2F2OA

Structure of calmodulin bound to a calcineurin peptide: a new way of making an old binding mode
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
171
structure length
156
Chain Sequence
TEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAIRNKIRAIGKMARVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Calmodulin fused with calmodulin-binding domain of calcineur
publication title Structure of calmodulin bound to a calcineurin Peptide: a new way of making an old binding mode.
pubmed doi rcsb
source organism Bos taurus
total genus 60
structure length 156
sequence length 171
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2005-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2f2oA01
4PCWA 1KCYA 2FOTA 3NSIA 3TS5B 2LANA 4M2QA 4XYNA 3SG3A 2JT3A 1XVJA 2WNDA 5KSZA 1FF1A 1XYDA 1SNLA 1UHIA 2L98A 2LC5A 1CFPA 1K94A 2CNPA 2SASA 1KQMB 1N0YA 1V1FA 1WRZA 3DF0A 1PRWA 1SY9A 1F4QA 2OTGB 1AVSA 2JTZA 2V53A 2KI4C 1XK4C 1JC2A 2NXQA 1N2DA 1WLMA 3AAJA 2L50A 3TZ1A 2K7CA 1CFCA 1SYMA 3EK7A 2LUXA 3O78A 3OB1B 4MVFA 5I8NA 3TUYC 2CT9A 4UPGA 2FCEA 1DF0B 1K95A 1GGZA 3KF9A 1NCZA 1SL8A 2Q4UA 5B8IB 1SRAA 4CFRA 1IJ5A 1CDMA 1PULA 1U5IB 4MBEA 4JWQA 2L5XB 1GGWA 3BUWB 4NDDA 4PHJA 4AQJA 1CB1A 1C7WA 2K7OA 1JWDA 1QVIY 2KGRA 2I2RE 3BQ3A 1RECA 2LLTA 1KQVA 4IL1A 1VRKA 2JXCA 2A4JA 3ICBA 1PSRA 1UWOA 1DJGA 2D8NA 3MSEB 2M49B 2ZNEA 3PALA 5DKNA 1J55A 1S36A 2QPTA 3BOWB 2KI6D 2RGIA 2KAXA 1C7VA 4YGEB 4I5KA 3KHEA 1R6PA 3I5FC 4PE0A 3DVEA 1MR8A 1IWQA 1QTXA 1S6IA 2COLB 5CSNA 5AFPA 1M39A 1NYAA 2ZRSA 1SPYA 1CM1A 4FQOA 2BCXA 1L2OC 1HT9A 1CLLA 1LINA 3SG4A 2QACA 3DVKA 1TNWA 2BKHB 4GUKA 1BU3A 4ZCVA 4CFQA 2JTTA 1A2XA 2JT8A 2WORA 2KBIA 1A75B 4YGCB 2KAYA 4ORAB 1XFXO 2KGBC 1QV0A 1SL7A 1ZUZA 2G9BA 4PDZA 2KNEA 1FPWA 4WRIA 1TOPA 1UHJA 1UHHA 1DGVA 3CR5X 1ALVA 1QLKA 1QS7A 2PVBA 2CTNA 2WOSA 1F70A 3VRPA 1EL4A 1OMRA 3NSLA 4N1GA 3O2PA 1SKTA 1FBVA 3OX5A 1QX2A 2JC2A 2MLFC 5FYXA 1CMFA 1LVCD 1QIWA 3TDIA 3D0YB 4CIDA 1QIVA 3FIAA 3GK1A 5AXIA 1DJXA 2LUCA 1WDCC 3KEVA 1GQMA 3K21A 4USLA 1SL9A 4PE4A 1M63B 1A4PA 1TCOB 2LHIA 3PATA 1G8IA 5CSIA 1B4CA 1NX3A 3LL8B 2H61C 3FS7A 2GV5A 1V1GA 4GGFC 2LAPA 1JSAA 2JZIA 1L7ZA 2PSRA 1N65A 1NX0A 2M1UA 4PHNA 1YUSA 3M0WA 1WRKA 3IQOA 4F0ZB 1DF0A 1TRFA 3F45A 4ZCUA 1KK8B 2EC6B 4OV2A 2G2BA 4QJ5B 5BPJA 3OP0A 3HCMA 2E30A 4GAOA 2M0RA 1U5IA 5F6TA 1BR4B 1G4YR 1X02A 2E6WA 1J7PA 3LCPC 2MHHA 3O4YA 1EXRA 3CZTX 1KK7Z 2LV7A 1KQMC 1NX1A 3I5GB 1E8AA 1KWOB 1J1DA 3VRNA 1J7QA 1TNQA 3PN7B 3PSRA 5AEQA 1F4OA 1UUSA 2JULA 2Y5IA 2KAVA 3AAKA 1AP4A 1ZFSA 3CWGA 2ZFDA 5JJGA 3BOWA 1BG1A 1OMVA 5HKZA 1Y0VH 5CSJA 2OPOA 1JUOA 1S6JA 1GJYA 3AKAA 2PMYA 4C0LA 1YTZC 4C0JA 2K0JA 5JOLA 1MXEA 1ODBA 3PLFB 4YI9A 2AMIA 3GK4X 3WXAA 2MJWB 2FJUB 4E68A 1EJ3A 3JTDC 4OCIA 1K8UA 5I2QA 3SG7A 3CR4X 4NDCA 1TN4A 1MUXA 4M2PA 2M1KB 1DTLA 2LNKA 1A75A 4TNCA 5ER5A 1M45A 1OZSA 1S3PA 3BYAA 3NSOA 2PALA 1MF8B 1FI6A 1AJ5A 2F2PA 1YRTB 4GFTA 1CNPA 2NZ0A 2F8PA 2K2FA 2LMVA 1J7OA 2JQ6A 4MZLA 1K9UA 4N5XA 3H4SE 1M46A 2HF5A 2NCOA 3DVMA 3ZNIA 3SIBA 1UHKA 1ZOTB 2BL0B 5I2OA 1AHRA 1PVBA 3D0YA 2LLSA 4I5JA 5TNCA 4NDBA 1SCMB 1B9AA 1RFJA 3GOFA 1CM4A 4JQ0D 3LLEA 1K2HA 4NQGA 1DJHA 3PM8A 2KQYA 2L0PA 2JT0A 1B7TY 1PSBA 1TIZA 1OOJA 1MHOA 2H2KA 2OS8B 3NXAA 2F3ZA 1BODA 4A4CA 2M97A 3AKBA 2ISDA 4A4BA 1OMDA 1NIWA 1S5GY 2HETA 3BUMB 5HLOA 2IS9A 2AAOA 2LE9B 2MRDA 1NUBA 3DVJA 4DS7A 1KFUS 1QASA 4MN0A 2JU0A 3OHMB 2JOJA 2LMUA 2KFGA 1SW8A 2HQWA 4MEWA 4WQ3A 2LVKA 3I5IB 1IH0A 4C0KA 1XFZO 1YVLA 2M7NA 2WCEA 4HSZA 3TDUA 3VRRA 1RWYA 3WNXB 4MSPA 1AK8A 2I94A 2BKIB 1LXFC 1MXLC 1JFJA 1MQ1A 3I5FB 5J3XA 5AERA 2KI6C 2Y1NA 4PHMA 2B1UA 1PK0D 2KYCA 2LHLA 3CGAA 3CS1A 1B8RA 3WHTB 4AOMA 1LA0A 5HKYA 1IJ6A 1QVIZ 1K93D 1KSMA 2NLNA 4PHKA 1PVAA 1IGVA 1TCFA 4YI8A 1SMGA 1XFVO 1CTRA 1K96A 4HRHA 2LVJA 3FWCA 4DIRA 3JVTC 1M31A 1CFFA 2CXJA 2M3WA 2EC6C 2ZN8A 5DKQA 2NCPA 3EVRA 3BXKA 1K9PA 1YRUB 4MZKA 1JFKA 5ER4X 3OX6A 2Y4QA 3SJSA 3I5HB 2CBLA 4AQIA 4N1FA 1DMOA 4ETOA 4ORCB 1Q80A 1B7TZ 2JXLA 2KQ6A 3SG5A 3TS5C 1NX2A 3EVUA 1BT6A 1QJTA 1WLZA 4MLWA 1F55A 3DD4A 1QV1A 1S1EA 2KSPA 3I5GC 4R1EA 2L4IA 1UHNA 1WDCB 1F8HA 1DJZA 3TDZA 1JF0A 3PN7C 2LM5A 2AUCA 1NCYA 3EKJA 1S5GZ 1LA3A 3BUNB 2OTGC 1WRLA 2F33A 1XK4A 1F54A 2ZKMX 4GNKB 4XJKB 3CTNA 2ZN9A 2O60A 4U8DA 5IBWA 1OZOA 1BMOA 1TNPA 1YX7A 2LCPA 2TN4A 1SR6B 3BUXB 3E3RA 2FCDA 1ZMZA 2R2IA 1KFUL 3RLZA 5KTYA 2K7DA 1BF5A 2LLUA 1CDPA 4YRUA 1IQ5A 2Y1MA 5HLVA 2JRFA 1SBJA 4DRWA 1DVIA 4D1EA 3EK8A 1FI5A 3BUOB 2WCFA 1CMGA 5CPVA 1J7RA 3KPXA 4GPLB 2DOQA 4QJ3B 1QXPA 5K89A 2L51A 1ALWA 1IG5A 2K7BA 1RJVA 4ICBA 2KYFA 2BL0C 2KBMA 1AUIB 1YURA 1K9KA 2BECA 2JPTA 1XA5A 2BE4A 5CSFA 4JPZB 1CDNA 3NSKA 4YGAA 3LK0A 3EKHA 2M8UA 1IKUA 1SCMC 3O6BA 4GBAA 2KI4B 1C07A 1CKKA 1YUTA 1UP5A 1MWNA 4HREE 1NP8A 2KDHA 1IQ3A 4MRXA 2BCAA 3A8RA 1F71A 4DUQA 1DJWA 1DGUA 3TUYB 1S26D 3CLNA 2K8MB 2OS8C 3JTDB 4BY5A 4YGDB 2ZNDA 3IQQA 1CFDA 1B8CA 1NCXA 2LMTA 2M9GA 4P2YB 1BR1B 1S6CA 4P5OE 5D7FA 3VRQA 4OR9B 5DKRA 1TTXA 3GK2A 1YVHA 1RROA 2JNFA 2BE6A 5I2LA 2Q91A 4OKHA 1XFUO 4GGNA 1KFXS 1QLSA 3DF0B 2P6BB 4PE7A 1K90D 3I5IC 1B8LA 1B1GA 1XFYO 1NSHA 1OSAA 1Y6WA 1BLQA 2LVIA 4CLNA 1UURA 2M29A 3D10A 4CPVA 2LVVA 4I5LB 1NWDA 2BBNA 1R2UA 3FWBA 1DT7B 1TNXA 2PASA 4PALA 1A29A 5PALA 3VROA 1DJIA 1RTP1 2BCBA 3PFVA 2SCPA 3SG2A 1WY9A 1EH2A 1B47A 2EGDA 2H61A 4GGFA 2LP2A 3HX4A 1KK7Y 1YX8A 1JBAA 2KFFA 1L2OB 3C1VA 5GQQC 4XJKA 1AJ4A 2L4HA 3SIAA 4ORBB 5HKWA 2JWWA 4PE1A 1KSOA 1CLMA 2PRUA 3CR2A 1CLBA 1IRJA 4DCKA 4WQ2A 2BBMA 1QX7A 3VGOA 3I5HC 4MRYA 1LKJA 5HYDA 1EG4A 1FW4A 1KK8C 1CDLA 1Y1XA 3KO0A 3A4UB 4I5NB 2MA2A 2ZRTA 1H8BA 2KHNA 2GGMA 1D1OA 1A03A 4L9MA 2I18A 2LP3A 4YBHB 1PALA 1XO5A 2KOTA 1G33A 1DJYA 3RM1A 2VRGA 1YUUA 1YR5A 3EK4A 1W7IB 5D69A 1ZACA 1Y1UA 3LK1A 2F2OA 1NPQA 3WHUB 5G08A 4Q04A 4HRGA 3IF7A 2K61A 1KWOC 2L2EA 1XFWO 2CCMA 2WC8A 4BY4A 2JNXA 2HPSA 2K2AA 3ZWHA 1H4BA 2MAZA 2WCBA 3SG6A 2GGZA 1RK9A 1SK6D 2EHBA 3OB2B 1W7JB 2F3YA 1BJFA 1SR6C 3JVTB 1SCVA 2M7LA 2HQ8A 1Y1AA 1BOCA 1OQPA 1EG3A 2O5GA 3QRXA 2MBXA 4QJ4B 1QX5B 2KFHA 4FTGA 1HQVA 1KFXL 1OE9B 4MZJA 3EVVA 1QATA 4YGBB 5KU1A 1J1EA 2I7AA 1JF2A 4M2OA 4OVNF 5AANA 2MLEC
chains in the Genus database with same CATH superfamily
4PCWA 2WCHA 2FOTA 3NSIA 3TS5B 2LANA 4M2QA 4XYNA 3SG3A 1KCYA 1C3ZA 1XVJA 2JT3A 1P28A 2WNDA 5KSZA 1FF1A 3S0EA 1XYDA 1SNLA 1UHIA 2L98A 2LC5A 1C3YA 2KLEA 1ORGA 1CFPA 1K94A 2CNPA 2SASA 1KQMB 1N0YA 1V1FA 1WRZA 3DF0A 1PRWA 1SY9A 1F4QA 2OTGB 1AVSA 2JTZA 1TUJA 2V53A 2KI4C 1XK4C 2P71A 2NXQA 1N2DA 1WLMA 2WC5A 3D73A 1JC2A 1DC1A 3AAJA 2L50A 3TZ1A 2K7CA 3DYEA 1CFCA 3NHTA 1SYMA 3EK7A 2LUXA 3O78A 3OB1B 4MVFA 5I8NA 3TUYC 2CT9A 4UPGA 2FCEA 2WCKA 1DF0B 1K95A 1GGZA 3KF9A 1NCZA 1SL8A 2Q4UA 5B8IB 1SRAA 4CFRA 3S0DA 1IJ5A 1CDMA 1PULA 2WC6A 1U5IB 4MBEA 4JWQA 2L5XB 1GGWA 3BUWB 4NDDA 4PHJA 4AQJA 1CB1A 1C7WA 2K7OA 3CZ1A 1QVIY 2KGRA 2I2RE 3BQ3A 3OGNA 3B7AA 1JWDA 1RECA 2LLTA 1KQVA 2L2CA 4IL1A 1VRKA 1OOHA 2JXCA 2A4JA 3B88A 1PSRA 3ICBA 4OZDA 1UWOA 1DJGA 2D8NA 3MSEB 2M49B 2ZNEA 3PALA 5DKNA 1J55A 1S36A 2QPTA 3BOWB 2KI6D 2RGIA 2GTEA 1Z2CB 2KAXA 1C7VA 4YGEB 4I5KA 3KHEA 1R6PA 3I5FC 4FQTA 4PE0A 3DVEA 1MR8A 1IWQA 1QTXA 1S6IA 2COLB 5CSNA 5AFPA 1M39A 1NYAA 2ZRSA 1SPYA 1CM1A 4FQOA 1L2OC 2BCXA 1HT9A 1CLLA 1LINA 3SG4A 2QACA 3DVKA 1TNWA 2BKHB 4GUKA 1BU3A 4ZCVA 4CFQA 2JTTA 1A2XA 2JT8A 2WORA 2KBIA 1A75B 4YGCB 2KAYA 4ORAB 1XFXO 2KGBC 1QV0A 1SL7A 1ZUZA 2G9BA 4PDZA 2KNEA 3CYZA 1FPWA 4WRIA 1TOPA 1UHJA 1UHHA 1DGVA 3CR5X 1ALVA 1QLKA 1QS7A 2QEVA 3DXLA 2PVBA 2CTNA 2WOSA 1F70A 3VRPA 1EL4A 1OMRA 3NSLA 4N1GA 3DZTA 3O2PA 1SKTA 4INWA 1FBVA 3OX5A 1QX2A 2JC2A 2MLFC 5FYXA 1CMFA 1LVCD 1QIWA 3TDIA 3D0YB 4CIDA 1QIVA 3FIAA 3GK1A 5AXIA 1DJXA 3B86A 2LUCA 1WDCC 3KEVA 1GQMA 3K21A 4USLA 1SL9A 4PE4A 1M63B 1A4PA 1TCOB 2LHIA 3PATA 1G8IA 5CSIA 1B4CA 1NX3A 3LL8B 4JKTA 2H61C 3FS7A 2GV5A 1V1GA 4GGFC 2LAPA 1JSAA 2JZIA 1L7ZA 2PSRA 1DQEA 1IIOA 1N65A 1NX0A 2M1UA 4PHNA 1YUSA 3M0WA 1WRKA 3IQOA 4F0ZB 1LS8A 1DF0A 1TRFA 3F45A 4ZCUA 1KK8B 2EC6B 2L5YA 2G2BA 4OV2A 4QJ5B 5BPJA 3OP0A 3HCMA 2E30A 4GAOA 1OOIX 3NHIA 2M0RA 3IVTA 1U5IA 5F6TA 1BR4B 1G4YR 1X02A 2E6WA 1J7PA 3LCPC 2MHHA 3O4YA 3SS3A 3BJHA 1EXRA 3CZTX 3L4AA 1KK7Z 2LV7A 1KQMC 3CZ2A 1NX1A 3V2LA 3I5GB 1E8AA 1KWOB 3K1EA 1J1DA 3VRNA 1J7QA 1TNQA 3PN7B 3PSRA 5AEQA 1F4OA 1UUSA 2JULA 2Y5IA 4PT1A 2KAVA 3AAKA 1AP4A 1ZFSA 3CWGA 2ZFDA 5JJGA 3BOWA 1BG1A 1OMVA 5HKZA 1Y0VH 5CSJA 2OPOA 1JUOA 1S6JA 1GJYA 3AKAA 2PMYA 3UNWA 1YTZC 4C0LA 4C0JA 2K0JA 5JOLA 1MXEA 1ODBA 3PLFB 4INXA 3O4XA 2WCJA 4YI9A 2AMIA 3GK4X 3WXAA 2MJWB 2FJUB 4E68A 1EJ3A 3JTDC 4OCIA 5FI7A 3VB1A 1W9ZA 1K8UA 5I2QA 3SG7A 3CR4X 4NDCA 1TN4A 1MUXA 4M2PA 2M1KB 1DTLA 2LNKA 1A75A 4TNCA 5EL2A 5ER5A 3D76A 1M45A 1OZSA 1S3PA 3BYAA 3NSOA 2PALA 3CZ0A 1MF8B 1FI6A 1AJ5A 2F2PA 1YRTB 4GFTA 1CNPA 2NZ0A 2F8PA 2K2FA 2LMVA 1J7OA 2JQ6A 4MZLA 1K9UA 4N5XA 3L4LA 3H4SE 2ERBA 1M46A 2HF5A 3UO9A 2NCOA 3DVMA 3ZNIA 3SIBA 1UHKA 1ZOTB 2BL0B 3S0BA 5I2OA 1AHRA 1PVBA 3D0YA 2LLSA 4I5JA 5TNCA 4NDBA 2YGUA 1SSEB 1SCMB 2PQLA 1B9AA 1RFJA 3GOFA 1CM4A 4JQ0D 3FE6A 3LLEA 1K2HA 2QEBA 4NQGA 1DJHA 3PM8A 2KQYA 2L0PA 2JT0A 1B7TY 1PSBA 1TIZA 1OOJA 5DICA 1TWOA 1MHOA 2H2KA 2OS8B 3NXAA 2F3ZA 1BODA 3D75A 2M97A 4A4CA 3AKBA 2ISDA 1GM0A 4A4BA 1OMDA 1NIWA 1S5GY 2HETA 3BUMB 5HLOA 2IS9A 2AAOA 2LE9B 2MRDA 1NUBA 3DVJA 4DS7A 1KFUS 1QASA 4MN0A 2JU0A 3OHMB 2JOJA 2LMUA 2KFGA 1SW8A 2HQWA 4MEWA 3DY9A 4WQ3A 2LVKA 3I5IB 1IH0A 4C0KA 1XFZO 1YVLA 2M7NA 2WCEA 3EG5B 4HSZA 3TDUA 3VRRA 1RWYA 3WNXB 4MSPA 1AK8A 2I94A 2BKIB 1LXFC 1MXLC 1JFJA 1MQ1A 3I5FB 5J3XA 5AERA 2KI6C 1OOFA 2Y1NA 4PHMA 2B1UA 1PK0D 2KYCA 2LHLA 3CGAA 3CS1A 1B8RA 3WHTB 4AOMA 1LA0A 5HKYA 1IJ6A 1QVIZ 1K93D 1KSMA 1XFRA 2NLNA 1PVAA 4KYNA 1IGVA 4PHKA 5I94A 1TCFA 4YI8A 1SMGA 1XFVO 1CTRA 1K96A 4HRHA 2LVJA 3FWCA 4DIRA 3JVTC 1M31A 2BNXA 1CFFA 2CXJA 2M3WA 2EC6C 2ZN8A 5DKQA 2NCPA 3EVRA 3BXKA 1K9PA 1YRUB 4MZKA 1JFKA 5ER4X 3OX6A 2Y4QA 3SJSA 3I5HB 2CBLA 4AQIA 4N1FA 1DMOA 3R1PA 5HL1A 4ETOA 4ORCB 3B6XA 1Q80A 1B7TZ 2JXLA 2KQ6A 3SG5A 3TS5C 1NX2A 3EVUA 1BT6A 1QJTA 1WLZA 4MLWA 1F55A 3DD4A 1QV1A 1S1EA 2KSPA 3I5GC 4R1EA 2L4IA 1UHNA 1WDCB 1F8HA 1DJZA 3TDZA 1JF0A 3PN7C 2LM5A 2WCMA 2AUCA 1NCYA 3EKJA 1S5GZ 1LA3A 2BAPA 3BUNB 2OTGC 1WRLA 2F33A 1XK4A 3QMEA 1F54A 5FI2A 2ZKMX 4GNKB 3Q8IA 4XJKB 3CTNA 2ZN9A 2O60A 4U8DA 5FI6A 1OZOA 1TNPA 1BMOA 1T14A 5IBWA 1YX7A 2LCPA 2TN4A 1SR6B 3BUXB 3E3RA 2FCDA 1ZMZA 2R2IA 1KFUL 3RLZA 5KTYA 2K7DA 1BF5A 2LLUA 1CDPA 3PM2A 4YRUA 1IQ5A 2FJYA 3FE8A 2Y1MA 5HLVA 2JRFA 1SBJA 3OBVA 4DRWA 1DVIA 4D1EA 3EK8A 1FI5A 1DELA 3D77A 1OOGA 3BUOB 2WCFA 3BFAA 5D3OA 1CMGA 5CPVA 3B87A 1J7RA 3KPXA 4GPLB 3S0GA 3SS5A 2DOQA 4QJ3B 1QXPA 5K89A 2L51A 3SS4A 1ALWA 1IG5A 2K7BA 1RJVA 1QWVA 4ICBA 2KYFA 2BL0C 2KBMA 1AUIB 1YURA 1K9KA 2BECA 2JPTA 1XA5A 2BE4A 5CSFA 4JPZB 1CDNA 3NSKA 4YGAA 3LK0A 1DEKA 3EKHA 2M8UA 1IKUA 1SCMC 3O6BA 2JPOA 2KI4B 4GBAA 1C07A 1YUTA 1UP5A 1MWNA 4HREE 1CKKA 1NP8A 2H8VA 2KDHA 1IQ3A 4MRXA 2BCAA 3A8RA 3S0AA 1F71A 4DUQA 1DJWA 1DGUA 3TUYB 1S26D 3CLNA 2K8MB 2OS8C 3JTDB 4BY5A 4YGDB 4F7FA 2ZNDA 3IQQA 1CFDA 1B8CA 1NCXA 2LMTA 2M9GA 4P2YB 1BR1B 1S6CA 4P5OE 5D7FA 3VRQA 4OR9B 5DKRA 1TTXA 3GK2A 1YVHA 1RROA 4JD9A 2JNFA 2BE6A 5I2LA 2P70A 2Q91A 4OKHA 2QEHA 1XFUO 4GGNA 1KFXS 1QLSA 3DF0B 2KPHA 2P6BB 4PE7A 1K90D 1OW4A 3I5IC 3R72A 3D74A 1B8LA 1B1GA 1XFYO 1NSHA 1OSAA 1Y6WA 3BFBA 3FE9A 1BLQA 2LVIA 4CLNA 2QEOA 1UURA 2M29A 3D10A 4CPVA 3RZSA 2LVVA 4I5LB 3CABA 1NWDA 2BBNA 1R2UA 3FWBA 1DT7B 1TNXA 2PASA 4PALA 1A29A 5PALA 3VROA 1DJIA 1RTP1 2BCBA 3PFVA 2SCPA 3SG2A 1WY9A 3R1OA 1EH2A 1B47A 3R1VA 2EGDA 2H61A 4GGFA 2LP2A 3HX4A 1KK7Y 1YX8A 1JBAA 2KFFA 1L2OB 3C1VA 5GQQC 4XJKA 1AJ4A 2L4HA 3SIAA 4ORBB 5HKWA 2JWWA 4PE1A 1KSOA 1CLMA 2PRUA 3CR2A 1CLBA 1IRJA 4DCKA 4WQ2A 2BBMA 1QX7A 3VGOA 3I5HC 4MRYA 1LKJA 5HYDA 3D78A 2KLDA 1EG4A 1FW4A 1KK8C 2QDIA 1CDLA 1Y1XA 3KO0A 3N7HA 3A4UB 2WCLA 3PJIA 4I5NB 2MA2A 2ZRTA 1H8BA 2KHNA 2GGMA 1D1OA 1A03A 4L9MA 2I18A 1Z4HA 2LP3A 4YBHB 1PALA 1XO5A 2KOTA 1G33A 1DJYA 3RM1A 2K60A 2VRGA 1YUUA 1YR5A 3L47A 3EK4A 1W7IB 5D69A 1ZACA 1Y1UA 3LK1A 2F2OA 1NPQA 3WHUB 5G08A 4Q04A 4HRGA 1TUZA 2PYQA 2K61A 1KWOC 2L2EA 1XFWO 2CCMA 2WC8A 3IF7A 3NGVA 2JNXA 2HPSA 2K2AA 4BY4A 3ZWHA 1H4BA 2MAZA 2WCBA 3S0FA 3SG6A 2GGZA 1RK9A 1SK6D 2EHBA 3OB2B 1W7JB 2F3YA 1BJFA 1SR6C 3JVTB 1SCVA 2M7LA 2HQ8A 1Y1AA 3BFHA 3CDNA 1BOCA 1OQPA 1EG3A 2O5GA 3QRXA 2MBXA 4QJ4B 1QX5B 2KFHA 4FTGA 1HQVA 1KFXL 1OE9B 4MZJA 3EVVA 1QATA 4YGBB 5KU1A 1J1EA 2I7AA 4IJ7A 1JF2A 4M2OA 4OVNF 5AANA 2MLEC
chains in the Genus database with same CATH topology
4PCWA 1KCYA 2FOTA 3NSIA 3TS5B 2LANA 4M2QA 4XYNA 3SG3A 2JT3A 1XVJA 2WNDA 5KSZA 1FF1A 1XYDA 1SNLA 1UHIA 2L98A 2LC5A 1CFPA 1K94A 2CNPA 2SASA 1KQMB 1N0YA 1V1FA 1WRZA 3DF0A 1PRWA 1SY9A 1F4QA 2OTGB 1AVSA 2JTZA 2V53A 2KI4C 1XK4C 1JC2A 2NXQA 1N2DA 1WLMA 3AAJA 2L50A 3TZ1A 2K7CA 1CFCA 1SYMA 3EK7A 2LUXA 3O78A 3OB1B 4MVFA 5I8NA 3TUYC 2CT9A 4UPGA 2FCEA 1DF0B 1K95A 1GGZA 3KF9A 1NCZA 1SL8A 2Q4UA 5B8IB 1SRAA 4CFRA 1IJ5A 1CDMA 1PULA 1U5IB 4MBEA 4JWQA 2L5XB 1GGWA 3BUWB 4NDDA 4PHJA 4AQJA 1CB1A 1C7WA 2K7OA 1JWDA 1QVIY 2KGRA 2I2RE 3BQ3A 1RECA 2LLTA 1KQVA 4IL1A 1VRKA 2JXCA 2A4JA 3ICBA 1PSRA 1UWOA 1DJGA 2D8NA 3MSEB 2M49B 2ZNEA 3PALA 5DKNA 1J55A 1S36A 2QPTA 3BOWB 2KI6D 2RGIA 2KAXA 1C7VA 4YGEB 4I5KA 3KHEA 1R6PA 3I5FC 4PE0A 3DVEA 1MR8A 1IWQA 1QTXA 1S6IA 2COLB 5CSNA 5AFPA 1M39A 1NYAA 2ZRSA 1SPYA 1CM1A 4FQOA 2BCXA 1L2OC 1HT9A 1CLLA 1LINA 3SG4A 2QACA 3DVKA 1TNWA 2BKHB 4GUKA 1BU3A 4ZCVA 4CFQA 2JTTA 1A2XA 2JT8A 2WORA 2KBIA 1A75B 4YGCB 2KAYA 4ORAB 1XFXO 2KGBC 1QV0A 1SL7A 1ZUZA 2G9BA 4PDZA 2KNEA 1FPWA 4WRIA 1TOPA 1UHJA 1UHHA 1DGVA 3CR5X 1ALVA 1QLKA 1QS7A 2PVBA 2CTNA 2WOSA 1F70A 3VRPA 1EL4A 1OMRA 3NSLA 4N1GA 3O2PA 1SKTA 1FBVA 3OX5A 1QX2A 2JC2A 2MLFC 5FYXA 1CMFA 1LVCD 1QIWA 3TDIA 3D0YB 4CIDA 1QIVA 3FIAA 3GK1A 5AXIA 1DJXA 2LUCA 1WDCC 3KEVA 1GQMA 3K21A 4USLA 1SL9A 4PE4A 1M63B 1A4PA 1TCOB 2LHIA 3PATA 1G8IA 5CSIA 1B4CA 1NX3A 3LL8B 2H61C 3FS7A 2GV5A 1V1GA 4GGFC 2LAPA 1JSAA 2JZIA 1L7ZA 2PSRA 1N65A 1NX0A 2M1UA 4PHNA 1YUSA 3M0WA 1WRKA 3IQOA 4F0ZB 1DF0A 1TRFA 3F45A 4ZCUA 1KK8B 2EC6B 4OV2A 2G2BA 4QJ5B 5BPJA 3OP0A 3HCMA 2E30A 4GAOA 2M0RA 1U5IA 5F6TA 1BR4B 1G4YR 1X02A 2E6WA 1J7PA 3LCPC 2MHHA 3O4YA 1EXRA 3CZTX 1KK7Z 2LV7A 1KQMC 1NX1A 3I5GB 1E8AA 1KWOB 1J1DA 3VRNA 1J7QA 1TNQA 3PN7B 3PSRA 5AEQA 1F4OA 1UUSA 2JULA 2Y5IA 2KAVA 3AAKA 1AP4A 1ZFSA 3CWGA 2ZFDA 5JJGA 3BOWA 1BG1A 1OMVA 5HKZA 1Y0VH 5CSJA 2OPOA 1JUOA 1S6JA 1GJYA 3AKAA 2PMYA 4C0LA 1YTZC 4C0JA 2K0JA 5JOLA 1MXEA 1ODBA 3PLFB 4YI9A 2AMIA 3GK4X 3WXAA 2MJWB 2FJUB 4E68A 1EJ3A 3JTDC 4OCIA 1K8UA 5I2QA 3SG7A 3CR4X 4NDCA 1TN4A 1MUXA 4M2PA 2M1KB 1DTLA 2LNKA 1A75A 4TNCA 5ER5A 1M45A 1OZSA 1S3PA 3BYAA 3NSOA 2PALA 1MF8B 1FI6A 1AJ5A 2F2PA 1YRTB 4GFTA 1CNPA 2NZ0A 2F8PA 2K2FA 2LMVA 1J7OA 2JQ6A 4MZLA 1K9UA 4N5XA 3H4SE 1M46A 2HF5A 2NCOA 3DVMA 3ZNIA 3SIBA 1UHKA 1ZOTB 2BL0B 5I2OA 1AHRA 1PVBA 3D0YA 2LLSA 4I5JA 5TNCA 4NDBA 1SCMB 1B9AA 1RFJA 3GOFA 1CM4A 4JQ0D 3LLEA 1K2HA 4NQGA 1DJHA 3PM8A 2KQYA 2L0PA 2JT0A 1B7TY 1PSBA 1TIZA 1OOJA 1MHOA 2H2KA 2OS8B 3NXAA 2F3ZA 1BODA 4A4CA 2M97A 3AKBA 2ISDA 4A4BA 1OMDA 1NIWA 1S5GY 2HETA 3BUMB 5HLOA 2IS9A 2AAOA 2LE9B 2MRDA 1NUBA 3DVJA 4DS7A 1KFUS 1QASA 4MN0A 2JU0A 3OHMB 2JOJA 2LMUA 2KFGA 1SW8A 2HQWA 4MEWA 4WQ3A 2LVKA 3I5IB 1IH0A 4C0KA 1XFZO 1YVLA 2M7NA 2WCEA 4HSZA 3TDUA 3VRRA 1RWYA 3WNXB 4MSPA 1AK8A 2I94A 2BKIB 1LXFC 1MXLC 1JFJA 1MQ1A 3I5FB 5J3XA 5AERA 2KI6C 2Y1NA 4PHMA 2B1UA 1PK0D 2KYCA 2LHLA 3CGAA 3CS1A 1B8RA 3WHTB 4AOMA 1LA0A 5HKYA 1IJ6A 1QVIZ 1K93D 1KSMA 2NLNA 4PHKA 1PVAA 1IGVA 1TCFA 4YI8A 1SMGA 1XFVO 1CTRA 1K96A 4HRHA 2LVJA 3FWCA 4DIRA 3JVTC 1M31A 1CFFA 2CXJA 2M3WA 2EC6C 2ZN8A 5DKQA 2NCPA 3EVRA 3BXKA 1K9PA 1YRUB 4MZKA 1JFKA 5ER4X 3OX6A 2Y4QA 3SJSA 3I5HB 2CBLA 4AQIA 4N1FA 1DMOA 4ETOA 4ORCB 1Q80A 1B7TZ 2JXLA 2KQ6A 3SG5A 3TS5C 1NX2A 3EVUA 1BT6A 1QJTA 1WLZA 4MLWA 1F55A 3DD4A 1QV1A 1S1EA 2KSPA 3I5GC 4R1EA 2L4IA 1UHNA 1WDCB 1F8HA 1DJZA 3TDZA 1JF0A 3PN7C 2LM5A 2AUCA 1NCYA 3EKJA 1S5GZ 1LA3A 3BUNB 2OTGC 1WRLA 2F33A 1XK4A 1F54A 2ZKMX 4GNKB 4XJKB 3CTNA 2ZN9A 2O60A 4U8DA 5IBWA 1OZOA 1BMOA 1TNPA 1YX7A 2LCPA 2TN4A 1SR6B 3BUXB 3E3RA 2FCDA 1ZMZA 2R2IA 1KFUL 3RLZA 5KTYA 2K7DA 1BF5A 2LLUA 1CDPA 4YRUA 1IQ5A 2Y1MA 5HLVA 2JRFA 1SBJA 4DRWA 1DVIA 4D1EA 3EK8A 1FI5A 3BUOB 2WCFA 1CMGA 5CPVA 1J7RA 3KPXA 4GPLB 2DOQA 4QJ3B 1QXPA 5K89A 2L51A 1ALWA 1IG5A 2K7BA 1RJVA 4ICBA 2KYFA 2BL0C 2KBMA 1AUIB 1YURA 1K9KA 2BECA 2JPTA 1XA5A 2BE4A 5CSFA 4JPZB 1CDNA 3NSKA 4YGAA 3LK0A 3EKHA 2M8UA 1IKUA 1SCMC 3O6BA 4GBAA 2KI4B 1C07A 1CKKA 1YUTA 1UP5A 1MWNA 4HREE 1NP8A 2KDHA 1IQ3A 4MRXA 2BCAA 3A8RA 1F71A 4DUQA 1DJWA 1DGUA 3TUYB 1S26D 3CLNA 2K8MB 2OS8C 3JTDB 4BY5A 4YGDB 2ZNDA 3IQQA 1CFDA 1B8CA 1NCXA 2LMTA 2M9GA 4P2YB 1BR1B 1S6CA 4P5OE 5D7FA 3VRQA 4OR9B 5DKRA 1TTXA 3GK2A 1YVHA 1RROA 2JNFA 2BE6A 5I2LA 2Q91A 4OKHA 1XFUO 4GGNA 1KFXS 1QLSA 3DF0B 2P6BB 4PE7A 1K90D 3I5IC 1B8LA 1B1GA 1XFYO 1NSHA 1OSAA 1Y6WA 1BLQA 2LVIA 4CLNA 1UURA 2M29A 3D10A 4CPVA 2LVVA 4I5LB 1NWDA 2BBNA 1R2UA 3FWBA 1DT7B 1TNXA 2PASA 4PALA 1A29A 5PALA 3VROA 1DJIA 1RTP1 2BCBA 3PFVA 2SCPA 3SG2A 1WY9A 1EH2A 1B47A 2EGDA 2H61A 4GGFA 2LP2A 3HX4A 1KK7Y 1YX8A 1JBAA 2KFFA 1L2OB 3C1VA 5GQQC 4XJKA 1AJ4A 2L4HA 3SIAA 4ORBB 5HKWA 2JWWA 4PE1A 1KSOA 1CLMA 2PRUA 3CR2A 1CLBA 1IRJA 4DCKA 4WQ2A 2BBMA 1QX7A 3VGOA 3I5HC 4MRYA 1LKJA 5HYDA 1EG4A 1FW4A 1KK8C 1CDLA 1Y1XA 3KO0A 3A4UB 4I5NB 2MA2A 2ZRTA 1H8BA 2KHNA 2GGMA 1D1OA 1A03A 4L9MA 2I18A 2LP3A 4YBHB 1PALA 1XO5A 2KOTA 1G33A 1DJYA 3RM1A 2VRGA 1YUUA 1YR5A 3EK4A 1W7IB 5D69A 1ZACA 1Y1UA 3LK1A 2F2OA 1NPQA 3WHUB 5G08A 4Q04A 4HRGA 3IF7A 2K61A 1KWOC 2L2EA 1XFWO 2CCMA 2WC8A 4BY4A 2JNXA 2HPSA 2K2AA 3ZWHA 1H4BA 2MAZA 2WCBA 3SG6A 2GGZA 1RK9A 1SK6D 2EHBA 3OB2B 1W7JB 2F3YA 1BJFA 1SR6C 3JVTB 1SCVA 2M7LA 2HQ8A 1Y1AA 1BOCA 1OQPA 1EG3A 2O5GA 3QRXA 2MBXA 4QJ4B 1QX5B 2KFHA 4FTGA 1HQVA 1KFXL 1OE9B 4MZJA 3EVVA 1QATA 4YGBB 5KU1A 1J1EA 2I7AA 1JF2A 4M2OA 4OVNF 5AANA 2MLEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PCW A;  1KCY A;  2FOT A;  3NSI A;  3TS5 B;  2LAN A;  4M2Q A;  4XYN A;  3SG3 A;  2JT3 A;  1XVJ A;  2WND A;  5KSZ A;  1FF1 A;  1XYD A;  1SNL A;  1UHI A;  2L98 A;  2LC5 A;  1CFP A;  1K94 A;  2CNP A;  2SAS A;  1KQM B;  1N0Y A;  1V1F A;  1WRZ A;  3DF0 A;  1PRW A;  1SY9 A;  1F4Q A;  2OTG B;  1AVS A;  2JTZ A;  2V53 A;  2KI4 C;  1XK4 C;  1JC2 A;  2NXQ A;  1N2D A;  1WLM A;  3AAJ A;  2L50 A;  3TZ1 A;  2K7C A;  1CFC A;  1SYM A;  3EK7 A;  2LUX A;  3O78 A;  3OB1 B;  4MVF A;  5I8N A;  3TUY C;  2CT9 A;  4UPG A;  2FCE A;  1DF0 B;  1K95 A;  1GGZ A;  3KF9 A;  1NCZ A;  1SL8 A;  2Q4U A;  5B8I B;  1SRA A;  4CFR A;  1IJ5 A;  1CDM A;  1PUL A;  1U5I B;  4MBE A;  4JWQ A;  2L5X B;  1GGW A;  3BUW B;  4NDD A;  4PHJ A;  4AQJ A;  1CB1 A;  1C7W A;  2K7O A;  1JWD A;  1QVI Y;  2KGR A;  2I2R E;  3BQ3 A;  1REC A;  2LLT A;  1KQV A;  4IL1 A;  1VRK A;  2JXC A;  2A4J A;  3ICB A;  1PSR A;  1UWO A;  1DJG A;  2D8N A;  3MSE B;  2M49 B;  2ZNE A;  3PAL A;  5DKN A;  1J55 A;  1S36 A;  2QPT A;  3BOW B;  2KI6 D;  2RGI A;  2KAX A;  1C7V A;  4YGE B;  4I5K A;  3KHE A;  1R6P A;  3I5F C;  4PE0 A;  3DVE A;  1MR8 A;  1IWQ A;  1QTX A;  1S6I A;  2COL B;  5CSN A;  5AFP A;  1M39 A;  1NYA A;  2ZRS A;  1SPY A;  1CM1 A;  4FQO A;  2BCX A;  1L2O C;  1HT9 A;  1CLL A;  1LIN A;  3SG4 A;  2QAC A;  3DVK A;  1TNW A;  2BKH B;  4GUK A;  1BU3 A;  4ZCV A;  4CFQ A;  2JTT A;  1A2X A;  2JT8 A;  2WOR A;  2KBI A;  1A75 B;  4YGC B;  2KAY A;  4ORA B;  1XFX O;  2KGB C;  1QV0 A;  1SL7 A;  1ZUZ A;  2G9B A;  4PDZ A;  2KNE A;  1FPW A;  4WRI A;  1TOP A;  1UHJ A;  1UHH A;  1DGV A;  3CR5 X;  1ALV A;  1QLK A;  1QS7 A;  2PVB A;  2CTN A;  2WOS A;  1F70 A;  3VRP A;  1EL4 A;  1OMR A;  3NSL A;  4N1G A;  3O2P A;  1SKT A;  1FBV A;  3OX5 A;  1QX2 A;  2JC2 A;  2MLF C;  5FYX A;  1CMF A;  1LVC D;  1QIW A;  3TDI A;  3D0Y B;  4CID A;  1QIV A;  3FIA A;  3GK1 A;  5AXI A;  1DJX A;  2LUC A;  1WDC C;  3KEV A;  1GQM A;  3K21 A;  4USL A;  1SL9 A;  4PE4 A;  1M63 B;  1A4P A;  1TCO B;  2LHI A;  3PAT A;  1G8I A;  5CSI A;  1B4C A;  1NX3 A;  3LL8 B;  2H61 C;  3FS7 A;  2GV5 A;  1V1G A;  4GGF C;  2LAP A;  1JSA A;  2JZI A;  1L7Z A;  2PSR A;  1N65 A;  1NX0 A;  2M1U A;  4PHN A;  1YUS A;  3M0W A;  1WRK A;  3IQO A;  4F0Z B;  1DF0 A;  1TRF A;  3F45 A;  4ZCU A;  1KK8 B;  2EC6 B;  4OV2 A;  2G2B A;  4QJ5 B;  5BPJ A;  3OP0 A;  3HCM A;  2E30 A;  4GAO A;  2M0R A;  1U5I A;  5F6T A;  1BR4 B;  1G4Y R;  1X02 A;  2E6W A;  1J7P A;  3LCP C;  2MHH A;  3O4Y A;  1EXR A;  3CZT X;  1KK7 Z;  2LV7 A;  1KQM C;  1NX1 A;  3I5G B;  1E8A A;  1KWO B;  1J1D A;  3VRN A;  1J7Q A;  1TNQ A;  3PN7 B;  3PSR A;  5AEQ A;  1F4O A;  1UUS A;  2JUL A;  2Y5I A;  2KAV A;  3AAK A;  1AP4 A;  1ZFS A;  3CWG A;  2ZFD A;  5JJG A;  3BOW A;  1BG1 A;  1OMV A;  5HKZ A;  1Y0V H;  5CSJ A;  2OPO A;  1JUO A;  1S6J A;  1GJY A;  3AKA A;  2PMY A;  4C0L A;  1YTZ C;  4C0J A;  2K0J A;  5JOL A;  1MXE A;  1ODB A;  3PLF B;  4YI9 A;  2AMI A;  3GK4 X;  3WXA A;  2MJW B;  2FJU B;  4E68 A;  1EJ3 A;  3JTD C;  4OCI A;  1K8U A;  5I2Q A;  3SG7 A;  3CR4 X;  4NDC A;  1TN4 A;  1MUX A;  4M2P A;  2M1K B;  1DTL A;  2LNK A;  1A75 A;  4TNC A;  5ER5 A;  1M45 A;  1OZS A;  1S3P A;  3BYA A;  3NSO A;  2PAL A;  1MF8 B;  1FI6 A;  1AJ5 A;  2F2P A;  1YRT B;  4GFT A;  1CNP A;  2NZ0 A;  2F8P A;  2K2F A;  2LMV A;  1J7O A;  2JQ6 A;  4MZL A;  1K9U A;  4N5X A;  3H4S E;  1M46 A;  2HF5 A;  2NCO A;  3DVM A;  3ZNI A;  3SIB A;  1UHK A;  1ZOT B;  2BL0 B;  5I2O A;  1AHR A;  1PVB A;  3D0Y A;  2LLS A;  4I5J A;  5TNC A;  4NDB A;  1SCM B;  1B9A A;  1RFJ A;  3GOF A;  1CM4 A;  4JQ0 D;  3LLE A;  1K2H A;  4NQG A;  1DJH A;  3PM8 A;  2KQY A;  2L0P A;  2JT0 A;  1B7T Y;  1PSB A;  1TIZ A;  1OOJ A;  1MHO A;  2H2K A;  2OS8 B;  3NXA A;  2F3Z A;  1BOD A;  4A4C A;  2M97 A;  3AKB A;  2ISD A;  4A4B A;  1OMD A;  1NIW A;  1S5G Y;  2HET A;  3BUM B;  5HLO A;  2IS9 A;  2AAO A;  2LE9 B;  2MRD A;  1NUB A;  3DVJ A;  4DS7 A;  1KFU S;  1QAS A;  4MN0 A;  2JU0 A;  3OHM B;  2JOJ A;  2LMU A;  2KFG A;  1SW8 A;  2HQW A;  4MEW A;  4WQ3 A;  2LVK A;  3I5I B;  1IH0 A;  4C0K A;  1XFZ O;  1YVL A;  2M7N A;  2WCE A;  4HSZ A;  3TDU A;  3VRR A;  1RWY A;  3WNX B;  4MSP A;  1AK8 A;  2I94 A;  2BKI B;  1LXF C;  1MXL C;  1JFJ A;  1MQ1 A;  3I5F B;  5J3X A;  5AER A;  2KI6 C;  2Y1N A;  4PHM A;  2B1U A;  1PK0 D;  2KYC A;  2LHL A;  3CGA A;  3CS1 A;  1B8R A;  3WHT B;  4AOM A;  1LA0 A;  5HKY A;  1IJ6 A;  1QVI Z;  1K93 D;  1KSM A;  2NLN A;  4PHK A;  1PVA A;  1IGV A;  1TCF A;  4YI8 A;  1SMG A;  1XFV O;  1CTR A;  1K96 A;  4HRH A;  2LVJ A;  3FWC A;  4DIR A;  3JVT C;  1M31 A;  1CFF A;  2CXJ A;  2M3W A;  2EC6 C;  2ZN8 A;  5DKQ A;  2NCP A;  3EVR A;  3BXK A;  1K9P A;  1YRU B;  4MZK A;  1JFK A;  5ER4 X;  3OX6 A;  2Y4Q A;  3SJS A;  3I5H B;  2CBL A;  4AQI A;  4N1F A;  1DMO A;  4ETO A;  4ORC B;  1Q80 A;  1B7T Z;  2JXL A;  2KQ6 A;  3SG5 A;  3TS5 C;  1NX2 A;  3EVU A;  1BT6 A;  1QJT A;  1WLZ A;  4MLW A;  1F55 A;  3DD4 A;  1QV1 A;  1S1E A;  2KSP A;  3I5G C;  4R1E A;  2L4I A;  1UHN A;  1WDC B;  1F8H A;  1DJZ A;  3TDZ A;  1JF0 A;  3PN7 C;  2LM5 A;  2AUC A;  1NCY A;  3EKJ A;  1S5G Z;  1LA3 A;  3BUN B;  2OTG C;  1WRL A;  2F33 A;  1XK4 A;  1F54 A;  2ZKM X;  4GNK B;  4XJK B;  3CTN A;  2ZN9 A;  2O60 A;  4U8D A;  5IBW A;  1OZO A;  1BMO A;  1TNP A;  1YX7 A;  2LCP A;  2TN4 A;  1SR6 B;  3BUX B;  3E3R A;  2FCD A;  1ZMZ A;  2R2I A;  1KFU L;  3RLZ A;  5KTY A;  2K7D A;  1BF5 A;  2LLU A;  1CDP A;  4YRU A;  1IQ5 A;  2Y1M A;  5HLV A;  2JRF A;  1SBJ A;  4DRW A;  1DVI A;  4D1E A;  3EK8 A;  1FI5 A;  3BUO B;  2WCF A;  1CMG A;  5CPV A;  1J7R A;  3KPX A;  4GPL B;  2DOQ A;  4QJ3 B;  1QXP A;  5K89 A;  2L51 A;  1ALW A;  1IG5 A;  2K7B A;  1RJV A;  4ICB A;  2KYF A;  2BL0 C;  2KBM A;  1AUI B;  1YUR A;  1K9K A;  2BEC A;  2JPT A;  1XA5 A;  2BE4 A;  5CSF A;  4JPZ B;  1CDN A;  3NSK A;  4YGA A;  3LK0 A;  3EKH A;  2M8U A;  1IKU A;  1SCM C;  3O6B A;  4GBA A;  2KI4 B;  1C07 A;  1CKK A;  1YUT A;  1UP5 A;  1MWN A;  4HRE E;  1NP8 A;  2KDH A;  1IQ3 A;  4MRX A;  2BCA A;  3A8R A;  1F71 A;  4DUQ A;  1DJW A;  1DGU A;  3TUY B;  1S26 D;  3CLN A;  2K8M B;  2OS8 C;  3JTD B;  4BY5 A;  4YGD B;  2ZND A;  3IQQ A;  1CFD A;  1B8C A;  1NCX A;  2LMT A;  2M9G A;  4P2Y B;  1BR1 B;  1S6C A;  4P5O E;  5D7F A;  3VRQ A;  4OR9 B;  5DKR A;  1TTX A;  3GK2 A;  1YVH A;  1RRO A;  2JNF A;  2BE6 A;  5I2L A;  2Q91 A;  4OKH A;  1XFU O;  4GGN A;  1KFX S;  1QLS A;  3DF0 B;  2P6B B;  4PE7 A;  1K90 D;  3I5I C;  1B8L A;  1B1G A;  1XFY O;  1NSH A;  1OSA A;  1Y6W A;  1BLQ A;  2LVI A;  4CLN A;  1UUR A;  2M29 A;  3D10 A;  4CPV A;  2LVV A;  4I5L B;  1NWD A;  2BBN A;  1R2U A;  3FWB A;  1DT7 B;  1TNX A;  2PAS A;  4PAL A;  1A29 A;  5PAL A;  3VRO A;  1DJI A;  1RTP 1;  2BCB A;  3PFV A;  2SCP A;  3SG2 A;  1WY9 A;  1EH2 A;  1B47 A;  2EGD A;  2H61 A;  4GGF A;  2LP2 A;  3HX4 A;  1KK7 Y;  1YX8 A;  1JBA A;  2KFF A;  1L2O B;  3C1V A;  5GQQ C;  4XJK A;  1AJ4 A;  2L4H A;  3SIA A;  4ORB B;  5HKW A;  2JWW A;  4PE1 A;  1KSO A;  1CLM A;  2PRU A;  3CR2 A;  1CLB A;  1IRJ A;  4DCK A;  4WQ2 A;  2BBM A;  1QX7 A;  3VGO A;  3I5H C;  4MRY A;  1LKJ A;  5HYD A;  1EG4 A;  1FW4 A;  1KK8 C;  1CDL A;  1Y1X A;  3KO0 A;  3A4U B;  4I5N B;  2MA2 A;  2ZRT A;  1H8B A;  2KHN A;  2GGM A;  1D1O A;  1A03 A;  4L9M A;  2I18 A;  2LP3 A;  4YBH B;  1PAL A;  1XO5 A;  2KOT A;  1G33 A;  1DJY A;  3RM1 A;  2VRG A;  1YUU A;  1YR5 A;  3EK4 A;  1W7I B;  5D69 A;  1ZAC A;  1Y1U A;  3LK1 A;  2F2O A;  1NPQ A;  3WHU B;  5G08 A;  4Q04 A;  4HRG A;  3IF7 A;  2K61 A;  1KWO C;  2L2E A;  1XFW O;  2CCM A;  2WC8 A;  4BY4 A;  2JNX A;  2HPS A;  2K2A A;  3ZWH A;  1H4B A;  2MAZ A;  2WCB A;  3SG6 A;  2GGZ A;  1RK9 A;  1SK6 D;  2EHB A;  3OB2 B;  1W7J B;  2F3Y A;  1BJF A;  1SR6 C;  3JVT B;  1SCV A;  2M7L A;  2HQ8 A;  1Y1A A;  1BOC A;  1OQP A;  1EG3 A;  2O5G A;  3QRX A;  2MBX A;  4QJ4 B;  1QX5 B;  2KFH A;  4FTG A;  1HQV A;  1KFX L;  1OE9 B;  4MZJ A;  3EVV A;  1QAT A;  4YGB B;  5KU1 A;  1J1E A;  2I7A A;  1JF2 A;  4M2O A;  4OVN F;  5AAN A;  2MLE C; 
#chains in the Genus database with same CATH topology
 4PCW A;  2WCH A;  2FOT A;  3NSI A;  3TS5 B;  2LAN A;  4M2Q A;  4XYN A;  3SG3 A;  1KCY A;  1C3Z A;  1XVJ A;  2JT3 A;  1P28 A;  2WND A;  5KSZ A;  1FF1 A;  3S0E A;  1XYD A;  1SNL A;  1UHI A;  2L98 A;  2LC5 A;  1C3Y A;  2KLE A;  1ORG A;  1CFP A;  1K94 A;  2CNP A;  2SAS A;  1KQM B;  1N0Y A;  1V1F A;  1WRZ A;  3DF0 A;  1PRW A;  1SY9 A;  1F4Q A;  2OTG B;  1AVS A;  2JTZ A;  1TUJ A;  2V53 A;  2KI4 C;  1XK4 C;  2P71 A;  2NXQ A;  1N2D A;  1WLM A;  2WC5 A;  3D73 A;  1JC2 A;  1DC1 A;  3AAJ A;  2L50 A;  3TZ1 A;  2K7C A;  3DYE A;  1CFC A;  3NHT A;  1SYM A;  3EK7 A;  2LUX A;  3O78 A;  3OB1 B;  4MVF A;  5I8N A;  3TUY C;  2CT9 A;  4UPG A;  2FCE A;  2WCK A;  1DF0 B;  1K95 A;  1GGZ A;  3KF9 A;  1NCZ A;  1SL8 A;  2Q4U A;  5B8I B;  1SRA A;  4CFR A;  3S0D A;  1IJ5 A;  1CDM A;  1PUL A;  2WC6 A;  1U5I B;  4MBE A;  4JWQ A;  2L5X B;  1GGW A;  3BUW B;  4NDD A;  4PHJ A;  4AQJ A;  1CB1 A;  1C7W A;  2K7O A;  3CZ1 A;  1QVI Y;  2KGR A;  2I2R E;  3BQ3 A;  3OGN A;  3B7A A;  1JWD A;  1REC A;  2LLT A;  1KQV A;  2L2C A;  4IL1 A;  1VRK A;  1OOH A;  2JXC A;  2A4J A;  3B88 A;  1PSR A;  3ICB A;  4OZD A;  1UWO A;  1DJG A;  2D8N A;  3MSE B;  2M49 B;  2ZNE A;  3PAL A;  5DKN A;  1J55 A;  1S36 A;  2QPT A;  3BOW B;  2KI6 D;  2RGI A;  2GTE A;  1Z2C B;  2KAX A;  1C7V A;  4YGE B;  4I5K A;  3KHE A;  1R6P A;  3I5F C;  4FQT A;  4PE0 A;  3DVE A;  1MR8 A;  1IWQ A;  1QTX A;  1S6I A;  2COL B;  5CSN A;  5AFP A;  1M39 A;  1NYA A;  2ZRS A;  1SPY A;  1CM1 A;  4FQO A;  1L2O C;  2BCX A;  1HT9 A;  1CLL A;  1LIN A;  3SG4 A;  2QAC A;  3DVK A;  1TNW A;  2BKH B;  4GUK A;  1BU3 A;  4ZCV A;  4CFQ A;  2JTT A;  1A2X A;  2JT8 A;  2WOR A;  2KBI A;  1A75 B;  4YGC B;  2KAY A;  4ORA B;  1XFX O;  2KGB C;  1QV0 A;  1SL7 A;  1ZUZ A;  2G9B A;  4PDZ A;  2KNE A;  3CYZ A;  1FPW A;  4WRI A;  1TOP A;  1UHJ A;  1UHH A;  1DGV A;  3CR5 X;  1ALV A;  1QLK A;  1QS7 A;  2QEV A;  3DXL A;  2PVB A;  2CTN A;  2WOS A;  1F70 A;  3VRP A;  1EL4 A;  1OMR A;  3NSL A;  4N1G A;  3DZT A;  3O2P A;  1SKT A;  4INW A;  1FBV A;  3OX5 A;  1QX2 A;  2JC2 A;  2MLF C;  5FYX A;  1CMF A;  1LVC D;  1QIW A;  3TDI A;  3D0Y B;  4CID A;  1QIV A;  3FIA A;  3GK1 A;  5AXI A;  1DJX A;  3B86 A;  2LUC A;  1WDC C;  3KEV A;  1GQM A;  3K21 A;  4USL A;  1SL9 A;  4PE4 A;  1M63 B;  1A4P A;  1TCO B;  2LHI A;  3PAT A;  1G8I A;  5CSI A;  1B4C A;  1NX3 A;  3LL8 B;  4JKT A;  2H61 C;  3FS7 A;  2GV5 A;  1V1G A;  4GGF C;  2LAP A;  1JSA A;  2JZI A;  1L7Z A;  2PSR A;  1DQE A;  1IIO A;  1N65 A;  1NX0 A;  2M1U A;  4PHN A;  1YUS A;  3M0W A;  1WRK A;  3IQO A;  4F0Z B;  1LS8 A;  1DF0 A;  1TRF A;  3F45 A;  4ZCU A;  1KK8 B;  2EC6 B;  2L5Y A;  2G2B A;  4OV2 A;  4QJ5 B;  5BPJ A;  3OP0 A;  3HCM A;  2E30 A;  4GAO A;  1OOI X;  3NHI A;  2M0R A;  3IVT A;  1U5I A;  5F6T A;  1BR4 B;  1G4Y R;  1X02 A;  2E6W A;  1J7P A;  3LCP C;  2MHH A;  3O4Y A;  3SS3 A;  3BJH A;  1EXR A;  3CZT X;  3L4A A;  1KK7 Z;  2LV7 A;  1KQM C;  3CZ2 A;  1NX1 A;  3V2L A;  3I5G B;  1E8A A;  1KWO B;  3K1E A;  1J1D A;  3VRN A;  1J7Q A;  1TNQ A;  3PN7 B;  3PSR A;  5AEQ A;  1F4O A;  1UUS A;  2JUL A;  2Y5I A;  4PT1 A;  2KAV A;  3AAK A;  1AP4 A;  1ZFS A;  3CWG A;  2ZFD A;  5JJG A;  3BOW A;  1BG1 A;  1OMV A;  5HKZ A;  1Y0V H;  5CSJ A;  2OPO A;  1JUO A;  1S6J A;  1GJY A;  3AKA A;  2PMY A;  3UNW A;  1YTZ C;  4C0L A;  4C0J A;  2K0J A;  5JOL A;  1MXE A;  1ODB A;  3PLF B;  4INX A;  3O4X A;  2WCJ A;  4YI9 A;  2AMI A;  3GK4 X;  3WXA A;  2MJW B;  2FJU B;  4E68 A;  1EJ3 A;  3JTD C;  4OCI A;  5FI7 A;  3VB1 A;  1W9Z A;  1K8U A;  5I2Q A;  3SG7 A;  3CR4 X;  4NDC A;  1TN4 A;  1MUX A;  4M2P A;  2M1K B;  1DTL A;  2LNK A;  1A75 A;  4TNC A;  5EL2 A;  5ER5 A;  3D76 A;  1M45 A;  1OZS A;  1S3P A;  3BYA A;  3NSO A;  2PAL A;  3CZ0 A;  1MF8 B;  1FI6 A;  1AJ5 A;  2F2P A;  1YRT B;  4GFT A;  1CNP A;  2NZ0 A;  2F8P A;  2K2F A;  2LMV A;  1J7O A;  2JQ6 A;  4MZL A;  1K9U A;  4N5X A;  3L4L A;  3H4S E;  2ERB A;  1M46 A;  2HF5 A;  3UO9 A;  2NCO A;  3DVM A;  3ZNI A;  3SIB A;  1UHK A;  1ZOT B;  2BL0 B;  3S0B A;  5I2O A;  1AHR A;  1PVB A;  3D0Y A;  2LLS A;  4I5J A;  5TNC A;  4NDB A;  2YGU A;  1SSE B;  1SCM B;  2PQL A;  1B9A A;  1RFJ A;  3GOF A;  1CM4 A;  4JQ0 D;  3FE6 A;  3LLE A;  1K2H A;  2QEB A;  4NQG A;  1DJH A;  3PM8 A;  2KQY A;  2L0P A;  2JT0 A;  1B7T Y;  1PSB A;  1TIZ A;  1OOJ A;  5DIC A;  1TWO A;  1MHO A;  2H2K A;  2OS8 B;  3NXA A;  2F3Z A;  1BOD A;  3D75 A;  2M97 A;  4A4C A;  3AKB A;  2ISD A;  1GM0 A;  4A4B A;  1OMD A;  1NIW A;  1S5G Y;  2HET A;  3BUM B;  5HLO A;  2IS9 A;  2AAO A;  2LE9 B;  2MRD A;  1NUB A;  3DVJ A;  4DS7 A;  1KFU S;  1QAS A;  4MN0 A;  2JU0 A;  3OHM B;  2JOJ A;  2LMU A;  2KFG A;  1SW8 A;  2HQW A;  4MEW A;  3DY9 A;  4WQ3 A;  2LVK A;  3I5I B;  1IH0 A;  4C0K A;  1XFZ O;  1YVL A;  2M7N A;  2WCE A;  3EG5 B;  4HSZ A;  3TDU A;  3VRR A;  1RWY A;  3WNX B;  4MSP A;  1AK8 A;  2I94 A;  2BKI B;  1LXF C;  1MXL C;  1JFJ A;  1MQ1 A;  3I5F B;  5J3X A;  5AER A;  2KI6 C;  1OOF A;  2Y1N A;  4PHM A;  2B1U A;  1PK0 D;  2KYC A;  2LHL A;  3CGA A;  3CS1 A;  1B8R A;  3WHT B;  4AOM A;  1LA0 A;  5HKY A;  1IJ6 A;  1QVI Z;  1K93 D;  1KSM A;  1XFR A;  2NLN A;  1PVA A;  4KYN A;  1IGV A;  4PHK A;  5I94 A;  1TCF A;  4YI8 A;  1SMG A;  1XFV O;  1CTR A;  1K96 A;  4HRH A;  2LVJ A;  3FWC A;  4DIR A;  3JVT C;  1M31 A;  2BNX A;  1CFF A;  2CXJ A;  2M3W A;  2EC6 C;  2ZN8 A;  5DKQ A;  2NCP A;  3EVR A;  3BXK A;  1K9P A;  1YRU B;  4MZK A;  1JFK A;  5ER4 X;  3OX6 A;  2Y4Q A;  3SJS A;  3I5H B;  2CBL A;  4AQI A;  4N1F A;  1DMO A;  3R1P A;  5HL1 A;  4ETO A;  4ORC B;  3B6X A;  1Q80 A;  1B7T Z;  2JXL A;  2KQ6 A;  3SG5 A;  3TS5 C;  1NX2 A;  3EVU A;  1BT6 A;  1QJT A;  1WLZ A;  4MLW A;  1F55 A;  3DD4 A;  1QV1 A;  1S1E A;  2KSP A;  3I5G C;  4R1E A;  2L4I A;  1UHN A;  1WDC B;  1F8H A;  1DJZ A;  3TDZ A;  1JF0 A;  3PN7 C;  2LM5 A;  2WCM A;  2AUC A;  1NCY A;  3EKJ A;  1S5G Z;  1LA3 A;  2BAP A;  3BUN B;  2OTG C;  1WRL A;  2F33 A;  1XK4 A;  3QME A;  1F54 A;  5FI2 A;  2ZKM X;  4GNK B;  3Q8I A;  4XJK B;  3CTN A;  2ZN9 A;  2O60 A;  4U8D A;  5FI6 A;  1OZO A;  1TNP A;  1BMO A;  1T14 A;  5IBW A;  1YX7 A;  2LCP A;  2TN4 A;  1SR6 B;  3BUX B;  3E3R A;  2FCD A;  1ZMZ A;  2R2I A;  1KFU L;  3RLZ A;  5KTY A;  2K7D A;  1BF5 A;  2LLU A;  1CDP A;  3PM2 A;  4YRU A;  1IQ5 A;  2FJY A;  3FE8 A;  2Y1M A;  5HLV A;  2JRF A;  1SBJ A;  3OBV A;  4DRW A;  1DVI A;  4D1E A;  3EK8 A;  1FI5 A;  1DEL A;  3D77 A;  1OOG A;  3BUO B;  2WCF A;  3BFA A;  5D3O A;  1CMG A;  5CPV A;  3B87 A;  1J7R A;  3KPX A;  4GPL B;  3S0G A;  3SS5 A;  2DOQ A;  4QJ3 B;  1QXP A;  5K89 A;  2L51 A;  3SS4 A;  1ALW A;  1IG5 A;  2K7B A;  1RJV A;  1QWV A;  4ICB A;  2KYF A;  2BL0 C;  2KBM A;  1AUI B;  1YUR A;  1K9K A;  2BEC A;  2JPT A;  1XA5 A;  2BE4 A;  5CSF A;  4JPZ B;  1CDN A;  3NSK A;  4YGA A;  3LK0 A;  1DEK A;  3EKH A;  2M8U A;  1IKU A;  1SCM C;  3O6B A;  2JPO A;  2KI4 B;  4GBA A;  1C07 A;  1YUT A;  1UP5 A;  1MWN A;  4HRE E;  1CKK A;  1NP8 A;  2H8V A;  2KDH A;  1IQ3 A;  4MRX A;  2BCA A;  3A8R A;  3S0A A;  1F71 A;  4DUQ A;  1DJW A;  1DGU A;  3TUY B;  1S26 D;  3CLN A;  2K8M B;  2OS8 C;  3JTD B;  4BY5 A;  4YGD B;  4F7F A;  2ZND A;  3IQQ A;  1CFD A;  1B8C A;  1NCX A;  2LMT A;  2M9G A;  4P2Y B;  1BR1 B;  1S6C A;  4P5O E;  5D7F A;  3VRQ A;  4OR9 B;  5DKR A;  1TTX A;  3GK2 A;  1YVH A;  1RRO A;  4JD9 A;  2JNF A;  2BE6 A;  5I2L A;  2P70 A;  2Q91 A;  4OKH A;  2QEH A;  1XFU O;  4GGN A;  1KFX S;  1QLS A;  3DF0 B;  2KPH A;  2P6B B;  4PE7 A;  1K90 D;  1OW4 A;  3I5I C;  3R72 A;  3D74 A;  1B8L A;  1B1G A;  1XFY O;  1NSH A;  1OSA A;  1Y6W A;  3BFB A;  3FE9 A;  1BLQ A;  2LVI A;  4CLN A;  2QEO A;  1UUR A;  2M29 A;  3D10 A;  4CPV A;  3RZS A;  2LVV A;  4I5L B;  3CAB A;  1NWD A;  2BBN A;  1R2U A;  3FWB A;  1DT7 B;  1TNX A;  2PAS A;  4PAL A;  1A29 A;  5PAL A;  3VRO A;  1DJI A;  1RTP 1;  2BCB A;  3PFV A;  2SCP A;  3SG2 A;  1WY9 A;  3R1O A;  1EH2 A;  1B47 A;  3R1V A;  2EGD A;  2H61 A;  4GGF A;  2LP2 A;  3HX4 A;  1KK7 Y;  1YX8 A;  1JBA A;  2KFF A;  1L2O B;  3C1V A;  5GQQ C;  4XJK A;  1AJ4 A;  2L4H A;  3SIA A;  4ORB B;  5HKW A;  2JWW A;  4PE1 A;  1KSO A;  1CLM A;  2PRU A;  3CR2 A;  1CLB A;  1IRJ A;  4DCK A;  4WQ2 A;  2BBM A;  1QX7 A;  3VGO A;  3I5H C;  4MRY A;  1LKJ A;  5HYD A;  3D78 A;  2KLD A;  1EG4 A;  1FW4 A;  1KK8 C;  2QDI A;  1CDL A;  1Y1X A;  3KO0 A;  3N7H A;  3A4U B;  2WCL A;  3PJI A;  4I5N B;  2MA2 A;  2ZRT A;  1H8B A;  2KHN A;  2GGM A;  1D1O A;  1A03 A;  4L9M A;  2I18 A;  1Z4H A;  2LP3 A;  4YBH B;  1PAL A;  1XO5 A;  2KOT A;  1G33 A;  1DJY A;  3RM1 A;  2K60 A;  2VRG A;  1YUU A;  1YR5 A;  3L47 A;  3EK4 A;  1W7I B;  5D69 A;  1ZAC A;  1Y1U A;  3LK1 A;  2F2O A;  1NPQ A;  3WHU B;  5G08 A;  4Q04 A;  4HRG A;  1TUZ A;  2PYQ A;  2K61 A;  1KWO C;  2L2E A;  1XFW O;  2CCM A;  2WC8 A;  3IF7 A;  3NGV A;  2JNX A;  2HPS A;  2K2A A;  4BY4 A;  3ZWH A;  1H4B A;  2MAZ A;  2WCB A;  3S0F A;  3SG6 A;  2GGZ A;  1RK9 A;  1SK6 D;  2EHB A;  3OB2 B;  1W7J B;  2F3Y A;  1BJF A;  1SR6 C;  3JVT B;  1SCV A;  2M7L A;  2HQ8 A;  1Y1A A;  3BFH A;  3CDN A;  1BOC A;  1OQP A;  1EG3 A;  2O5G A;  3QRX A;  2MBX A;  4QJ4 B;  1QX5 B;  2KFH A;  4FTG A;  1HQV A;  1KFX L;  1OE9 B;  4MZJ A;  3EVV A;  1QAT A;  4YGB B;  5KU1 A;  1J1E A;  2I7A A;  4IJ7 A;  1JF2 A;  4M2O A;  4OVN F;  5AAN A;  2MLE C; 
#chains in the Genus database with same CATH homology
 4PCW A;  1KCY A;  2FOT A;  3NSI A;  3TS5 B;  2LAN A;  4M2Q A;  4XYN A;  3SG3 A;  2JT3 A;  1XVJ A;  2WND A;  5KSZ A;  1FF1 A;  1XYD A;  1SNL A;  1UHI A;  2L98 A;  2LC5 A;  1CFP A;  1K94 A;  2CNP A;  2SAS A;  1KQM B;  1N0Y A;  1V1F A;  1WRZ A;  3DF0 A;  1PRW A;  1SY9 A;  1F4Q A;  2OTG B;  1AVS A;  2JTZ A;  2V53 A;  2KI4 C;  1XK4 C;  1JC2 A;  2NXQ A;  1N2D A;  1WLM A;  3AAJ A;  2L50 A;  3TZ1 A;  2K7C A;  1CFC A;  1SYM A;  3EK7 A;  2LUX A;  3O78 A;  3OB1 B;  4MVF A;  5I8N A;  3TUY C;  2CT9 A;  4UPG A;  2FCE A;  1DF0 B;  1K95 A;  1GGZ A;  3KF9 A;  1NCZ A;  1SL8 A;  2Q4U A;  5B8I B;  1SRA A;  4CFR A;  1IJ5 A;  1CDM A;  1PUL A;  1U5I B;  4MBE A;  4JWQ A;  2L5X B;  1GGW A;  3BUW B;  4NDD A;  4PHJ A;  4AQJ A;  1CB1 A;  1C7W A;  2K7O A;  1JWD A;  1QVI Y;  2KGR A;  2I2R E;  3BQ3 A;  1REC A;  2LLT A;  1KQV A;  4IL1 A;  1VRK A;  2JXC A;  2A4J A;  3ICB A;  1PSR A;  1UWO A;  1DJG A;  2D8N A;  3MSE B;  2M49 B;  2ZNE A;  3PAL A;  5DKN A;  1J55 A;  1S36 A;  2QPT A;  3BOW B;  2KI6 D;  2RGI A;  2KAX A;  1C7V A;  4YGE B;  4I5K A;  3KHE A;  1R6P A;  3I5F C;  4PE0 A;  3DVE A;  1MR8 A;  1IWQ A;  1QTX A;  1S6I A;  2COL B;  5CSN A;  5AFP A;  1M39 A;  1NYA A;  2ZRS A;  1SPY A;  1CM1 A;  4FQO A;  2BCX A;  1L2O C;  1HT9 A;  1CLL A;  1LIN A;  3SG4 A;  2QAC A;  3DVK A;  1TNW A;  2BKH B;  4GUK A;  1BU3 A;  4ZCV A;  4CFQ A;  2JTT A;  1A2X A;  2JT8 A;  2WOR A;  2KBI A;  1A75 B;  4YGC B;  2KAY A;  4ORA B;  1XFX O;  2KGB C;  1QV0 A;  1SL7 A;  1ZUZ A;  2G9B A;  4PDZ A;  2KNE A;  1FPW A;  4WRI A;  1TOP A;  1UHJ A;  1UHH A;  1DGV A;  3CR5 X;  1ALV A;  1QLK A;  1QS7 A;  2PVB A;  2CTN A;  2WOS A;  1F70 A;  3VRP A;  1EL4 A;  1OMR A;  3NSL A;  4N1G A;  3O2P A;  1SKT A;  1FBV A;  3OX5 A;  1QX2 A;  2JC2 A;  2MLF C;  5FYX A;  1CMF A;  1LVC D;  1QIW A;  3TDI A;  3D0Y B;  4CID A;  1QIV A;  3FIA A;  3GK1 A;  5AXI A;  1DJX A;  2LUC A;  1WDC C;  3KEV A;  1GQM A;  3K21 A;  4USL A;  1SL9 A;  4PE4 A;  1M63 B;  1A4P A;  1TCO B;  2LHI A;  3PAT A;  1G8I A;  5CSI A;  1B4C A;  1NX3 A;  3LL8 B;  2H61 C;  3FS7 A;  2GV5 A;  1V1G A;  4GGF C;  2LAP A;  1JSA A;  2JZI A;  1L7Z A;  2PSR A;  1N65 A;  1NX0 A;  2M1U A;  4PHN A;  1YUS A;  3M0W A;  1WRK A;  3IQO A;  4F0Z B;  1DF0 A;  1TRF A;  3F45 A;  4ZCU A;  1KK8 B;  2EC6 B;  4OV2 A;  2G2B A;  4QJ5 B;  5BPJ A;  3OP0 A;  3HCM A;  2E30 A;  4GAO A;  2M0R A;  1U5I A;  5F6T A;  1BR4 B;  1G4Y R;  1X02 A;  2E6W A;  1J7P A;  3LCP C;  2MHH A;  3O4Y A;  1EXR A;  3CZT X;  1KK7 Z;  2LV7 A;  1KQM C;  1NX1 A;  3I5G B;  1E8A A;  1KWO B;  1J1D A;  3VRN A;  1J7Q A;  1TNQ A;  3PN7 B;  3PSR A;  5AEQ A;  1F4O A;  1UUS A;  2JUL A;  2Y5I A;  2KAV A;  3AAK A;  1AP4 A;  1ZFS A;  3CWG A;  2ZFD A;  5JJG A;  3BOW A;  1BG1 A;  1OMV A;  5HKZ A;  1Y0V H;  5CSJ A;  2OPO A;  1JUO A;  1S6J A;  1GJY A;  3AKA A;  2PMY A;  4C0L A;  1YTZ C;  4C0J A;  2K0J A;  5JOL A;  1MXE A;  1ODB A;  3PLF B;  4YI9 A;  2AMI A;  3GK4 X;  3WXA A;  2MJW B;  2FJU B;  4E68 A;  1EJ3 A;  3JTD C;  4OCI A;  1K8U A;  5I2Q A;  3SG7 A;  3CR4 X;  4NDC A;  1TN4 A;  1MUX A;  4M2P A;  2M1K B;  1DTL A;  2LNK A;  1A75 A;  4TNC A;  5ER5 A;  1M45 A;  1OZS A;  1S3P A;  3BYA A;  3NSO A;  2PAL A;  1MF8 B;  1FI6 A;  1AJ5 A;  2F2P A;  1YRT B;  4GFT A;  1CNP A;  2NZ0 A;  2F8P A;  2K2F A;  2LMV A;  1J7O A;  2JQ6 A;  4MZL A;  1K9U A;  4N5X A;  3H4S E;  1M46 A;  2HF5 A;  2NCO A;  3DVM A;  3ZNI A;  3SIB A;  1UHK A;  1ZOT B;  2BL0 B;  5I2O A;  1AHR A;  1PVB A;  3D0Y A;  2LLS A;  4I5J A;  5TNC A;  4NDB A;  1SCM B;  1B9A A;  1RFJ A;  3GOF A;  1CM4 A;  4JQ0 D;  3LLE A;  1K2H A;  4NQG A;  1DJH A;  3PM8 A;  2KQY A;  2L0P A;  2JT0 A;  1B7T Y;  1PSB A;  1TIZ A;  1OOJ A;  1MHO A;  2H2K A;  2OS8 B;  3NXA A;  2F3Z A;  1BOD A;  4A4C A;  2M97 A;  3AKB A;  2ISD A;  4A4B A;  1OMD A;  1NIW A;  1S5G Y;  2HET A;  3BUM B;  5HLO A;  2IS9 A;  2AAO A;  2LE9 B;  2MRD A;  1NUB A;  3DVJ A;  4DS7 A;  1KFU S;  1QAS A;  4MN0 A;  2JU0 A;  3OHM B;  2JOJ A;  2LMU A;  2KFG A;  1SW8 A;  2HQW A;  4MEW A;  4WQ3 A;  2LVK A;  3I5I B;  1IH0 A;  4C0K A;  1XFZ O;  1YVL A;  2M7N A;  2WCE A;  4HSZ A;  3TDU A;  3VRR A;  1RWY A;  3WNX B;  4MSP A;  1AK8 A;  2I94 A;  2BKI B;  1LXF C;  1MXL C;  1JFJ A;  1MQ1 A;  3I5F B;  5J3X A;  5AER A;  2KI6 C;  2Y1N A;  4PHM A;  2B1U A;  1PK0 D;  2KYC A;  2LHL A;  3CGA A;  3CS1 A;  1B8R A;  3WHT B;  4AOM A;  1LA0 A;  5HKY A;  1IJ6 A;  1QVI Z;  1K93 D;  1KSM A;  2NLN A;  4PHK A;  1PVA A;  1IGV A;  1TCF A;  4YI8 A;  1SMG A;  1XFV O;  1CTR A;  1K96 A;  4HRH A;  2LVJ A;  3FWC A;  4DIR A;  3JVT C;  1M31 A;  1CFF A;  2CXJ A;  2M3W A;  2EC6 C;  2ZN8 A;  5DKQ A;  2NCP A;  3EVR A;  3BXK A;  1K9P A;  1YRU B;  4MZK A;  1JFK A;  5ER4 X;  3OX6 A;  2Y4Q A;  3SJS A;  3I5H B;  2CBL A;  4AQI A;  4N1F A;  1DMO A;  4ETO A;  4ORC B;  1Q80 A;  1B7T Z;  2JXL A;  2KQ6 A;  3SG5 A;  3TS5 C;  1NX2 A;  3EVU A;  1BT6 A;  1QJT A;  1WLZ A;  4MLW A;  1F55 A;  3DD4 A;  1QV1 A;  1S1E A;  2KSP A;  3I5G C;  4R1E A;  2L4I A;  1UHN A;  1WDC B;  1F8H A;  1DJZ A;  3TDZ A;  1JF0 A;  3PN7 C;  2LM5 A;  2AUC A;  1NCY A;  3EKJ A;  1S5G Z;  1LA3 A;  3BUN B;  2OTG C;  1WRL A;  2F33 A;  1XK4 A;  1F54 A;  2ZKM X;  4GNK B;  4XJK B;  3CTN A;  2ZN9 A;  2O60 A;  4U8D A;  5IBW A;  1OZO A;  1BMO A;  1TNP A;  1YX7 A;  2LCP A;  2TN4 A;  1SR6 B;  3BUX B;  3E3R A;  2FCD A;  1ZMZ A;  2R2I A;  1KFU L;  3RLZ A;  5KTY A;  2K7D A;  1BF5 A;  2LLU A;  1CDP A;  4YRU A;  1IQ5 A;  2Y1M A;  5HLV A;  2JRF A;  1SBJ A;  4DRW A;  1DVI A;  4D1E A;  3EK8 A;  1FI5 A;  3BUO B;  2WCF A;  1CMG A;  5CPV A;  1J7R A;  3KPX A;  4GPL B;  2DOQ A;  4QJ3 B;  1QXP A;  5K89 A;  2L51 A;  1ALW A;  1IG5 A;  2K7B A;  1RJV A;  4ICB A;  2KYF A;  2BL0 C;  2KBM A;  1AUI B;  1YUR A;  1K9K A;  2BEC A;  2JPT A;  1XA5 A;  2BE4 A;  5CSF A;  4JPZ B;  1CDN A;  3NSK A;  4YGA A;  3LK0 A;  3EKH A;  2M8U A;  1IKU A;  1SCM C;  3O6B A;  4GBA A;  2KI4 B;  1C07 A;  1CKK A;  1YUT A;  1UP5 A;  1MWN A;  4HRE E;  1NP8 A;  2KDH A;  1IQ3 A;  4MRX A;  2BCA A;  3A8R A;  1F71 A;  4DUQ A;  1DJW A;  1DGU A;  3TUY B;  1S26 D;  3CLN A;  2K8M B;  2OS8 C;  3JTD B;  4BY5 A;  4YGD B;  2ZND A;  3IQQ A;  1CFD A;  1B8C A;  1NCX A;  2LMT A;  2M9G A;  4P2Y B;  1BR1 B;  1S6C A;  4P5O E;  5D7F A;  3VRQ A;  4OR9 B;  5DKR A;  1TTX A;  3GK2 A;  1YVH A;  1RRO A;  2JNF A;  2BE6 A;  5I2L A;  2Q91 A;  4OKH A;  1XFU O;  4GGN A;  1KFX S;  1QLS A;  3DF0 B;  2P6B B;  4PE7 A;  1K90 D;  3I5I C;  1B8L A;  1B1G A;  1XFY O;  1NSH A;  1OSA A;  1Y6W A;  1BLQ A;  2LVI A;  4CLN A;  1UUR A;  2M29 A;  3D10 A;  4CPV A;  2LVV A;  4I5L B;  1NWD A;  2BBN A;  1R2U A;  3FWB A;  1DT7 B;  1TNX A;  2PAS A;  4PAL A;  1A29 A;  5PAL A;  3VRO A;  1DJI A;  1RTP 1;  2BCB A;  3PFV A;  2SCP A;  3SG2 A;  1WY9 A;  1EH2 A;  1B47 A;  2EGD A;  2H61 A;  4GGF A;  2LP2 A;  3HX4 A;  1KK7 Y;  1YX8 A;  1JBA A;  2KFF A;  1L2O B;  3C1V A;  5GQQ C;  4XJK A;  1AJ4 A;  2L4H A;  3SIA A;  4ORB B;  5HKW A;  2JWW A;  4PE1 A;  1KSO A;  1CLM A;  2PRU A;  3CR2 A;  1CLB A;  1IRJ A;  4DCK A;  4WQ2 A;  2BBM A;  1QX7 A;  3VGO A;  3I5H C;  4MRY A;  1LKJ A;  5HYD A;  1EG4 A;  1FW4 A;  1KK8 C;  1CDL A;  1Y1X A;  3KO0 A;  3A4U B;  4I5N B;  2MA2 A;  2ZRT A;  1H8B A;  2KHN A;  2GGM A;  1D1O A;  1A03 A;  4L9M A;  2I18 A;  2LP3 A;  4YBH B;  1PAL A;  1XO5 A;  2KOT A;  1G33 A;  1DJY A;  3RM1 A;  2VRG A;  1YUU A;  1YR5 A;  3EK4 A;  1W7I B;  5D69 A;  1ZAC A;  1Y1U A;  3LK1 A;  2F2O A;  1NPQ A;  3WHU B;  5G08 A;  4Q04 A;  4HRG A;  3IF7 A;  2K61 A;  1KWO C;  2L2E A;  1XFW O;  2CCM A;  2WC8 A;  4BY4 A;  2JNX A;  2HPS A;  2K2A A;  3ZWH A;  1H4B A;  2MAZ A;  2WCB A;  3SG6 A;  2GGZ A;  1RK9 A;  1SK6 D;  2EHB A;  3OB2 B;  1W7J B;  2F3Y A;  1BJF A;  1SR6 C;  3JVT B;  1SCV A;  2M7L A;  2HQ8 A;  1Y1A A;  1BOC A;  1OQP A;  1EG3 A;  2O5G A;  3QRX A;  2MBX A;  4QJ4 B;  1QX5 B;  2KFH A;  4FTG A;  1HQV A;  1KFX L;  1OE9 B;  4MZJ A;  3EVV A;  1QAT A;  4YGB B;  5KU1 A;  1J1E A;  2I7A A;  1JF2 A;  4M2O A;  4OVN F;  5AAN A;  2MLE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...