMO A;  4A4C A;  1FF1 A;  1CFP A;  2F2P A;  1KK7 Z;  2BAP A;  3C1V A;  1NUB A;  1KFU S;  2L5Y A;  5DKR A;  2WCM A;  3JVT B;  3RZS A;  4GPL B;  3R1P A;  3O78 A;  5D69 A;  1QX2 A;  2KPH A;  2JXL A;  1MHO A;  1NX3 A;  2L2E A;  1CKK A;  1QS7 A;  1B4C A;  1WRZ A;  1A75 A;  2JPO A;  2PVB A;  3BOW A;  2KI6 D;  2L5X B;  2OS8 C;  1NP8 A;  3BUM B;  3RLZ A;  4GGF C;  3OB1 B;  1BG1 A;  1CMG A;  5ER4 X;  2QEO A;  2JQ6 A;  5G08 A;  1OMV A;  1Y1U A;  1YRU B;  3PN7 C;  2PYQ A;  4CLN A;  2JRF A;  4CFQ A;  1AUI B;  2K60 A;  2HF5 A;  3S0A A;  2SAS A;  2NCO A;  4ORB B;  2WC6 A;  2P70 A;  1NPQ A;  2I18 A;  1F8H A;  1OOG A;  3AKA A;  2D8N A;  1MF8 B;  2H61 A;  2NCP A;  2LMV A;  2QEV A;  1DJH A;  1JF2 A;  1F70 A;  4N1F A;  2LVK A;  3CTN A;  3D10 A;  1JC2 A;  2YGU A;  1BOC A;  1CDM A;  1BT6 A;  2KGR A;  4USL A;  1WLZ A;  4KYN A;  2BL0 B;  2JWW A;  2PAS A;  3Q8I A;  1EH2 A;  1H4B A;  1EL4 A;  1DF0 A;  1S26 D;  3MSE B;  2PQL A;  2FOT A;  2HQ8 A;  2LUC A;  1IG5 A;  4D1E A;  4ZCV A;  3S0D A;  4QJ4 B;  3EKJ A;  1BR4 B;  1MQ1 A;  2MLE C;  1OMD A;  3DZT A;  4JQ0 D;  3VRN A;  4OZD A;  2K7B A;  4L9M A;  3CGA A;  4AQJ A;  3BFH A;  4MBE A;  5AEQ A;  2BCA A;  4CFR A;  5KSZ A;  3CAB A;  1FPW A;  1S5G Z;  1IIO A;  2HET A;  2WCB A;  1F54 A;  1U5I B;  2LP3 A;  2BKI B;  2M9G A;  3ZWH A;  3DY9 A;  1DC1 A;  1SK6 D;  4I5N B;  3EK7 A;  4MVF A;  1KK8 B;  5AER A;  1KCY A;  2LMU A;  3TUY C;  2LVV A;  3SG3 A;  1OZO A;  1XFU O;  1OOJ A;  1Y1X A;  2KFF A;  2G9B A;  1NCX A;  2BE4 A;  5D3O A;  1G8I A;  1J1E A;  3KO0 A;  1DEK A;  2GGM A;  1BF5 A;  2QAC A;  1RRO A;  2LV7 A;  4HRG A;  1ZMZ A;  2ZN8 A;  1HT9 A;  1DJG A;  3CWG A;  1IH0 A;  1A29 A;  5FI7 A;  1V1G A;  2WOS A;  3I5F C;  3PJI A;  1AP4 A;  1NIW A;  2ZRT A;  1SW8 A;  1CTR A;  1AK8 A;  1LXF C;  4DCK A;  1PK0 D;  1WDC C;  4YI9 A;  1YX8 A;  4DUQ A;  4MZK A;  1GGW A;  5DIC A;  1WY9 A;  1W9Z A;  2NXQ A;  4M2Q A;  1TOP A;  1CFC A;  1CLM A;  2KYF A;  4YBH B;  2ZN9 A;  1TNP A;  2LNK A;  3LK1 A;  1J7P A;  1SRA A;  3TS5 C;  1M46 A;  1GJY A;  3AAK A;  5FI2 A;  4CPV A;  2JTZ A;  3ICB A;  1QX5 B;  2BKH B;  1NX1 A;  1KK7 Y;  1SL9 A;  1JFK A;  5B8I B;  1Y6W A;  1UHK A;  5CSN A;  2KAX A;  2E6W A;  2M1U A;  2KI4 C;  1NX0 A;  1X02 A;  1BU3 A;  2MBX A;  1RJV A;  1IJ6 A;  5ER5 A;  4DIR A;  1U5I A;  4YGC B;  2KYC A;  3F45 A;  1S6J A;  3JTD C;  1OE9 B;  4C0L A;  1E8A A;  2OTG B;  2FJU B;  2KI6 C;  2VRG A;  4PE7 A;  2L51 A;  2MAZ A;  3QME A;  1L7Z A;  1PVB A;  4GGN A;  2OPO A;  4NDC A;  5CSF A;  3TUY B;  1Y1A A;  3DVM A;  3SIA A;  3D74 A;  1QV1 A;  3GK4 X;  4CID A;  4QJ5 B;  4UPG A;  4MRX A;  2M3W A;  4HRE E;  1R2U A;  2ZRS A;  4JD9 A;  1C07 A;  1JBA A;  4YGD B;  4BY4 A;  3H4S E;  5HYD A;  3I5G C;  1XK4 A;  3LL8 B;  4GNK B;  4I5K A;  2H2K A;  1NYA A;  3B87 A;  1FI5 A;  2CCM A;  1EG3 A;  3GOF A;  1QJT A;  2NZ0 A;  1VRK A;  1WDC B;  2L4H A;  3TDI A;  3SS4 A;  4YI8 A;  2KHN A;  1DEL A;  1RK9 A;  2CBL A;  1F55 A;  3BYA A;  1ZOT B;  1J1D A;  3O2P A;  1L2O C;  4GUK A;  1F4Q A;  1S5G Y;  3L4L A;  3OX6 A;  3DF0 B;  4HSZ A;  1PRW A;  1GQM A;  3BFB A;  1C7V A;  1RTP 1;  1S3P A;  5KU1 A;  1YRT B;  3R1O A;  1SCM B;  3HCM A;  2JNX A;  4ORA B;  1FBV A;  2WCL A;  3EG5 B;  1B47 A;  4BY5 A;  1OOF A;  3IQO A;  1N0Y A;  2RGI A;  2EC6 C;  4GFT A;  3O6B A;  1DMO A;  1SNL A;  1JF0 A;  1SCV A;  2K0J A;  4P5O E;  1PAL A;  2F3Y A;  3OBV A;  1YUS A;  3I5H B;  4OR9 B;  4PHM A;  3SS3 A;  1J7R A;  1XFX O;  3KPX A;  2I94 A;  2FJY A;  1TTX A;  3B88 A;  2BBN A;  5CSJ A;  1K90 D;  2BE6 A;  2BEC A;  1SR6 C;  2K2F A;  2JT0 A;  3NSK A;  3R72 A;  4FTG A;  4F0Z B;  2AUC A;  2M0R A;  3QRX A;  2LLT A;  3DYE A;  1DGV A;  3LCP C;  1PSR A;  5BPJ A;  1B8L A;  3BQ3 A;  1JUO A;  1SY9 A;  3SS5 A;  1SMG A;  2LLU A;  1IQ5 A;  3I5I B;  2KSP A;  3CR4 X;  2ZKM X;  5DKQ A;  2BCX A;  2A4J A;  2G2B A;  1CLL A;  3S0F A;  5HLV A;  2M7L A;  3WNX B;  3D78 A;  4FQO A;  1QAT A;  5FYX A;  1TNW A;  1TCF A;  3DF0 A;  1S6I A;  3VRR A;  3D75 A;  1TNX A;  3SJS A;  3TDU A;  1XA5 A;  3UNW A;  1Z4H A;  2AMI A;  1QIV A;  1SYM A;  4I5L B;  1IJ5 A;  2LM5 A;  4TNC A;  1UP5 A;  3FIA A;  1QWV A;  4NDB A;  1G33 A;  2F2O A;  4PE4 A;  3SG5 A;  4JKT A;  1PUL A;  1S36 A;  1HQV A;  1S6C A;  2WC5 A;  2OS8 B;  5PAL A;  1UHH A;  1TN4 A;  1ZUZ A;  2I7A A;  2Y1N A;  2ZNE A;  2L98 A;  4PCW A;  5EL2 A;  4AQI A;  1TUJ A;  5KTY A;  2K7D A;  2TN4 A;  2ZND A;  1N2D A;  1KWO C;  1Z2C B;  1B7T Y;  1CDP A;  4M2O A;  1CFD A;  3PN7 B;  2Y5I A;  2LLS A;  2CTN A;  2GTE A;  3A4U B;  1K9P A;  4F7F A;  5FI6 A;  3V2L A;  1EJ3 A;  1MXL C;  3EK8 A;  1KQM C;  1MUX A;  4MZL A;  3D0Y B;  4E68 A;  4PAL A;  1Y0V H;  2WOR A;  3OX5 A;  4MEW A;  1FW4 A;  1B9A A;  2H61 C;  4IJ7 A;  1R6P A;  2JTT A;  2KDH A;  3NSI A;  2QEH A;  5AFP A;  3PLF B;  2H8V A;  1FI6 A;  3BFA A;  4MRY A;  1IKU A;  3R1V A;  2I2R E;  4PT1 A;  2KGB C;  2LP2 A;  3RM1 A;  3NSL A;  4N5X A;  3O4Y A;  4FQT A;  2K2A A;  3VB1 A;  3VRQ A;  4AOM A;  1A2X A;  3IF7 A;  3DVJ A;  4MN0 A;  3SG7 A;  1SSE B;  2Q4U A;  1NX2 A;  4M2P A;  3KEV A;  1JFJ A;  2Y1M A;  5K89 A;  1OOI X;  2P71 A;  3UO9 A;  1K8U A;  2F8P A;  2KBM A;  1UHI A;  3OGN A;  3VRO A;  5HL1 A;  1WRL A;  3BUO B;  2K7C A;  2L4I A;  3PAT A;  1NCZ A;  1SL7 A;  1QVI Z;  3EKH A;  3SIB A;  2M97 A;  3CZT X;  3JVT C;  4PHJ A;  4XYN A;  2QPT A;  1K9U A;  1C3Z A;  1MWN A;  3PSR A;  2LUX A;  4GGF A;  1B7T Z;  4XJK B;  1RFJ A;  1YX7 A;  4I5J A;  2AAO A;  2MA2 A;  2V53 A;  1IQ3 A;  1W7J B;  5DKN A;  1YVL A;  2KFG A;  1H8B A;  2KOT A;  2K8M B;  3DXL A;  1CMF A;  3FE9 A;  1UHN A;  3I5F B;  5I2L A;  4YRU A;  2JT8 A;  2L2C A;  1K93 D;  4GAO A;  3D76 A;  3D0Y A;  3FS7 A;  2JZI A;  1MR8 A;  1CDN A;  2WCE A;  1XYD A;  1RWY A;  1GGZ A;  3SG4 A;  3FWC A;  2SCP A;  1K94 A;  4P2Y B;  1BOD A;  3KHE A;  2FCD A;  4IL1 A;  1DJX A;  3VGO A;  1YTZ C;  2PSR A;  3EVV A;  1XFW O;  4NDD A;  2BL0 C;  1BJF A;  4YGE B;  3CZ0 A;  3TS5 B;  1OZS A;  4C0J A;  1K2H A;  2CXJ A;  2PMY A;  2IS9 A;  2KLE A;  1PSB A;  1ORG A;  1OW4 A;  2M49 B;  3BXK A;  3OB2 B;  1DJW A;  1UUS A;  2KAV A;  3B7A A;  1WRK A;  2KI4 B;  4N1G A;  4PHK A;  1YUR A;  2GV5 A;  1DF0 B;  2CNP A;  1QXP A;  3D77 A;  3WHT B;  1C7W A;  3CZ2 A;  1UUR A;  2WCF A;  4C0K A;  1AJ4 A;  3JTD B;  3OHM B;  4ETO A;  2M1K B;  1ODB A;  2HPS A;  1T14 A;  3CR5 X;  1DJZ A;  1XVJ A;  1A03 A;  3OP0 A;  1KK8 C;  2GGZ A;  4WQ2 A;  1CFF A;  2WCJ A;  3EK4 A;  4PHN A;  2MRD A;  4XJK A;  1CNP A;  1UWO A;  1CLB A;  1IRJ A;  3S0E A;  2R2I A;  3TZ1 A;  2LAN A;  4ZCU A;  1KFX S;  4JPZ B;  3KF9 A;  3BJH A;  2PRU A;  1XFZ O;  3PAL A;  5TNC A;  2FCE A;  3DD4 A;  2WC8 A;  3CS1 A;  5D7F A;  1J7O A;  4INX A;  2O60 A;  3BUX B;  1M31 A;  1YUT A;  1QIW A;  2WND A;  3WHU B;  5HKW A;  2PAL A;  3I5G B;  2KNE A;  1CM1 A;  1ALV A;  3PM8 A;  1REC A;  2LHI A;  1DQE A;  1M63 B;  4Q04 A;  3LK0 A;  1XK4 C;  2KLD A;  3M0W A;  5I8N A;  5HKZ A;  2E30 A;  1XFR A;  1EXR A;  1M45 A;  2LVJ A;  4INW A;  1SL8 A;  5HLO A;  3SG2 A;  1QV0 A;  2LHL A;  1K9K A;  2M8U A;  1AVS A;  1W7I B;  3FE8 A;  3HX4 A;  2ISD A;  1GM0 A;  3LLE A;  5AAN A;  2BBM A;  2KAY A;  1K96 A;  1F71 A;  2MJW B;  1L2O B;  3N7H A;  3D73 A;  1DJI A;  5F6T A;  3K21 A;  3S0G A;  2BNX A;  1BR1 B;  1QVI Y;  1NWD A;  1NSH A;  3CLN A;  5HKY A;  1PVA A;  1MXE A;  1KSM A;  1UHJ A;  3NHT A;  4QJ3 B;  1J55 A;  2BCB A;  4JWQ A;  2M7N A;  1LA0 A;  1TNQ A;  2JU0 A;  4NQG A;  2ERB A;  2EC6 B;  4MZJ A;  4PE0 A;  1ALW A;  1B8C A;  4OKH A;  3CR2 A;  1N65 A;  1P28 A;  1YR5 A;  1KSO A;  2OTG C;  3CYZ A;  2L50 A;  1Q80 A;  2COL B;  1LIN A;  3BUN B;  4DS7 A;  2KQ6 A;  1XO5 A;  1QLS A;  4DRW A;  2F33 A;  3ZNI A;  1LS8 A;  1EG4 A;  1LVC D;  1QTX A;  4U8D A;  3NHI A;  1KQV A;  1OQP A; 
#chains in the Genus database with same CATH homology
 3PFV A;  5I2O A;  3EVR A;  5CPV A;  1SR6 B;  1IWQ A;  1KFU L;  3DVK A;  5CSI A;  2CT9 A;  1DT7 B;  1YUU A;  1LKJ A;  1SBJ A;  4MLW A;  1KFX L;  2M29 A;  3GK2 A;  1CB1 A;  1JSA A;  3TDZ A;  4OV2 A;  4WQ3 A;  3NSO A;  2JOJ A;  3DVE A;  4PE1 A;  2KQY A;  1DVI A;  2F3Z A;  1XFV O;  4PDZ A;  2KFH A;  1ZFS A;  3IQQ A;  1SPY A;  1BLQ A;  2L0P A;  3FWB A;  1V1F A;  4MSP A;  2DOQ A;  1QLK A;  2MLF C;  2LE9 B;  1ZAC A;  1B1G A;  1XFY O;  1SCM C;  2K7O A;  4OVN F;  3GK1 A;  2JXC A;  1YVH A;  1OMR A;  4WRI A;  1DGU A;  2ZFD A;  5J3X A;  1A75 B;  4OCI A;  5JOL A;  1NCY A;  5AXI A;  2KBI A;  3BOW B;  2JUL A;  2LCP A;  2O5G A;  2HQW A;  1KWO B;  1CDL A;  3AAJ A;  4GBA A;  4HRH A;  1J7Q A;  2Y4Q A;  2JC2 A;  4A4B A;  3NXA A;  2P6B B;  1TRF A;  3A8R A;  1B8R A;  3VRP A;  3BUW B;  1S1E A;  2JT3 A;  2K61 A;  2JNF A;  1KQM B;  3I5H C;  4R1E A;  1AHR A;  1SKT A;  1DTL A;  4ORC B;  1AJ5 A;  2EHB A;  1D1O A;  1QX7 A;  2LVI A;  3WXA A;  2B1U A;  1G4Y R;  1DJY A;  1M39 A;  1TCO B;  1CM4 A;  1K95 A;  1QAS A;  2NLN A;  1JWD A;  1OSA A;  5I2Q A;  2MHH A;  2Q91 A;  1WLM A;  1TIZ A;  5IBW A;  2JPT A;  3SG6 A;  3EVU A;  4YGB B;  1A4P A;  4ICB A;  3I5I C;  1F4O A;  1IGV A;  3E3R A;  2LC5 A;  4YGA A;  5GQQ C;  1LA3 A;  2LAP A;  3AKB A;  5JJG A;  2LMT A;  2EGD A;  1BMO A;  4A4C A;  1FF1 A;  1CFP A;  2F2P A;  1KK7 Z;  3C1V A;  1NUB A;  1KFU S;  5DKR A;  3JVT B;  4GPL B;  3O78 A;  5D69 A;  1QX2 A;  2JXL A;  1MHO A;  1NX3 A;  2L2E A;  1CKK A;  1QS7 A;  1B4C A;  1WRZ A;  1A75 A;  2PVB A;  3BOW A;  2KI6 D;  2L5X B;  2OS8 C;  1NP8 A;  3BUM B;  3RLZ A;  4GGF C;  3OB1 B;  1BG1 A;  1CMG A;  5ER4 X;  2JQ6 A;  5G08 A;  1OMV A;  1Y1U A;  1YRU B;  3PN7 C;  4CLN A;  2JRF A;  4CFQ A;  1AUI B;  2HF5 A;  2SAS A;  2NCO A;  4ORB B;  1NPQ A;  2I18 A;  1F8H A;  3AKA A;  2D8N A;  1MF8 B;  2H61 A;  2NCP A;  2LMV A;  1DJH A;  1JF2 A;  1F70 A;  4N1F A;  2LVK A;  3CTN A;  3D10 A;  1JC2 A;  1BOC A;  1CDM A;  1BT6 A;  2KGR A;  4USL A;  1WLZ A;  2BL0 B;  2JWW A;  2PAS A;  1EH2 A;  1H4B A;  1EL4 A;  1DF0 A;  1S26 D;  3MSE B;  2FOT A;  2HQ8 A;  2LUC A;  1IG5 A;  4D1E A;  4ZCV A;  4QJ4 B;  3EKJ A;  1BR4 B;  1MQ1 A;  2MLE C;  1OMD A;  4JQ0 D;  3VRN A;  2K7B A;  4L9M A;  3CGA A;  4AQJ A;  1FPW A;  4MBE A;  5AEQ A;  2BCA A;  4CFR A;  5KSZ A;  1S5G Z;  2HET A;  2WCB A;  1F54 A;  1U5I B;  2LP3 A;  2BKI B;  2M9G A;  3ZWH A;  1SK6 D;  4I5N B;  3EK7 A;  4MVF A;  1KK8 B;  5AER A;  1KCY A;  2LMU A;  3TUY C;  2LVV A;  3SG3 A;  1OZO A;  1XFU O;  1OOJ A;  1Y1X A;  2KFF A;  2G9B A;  1NCX A;  2BE4 A;  1G8I A;  1J1E A;  3KO0 A;  2GGM A;  1BF5 A;  2QAC A;  1RRO A;  2LV7 A;  4HRG A;  1ZMZ A;  2ZN8 A;  1HT9 A;  1DJG A;  3CWG A;  1IH0 A;  1A29 A;  1V1G A;  2WOS A;  3I5F C;  1AP4 A;  1NIW A;  2ZRT A;  1SW8 A;  1CTR A;  1AK8 A;  1LXF C;  4DCK A;  1PK0 D;  1WDC C;  4YI9 A;  1YX8 A;  4DUQ A;  4MZK A;  1GGW A;  1WY9 A;  2NXQ A;  4M2Q A;  1TOP A;  1CFC A;  1CLM A;  2KYF A;  4YBH B;  2ZN9 A;  1TNP A;  2LNK A;  3LK1 A;  1J7P A;  1SRA A;  3TS5 C;  1M46 A;  1GJY A;  3AAK A;  4CPV A;  2JTZ A;  3ICB A;  1QX5 B;  2BKH B;  1NX1 A;  1KK7 Y;  1SL9 A;  1JFK A;  5B8I B;  1Y6W A;  1UHK A;  5CSN A;  2KAX A;  2E6W A;  2M1U A;  2KI4 C;  1NX0 A;  1X02 A;  1BU3 A;  2MBX A;  1RJV A;  1IJ6 A;  5ER5 A;  4DIR A;  1U5I A;  4YGC B;  2KYC A;  3F45 A;  1S6J A;  3JTD C;  1OE9 B;  4C0L A;  1E8A A;  2OTG B;  2FJU B;  2KI6 C;  2VRG A;  4PE7 A;  2L51 A;  2MAZ A;  1L7Z A;  1PVB A;  4GGN A;  2OPO A;  4NDC A;  5CSF A;  3TUY B;  1Y1A A;  3DVM A;  3SIA A;  1QV1 A;  3GK4 X;  4CID A;  4QJ5 B;  4UPG A;  4MRX A;  2M3W A;  4HRE E;  1R2U A;  2ZRS A;  1C07 A;  1JBA A;  4YGD B;  4BY4 A;  3H4S E;  5HYD A;  3I5G C;  1XK4 A;  3LL8 B;  4GNK B;  4I5K A;  2H2K A;  1NYA A;  1FI5 A;  2CCM A;  1EG3 A;  3GOF A;  1QJT A;  2NZ0 A;  1VRK A;  1WDC B;  2L4H A;  3TDI A;  4YI8 A;  2KHN A;  1RK9 A;  2CBL A;  1F55 A;  3BYA A;  1ZOT B;  1J1D A;  3O2P A;  1L2O C;  4GUK A;  1F4Q A;  1S5G Y;  3OX6 A;  4HSZ A;  3DF0 B;  1PRW A;  1GQM A;  1C7V A;  1RTP 1;  1S3P A;  5KU1 A;  1YRT B;  1SCM B;  3HCM A;  2JNX A;  4ORA B;  1FBV A;  1B47 A;  4BY5 A;  3IQO A;  1N0Y A;  2RGI A;  2EC6 C;  4GFT A;  3O6B A;  1DMO A;  1SNL A;  1JF0 A;  1SCV A;  2K0J A;  4P5O E;  1PAL A;  2F3Y A;  1YUS A;  3I5H B;  4OR9 B;  4PHM A;  1J7R A;  1XFX O;  3KPX A;  2I94 A;  1TTX A;  2BBN A;  5CSJ A;  1K90 D;  2BE6 A;  2BEC A;  1SR6 C;  2K2F A;  2JT0 A;  3NSK A;  4FTG A;  4F0Z B;  2AUC A;  2M0R A;  3QRX A;  2LLT A;  3LCP C;  1DGV A;  1PSR A;  5BPJ A;  1B8L A;  3BQ3 A;  1JUO A;  1SY9 A;  1SMG A;  2LLU A;  1IQ5 A;  3I5I B;  2KSP A;  3CR4 X;  2ZKM X;  5DKQ A;  2BCX A;  2A4J A;  2G2B A;  1CLL A;  5HLV A;  2M7L A;  3WNX B;  4FQO A;  1QAT A;  5FYX A;  1TNW A;  1TCF A;  3DF0 A;  1S6I A;  3VRR A;  1TNX A;  3SJS A;  3TDU A;  1XA5 A;  2AMI A;  1QIV A;  1SYM A;  4I5L B;  1IJ5 A;  2LM5 A;  4TNC A;  1UP5 A;  3FIA A;  4NDB A;  1G33 A;  2F2O A;  4PE4 A;  3SG5 A;  1PUL A;  1S36 A;  1HQV A;  1S6C A;  5PAL A;  2OS8 B;  1UHH A;  1TN4 A;  1ZUZ A;  2I7A A;  2Y1N A;  2ZNE A;  2L98 A;  4PCW A;  4AQI A;  5KTY A;  2K7D A;  2TN4 A;  2ZND A;  1N2D A;  1KWO C;  1B7T Y;  1CDP A;  4M2O A;  1CFD A;  3PN7 B;  2Y5I A;  2LLS A;  2CTN A;  3A4U B;  1K9P A;  1EJ3 A;  1MXL C;  3EK8 A;  1KQM C;  1MUX A;  4MZL A;  3D0Y B;  4E68 A;  4PAL A;  1Y0V H;  2WOR A;  3OX5 A;  4MEW A;  1FW4 A;  1B9A A;  2H61 C;  1R6P A;  2JTT A;  2KDH A;  3NSI A;  5AFP A;  3PLF B;  1FI6 A;  4MRY A;  1IKU A;  2I2R E;  2KGB C;  2LP2 A;  3RM1 A;  3NSL A;  4N5X A;  3O4Y A;  2K2A A;  3VRQ A;  4AOM A;  1A2X A;  3IF7 A;  3DVJ A;  4MN0 A;  3SG7 A;  2Q4U A;  1NX2 A;  4M2P A;  3KEV A;  1JFJ A;  2Y1M A;  5K89 A;  1K8U A;  2F8P A;  2KBM A;  1UHI A;  3VRO A;  1WRL A;  3BUO B;  2K7C A;  2L4I A;  3PAT A;  1NCZ A;  1SL7 A;  1QVI Z;  3EKH A;  3SIB A;  2M97 A;  3CZT X;  3JVT C;  4PHJ A;  4XYN A;  2QPT A;  1K9U A;  1MWN A;  3PSR A;  2LUX A;  4GGF A;  1B7T Z;  4XJK B;  1RFJ A;  1YX7 A;  4I5J A;  2AAO A;  2MA2 A;  2V53 A;  1IQ3 A;  1W7J B;  5DKN A;  1YVL A;  2KFG A;  1H8B A;  2KOT A;  2K8M B;  1CMF A;  1UHN A;  3I5F B;  5I2L A;  4YRU A;  2JT8 A;  1K93 D;  4GAO A;  3FS7 A;  3D0Y A;  2JZI A;  1MR8 A;  1CDN A;  2WCE A;  1XYD A;  1RWY A;  1GGZ A;  3SG4 A;  3FWC A;  2SCP A;  1K94 A;  4P2Y B;  1BOD A;  3KHE A;  2FCD A;  4IL1 A;  1DJX A;  3VGO A;  1YTZ C;  2PSR A;  3EVV A;  1XFW O;  4NDD A;  2BL0 C;  1BJF A;  4YGE B;  3TS5 B;  1OZS A;  4C0J A;  1K2H A;  2CXJ A;  2PMY A;  2IS9 A;  3BXK A;  1PSB A;  2M49 B;  3OB2 B;  1DJW A;  1UUS A;  2KAV A;  1WRK A;  2KI4 B;  4N1G A;  4PHK A;  1YUR A;  2GV5 A;  1DF0 B;  2CNP A;  1QXP A;  3WHT B;  1C7W A;  1UUR A;  2WCF A;  4C0K A;  1AJ4 A;  3JTD B;  3OHM B;  4ETO A;  2M1K B;  1ODB A;  2HPS A;  3CR5 X;  1DJZ A;  1XVJ A;  1A03 A;  3OP0 A;  1KK8 C;  2GGZ A;  4WQ2 A;  1CFF A;  3EK4 A;  4PHN A;  2MRD A;  4XJK A;  1CNP A;  1UWO A;  1CLB A;  1IRJ A;  3TZ1 A;  2R2I A;  2LAN A;  4ZCU A;  1KFX S;  4JPZ B;  3KF9 A;  3PAL A;  2PRU A;  1XFZ O;  5TNC A;  2FCE A;  3DD4 A;  2WC8 A;  3CS1 A;  5D7F A;  1J7O A;  2O60 A;  3BUX B;  1M31 A;  1YUT A;  1QIW A;  2WND A;  3WHU B;  5HKW A;  2PAL A;  3I5G B;  2KNE A;  1CM1 A;  1ALV A;  3PM8 A;  1REC A;  2LHI A;  1M63 B;  4Q04 A;  3LK0 A;  1XK4 C;  5I8N A;  3M0W A;  5HKZ A;  2E30 A;  1EXR A;  1M45 A;  2LVJ A;  1SL8 A;  5HLO A;  3SG2 A;  1QV0 A;  2LHL A;  1K9K A;  2M8U A;  1AVS A;  1W7I B;  3HX4 A;  2ISD A;  3LLE A;  5AAN A;  2BBM A;  2KAY A;  1K96 A;  1F71 A;  2MJW B;  1L2O B;  1DJI A;  5F6T A;  3K21 A;  1BR1 B;  1QVI Y;  1NWD A;  1NSH A;  3CLN A;  5HKY A;  1PVA A;  1MXE A;  1KSM A;  1UHJ A;  4QJ3 B;  1J55 A;  2BCB A;  4JWQ A;  2M7N A;  1LA0 A;  1TNQ A;  2JU0 A;  4NQG A;  2EC6 B;  4MZJ A;  4PE0 A;  1ALW A;  1B8C A;  4OKH A;  3CR2 A;  1N65 A;  1YR5 A;  1KSO A;  2OTG C;  2L50 A;  1Q80 A;  2COL B;  1LIN A;  3BUN B;  4DS7 A;  2KQ6 A;  1XO5 A;  1QLS A;  4DRW A;  2F33 A;  3ZNI A;  1EG4 A;  1LVC D;  1QTX A;  4U8D A;  1KQV A;  1OQP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...