2F2OA

Structure of calmodulin bound to a calcineurin peptide: a new way of making an old binding mode
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
171
structure length
156
Chain Sequence
TEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAIRNKIRAIGKMARVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin fused with calmodulin-binding domain of calcineur
publication title Structure of calmodulin bound to a calcineurin Peptide: a new way of making an old binding mode.
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 60
structure length 156
sequence length 171
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2005-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2f2oA01
4HREE 1L2OB 4ORAB 2OTGB 1KFXL 4R1EA 1L7ZA 3DF0A 4WQ2A 5HKYA 3BUNB 4GGFC 1NYAA 5DKRA 5F6TA 3SIBA 2KI6D 1DJHA 3E3RA 1KK7Y 2AMIA 1SL7A 1IG5A 1AVSA 1UWOA 3O78A 1BT6A 2KNEA 3GOFA 2LMUA 2K8MB 3EVVA 2FOTA 1CLBA 2BCBA 2KBIA 4ZCUA 2SCPA 2M1UA 3I5GC 1S26D 1YRTB 5CSJA 2BL0B 3NXAA 1SR6C 4NDDA 1GGWA 4F0ZB 1FBVA 2ZFDA 1ZFSA 2K2FA 4E68A 4A4BA 3EK7A 3GK4X 4C0JA 1YVLA 2NZ0A 1S6JA 5PALA 2F33A 4I5KA 1QX5B 1UHNA 4CIDA 1H8BA 1KSOA 2LUCA 1K9KA 4PE7A 4MN0A 3OB1B 3TS5C 2WC8A 1SPYA 2KGBC 1YTZC 2F3YA 4DCKA 2MRDA 2PMYA 2G9BA 2JT0A 1AJ5A 4HSZA 1ZACA 4CLNA 5K89A 1TIZA 1CDPA 1QIVA 3IQQA 3SG4A 1D1OA 1RJVA 1S3PA 3EVUA 3CZTX 1S6IA 1TTXA 2LE9B 3LK0A 1QLSA 2O5GA 3WXAA 1IQ3A 1QIWA 4L9MA 2GGZA 2D8NA 3OB2B 1MHOA 3PLFB 1OMVA 2JQ6A 2MBXA 4AQIA 1N2DA 2I94A 1CDNA 4GPLB 2HF5A 1KQMB 4OKHA 2KSPA 1B7TZ 2QPTA 1K93D 1OZOA 2H2KA 1YX8A 1CFPA 1ALVA 1PVAA 2GV5A 3OX5A 4PHNA 2ZRSA 4OV2A 4YI9A 1C07A 2M97A 1A4PA 1JWDA 4ORCB 2KI4C 1Y6WA 1CM1A 1M31A 3TZ1A 2ZN9A 3JTDB 1RECA 2KQYA 3BXKA 1NCYA 3KF9A 5FYXA 1FI6A 1G4YR 1J1EA 1UUSA 1FPWA 2H61C 1AHRA 1K96A 3WNXB 5DKNA 1QXPA 2O60A 2NCPA 1YVHA 1F4QA 2Y1MA 1LKJA 2TN4A 3VRQA 2LP3A 5CSNA 1MQ1A 2BCXA 1ODBA 3CTNA 1W7IB 1SL9A 4GBAA 1XFWO 1EL4A 1SY9A 1QATA 1BOCA 1WRKA 1LINA 2NLNA 1Q80A 1SL8A 4BY4A 4FTGA 1B4CA 1QS7A 1QV0A 2LVVA 4BY5A 1XA5A 1F70A 2KQ6A 2Q4UA 3CS1A 3TDZA 4JWQA 2EC6C 2MJWB 3RLZA 2F8PA 1UHKA 4OVNF 1AJ4A 1B7TY 2K61A 2LNKA 4HRGA 3SG5A 2V53A 3EK8A 1V1FA 2LHLA 1CMFA 2HPSA 1MXLC 3TUYB 1EG3A 4MZLA 4OCIA 3HCMA 2CNPA 1GJYA 3FS7A 1UHIA 3WHTB 3FWBA 3MSEB 3A8RA 1IGVA 1RK9A 1WLZA 2LUXA 3I5FB 4PALA 1DJGA 1M63B 5DKQA 2ZNDA 3VGOA 1EJ3A 1DJZA 2K2AA 2GGMA 1XVJA 1F4OA 2PSRA 1M45A 2OS8C 2ZKMX 3I5HB 1CLMA 1PULA 2WNDA 1QV1A 2JC2A 2Y4QA 2EGDA 2DOQA 2K7OA 3DD4A 3VRPA 2SASA 3EVRA 1HQVA 1S1EA 1JUOA 1YR5A 1PSRA 2JTZA 2KAYA 1DJIA 1Y1UA 3QRXA 5ER5A 1LVCD 1A29A 2FJUB 4YI8A 1YUTA 4DUQA 3DVJA 2KAVA 1NX3A 1WRZA 4MVFA 2L98A 1GQMA 3EK4A 2BL0C 1KFUS 1AP4A 2KFHA 1DVIA 1RFJA 1NX0A 4MRXA 2MLEC 2RGIA 4GGNA 4ZCVA 2I2RE 2JT8A 1NIWA 5I2QA 4MZJA 5IBWA 2BE4A 1CFDA 1QTXA 3ZWHA 4YGEB 1EXRA 4PHJA 1F55A 4USLA 4YBHB 2F3ZA 1XFUO 2M49B 1E8AA 1J7PA 2M8UA 5KTYA 2BE6A 1A75A 1G33A 1S6CA 2I18A 5AANA 2M9GA 2Y5IA 2LANA 3AKAA 3NSIA 3VRNA 1U5IB 4ORBB 1F54A 1B8RA 1KWOB 1K94A 3A4UB 2FCDA 2L50A 2WCFA 1SYMA 2L2EA 1CFCA 2E30A 4JQ0D 3VROA 4CFRA 2KHNA 3SG6A 1BMOA 1FW4A 1UURA 2KI6C 1C7WA 2LHIA 1W7JB 1KQMC 4C0KA 1A75B 1WRLA 1JFKA 2LLTA 1OMDA 1BODA 3JVTC 3CR2A 1JBAA 2A4JA 2LC5A 2K0JA 4FQOA 1CTRA 1CFFA 1JC2A 4I5JA 5AEQA 2NXQA 1M46A 4XJKB 1TNXA 2Q91A 4P5OE 3JTDC 1QASA 3PFVA 3TS5B 3AAJA 1YUUA 5HKZA 2L5XB 1B8CA 3PATA 2LVKA 2L4HA 2HETA 4M2OA 2K7CA 1PRWA 3LL8B 1KCYA 2KGRA 1QLKA 3HX4A 1SW8A 1PK0D 3DVKA 1QX7A 2ZN8A 1Y1AA 3PN7B 1N0YA 1AK8A 1BR4B 2JZIA 1K2HA 4P2YB 2MA2A 1KQVA 3LCPC 4AOMA 1TNWA 1RROA 3CR4X 1ZMZA 5JJGA 1CNPA 1CDMA 2CBLA 1EH2A 2JWWA 1RWYA 2JTTA 3IF7A 3M0WA 2F2PA 5I2OA 3SG7A 1K9PA 3CLNA 4OR9B 2LCPA 1SBJA 2JXCA 2KYCA 2NCOA 2LM5A 1YUSA 3RM1A 2M7LA 2CTNA 1TNPA 2WCEA 3C1VA 1MF8B 2PVBA 1SCVA 3FIAA 4WRIA 2B1UA 1XK4A 4MLWA 1PSBA 2KI4B 3WHUB 5D7FA 1XFVO 4QJ5B 5HYDA 4N5XA 1B9AA 4XYNA 4TNCA 2CXJA 2AUCA 2QACA 5G08A 2P6BB 2BBNA 1Y0VH 2AAOA 2MLFC 3AKBA 4GNKB 3TDIA 1SRAA 1V1GA 1B47A 2JULA 1J7RA 3OX6A 4GAOA 1L2OC 2VRGA 1PVBA 2OTGC 4DS7A 1R6PA 1YRUB 2BKHB 2R2IA 1A03A 2JOJA 1WDCB 1UHHA 1DGVA 1CKKA 1TNQA 1WY9A 1LXFC 2CCMA 1Y1XA 1J7QA 2BKIB 4MBEA 1JF0A 1B8LA 4N1GA 3OP0A 1LA0A 1SCMB 2KOTA 1BF5A 5CPVA 1IKUA 5AXIA 4AQJA 5AFPA 1MUXA 1UHJA 4CPVA 1XFXO 2JT3A 1J1DA 4GFTA 1ZUZA 1NPQA 3BUWB 1DTLA 1NP8A 2G2BA 1A2XA 3SIAA 1DF0B 1NCZA 1B1GA 1TRFA 2M1KB 4QJ3B 4MZKA 3GK2A 1U5IA 1M39A 4GGFA 2OS8B 1BG1A 1OZSA 3CR5X 4ICBA 3CGAA 2L0PA 1KFUL 2Y1NA 3O2PA 2JPTA 2BBMA 2HQ8A 3I5IB 1OOJA 1KK8B 1KWOC 1K90D 1NSHA 2E6WA 3BUMB 3SG2A 1TCFA 4JPZB 5CSFA 2L51A 2LLUA 1BLQA 2KYFA 3EKHA 3D0YB 2BCAA 2ZRTA 1UP5A 1XFYO 3PSRA 1K95A 4YRUA 1RTP1 5ER4X 4NDBA 4XJKA 2KFGA 3DF0B 5B8IB 1FI5A 1IWQA 1NWDA 1S36A 2JNFA 2F2OA 2COLB 1JSAA 4NQGA 4YGDB 1VRKA 3TDUA 1SKTA 2KAXA 1F8HA 3I5GB 2BECA 2LVJA 1SMGA 4DIRA 1F71A 4MSPA 1SR6B 4QJ4B 2PASA 1CDLA 1BR1B 5J3XA 5JOLA 3IQOA 1S5GZ 3O4YA 4YGCB 4DRWA 3D10A 3K21A 5KSZA 1IQ5A 2L4IA 1IH0A 1YX7A 4D1EA 4UPGA 3PM8A 2MHHA 3KPXA 4PHKA 1QVIZ 3VRRA 2KDHA 5TNCA 3PN7C 3BYAA 4U8DA 4PCWA 3NSOA 1HT9A 1MWNA 2KFFA 2M7NA 2OPOA 1MXEA 2LV7A 5GQQC 3AAKA 4N1FA 3BUXB 3LK1A 5HLVA 1XYDA 2IS9A 1SNLA 5HLOA 3JVTB 1DJWA 1OQPA 3NSKA 4ETOA 4PHMA 3GK1A 1ZOTB 3EKJA 3FWCA 5HKWA 3SJSA 5BPJA 1BU3A 2JXLA 1SK6D 1JF2A 1NUBA 1CLLA 1G8IA 1TCOB 3DVEA 2H61A 1NX2A 2LP2A 5CSIA 1DT7B 1CM4A 1K8UA 1OMRA 4HRHA 4M2PA 1TN4A 1XFZO 1EG4A 1J7OA 1LA3A 2WORA 2FCEA 2JNXA 1DJYA 3TUYC 1S5GY 1X02A 1IJ5A 3OHMB 1N65A 2MAZA 2HQWA 4PDZA 1OE9B 2K7BA 3KEVA 4PE1A 3O6BA 3BUOB 3ZNIA 3I5FC 1IJ6A 1XK4C 1KSMA 3LLEA 1PALA 4YGBB 1QVIY 3CWGA 3BQ3A 3H4SE 1ALWA 4IL1A 1DJXA 1OSAA 4WQ3A 4M2QA 1K9UA 3I5HC 1QJTA 1J55A 1C7VA 1DGUA 1NCXA 4MEWA 1TOPA 4C0LA 1QX2A 1WDCC 1XO5A 3KHEA 4Q04A 1KK7Z 2LMVA 4GUKA 2ISDA 1CB1A 1FF1A 4YGAA 1JFJA 2JU0A 5KU1A 1GGZA 2M29A 4PE4A 4I5LB 5D69A 2M3WA 1R2UA 4I5NB 1SCMC 1MR8A 1AUIB 2EC6B 3KO0A 2CT9A 1DF0A 3F45A 5AERA 1DMOA 1YURA 5I2LA 2ZNEA 2LLSA 1WLMA 3BOWA 4PE0A 2LMTA 2LAPA 4CFQA 2I7AA 2LVIA 2JRFA 2K7DA 4A4CA 3ICBA 1NX1A 5I8NA 4NDCA 2M0RA 1BJFA 1KFXS 3PALA 1CMGA 2WOSA 4MRYA 2PRUA 3SG3A 3DVMA 2WCBA 2PALA 3NSLA 3D0YA 1H4BA 1IRJA 2EHBA 3I5IC 1KK8C 3BOWB 2KBMA
chains in the Genus database with same CATH superfamily
4HREE 1L2OB 4ORAB 2OTGB 1KFXL 4R1EA 1L7ZA 3DF0A 4WQ2A 4KYNA 5HKYA 3BUNB 4GGFC 1NYAA 5DKRA 5F6TA 3SIBA 2KI6D 1DJHA 5DICA 3E3RA 1KK7Y 2AMIA 1SL7A 1IG5A 1AVSA 3L47A 1UWOA 3O78A 1BT6A 2QEHA 2KNEA 3GOFA 2LMUA 2K8MB 3EVVA 2FOTA 2K60A 1CLBA 2BCBA 2KBIA 4ZCUA 2SCPA 2M1UA 3I5GC 1S26D 1YRTB 2KLEA 5CSJA 2BL0B 3NXAA 1SR6C 3CZ0A 3FE6A 4NDDA 4F0ZB 1GGWA 1FBVA 2ZFDA 1ZFSA 2K2FA 4E68A 4A4BA 3EK7A 3GK4X 4C0JA 1YVLA 2NZ0A 1S6JA 5PALA 2F33A 4I5KA 1QX5B 1UHNA 3BOWB 4CIDA 3RZSA 1KSOA 2BNXA 1C3YA 2LUCA 2KPHA 1H8BA 1OOFA 1K9KA 4PE7A 4MN0A 3OB1B 3TS5C 2WC8A 1SPYA 2KGBC 2L2CA 1YTZC 2F3YA 4IJ7A 4DCKA 2MRDA 2PMYA 2G9BA 2JT0A 1AJ5A 4HSZA 1ZACA 4CLNA 5K89A 1TIZA 1CDPA 1QIVA 3IQQA 3SG4A 1D1OA 1RJVA 1S3PA 3EVUA 3CZTX 1S6IA 1TTXA 2LE9B 3LK0A 1QLSA 2O5GA 3WXAA 2P70A 1IQ3A 1QIWA 4L9MA 2GGZA 2D8NA 3OB2B 1MHOA 3PLFB 1OMVA 2JQ6A 2MBXA 2YGUA 4AQIA 1N2DA 2I94A 1CDNA 4GPLB 2HF5A 1KQMB 2JPOA 1GM0A 4OKHA 2KSPA 1B7TZ 2QPTA 1K93D 1OZOA 2H2KA 1YX8A 1CFPA 1ALVA 1PVAA 2GV5A 3OX5A 4PHNA 2ZRSA 4OV2A 1IIOA 4YI9A 1C07A 2M97A 1A4PA 1JWDA 4ORCB 2KI4C 1Y6WA 1CM1A 1M31A 3TZ1A 2ZN9A 3UO9A 3JTDB 1RECA 2KQYA 4F7FA 3BXKA 1NCYA 1LS8A 3KF9A 5FYXA 1FI6A 1TUZA 1T14A 1G4YR 1J1EA 1UUSA 1FPWA 2H61C 1AHRA 1K96A 3WNXB 5DKNA 1QXPA 2O60A 3CDNA 2NCPA 1YVHA 1F4QA 3Q8IA 2Y1MA 1LKJA 2TN4A 3VRQA 2LP3A 5CSNA 1MQ1A 2BCXA 1ODBA 3EG5B 3CTNA 1W7IB 1Z4HA 1SL9A 4GBAA 1XFWO 1EL4A 1SY9A 1QATA 1BOCA 1WRKA 1LINA 3DZTA 2NLNA 1Q80A 1SL8A 4BY4A 4FTGA 5FI7A 1QS7A 1QV0A 2LVVA 4BY5A 1XA5A 1B4CA 1F70A 2KQ6A 2Q4UA 3CS1A 3TDZA 4JWQA 2EC6C 2MJWB 3RLZA 2F8PA 3B86A 1UHKA 4OVNF 1AJ4A 1B7TY 2K61A 2LNKA 4HRGA 3SG5A 2V53A 3EK8A 1V1FA 2LHLA 1W9ZA 1CMFA 5I94A 2HPSA 1MXLC 3TUYB 1EG3A 4MZLA 4OCIA 3HCMA 2CNPA 1GJYA 3FS7A 1UHIA 3WHTB 2H8VA 3FWBA 3MSEB 3A8RA 1IGVA 1RK9A 1WLZA 2LUXA 3I5FB 4PALA 1DJGA 1M63B 5DKQA 2ZNDA 3VGOA 1EJ3A 1DJZA 2K2AA 2GGMA 1XVJA 1F4OA 2PSRA 1DC1A 1M45A 2WCHA 2OS8C 2ZKMX 3I5HB 1CLMA 1PULA 2WNDA 1QV1A 2JC2A 2Y4QA 2EGDA 2DOQA 2QEVA 3DXLA 2K7OA 3DD4A 3VRPA 2SASA 3EVRA 1HQVA 1S1EA 1JUOA 1YR5A 1PSRA 2JTZA 2KAYA 1DJIA 1Y1UA 3QRXA 5ER5A 1LVCD 1A29A 2FJUB 4YI8A 1YUTA 4DUQA 4FQTA 3DVJA 2KAVA 1NX3A 1WRZA 4MVFA 2L98A 1GQMA 3EK4A 1KFUS 2BL0C 1AP4A 2KFHA 1DVIA 1RFJA 1NX0A 4MRXA 2MLEC 2RGIA 4GGNA 3S0DA 3OBVA 2I2RE 2JT8A 4ZCVA 1NIWA 5I2QA 3IVTA 4MZJA 5IBWA 1CFDA 1QTXA 2BE4A 3ZWHA 4YGEB 1EXRA 4PHJA 1F55A 4USLA 4YBHB 2F3ZA 3CZ1A 1XFUO 2M49B 1E8AA 1J7PA 1SSEB 2M8UA 5KTYA 2BE6A 1A75A 1G33A 2WCJA 1S6CA 2I18A 5AANA 2M9GA 2Y5IA 3D74A 2LANA 3AKAA 3NSIA 3VRNA 1U5IB 4ORBB 1F54A 1B8RA 1KWOB 3D75A 1K94A 3A4UB 2FCDA 2L50A 2WCFA 1TUJA 4JD9A 1SYMA 2L2EA 1CFCA 2E30A 4JQ0D 3VROA 4CFRA 2KHNA 3SG6A 1BMOA 1FW4A 1UURA 2KI6C 2L5YA 1C7WA 2LHIA 1W7JB 2WC5A 1KQMC 1ORGA 4C0KA 1A75B 1WRLA 1JFKA 2LLTA 1OMDA 1BODA 3JVTC 3CR2A 1JBAA 2A4JA 2LC5A 2K0JA 4FQOA 1CTRA 1CFFA 1JC2A 4I5JA 5AEQA 2NXQA 1M46A 4XJKB 1TNXA 2Q91A 4P5OE 3JTDC 1QASA 3PFVA 5HL1A 3TS5B 3AAJA 3D78A 1YUUA 5HKZA 2WCKA 2L5XB 1B8CA 3PATA 2LVKA 2L4HA 2HETA 4M2OA 2K7CA 1PRWA 3LL8B 1KCYA 2KGRA 1QLKA 3HX4A 1SW8A 1DQEA 1PK0D 3DVKA 1QX7A 2ZN8A 1Y1AA 3PN7B 1N0YA 3N7HA 1AK8A 1BR4B 2JZIA 3SS4A 1K2HA 2QEBA 4P2YB 2MA2A 1KQVA 3LCPC 4AOMA 4INWA 1TNWA 1RROA 3CR4X 1ZMZA 5JJGA 1CNPA 1CDMA 2CBLA 3R1PA 2JWWA 1RWYA 2JTTA 3IF7A 3M0WA 2F2PA 3BJHA 3SG7A 1K9PA 3CLNA 4OR9B 2LCPA 1SBJA 2JXCA 3V2LA 2KYCA 2NCOA 2LM5A 1YUSA 3RM1A 3UNWA 3L4LA 3S0EA 2M7LA 2CTNA 1TNPA 2WCEA 3C1VA 3VB1A 1MF8B 2PVBA 1SCVA 3B7AA 3FIAA 4WRIA 2B1UA 1XK4A 3BFAA 4MLWA 3R1OA 1PSBA 2KI4B 1DELA 3WHUB 5D7FA 1XFVO 4QJ5B 5HYDA 4N5XA 2WCMA 1B9AA 4XYNA 4TNCA 2CXJA 3DY9A 2AUCA 2QACA 5G08A 3S0FA 2P6BB 2BBNA 4INXA 1Y0VH 2AAOA 2MLFC 2PQLA 1OOIX 3AKBA 4GNKB 3TDIA 1SRAA 1V1GA 3D77A 2WC6A 1B47A 2JULA 1J7RA 3OX6A 2ERBA 4GAOA 1L2OC 3DYEA 2VRGA 1PVBA 2OTGC 4DS7A 1R6PA 1YRUB 2BKHB 2R2IA 1A03A 2JOJA 1WDCB 1OOHA 1UHHA 1DGVA 1CKKA 1TNQA 3OGNA 3NHTA 1WY9A 1LXFC 2CCMA 1Y1XA 1J7QA 2BKIB 4MBEA 1JF0A 1B8LA 4N1GA 3OP0A 1LA0A 1DEKA 3D73A 1SCMB 2KOTA 1BF5A 5CPVA 1IKUA 5AXIA 4AQJA 3SS3A 5AFPA 1MUXA 1UHJA 4CPVA 5FI6A 5D3OA 1XFXO 2JT3A 1J1DA 4GFTA 1ZUZA 1NPQA 3PJIA 3BUWB 4OZDA 1DTLA 1NP8A 2G2BA 1A2XA 3SIAA 1DF0B 1NCZA 1B1GA 1TRFA 2M1KB 4QJ3B 4MZKA 3GK2A 1U5IA 1M39A 4GGFA 2OS8B 1BG1A 1OZSA 3CR5X 4ICBA 3CGAA 2L0PA 1KFUL 2Y1NA 3O2PA 2BAPA 2JPTA 3R1VA 2BBMA 3K1EA 2HQ8A 3I5IB 1OOJA 1KK8B 1KWOC 1K90D 1NSHA 2QDIA 2E6WA 3BUMB 3SG2A 1TCFA 4JPZB 5CSFA 2L51A 2LLUA 1BLQA 2KYFA 3EKHA 3D0YB 2BCAA 2ZRTA 3SS5A 4JKTA 1UP5A 1XFYO 3PSRA 1K95A 3NHIA 4YRUA 1RTP1 5ER4X 4NDBA 4XJKA 2KFGA 3DF0B 5B8IB 1FI5A 1IWQA 1NWDA 1S36A 2JNFA 2F2OA 2COLB 1JSAA 4NQGA 4YGDB 1VRKA 3TDUA 1SKTA 2KAXA 1F8HA 3I5GB 5I2OA 2BECA 2LVJA 3NGVA 5EL2A 1SMGA 4DIRA 1F71A 4MSPA 1SR6B 3B6XA 3QMEA 4QJ4B 2PASA 3BFHA 1CDLA 1BR1B 1C3ZA 5J3XA 5JOLA 3IQOA 1S5GZ 3O4YA 4YGCB 4DRWA 3D10A 3K21A 5KSZA 1IQ5A 2L4IA 3D76A 1YX7A 4D1EA 1IH0A 4UPGA 2KLDA 3PM8A 2MHHA 1Z2CB 3KPXA 4PHKA 1QVIZ 3VRRA 2KDHA 5TNCA 3PN7C 3BYAA 4U8DA 4PCWA 3NSOA 1HT9A 1MWNA 2KFFA 2M7NA 2OPOA 1MXEA 2LV7A 5GQQC 3AAKA 4N1FA 3BUXB 3LK1A 5HLVA 1XYDA 2IS9A 1SNLA 1QWVA 5HLOA 1EH2A 3JVTB 1DJWA 1OQPA 3NSKA 3FE9A 4PHMA 2PYQA 3GK1A 4ETOA 3R72A 1ZOTB 3EKJA 3FWCA 5HKWA 3SJSA 5BPJA 1BU3A 2JXLA 1SK6D 1JF2A 1NUBA 4PT1A 1CLLA 1G8IA 1TCOB 3DVEA 2H61A 1NX2A 3O4XA 5FI2A 2LP2A 5CSIA 1DT7B 1CM4A 3S0AA 1K8UA 1OMRA 4HRHA 4M2PA 1TN4A 1XFZO 1EG4A 1J7OA 1LA3A 2WORA 2FCEA 2JNXA 1DJYA 3TUYC 1S5GY 1X02A 1IJ5A 3OHMB 2P71A 1N65A 2MAZA 2HQWA 4PDZA 1OE9B 2K7BA 3KEVA 4PE1A 1OOGA 3O6BA 3BUOB 3ZNIA 3I5FC 1IJ6A 1XK4C 1KSMA 3LLEA 1PALA 4YGBB 1QVIY 3CWGA 3BQ3A 1OW4A 3H4SE 1ALWA 4IL1A 1DJXA 1OSAA 4WQ3A 3S0GA 4M2QA 1K9UA 3I5HC 2FJYA 1QJTA 1J55A 1C7VA 1DGUA 1NCXA 4MEWA 1TOPA 4C0LA 1QX2A 1WDCC 1XO5A 3KHEA 4Q04A 1KK7Z 2LMVA 3B88A 4GUKA 3BFBA 2ISDA 1CB1A 1FF1A 4YGAA 1JFJA 2JU0A 5KU1A 1GGZA 2M29A 4PE4A 4I5LB 5D69A 2M3WA 1R2UA 4I5NB 1SCMC 1MR8A 3CYZA 1AUIB 2EC6B 3KO0A 2CT9A 1DF0A 3F45A 5AERA 1DMOA 1YURA 3PM2A 3S0BA 5I2LA 2ZNEA 2WCLA 2LLSA 1WLMA 3B87A 3BOWA 4PE0A 2LMTA 2LAPA 4CFQA 2I7AA 2LVIA 2JRFA 2K7DA 4A4CA 3ICBA 1NX1A 5I8NA 3L4AA 3FE8A 1TWOA 1P28A 4NDCA 2M0RA 1BJFA 1KFXS 3CABA 3PALA 1CMGA 2GTEA 2WOSA 4MRYA 2PRUA 3SG3A 3DVMA 2WCBA 1XFRA 2PALA 3NSLA 3D0YA 1H4BA 1IRJA 2EHBA 3I5IC 1KK8C 2QEOA 2KBMA 3CZ2A
chains in the Genus database with same CATH topology
4HREE 1L2OB 4ORAB 2OTGB 1KFXL 4R1EA 1L7ZA 3DF0A 4WQ2A 5HKYA 3BUNB 4GGFC 1NYAA 5DKRA 5F6TA 3SIBA 2KI6D 1DJHA 3E3RA 1KK7Y 2AMIA 1SL7A 1IG5A 1AVSA 1UWOA 3O78A 1BT6A 2KNEA 3GOFA 2LMUA 2K8MB 3EVVA 2FOTA 1CLBA 2BCBA 2KBIA 4ZCUA 2SCPA 2M1UA 3I5GC 1S26D 1YRTB 5CSJA 2BL0B 3NXAA 1SR6C 4NDDA 1GGWA 4F0ZB 1FBVA 2ZFDA 1ZFSA 2K2FA 4E68A 4A4BA 3EK7A 3GK4X 4C0JA 1YVLA 2NZ0A 1S6JA 5PALA 2F33A 4I5KA 1QX5B 1UHNA 4CIDA 1H8BA 1KSOA 2LUCA 1K9KA 4PE7A 4MN0A 3OB1B 3TS5C 2WC8A 1SPYA 2KGBC 1YTZC 2F3YA 4DCKA 2MRDA 2PMYA 2G9BA 2JT0A 1AJ5A 4HSZA 1ZACA 4CLNA 5K89A 1TIZA 1CDPA 1QIVA 3IQQA 3SG4A 1D1OA 1RJVA 1S3PA 3EVUA 3CZTX 1S6IA 1TTXA 2LE9B 3LK0A 1QLSA 2O5GA 3WXAA 1IQ3A 1QIWA 4L9MA 2GGZA 2D8NA 3OB2B 1MHOA 3PLFB 1OMVA 2JQ6A 2MBXA 4AQIA 1N2DA 2I94A 1CDNA 4GPLB 2HF5A 1KQMB 4OKHA 2KSPA 1B7TZ 2QPTA 1K93D 1OZOA 2H2KA 1YX8A 1CFPA 1ALVA 1PVAA 2GV5A 3OX5A 4PHNA 2ZRSA 4OV2A 4YI9A 1C07A 2M97A 1A4PA 1JWDA 4ORCB 2KI4C 1Y6WA 1CM1A 1M31A 3TZ1A 2ZN9A 3JTDB 1RECA 2KQYA 3BXKA 1NCYA 3KF9A 5FYXA 1FI6A 1G4YR 1J1EA 1UUSA 1FPWA 2H61C 1AHRA 1K96A 3WNXB 5DKNA 1QXPA 2O60A 2NCPA 1YVHA 1F4QA 2Y1MA 1LKJA 2TN4A 3VRQA 2LP3A 5CSNA 1MQ1A 2BCXA 1ODBA 3CTNA 1W7IB 1SL9A 4GBAA 1XFWO 1EL4A 1SY9A 1QATA 1BOCA 1WRKA 1LINA 2NLNA 1Q80A 1SL8A 4BY4A 4FTGA 1B4CA 1QS7A 1QV0A 2LVVA 4BY5A 1XA5A 1F70A 2KQ6A 2Q4UA 3CS1A 3TDZA 4JWQA 2EC6C 2MJWB 3RLZA 2F8PA 1UHKA 4OVNF 1AJ4A 1B7TY 2K61A 2LNKA 4HRGA 3SG5A 2V53A 3EK8A 1V1FA 2LHLA 1CMFA 2HPSA 1MXLC 3TUYB 1EG3A 4MZLA 4OCIA 3HCMA 2CNPA 1GJYA 3FS7A 1UHIA 3WHTB 3FWBA 3MSEB 3A8RA 1IGVA 1RK9A 1WLZA 2LUXA 3I5FB 4PALA 1DJGA 1M63B 5DKQA 2ZNDA 3VGOA 1EJ3A 1DJZA 2K2AA 2GGMA 1XVJA 1F4OA 2PSRA 1M45A 2OS8C 2ZKMX 3I5HB 1CLMA 1PULA 2WNDA 1QV1A 2JC2A 2Y4QA 2EGDA 2DOQA 2K7OA 3DD4A 3VRPA 2SASA 3EVRA 1HQVA 1S1EA 1JUOA 1YR5A 1PSRA 2JTZA 2KAYA 1DJIA 1Y1UA 3QRXA 5ER5A 1LVCD 1A29A 2FJUB 4YI8A 1YUTA 4DUQA 3DVJA 2KAVA 1NX3A 1WRZA 4MVFA 2L98A 1GQMA 3EK4A 2BL0C 1KFUS 1AP4A 2KFHA 1DVIA 1RFJA 1NX0A 4MRXA 2MLEC 2RGIA 4GGNA 4ZCVA 2I2RE 2JT8A 1NIWA 5I2QA 4MZJA 5IBWA 2BE4A 1CFDA 1QTXA 3ZWHA 4YGEB 1EXRA 4PHJA 1F55A 4USLA 4YBHB 2F3ZA 1XFUO 2M49B 1E8AA 1J7PA 2M8UA 5KTYA 2BE6A 1A75A 1G33A 1S6CA 2I18A 5AANA 2M9GA 2Y5IA 2LANA 3AKAA 3NSIA 3VRNA 1U5IB 4ORBB 1F54A 1B8RA 1KWOB 1K94A 3A4UB 2FCDA 2L50A 2WCFA 1SYMA 2L2EA 1CFCA 2E30A 4JQ0D 3VROA 4CFRA 2KHNA 3SG6A 1BMOA 1FW4A 1UURA 2KI6C 1C7WA 2LHIA 1W7JB 1KQMC 4C0KA 1A75B 1WRLA 1JFKA 2LLTA 1OMDA 1BODA 3JVTC 3CR2A 1JBAA 2A4JA 2LC5A 2K0JA 4FQOA 1CTRA 1CFFA 1JC2A 4I5JA 5AEQA 2NXQA 1M46A 4XJKB 1TNXA 2Q91A 4P5OE 3JTDC 1QASA 3PFVA 3TS5B 3AAJA 1YUUA 5HKZA 2L5XB 1B8CA 3PATA 2LVKA 2L4HA 2HETA 4M2OA 2K7CA 1PRWA 3LL8B 1KCYA 2KGRA 1QLKA 3HX4A 1SW8A 1PK0D 3DVKA 1QX7A 2ZN8A 1Y1AA 3PN7B 1N0YA 1AK8A 1BR4B 2JZIA 1K2HA 4P2YB 2MA2A 1KQVA 3LCPC 4AOMA 1TNWA 1RROA 3CR4X 1ZMZA 5JJGA 1CNPA 1CDMA 2CBLA 1EH2A 2JWWA 1RWYA 2JTTA 3IF7A 3M0WA 2F2PA 5I2OA 3SG7A 1K9PA 3CLNA 4OR9B 2LCPA 1SBJA 2JXCA 2KYCA 2NCOA 2LM5A 1YUSA 3RM1A 2M7LA 2CTNA 1TNPA 2WCEA 3C1VA 1MF8B 2PVBA 1SCVA 3FIAA 4WRIA 2B1UA 1XK4A 4MLWA 1PSBA 2KI4B 3WHUB 5D7FA 1XFVO 4QJ5B 5HYDA 4N5XA 1B9AA 4XYNA 4TNCA 2CXJA 2AUCA 2QACA 5G08A 2P6BB 2BBNA 1Y0VH 2AAOA 2MLFC 3AKBA 4GNKB 3TDIA 1SRAA 1V1GA 1B47A 2JULA 1J7RA 3OX6A 4GAOA 1L2OC 2VRGA 1PVBA 2OTGC 4DS7A 1R6PA 1YRUB 2BKHB 2R2IA 1A03A 2JOJA 1WDCB 1UHHA 1DGVA 1CKKA 1TNQA 1WY9A 1LXFC 2CCMA 1Y1XA 1J7QA 2BKIB 4MBEA 1JF0A 1B8LA 4N1GA 3OP0A 1LA0A 1SCMB 2KOTA 1BF5A 5CPVA 1IKUA 5AXIA 4AQJA 5AFPA 1MUXA 1UHJA 4CPVA 1XFXO 2JT3A 1J1DA 4GFTA 1ZUZA 1NPQA 3BUWB 1DTLA 1NP8A 2G2BA 1A2XA 3SIAA 1DF0B 1NCZA 1B1GA 1TRFA 2M1KB 4QJ3B 4MZKA 3GK2A 1U5IA 1M39A 4GGFA 2OS8B 1BG1A 1OZSA 3CR5X 4ICBA 3CGAA 2L0PA 1KFUL 2Y1NA 3O2PA 2JPTA 2BBMA 2HQ8A 3I5IB 1OOJA 1KK8B 1KWOC 1K90D 1NSHA 2E6WA 3BUMB 3SG2A 1TCFA 4JPZB 5CSFA 2L51A 2LLUA 1BLQA 2KYFA 3EKHA 3D0YB 2BCAA 2ZRTA 1UP5A 1XFYO 3PSRA 1K95A 4YRUA 1RTP1 5ER4X 4NDBA 4XJKA 2KFGA 3DF0B 5B8IB 1FI5A 1IWQA 1NWDA 1S36A 2JNFA 2F2OA 2COLB 1JSAA 4NQGA 4YGDB 1VRKA 3TDUA 1SKTA 2KAXA 1F8HA 3I5GB 2BECA 2LVJA 1SMGA 4DIRA 1F71A 4MSPA 1SR6B 4QJ4B 2PASA 1CDLA 1BR1B 5J3XA 5JOLA 3IQOA 1S5GZ 3O4YA 4YGCB 4DRWA 3D10A 3K21A 5KSZA 1IQ5A 2L4IA 1IH0A 1YX7A 4D1EA 4UPGA 3PM8A 2MHHA 3KPXA 4PHKA 1QVIZ 3VRRA 2KDHA 5TNCA 3PN7C 3BYAA 4U8DA 4PCWA 3NSOA 1HT9A 1MWNA 2KFFA 2M7NA 2OPOA 1MXEA 2LV7A 5GQQC 3AAKA 4N1FA 3BUXB 3LK1A 5HLVA 1XYDA 2IS9A 1SNLA 5HLOA 3JVTB 1DJWA 1OQPA 3NSKA 4ETOA 4PHMA 3GK1A 1ZOTB 3EKJA 3FWCA 5HKWA 3SJSA 5BPJA 1BU3A 2JXLA 1SK6D 1JF2A 1NUBA 1CLLA 1G8IA 1TCOB 3DVEA 2H61A 1NX2A 2LP2A 5CSIA 1DT7B 1CM4A 1K8UA 1OMRA 4HRHA 4M2PA 1TN4A 1XFZO 1EG4A 1J7OA 1LA3A 2WORA 2FCEA 2JNXA 1DJYA 3TUYC 1S5GY 1X02A 1IJ5A 3OHMB 1N65A 2MAZA 2HQWA 4PDZA 1OE9B 2K7BA 3KEVA 4PE1A 3O6BA 3BUOB 3ZNIA 3I5FC 1IJ6A 1XK4C 1KSMA 3LLEA 1PALA 4YGBB 1QVIY 3CWGA 3BQ3A 3H4SE 1ALWA 4IL1A 1DJXA 1OSAA 4WQ3A 4M2QA 1K9UA 3I5HC 1QJTA 1J55A 1C7VA 1DGUA 1NCXA 4MEWA 1TOPA 4C0LA 1QX2A 1WDCC 1XO5A 3KHEA 4Q04A 1KK7Z 2LMVA 4GUKA 2ISDA 1CB1A 1FF1A 4YGAA 1JFJA 2JU0A 5KU1A 1GGZA 2M29A 4PE4A 4I5LB 5D69A 2M3WA 1R2UA 4I5NB 1SCMC 1MR8A 1AUIB 2EC6B 3KO0A 2CT9A 1DF0A 3F45A 5AERA 1DMOA 1YURA 5I2LA 2ZNEA 2LLSA 1WLMA 3BOWA 4PE0A 2LMTA 2LAPA 4CFQA 2I7AA 2LVIA 2JRFA 2K7DA 4A4CA 3ICBA 1NX1A 5I8NA 4NDCA 2M0RA 1BJFA 1KFXS 3PALA 1CMGA 2WOSA 4MRYA 2PRUA 3SG3A 3DVMA 2WCBA 2PALA 3NSLA 3D0YA 1H4BA 1IRJA 2EHBA 3I5IC 1KK8C 3BOWB 2KBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HRE E;  1L2O B;  4ORA B;  2OTG B;  1KFX L;  4R1E A;  1L7Z A;  3DF0 A;  4WQ2 A;  5HKY A;  3BUN B;  4GGF C;  1NYA A;  5DKR A;  5F6T A;  3SIB A;  2KI6 D;  1DJH A;  3E3R A;  1KK7 Y;  2AMI A;  1SL7 A;  1IG5 A;  1AVS A;  1UWO A;  3O78 A;  1BT6 A;  2KNE A;  3GOF A;  2LMU A;  2K8M B;  3EVV A;  2FOT A;  1CLB A;  2BCB A;  2KBI A;  4ZCU A;  2SCP A;  2M1U A;  3I5G C;  1S26 D;  1YRT B;  5CSJ A;  2BL0 B;  3NXA A;  1SR6 C;  4NDD A;  1GGW A;  4F0Z B;  1FBV A;  2ZFD A;  1ZFS A;  2K2F A;  4E68 A;  4A4B A;  3EK7 A;  3GK4 X;  4C0J A;  1YVL A;  2NZ0 A;  1S6J A;  5PAL A;  2F33 A;  4I5K A;  1QX5 B;  1UHN A;  4CID A;  1H8B A;  1KSO A;  2LUC A;  1K9K A;  4PE7 A;  4MN0 A;  3OB1 B;  3TS5 C;  2WC8 A;  1SPY A;  2KGB C;  1YTZ C;  2F3Y A;  4DCK A;  2MRD A;  2PMY A;  2G9B A;  2JT0 A;  1AJ5 A;  4HSZ A;  1ZAC A;  4CLN A;  5K89 A;  1TIZ A;  1CDP A;  1QIV A;  3IQQ A;  3SG4 A;  1D1O A;  1RJV A;  1S3P A;  3EVU A;  3CZT X;  1S6I A;  1TTX A;  2LE9 B;  3LK0 A;  1QLS A;  2O5G A;  3WXA A;  1IQ3 A;  1QIW A;  4L9M A;  2GGZ A;  2D8N A;  3OB2 B;  1MHO A;  3PLF B;  1OMV A;  2JQ6 A;  2MBX A;  4AQI A;  1N2D A;  2I94 A;  1CDN A;  4GPL B;  2HF5 A;  1KQM B;  4OKH A;  2KSP A;  1B7T Z;  2QPT A;  1K93 D;  1OZO A;  2H2K A;  1YX8 A;  1CFP A;  1ALV A;  1PVA A;  2GV5 A;  3OX5 A;  4PHN A;  2ZRS A;  4OV2 A;  4YI9 A;  1C07 A;  2M97 A;  1A4P A;  1JWD A;  4ORC B;  2KI4 C;  1Y6W A;  1CM1 A;  1M31 A;  3TZ1 A;  2ZN9 A;  3JTD B;  1REC A;  2KQY A;  3BXK A;  1NCY A;  3KF9 A;  5FYX A;  1FI6 A;  1G4Y R;  1J1E A;  1UUS A;  1FPW A;  2H61 C;  1AHR A;  1K96 A;  3WNX B;  5DKN A;  1QXP A;  2O60 A;  2NCP A;  1YVH A;  1F4Q A;  2Y1M A;  1LKJ A;  2TN4 A;  3VRQ A;  2LP3 A;  5CSN A;  1MQ1 A;  2BCX A;  1ODB A;  3CTN A;  1W7I B;  1SL9 A;  4GBA A;  1XFW O;  1EL4 A;  1SY9 A;  1QAT A;  1BOC A;  1WRK A;  1LIN A;  2NLN A;  1Q80 A;  1SL8 A;  4BY4 A;  4FTG A;  1B4C A;  1QS7 A;  1QV0 A;  2LVV A;  4BY5 A;  1XA5 A;  1F70 A;  2KQ6 A;  2Q4U A;  3CS1 A;  3TDZ A;  4JWQ A;  2EC6 C;  2MJW B;  3RLZ A;  2F8P A;  1UHK A;  4OVN F;  1AJ4 A;  1B7T Y;  2K61 A;  2LNK A;  4HRG A;  3SG5 A;  2V53 A;  3EK8 A;  1V1F A;  2LHL A;  1CMF A;  2HPS A;  1MXL C;  3TUY B;  1EG3 A;  4MZL A;  4OCI A;  3HCM A;  2CNP A;  1GJY A;  3FS7 A;  1UHI A;  3WHT B;  3FWB A;  3MSE B;  3A8R A;  1IGV A;  1RK9 A;  1WLZ A;  2LUX A;  3I5F B;  4PAL A;  1DJG A;  1M63 B;  5DKQ A;  2ZND A;  3VGO A;  1EJ3 A;  1DJZ A;  2K2A A;  2GGM A;  1XVJ A;  1F4O A;  2PSR A;  1M45 A;  2OS8 C;  2ZKM X;  3I5H B;  1CLM A;  1PUL A;  2WND A;  1QV1 A;  2JC2 A;  2Y4Q A;  2EGD A;  2DOQ A;  2K7O A;  3DD4 A;  3VRP A;  2SAS A;  3EVR A;  1HQV A;  1S1E A;  1JUO A;  1YR5 A;  1PSR A;  2JTZ A;  2KAY A;  1DJI A;  1Y1U A;  3QRX A;  5ER5 A;  1LVC D;  1A29 A;  2FJU B;  4YI8 A;  1YUT A;  4DUQ A;  3DVJ A;  2KAV A;  1NX3 A;  1WRZ A;  4MVF A;  2L98 A;  1GQM A;  3EK4 A;  2BL0 C;  1KFU S;  1AP4 A;  2KFH A;  1DVI A;  1RFJ A;  1NX0 A;  4MRX A;  2MLE C;  2RGI A;  4GGN A;  4ZCV A;  2I2R E;  2JT8 A;  1NIW A;  5I2Q A;  4MZJ A;  5IBW A;  2BE4 A;  1CFD A;  1QTX A;  3ZWH A;  4YGE B;  1EXR A;  4PHJ A;  1F55 A;  4USL A;  4YBH B;  2F3Z A;  1XFU O;  2M49 B;  1E8A A;  1J7P A;  2M8U A;  5KTY A;  2BE6 A;  1A75 A;  1G33 A;  1S6C A;  2I18 A;  5AAN A;  2M9G A;  2Y5I A;  2LAN A;  3AKA A;  3NSI A;  3VRN A;  1U5I B;  4ORB B;  1F54 A;  1B8R A;  1KWO B;  1K94 A;  3A4U B;  2FCD A;  2L50 A;  2WCF A;  1SYM A;  2L2E A;  1CFC A;  2E30 A;  4JQ0 D;  3VRO A;  4CFR A;  2KHN A;  3SG6 A;  1BMO A;  1FW4 A;  1UUR A;  2KI6 C;  1C7W A;  2LHI A;  1W7J B;  1KQM C;  4C0K A;  1A75 B;  1WRL A;  1JFK A;  2LLT A;  1OMD A;  1BOD A;  3JVT C;  3CR2 A;  1JBA A;  2A4J A;  2LC5 A;  2K0J A;  4FQO A;  1CTR A;  1CFF A;  1JC2 A;  4I5J A;  5AEQ A;  2NXQ A;  1M46 A;  4XJK B;  1TNX A;  2Q91 A;  4P5O E;  3JTD C;  1QAS A;  3PFV A;  3TS5 B;  3AAJ A;  1YUU A;  5HKZ A;  2L5X B;  1B8C A;  3PAT A;  2LVK A;  2L4H A;  2HET A;  4M2O A;  2K7C A;  1PRW A;  3LL8 B;  1KCY A;  2KGR A;  1QLK A;  3HX4 A;  1SW8 A;  1PK0 D;  3DVK A;  1QX7 A;  2ZN8 A;  1Y1A A;  3PN7 B;  1N0Y A;  1AK8 A;  1BR4 B;  2JZI A;  1K2H A;  4P2Y B;  2MA2 A;  1KQV A;  3LCP C;  4AOM A;  1TNW A;  1RRO A;  3CR4 X;  1ZMZ A;  5JJG A;  1CNP A;  1CDM A;  2CBL A;  1EH2 A;  2JWW A;  1RWY A;  2JTT A;  3IF7 A;  3M0W A;  2F2P A;  5I2O A;  3SG7 A;  1K9P A;  3CLN A;  4OR9 B;  2LCP A;  1SBJ A;  2JXC A;  2KYC A;  2NCO A;  2LM5 A;  1YUS A;  3RM1 A;  2M7L A;  2CTN A;  1TNP A;  2WCE A;  3C1V A;  1MF8 B;  2PVB A;  1SCV A;  3FIA A;  4WRI A;  2B1U A;  1XK4 A;  4MLW A;  1PSB A;  2KI4 B;  3WHU B;  5D7F A;  1XFV O;  4QJ5 B;  5HYD A;  4N5X A;  1B9A A;  4XYN A;  4TNC A;  2CXJ A;  2AUC A;  2QAC A;  5G08 A;  2P6B B;  2BBN A;  1Y0V H;  2AAO A;  2MLF C;  3AKB A;  4GNK B;  3TDI A;  1SRA A;  1V1G A;  1B47 A;  2JUL A;  1J7R A;  3OX6 A;  4GAO A;  1L2O C;  2VRG A;  1PVB A;  2OTG C;  4DS7 A;  1R6P A;  1YRU B;  2BKH B;  2R2I A;  1A03 A;  2JOJ A;  1WDC B;  1UHH A;  1DGV A;  1CKK A;  1TNQ A;  1WY9 A;  1LXF C;  2CCM A;  1Y1X A;  1J7Q A;  2BKI B;  4MBE A;  1JF0 A;  1B8L A;  4N1G A;  3OP0 A;  1LA0 A;  1SCM B;  2KOT A;  1BF5 A;  5CPV A;  1IKU A;  5AXI A;  4AQJ A;  5AFP A;  1MUX A;  1UHJ A;  4CPV A;  1XFX O;  2JT3 A;  1J1D A;  4GFT A;  1ZUZ A;  1NPQ A;  3BUW B;  1DTL A;  1NP8 A;  2G2B A;  1A2X A;  3SIA A;  1DF0 B;  1NCZ A;  1B1G A;  1TRF A;  2M1K B;  4QJ3 B;  4MZK A;  3GK2 A;  1U5I A;  1M39 A;  4GGF A;  2OS8 B;  1BG1 A;  1OZS A;  3CR5 X;  4ICB A;  3CGA A;  2L0P A;  1KFU L;  2Y1N A;  3O2P A;  2JPT A;  2BBM A;  2HQ8 A;  3I5I B;  1OOJ A;  1KK8 B;  1KWO C;  1K90 D;  1NSH A;  2E6W A;  3BUM B;  3SG2 A;  1TCF A;  4JPZ B;  5CSF A;  2L51 A;  2LLU A;  1BLQ A;  2KYF A;  3EKH A;  3D0Y B;  2BCA A;  2ZRT A;  1UP5 A;  1XFY O;  3PSR A;  1K95 A;  4YRU A;  1RTP 1;  5ER4 X;  4NDB A;  4XJK A;  2KFG A;  3DF0 B;  5B8I B;  1FI5 A;  1IWQ A;  1NWD A;  1S36 A;  2JNF A;  2F2O A;  2COL B;  1JSA A;  4NQG A;  4YGD B;  1VRK A;  3TDU A;  1SKT A;  2KAX A;  1F8H A;  3I5G B;  2BEC A;  2LVJ A;  1SMG A;  4DIR A;  1F71 A;  4MSP A;  1SR6 B;  4QJ4 B;  2PAS A;  1CDL A;  1BR1 B;  5J3X A;  5JOL A;  3IQO A;  1S5G Z;  3O4Y A;  4YGC B;  4DRW A;  3D10 A;  3K21 A;  5KSZ A;  1IQ5 A;  2L4I A;  1IH0 A;  1YX7 A;  4D1E A;  4UPG A;  3PM8 A;  2MHH A;  3KPX A;  4PHK A;  1QVI Z;  3VRR A;  2KDH A;  5TNC A;  3PN7 C;  3BYA A;  4U8D A;  4PCW A;  3NSO A;  1HT9 A;  1MWN A;  2KFF A;  2M7N A;  2OPO A;  1MXE A;  2LV7 A;  5GQQ C;  3AAK A;  4N1F A;  3BUX B;  3LK1 A;  5HLV A;  1XYD A;  2IS9 A;  1SNL A;  5HLO A;  3JVT B;  1DJW A;  1OQP A;  3NSK A;  4ETO A;  4PHM A;  3GK1 A;  1ZOT B;  3EKJ A;  3FWC A;  5HKW A;  3SJS A;  5BPJ A;  1BU3 A;  2JXL A;  1SK6 D;  1JF2 A;  1NUB A;  1CLL A;  1G8I A;  1TCO B;  3DVE A;  2H61 A;  1NX2 A;  2LP2 A;  5CSI A;  1DT7 B;  1CM4 A;  1K8U A;  1OMR A;  4HRH A;  4M2P A;  1TN4 A;  1XFZ O;  1EG4 A;  1J7O A;  1LA3 A;  2WOR A;  2FCE A;  2JNX A;  1DJY A;  3TUY C;  1S5G Y;  1X02 A;  1IJ5 A;  3OHM B;  1N65 A;  2MAZ A;  2HQW A;  4PDZ A;  1OE9 B;  2K7B A;  3KEV A;  4PE1 A;  3O6B A;  3BUO B;  3ZNI A;  3I5F C;  1IJ6 A;  1XK4 C;  1KSM A;  3LLE A;  1PAL A;  4YGB B;  1QVI Y;  3CWG A;  3BQ3 A;  3H4S E;  1ALW A;  4IL1 A;  1DJX A;  1OSA A;  4WQ3 A;  4M2Q A;  1K9U A;  3I5H C;  1QJT A;  1J55 A;  1C7V A;  1DGU A;  1NCX A;  4MEW A;  1TOP A;  4C0L A;  1QX2 A;  1WDC C;  1XO5 A;  3KHE A;  4Q04 A;  1KK7 Z;  2LMV A;  4GUK A;  2ISD A;  1CB1 A;  1FF1 A;  4YGA A;  1JFJ A;  2JU0 A;  5KU1 A;  1GGZ A;  2M29 A;  4PE4 A;  4I5L B;  5D69 A;  2M3W A;  1R2U A;  4I5N B;  1SCM C;  1MR8 A;  1AUI B;  2EC6 B;  3KO0 A;  2CT9 A;  1DF0 A;  3F45 A;  5AER A;  1DMO A;  1YUR A;  5I2L A;  2ZNE A;  2LLS A;  1WLM A;  3BOW A;  4PE0 A;  2LMT A;  2LAP A;  4CFQ A;  2I7A A;  2LVI A;  2JRF A;  2K7D A;  4A4C A;  3ICB A;  1NX1 A;  5I8N A;  4NDC A;  2M0R A;  1BJF A;  1KFX S;  3PAL A;  1CMG A;  2WOS A;  4MRY A;  2PRU A;  3SG3 A;  3DVM A;  2WCB A;  2PAL A;  3NSL A;  3D0Y A;  1H4B A;  1IRJ A;  2EHB A;  3I5I C;  1KK8 C;  3BOW B;  2KBM A; 
#chains in the Genus database with same CATH topology
 4HRE E;  1L2O B;  4ORA B;  2OTG B;  1KFX L;  4R1E A;  1L7Z A;  3DF0 A;  4WQ2 A;  4KYN A;  5HKY A;  3BUN B;  4GGF C;  1NYA A;  5DKR A;  5F6T A;  3SIB A;  2KI6 D;  1DJH A;  5DIC A;  3E3R A;  1KK7 Y;  2AMI A;  1SL7 A;  1IG5 A;  1AVS A;  3L47 A;  1UWO A;  3O78 A;  1BT6 A;  2QEH A;  2KNE A;  3GOF A;  2LMU A;  2K8M B;  3EVV A;  2FOT A;  2K60 A;  1CLB A;  2BCB A;  2KBI A;  4ZCU A;  2SCP A;  2M1U A;  3I5G C;  1S26 D;  1YRT B;  2KLE A;  5CSJ A;  2BL0 B;  3NXA A;  1SR6 C;  3CZ0 A;  3FE6 A;  4NDD A;  4F0Z B;  1GGW A;  1FBV A;  2ZFD A;  1ZFS A;  2K2F A;  4E68 A;  4A4B A;  3EK7 A;  3GK4 X;  4C0J A;  1YVL A;  2NZ0 A;  1S6J A;  5PAL A;  2F33 A;  4I5K A;  1QX5 B;  1UHN A;  3BOW B;  4CID A;  3RZS A;  1KSO A;  2BNX A;  1C3Y A;  2LUC A;  2KPH A;  1H8B A;  1OOF A;  1K9K A;  4PE7 A;  4MN0 A;  3OB1 B;  3TS5 C;  2WC8 A;  1SPY A;  2KGB C;  2L2C A;  1YTZ C;  2F3Y A;  4IJ7 A;  4DCK A;  2MRD A;  2PMY A;  2G9B A;  2JT0 A;  1AJ5 A;  4HSZ A;  1ZAC A;  4CLN A;  5K89 A;  1TIZ A;  1CDP A;  1QIV A;  3IQQ A;  3SG4 A;  1D1O A;  1RJV A;  1S3P A;  3EVU A;  3CZT X;  1S6I A;  1TTX A;  2LE9 B;  3LK0 A;  1QLS A;  2O5G A;  3WXA A;  2P70 A;  1IQ3 A;  1QIW A;  4L9M A;  2GGZ A;  2D8N A;  3OB2 B;  1MHO A;  3PLF B;  1OMV A;  2JQ6 A;  2MBX A;  2YGU A;  4AQI A;  1N2D A;  2I94 A;  1CDN A;  4GPL B;  2HF5 A;  1KQM B;  2JPO A;  1GM0 A;  4OKH A;  2KSP A;  1B7T Z;  2QPT A;  1K93 D;  1OZO A;  2H2K A;  1YX8 A;  1CFP A;  1ALV A;  1PVA A;  2GV5 A;  3OX5 A;  4PHN A;  2ZRS A;  4OV2 A;  1IIO A;  4YI9 A;  1C07 A;  2M97 A;  1A4P A;  1JWD A;  4ORC B;  2KI4 C;  1Y6W A;  1CM1 A;  1M31 A;  3TZ1 A;  2ZN9 A;  3UO9 A;  3JTD B;  1REC A;  2KQY A;  4F7F A;  3BXK A;  1NCY A;  1LS8 A;  3KF9 A;  5FYX A;  1FI6 A;  1TUZ A;  1T14 A;  1G4Y R;  1J1E A;  1UUS A;  1FPW A;  2H61 C;  1AHR A;  1K96 A;  3WNX B;  5DKN A;  1QXP A;  2O60 A;  3CDN A;  2NCP A;  1YVH A;  1F4Q A;  3Q8I A;  2Y1M A;  1LKJ A;  2TN4 A;  3VRQ A;  2LP3 A;  5CSN A;  1MQ1 A;  2BCX A;  1ODB A;  3EG5 B;  3CTN A;  1W7I B;  1Z4H A;  1SL9 A;  4GBA A;  1XFW O;  1EL4 A;  1SY9 A;  1QAT A;  1BOC A;  1WRK A;  1LIN A;  3DZT A;  2NLN A;  1Q80 A;  1SL8 A;  4BY4 A;  4FTG A;  5FI7 A;  1QS7 A;  1QV0 A;  2LVV A;  4BY5 A;  1XA5 A;  1B4C A;  1F70 A;  2KQ6 A;  2Q4U A;  3CS1 A;  3TDZ A;  4JWQ A;  2EC6 C;  2MJW B;  3RLZ A;  2F8P A;  3B86 A;  1UHK A;  4OVN F;  1AJ4 A;  1B7T Y;  2K61 A;  2LNK A;  4HRG A;  3SG5 A;  2V53 A;  3EK8 A;  1V1F A;  2LHL A;  1W9Z A;  1CMF A;  5I94 A;  2HPS A;  1MXL C;  3TUY B;  1EG3 A;  4MZL A;  4OCI A;  3HCM A;  2CNP A;  1GJY A;  3FS7 A;  1UHI A;  3WHT B;  2H8V A;  3FWB A;  3MSE B;  3A8R A;  1IGV A;  1RK9 A;  1WLZ A;  2LUX A;  3I5F B;  4PAL A;  1DJG A;  1M63 B;  5DKQ A;  2ZND A;  3VGO A;  1EJ3 A;  1DJZ A;  2K2A A;  2GGM A;  1XVJ A;  1F4O A;  2PSR A;  1DC1 A;  1M45 A;  2WCH A;  2OS8 C;  2ZKM X;  3I5H B;  1CLM A;  1PUL A;  2WND A;  1QV1 A;  2JC2 A;  2Y4Q A;  2EGD A;  2DOQ A;  2QEV A;  3DXL A;  2K7O A;  3DD4 A;  3VRP A;  2SAS A;  3EVR A;  1HQV A;  1S1E A;  1JUO A;  1YR5 A;  1PSR A;  2JTZ A;  2KAY A;  1DJI A;  1Y1U A;  3QRX A;  5ER5 A;  1LVC D;  1A29 A;  2FJU B;  4YI8 A;  1YUT A;  4DUQ A;  4FQT A;  3DVJ A;  2KAV A;  1NX3 A;  1WRZ A;  4MVF A;  2L98 A;  1GQM A;  3EK4 A;  1KFU S;  2BL0 C;  1AP4 A;  2KFH A;  1DVI A;  1RFJ A;  1NX0 A;  4MRX A;  2MLE C;  2RGI A;  4GGN A;  3S0D A;  3OBV A;  2I2R E;  2JT8 A;  4ZCV A;  1NIW A;  5I2Q A;  3IVT A;  4MZJ A;  5IBW A;  1CFD A;  1QTX A;  2BE4 A;  3ZWH A;  4YGE B;  1EXR A;  4PHJ A;  1F55 A;  4USL A;  4YBH B;  2F3Z A;  3CZ1 A;  1XFU O;  2M49 B;  1E8A A;  1J7P A;  1SSE B;  2M8U A;  5KTY A;  2BE6 A;  1A75 A;  1G33 A;  2WCJ A;  1S6C A;  2I18 A;  5AAN A;  2M9G A;  2Y5I A;  3D74 A;  2LAN A;  3AKA A;  3NSI A;  3VRN A;  1U5I B;  4ORB B;  1F54 A;  1B8R A;  1KWO B;  3D75 A;  1K94 A;  3A4U B;  2FCD A;  2L50 A;  2WCF A;  1TUJ A;  4JD9 A;  1SYM A;  2L2E A;  1CFC A;  2E30 A;  4JQ0 D;  3VRO A;  4CFR A;  2KHN A;  3SG6 A;  1BMO A;  1FW4 A;  1UUR A;  2KI6 C;  2L5Y A;  1C7W A;  2LHI A;  1W7J B;  2WC5 A;  1KQM C;  1ORG A;  4C0K A;  1A75 B;  1WRL A;  1JFK A;  2LLT A;  1OMD A;  1BOD A;  3JVT C;  3CR2 A;  1JBA A;  2A4J A;  2LC5 A;  2K0J A;  4FQO A;  1CTR A;  1CFF A;  1JC2 A;  4I5J A;  5AEQ A;  2NXQ A;  1M46 A;  4XJK B;  1TNX A;  2Q91 A;  4P5O E;  3JTD C;  1QAS A;  3PFV A;  5HL1 A;  3TS5 B;  3AAJ A;  3D78 A;  1YUU A;  5HKZ A;  2WCK A;  2L5X B;  1B8C A;  3PAT A;  2LVK A;  2L4H A;  2HET A;  4M2O A;  2K7C A;  1PRW A;  3LL8 B;  1KCY A;  2KGR A;  1QLK A;  3HX4 A;  1SW8 A;  1DQE A;  1PK0 D;  3DVK A;  1QX7 A;  2ZN8 A;  1Y1A A;  3PN7 B;  1N0Y A;  3N7H A;  1AK8 A;  1BR4 B;  2JZI A;  3SS4 A;  1K2H A;  2QEB A;  4P2Y B;  2MA2 A;  1KQV A;  3LCP C;  4AOM A;  4INW A;  1TNW A;  1RRO A;  3CR4 X;  1ZMZ A;  5JJG A;  1CNP A;  1CDM A;  2CBL A;  3R1P A;  2JWW A;  1RWY A;  2JTT A;  3IF7 A;  3M0W A;  2F2P A;  3BJH A;  3SG7 A;  1K9P A;  3CLN A;  4OR9 B;  2LCP A;  1SBJ A;  2JXC A;  3V2L A;  2KYC A;  2NCO A;  2LM5 A;  1YUS A;  3RM1 A;  3UNW A;  3L4L A;  3S0E A;  2M7L A;  2CTN A;  1TNP A;  2WCE A;  3C1V A;  3VB1 A;  1MF8 B;  2PVB A;  1SCV A;  3B7A A;  3FIA A;  4WRI A;  2B1U A;  1XK4 A;  3BFA A;  4MLW A;  3R1O A;  1PSB A;  2KI4 B;  1DEL A;  3WHU B;  5D7F A;  1XFV O;  4QJ5 B;  5HYD A;  4N5X A;  2WCM A;  1B9A A;  4XYN A;  4TNC A;  2CXJ A;  3DY9 A;  2AUC A;  2QAC A;  5G08 A;  3S0F A;  2P6B B;  2BBN A;  4INX A;  1Y0V H;  2AAO A;  2MLF C;  2PQL A;  1OOI X;  3AKB A;  4GNK B;  3TDI A;  1SRA A;  1V1G A;  3D77 A;  2WC6 A;  1B47 A;  2JUL A;  1J7R A;  3OX6 A;  2ERB A;  4GAO A;  1L2O C;  3DYE A;  2VRG A;  1PVB A;  2OTG C;  4DS7 A;  1R6P A;  1YRU B;  2BKH B;  2R2I A;  1A03 A;  2JOJ A;  1WDC B;  1OOH A;  1UHH A;  1DGV A;  1CKK A;  1TNQ A;  3OGN A;  3NHT A;  1WY9 A;  1LXF C;  2CCM A;  1Y1X A;  1J7Q A;  2BKI B;  4MBE A;  1JF0 A;  1B8L A;  4N1G A;  3OP0 A;  1LA0 A;  1DEK A;  3D73 A;  1SCM B;  2KOT A;  1BF5 A;  5CPV A;  1IKU A;  5AXI A;  4AQJ A;  3SS3 A;  5AFP A;  1MUX A;  1UHJ A;  4CPV A;  5FI6 A;  5D3O A;  1XFX O;  2JT3 A;  1J1D A;  4GFT A;  1ZUZ A;  1NPQ A;  3PJI A;  3BUW B;  4OZD A;  1DTL A;  1NP8 A;  2G2B A;  1A2X A;  3SIA A;  1DF0 B;  1NCZ A;  1B1G A;  1TRF A;  2M1K B;  4QJ3 B;  4MZK A;  3GK2 A;  1U5I A;  1M39 A;  4GGF A;  2OS8 B;  1BG1 A;  1OZS A;  3CR5 X;  4ICB A;  3CGA A;  2L0P A;  1KFU L;  2Y1N A;  3O2P A;  2BAP A;  2JPT A;  3R1V A;  2BBM A;  3K1E A;  2HQ8 A;  3I5I B;  1OOJ A;  1KK8 B;  1KWO C;  1K90 D;  1NSH A;  2QDI A;  2E6W A;  3BUM B;  3SG2 A;  1TCF A;  4JPZ B;  5CSF A;  2L51 A;  2LLU A;  1BLQ A;  2KYF A;  3EKH A;  3D0Y B;  2BCA A;  2ZRT A;  3SS5 A;  4JKT A;  1UP5 A;  1XFY O;  3PSR A;  1K95 A;  3NHI A;  4YRU A;  1RTP 1;  5ER4 X;  4NDB A;  4XJK A;  2KFG A;  3DF0 B;  5B8I B;  1FI5 A;  1IWQ A;  1NWD A;  1S36 A;  2JNF A;  2F2O A;  2COL B;  1JSA A;  4NQG A;  4YGD B;  1VRK A;  3TDU A;  1SKT A;  2KAX A;  1F8H A;  3I5G B;  5I2O A;  2BEC A;  2LVJ A;  3NGV A;  5EL2 A;  1SMG A;  4DIR A;  1F71 A;  4MSP A;  1SR6 B;  3B6X A;  3QME A;  4QJ4 B;  2PAS A;  3BFH A;  1CDL A;  1BR1 B;  1C3Z A;  5J3X A;  5JOL A;  3IQO A;  1S5G Z;  3O4Y A;  4YGC B;  4DRW A;  3D10 A;  3K21 A;  5KSZ A;  1IQ5 A;  2L4I A;  3D76 A;  1YX7 A;  4D1E A;  1IH0 A;  4UPG A;  2KLD A;  3PM8 A;  2MHH A;  1Z2C B;  3KPX A;  4PHK A;  1QVI Z;  3VRR A;  2KDH A;  5TNC A;  3PN7 C;  3BYA A;  4U8D A;  4PCW A;  3NSO A;  1HT9 A;  1MWN A;  2KFF A;  2M7N A;  2OPO A;  1MXE A;  2LV7 A;  5GQQ C;  3AAK A;  4N1F A;  3BUX B;  3LK1 A;  5HLV A;  1XYD A;  2IS9 A;  1SNL A;  1QWV A;  5HLO A;  1EH2 A;  3JVT B;  1DJW A;  1OQP A;  3NSK A;  3FE9 A;  4PHM A;  2PYQ A;  3GK1 A;  4ETO A;  3R72 A;  1ZOT B;  3EKJ A;  3FWC A;  5HKW A;  3SJS A;  5BPJ A;  1BU3 A;  2JXL A;  1SK6 D;  1JF2 A;  1NUB A;  4PT1 A;  1CLL A;  1G8I A;  1TCO B;  3DVE A;  2H61 A;  1NX2 A;  3O4X A;  5FI2 A;  2LP2 A;  5CSI A;  1DT7 B;  1CM4 A;  3S0A A;  1K8U A;  1OMR A;  4HRH A;  4M2P A;  1TN4 A;  1XFZ O;  1EG4 A;  1J7O A;  1LA3 A;  2WOR A;  2FCE A;  2JNX A;  1DJY A;  3TUY C;  1S5G Y;  1X02 A;  1IJ5 A;  3OHM B;  2P71 A;  1N65 A;  2MAZ A;  2HQW A;  4PDZ A;  1OE9 B;  2K7B A;  3KEV A;  4PE1 A;  1OOG A;  3O6B A;  3BUO B;  3ZNI A;  3I5F C;  1IJ6 A;  1XK4 C;  1KSM A;  3LLE A;  1PAL A;  4YGB B;  1QVI Y;  3CWG A;  3BQ3 A;  1OW4 A;  3H4S E;  1ALW A;  4IL1 A;  1DJX A;  1OSA A;  4WQ3 A;  3S0G A;  4M2Q A;  1K9U A;  3I5H C;  2FJY A;  1QJT A;  1J55 A;  1C7V A;  1DGU A;  1NCX A;  4MEW A;  1TOP A;  4C0L A;  1QX2 A;  1WDC C;  1XO5 A;  3KHE A;  4Q04 A;  1KK7 Z;  2LMV A;  3B88 A;  4GUK A;  3BFB A;  2ISD A;  1CB1 A;  1FF1 A;  4YGA A;  1JFJ A;  2JU0 A;  5KU1 A;  1GGZ A;  2M29 A;  4PE4 A;  4I5L B;  5D69 A;  2M3W A;  1R2U A;  4I5N B;  1SCM C;  1MR8 A;  3CYZ A;  1AUI B;  2EC6 B;  3KO0 A;  2CT9 A;  1DF0 A;  3F45 A;  5AER A;  1DMO A;  1YUR A;  3PM2 A;  3S0B A;  5I2L A;  2ZNE A;  2WCL A;  2LLS A;  1WLM A;  3B87 A;  3BOW A;  4PE0 A;  2LMT A;  2LAP A;  4CFQ A;  2I7A A;  2LVI A;  2JRF A;  2K7D A;  4A4C A;  3ICB A;  1NX1 A;  5I8N A;  3L4A A;  3FE8 A;  1TWO A;  1P28 A;  4NDC A;  2M0R A;  1BJF A;  1KFX S;  3CAB A;  3PAL A;  1CMG A;  2GTE A;  2WOS A;  4MRY A;  2PRU A;  3SG3 A;  3DVM A;  2WCB A;  1XFR A;  2PAL A;  3NSL A;  3D0Y A;  1H4B A;  1IRJ A;  2EHB A;  3I5I C;  1KK8 C;  2QEO A;  2KBM A;  3CZ2 A; 
#chains in the Genus database with same CATH homology
 4HRE E;  1L2O B;  4ORA B;  2OTG B;  1KFX L;  4R1E A;  1L7Z A;  3DF0 A;  4WQ2 A;  5HKY A;  3BUN B;  4GGF C;  1NYA A;  5DKR A;  5F6T A;  3SIB A;  2KI6 D;  1DJH A;  3E3R A;  1KK7 Y;  2AMI A;  1SL7 A;  1IG5 A;  1AVS A;  1UWO A;  3O78 A;  1BT6 A;  2KNE A;  3GOF A;  2LMU A;  2K8M B;  3EVV A;  2FOT A;  1CLB A;  2BCB A;  2KBI A;  4ZCU A;  2SCP A;  2M1U A;  3I5G C;  1S26 D;  1YRT B;  5CSJ A;  2BL0 B;  3NXA A;  1SR6 C;  4NDD A;  1GGW A;  4F0Z B;  1FBV A;  2ZFD A;  1ZFS A;  2K2F A;  4E68 A;  4A4B A;  3EK7 A;  3GK4 X;  4C0J A;  1YVL A;  2NZ0 A;  1S6J A;  5PAL A;  2F33 A;  4I5K A;  1QX5 B;  1UHN A;  4CID A;  1H8B A;  1KSO A;  2LUC A;  1K9K A;  4PE7 A;  4MN0 A;  3OB1 B;  3TS5 C;  2WC8 A;  1SPY A;  2KGB C;  1YTZ C;  2F3Y A;  4DCK A;  2MRD A;  2PMY A;  2G9B A;  2JT0 A;  1AJ5 A;  4HSZ A;  1ZAC A;  4CLN A;  5K89 A;  1TIZ A;  1CDP A;  1QIV A;  3IQQ A;  3SG4 A;  1D1O A;  1RJV A;  1S3P A;  3EVU A;  3CZT X;  1S6I A;  1TTX A;  2LE9 B;  3LK0 A;  1QLS A;  2O5G A;  3WXA A;  1IQ3 A;  1QIW A;  4L9M A;  2GGZ A;  2D8N A;  3OB2 B;  1MHO A;  3PLF B;  1OMV A;  2JQ6 A;  2MBX A;  4AQI A;  1N2D A;  2I94 A;  1CDN A;  4GPL B;  2HF5 A;  1KQM B;  4OKH A;  2KSP A;  1B7T Z;  2QPT A;  1K93 D;  1OZO A;  2H2K A;  1YX8 A;  1CFP A;  1ALV A;  1PVA A;  2GV5 A;  3OX5 A;  4PHN A;  2ZRS A;  4OV2 A;  4YI9 A;  1C07 A;  2M97 A;  1A4P A;  1JWD A;  4ORC B;  2KI4 C;  1Y6W A;  1CM1 A;  1M31 A;  3TZ1 A;  2ZN9 A;  3JTD B;  1REC A;  2KQY A;  3BXK A;  1NCY A;  3KF9 A;  5FYX A;  1FI6 A;  1G4Y R;  1J1E A;  1UUS A;  1FPW A;  2H61 C;  1AHR A;  1K96 A;  3WNX B;  5DKN A;  1QXP A;  2O60 A;  2NCP A;  1YVH A;  1F4Q A;  2Y1M A;  1LKJ A;  2TN4 A;  3VRQ A;  2LP3 A;  5CSN A;  1MQ1 A;  2BCX A;  1ODB A;  3CTN A;  1W7I B;  1SL9 A;  4GBA A;  1XFW O;  1EL4 A;  1SY9 A;  1QAT A;  1BOC A;  1WRK A;  1LIN A;  2NLN A;  1Q80 A;  1SL8 A;  4BY4 A;  4FTG A;  1B4C A;  1QS7 A;  1QV0 A;  2LVV A;  4BY5 A;  1XA5 A;  1F70 A;  2KQ6 A;  2Q4U A;  3CS1 A;  3TDZ A;  4JWQ A;  2EC6 C;  2MJW B;  3RLZ A;  2F8P A;  1UHK A;  4OVN F;  1AJ4 A;  1B7T Y;  2K61 A;  2LNK A;  4HRG A;  3SG5 A;  2V53 A;  3EK8 A;  1V1F A;  2LHL A;  1CMF A;  2HPS A;  1MXL C;  3TUY B;  1EG3 A;  4MZL A;  4OCI A;  3HCM A;  2CNP A;  1GJY A;  3FS7 A;  1UHI A;  3WHT B;  3FWB A;  3MSE B;  3A8R A;  1IGV A;  1RK9 A;  1WLZ A;  2LUX A;  3I5F B;  4PAL A;  1DJG A;  1M63 B;  5DKQ A;  2ZND A;  3VGO A;  1EJ3 A;  1DJZ A;  2K2A A;  2GGM A;  1XVJ A;  1F4O A;  2PSR A;  1M45 A;  2OS8 C;  2ZKM X;  3I5H B;  1CLM A;  1PUL A;  2WND A;  1QV1 A;  2JC2 A;  2Y4Q A;  2EGD A;  2DOQ A;  2K7O A;  3DD4 A;  3VRP A;  2SAS A;  3EVR A;  1HQV A;  1S1E A;  1JUO A;  1YR5 A;  1PSR A;  2JTZ A;  2KAY A;  1DJI A;  1Y1U A;  3QRX A;  5ER5 A;  1LVC D;  1A29 A;  2FJU B;  4YI8 A;  1YUT A;  4DUQ A;  3DVJ A;  2KAV A;  1NX3 A;  1WRZ A;  4MVF A;  2L98 A;  1GQM A;  3EK4 A;  2BL0 C;  1KFU S;  1AP4 A;  2KFH A;  1DVI A;  1RFJ A;  1NX0 A;  4MRX A;  2MLE C;  2RGI A;  4GGN A;  4ZCV A;  2I2R E;  2JT8 A;  1NIW A;  5I2Q A;  4MZJ A;  5IBW A;  2BE4 A;  1CFD A;  1QTX A;  3ZWH A;  4YGE B;  1EXR A;  4PHJ A;  1F55 A;  4USL A;  4YBH B;  2F3Z A;  1XFU O;  2M49 B;  1E8A A;  1J7P A;  2M8U A;  5KTY A;  2BE6 A;  1A75 A;  1G33 A;  1S6C A;  2I18 A;  5AAN A;  2M9G A;  2Y5I A;  2LAN A;  3AKA A;  3NSI A;  3VRN A;  1U5I B;  4ORB B;  1F54 A;  1B8R A;  1KWO B;  1K94 A;  3A4U B;  2FCD A;  2L50 A;  2WCF A;  1SYM A;  2L2E A;  1CFC A;  2E30 A;  4JQ0 D;  3VRO A;  4CFR A;  2KHN A;  3SG6 A;  1BMO A;  1FW4 A;  1UUR A;  2KI6 C;  1C7W A;  2LHI A;  1W7J B;  1KQM C;  4C0K A;  1A75 B;  1WRL A;  1JFK A;  2LLT A;  1OMD A;  1BOD A;  3JVT C;  3CR2 A;  1JBA A;  2A4J A;  2LC5 A;  2K0J A;  4FQO A;  1CTR A;  1CFF A;  1JC2 A;  4I5J A;  5AEQ A;  2NXQ A;  1M46 A;  4XJK B;  1TNX A;  2Q91 A;  4P5O E;  3JTD C;  1QAS A;  3PFV A;  3TS5 B;  3AAJ A;  1YUU A;  5HKZ A;  2L5X B;  1B8C A;  3PAT A;  2LVK A;  2L4H A;  2HET A;  4M2O A;  2K7C A;  1PRW A;  3LL8 B;  1KCY A;  2KGR A;  1QLK A;  3HX4 A;  1SW8 A;  1PK0 D;  3DVK A;  1QX7 A;  2ZN8 A;  1Y1A A;  3PN7 B;  1N0Y A;  1AK8 A;  1BR4 B;  2JZI A;  1K2H A;  4P2Y B;  2MA2 A;  1KQV A;  3LCP C;  4AOM A;  1TNW A;  1RRO A;  3CR4 X;  1ZMZ A;  5JJG A;  1CNP A;  1CDM A;  2CBL A;  1EH2 A;  2JWW A;  1RWY A;  2JTT A;  3IF7 A;  3M0W A;  2F2P A;  5I2O A;  3SG7 A;  1K9P A;  3CLN A;  4OR9 B;  2LCP A;  1SBJ A;  2JXC A;  2KYC A;  2NCO A;  2LM5 A;  1YUS A;  3RM1 A;  2M7L A;  2CTN A;  1TNP A;  2WCE A;  3C1V A;  1MF8 B;  2PVB A;  1SCV A;  3FIA A;  4WRI A;  2B1U A;  1XK4 A;  4MLW A;  1PSB A;  2KI4 B;  3WHU B;  5D7F A;  1XFV O;  4QJ5 B;  5HYD A;  4N5X A;  1B9A A;  4XYN A;  4TNC A;  2CXJ A;  2AUC A;  2QAC A;  5G08 A;  2P6B B;  2BBN A;  1Y0V H;  2AAO A;  2MLF C;  3AKB A;  4GNK B;  3TDI A;  1SRA A;  1V1G A;  1B47 A;  2JUL A;  1J7R A;  3OX6 A;  4GAO A;  1L2O C;  2VRG A;  1PVB A;  2OTG C;  4DS7 A;  1R6P A;  1YRU B;  2BKH B;  2R2I A;  1A03 A;  2JOJ A;  1WDC B;  1UHH A;  1DGV A;  1CKK A;  1TNQ A;  1WY9 A;  1LXF C;  2CCM A;  1Y1X A;  1J7Q A;  2BKI B;  4MBE A;  1JF0 A;  1B8L A;  4N1G A;  3OP0 A;  1LA0 A;  1SCM B;  2KOT A;  1BF5 A;  5CPV A;  1IKU A;  5AXI A;  4AQJ A;  5AFP A;  1MUX A;  1UHJ A;  4CPV A;  1XFX O;  2JT3 A;  1J1D A;  4GFT A;  1ZUZ A;  1NPQ A;  3BUW B;  1DTL A;  1NP8 A;  2G2B A;  1A2X A;  3SIA A;  1DF0 B;  1NCZ A;  1B1G A;  1TRF A;  2M1K B;  4QJ3 B;  4MZK A;  3GK2 A;  1U5I A;  1M39 A;  4GGF A;  2OS8 B;  1BG1 A;  1OZS A;  3CR5 X;  4ICB A;  3CGA A;  2L0P A;  1KFU L;  2Y1N A;  3O2P A;  2JPT A;  2BBM A;  2HQ8 A;  3I5I B;  1OOJ A;  1KK8 B;  1KWO C;  1K90 D;  1NSH A;  2E6W A;  3BUM B;  3SG2 A;  1TCF A;  4JPZ B;  5CSF A;  2L51 A;  2LLU A;  1BLQ A;  2KYF A;  3EKH A;  3D0Y B;  2BCA A;  2ZRT A;  1UP5 A;  1XFY O;  3PSR A;  1K95 A;  4YRU A;  1RTP 1;  5ER4 X;  4NDB A;  4XJK A;  2KFG A;  3DF0 B;  5B8I B;  1FI5 A;  1IWQ A;  1NWD A;  1S36 A;  2JNF A;  2F2O A;  2COL B;  1JSA A;  4NQG A;  4YGD B;  1VRK A;  3TDU A;  1SKT A;  2KAX A;  1F8H A;  3I5G B;  2BEC A;  2LVJ A;  1SMG A;  4DIR A;  1F71 A;  4MSP A;  1SR6 B;  4QJ4 B;  2PAS A;  1CDL A;  1BR1 B;  5J3X A;  5JOL A;  3IQO A;  1S5G Z;  3O4Y A;  4YGC B;  4DRW A;  3D10 A;  3K21 A;  5KSZ A;  1IQ5 A;  2L4I A;  1IH0 A;  1YX7 A;  4D1E A;  4UPG A;  3PM8 A;  2MHH A;  3KPX A;  4PHK A;  1QVI Z;  3VRR A;  2KDH A;  5TNC A;  3PN7 C;  3BYA A;  4U8D A;  4PCW A;  3NSO A;  1HT9 A;  1MWN A;  2KFF A;  2M7N A;  2OPO A;  1MXE A;  2LV7 A;  5GQQ C;  3AAK A;  4N1F A;  3BUX B;  3LK1 A;  5HLV A;  1XYD A;  2IS9 A;  1SNL A;  5HLO A;  3JVT B;  1DJW A;  1OQP A;  3NSK A;  4ETO A;  4PHM A;  3GK1 A;  1ZOT B;  3EKJ A;  3FWC A;  5HKW A;  3SJS A;  5BPJ A;  1BU3 A;  2JXL A;  1SK6 D;  1JF2 A;  1NUB A;  1CLL A;  1G8I A;  1TCO B;  3DVE A;  2H61 A;  1NX2 A;  2LP2 A;  5CSI A;  1DT7 B;  1CM4 A;  1K8U A;  1OMR A;  4HRH A;  4M2P A;  1TN4 A;  1XFZ O;  1EG4 A;  1J7O A;  1LA3 A;  2WOR A;  2FCE A;  2JNX A;  1DJY A;  3TUY C;  1S5G Y;  1X02 A;  1IJ5 A;  3OHM B;  1N65 A;  2MAZ A;  2HQW A;  4PDZ A;  1OE9 B;  2K7B A;  3KEV A;  4PE1 A;  3O6B A;  3BUO B;  3ZNI A;  3I5F C;  1IJ6 A;  1XK4 C;  1KSM A;  3LLE A;  1PAL A;  4YGB B;  1QVI Y;  3CWG A;  3BQ3 A;  3H4S E;  1ALW A;  4IL1 A;  1DJX A;  1OSA A;  4WQ3 A;  4M2Q A;  1K9U A;  3I5H C;  1QJT A;  1J55 A;  1C7V A;  1DGU A;  1NCX A;  4MEW A;  1TOP A;  4C0L A;  1QX2 A;  1WDC C;  1XO5 A;  3KHE A;  4Q04 A;  1KK7 Z;  2LMV A;  4GUK A;  2ISD A;  1CB1 A;  1FF1 A;  4YGA A;  1JFJ A;  2JU0 A;  5KU1 A;  1GGZ A;  2M29 A;  4PE4 A;  4I5L B;  5D69 A;  2M3W A;  1R2U A;  4I5N B;  1SCM C;  1MR8 A;  1AUI B;  2EC6 B;  3KO0 A;  2CT9 A;  1DF0 A;  3F45 A;  5AER A;  1DMO A;  1YUR A;  5I2L A;  2ZNE A;  2LLS A;  1WLM A;  3BOW A;  4PE0 A;  2LMT A;  2LAP A;  4CFQ A;  2I7A A;  2LVI A;  2JRF A;  2K7D A;  4A4C A;  3ICB A;  1NX1 A;  5I8N A;  4NDC A;  2M0R A;  1BJF A;  1KFX S;  3PAL A;  1CMG A;  2WOS A;  4MRY A;  2PRU A;  3SG3 A;  3DVM A;  2WCB A;  2PAL A;  3NSL A;  3D0Y A;  1H4B A;  1IRJ A;  2EHB A;  3I5I C;  1KK8 C;  3BOW B;  2KBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...