2F2OA

Structure of calmodulin bound to a calcineurin peptide: a new way of making an old binding mode
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
171
structure length
156
Chain Sequence
TEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAIRNKIRAIGKMARVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin fused with calmodulin-binding domain of calcineur
publication title Structure of calmodulin bound to a calcineurin Peptide: a new way of making an old binding mode.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 60
structure length 156
sequence length 171
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2005-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2f2oA01
3I5IB 2AUCA 4HRHA 2GGZA 2LCPA 2LVJA 3IQQA 4DS7A 3CWGA 4GUKA 2BCBA 4ORBB 1F54A 1J1EA 1NPQA 3CR5X 3I5GB 3I5FC 1K9UA 1TNPA 3DVEA 4OCIA 1JFKA 1Y1UA 1R2UA 3TS5B 1ZUZA 1IWQA 4XJKA 4CFQA 3PM8A 1KQMB 2KI6C 1XYDA 1OOJA 3EKJA 1TN4A 1CFCA 2I7AA 1YVLA 1DJHA 2JTZA 1QJTA 5D7FA 1M31A 3NXAA 2Y4QA 2LVIA 4HRGA 1UHNA 1S5GY 2MA2A 5K89A 2F8PA 3O2PA 2H61C 5CPVA 1OMRA 3FWCA 4XYNA 2KI4B 3IF7A 4XJKB 1QV0A 3OP0A 1SCVA 1WDCC 2KOTA 2BL0B 2MJWB 1QV1A 2JNFA 2Q4UA 4GGNA 4OKHA 3TZ1A 1U5IA 4AQIA 1VRKA 2IS9A 3KHEA 1MF8B 2Y5IA 3EK7A 2K0JA 1DJIA 1NX2A 1V1GA 3EVUA 1HQVA 3O4YA 2K8MB 1K9KA 1WLZA 3E3RA 1J1DA 2OTGB 4PALA 1KSOA 1BR1B 3PATA 1YRUB 1MHOA 2BBMA 1CNPA 1TRFA 1BJFA 3LK0A 4WQ2A 1U5IB 2AAOA 1OMVA 2B1UA 2ZFDA 2WORA 3PLFB 4I5KA 1CKKA 1B1GA 1SCMC 4R1EA 2PALA 2ZNEA 2M29A 3DD4A 2KYFA 2WC8A 3AAKA 1BT6A 3SIAA 2CT9A 1SL9A 2K2FA 4WRIA 2LM5A 3SG6A 2JULA 1KSMA 3VRPA 4A4CA 1AHRA 1CDLA 1OSAA 3OHMB 3DVMA 4GGFA 5I8NA 1EXRA 1NCZA 1PVAA 2JOJA 2WCEA 1L2OC 2LMTA 2LP2A 2JU0A 5HKWA 1ZACA 2E6WA 5FYXA 1YRTB 4YGCB 2AMIA 1S6IA 2BCXA 2OPOA 1M39A 5DKQA 1PSRA 4PHNA 4AQJA 1NX0A 1XK4A 1QLSA 2TN4A 2LLSA 5JJGA 1YUUA 4YBHB 1Q80A 1IJ6A 1OE9B 1QVIZ 1B7TY 1IQ3A 3WHUB 1K90D 1QIVA 3TDIA 2CBLA 3HCMA 4YGEB 2KAXA 3WHTB 2KQYA 4PE0A 5CSNA 3TUYB 4M2PA 1K8UA 1EG4A 3PN7C 1F4OA 1B8CA 1XFUO 1KFUL 1PALA 4ZCVA 4I5NB 1DTLA 3JTDB 1XFWO 1EJ3A 1K95A 1BODA 2M7LA 2JXCA 1DJYA 2BKIB 4GFTA 2K7BA 2H2KA 1Y0VH 1B8RA 4F0ZB 5HKYA 1XO5A 1KFXS 1LINA 4FQOA 4ETOA 1J55A 3DVKA 3M0WA 4P5OE 1K9PA 1JBAA 3EK4A 3D10A 2BE4A 2M0RA 1K96A 3CLNA 2K61A 3OX5A 2EGDA 2F3ZA 1S36A 2G9BA 2LUXA 2SASA 1FI6A 2JWWA 1PSBA 1CDPA 2LANA 3DF0A 2KAYA 4NDBA 1AJ4A 2LP3A 2LV7A 4IL1A 5CSFA 1XK4C 2WCBA 1IH0A 3OX6A 1QXPA 2RGIA 3EVVA 4C0JA 1CLMA 1LA3A 1YURA 2L0PA 3PALA 5ER4X 1HT9A 2L5XB 3D0YA 1RWYA 1S1EA 1MXLC 2A4JA 1FW4A 2F2PA 4PE7A 4NDCA 3DF0B 1KWOB 2LLTA 4WQ3A 1CFFA 2MAZA 1A75A 1MXEA 2MRDA 2SCPA 3PFVA 3TDUA 1NP8A 1C7WA 1SK6D 5AANA 1NX1A 3I5HC 2F33A 4DIRA 4JPZB 1IG5A 2CNPA 1CTRA 1J7PA 3D0YB 3I5IC 3F45A 2KGRA 3FWBA 4MRYA 2JZIA 2LNKA 1EH2A 2PSRA 1CFDA 5AXIA 3JVTB 2BCAA 3CR2A 4I5JA 1C7VA 2FOTA 3I5GC 4MBEA 1J7OA 1A75B 2M7NA 2R2IA 1BLQA 1GQMA 2BBNA 1SBJA 2QACA 3VRRA 3TS5C 2ZN8A 2L50A 1YX7A 1ALVA 1K93D 5HLVA 1LKJA 1KQMC 3O78A 3CGAA 2MBXA 4PCWA 4QJ4B 2HQ8A 1TNXA 2M3WA 2L98A 5BPJA 5TNCA 3A8RA 2QPTA 1QASA 4Q04A 2L2EA 1KK7Y 4DUQA 1H8BA 1B8LA 1AP4A 1NWDA 2I94A 2OS8B 4CIDA 1YUTA 2KI4C 1K2HA 1QIWA 2LE9B 1TTXA 2JQ6A 1UHHA 2O5GA 4ORCB 4UPGA 2BL0C 1IQ5A 4JQ0D 3LCPC 2Y1NA 1KQVA 1MQ1A 4YI8A 2LHIA 3SG2A 1IGVA 2CXJA 1IKUA 3BUNB 1FBVA 2BECA 2KFFA 3OB1B 1UP5A 5AEQA 3VROA 5HKZA 2OTGC 3SG7A 1SW8A 2EC6B 4E68A 5CSIA 2G2BA 2LMVA 1JFJA 1OMDA 1RROA 1V1FA 2GGMA 3OB2B 4PE4A 4CLNA 2JNXA 1DF0A 5ER5A 1GGZA 3SIBA 1B4CA 2MLFC 4P2YB 5DKNA 3SG5A 1WRZA 1SR6B 1MUXA 2F2OA 2LVVA 3FIAA 1RECA 3AKAA 1XFYO 1FI5A 3WXAA 4BY5A 5AERA 4M2OA 4OV2A 2K7OA 2Y1MA 2LVKA 2ISDA 3LLEA 2D8NA 5G08A 3KO0A 3SJSA 1EG3A 1DF0B 2MHHA 1B47A 3MSEB 1KCYA 2I18A 1AJ5A 2BE6A 1SY9A 2M1KB 2LMUA 4BY4A 1MWNA 1A4PA 1TIZA 4N1GA 2PRUA 1F71A 1PVBA 1WRLA 2K7CA 1YTZC 2KDHA 3BXKA 3ICBA 5PALA 5KTYA 1D1OA 1SYMA 1CFPA 2FCEA 5KSZA 5DKRA 1TCOB 2L4IA 3VRQA 4PHKA 2K7DA 4MRXA 1CMFA 4PHJA 1SR6C 2M9GA 2ZNDA 3GK2A 4I5LB 1PK0D 1DVIA 4GGFC 1WY9A 1LVCD 1UHIA 3GK1A 1EL4A 4JWQA 1SPYA 1XVJA 2E30A 4ZCUA 1QS7A 4N5XA 3GOFA 4MVFA 1YX8A 1FPWA 3TUYC 1RTP1 3I5FB 1JF2A 1DJGA 2KAVA 2M8UA 4HREE 2KFHA 4OR9B 4C0LA 2KQ6A 1UUSA 1J7QA 1RJVA 1W7IB 1JC2A 1BF5A 1Y6WA 1ZOTB 4MEWA 4TNCA 1UWOA 1OQPA 2O60A 3JTDC 4YGDB 3K21A 1RFJA 2KGBC 1L7ZA 3ZNIA 4DCKA 3KEVA 1S6CA 3CR4X 1H4BA 1M46A 4QJ5B 1NUBA 2KBIA 1W7JB 1FF1A 5B8IB 4CPVA 1TNWA 1CLLA 2NCOA 4U8DA 3AKBA 2VRGA 3H4SE 2KHNA 3FS7A 5CSJA 1YR5A 1JUOA 1JF0A 4MSPA 3EVRA 1CDNA 3C1VA 3NSIA 1ZFSA 1F70A 2KBMA 1WDCB 1B7TZ 4M2QA 2Q91A 1OZSA 4FTGA 2NCPA 1MR8A 1AK8A 1QATA 1SRAA 3VGOA 5I2LA 2FJUB 1UHJA 5GQQC 4CFRA 5JOLA 1A03A 1SL8A 1QX2A 2JC2A 1B9AA 1KK8B 1LXFC 1BG1A 3NSLA 2MLEC 4ORAB 1R6PA 4MZJA 1SNLA 2M97A 1E8AA 2PMYA 4MZKA 1KWOC 4MN0A 1CMGA 1IJ5A 1IRJA 4HSZA 1GJYA 3WNXB 2WOSA 4MLWA 5D69A 1DJXA 2FCDA 2COLB 2NZ0A 1SCMB 1F8HA 1TCFA 2ZKMX 2JXLA 1QVIY 2HF5A 2PVBA 2PASA 1KFXL 1ODBA 3NSKA 3QRXA 3JVTC 2ZRTA 2JRFA 1A2XA 1KFUS 4YGAA 2NXQA 1Y1XA 1QLKA 3KF9A 5HLOA 1PULA 2ZRSA 1DMOA 1S26D 3PSRA 1G33A 1KK8C 4GPLB 5KU1A 4YGBB 1GGWA 1UHKA 4AOMA 3A4UB 1C07A 4NQGA 1BMOA 1L2OB 2M1UA 1XFZO 1DGVA 1S3PA 1AUIB 1DJZA 2WNDA 4PHMA 1CDMA 1NCXA 1M63B 2LLUA 1DGUA 2KI6D 1UURA 2HQWA 3IQOA 2K2AA 4DRWA 1NIWA 1PRWA 5HYDA 1K94A 1F4QA 2CCMA 3O6BA 3BOWA 3SG3A 3HX4A 1J7RA 3CZTX 3NSOA 4PE1A 3BUMB 1G8IA 2OS8C 2WCFA 1Y1AA 3CTNA 3BUWB 3RM1A 3ZWHA 1F55A 1S5GZ 2KYCA 3LL8B 4GAOA 1XFXO 4USLA 1SL7A 2JTTA 1JSAA 5F6TA 5J3XA 2LUCA 2P6BB 3TDZA 4ICBA 5I2OA 1NCYA 1YUSA 1AVSA 2V53A 3PN7B 3BOWB 5IBWA 1JWDA 3GK4X 1NSHA 2HETA 1NX3A 3AAJA 4N1FA 2EC6C 4C0KA 1XA5A 1BOCA 3DVJA 1N65A 4GNKB 4YI9A 2JPTA 1QX5B 2F3YA 1CM4A 4NDDA 5AFPA 1CB1A 2DOQA 1DT7B 2JT0A 1SKTA 4QJ3B 1XFVO 2KNEA 4OVNF 1BR4B 1QX7A 1KK7Z 4GBAA 3CS1A 1WLMA 4L9MA 4D1EA 4YRUA 3EK8A 1LA0A 3BYAA 1DJWA 1ALWA 2LHLA 2GV5A 2KSPA 2LC5A 1N2DA 2I2RE 2M49B 1YVHA 1M45A 2LAPA 1TOPA 1A29A 1S6JA 1X02A 1TNQA 1WRKA 4PDZA 2ZN9A 1OZOA 2H61A 3EKHA 1SMGA 1ZMZA 3RLZA 2NLNA 2JT8A 1NYAA 1G4YR 3LK1A 4A4BA 3BUXB 2KFGA 1RK9A 2JT3A 4MZLA 2EHBA 3KPXA 5I2QA 1CLBA 1QTXA 2HPSA 3BQ3A 2L4HA 2BKHB 2CTNA 3I5HB 3VRNA 2L51A 1N0YA 1CM1A 1BU3A 3SG4A 3BUOB
chains in the Genus database with same CATH superfamily
3I5IB 2AUCA 3BFBA 4HRHA 2GGZA 2LCPA 2LVJA 3IQQA 4DS7A 3CWGA 4GUKA 2BCBA 4ORBB 1F54A 1J1EA 1NPQA 3CR5X 3I5GB 3I5FC 1K9UA 1TNPA 3DVEA 3CZ2A 4OCIA 3N7HA 1JFKA 1Y1UA 1R2UA 3TS5B 1ZUZA 1LS8A 1IWQA 4XJKA 4CFQA 3PM8A 1KQMB 2KI6C 1XYDA 3B6XA 1OOJA 3FE8A 3EKJA 1TN4A 1CFCA 2I7AA 1YVLA 3B87A 3UO9A 1DJHA 2JTZA 1QJTA 5D7FA 1M31A 3NXAA 2Y4QA 2LVIA 4HRGA 1UHNA 1S5GY 2MA2A 5K89A 2F8PA 3O2PA 2H61C 5CPVA 1OMRA 3FWCA 4XYNA 2KI4B 3IF7A 4XJKB 1QV0A 3OP0A 1SCVA 1WDCC 2KOTA 2BL0B 2MJWB 1QV1A 2JNFA 2Q4UA 4GGNA 4OKHA 3TZ1A 1U5IA 4AQIA 1VRKA 2IS9A 3KHEA 4JKTA 1MF8B 2Y5IA 3EK7A 2K0JA 1DJIA 1NX2A 1V1GA 2H8VA 1HQVA 3EVUA 2K8MB 1OOIX 1K9KA 3O4YA 5EL2A 1WLZA 3E3RA 1J1DA 2OTGB 4PALA 3EG5B 1KSOA 1BR1B 3PATA 1YRUB 1MHOA 2BBMA 1CNPA 1TRFA 1TUJA 1BJFA 3LK0A 4WQ2A 1U5IB 2AAOA 1DC1A 1T14A 1OMVA 2B1UA 2ZFDA 2WORA 3PLFB 3FE9A 4I5KA 1CKKA 1B1GA 1SCMC 4R1EA 3L47A 2PALA 2ZNEA 2M29A 3DD4A 2KYFA 1SSEB 2WC8A 3AAKA 1BT6A 3SIAA 2CT9A 1SL9A 2K2FA 4WRIA 2LM5A 3SG6A 3BFHA 3SS4A 2JULA 1KSMA 3VRPA 4A4CA 1AHRA 1CDLA 1OSAA 3OHMB 3DVMA 4GGFA 5I8NA 1EXRA 1NCZA 3NHIA 1PVAA 2JOJA 2WCEA 1L2OC 2LMTA 2LP2A 2JU0A 5HKWA 1ZACA 2E6WA 5FYXA 1YRTB 4YGCB 2AMIA 1S6IA 2BCXA 2OPOA 1M39A 5DKQA 1PSRA 4PHNA 4AQJA 1OW4A 1NX0A 1XK4A 5I2QA 3CYZA 1QLSA 2TN4A 3V2LA 2LLSA 5JJGA 1YUUA 4YBHB 1Q80A 1IJ6A 1OE9B 1QVIZ 1B7TY 1IQ3A 3WHUB 1K90D 1QIVA 3TDIA 2CBLA 3HCMA 4YGEB 2KAXA 3WHTB 2KQYA 4PE0A 5CSNA 3TUYB 3D74A 3SS3A 4M2PA 1K8UA 1EG4A 3PN7C 1F4OA 1B8CA 1XFUO 1KFUL 1PALA 4ZCVA 4I5NB 1DTLA 2KPHA 3JTDB 2L5YA 1XFWO 1EJ3A 1K95A 1BODA 2M7LA 2JXCA 1DJYA 2BKIB 4GFTA 4INXA 2K7BA 2H2KA 1Y0VH 1B8RA 4F0ZB 5HKYA 1XO5A 1KFXS 1LINA 3B88A 4FQOA 3UNWA 4ETOA 1J55A 3DVKA 3M0WA 4P5OE 1K9PA 1JBAA 3EK4A 3D10A 2BE4A 2M0RA 1K96A 3CLNA 1XFRA 2K61A 3OX5A 2EGDA 2F3ZA 1OOHA 1S36A 2G9BA 2LUXA 2SASA 1FI6A 3D78A 2JWWA 1PSBA 1CDPA 2LANA 3DF0A 2KAYA 4NDBA 1AJ4A 2LP3A 2PYQA 2LV7A 4IL1A 3O4XA 5CSFA 1XK4C 2WCBA 1IH0A 3OX6A 1QXPA 2FJYA 2RGIA 3EVVA 4C0JA 1CLMA 1LA3A 1YURA 1OOGA 2L0PA 3PALA 5ER4X 2WC6A 1HT9A 2L5XB 3B86A 3D0YA 1RWYA 1S1EA 1C3YA 1MXLC 2A4JA 1FW4A 2F2PA 2WCKA 3D76A 4NDCA 3DF0B 4PE7A 5FI7A 1KWOB 2LLTA 4WQ3A 1CFFA 3R1PA 2MAZA 1A75A 1MXEA 2MRDA 2SCPA 3PFVA 3TDUA 1NP8A 1C7WA 1SK6D 5AANA 1NX1A 3I5HC 2F33A 4DIRA 4JPZB 1TWOA 1IG5A 2CNPA 1CTRA 1J7PA 2KLEA 3D0YB 3I5IC 3F45A 2KGRA 3CDNA 3FWBA 2JZIA 2LNKA 4MRYA 2PSRA 1EH2A 1CFDA 5AXIA 3JVTB 2BCAA 3CR2A 4I5JA 1C7VA 2FOTA 3I5GC 4MBEA 1J7OA 1A75B 2M7NA 2R2IA 1BLQA 1GQMA 2BBNA 1SBJA 2QACA 3VRRA 3DXLA 3TS5C 2P70A 2ZN8A 2L50A 1YX7A 3S0GA 1ALVA 1K93D 2QEBA 5HLVA 1OOFA 1LKJA 1KQMC 3O78A 3CGAA 3B7AA 2MBXA 4PCWA 4QJ4B 2HQ8A 1TNXA 2M3WA 2L98A 5BPJA 3K1EA 5TNCA 3A8RA 2QPTA 1QASA 4Q04A 2L2EA 1KK7Y 4DUQA 1H8BA 1B8LA 1AP4A 1NWDA 2I94A 2OS8B 4CIDA 1YUTA 3S0EA 2KI4C 2K60A 1K2HA 1QIWA 2LE9B 1TTXA 2JQ6A 1UHHA 2O5GA 4ORCB 4UPGA 2BAPA 2BL0C 1IQ5A 4JQ0D 3LCPC 2Y1NA 1KQVA 1MQ1A 4YI8A 2LHIA 2P71A 3SG2A 1IGVA 2CXJA 1IKUA 3BUNB 1TUZA 1FBVA 2BECA 2KFFA 1C3ZA 3OB1B 1UP5A 5AEQA 3VROA 5HKZA 2OTGC 3SG7A 1SW8A 2EC6B 3CABA 4E68A 5CSIA 2G2BA 2LMVA 1JFJA 1OMDA 1RROA 1V1FA 2GGMA 3OB2B 4PE4A 4CLNA 2WCLA 2JNXA 1DF0A 5ER5A 3S0BA 1GGZA 3SIBA 1B4CA 3IVTA 2MLFC 4P2YB 5DKNA 3SG5A 1WRZA 1SR6B 1MUXA 2F2OA 2LVVA 3FIAA 1RECA 3AKAA 1XFYO 1FI5A 1DELA 3WXAA 4BY5A 5AERA 4M2OA 4OV2A 2K7OA 2Y1MA 2LVKA 2ISDA 5HL1A 3QMEA 2QEHA 3LLEA 3RZSA 2D8NA 1GM0A 5G08A 3KO0A 3SJSA 1EG3A 1DF0B 2MHHA 1B47A 2WCHA 3MSEB 1KCYA 2I18A 1AJ5A 2BE6A 1SY9A 2M1KB 3D77A 1Z4HA 2LMUA 5FI2A 4BY4A 1MWNA 1A4PA 1TIZA 4N1GA 2PRUA 1F71A 1PVBA 1WRLA 2K7CA 1YTZC 2KDHA 3BXKA 3ICBA 3Q8IA 5PALA 5KTYA 1SYMA 1CFPA 2FCEA 3NGVA 5KSZA 1D1OA 5DKRA 1TCOB 2L4IA 3VRQA 4PHKA 2K7DA 4MRXA 1CMFA 4PHJA 1SR6C 2M9GA 2ZNDA 3GK2A 4I5LB 3SS5A 3R1VA 1PK0D 1DVIA 4GGFC 4IJ7A 1WY9A 1LVCD 1UHIA 3FE6A 1EL4A 3GK1A 3L4LA 4JWQA 1SPYA 1XVJA 2E30A 2QDIA 3CZ1A 3DZTA 3PM2A 4ZCUA 2YGUA 1QS7A 4N5XA 3GOFA 4MVFA 1YX8A 1FPWA 4JD9A 3TUYC 1RTP1 3I5FB 1JF2A 1DJGA 2KAVA 2M8UA 4HREE 2KFHA 1ORGA 2JPOA 4OR9B 4C0LA 2KQ6A 1UUSA 1J7QA 1RJVA 1W7IB 1JC2A 1BF5A 1Y6WA 1ZOTB 4MEWA 4TNCA 1UWOA 1OQPA 2O60A 3JTDC 4YGDB 3K21A 1RFJA 2QEOA 2KGBC 1L7ZA 3ZNIA 4DCKA 3KEVA 1S6CA 3CR4X 1H4BA 1M46A 4QJ5B 1NUBA 2KBIA 1W7JB 2QEVA 1FF1A 5B8IB 4CPVA 1TNWA 1CLLA 2NCOA 4U8DA 3AKBA 2VRGA 3H4SE 2KHNA 3FS7A 2ERBA 5CSJA 1YR5A 1JUOA 1JF0A 4MSPA 3EVRA 1CDNA 3C1VA 3NSIA 1ZFSA 1F70A 1Z2CB 1WDCB 2KBMA 1B7TZ 4M2QA 2Q91A 1OZSA 4FTGA 4PT1A 2NCPA 1MR8A 3BJHA 1AK8A 1QATA 1SRAA 1IIOA 3VGOA 5I2LA 2FJUB 1UHJA 5GQQC 4CFRA 5JOLA 1A03A 3DYEA 1SL8A 1QX2A 1P28A 2JC2A 1B9AA 1KK8B 1LXFC 3R72A 1BG1A 3NSLA 2MLEC 4ORAB 3CZ0A 1R6PA 4MZJA 1SNLA 2M97A 1E8AA 2PMYA 4MZKA 1KWOC 4MN0A 1CMGA 1IJ5A 1IRJA 4HSZA 1GJYA 3WNXB 2GTEA 2WOSA 4MLWA 5D69A 1DJXA 2FCDA 2COLB 2NZ0A 1SCMB 1F8HA 1TCFA 2ZKMX 2JXLA 1QVIY 2HF5A 2PVBA 2PASA 1KFXL 1ODBA 3NSKA 3QRXA 3JVTC 2ZRTA 2JRFA 1A2XA 1KFUS 4YGAA 1QWVA 2NXQA 3DY9A 5DICA 1Y1XA 1QLKA 3KF9A 5HLOA 1PULA 2BNXA 2ZRSA 1DMOA 1S26D 3PSRA 1G33A 1KK8C 4GPLB 5KU1A 4YGBB 1GGWA 1UHKA 4AOMA 3A4UB 1C07A 4NQGA 1BMOA 1L2OB 2M1UA 1XFZO 1DGVA 1S3PA 1AUIB 1DJZA 2WNDA 4PHMA 5D3OA 1CDMA 1NCXA 2KLDA 1M63B 2LLUA 1DGUA 2KI6D 1UURA 2HQWA 3IQOA 2K2AA 4DRWA 1CB1A 1NIWA 1PRWA 5HYDA 1K94A 1F4QA 3VB1A 2CCMA 3O6BA 3BOWA 3SG3A 3HX4A 1J7RA 3CZTX 3NSOA 4PE1A 3BUMB 1G8IA 2OS8C 2WCFA 1Y1AA 3CTNA 3BUWB 4KYNA 3RM1A 3ZWHA 1F55A 1S5GZ 2KYCA 4F7FA 3LL8B 4GAOA 1XFXO 4USLA 1SL7A 2JTTA 1JSAA 5F6TA 5J3XA 2LUCA 2P6BB 3TDZA 4ICBA 1W9ZA 5I2OA 1NCYA 3R1OA 1YUSA 3S0DA 1AVSA 3S0FA 2V53A 3PN7B 3BOWB 5IBWA 1JWDA 3GK4X 1NSHA 2HETA 1NX3A 3AAJA 4N1FA 2EC6C 4C0KA 1XA5A 3NHTA 1BOCA 3DVJA 1N65A 4GNKB 4YI9A 2JPTA 1QX5B 2F3YA 1CM4A 3BFAA 4NDDA 5AFPA 2DOQA 2WCJA 1DT7B 2JT0A 1SKTA 4QJ3B 1XFVO 2KNEA 4OVNF 3D73A 1BR4B 1QX7A 3S0AA 1KK7Z 4GBAA 3CS1A 1WLMA 4L9MA 2PQLA 3PJIA 4D1EA 5I94A 4YRUA 3EK8A 1LA0A 3BYAA 1DJWA 1ALWA 3OGNA 2LHLA 2GV5A 2KSPA 4INWA 2LC5A 1N2DA 2I2RE 2L2CA 1YVHA 2M49B 1M45A 2LAPA 1TOPA 1A29A 1S6JA 1DQEA 4FQTA 1X02A 1TNQA 1WRKA 4PDZA 2ZN9A 1OZOA 2H61A 3EKHA 1SMGA 1ZMZA 3RLZA 2WCMA 2NLNA 2JT8A 1NYAA 1G4YR 2WC5A 3LK1A 4A4BA 3BUXB 2KFGA 1RK9A 2JT3A 4MZLA 2EHBA 3KPXA 3OBVA 1CLBA 1QTXA 2HPSA 3BQ3A 1DEKA 2L4HA 3D75A 2BKHB 2CTNA 3I5HB 4OZDA 5FI6A 3VRNA 2L51A 1N0YA 1CM1A 1BU3A 3SG4A 3BUOB 3L4AA
chains in the Genus database with same CATH topology
3I5IB 2AUCA 4HRHA 2GGZA 2LCPA 2LVJA 3IQQA 4DS7A 3CWGA 4GUKA 2BCBA 4ORBB 1F54A 1J1EA 1NPQA 3CR5X 3I5GB 3I5FC 1K9UA 1TNPA 3DVEA 4OCIA 1JFKA 1Y1UA 1R2UA 3TS5B 1ZUZA 1IWQA 4XJKA 4CFQA 3PM8A 1KQMB 2KI6C 1XYDA 1OOJA 3EKJA 1TN4A 1CFCA 2I7AA 1YVLA 1DJHA 2JTZA 1QJTA 5D7FA 1M31A 3NXAA 2Y4QA 2LVIA 4HRGA 1UHNA 1S5GY 2MA2A 5K89A 2F8PA 3O2PA 2H61C 5CPVA 1OMRA 3FWCA 4XYNA 2KI4B 3IF7A 4XJKB 1QV0A 3OP0A 1SCVA 1WDCC 2KOTA 2BL0B 2MJWB 1QV1A 2JNFA 2Q4UA 4GGNA 4OKHA 3TZ1A 1U5IA 4AQIA 1VRKA 2IS9A 3KHEA 1MF8B 2Y5IA 3EK7A 2K0JA 1DJIA 1NX2A 1V1GA 3EVUA 1HQVA 3O4YA 2K8MB 1K9KA 1WLZA 3E3RA 1J1DA 2OTGB 4PALA 1KSOA 1BR1B 3PATA 1YRUB 1MHOA 2BBMA 1CNPA 1TRFA 1BJFA 3LK0A 4WQ2A 1U5IB 2AAOA 1OMVA 2B1UA 2ZFDA 2WORA 3PLFB 4I5KA 1CKKA 1B1GA 1SCMC 4R1EA 2PALA 2ZNEA 2M29A 3DD4A 2KYFA 2WC8A 3AAKA 1BT6A 3SIAA 2CT9A 1SL9A 2K2FA 4WRIA 2LM5A 3SG6A 2JULA 1KSMA 3VRPA 4A4CA 1AHRA 1CDLA 1OSAA 3OHMB 3DVMA 4GGFA 5I8NA 1EXRA 1NCZA 1PVAA 2JOJA 2WCEA 1L2OC 2LMTA 2LP2A 2JU0A 5HKWA 1ZACA 2E6WA 5FYXA 1YRTB 4YGCB 2AMIA 1S6IA 2BCXA 2OPOA 1M39A 5DKQA 1PSRA 4PHNA 4AQJA 1NX0A 1XK4A 1QLSA 2TN4A 2LLSA 5JJGA 1YUUA 4YBHB 1Q80A 1IJ6A 1OE9B 1QVIZ 1B7TY 1IQ3A 3WHUB 1K90D 1QIVA 3TDIA 2CBLA 3HCMA 4YGEB 2KAXA 3WHTB 2KQYA 4PE0A 5CSNA 3TUYB 4M2PA 1K8UA 1EG4A 3PN7C 1F4OA 1B8CA 1XFUO 1KFUL 1PALA 4ZCVA 4I5NB 1DTLA 3JTDB 1XFWO 1EJ3A 1K95A 1BODA 2M7LA 2JXCA 1DJYA 2BKIB 4GFTA 2K7BA 2H2KA 1Y0VH 1B8RA 4F0ZB 5HKYA 1XO5A 1KFXS 1LINA 4FQOA 4ETOA 1J55A 3DVKA 3M0WA 4P5OE 1K9PA 1JBAA 3EK4A 3D10A 2BE4A 2M0RA 1K96A 3CLNA 2K61A 3OX5A 2EGDA 2F3ZA 1S36A 2G9BA 2LUXA 2SASA 1FI6A 2JWWA 1PSBA 1CDPA 2LANA 3DF0A 2KAYA 4NDBA 1AJ4A 2LP3A 2LV7A 4IL1A 5CSFA 1XK4C 2WCBA 1IH0A 3OX6A 1QXPA 2RGIA 3EVVA 4C0JA 1CLMA 1LA3A 1YURA 2L0PA 3PALA 5ER4X 1HT9A 2L5XB 3D0YA 1RWYA 1S1EA 1MXLC 2A4JA 1FW4A 2F2PA 4PE7A 4NDCA 3DF0B 1KWOB 2LLTA 4WQ3A 1CFFA 2MAZA 1A75A 1MXEA 2MRDA 2SCPA 3PFVA 3TDUA 1NP8A 1C7WA 1SK6D 5AANA 1NX1A 3I5HC 2F33A 4DIRA 4JPZB 1IG5A 2CNPA 1CTRA 1J7PA 3D0YB 3I5IC 3F45A 2KGRA 3FWBA 4MRYA 2JZIA 2LNKA 1EH2A 2PSRA 1CFDA 5AXIA 3JVTB 2BCAA 3CR2A 4I5JA 1C7VA 2FOTA 3I5GC 4MBEA 1J7OA 1A75B 2M7NA 2R2IA 1BLQA 1GQMA 2BBNA 1SBJA 2QACA 3VRRA 3TS5C 2ZN8A 2L50A 1YX7A 1ALVA 1K93D 5HLVA 1LKJA 1KQMC 3O78A 3CGAA 2MBXA 4PCWA 4QJ4B 2HQ8A 1TNXA 2M3WA 2L98A 5BPJA 5TNCA 3A8RA 2QPTA 1QASA 4Q04A 2L2EA 1KK7Y 4DUQA 1H8BA 1B8LA 1AP4A 1NWDA 2I94A 2OS8B 4CIDA 1YUTA 2KI4C 1K2HA 1QIWA 2LE9B 1TTXA 2JQ6A 1UHHA 2O5GA 4ORCB 4UPGA 2BL0C 1IQ5A 4JQ0D 3LCPC 2Y1NA 1KQVA 1MQ1A 4YI8A 2LHIA 3SG2A 1IGVA 2CXJA 1IKUA 3BUNB 1FBVA 2BECA 2KFFA 3OB1B 1UP5A 5AEQA 3VROA 5HKZA 2OTGC 3SG7A 1SW8A 2EC6B 4E68A 5CSIA 2G2BA 2LMVA 1JFJA 1OMDA 1RROA 1V1FA 2GGMA 3OB2B 4PE4A 4CLNA 2JNXA 1DF0A 5ER5A 1GGZA 3SIBA 1B4CA 2MLFC 4P2YB 5DKNA 3SG5A 1WRZA 1SR6B 1MUXA 2F2OA 2LVVA 3FIAA 1RECA 3AKAA 1XFYO 1FI5A 3WXAA 4BY5A 5AERA 4M2OA 4OV2A 2K7OA 2Y1MA 2LVKA 2ISDA 3LLEA 2D8NA 5G08A 3KO0A 3SJSA 1EG3A 1DF0B 2MHHA 1B47A 3MSEB 1KCYA 2I18A 1AJ5A 2BE6A 1SY9A 2M1KB 2LMUA 4BY4A 1MWNA 1A4PA 1TIZA 4N1GA 2PRUA 1F71A 1PVBA 1WRLA 2K7CA 1YTZC 2KDHA 3BXKA 3ICBA 5PALA 5KTYA 1D1OA 1SYMA 1CFPA 2FCEA 5KSZA 5DKRA 1TCOB 2L4IA 3VRQA 4PHKA 2K7DA 4MRXA 1CMFA 4PHJA 1SR6C 2M9GA 2ZNDA 3GK2A 4I5LB 1PK0D 1DVIA 4GGFC 1WY9A 1LVCD 1UHIA 3GK1A 1EL4A 4JWQA 1SPYA 1XVJA 2E30A 4ZCUA 1QS7A 4N5XA 3GOFA 4MVFA 1YX8A 1FPWA 3TUYC 1RTP1 3I5FB 1JF2A 1DJGA 2KAVA 2M8UA 4HREE 2KFHA 4OR9B 4C0LA 2KQ6A 1UUSA 1J7QA 1RJVA 1W7IB 1JC2A 1BF5A 1Y6WA 1ZOTB 4MEWA 4TNCA 1UWOA 1OQPA 2O60A 3JTDC 4YGDB 3K21A 1RFJA 2KGBC 1L7ZA 3ZNIA 4DCKA 3KEVA 1S6CA 3CR4X 1H4BA 1M46A 4QJ5B 1NUBA 2KBIA 1W7JB 1FF1A 5B8IB 4CPVA 1TNWA 1CLLA 2NCOA 4U8DA 3AKBA 2VRGA 3H4SE 2KHNA 3FS7A 5CSJA 1YR5A 1JUOA 1JF0A 4MSPA 3EVRA 1CDNA 3C1VA 3NSIA 1ZFSA 1F70A 2KBMA 1WDCB 1B7TZ 4M2QA 2Q91A 1OZSA 4FTGA 2NCPA 1MR8A 1AK8A 1QATA 1SRAA 3VGOA 5I2LA 2FJUB 1UHJA 5GQQC 4CFRA 5JOLA 1A03A 1SL8A 1QX2A 2JC2A 1B9AA 1KK8B 1LXFC 1BG1A 3NSLA 2MLEC 4ORAB 1R6PA 4MZJA 1SNLA 2M97A 1E8AA 2PMYA 4MZKA 1KWOC 4MN0A 1CMGA 1IJ5A 1IRJA 4HSZA 1GJYA 3WNXB 2WOSA 4MLWA 5D69A 1DJXA 2FCDA 2COLB 2NZ0A 1SCMB 1F8HA 1TCFA 2ZKMX 2JXLA 1QVIY 2HF5A 2PVBA 2PASA 1KFXL 1ODBA 3NSKA 3QRXA 3JVTC 2ZRTA 2JRFA 1A2XA 1KFUS 4YGAA 2NXQA 1Y1XA 1QLKA 3KF9A 5HLOA 1PULA 2ZRSA 1DMOA 1S26D 3PSRA 1G33A 1KK8C 4GPLB 5KU1A 4YGBB 1GGWA 1UHKA 4AOMA 3A4UB 1C07A 4NQGA 1BMOA 1L2OB 2M1UA 1XFZO 1DGVA 1S3PA 1AUIB 1DJZA 2WNDA 4PHMA 1CDMA 1NCXA 1M63B 2LLUA 1DGUA 2KI6D 1UURA 2HQWA 3IQOA 2K2AA 4DRWA 1NIWA 1PRWA 5HYDA 1K94A 1F4QA 2CCMA 3O6BA 3BOWA 3SG3A 3HX4A 1J7RA 3CZTX 3NSOA 4PE1A 3BUMB 1G8IA 2OS8C 2WCFA 1Y1AA 3CTNA 3BUWB 3RM1A 3ZWHA 1F55A 1S5GZ 2KYCA 3LL8B 4GAOA 1XFXO 4USLA 1SL7A 2JTTA 1JSAA 5F6TA 5J3XA 2LUCA 2P6BB 3TDZA 4ICBA 5I2OA 1NCYA 1YUSA 1AVSA 2V53A 3PN7B 3BOWB 5IBWA 1JWDA 3GK4X 1NSHA 2HETA 1NX3A 3AAJA 4N1FA 2EC6C 4C0KA 1XA5A 1BOCA 3DVJA 1N65A 4GNKB 4YI9A 2JPTA 1QX5B 2F3YA 1CM4A 4NDDA 5AFPA 1CB1A 2DOQA 1DT7B 2JT0A 1SKTA 4QJ3B 1XFVO 2KNEA 4OVNF 1BR4B 1QX7A 1KK7Z 4GBAA 3CS1A 1WLMA 4L9MA 4D1EA 4YRUA 3EK8A 1LA0A 3BYAA 1DJWA 1ALWA 2LHLA 2GV5A 2KSPA 2LC5A 1N2DA 2I2RE 2M49B 1YVHA 1M45A 2LAPA 1TOPA 1A29A 1S6JA 1X02A 1TNQA 1WRKA 4PDZA 2ZN9A 1OZOA 2H61A 3EKHA 1SMGA 1ZMZA 3RLZA 2NLNA 2JT8A 1NYAA 1G4YR 3LK1A 4A4BA 3BUXB 2KFGA 1RK9A 2JT3A 4MZLA 2EHBA 3KPXA 5I2QA 1CLBA 1QTXA 2HPSA 3BQ3A 2L4HA 2BKHB 2CTNA 3I5HB 3VRNA 2L51A 1N0YA 1CM1A 1BU3A 3SG4A 3BUOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5I B;  2AUC A;  4HRH A;  2GGZ A;  2LCP A;  2LVJ A;  3IQQ A;  4DS7 A;  3CWG A;  4GUK A;  2BCB A;  4ORB B;  1F54 A;  1J1E A;  1NPQ A;  3CR5 X;  3I5G B;  3I5F C;  1K9U A;  1TNP A;  3DVE A;  4OCI A;  1JFK A;  1Y1U A;  1R2U A;  3TS5 B;  1ZUZ A;  1IWQ A;  4XJK A;  4CFQ A;  3PM8 A;  1KQM B;  2KI6 C;  1XYD A;  1OOJ A;  3EKJ A;  1TN4 A;  1CFC A;  2I7A A;  1YVL A;  1DJH A;  2JTZ A;  1QJT A;  5D7F A;  1M31 A;  3NXA A;  2Y4Q A;  2LVI A;  4HRG A;  1UHN A;  1S5G Y;  2MA2 A;  5K89 A;  2F8P A;  3O2P A;  2H61 C;  5CPV A;  1OMR A;  3FWC A;  4XYN A;  2KI4 B;  3IF7 A;  4XJK B;  1QV0 A;  3OP0 A;  1SCV A;  1WDC C;  2KOT A;  2BL0 B;  2MJW B;  1QV1 A;  2JNF A;  2Q4U A;  4GGN A;  4OKH A;  3TZ1 A;  1U5I A;  4AQI A;  1VRK A;  2IS9 A;  3KHE A;  1MF8 B;  2Y5I A;  3EK7 A;  2K0J A;  1DJI A;  1NX2 A;  1V1G A;  3EVU A;  1HQV A;  3O4Y A;  2K8M B;  1K9K A;  1WLZ A;  3E3R A;  1J1D A;  2OTG B;  4PAL A;  1KSO A;  1BR1 B;  3PAT A;  1YRU B;  1MHO A;  2BBM A;  1CNP A;  1TRF A;  1BJF A;  3LK0 A;  4WQ2 A;  1U5I B;  2AAO A;  1OMV A;  2B1U A;  2ZFD A;  2WOR A;  3PLF B;  4I5K A;  1CKK A;  1B1G A;  1SCM C;  4R1E A;  2PAL A;  2ZNE A;  2M29 A;  3DD4 A;  2KYF A;  2WC8 A;  3AAK A;  1BT6 A;  3SIA A;  2CT9 A;  1SL9 A;  2K2F A;  4WRI A;  2LM5 A;  3SG6 A;  2JUL A;  1KSM A;  3VRP A;  4A4C A;  1AHR A;  1CDL A;  1OSA A;  3OHM B;  3DVM A;  4GGF A;  5I8N A;  1EXR A;  1NCZ A;  1PVA A;  2JOJ A;  2WCE A;  1L2O C;  2LMT A;  2LP2 A;  2JU0 A;  5HKW A;  1ZAC A;  2E6W A;  5FYX A;  1YRT B;  4YGC B;  2AMI A;  1S6I A;  2BCX A;  2OPO A;  1M39 A;  5DKQ A;  1PSR A;  4PHN A;  4AQJ A;  1NX0 A;  1XK4 A;  1QLS A;  2TN4 A;  2LLS A;  5JJG A;  1YUU A;  4YBH B;  1Q80 A;  1IJ6 A;  1OE9 B;  1QVI Z;  1B7T Y;  1IQ3 A;  3WHU B;  1K90 D;  1QIV A;  3TDI A;  2CBL A;  3HCM A;  4YGE B;  2KAX A;  3WHT B;  2KQY A;  4PE0 A;  5CSN A;  3TUY B;  4M2P A;  1K8U A;  1EG4 A;  3PN7 C;  1F4O A;  1B8C A;  1XFU O;  1KFU L;  1PAL A;  4ZCV A;  4I5N B;  1DTL A;  3JTD B;  1XFW O;  1EJ3 A;  1K95 A;  1BOD A;  2M7L A;  2JXC A;  1DJY A;  2BKI B;  4GFT A;  2K7B A;  2H2K A;  1Y0V H;  1B8R A;  4F0Z B;  5HKY A;  1XO5 A;  1KFX S;  1LIN A;  4FQO A;  4ETO A;  1J55 A;  3DVK A;  3M0W A;  4P5O E;  1K9P A;  1JBA A;  3EK4 A;  3D10 A;  2BE4 A;  2M0R A;  1K96 A;  3CLN A;  2K61 A;  3OX5 A;  2EGD A;  2F3Z A;  1S36 A;  2G9B A;  2LUX A;  2SAS A;  1FI6 A;  2JWW A;  1PSB A;  1CDP A;  2LAN A;  3DF0 A;  2KAY A;  4NDB A;  1AJ4 A;  2LP3 A;  2LV7 A;  4IL1 A;  5CSF A;  1XK4 C;  2WCB A;  1IH0 A;  3OX6 A;  1QXP A;  2RGI A;  3EVV A;  4C0J A;  1CLM A;  1LA3 A;  1YUR A;  2L0P A;  3PAL A;  5ER4 X;  1HT9 A;  2L5X B;  3D0Y A;  1RWY A;  1S1E A;  1MXL C;  2A4J A;  1FW4 A;  2F2P A;  4PE7 A;  4NDC A;  3DF0 B;  1KWO B;  2LLT A;  4WQ3 A;  1CFF A;  2MAZ A;  1A75 A;  1MXE A;  2MRD A;  2SCP A;  3PFV A;  3TDU A;  1NP8 A;  1C7W A;  1SK6 D;  5AAN A;  1NX1 A;  3I5H C;  2F33 A;  4DIR A;  4JPZ B;  1IG5 A;  2CNP A;  1CTR A;  1J7P A;  3D0Y B;  3I5I C;  3F45 A;  2KGR A;  3FWB A;  4MRY A;  2JZI A;  2LNK A;  1EH2 A;  2PSR A;  1CFD A;  5AXI A;  3JVT B;  2BCA A;  3CR2 A;  4I5J A;  1C7V A;  2FOT A;  3I5G C;  4MBE A;  1J7O A;  1A75 B;  2M7N A;  2R2I A;  1BLQ A;  1GQM A;  2BBN A;  1SBJ A;  2QAC A;  3VRR A;  3TS5 C;  2ZN8 A;  2L50 A;  1YX7 A;  1ALV A;  1K93 D;  5HLV A;  1LKJ A;  1KQM C;  3O78 A;  3CGA A;  2MBX A;  4PCW A;  4QJ4 B;  2HQ8 A;  1TNX A;  2M3W A;  2L98 A;  5BPJ A;  5TNC A;  3A8R A;  2QPT A;  1QAS A;  4Q04 A;  2L2E A;  1KK7 Y;  4DUQ A;  1H8B A;  1B8L A;  1AP4 A;  1NWD A;  2I94 A;  2OS8 B;  4CID A;  1YUT A;  2KI4 C;  1K2H A;  1QIW A;  2LE9 B;  1TTX A;  2JQ6 A;  1UHH A;  2O5G A;  4ORC B;  4UPG A;  2BL0 C;  1IQ5 A;  4JQ0 D;  3LCP C;  2Y1N A;  1KQV A;  1MQ1 A;  4YI8 A;  2LHI A;  3SG2 A;  1IGV A;  2CXJ A;  1IKU A;  3BUN B;  1FBV A;  2BEC A;  2KFF A;  3OB1 B;  1UP5 A;  5AEQ A;  3VRO A;  5HKZ A;  2OTG C;  3SG7 A;  1SW8 A;  2EC6 B;  4E68 A;  5CSI A;  2G2B A;  2LMV A;  1JFJ A;  1OMD A;  1RRO A;  1V1F A;  2GGM A;  3OB2 B;  4PE4 A;  4CLN A;  2JNX A;  1DF0 A;  5ER5 A;  1GGZ A;  3SIB A;  1B4C A;  2MLF C;  4P2Y B;  5DKN A;  3SG5 A;  1WRZ A;  1SR6 B;  1MUX A;  2F2O A;  2LVV A;  3FIA A;  1REC A;  3AKA A;  1XFY O;  1FI5 A;  3WXA A;  4BY5 A;  5AER A;  4M2O A;  4OV2 A;  2K7O A;  2Y1M A;  2LVK A;  2ISD A;  3LLE A;  2D8N A;  5G08 A;  3KO0 A;  3SJS A;  1EG3 A;  1DF0 B;  2MHH A;  1B47 A;  3MSE B;  1KCY A;  2I18 A;  1AJ5 A;  2BE6 A;  1SY9 A;  2M1K B;  2LMU A;  4BY4 A;  1MWN A;  1A4P A;  1TIZ A;  4N1G A;  2PRU A;  1F71 A;  1PVB A;  1WRL A;  2K7C A;  1YTZ C;  2KDH A;  3BXK A;  3ICB A;  5PAL A;  5KTY A;  1D1O A;  1SYM A;  1CFP A;  2FCE A;  5KSZ A;  5DKR A;  1TCO B;  2L4I A;  3VRQ A;  4PHK A;  2K7D A;  4MRX A;  1CMF A;  4PHJ A;  1SR6 C;  2M9G A;  2ZND A;  3GK2 A;  4I5L B;  1PK0 D;  1DVI A;  4GGF C;  1WY9 A;  1LVC D;  1UHI A;  3GK1 A;  1EL4 A;  4JWQ A;  1SPY A;  1XVJ A;  2E30 A;  4ZCU A;  1QS7 A;  4N5X A;  3GOF A;  4MVF A;  1YX8 A;  1FPW A;  3TUY C;  1RTP 1;  3I5F B;  1JF2 A;  1DJG A;  2KAV A;  2M8U A;  4HRE E;  2KFH A;  4OR9 B;  4C0L A;  2KQ6 A;  1UUS A;  1J7Q A;  1RJV A;  1W7I B;  1JC2 A;  1BF5 A;  1Y6W A;  1ZOT B;  4MEW A;  4TNC A;  1UWO A;  1OQP A;  2O60 A;  3JTD C;  4YGD B;  3K21 A;  1RFJ A;  2KGB C;  1L7Z A;  3ZNI A;  4DCK A;  3KEV A;  1S6C A;  3CR4 X;  1H4B A;  1M46 A;  4QJ5 B;  1NUB A;  2KBI A;  1W7J B;  1FF1 A;  5B8I B;  4CPV A;  1TNW A;  1CLL A;  2NCO A;  4U8D A;  3AKB A;  2VRG A;  3H4S E;  2KHN A;  3FS7 A;  5CSJ A;  1YR5 A;  1JUO A;  1JF0 A;  4MSP A;  3EVR A;  1CDN A;  3C1V A;  3NSI A;  1ZFS A;  1F70 A;  2KBM A;  1WDC B;  1B7T Z;  4M2Q A;  2Q91 A;  1OZS A;  4FTG A;  2NCP A;  1MR8 A;  1AK8 A;  1QAT A;  1SRA A;  3VGO A;  5I2L A;  2FJU B;  1UHJ A;  5GQQ C;  4CFR A;  5JOL A;  1A03 A;  1SL8 A;  1QX2 A;  2JC2 A;  1B9A A;  1KK8 B;  1LXF C;  1BG1 A;  3NSL A;  2MLE C;  4ORA B;  1R6P A;  4MZJ A;  1SNL A;  2M97 A;  1E8A A;  2PMY A;  4MZK A;  1KWO C;  4MN0 A;  1CMG A;  1IJ5 A;  1IRJ A;  4HSZ A;  1GJY A;  3WNX B;  2WOS A;  4MLW A;  5D69 A;  1DJX A;  2FCD A;  2COL B;  2NZ0 A;  1SCM B;  1F8H A;  1TCF A;  2ZKM X;  2JXL A;  1QVI Y;  2HF5 A;  2PVB A;  2PAS A;  1KFX L;  1ODB A;  3NSK A;  3QRX A;  3JVT C;  2ZRT A;  2JRF A;  1A2X A;  1KFU S;  4YGA A;  2NXQ A;  1Y1X A;  1QLK A;  3KF9 A;  5HLO A;  1PUL A;  2ZRS A;  1DMO A;  1S26 D;  3PSR A;  1G33 A;  1KK8 C;  4GPL B;  5KU1 A;  4YGB B;  1GGW A;  1UHK A;  4AOM A;  3A4U B;  1C07 A;  4NQG A;  1BMO A;  1L2O B;  2M1U A;  1XFZ O;  1DGV A;  1S3P A;  1AUI B;  1DJZ A;  2WND A;  4PHM A;  1CDM A;  1NCX A;  1M63 B;  2LLU A;  1DGU A;  2KI6 D;  1UUR A;  2HQW A;  3IQO A;  2K2A A;  4DRW A;  1NIW A;  1PRW A;  5HYD A;  1K94 A;  1F4Q A;  2CCM A;  3O6B A;  3BOW A;  3SG3 A;  3HX4 A;  1J7R A;  3CZT X;  3NSO A;  4PE1 A;  3BUM B;  1G8I A;  2OS8 C;  2WCF A;  1Y1A A;  3CTN A;  3BUW B;  3RM1 A;  3ZWH A;  1F55 A;  1S5G Z;  2KYC A;  3LL8 B;  4GAO A;  1XFX O;  4USL A;  1SL7 A;  2JTT A;  1JSA A;  5F6T A;  5J3X A;  2LUC A;  2P6B B;  3TDZ A;  4ICB A;  5I2O A;  1NCY A;  1YUS A;  1AVS A;  2V53 A;  3PN7 B;  3BOW B;  5IBW A;  1JWD A;  3GK4 X;  1NSH A;  2HET A;  1NX3 A;  3AAJ A;  4N1F A;  2EC6 C;  4C0K A;  1XA5 A;  1BOC A;  3DVJ A;  1N65 A;  4GNK B;  4YI9 A;  2JPT A;  1QX5 B;  2F3Y A;  1CM4 A;  4NDD A;  5AFP A;  1CB1 A;  2DOQ A;  1DT7 B;  2JT0 A;  1SKT A;  4QJ3 B;  1XFV O;  2KNE A;  4OVN F;  1BR4 B;  1QX7 A;  1KK7 Z;  4GBA A;  3CS1 A;  1WLM A;  4L9M A;  4D1E A;  4YRU A;  3EK8 A;  1LA0 A;  3BYA A;  1DJW A;  1ALW A;  2LHL A;  2GV5 A;  2KSP A;  2LC5 A;  1N2D A;  2I2R E;  2M49 B;  1YVH A;  1M45 A;  2LAP A;  1TOP A;  1A29 A;  1S6J A;  1X02 A;  1TNQ A;  1WRK A;  4PDZ A;  2ZN9 A;  1OZO A;  2H61 A;  3EKH A;  1SMG A;  1ZMZ A;  3RLZ A;  2NLN A;  2JT8 A;  1NYA A;  1G4Y R;  3LK1 A;  4A4B A;  3BUX B;  2KFG A;  1RK9 A;  2JT3 A;  4MZL A;  2EHB A;  3KPX A;  5I2Q A;  1CLB A;  1QTX A;  2HPS A;  3BQ3 A;  2L4H A;  2BKH B;  2CTN A;  3I5H B;  3VRN A;  2L51 A;  1N0Y A;  1CM1 A;  1BU3 A;  3SG4 A;  3BUO B; 
#chains in the Genus database with same CATH topology
 3I5I B;  2AUC A;  3BFB A;  4HRH A;  2GGZ A;  2LCP A;  2LVJ A;  3IQQ A;  4DS7 A;  3CWG A;  4GUK A;  2BCB A;  4ORB B;  1F54 A;  1J1E A;  1NPQ A;  3CR5 X;  3I5G B;  3I5F C;  1K9U A;  1TNP A;  3DVE A;  3CZ2 A;  4OCI A;  3N7H A;  1JFK A;  1Y1U A;  1R2U A;  3TS5 B;  1ZUZ A;  1LS8 A;  1IWQ A;  4XJK A;  4CFQ A;  3PM8 A;  1KQM B;  2KI6 C;  1XYD A;  3B6X A;  1OOJ A;  3FE8 A;  3EKJ A;  1TN4 A;  1CFC A;  2I7A A;  1YVL A;  3B87 A;  3UO9 A;  1DJH A;  2JTZ A;  1QJT A;  5D7F A;  1M31 A;  3NXA A;  2Y4Q A;  2LVI A;  4HRG A;  1UHN A;  1S5G Y;  2MA2 A;  5K89 A;  2F8P A;  3O2P A;  2H61 C;  5CPV A;  1OMR A;  3FWC A;  4XYN A;  2KI4 B;  3IF7 A;  4XJK B;  1QV0 A;  3OP0 A;  1SCV A;  1WDC C;  2KOT A;  2BL0 B;  2MJW B;  1QV1 A;  2JNF A;  2Q4U A;  4GGN A;  4OKH A;  3TZ1 A;  1U5I A;  4AQI A;  1VRK A;  2IS9 A;  3KHE A;  4JKT A;  1MF8 B;  2Y5I A;  3EK7 A;  2K0J A;  1DJI A;  1NX2 A;  1V1G A;  2H8V A;  1HQV A;  3EVU A;  2K8M B;  1OOI X;  1K9K A;  3O4Y A;  5EL2 A;  1WLZ A;  3E3R A;  1J1D A;  2OTG B;  4PAL A;  3EG5 B;  1KSO A;  1BR1 B;  3PAT A;  1YRU B;  1MHO A;  2BBM A;  1CNP A;  1TRF A;  1TUJ A;  1BJF A;  3LK0 A;  4WQ2 A;  1U5I B;  2AAO A;  1DC1 A;  1T14 A;  1OMV A;  2B1U A;  2ZFD A;  2WOR A;  3PLF B;  3FE9 A;  4I5K A;  1CKK A;  1B1G A;  1SCM C;  4R1E A;  3L47 A;  2PAL A;  2ZNE A;  2M29 A;  3DD4 A;  2KYF A;  1SSE B;  2WC8 A;  3AAK A;  1BT6 A;  3SIA A;  2CT9 A;  1SL9 A;  2K2F A;  4WRI A;  2LM5 A;  3SG6 A;  3BFH A;  3SS4 A;  2JUL A;  1KSM A;  3VRP A;  4A4C A;  1AHR A;  1CDL A;  1OSA A;  3OHM B;  3DVM A;  4GGF A;  5I8N A;  1EXR A;  1NCZ A;  3NHI A;  1PVA A;  2JOJ A;  2WCE A;  1L2O C;  2LMT A;  2LP2 A;  2JU0 A;  5HKW A;  1ZAC A;  2E6W A;  5FYX A;  1YRT B;  4YGC B;  2AMI A;  1S6I A;  2BCX A;  2OPO A;  1M39 A;  5DKQ A;  1PSR A;  4PHN A;  4AQJ A;  1OW4 A;  1NX0 A;  1XK4 A;  5I2Q A;  3CYZ A;  1QLS A;  2TN4 A;  3V2L A;  2LLS A;  5JJG A;  1YUU A;  4YBH B;  1Q80 A;  1IJ6 A;  1OE9 B;  1QVI Z;  1B7T Y;  1IQ3 A;  3WHU B;  1K90 D;  1QIV A;  3TDI A;  2CBL A;  3HCM A;  4YGE B;  2KAX A;  3WHT B;  2KQY A;  4PE0 A;  5CSN A;  3TUY B;  3D74 A;  3SS3 A;  4M2P A;  1K8U A;  1EG4 A;  3PN7 C;  1F4O A;  1B8C A;  1XFU O;  1KFU L;  1PAL A;  4ZCV A;  4I5N B;  1DTL A;  2KPH A;  3JTD B;  2L5Y A;  1XFW O;  1EJ3 A;  1K95 A;  1BOD A;  2M7L A;  2JXC A;  1DJY A;  2BKI B;  4GFT A;  4INX A;  2K7B A;  2H2K A;  1Y0V H;  1B8R A;  4F0Z B;  5HKY A;  1XO5 A;  1KFX S;  1LIN A;  3B88 A;  4FQO A;  3UNW A;  4ETO A;  1J55 A;  3DVK A;  3M0W A;  4P5O E;  1K9P A;  1JBA A;  3EK4 A;  3D10 A;  2BE4 A;  2M0R A;  1K96 A;  3CLN A;  1XFR A;  2K61 A;  3OX5 A;  2EGD A;  2F3Z A;  1OOH A;  1S36 A;  2G9B A;  2LUX A;  2SAS A;  1FI6 A;  3D78 A;  2JWW A;  1PSB A;  1CDP A;  2LAN A;  3DF0 A;  2KAY A;  4NDB A;  1AJ4 A;  2LP3 A;  2PYQ A;  2LV7 A;  4IL1 A;  3O4X A;  5CSF A;  1XK4 C;  2WCB A;  1IH0 A;  3OX6 A;  1QXP A;  2FJY A;  2RGI A;  3EVV A;  4C0J A;  1CLM A;  1LA3 A;  1YUR A;  1OOG A;  2L0P A;  3PAL A;  5ER4 X;  2WC6 A;  1HT9 A;  2L5X B;  3B86 A;  3D0Y A;  1RWY A;  1S1E A;  1C3Y A;  1MXL C;  2A4J A;  1FW4 A;  2F2P A;  2WCK A;  3D76 A;  4NDC A;  3DF0 B;  4PE7 A;  5FI7 A;  1KWO B;  2LLT A;  4WQ3 A;  1CFF A;  3R1P A;  2MAZ A;  1A75 A;  1MXE A;  2MRD A;  2SCP A;  3PFV A;  3TDU A;  1NP8 A;  1C7W A;  1SK6 D;  5AAN A;  1NX1 A;  3I5H C;  2F33 A;  4DIR A;  4JPZ B;  1TWO A;  1IG5 A;  2CNP A;  1CTR A;  1J7P A;  2KLE A;  3D0Y B;  3I5I C;  3F45 A;  2KGR A;  3CDN A;  3FWB A;  2JZI A;  2LNK A;  4MRY A;  2PSR A;  1EH2 A;  1CFD A;  5AXI A;  3JVT B;  2BCA A;  3CR2 A;  4I5J A;  1C7V A;  2FOT A;  3I5G C;  4MBE A;  1J7O A;  1A75 B;  2M7N A;  2R2I A;  1BLQ A;  1GQM A;  2BBN A;  1SBJ A;  2QAC A;  3VRR A;  3DXL A;  3TS5 C;  2P70 A;  2ZN8 A;  2L50 A;  1YX7 A;  3S0G A;  1ALV A;  1K93 D;  2QEB A;  5HLV A;  1OOF A;  1LKJ A;  1KQM C;  3O78 A;  3CGA A;  3B7A A;  2MBX A;  4PCW A;  4QJ4 B;  2HQ8 A;  1TNX A;  2M3W A;  2L98 A;  5BPJ A;  3K1E A;  5TNC A;  3A8R A;  2QPT A;  1QAS A;  4Q04 A;  2L2E A;  1KK7 Y;  4DUQ A;  1H8B A;  1B8L A;  1AP4 A;  1NWD A;  2I94 A;  2OS8 B;  4CID A;  1YUT A;  3S0E A;  2KI4 C;  2K60 A;  1K2H A;  1QIW A;  2LE9 B;  1TTX A;  2JQ6 A;  1UHH A;  2O5G A;  4ORC B;  4UPG A;  2BAP A;  2BL0 C;  1IQ5 A;  4JQ0 D;  3LCP C;  2Y1N A;  1KQV A;  1MQ1 A;  4YI8 A;  2LHI A;  2P71 A;  3SG2 A;  1IGV A;  2CXJ A;  1IKU A;  3BUN B;  1TUZ A;  1FBV A;  2BEC A;  2KFF A;  1C3Z A;  3OB1 B;  1UP5 A;  5AEQ A;  3VRO A;  5HKZ A;  2OTG C;  3SG7 A;  1SW8 A;  2EC6 B;  3CAB A;  4E68 A;  5CSI A;  2G2B A;  2LMV A;  1JFJ A;  1OMD A;  1RRO A;  1V1F A;  2GGM A;  3OB2 B;  4PE4 A;  4CLN A;  2WCL A;  2JNX A;  1DF0 A;  5ER5 A;  3S0B A;  1GGZ A;  3SIB A;  1B4C A;  3IVT A;  2MLF C;  4P2Y B;  5DKN A;  3SG5 A;  1WRZ A;  1SR6 B;  1MUX A;  2F2O A;  2LVV A;  3FIA A;  1REC A;  3AKA A;  1XFY O;  1FI5 A;  1DEL A;  3WXA A;  4BY5 A;  5AER A;  4M2O A;  4OV2 A;  2K7O A;  2Y1M A;  2LVK A;  2ISD A;  5HL1 A;  3QME A;  2QEH A;  3LLE A;  3RZS A;  2D8N A;  1GM0 A;  5G08 A;  3KO0 A;  3SJS A;  1EG3 A;  1DF0 B;  2MHH A;  1B47 A;  2WCH A;  3MSE B;  1KCY A;  2I18 A;  1AJ5 A;  2BE6 A;  1SY9 A;  2M1K B;  3D77 A;  1Z4H A;  2LMU A;  5FI2 A;  4BY4 A;  1MWN A;  1A4P A;  1TIZ A;  4N1G A;  2PRU A;  1F71 A;  1PVB A;  1WRL A;  2K7C A;  1YTZ C;  2KDH A;  3BXK A;  3ICB A;  3Q8I A;  5PAL A;  5KTY A;  1SYM A;  1CFP A;  2FCE A;  3NGV A;  5KSZ A;  1D1O A;  5DKR A;  1TCO B;  2L4I A;  3VRQ A;  4PHK A;  2K7D A;  4MRX A;  1CMF A;  4PHJ A;  1SR6 C;  2M9G A;  2ZND A;  3GK2 A;  4I5L B;  3SS5 A;  3R1V A;  1PK0 D;  1DVI A;  4GGF C;  4IJ7 A;  1WY9 A;  1LVC D;  1UHI A;  3FE6 A;  1EL4 A;  3GK1 A;  3L4L A;  4JWQ A;  1SPY A;  1XVJ A;  2E30 A;  2QDI A;  3CZ1 A;  3DZT A;  3PM2 A;  4ZCU A;  2YGU A;  1QS7 A;  4N5X A;  3GOF A;  4MVF A;  1YX8 A;  1FPW A;  4JD9 A;  3TUY C;  1RTP 1;  3I5F B;  1JF2 A;  1DJG A;  2KAV A;  2M8U A;  4HRE E;  2KFH A;  1ORG A;  2JPO A;  4OR9 B;  4C0L A;  2KQ6 A;  1UUS A;  1J7Q A;  1RJV A;  1W7I B;  1JC2 A;  1BF5 A;  1Y6W A;  1ZOT B;  4MEW A;  4TNC A;  1UWO A;  1OQP A;  2O60 A;  3JTD C;  4YGD B;  3K21 A;  1RFJ A;  2QEO A;  2KGB C;  1L7Z A;  3ZNI A;  4DCK A;  3KEV A;  1S6C A;  3CR4 X;  1H4B A;  1M46 A;  4QJ5 B;  1NUB A;  2KBI A;  1W7J B;  2QEV A;  1FF1 A;  5B8I B;  4CPV A;  1TNW A;  1CLL A;  2NCO A;  4U8D A;  3AKB A;  2VRG A;  3H4S E;  2KHN A;  3FS7 A;  2ERB A;  5CSJ A;  1YR5 A;  1JUO A;  1JF0 A;  4MSP A;  3EVR A;  1CDN A;  3C1V A;  3NSI A;  1ZFS A;  1F70 A;  1Z2C B;  1WDC B;  2KBM A;  1B7T Z;  4M2Q A;  2Q91 A;  1OZS A;  4FTG A;  4PT1 A;  2NCP A;  1MR8 A;  3BJH A;  1AK8 A;  1QAT A;  1SRA A;  1IIO A;  3VGO A;  5I2L A;  2FJU B;  1UHJ A;  5GQQ C;  4CFR A;  5JOL A;  1A03 A;  3DYE A;  1SL8 A;  1QX2 A;  1P28 A;  2JC2 A;  1B9A A;  1KK8 B;  1LXF C;  3R72 A;  1BG1 A;  3NSL A;  2MLE C;  4ORA B;  3CZ0 A;  1R6P A;  4MZJ A;  1SNL A;  2M97 A;  1E8A A;  2PMY A;  4MZK A;  1KWO C;  4MN0 A;  1CMG A;  1IJ5 A;  1IRJ A;  4HSZ A;  1GJY A;  3WNX B;  2GTE A;  2WOS A;  4MLW A;  5D69 A;  1DJX A;  2FCD A;  2COL B;  2NZ0 A;  1SCM B;  1F8H A;  1TCF A;  2ZKM X;  2JXL A;  1QVI Y;  2HF5 A;  2PVB A;  2PAS A;  1KFX L;  1ODB A;  3NSK A;  3QRX A;  3JVT C;  2ZRT A;  2JRF A;  1A2X A;  1KFU S;  4YGA A;  1QWV A;  2NXQ A;  3DY9 A;  5DIC A;  1Y1X A;  1QLK A;  3KF9 A;  5HLO A;  1PUL A;  2BNX A;  2ZRS A;  1DMO A;  1S26 D;  3PSR A;  1G33 A;  1KK8 C;  4GPL B;  5KU1 A;  4YGB B;  1GGW A;  1UHK A;  4AOM A;  3A4U B;  1C07 A;  4NQG A;  1BMO A;  1L2O B;  2M1U A;  1XFZ O;  1DGV A;  1S3P A;  1AUI B;  1DJZ A;  2WND A;  4PHM A;  5D3O A;  1CDM A;  1NCX A;  2KLD A;  1M63 B;  2LLU A;  1DGU A;  2KI6 D;  1UUR A;  2HQW A;  3IQO A;  2K2A A;  4DRW A;  1CB1 A;  1NIW A;  1PRW A;  5HYD A;  1K94 A;  1F4Q A;  3VB1 A;  2CCM A;  3O6B A;  3BOW A;  3SG3 A;  3HX4 A;  1J7R A;  3CZT X;  3NSO A;  4PE1 A;  3BUM B;  1G8I A;  2OS8 C;  2WCF A;  1Y1A A;  3CTN A;  3BUW B;  4KYN A;  3RM1 A;  3ZWH A;  1F55 A;  1S5G Z;  2KYC A;  4F7F A;  3LL8 B;  4GAO A;  1XFX O;  4USL A;  1SL7 A;  2JTT A;  1JSA A;  5F6T A;  5J3X A;  2LUC A;  2P6B B;  3TDZ A;  4ICB A;  1W9Z A;  5I2O A;  1NCY A;  3R1O A;  1YUS A;  3S0D A;  1AVS A;  3S0F A;  2V53 A;  3PN7 B;  3BOW B;  5IBW A;  1JWD A;  3GK4 X;  1NSH A;  2HET A;  1NX3 A;  3AAJ A;  4N1F A;  2EC6 C;  4C0K A;  1XA5 A;  3NHT A;  1BOC A;  3DVJ A;  1N65 A;  4GNK B;  4YI9 A;  2JPT A;  1QX5 B;  2F3Y A;  1CM4 A;  3BFA A;  4NDD A;  5AFP A;  2DOQ A;  2WCJ A;  1DT7 B;  2JT0 A;  1SKT A;  4QJ3 B;  1XFV O;  2KNE A;  4OVN F;  3D73 A;  1BR4 B;  1QX7 A;  3S0A A;  1KK7 Z;  4GBA A;  3CS1 A;  1WLM A;  4L9M A;  2PQL A;  3PJI A;  4D1E A;  5I94 A;  4YRU A;  3EK8 A;  1LA0 A;  3BYA A;  1DJW A;  1ALW A;  3OGN A;  2LHL A;  2GV5 A;  2KSP A;  4INW A;  2LC5 A;  1N2D A;  2I2R E;  2L2C A;  1YVH A;  2M49 B;  1M45 A;  2LAP A;  1TOP A;  1A29 A;  1S6J A;  1DQE A;  4FQT A;  1X02 A;  1TNQ A;  1WRK A;  4PDZ A;  2ZN9 A;  1OZO A;  2H61 A;  3EKH A;  1SMG A;  1ZMZ A;  3RLZ A;  2WCM A;  2NLN A;  2JT8 A;  1NYA A;  1G4Y R;  2WC5 A;  3LK1 A;  4A4B A;  3BUX B;  2KFG A;  1RK9 A;  2JT3 A;  4MZL A;  2EHB A;  3KPX A;  3OBV A;  1CLB A;  1QTX A;  2HPS A;  3BQ3 A;  1DEK A;  2L4H A;  3D75 A;  2BKH B;  2CTN A;  3I5H B;  4OZD A;  5FI6 A;  3VRN A;  2L51 A;  1N0Y A;  1CM1 A;  1BU3 A;  3SG4 A;  3BUO B;  3L4A A; 
#chains in the Genus database with same CATH homology
 3I5I B;  2AUC A;  4HRH A;  2GGZ A;  2LCP A;  2LVJ A;  3IQQ A;  4DS7 A;  3CWG A;  4GUK A;  2BCB A;  4ORB B;  1F54 A;  1J1E A;  1NPQ A;  3CR5 X;  3I5G B;  3I5F C;  1K9U A;  1TNP A;  3DVE A;  4OCI A;  1JFK A;  1Y1U A;  1R2U A;  3TS5 B;  1ZUZ A;  1IWQ A;  4XJK A;  4CFQ A;  3PM8 A;  1KQM B;  2KI6 C;  1XYD A;  1OOJ A;  3EKJ A;  1TN4 A;  1CFC A;  2I7A A;  1YVL A;  1DJH A;  2JTZ A;  1QJT A;  5D7F A;  1M31 A;  3NXA A;  2Y4Q A;  2LVI A;  4HRG A;  1UHN A;  1S5G Y;  2MA2 A;  5K89 A;  2F8P A;  3O2P A;  2H61 C;  5CPV A;  1OMR A;  3FWC A;  4XYN A;  2KI4 B;  3IF7 A;  4XJK B;  1QV0 A;  3OP0 A;  1SCV A;  1WDC C;  2KOT A;  2BL0 B;  2MJW B;  1QV1 A;  2JNF A;  2Q4U A;  4GGN A;  4OKH A;  3TZ1 A;  1U5I A;  4AQI A;  1VRK A;  2IS9 A;  3KHE A;  1MF8 B;  2Y5I A;  3EK7 A;  2K0J A;  1DJI A;  1NX2 A;  1V1G A;  3EVU A;  1HQV A;  3O4Y A;  2K8M B;  1K9K A;  1WLZ A;  3E3R A;  1J1D A;  2OTG B;  4PAL A;  1KSO A;  1BR1 B;  3PAT A;  1YRU B;  1MHO A;  2BBM A;  1CNP A;  1TRF A;  1BJF A;  3LK0 A;  4WQ2 A;  1U5I B;  2AAO A;  1OMV A;  2B1U A;  2ZFD A;  2WOR A;  3PLF B;  4I5K A;  1CKK A;  1B1G A;  1SCM C;  4R1E A;  2PAL A;  2ZNE A;  2M29 A;  3DD4 A;  2KYF A;  2WC8 A;  3AAK A;  1BT6 A;  3SIA A;  2CT9 A;  1SL9 A;  2K2F A;  4WRI A;  2LM5 A;  3SG6 A;  2JUL A;  1KSM A;  3VRP A;  4A4C A;  1AHR A;  1CDL A;  1OSA A;  3OHM B;  3DVM A;  4GGF A;  5I8N A;  1EXR A;  1NCZ A;  1PVA A;  2JOJ A;  2WCE A;  1L2O C;  2LMT A;  2LP2 A;  2JU0 A;  5HKW A;  1ZAC A;  2E6W A;  5FYX A;  1YRT B;  4YGC B;  2AMI A;  1S6I A;  2BCX A;  2OPO A;  1M39 A;  5DKQ A;  1PSR A;  4PHN A;  4AQJ A;  1NX0 A;  1XK4 A;  1QLS A;  2TN4 A;  2LLS A;  5JJG A;  1YUU A;  4YBH B;  1Q80 A;  1IJ6 A;  1OE9 B;  1QVI Z;  1B7T Y;  1IQ3 A;  3WHU B;  1K90 D;  1QIV A;  3TDI A;  2CBL A;  3HCM A;  4YGE B;  2KAX A;  3WHT B;  2KQY A;  4PE0 A;  5CSN A;  3TUY B;  4M2P A;  1K8U A;  1EG4 A;  3PN7 C;  1F4O A;  1B8C A;  1XFU O;  1KFU L;  1PAL A;  4ZCV A;  4I5N B;  1DTL A;  3JTD B;  1XFW O;  1EJ3 A;  1K95 A;  1BOD A;  2M7L A;  2JXC A;  1DJY A;  2BKI B;  4GFT A;  2K7B A;  2H2K A;  1Y0V H;  1B8R A;  4F0Z B;  5HKY A;  1XO5 A;  1KFX S;  1LIN A;  4FQO A;  4ETO A;  1J55 A;  3DVK A;  3M0W A;  4P5O E;  1K9P A;  1JBA A;  3EK4 A;  3D10 A;  2BE4 A;  2M0R A;  1K96 A;  3CLN A;  2K61 A;  3OX5 A;  2EGD A;  2F3Z A;  1S36 A;  2G9B A;  2LUX A;  2SAS A;  1FI6 A;  2JWW A;  1PSB A;  1CDP A;  2LAN A;  3DF0 A;  2KAY A;  4NDB A;  1AJ4 A;  2LP3 A;  2LV7 A;  4IL1 A;  5CSF A;  1XK4 C;  2WCB A;  1IH0 A;  3OX6 A;  1QXP A;  2RGI A;  3EVV A;  4C0J A;  1CLM A;  1LA3 A;  1YUR A;  2L0P A;  3PAL A;  5ER4 X;  1HT9 A;  2L5X B;  3D0Y A;  1RWY A;  1S1E A;  1MXL C;  2A4J A;  1FW4 A;  2F2P A;  4PE7 A;  4NDC A;  3DF0 B;  1KWO B;  2LLT A;  4WQ3 A;  1CFF A;  2MAZ A;  1A75 A;  1MXE A;  2MRD A;  2SCP A;  3PFV A;  3TDU A;  1NP8 A;  1C7W A;  1SK6 D;  5AAN A;  1NX1 A;  3I5H C;  2F33 A;  4DIR A;  4JPZ B;  1IG5 A;  2CNP A;  1CTR A;  1J7P A;  3D0Y B;  3I5I C;  3F45 A;  2KGR A;  3FWB A;  4MRY A;  2JZI A;  2LNK A;  1EH2 A;  2PSR A;  1CFD A;  5AXI A;  3JVT B;  2BCA A;  3CR2 A;  4I5J A;  1C7V A;  2FOT A;  3I5G C;  4MBE A;  1J7O A;  1A75 B;  2M7N A;  2R2I A;  1BLQ A;  1GQM A;  2BBN A;  1SBJ A;  2QAC A;  3VRR A;  3TS5 C;  2ZN8 A;  2L50 A;  1YX7 A;  1ALV A;  1K93 D;  5HLV A;  1LKJ A;  1KQM C;  3O78 A;  3CGA A;  2MBX A;  4PCW A;  4QJ4 B;  2HQ8 A;  1TNX A;  2M3W A;  2L98 A;  5BPJ A;  5TNC A;  3A8R A;  2QPT A;  1QAS A;  4Q04 A;  2L2E A;  1KK7 Y;  4DUQ A;  1H8B A;  1B8L A;  1AP4 A;  1NWD A;  2I94 A;  2OS8 B;  4CID A;  1YUT A;  2KI4 C;  1K2H A;  1QIW A;  2LE9 B;  1TTX A;  2JQ6 A;  1UHH A;  2O5G A;  4ORC B;  4UPG A;  2BL0 C;  1IQ5 A;  4JQ0 D;  3LCP C;  2Y1N A;  1KQV A;  1MQ1 A;  4YI8 A;  2LHI A;  3SG2 A;  1IGV A;  2CXJ A;  1IKU A;  3BUN B;  1FBV A;  2BEC A;  2KFF A;  3OB1 B;  1UP5 A;  5AEQ A;  3VRO A;  5HKZ A;  2OTG C;  3SG7 A;  1SW8 A;  2EC6 B;  4E68 A;  5CSI A;  2G2B A;  2LMV A;  1JFJ A;  1OMD A;  1RRO A;  1V1F A;  2GGM A;  3OB2 B;  4PE4 A;  4CLN A;  2JNX A;  1DF0 A;  5ER5 A;  1GGZ A;  3SIB A;  1B4C A;  2MLF C;  4P2Y B;  5DKN A;  3SG5 A;  1WRZ A;  1SR6 B;  1MUX A;  2F2O A;  2LVV A;  3FIA A;  1REC A;  3AKA A;  1XFY O;  1FI5 A;  3WXA A;  4BY5 A;  5AER A;  4M2O A;  4OV2 A;  2K7O A;  2Y1M A;  2LVK A;  2ISD A;  3LLE A;  2D8N A;  5G08 A;  3KO0 A;  3SJS A;  1EG3 A;  1DF0 B;  2MHH A;  1B47 A;  3MSE B;  1KCY A;  2I18 A;  1AJ5 A;  2BE6 A;  1SY9 A;  2M1K B;  2LMU A;  4BY4 A;  1MWN A;  1A4P A;  1TIZ A;  4N1G A;  2PRU A;  1F71 A;  1PVB A;  1WRL A;  2K7C A;  1YTZ C;  2KDH A;  3BXK A;  3ICB A;  5PAL A;  5KTY A;  1D1O A;  1SYM A;  1CFP A;  2FCE A;  5KSZ A;  5DKR A;  1TCO B;  2L4I A;  3VRQ A;  4PHK A;  2K7D A;  4MRX A;  1CMF A;  4PHJ A;  1SR6 C;  2M9G A;  2ZND A;  3GK2 A;  4I5L B;  1PK0 D;  1DVI A;  4GGF C;  1WY9 A;  1LVC D;  1UHI A;  3GK1 A;  1EL4 A;  4JWQ A;  1SPY A;  1XVJ A;  2E30 A;  4ZCU A;  1QS7 A;  4N5X A;  3GOF A;  4MVF A;  1YX8 A;  1FPW A;  3TUY C;  1RTP 1;  3I5F B;  1JF2 A;  1DJG A;  2KAV A;  2M8U A;  4HRE E;  2KFH A;  4OR9 B;  4C0L A;  2KQ6 A;  1UUS A;  1J7Q A;  1RJV A;  1W7I B;  1JC2 A;  1BF5 A;  1Y6W A;  1ZOT B;  4MEW A;  4TNC A;  1UWO A;  1OQP A;  2O60 A;  3JTD C;  4YGD B;  3K21 A;  1RFJ A;  2KGB C;  1L7Z A;  3ZNI A;  4DCK A;  3KEV A;  1S6C A;  3CR4 X;  1H4B A;  1M46 A;  4QJ5 B;  1NUB A;  2KBI A;  1W7J B;  1FF1 A;  5B8I B;  4CPV A;  1TNW A;  1CLL A;  2NCO A;  4U8D A;  3AKB A;  2VRG A;  3H4S E;  2KHN A;  3FS7 A;  5CSJ A;  1YR5 A;  1JUO A;  1JF0 A;  4MSP A;  3EVR A;  1CDN A;  3C1V A;  3NSI A;  1ZFS A;  1F70 A;  2KBM A;  1WDC B;  1B7T Z;  4M2Q A;  2Q91 A;  1OZS A;  4FTG A;  2NCP A;  1MR8 A;  1AK8 A;  1QAT A;  1SRA A;  3VGO A;  5I2L A;  2FJU B;  1UHJ A;  5GQQ C;  4CFR A;  5JOL A;  1A03 A;  1SL8 A;  1QX2 A;  2JC2 A;  1B9A A;  1KK8 B;  1LXF C;  1BG1 A;  3NSL A;  2MLE C;  4ORA B;  1R6P A;  4MZJ A;  1SNL A;  2M97 A;  1E8A A;  2PMY A;  4MZK A;  1KWO C;  4MN0 A;  1CMG A;  1IJ5 A;  1IRJ A;  4HSZ A;  1GJY A;  3WNX B;  2WOS A;  4MLW A;  5D69 A;  1DJX A;  2FCD A;  2COL B;  2NZ0 A;  1SCM B;  1F8H A;  1TCF A;  2ZKM X;  2JXL A;  1QVI Y;  2HF5 A;  2PVB A;  2PAS A;  1KFX L;  1ODB A;  3NSK A;  3QRX A;  3JVT C;  2ZRT A;  2JRF A;  1A2X A;  1KFU S;  4YGA A;  2NXQ A;  1Y1X A;  1QLK A;  3KF9 A;  5HLO A;  1PUL A;  2ZRS A;  1DMO A;  1S26 D;  3PSR A;  1G33 A;  1KK8 C;  4GPL B;  5KU1 A;  4YGB B;  1GGW A;  1UHK A;  4AOM A;  3A4U B;  1C07 A;  4NQG A;  1BMO A;  1L2O B;  2M1U A;  1XFZ O;  1DGV A;  1S3P A;  1AUI B;  1DJZ A;  2WND A;  4PHM A;  1CDM A;  1NCX A;  1M63 B;  2LLU A;  1DGU A;  2KI6 D;  1UUR A;  2HQW A;  3IQO A;  2K2A A;  4DRW A;  1NIW A;  1PRW A;  5HYD A;  1K94 A;  1F4Q A;  2CCM A;  3O6B A;  3BOW A;  3SG3 A;  3HX4 A;  1J7R A;  3CZT X;  3NSO A;  4PE1 A;  3BUM B;  1G8I A;  2OS8 C;  2WCF A;  1Y1A A;  3CTN A;  3BUW B;  3RM1 A;  3ZWH A;  1F55 A;  1S5G Z;  2KYC A;  3LL8 B;  4GAO A;  1XFX O;  4USL A;  1SL7 A;  2JTT A;  1JSA A;  5F6T A;  5J3X A;  2LUC A;  2P6B B;  3TDZ A;  4ICB A;  5I2O A;  1NCY A;  1YUS A;  1AVS A;  2V53 A;  3PN7 B;  3BOW B;  5IBW A;  1JWD A;  3GK4 X;  1NSH A;  2HET A;  1NX3 A;  3AAJ A;  4N1F A;  2EC6 C;  4C0K A;  1XA5 A;  1BOC A;  3DVJ A;  1N65 A;  4GNK B;  4YI9 A;  2JPT A;  1QX5 B;  2F3Y A;  1CM4 A;  4NDD A;  5AFP A;  1CB1 A;  2DOQ A;  1DT7 B;  2JT0 A;  1SKT A;  4QJ3 B;  1XFV O;  2KNE A;  4OVN F;  1BR4 B;  1QX7 A;  1KK7 Z;  4GBA A;  3CS1 A;  1WLM A;  4L9M A;  4D1E A;  4YRU A;  3EK8 A;  1LA0 A;  3BYA A;  1DJW A;  1ALW A;  2LHL A;  2GV5 A;  2KSP A;  2LC5 A;  1N2D A;  2I2R E;  2M49 B;  1YVH A;  1M45 A;  2LAP A;  1TOP A;  1A29 A;  1S6J A;  1X02 A;  1TNQ A;  1WRK A;  4PDZ A;  2ZN9 A;  1OZO A;  2H61 A;  3EKH A;  1SMG A;  1ZMZ A;  3RLZ A;  2NLN A;  2JT8 A;  1NYA A;  1G4Y R;  3LK1 A;  4A4B A;  3BUX B;  2KFG A;  1RK9 A;  2JT3 A;  4MZL A;  2EHB A;  3KPX A;  5I2Q A;  1CLB A;  1QTX A;  2HPS A;  3BQ3 A;  2L4H A;  2BKH B;  2CTN A;  3I5H B;  3VRN A;  2L51 A;  1N0Y A;  1CM1 A;  1BU3 A;  3SG4 A;  3BUO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...