1C7VA

Nmr solution structure of the calcium-bound c-terminal domain (w81-s161) of calcium vector protein from amphioxus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
68
structure length
68
Chain Sequence
EEEILRAFKVFDANGDGVIDFDEFKFIMQKVGEEPLTDAEVEEAMKEADEDGNGVIDIPEFMDLIKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CALCIUM VECTOR PROTEIN
publication title Sequential calcium binding to the regulatory domain of calcium vector protein reveals functional asymmetry and a novel mode of structural rearrangement.
pubmed doi rcsb
source organism Branchiostoma lanceolatum
molecule tags Metal binding protein
total genus 19
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2000-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1c7vA00
2EGDA 1N65A 4DRWA 5DKQA 4D1EA 3F45A 1A75A 2KFHA 1DJZA 4CIDA 1K96A 2WNDA 4MEWA 1CFDA 2I18A 2PVBA 3E3RA 1JF0A 1OOJA 3M0WA 2Y1MA 4PCWA 2GGZA 1K9PA 1OQPA 1ZMZA 1L2OC 1MF8B 1SL8A 2LAPA 3EKJA 4XJKB 1N2DA 2BBNA 4YI9A 1M31A 5AFPA 1DJGA 2JULA 3NSOA 1CMFA 4YGAA 1AK8A 1F70A 2P6BB 2KBMA 1K95A 3H4SE 2CTNA 2E30A 4MRXA 1J55A 1QX7A 4MN0A 2LCPA 1B47A 2HPSA 1BT6A 1M63B 4CFQA 1NPQA 4M2QA 1MUXA 1PRWA 1J7RA 1KQMC 2PALA 1CM1A 4WRIA 3IQQA 2ZNDA 2F33A 1IJ5A 5CSJA 1ZACA 1KFXS 2DOQA 1K2HA 2LP2A 2LHLA 5K89A 3O6BA 1CDNA 2BCAA 4ZCUA 5ER5A 5JJGA 2FCEA 4ORBB 1QV1A 3BUNB 3SG4A 4C0KA 3OB2B 4PE0A 5F6TA 1TCFA 2KQ6A 5JOLA 3SG5A 2M1KB 2JQ6A 2LVVA 2LVKA 1J1EA 4MLWA 4DUQA 2COLB 1TNQA 1IGVA 1ODBA 4PE1A 2LLTA 2KAXA 3EKHA 1PSRA 1NP8A 4GAOA 3I5GB 1GGZA 1KFUL 3DVKA 3FIAA 4PDZA 2F2OA 2Q4UA 1JSAA 1DGVA 1ZUZA 1OMVA 3WXAA 1XFZO 1XFXO 2L98A 3PALA 1SW8A 1G33A 1AP4A 1EG3A 3VRRA 4ZCVA 1NX0A 1ZOTB 5D69A 1QLKA 4NDDA 1F55A 2Q91A 1WRZA 1AJ4A 4GGFA 1EJ3A 3JTDB 1Y1XA 3DF0A 1BLQA 2KI4C 1IQ3A 1FI5A 1IG5A 2B1UA 3GK2A 1AUIB 3A8RA 3JVTC 1PK0D 1J7PA 1PVAA 1GJYA 1YVLA 1JFKA 3LK0A 1BJFA 1YURA 1QLSA 1SKTA 1QS7A 3CWGA 1GGWA 1PALA 2LMVA 4USLA 4R1EA 1KWOC 4HRGA 1BU3A 1NX2A 2OPOA 1WDCB 2ZRSA 4QJ5B 1QVIY 1LKJA 1XK4C 3WNXB 1OSAA 2CNPA 2QACA 4U8DA 1SNLA 3BUMB 2WOSA 4XYNA 4MBEA 1TNXA 4MVFA 1JC2A 4GGFC 1CDLA 1NIWA 2JNXA 2WC8A 3LK1A 4GFTA 2OS8C 2VRGA 1ALWA 3DD4A 3CGAA 4BY5A 1JF2A 2LV7A 3KHEA 1B7TY 1KFUS 3IF7A 2LMUA 1EG4A 2SASA 4CPVA 1DF0B 1E8AA 1F4QA 2KNEA 5I2QA 3PN7B 2MHHA 1QIVA 2KQYA 1MR8A 2KBIA 3PFVA 1SL7A 2HQ8A 2KGBC 3FS7A 4JQ0D 4A4BA 2EHBA 2LHIA 1F4OA 4GBAA 3KEVA 1XFWO 2CBLA 3O78A 1A03A 1NWDA 1QX2A 2K0JA 5J3XA 5B8IB 2PASA 2KAYA 3VRPA 1LXFC 2JTZA 1V1GA 2AUCA 2BCBA 2GV5A 3GK1A 1B1GA 4C0JA 5I2OA 4JWQA 4QJ3B 2PMYA 3PATA 4DS7A 1MXLC 2SCPA 2JT3A 3OX6A 1A4PA 1SBJA 3KF9A 1RTP1 2KYCA 1HT9A 1NCYA 1J7QA 1RK9A 3BUXB 1XVJA 1VRKA 1A75B 2F3ZA 1UP5A 2Y5IA 1B9AA 1B8RA 1UHKA 3TDIA 2BECA 1FW4A 3KO0A 3SJSA 2L5XB 1KQMB 2FCDA 2M29A 1F8HA 4PALA 2PSRA 2I2RE 4HREE 4A4CA 1CLLA 1OZOA 2KI6D 4DIRA 1QVIZ 4MZJA 4YI8A 5HLVA 5BPJA 1DMOA 3BXKA 5AEQA 1OMRA 2K2FA 5G08A 1WLMA 1DGUA 4I5LB 1TN4A 2F8PA 2CCMA 2MAZA 1FPWA 1MXEA 3PM8A 2M3WA 2LUCA 3SG7A 2M8UA 1B7TZ 1BR4B 1SR6C 2H2KA 2MA2A 2ZNEA 1C7WA 3GOFA 1QIWA 1BMOA 1CLMA 1QV0A 1KSMA 3CR2A 4GGNA 2FOTA 3CR4X 1OMDA 4AQJA 3TUYC 1SY9A 1NX1A 4I5KA 1B8CA 2M1UA 3D0YA 1CFFA 1Y0VH 3EVUA 3I5FC 4YGEB 1CFPA 2BKIB 1CDMA 2K61A 4CLNA 1SYMA 1OE9B 2MBXA 4YBHB 2L2EA 4PHKA 2LLSA 2K7DA 1AVSA 3FWBA 3LL8B 4FTGA 4DCKA 1QJTA 1J1DA 1XK4A 2K7BA 4OR9B 3SG2A 1B8LA 2BCXA 5HYDA 2KYFA 1RFJA 2PRUA 1SMGA 3CS1A 2MLFC 1XFYO 1S5GY 3MSEB 4MSPA 1X02A 1WRKA 2WCBA 2ZKMX 2LC5A 5CSFA 3AKBA 1UHNA 1NYAA 3PLFB 2K7OA 2M97A 1TIZA 5AXIA 2JNFA 1IQ5A 2LVJA 2TN4A 4BY4A 2MRDA 1CDPA 1UUSA 1S36A 1QXPA 3FWCA 1IJ6A 1MWNA 1QTXA 4WQ3A 4YRUA 1QX5B 1WRLA 2H61C 1KK8C 3I5HC 1EH2A 2JOJA 4YGDB 3EK8A 2A4JA 1XFUO 1UHIA 2NZ0A 2KAVA 2KI6C 2M0RA 2OS8B 3DF0B 1CM4A 2BE4A 2ISDA 3VGOA 3DVJA 2M7LA 3AAKA 3VRQA 3K21A 5PALA 1AHRA 2M49B 1BF5A 1K9KA 1NSHA 1YRTB 2MJWB 3BOWA 4PHNA 1LINA 3SG3A 2JPTA 1JWDA 2LLUA 1YUUA 5GQQC 1CNPA 2BL0C 1SRAA 2JC2A 3ICBA 4E68A 1L7ZA 3BQ3A 2JTTA 3CLNA 3JTDC 3O4YA 2OTGB 5ER4X 4M2PA 1BR1B 1IRJA 1CKKA 4QJ4B 3TS5B 3SG6A 2JRFA 3OHMB 1CFCA 1LA0A 4PE7A 2K8MB 2HF5A 3I5IC 1W7JB 3SIAA 2MLEC 1BOCA 5CPVA 1ZFSA 1AJ5A 4OKHA 1JBAA 1DJIA 4MZKA 1IKUA 1W7IB 2M9GA 2ZFDA 1CB1A 3WHUB 3HX4A 1S6IA 1L2OB 2JXLA 4OVNF 3CZTX 4HRHA 4ETOA 1H4BA 2HQWA 1TTXA 3IQOA 3O2PA 4GUKA 1U5IA 2LM5A 5I2LA 3ZNIA 1FF1A 3D10A 2I94A 4M2OA 3NXAA 4OV2A 1S5GZ 3VROA 3EK7A 2L0PA 2CXJA 4IL1A 1SCMC 2LMTA 1Y1UA 2L50A 3TZ1A 4GNKB 1NX3A 3OX5A 4NDCA 2EC6C 2Y1NA 1KQVA 5DKNA 5DKRA 1RJVA 2RGIA 1H8BA 3GK4X 1ALVA 2QPTA 3KPXA 1Y1AA 1UWOA 5IBWA 1BG1A 5CSIA 4XJKA 3WHTB 1D1OA 4YGBB 1PVBA 3AKAA 2BBMA 2D8NA 1CLBA 1FI6A 3LLEA 4AOMA 1K8UA 2O5GA 1Y6WA 1EL4A 1MHOA 5KTYA 4ORAB 1SCVA 1SR6B 2G2BA 1LA3A 2JXCA 2WORA 1N0YA 2I7AA 1K90D 3QRXA 2LE9B 5D7FA 1S6CA 3TUYB 4N1FA 4YGCB 2JU0A 3ZWHA 1M45A 1R6PA 1JFJA 1WY9A 1C7VA 3PSRA 5HLOA 3I5FB 3VRNA 1XO5A 1DJWA 1NCZA 2BKHB 1S6JA 3TDUA 3OB1B 3C1VA 1YRUB 2R2IA 4ICBA 3EVVA 4TNCA 1DJHA 1FBVA 1KK7Y 1RECA 1TRFA 3RM1A 2KSPA 2AMIA 1K9UA 1XYDA 2FJUB 1GQMA 1SK6D 2L51A 1DT7B 4NDBA 1S3PA 1YX8A 3CR5X 1BODA 1QASA 1RROA 1B4CA 5FYXA 2H61A 1NUBA 1XFVO 1SL9A 2NCPA 3NSIA 3D0YB 1IWQA 3SIBA 1QATA 5HKZA 2AAOA 2KI4B 2KDHA 1DJXA 3EK4A 3EVRA 3JVTB 1SPYA 1KK8B 1PSBA 3I5HB 2K2AA 2V53A 3RLZA 4CFRA 3NSLA 1KWOB 2K7CA 1HQVA 1G4YR 1A2XA 2KFFA 1JUOA 4AQIA 1C07A 4N1GA 2O60A 4MZLA 3BUWB 1TOPA 2ZN8A 1IH0A 1S1EA 5KU1A 4HSZA 1LVCD 4Q04A 1TCOB 5HKWA 1YVHA 1TNPA 1YX7A 1DTLA 1NCXA 2BL0B 1YTZC 3DVEA 2BE6A 3I5GC 1F71A 1CTRA 2WCFA 2JT8A 4WQ2A 4F0ZB 2F2PA 1M39A 3CTNA 2KHNA 1KCYA 2Y4QA 1K93D 1YUSA 3HCMA 5AANA 1DVIA 4PHJA 2G9BA 4I5JA 3LCPC 4OCIA 2JZIA 1MQ1A 1F54A 3I5IB 2JT0A 4UPGA 1DJYA 2ZN9A 3BOWB 5KSZA 1YR5A 2NXQA 2GGMA 1KK7Z 2KGRA 3NSKA 1PULA 1R2UA 2CT9A 1UHHA 1DF0A 2KOTA 3BUOB 4MRYA 2F3YA 1G8IA 1XA5A 2JWWA 2E6WA 2HETA 3BYAA 3TDZA 3OP0A 1WDCC 2KFGA 4ORCB 4PE4A 2L4HA 5HKYA 1A29A 5CSNA 1SCMB 1UURA 4GPLB 2LVIA 1K94A 1UHJA 2LANA 1EXRA 2LNKA 1KSOA 2M7NA 4PHMA 3A4UB 4N5XA 5TNCA 1YUTA 2EC6B 1TNWA 1M46A 1OZSA 1Q80A 2NLNA 1WLZA 4L9MA 4P2YB 3DVMA 2L4IA 2WCEA 4NQGA 1S26D 4JPZB 4I5NB 2LUXA 1J7OA 3AAJA 2LP3A 1CMGA 3PN7C 5AERA 5I8NA 1KFXL 2OTGC 4FQOA 2NCOA 2ZRTA 1U5IB 1RWYA 4C0LA 1V1FA 2IS9A 3TS5C 4P5OE
chains in the Genus database with same CATH superfamily
2EGDA 1N65A 4DRWA 5DKQA 4D1EA 3F45A 1A75A 2KFHA 1DJZA 1OOFA 1K96A 2WNDA 3OBVA 4CIDA 4MEWA 2L5YA 1CFDA 2I18A 2PVBA 3E3RA 1JF0A 1OOJA 3M0WA 2Y1MA 4PCWA 2GGZA 1K9PA 1OQPA 5FI7A 1C3YA 1ZMZA 1L2OC 1MF8B 1SL8A 2LAPA 3BFHA 3EKJA 4XJKB 1N2DA 2BBNA 4YI9A 1M31A 5AFPA 1DJGA 2JULA 3NSOA 1CMFA 4YGAA 1TUZA 1AK8A 1F70A 2P6BB 2KBMA 1K95A 3H4SE 2CTNA 2E30A 4MRXA 1J55A 1QX7A 4MN0A 2LCPA 1B47A 2HPSA 1BT6A 1M63B 4CFQA 1NPQA 4M2QA 1MUXA 2KPHA 1PRWA 1J7RA 1KQMC 2PALA 1CM1A 4WRIA 3IQQA 2ZNDA 2F33A 1IJ5A 5CSJA 1ZACA 3D76A 1KFXS 2DOQA 1K2HA 2LP2A 2LHLA 5K89A 3O6BA 2KLEA 1CDNA 2BCAA 4ZCUA 1DQEA 5ER5A 5JJGA 2FCEA 4ORBB 1QV1A 3BUNB 3SG4A 4C0KA 3OB2B 4PE0A 5F6TA 1TCFA 2KQ6A 5JOLA 1XFRA 3SG5A 2M1KB 2JQ6A 2LVVA 2LVKA 1W9ZA 1J1EA 4MLWA 4DUQA 2COLB 1TNQA 1IGVA 1ODBA 4PE1A 2LLTA 2KAXA 3EKHA 1PSRA 1NP8A 4GAOA 3I5GB 1GGZA 1KFUL 3DVKA 3B7AA 3FIAA 3S0FA 4JD9A 4PDZA 2F2OA 2Q4UA 1JSAA 1DGVA 1ZUZA 3SS5A 1OMVA 3WXAA 1XFZO 1XFXO 1SSEB 2L98A 1SW8A 1G33A 3PALA 1EG3A 3VRRA 1AP4A 4ZCVA 4OZDA 1NX0A 1ZOTB 3CZ1A 3NHIA 3PM2A 3CZ2A 5D69A 1QLKA 4NDDA 1F55A 2Q91A 1QWVA 1WRZA 1AJ4A 4GGFA 1EJ3A 3JTDB 1ORGA 1Y1XA 3DF0A 1BLQA 2KI4C 1IQ3A 1FI5A 1IG5A 2B1UA 3GK2A 1AUIB 3A8RA 3JVTC 1PK0D 1J7PA 1PVAA 1GJYA 1YVLA 3S0GA 1JFKA 3LK0A 1IIOA 1BJFA 1YURA 3DXLA 1QLSA 1SKTA 1QS7A 3CWGA 1GGWA 1PALA 2LMVA 4USLA 4R1EA 1KWOC 4HRGA 3S0AA 1BU3A 1NX2A 2OPOA 1WDCB 2ZRSA 4QJ5B 1QVIY 1LKJA 1XK4C 3WNXB 1OSAA 2CNPA 3S0EA 2QEBA 2QACA 3L4AA 4U8DA 1SNLA 3BUMB 2WOSA 4XYNA 4MBEA 1TNXA 4MVFA 1JC2A 4GGFC 1CDLA 1NIWA 2JNXA 4KYNA 2WC8A 3LK1A 4GFTA 2OS8C 2VRGA 1ALWA 3DD4A 3CGAA 4BY5A 1JF2A 2LV7A 3KHEA 1B7TY 1KFUS 3IF7A 2LMUA 1EG4A 2SASA 4CPVA 1DF0B 1E8AA 1F4QA 2P71A 2KNEA 5I2QA 3PN7B 2MHHA 1QIVA 2KQYA 1MR8A 2KBIA 3PFVA 1SL7A 2HQ8A 2KGBC 3FS7A 4JQ0D 4A4BA 2EHBA 2LHIA 1F4OA 4GBAA 3CABA 3KEVA 1XFWO 2CBLA 3O78A 1A03A 1NWDA 1QX2A 2K0JA 5J3XA 5B8IB 2PASA 2KAYA 3UO9A 3NGVA 3VRPA 1LXFC 2JTZA 1V1GA 2AUCA 2BCBA 2BAPA 2GV5A 3GK1A 1DC1A 1B1GA 3K1EA 4C0JA 5I2OA 4JWQA 4QJ3B 2PMYA 3PATA 4DS7A 1MXLC 2SCPA 2PYQA 2JT3A 3SS3A 3OX6A 1A4PA 1SBJA 3KF9A 1RTP1 2KYCA 1HT9A 1NCYA 2ERBA 4FQTA 1J7QA 1RK9A 3BUXB 2KLDA 1XVJA 1VRKA 1A75B 1T14A 2F3ZA 1UP5A 2Y5IA 1B9AA 1B8RA 1UHKA 2P70A 2BECA 1FW4A 3KO0A 3TDIA 3SJSA 2L5XB 1KQMB 2FCDA 3R1PA 2M29A 2BNXA 1F8HA 4PALA 4JKTA 2PSRA 2I2RE 4HREE 4A4CA 1CLLA 1OZOA 2K60A 2KI6D 4DIRA 1QVIZ 4MZJA 4YI8A 5HLVA 3D74A 5BPJA 1DMOA 3B86A 3BXKA 5AEQA 1OMRA 3FE6A 2WCKA 2K2FA 5G08A 1WLMA 1DGUA 4I5LB 1TN4A 2F8PA 2CCMA 2MAZA 1FPWA 1MXEA 3PM8A 2M3WA 2LUCA 1Z4HA 3SG7A 2M8UA 1B7TZ 1BR4B 1SR6C 2H2KA 2MA2A 2ZNEA 1C7WA 3GOFA 1QIWA 1BMOA 1CLMA 1QV0A 1KSMA 3CR2A 4GGNA 2FOTA 3CR4X 1OMDA 4AQJA 3TUYC 1SY9A 3B88A 2QEOA 1NX1A 4I5KA 1B8CA 3R72A 5FI2A 2M1UA 3D0YA 1CFFA 1Y0VH 3EVUA 3I5FC 4YGEB 2WCLA 2BKIB 1CDMA 2K61A 4CLNA 1CFPA 1SYMA 3D75A 1OE9B 2MBXA 4YBHB 2L2EA 4PHKA 2LLSA 2K7DA 1AVSA 3FWBA 3LL8B 1OW4A 4FTGA 4DCKA 1QJTA 3PJIA 1J1DA 1XK4A 2K7BA 3R1VA 4OR9B 1B8LA 2BCXA 3SG2A 5HYDA 2KYFA 1RFJA 2PRUA 1SMGA 3CS1A 2MLFC 1XFYO 1S5GY 3MSEB 3D78A 4MSPA 1X02A 1WRKA 2WCBA 2ZKMX 2LC5A 5CSFA 3AKBA 3IVTA 1UHNA 1NYAA 3PLFB 2K7OA 2M97A 1TIZA 5AXIA 2JNFA 1IQ5A 2LVJA 2TN4A 4BY4A 2MRDA 1CDPA 1UUSA 1S36A 1QXPA 3FWCA 1IJ6A 1MWNA 1QTXA 4WQ3A 4YRUA 1C3ZA 1QX5B 1WRLA 1KK8C 2H61C 3I5HC 2JOJA 4YGDB 3EK8A 2A4JA 1XFUO 1UHIA 2QDIA 2NZ0A 2KAVA 2KI6C 2M0RA 2OS8B 3DF0B 1CM4A 2BE4A 2ISDA 3VGOA 3DVJA 2M7LA 3AAKA 3VRQA 2WCMA 3SS4A 3S0BA 1DELA 3K21A 5PALA 1AHRA 2M49B 3FE9A 1BF5A 1K9KA 1NSHA 1YRTB 2MJWB 3BOWA 4PHNA 1LINA 2FJYA 3SG3A 2JPTA 1JWDA 2LLUA 1YUUA 1GM0A 5GQQC 1CNPA 2BL0C 1SRAA 2JC2A 5D3OA 3ICBA 4E68A 1L7ZA 3BQ3A 2JTTA 3CLNA 3JTDC 3O4YA 2OTGB 5ER4X 4M2PA 1BR1B 1IRJA 2QEHA 1CKKA 4QJ4B 3EG5B 3TS5B 3SG6A 2JRFA 3BFAA 3OHMB 2QEVA 1CFCA 1LA0A 4PE7A 2K8MB 2HF5A 3I5IC 1W7JB 3SIAA 2MLEC 3B87A 1BOCA 5CPVA 1ZFSA 1AJ5A 4OKHA 2PQLA 1DJIA 1JBAA 4MZKA 1IKUA 1W7IB 2M9GA 2ZFDA 1CB1A 5HL1A 3WHUB 3HX4A 1S6IA 1L2OB 2JXLA 4OVNF 3CZTX 4HRHA 2GTEA 4ETOA 1H4BA 2HQWA 1TTXA 3IQOA 3O2PA 4GUKA 1TUJA 1U5IA 2LM5A 5I2LA 3ZNIA 5I94A 1FF1A 3D10A 2I94A 4M2OA 3NXAA 4OV2A 1S5GZ 3VROA 3EK7A 2L0PA 2CXJA 4IL1A 1SCMC 2LMTA 3L4LA 1Y1UA 2L50A 3TZ1A 4GNKB 1NX3A 3OX5A 4NDCA 2EC6C 2Y1NA 3BFBA 1KQVA 5DKNA 5DKRA 1RJVA 2RGIA 1H8BA 3D73A 3GK4X 1ALVA 2QPTA 3KPXA 1Y1AA 1UWOA 5IBWA 1BG1A 5CSIA 4XJKA 3WHTB 1D1OA 4YGBB 1PVBA 3AKAA 2BBMA 3RZSA 2D8NA 1CLBA 1OOIX 3LLEA 1FI6A 4AOMA 1K8UA 2O5GA 1Y6WA 1EL4A 1MHOA 3CYZA 4ORAB 1SCVA 1SR6B 2G2BA 5KTYA 1LA3A 2JXCA 2YGUA 3Q8IA 2WORA 1N0YA 2I7AA 1K90D 2H8VA 2LE9B 3OGNA 3QRXA 1S6CA 5D7FA 3TUYB 4N1FA 4YGCB 2JU0A 3ZWHA 1M45A 1R6PA 3VB1A 1JFJA 1WY9A 1C7VA 3PSRA 5HLOA 3I5FB 3VRNA 1XO5A 1DJWA 1NCZA 1S6JA 2BKHB 3TDUA 3V2LA 3OB1B 3C1VA 1YRUB 2R2IA 3FE8A 3EVVA 4ICBA 4TNCA 5EL2A 1DJHA 1FBVA 1KK7Y 1RECA 1TRFA 5DICA 3D77A 3RM1A 2KSPA 2AMIA 1K9UA 1XYDA 3DYEA 2FJUB 1GQMA 1SK6D 2L51A 4IJ7A 4NDBA 2JPOA 1DT7B 1S3PA 1YX8A 3CR5X 1BODA 1QASA 1RROA 1B4CA 3DZTA 5FYXA 2H61A 1NUBA 1XFVO 1SL9A 3DY9A 2NCPA 3NSIA 3D0YB 1IWQA 3SIBA 1QATA 5HKZA 2AAOA 2KI4B 2KDHA 1DJXA 3EK4A 3EVRA 3JVTB 1SPYA 1KK8B 1PSBA 3I5HB 3QMEA 2K2AA 2V53A 3RLZA 4CFRA 3NSLA 1KWOB 3UNWA 2K7CA 1HQVA 1G4YR 1A2XA 2KFFA 1JUOA 4AQIA 1C07A 4N1GA 2O60A 4MZLA 3BUWB 1TOPA 1LS8A 2ZN8A 1IH0A 1S1EA 5KU1A 4HSZA 4PT1A 2WC5A 1LVCD 4Q04A 1TCOB 5HKWA 1YVHA 1TNPA 1OOGA 1YX7A 1DEKA 1DTLA 4INXA 1NCXA 2BL0B 1YTZC 3DVEA 2BE6A 3I5GC 1F71A 1CTRA 2WCFA 2JT8A 4WQ2A 1OOHA 4F0ZB 2F2PA 1M39A 3S0DA 3CTNA 2KHNA 1KCYA 2Y4QA 1K93D 1YUSA 4F7FA 3HCMA 5AANA 2L2CA 1DVIA 4PHJA 3BJHA 2G9BA 4I5JA 3LCPC 3B6XA 4OCIA 2JZIA 1MQ1A 3NHTA 3N7HA 1F54A 3I5IB 2JT0A 4UPGA 1TWOA 1DJYA 2ZN9A 3BOWB 3CZ0A 5KSZA 3L47A 1P28A 1YR5A 2NXQA 2GGMA 1KK7Z 2KGRA 3NSKA 1PULA 1R2UA 3O4XA 2CT9A 1UHHA 1DF0A 2KOTA 3BUOB 4MRYA 2F3YA 2WC6A 1G8IA 1XA5A 2JWWA 2E6WA 2HETA 3BYAA 3TDZA 3OP0A 3CDNA 1WDCC 2KFGA 4ORCB 4PE4A 2L4HA 5HKYA 1A29A 5CSNA 1SCMB 1UURA 4GPLB 1EH2A 2LVIA 1K94A 1UHJA 2LANA 5FI6A 1EXRA 1Z2CB 1KSOA 2LNKA 2M7NA 4PHMA 3A4UB 4N5XA 5TNCA 1YUTA 2WCHA 2EC6B 1TNWA 1M46A 1OZSA 1Q80A 2NLNA 1WLZA 4L9MA 4P2YB 3DVMA 2L4IA 2WCEA 4NQGA 1S26D 3R1OA 4I5NB 2LUXA 4JPZB 3AAJA 1J7OA 2LP3A 1CMGA 3PN7C 5AERA 2WCJA 5I8NA 1KFXL 2OTGC 4FQOA 2NCOA 2ZRTA 1U5IB 1RWYA 4C0LA 1V1FA 2IS9A 4INWA 3TS5C 4P5OE
chains in the Genus database with same CATH topology
2EGDA 1N65A 4DRWA 5DKQA 4D1EA 3F45A 1A75A 2KFHA 1DJZA 4CIDA 1K96A 2WNDA 4MEWA 1CFDA 2I18A 2PVBA 3E3RA 1JF0A 1OOJA 3M0WA 2Y1MA 4PCWA 2GGZA 1K9PA 1OQPA 1ZMZA 1L2OC 1MF8B 1SL8A 2LAPA 3EKJA 4XJKB 1N2DA 2BBNA 4YI9A 1M31A 5AFPA 1DJGA 2JULA 3NSOA 1CMFA 4YGAA 1AK8A 1F70A 2P6BB 2KBMA 1K95A 3H4SE 2CTNA 2E30A 4MRXA 1J55A 1QX7A 4MN0A 2LCPA 1B47A 2HPSA 1BT6A 1M63B 4CFQA 1NPQA 4M2QA 1MUXA 1PRWA 1J7RA 1KQMC 2PALA 1CM1A 4WRIA 3IQQA 2ZNDA 2F33A 1IJ5A 5CSJA 1ZACA 1KFXS 2DOQA 1K2HA 2LP2A 2LHLA 5K89A 3O6BA 1CDNA 2BCAA 4ZCUA 5ER5A 5JJGA 2FCEA 4ORBB 1QV1A 3BUNB 3SG4A 4C0KA 3OB2B 4PE0A 5F6TA 1TCFA 2KQ6A 5JOLA 3SG5A 2M1KB 2JQ6A 2LVVA 2LVKA 1J1EA 4MLWA 4DUQA 2COLB 1TNQA 1IGVA 1ODBA 4PE1A 2LLTA 2KAXA 3EKHA 1PSRA 1NP8A 4GAOA 3I5GB 1GGZA 1KFUL 3DVKA 3FIAA 4PDZA 2F2OA 2Q4UA 1JSAA 1DGVA 1ZUZA 1OMVA 3WXAA 1XFZO 1XFXO 2L98A 3PALA 1SW8A 1G33A 1AP4A 1EG3A 3VRRA 4ZCVA 1NX0A 1ZOTB 5D69A 1QLKA 4NDDA 1F55A 2Q91A 1WRZA 1AJ4A 4GGFA 1EJ3A 3JTDB 1Y1XA 3DF0A 1BLQA 2KI4C 1IQ3A 1FI5A 1IG5A 2B1UA 3GK2A 1AUIB 3A8RA 3JVTC 1PK0D 1J7PA 1PVAA 1GJYA 1YVLA 1JFKA 3LK0A 1BJFA 1YURA 1QLSA 1SKTA 1QS7A 3CWGA 1GGWA 1PALA 2LMVA 4USLA 4R1EA 1KWOC 4HRGA 1BU3A 1NX2A 2OPOA 1WDCB 2ZRSA 4QJ5B 1QVIY 1LKJA 1XK4C 3WNXB 1OSAA 2CNPA 2QACA 4U8DA 1SNLA 3BUMB 2WOSA 4XYNA 4MBEA 1TNXA 4MVFA 1JC2A 4GGFC 1CDLA 1NIWA 2JNXA 2WC8A 3LK1A 4GFTA 2OS8C 2VRGA 1ALWA 3DD4A 3CGAA 4BY5A 1JF2A 2LV7A 3KHEA 1B7TY 1KFUS 3IF7A 2LMUA 1EG4A 2SASA 4CPVA 1DF0B 1E8AA 1F4QA 2KNEA 5I2QA 3PN7B 2MHHA 1QIVA 2KQYA 1MR8A 2KBIA 3PFVA 1SL7A 2HQ8A 2KGBC 3FS7A 4JQ0D 4A4BA 2EHBA 2LHIA 1F4OA 4GBAA 3KEVA 1XFWO 2CBLA 3O78A 1A03A 1NWDA 1QX2A 2K0JA 5J3XA 5B8IB 2PASA 2KAYA 3VRPA 1LXFC 2JTZA 1V1GA 2AUCA 2BCBA 2GV5A 3GK1A 1B1GA 4C0JA 5I2OA 4JWQA 4QJ3B 2PMYA 3PATA 4DS7A 1MXLC 2SCPA 2JT3A 3OX6A 1A4PA 1SBJA 3KF9A 1RTP1 2KYCA 1HT9A 1NCYA 1J7QA 1RK9A 3BUXB 1XVJA 1VRKA 1A75B 2F3ZA 1UP5A 2Y5IA 1B9AA 1B8RA 1UHKA 3TDIA 2BECA 1FW4A 3KO0A 3SJSA 2L5XB 1KQMB 2FCDA 2M29A 1F8HA 4PALA 2PSRA 2I2RE 4HREE 4A4CA 1CLLA 1OZOA 2KI6D 4DIRA 1QVIZ 4MZJA 4YI8A 5HLVA 5BPJA 1DMOA 3BXKA 5AEQA 1OMRA 2K2FA 5G08A 1WLMA 1DGUA 4I5LB 1TN4A 2F8PA 2CCMA 2MAZA 1FPWA 1MXEA 3PM8A 2M3WA 2LUCA 3SG7A 2M8UA 1B7TZ 1BR4B 1SR6C 2H2KA 2MA2A 2ZNEA 1C7WA 3GOFA 1QIWA 1BMOA 1CLMA 1QV0A 1KSMA 3CR2A 4GGNA 2FOTA 3CR4X 1OMDA 4AQJA 3TUYC 1SY9A 1NX1A 4I5KA 1B8CA 2M1UA 3D0YA 1CFFA 1Y0VH 3EVUA 3I5FC 4YGEB 1CFPA 2BKIB 1CDMA 2K61A 4CLNA 1SYMA 1OE9B 2MBXA 4YBHB 2L2EA 4PHKA 2LLSA 2K7DA 1AVSA 3FWBA 3LL8B 4FTGA 4DCKA 1QJTA 1J1DA 1XK4A 2K7BA 4OR9B 3SG2A 1B8LA 2BCXA 5HYDA 2KYFA 1RFJA 2PRUA 1SMGA 3CS1A 2MLFC 1XFYO 1S5GY 3MSEB 4MSPA 1X02A 1WRKA 2WCBA 2ZKMX 2LC5A 5CSFA 3AKBA 1UHNA 1NYAA 3PLFB 2K7OA 2M97A 1TIZA 5AXIA 2JNFA 1IQ5A 2LVJA 2TN4A 4BY4A 2MRDA 1CDPA 1UUSA 1S36A 1QXPA 3FWCA 1IJ6A 1MWNA 1QTXA 4WQ3A 4YRUA 1QX5B 1WRLA 2H61C 1KK8C 3I5HC 1EH2A 2JOJA 4YGDB 3EK8A 2A4JA 1XFUO 1UHIA 2NZ0A 2KAVA 2KI6C 2M0RA 2OS8B 3DF0B 1CM4A 2BE4A 2ISDA 3VGOA 3DVJA 2M7LA 3AAKA 3VRQA 3K21A 5PALA 1AHRA 2M49B 1BF5A 1K9KA 1NSHA 1YRTB 2MJWB 3BOWA 4PHNA 1LINA 3SG3A 2JPTA 1JWDA 2LLUA 1YUUA 5GQQC 1CNPA 2BL0C 1SRAA 2JC2A 3ICBA 4E68A 1L7ZA 3BQ3A 2JTTA 3CLNA 3JTDC 3O4YA 2OTGB 5ER4X 4M2PA 1BR1B 1IRJA 1CKKA 4QJ4B 3TS5B 3SG6A 2JRFA 3OHMB 1CFCA 1LA0A 4PE7A 2K8MB 2HF5A 3I5IC 1W7JB 3SIAA 2MLEC 1BOCA 5CPVA 1ZFSA 1AJ5A 4OKHA 1JBAA 1DJIA 4MZKA 1IKUA 1W7IB 2M9GA 2ZFDA 1CB1A 3WHUB 3HX4A 1S6IA 1L2OB 2JXLA 4OVNF 3CZTX 4HRHA 4ETOA 1H4BA 2HQWA 1TTXA 3IQOA 3O2PA 4GUKA 1U5IA 2LM5A 5I2LA 3ZNIA 1FF1A 3D10A 2I94A 4M2OA 3NXAA 4OV2A 1S5GZ 3VROA 3EK7A 2L0PA 2CXJA 4IL1A 1SCMC 2LMTA 1Y1UA 2L50A 3TZ1A 4GNKB 1NX3A 3OX5A 4NDCA 2EC6C 2Y1NA 1KQVA 5DKNA 5DKRA 1RJVA 2RGIA 1H8BA 3GK4X 1ALVA 2QPTA 3KPXA 1Y1AA 1UWOA 5IBWA 1BG1A 5CSIA 4XJKA 3WHTB 1D1OA 4YGBB 1PVBA 3AKAA 2BBMA 2D8NA 1CLBA 1FI6A 3LLEA 4AOMA 1K8UA 2O5GA 1Y6WA 1EL4A 1MHOA 5KTYA 4ORAB 1SCVA 1SR6B 2G2BA 1LA3A 2JXCA 2WORA 1N0YA 2I7AA 1K90D 3QRXA 2LE9B 5D7FA 1S6CA 3TUYB 4N1FA 4YGCB 2JU0A 3ZWHA 1M45A 1R6PA 1JFJA 1WY9A 1C7VA 3PSRA 5HLOA 3I5FB 3VRNA 1XO5A 1DJWA 1NCZA 2BKHB 1S6JA 3TDUA 3OB1B 3C1VA 1YRUB 2R2IA 4ICBA 3EVVA 4TNCA 1DJHA 1FBVA 1KK7Y 1RECA 1TRFA 3RM1A 2KSPA 2AMIA 1K9UA 1XYDA 2FJUB 1GQMA 1SK6D 2L51A 1DT7B 4NDBA 1S3PA 1YX8A 3CR5X 1BODA 1QASA 1RROA 1B4CA 5FYXA 2H61A 1NUBA 1XFVO 1SL9A 2NCPA 3NSIA 3D0YB 1IWQA 3SIBA 1QATA 5HKZA 2AAOA 2KI4B 2KDHA 1DJXA 3EK4A 3EVRA 3JVTB 1SPYA 1KK8B 1PSBA 3I5HB 2K2AA 2V53A 3RLZA 4CFRA 3NSLA 1KWOB 2K7CA 1HQVA 1G4YR 1A2XA 2KFFA 1JUOA 4AQIA 1C07A 4N1GA 2O60A 4MZLA 3BUWB 1TOPA 2ZN8A 1IH0A 1S1EA 5KU1A 4HSZA 1LVCD 4Q04A 1TCOB 5HKWA 1YVHA 1TNPA 1YX7A 1DTLA 1NCXA 2BL0B 1YTZC 3DVEA 2BE6A 3I5GC 1F71A 1CTRA 2WCFA 2JT8A 4WQ2A 4F0ZB 2F2PA 1M39A 3CTNA 2KHNA 1KCYA 2Y4QA 1K93D 1YUSA 3HCMA 5AANA 1DVIA 4PHJA 2G9BA 4I5JA 3LCPC 4OCIA 2JZIA 1MQ1A 1F54A 3I5IB 2JT0A 4UPGA 1DJYA 2ZN9A 3BOWB 5KSZA 1YR5A 2NXQA 2GGMA 1KK7Z 2KGRA 3NSKA 1PULA 1R2UA 2CT9A 1UHHA 1DF0A 2KOTA 3BUOB 4MRYA 2F3YA 1G8IA 1XA5A 2JWWA 2E6WA 2HETA 3BYAA 3TDZA 3OP0A 1WDCC 2KFGA 4ORCB 4PE4A 2L4HA 5HKYA 1A29A 5CSNA 1SCMB 1UURA 4GPLB 2LVIA 1K94A 1UHJA 2LANA 1EXRA 2LNKA 1KSOA 2M7NA 4PHMA 3A4UB 4N5XA 5TNCA 1YUTA 2EC6B 1TNWA 1M46A 1OZSA 1Q80A 2NLNA 1WLZA 4L9MA 4P2YB 3DVMA 2L4IA 2WCEA 4NQGA 1S26D 4JPZB 4I5NB 2LUXA 1J7OA 3AAJA 2LP3A 1CMGA 3PN7C 5AERA 5I8NA 1KFXL 2OTGC 4FQOA 2NCOA 2ZRTA 1U5IB 1RWYA 4C0LA 1V1FA 2IS9A 3TS5C 4P5OE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EGD A;  1N65 A;  4DRW A;  5DKQ A;  4D1E A;  3F45 A;  1A75 A;  2KFH A;  1DJZ A;  4CID A;  1K96 A;  2WND A;  4MEW A;  1CFD A;  2I18 A;  2PVB A;  3E3R A;  1JF0 A;  1OOJ A;  3M0W A;  2Y1M A;  4PCW A;  2GGZ A;  1K9P A;  1OQP A;  1ZMZ A;  1L2O C;  1MF8 B;  1SL8 A;  2LAP A;  3EKJ A;  4XJK B;  1N2D A;  2BBN A;  4YI9 A;  1M31 A;  5AFP A;  1DJG A;  2JUL A;  3NSO A;  1CMF A;  4YGA A;  1AK8 A;  1F70 A;  2P6B B;  2KBM A;  1K95 A;  3H4S E;  2CTN A;  2E30 A;  4MRX A;  1J55 A;  1QX7 A;  4MN0 A;  2LCP A;  1B47 A;  2HPS A;  1BT6 A;  1M63 B;  4CFQ A;  1NPQ A;  4M2Q A;  1MUX A;  1PRW A;  1J7R A;  1KQM C;  2PAL A;  1CM1 A;  4WRI A;  3IQQ A;  2ZND A;  2F33 A;  1IJ5 A;  5CSJ A;  1ZAC A;  1KFX S;  2DOQ A;  1K2H A;  2LP2 A;  2LHL A;  5K89 A;  3O6B A;  1CDN A;  2BCA A;  4ZCU A;  5ER5 A;  5JJG A;  2FCE A;  4ORB B;  1QV1 A;  3BUN B;  3SG4 A;  4C0K A;  3OB2 B;  4PE0 A;  5F6T A;  1TCF A;  2KQ6 A;  5JOL A;  3SG5 A;  2M1K B;  2JQ6 A;  2LVV A;  2LVK A;  1J1E A;  4MLW A;  4DUQ A;  2COL B;  1TNQ A;  1IGV A;  1ODB A;  4PE1 A;  2LLT A;  2KAX A;  3EKH A;  1PSR A;  1NP8 A;  4GAO A;  3I5G B;  1GGZ A;  1KFU L;  3DVK A;  3FIA A;  4PDZ A;  2F2O A;  2Q4U A;  1JSA A;  1DGV A;  1ZUZ A;  1OMV A;  3WXA A;  1XFZ O;  1XFX O;  2L98 A;  3PAL A;  1SW8 A;  1G33 A;  1AP4 A;  1EG3 A;  3VRR A;  4ZCV A;  1NX0 A;  1ZOT B;  5D69 A;  1QLK A;  4NDD A;  1F55 A;  2Q91 A;  1WRZ A;  1AJ4 A;  4GGF A;  1EJ3 A;  3JTD B;  1Y1X A;  3DF0 A;  1BLQ A;  2KI4 C;  1IQ3 A;  1FI5 A;  1IG5 A;  2B1U A;  3GK2 A;  1AUI B;  3A8R A;  3JVT C;  1PK0 D;  1J7P A;  1PVA A;  1GJY A;  1YVL A;  1JFK A;  3LK0 A;  1BJF A;  1YUR A;  1QLS A;  1SKT A;  1QS7 A;  3CWG A;  1GGW A;  1PAL A;  2LMV A;  4USL A;  4R1E A;  1KWO C;  4HRG A;  1BU3 A;  1NX2 A;  2OPO A;  1WDC B;  2ZRS A;  4QJ5 B;  1QVI Y;  1LKJ A;  1XK4 C;  3WNX B;  1OSA A;  2CNP A;  2QAC A;  4U8D A;  1SNL A;  3BUM B;  2WOS A;  4XYN A;  4MBE A;  1TNX A;  4MVF A;  1JC2 A;  4GGF C;  1CDL A;  1NIW A;  2JNX A;  2WC8 A;  3LK1 A;  4GFT A;  2OS8 C;  2VRG A;  1ALW A;  3DD4 A;  3CGA A;  4BY5 A;  1JF2 A;  2LV7 A;  3KHE A;  1B7T Y;  1KFU S;  3IF7 A;  2LMU A;  1EG4 A;  2SAS A;  4CPV A;  1DF0 B;  1E8A A;  1F4Q A;  2KNE A;  5I2Q A;  3PN7 B;  2MHH A;  1QIV A;  2KQY A;  1MR8 A;  2KBI A;  3PFV A;  1SL7 A;  2HQ8 A;  2KGB C;  3FS7 A;  4JQ0 D;  4A4B A;  2EHB A;  2LHI A;  1F4O A;  4GBA A;  3KEV A;  1XFW O;  2CBL A;  3O78 A;  1A03 A;  1NWD A;  1QX2 A;  2K0J A;  5J3X A;  5B8I B;  2PAS A;  2KAY A;  3VRP A;  1LXF C;  2JTZ A;  1V1G A;  2AUC A;  2BCB A;  2GV5 A;  3GK1 A;  1B1G A;  4C0J A;  5I2O A;  4JWQ A;  4QJ3 B;  2PMY A;  3PAT A;  4DS7 A;  1MXL C;  2SCP A;  2JT3 A;  3OX6 A;  1A4P A;  1SBJ A;  3KF9 A;  1RTP 1;  2KYC A;  1HT9 A;  1NCY A;  1J7Q A;  1RK9 A;  3BUX B;  1XVJ A;  1VRK A;  1A75 B;  2F3Z A;  1UP5 A;  2Y5I A;  1B9A A;  1B8R A;  1UHK A;  3TDI A;  2BEC A;  1FW4 A;  3KO0 A;  3SJS A;  2L5X B;  1KQM B;  2FCD A;  2M29 A;  1F8H A;  4PAL A;  2PSR A;  2I2R E;  4HRE E;  4A4C A;  1CLL A;  1OZO A;  2KI6 D;  4DIR A;  1QVI Z;  4MZJ A;  4YI8 A;  5HLV A;  5BPJ A;  1DMO A;  3BXK A;  5AEQ A;  1OMR A;  2K2F A;  5G08 A;  1WLM A;  1DGU A;  4I5L B;  1TN4 A;  2F8P A;  2CCM A;  2MAZ A;  1FPW A;  1MXE A;  3PM8 A;  2M3W A;  2LUC A;  3SG7 A;  2M8U A;  1B7T Z;  1BR4 B;  1SR6 C;  2H2K A;  2MA2 A;  2ZNE A;  1C7W A;  3GOF A;  1QIW A;  1BMO A;  1CLM A;  1QV0 A;  1KSM A;  3CR2 A;  4GGN A;  2FOT A;  3CR4 X;  1OMD A;  4AQJ A;  3TUY C;  1SY9 A;  1NX1 A;  4I5K A;  1B8C A;  2M1U A;  3D0Y A;  1CFF A;  1Y0V H;  3EVU A;  3I5F C;  4YGE B;  1CFP A;  2BKI B;  1CDM A;  2K61 A;  4CLN A;  1SYM A;  1OE9 B;  2MBX A;  4YBH B;  2L2E A;  4PHK A;  2LLS A;  2K7D A;  1AVS A;  3FWB A;  3LL8 B;  4FTG A;  4DCK A;  1QJT A;  1J1D A;  1XK4 A;  2K7B A;  4OR9 B;  3SG2 A;  1B8L A;  2BCX A;  5HYD A;  2KYF A;  1RFJ A;  2PRU A;  1SMG A;  3CS1 A;  2MLF C;  1XFY O;  1S5G Y;  3MSE B;  4MSP A;  1X02 A;  1WRK A;  2WCB A;  2ZKM X;  2LC5 A;  5CSF A;  3AKB A;  1UHN A;  1NYA A;  3PLF B;  2K7O A;  2M97 A;  1TIZ A;  5AXI A;  2JNF A;  1IQ5 A;  2LVJ A;  2TN4 A;  4BY4 A;  2MRD A;  1CDP A;  1UUS A;  1S36 A;  1QXP A;  3FWC A;  1IJ6 A;  1MWN A;  1QTX A;  4WQ3 A;  4YRU A;  1QX5 B;  1WRL A;  2H61 C;  1KK8 C;  3I5H C;  1EH2 A;  2JOJ A;  4YGD B;  3EK8 A;  2A4J A;  1XFU O;  1UHI A;  2NZ0 A;  2KAV A;  2KI6 C;  2M0R A;  2OS8 B;  3DF0 B;  1CM4 A;  2BE4 A;  2ISD A;  3VGO A;  3DVJ A;  2M7L A;  3AAK A;  3VRQ A;  3K21 A;  5PAL A;  1AHR A;  2M49 B;  1BF5 A;  1K9K A;  1NSH A;  1YRT B;  2MJW B;  3BOW A;  4PHN A;  1LIN A;  3SG3 A;  2JPT A;  1JWD A;  2LLU A;  1YUU A;  5GQQ C;  1CNP A;  2BL0 C;  1SRA A;  2JC2 A;  3ICB A;  4E68 A;  1L7Z A;  3BQ3 A;  2JTT A;  3CLN A;  3JTD C;  3O4Y A;  2OTG B;  5ER4 X;  4M2P A;  1BR1 B;  1IRJ A;  1CKK A;  4QJ4 B;  3TS5 B;  3SG6 A;  2JRF A;  3OHM B;  1CFC A;  1LA0 A;  4PE7 A;  2K8M B;  2HF5 A;  3I5I C;  1W7J B;  3SIA A;  2MLE C;  1BOC A;  5CPV A;  1ZFS A;  1AJ5 A;  4OKH A;  1JBA A;  1DJI A;  4MZK A;  1IKU A;  1W7I B;  2M9G A;  2ZFD A;  1CB1 A;  3WHU B;  3HX4 A;  1S6I A;  1L2O B;  2JXL A;  4OVN F;  3CZT X;  4HRH A;  4ETO A;  1H4B A;  2HQW A;  1TTX A;  3IQO A;  3O2P A;  4GUK A;  1U5I A;  2LM5 A;  5I2L A;  3ZNI A;  1FF1 A;  3D10 A;  2I94 A;  4M2O A;  3NXA A;  4OV2 A;  1S5G Z;  3VRO A;  3EK7 A;  2L0P A;  2CXJ A;  4IL1 A;  1SCM C;  2LMT A;  1Y1U A;  2L50 A;  3TZ1 A;  4GNK B;  1NX3 A;  3OX5 A;  4NDC A;  2EC6 C;  2Y1N A;  1KQV A;  5DKN A;  5DKR A;  1RJV A;  2RGI A;  1H8B A;  3GK4 X;  1ALV A;  2QPT A;  3KPX A;  1Y1A A;  1UWO A;  5IBW A;  1BG1 A;  5CSI A;  4XJK A;  3WHT B;  1D1O A;  4YGB B;  1PVB A;  3AKA A;  2BBM A;  2D8N A;  1CLB A;  1FI6 A;  3LLE A;  4AOM A;  1K8U A;  2O5G A;  1Y6W A;  1EL4 A;  1MHO A;  5KTY A;  4ORA B;  1SCV A;  1SR6 B;  2G2B A;  1LA3 A;  2JXC A;  2WOR A;  1N0Y A;  2I7A A;  1K90 D;  3QRX A;  2LE9 B;  5D7F A;  1S6C A;  3TUY B;  4N1F A;  4YGC B;  2JU0 A;  3ZWH A;  1M45 A;  1R6P A;  1JFJ A;  1WY9 A;  1C7V A;  3PSR A;  5HLO A;  3I5F B;  3VRN A;  1XO5 A;  1DJW A;  1NCZ A;  2BKH B;  1S6J A;  3TDU A;  3OB1 B;  3C1V A;  1YRU B;  2R2I A;  4ICB A;  3EVV A;  4TNC A;  1DJH A;  1FBV A;  1KK7 Y;  1REC A;  1TRF A;  3RM1 A;  2KSP A;  2AMI A;  1K9U A;  1XYD A;  2FJU B;  1GQM A;  1SK6 D;  2L51 A;  1DT7 B;  4NDB A;  1S3P A;  1YX8 A;  3CR5 X;  1BOD A;  1QAS A;  1RRO A;  1B4C A;  5FYX A;  2H61 A;  1NUB A;  1XFV O;  1SL9 A;  2NCP A;  3NSI A;  3D0Y B;  1IWQ A;  3SIB A;  1QAT A;  5HKZ A;  2AAO A;  2KI4 B;  2KDH A;  1DJX A;  3EK4 A;  3EVR A;  3JVT B;  1SPY A;  1KK8 B;  1PSB A;  3I5H B;  2K2A A;  2V53 A;  3RLZ A;  4CFR A;  3NSL A;  1KWO B;  2K7C A;  1HQV A;  1G4Y R;  1A2X A;  2KFF A;  1JUO A;  4AQI A;  1C07 A;  4N1G A;  2O60 A;  4MZL A;  3BUW B;  1TOP A;  2ZN8 A;  1IH0 A;  1S1E A;  5KU1 A;  4HSZ A;  1LVC D;  4Q04 A;  1TCO B;  5HKW A;  1YVH A;  1TNP A;  1YX7 A;  1DTL A;  1NCX A;  2BL0 B;  1YTZ C;  3DVE A;  2BE6 A;  3I5G C;  1F71 A;  1CTR A;  2WCF A;  2JT8 A;  4WQ2 A;  4F0Z B;  2F2P A;  1M39 A;  3CTN A;  2KHN A;  1KCY A;  2Y4Q A;  1K93 D;  1YUS A;  3HCM A;  5AAN A;  1DVI A;  4PHJ A;  2G9B A;  4I5J A;  3LCP C;  4OCI A;  2JZI A;  1MQ1 A;  1F54 A;  3I5I B;  2JT0 A;  4UPG A;  1DJY A;  2ZN9 A;  3BOW B;  5KSZ A;  1YR5 A;  2NXQ A;  2GGM A;  1KK7 Z;  2KGR A;  3NSK A;  1PUL A;  1R2U A;  2CT9 A;  1UHH A;  1DF0 A;  2KOT A;  3BUO B;  4MRY A;  2F3Y A;  1G8I A;  1XA5 A;  2JWW A;  2E6W A;  2HET A;  3BYA A;  3TDZ A;  3OP0 A;  1WDC C;  2KFG A;  4ORC B;  4PE4 A;  2L4H A;  5HKY A;  1A29 A;  5CSN A;  1SCM B;  1UUR A;  4GPL B;  2LVI A;  1K94 A;  1UHJ A;  2LAN A;  1EXR A;  2LNK A;  1KSO A;  2M7N A;  4PHM A;  3A4U B;  4N5X A;  5TNC A;  1YUT A;  2EC6 B;  1TNW A;  1M46 A;  1OZS A;  1Q80 A;  2NLN A;  1WLZ A;  4L9M A;  4P2Y B;  3DVM A;  2L4I A;  2WCE A;  4NQG A;  1S26 D;  4JPZ B;  4I5N B;  2LUX A;  1J7O A;  3AAJ A;  2LP3 A;  1CMG A;  3PN7 C;  5AER A;  5I8N A;  1KFX L;  2OTG C;  4FQO A;  2NCO A;  2ZRT A;  1U5I B;  1RWY A;  4C0L A;  1V1F A;  2IS9 A;  3TS5 C;  4P5O E; 
#chains in the Genus database with same CATH topology
 2EGD A;  1N65 A;  4DRW A;  5DKQ A;  4D1E A;  3F45 A;  1A75 A;  2KFH A;  1DJZ A;  1OOF A;  1K96 A;  2WND A;  3OBV A;  4CID A;  4MEW A;  2L5Y A;  1CFD A;  2I18 A;  2PVB A;  3E3R A;  1JF0 A;  1OOJ A;  3M0W A;  2Y1M A;  4PCW A;  2GGZ A;  1K9P A;  1OQP A;  5FI7 A;  1C3Y A;  1ZMZ A;  1L2O C;  1MF8 B;  1SL8 A;  2LAP A;  3BFH A;  3EKJ A;  4XJK B;  1N2D A;  2BBN A;  4YI9 A;  1M31 A;  5AFP A;  1DJG A;  2JUL A;  3NSO A;  1CMF A;  4YGA A;  1TUZ A;  1AK8 A;  1F70 A;  2P6B B;  2KBM A;  1K95 A;  3H4S E;  2CTN A;  2E30 A;  4MRX A;  1J55 A;  1QX7 A;  4MN0 A;  2LCP A;  1B47 A;  2HPS A;  1BT6 A;  1M63 B;  4CFQ A;  1NPQ A;  4M2Q A;  1MUX A;  2KPH A;  1PRW A;  1J7R A;  1KQM C;  2PAL A;  1CM1 A;  4WRI A;  3IQQ A;  2ZND A;  2F33 A;  1IJ5 A;  5CSJ A;  1ZAC A;  3D76 A;  1KFX S;  2DOQ A;  1K2H A;  2LP2 A;  2LHL A;  5K89 A;  3O6B A;  2KLE A;  1CDN A;  2BCA A;  4ZCU A;  1DQE A;  5ER5 A;  5JJG A;  2FCE A;  4ORB B;  1QV1 A;  3BUN B;  3SG4 A;  4C0K A;  3OB2 B;  4PE0 A;  5F6T A;  1TCF A;  2KQ6 A;  5JOL A;  1XFR A;  3SG5 A;  2M1K B;  2JQ6 A;  2LVV A;  2LVK A;  1W9Z A;  1J1E A;  4MLW A;  4DUQ A;  2COL B;  1TNQ A;  1IGV A;  1ODB A;  4PE1 A;  2LLT A;  2KAX A;  3EKH A;  1PSR A;  1NP8 A;  4GAO A;  3I5G B;  1GGZ A;  1KFU L;  3DVK A;  3B7A A;  3FIA A;  3S0F A;  4JD9 A;  4PDZ A;  2F2O A;  2Q4U A;  1JSA A;  1DGV A;  1ZUZ A;  3SS5 A;  1OMV A;  3WXA A;  1XFZ O;  1XFX O;  1SSE B;  2L98 A;  1SW8 A;  1G33 A;  3PAL A;  1EG3 A;  3VRR A;  1AP4 A;  4ZCV A;  4OZD A;  1NX0 A;  1ZOT B;  3CZ1 A;  3NHI A;  3PM2 A;  3CZ2 A;  5D69 A;  1QLK A;  4NDD A;  1F55 A;  2Q91 A;  1QWV A;  1WRZ A;  1AJ4 A;  4GGF A;  1EJ3 A;  3JTD B;  1ORG A;  1Y1X A;  3DF0 A;  1BLQ A;  2KI4 C;  1IQ3 A;  1FI5 A;  1IG5 A;  2B1U A;  3GK2 A;  1AUI B;  3A8R A;  3JVT C;  1PK0 D;  1J7P A;  1PVA A;  1GJY A;  1YVL A;  3S0G A;  1JFK A;  3LK0 A;  1IIO A;  1BJF A;  1YUR A;  3DXL A;  1QLS A;  1SKT A;  1QS7 A;  3CWG A;  1GGW A;  1PAL A;  2LMV A;  4USL A;  4R1E A;  1KWO C;  4HRG A;  3S0A A;  1BU3 A;  1NX2 A;  2OPO A;  1WDC B;  2ZRS A;  4QJ5 B;  1QVI Y;  1LKJ A;  1XK4 C;  3WNX B;  1OSA A;  2CNP A;  3S0E A;  2QEB A;  2QAC A;  3L4A A;  4U8D A;  1SNL A;  3BUM B;  2WOS A;  4XYN A;  4MBE A;  1TNX A;  4MVF A;  1JC2 A;  4GGF C;  1CDL A;  1NIW A;  2JNX A;  4KYN A;  2WC8 A;  3LK1 A;  4GFT A;  2OS8 C;  2VRG A;  1ALW A;  3DD4 A;  3CGA A;  4BY5 A;  1JF2 A;  2LV7 A;  3KHE A;  1B7T Y;  1KFU S;  3IF7 A;  2LMU A;  1EG4 A;  2SAS A;  4CPV A;  1DF0 B;  1E8A A;  1F4Q A;  2P71 A;  2KNE A;  5I2Q A;  3PN7 B;  2MHH A;  1QIV A;  2KQY A;  1MR8 A;  2KBI A;  3PFV A;  1SL7 A;  2HQ8 A;  2KGB C;  3FS7 A;  4JQ0 D;  4A4B A;  2EHB A;  2LHI A;  1F4O A;  4GBA A;  3CAB A;  3KEV A;  1XFW O;  2CBL A;  3O78 A;  1A03 A;  1NWD A;  1QX2 A;  2K0J A;  5J3X A;  5B8I B;  2PAS A;  2KAY A;  3UO9 A;  3NGV A;  3VRP A;  1LXF C;  2JTZ A;  1V1G A;  2AUC A;  2BCB A;  2BAP A;  2GV5 A;  3GK1 A;  1DC1 A;  1B1G A;  3K1E A;  4C0J A;  5I2O A;  4JWQ A;  4QJ3 B;  2PMY A;  3PAT A;  4DS7 A;  1MXL C;  2SCP A;  2PYQ A;  2JT3 A;  3SS3 A;  3OX6 A;  1A4P A;  1SBJ A;  3KF9 A;  1RTP 1;  2KYC A;  1HT9 A;  1NCY A;  2ERB A;  4FQT A;  1J7Q A;  1RK9 A;  3BUX B;  2KLD A;  1XVJ A;  1VRK A;  1A75 B;  1T14 A;  2F3Z A;  1UP5 A;  2Y5I A;  1B9A A;  1B8R A;  1UHK A;  2P70 A;  2BEC A;  1FW4 A;  3KO0 A;  3TDI A;  3SJS A;  2L5X B;  1KQM B;  2FCD A;  3R1P A;  2M29 A;  2BNX A;  1F8H A;  4PAL A;  4JKT A;  2PSR A;  2I2R E;  4HRE E;  4A4C A;  1CLL A;  1OZO A;  2K60 A;  2KI6 D;  4DIR A;  1QVI Z;  4MZJ A;  4YI8 A;  5HLV A;  3D74 A;  5BPJ A;  1DMO A;  3B86 A;  3BXK A;  5AEQ A;  1OMR A;  3FE6 A;  2WCK A;  2K2F A;  5G08 A;  1WLM A;  1DGU A;  4I5L B;  1TN4 A;  2F8P A;  2CCM A;  2MAZ A;  1FPW A;  1MXE A;  3PM8 A;  2M3W A;  2LUC A;  1Z4H A;  3SG7 A;  2M8U A;  1B7T Z;  1BR4 B;  1SR6 C;  2H2K A;  2MA2 A;  2ZNE A;  1C7W A;  3GOF A;  1QIW A;  1BMO A;  1CLM A;  1QV0 A;  1KSM A;  3CR2 A;  4GGN A;  2FOT A;  3CR4 X;  1OMD A;  4AQJ A;  3TUY C;  1SY9 A;  3B88 A;  2QEO A;  1NX1 A;  4I5K A;  1B8C A;  3R72 A;  5FI2 A;  2M1U A;  3D0Y A;  1CFF A;  1Y0V H;  3EVU A;  3I5F C;  4YGE B;  2WCL A;  2BKI B;  1CDM A;  2K61 A;  4CLN A;  1CFP A;  1SYM A;  3D75 A;  1OE9 B;  2MBX A;  4YBH B;  2L2E A;  4PHK A;  2LLS A;  2K7D A;  1AVS A;  3FWB A;  3LL8 B;  1OW4 A;  4FTG A;  4DCK A;  1QJT A;  3PJI A;  1J1D A;  1XK4 A;  2K7B A;  3R1V A;  4OR9 B;  1B8L A;  2BCX A;  3SG2 A;  5HYD A;  2KYF A;  1RFJ A;  2PRU A;  1SMG A;  3CS1 A;  2MLF C;  1XFY O;  1S5G Y;  3MSE B;  3D78 A;  4MSP A;  1X02 A;  1WRK A;  2WCB A;  2ZKM X;  2LC5 A;  5CSF A;  3AKB A;  3IVT A;  1UHN A;  1NYA A;  3PLF B;  2K7O A;  2M97 A;  1TIZ A;  5AXI A;  2JNF A;  1IQ5 A;  2LVJ A;  2TN4 A;  4BY4 A;  2MRD A;  1CDP A;  1UUS A;  1S36 A;  1QXP A;  3FWC A;  1IJ6 A;  1MWN A;  1QTX A;  4WQ3 A;  4YRU A;  1C3Z A;  1QX5 B;  1WRL A;  1KK8 C;  2H61 C;  3I5H C;  2JOJ A;  4YGD B;  3EK8 A;  2A4J A;  1XFU O;  1UHI A;  2QDI A;  2NZ0 A;  2KAV A;  2KI6 C;  2M0R A;  2OS8 B;  3DF0 B;  1CM4 A;  2BE4 A;  2ISD A;  3VGO A;  3DVJ A;  2M7L A;  3AAK A;  3VRQ A;  2WCM A;  3SS4 A;  3S0B A;  1DEL A;  3K21 A;  5PAL A;  1AHR A;  2M49 B;  3FE9 A;  1BF5 A;  1K9K A;  1NSH A;  1YRT B;  2MJW B;  3BOW A;  4PHN A;  1LIN A;  2FJY A;  3SG3 A;  2JPT A;  1JWD A;  2LLU A;  1YUU A;  1GM0 A;  5GQQ C;  1CNP A;  2BL0 C;  1SRA A;  2JC2 A;  5D3O A;  3ICB A;  4E68 A;  1L7Z A;  3BQ3 A;  2JTT A;  3CLN A;  3JTD C;  3O4Y A;  2OTG B;  5ER4 X;  4M2P A;  1BR1 B;  1IRJ A;  2QEH A;  1CKK A;  4QJ4 B;  3EG5 B;  3TS5 B;  3SG6 A;  2JRF A;  3BFA A;  3OHM B;  2QEV A;  1CFC A;  1LA0 A;  4PE7 A;  2K8M B;  2HF5 A;  3I5I C;  1W7J B;  3SIA A;  2MLE C;  3B87 A;  1BOC A;  5CPV A;  1ZFS A;  1AJ5 A;  4OKH A;  2PQL A;  1DJI A;  1JBA A;  4MZK A;  1IKU A;  1W7I B;  2M9G A;  2ZFD A;  1CB1 A;  5HL1 A;  3WHU B;  3HX4 A;  1S6I A;  1L2O B;  2JXL A;  4OVN F;  3CZT X;  4HRH A;  2GTE A;  4ETO A;  1H4B A;  2HQW A;  1TTX A;  3IQO A;  3O2P A;  4GUK A;  1TUJ A;  1U5I A;  2LM5 A;  5I2L A;  3ZNI A;  5I94 A;  1FF1 A;  3D10 A;  2I94 A;  4M2O A;  3NXA A;  4OV2 A;  1S5G Z;  3VRO A;  3EK7 A;  2L0P A;  2CXJ A;  4IL1 A;  1SCM C;  2LMT A;  3L4L A;  1Y1U A;  2L50 A;  3TZ1 A;  4GNK B;  1NX3 A;  3OX5 A;  4NDC A;  2EC6 C;  2Y1N A;  3BFB A;  1KQV A;  5DKN A;  5DKR A;  1RJV A;  2RGI A;  1H8B A;  3D73 A;  3GK4 X;  1ALV A;  2QPT A;  3KPX A;  1Y1A A;  1UWO A;  5IBW A;  1BG1 A;  5CSI A;  4XJK A;  3WHT B;  1D1O A;  4YGB B;  1PVB A;  3AKA A;  2BBM A;  3RZS A;  2D8N A;  1CLB A;  1OOI X;  3LLE A;  1FI6 A;  4AOM A;  1K8U A;  2O5G A;  1Y6W A;  1EL4 A;  1MHO A;  3CYZ A;  4ORA B;  1SCV A;  1SR6 B;  2G2B A;  5KTY A;  1LA3 A;  2JXC A;  2YGU A;  3Q8I A;  2WOR A;  1N0Y A;  2I7A A;  1K90 D;  2H8V A;  2LE9 B;  3OGN A;  3QRX A;  1S6C A;  5D7F A;  3TUY B;  4N1F A;  4YGC B;  2JU0 A;  3ZWH A;  1M45 A;  1R6P A;  3VB1 A;  1JFJ A;  1WY9 A;  1C7V A;  3PSR A;  5HLO A;  3I5F B;  3VRN A;  1XO5 A;  1DJW A;  1NCZ A;  1S6J A;  2BKH B;  3TDU A;  3V2L A;  3OB1 B;  3C1V A;  1YRU B;  2R2I A;  3FE8 A;  3EVV A;  4ICB A;  4TNC A;  5EL2 A;  1DJH A;  1FBV A;  1KK7 Y;  1REC A;  1TRF A;  5DIC A;  3D77 A;  3RM1 A;  2KSP A;  2AMI A;  1K9U A;  1XYD A;  3DYE A;  2FJU B;  1GQM A;  1SK6 D;  2L51 A;  4IJ7 A;  4NDB A;  2JPO A;  1DT7 B;  1S3P A;  1YX8 A;  3CR5 X;  1BOD A;  1QAS A;  1RRO A;  1B4C A;  3DZT A;  5FYX A;  2H61 A;  1NUB A;  1XFV O;  1SL9 A;  3DY9 A;  2NCP A;  3NSI A;  3D0Y B;  1IWQ A;  3SIB A;  1QAT A;  5HKZ A;  2AAO A;  2KI4 B;  2KDH A;  1DJX A;  3EK4 A;  3EVR A;  3JVT B;  1SPY A;  1KK8 B;  1PSB A;  3I5H B;  3QME A;  2K2A A;  2V53 A;  3RLZ A;  4CFR A;  3NSL A;  1KWO B;  3UNW A;  2K7C A;  1HQV A;  1G4Y R;  1A2X A;  2KFF A;  1JUO A;  4AQI A;  1C07 A;  4N1G A;  2O60 A;  4MZL A;  3BUW B;  1TOP A;  1LS8 A;  2ZN8 A;  1IH0 A;  1S1E A;  5KU1 A;  4HSZ A;  4PT1 A;  2WC5 A;  1LVC D;  4Q04 A;  1TCO B;  5HKW A;  1YVH A;  1TNP A;  1OOG A;  1YX7 A;  1DEK A;  1DTL A;  4INX A;  1NCX A;  2BL0 B;  1YTZ C;  3DVE A;  2BE6 A;  3I5G C;  1F71 A;  1CTR A;  2WCF A;  2JT8 A;  4WQ2 A;  1OOH A;  4F0Z B;  2F2P A;  1M39 A;  3S0D A;  3CTN A;  2KHN A;  1KCY A;  2Y4Q A;  1K93 D;  1YUS A;  4F7F A;  3HCM A;  5AAN A;  2L2C A;  1DVI A;  4PHJ A;  3BJH A;  2G9B A;  4I5J A;  3LCP C;  3B6X A;  4OCI A;  2JZI A;  1MQ1 A;  3NHT A;  3N7H A;  1F54 A;  3I5I B;  2JT0 A;  4UPG A;  1TWO A;  1DJY A;  2ZN9 A;  3BOW B;  3CZ0 A;  5KSZ A;  3L47 A;  1P28 A;  1YR5 A;  2NXQ A;  2GGM A;  1KK7 Z;  2KGR A;  3NSK A;  1PUL A;  1R2U A;  3O4X A;  2CT9 A;  1UHH A;  1DF0 A;  2KOT A;  3BUO B;  4MRY A;  2F3Y A;  2WC6 A;  1G8I A;  1XA5 A;  2JWW A;  2E6W A;  2HET A;  3BYA A;  3TDZ A;  3OP0 A;  3CDN A;  1WDC C;  2KFG A;  4ORC B;  4PE4 A;  2L4H A;  5HKY A;  1A29 A;  5CSN A;  1SCM B;  1UUR A;  4GPL B;  1EH2 A;  2LVI A;  1K94 A;  1UHJ A;  2LAN A;  5FI6 A;  1EXR A;  1Z2C B;  1KSO A;  2LNK A;  2M7N A;  4PHM A;  3A4U B;  4N5X A;  5TNC A;  1YUT A;  2WCH A;  2EC6 B;  1TNW A;  1M46 A;  1OZS A;  1Q80 A;  2NLN A;  1WLZ A;  4L9M A;  4P2Y B;  3DVM A;  2L4I A;  2WCE A;  4NQG A;  1S26 D;  3R1O A;  4I5N B;  2LUX A;  4JPZ B;  3AAJ A;  1J7O A;  2LP3 A;  1CMG A;  3PN7 C;  5AER A;  2WCJ A;  5I8N A;  1KFX L;  2OTG C;  4FQO A;  2NCO A;  2ZRT A;  1U5I B;  1RWY A;  4C0L A;  1V1F A;  2IS9 A;  4INW A;  3TS5 C;  4P5O E; 
#chains in the Genus database with same CATH homology
 2EGD A;  1N65 A;  4DRW A;  5DKQ A;  4D1E A;  3F45 A;  1A75 A;  2KFH A;  1DJZ A;  4CID A;  1K96 A;  2WND A;  4MEW A;  1CFD A;  2I18 A;  2PVB A;  3E3R A;  1JF0 A;  1OOJ A;  3M0W A;  2Y1M A;  4PCW A;  2GGZ A;  1K9P A;  1OQP A;  1ZMZ A;  1L2O C;  1MF8 B;  1SL8 A;  2LAP A;  3EKJ A;  4XJK B;  1N2D A;  2BBN A;  4YI9 A;  1M31 A;  5AFP A;  1DJG A;  2JUL A;  3NSO A;  1CMF A;  4YGA A;  1AK8 A;  1F70 A;  2P6B B;  2KBM A;  1K95 A;  3H4S E;  2CTN A;  2E30 A;  4MRX A;  1J55 A;  1QX7 A;  4MN0 A;  2LCP A;  1B47 A;  2HPS A;  1BT6 A;  1M63 B;  4CFQ A;  1NPQ A;  4M2Q A;  1MUX A;  1PRW A;  1J7R A;  1KQM C;  2PAL A;  1CM1 A;  4WRI A;  3IQQ A;  2ZND A;  2F33 A;  1IJ5 A;  5CSJ A;  1ZAC A;  1KFX S;  2DOQ A;  1K2H A;  2LP2 A;  2LHL A;  5K89 A;  3O6B A;  1CDN A;  2BCA A;  4ZCU A;  5ER5 A;  5JJG A;  2FCE A;  4ORB B;  1QV1 A;  3BUN B;  3SG4 A;  4C0K A;  3OB2 B;  4PE0 A;  5F6T A;  1TCF A;  2KQ6 A;  5JOL A;  3SG5 A;  2M1K B;  2JQ6 A;  2LVV A;  2LVK A;  1J1E A;  4MLW A;  4DUQ A;  2COL B;  1TNQ A;  1IGV A;  1ODB A;  4PE1 A;  2LLT A;  2KAX A;  3EKH A;  1PSR A;  1NP8 A;  4GAO A;  3I5G B;  1GGZ A;  1KFU L;  3DVK A;  3FIA A;  4PDZ A;  2F2O A;  2Q4U A;  1JSA A;  1DGV A;  1ZUZ A;  1OMV A;  3WXA A;  1XFZ O;  1XFX O;  2L98 A;  3PAL A;  1SW8 A;  1G33 A;  1AP4 A;  1EG3 A;  3VRR A;  4ZCV A;  1NX0 A;  1ZOT B;  5D69 A;  1QLK A;  4NDD A;  1F55 A;  2Q91 A;  1WRZ A;  1AJ4 A;  4GGF A;  1EJ3 A;  3JTD B;  1Y1X A;  3DF0 A;  1BLQ A;  2KI4 C;  1IQ3 A;  1FI5 A;  1IG5 A;  2B1U A;  3GK2 A;  1AUI B;  3A8R A;  3JVT C;  1PK0 D;  1J7P A;  1PVA A;  1GJY A;  1YVL A;  1JFK A;  3LK0 A;  1BJF A;  1YUR A;  1QLS A;  1SKT A;  1QS7 A;  3CWG A;  1GGW A;  1PAL A;  2LMV A;  4USL A;  4R1E A;  1KWO C;  4HRG A;  1BU3 A;  1NX2 A;  2OPO A;  1WDC B;  2ZRS A;  4QJ5 B;  1QVI Y;  1LKJ A;  1XK4 C;  3WNX B;  1OSA A;  2CNP A;  2QAC A;  4U8D A;  1SNL A;  3BUM B;  2WOS A;  4XYN A;  4MBE A;  1TNX A;  4MVF A;  1JC2 A;  4GGF C;  1CDL A;  1NIW A;  2JNX A;  2WC8 A;  3LK1 A;  4GFT A;  2OS8 C;  2VRG A;  1ALW A;  3DD4 A;  3CGA A;  4BY5 A;  1JF2 A;  2LV7 A;  3KHE A;  1B7T Y;  1KFU S;  3IF7 A;  2LMU A;  1EG4 A;  2SAS A;  4CPV A;  1DF0 B;  1E8A A;  1F4Q A;  2KNE A;  5I2Q A;  3PN7 B;  2MHH A;  1QIV A;  2KQY A;  1MR8 A;  2KBI A;  3PFV A;  1SL7 A;  2HQ8 A;  2KGB C;  3FS7 A;  4JQ0 D;  4A4B A;  2EHB A;  2LHI A;  1F4O A;  4GBA A;  3KEV A;  1XFW O;  2CBL A;  3O78 A;  1A03 A;  1NWD A;  1QX2 A;  2K0J A;  5J3X A;  5B8I B;  2PAS A;  2KAY A;  3VRP A;  1LXF C;  2JTZ A;  1V1G A;  2AUC A;  2BCB A;  2GV5 A;  3GK1 A;  1B1G A;  4C0J A;  5I2O A;  4JWQ A;  4QJ3 B;  2PMY A;  3PAT A;  4DS7 A;  1MXL C;  2SCP A;  2JT3 A;  3OX6 A;  1A4P A;  1SBJ A;  3KF9 A;  1RTP 1;  2KYC A;  1HT9 A;  1NCY A;  1J7Q A;  1RK9 A;  3BUX B;  1XVJ A;  1VRK A;  1A75 B;  2F3Z A;  1UP5 A;  2Y5I A;  1B9A A;  1B8R A;  1UHK A;  3TDI A;  2BEC A;  1FW4 A;  3KO0 A;  3SJS A;  2L5X B;  1KQM B;  2FCD A;  2M29 A;  1F8H A;  4PAL A;  2PSR A;  2I2R E;  4HRE E;  4A4C A;  1CLL A;  1OZO A;  2KI6 D;  4DIR A;  1QVI Z;  4MZJ A;  4YI8 A;  5HLV A;  5BPJ A;  1DMO A;  3BXK A;  5AEQ A;  1OMR A;  2K2F A;  5G08 A;  1WLM A;  1DGU A;  4I5L B;  1TN4 A;  2F8P A;  2CCM A;  2MAZ A;  1FPW A;  1MXE A;  3PM8 A;  2M3W A;  2LUC A;  3SG7 A;  2M8U A;  1B7T Z;  1BR4 B;  1SR6 C;  2H2K A;  2MA2 A;  2ZNE A;  1C7W A;  3GOF A;  1QIW A;  1BMO A;  1CLM A;  1QV0 A;  1KSM A;  3CR2 A;  4GGN A;  2FOT A;  3CR4 X;  1OMD A;  4AQJ A;  3TUY C;  1SY9 A;  1NX1 A;  4I5K A;  1B8C A;  2M1U A;  3D0Y A;  1CFF A;  1Y0V H;  3EVU A;  3I5F C;  4YGE B;  1CFP A;  2BKI B;  1CDM A;  2K61 A;  4CLN A;  1SYM A;  1OE9 B;  2MBX A;  4YBH B;  2L2E A;  4PHK A;  2LLS A;  2K7D A;  1AVS A;  3FWB A;  3LL8 B;  4FTG A;  4DCK A;  1QJT A;  1J1D A;  1XK4 A;  2K7B A;  4OR9 B;  3SG2 A;  1B8L A;  2BCX A;  5HYD A;  2KYF A;  1RFJ A;  2PRU A;  1SMG A;  3CS1 A;  2MLF C;  1XFY O;  1S5G Y;  3MSE B;  4MSP A;  1X02 A;  1WRK A;  2WCB A;  2ZKM X;  2LC5 A;  5CSF A;  3AKB A;  1UHN A;  1NYA A;  3PLF B;  2K7O A;  2M97 A;  1TIZ A;  5AXI A;  2JNF A;  1IQ5 A;  2LVJ A;  2TN4 A;  4BY4 A;  2MRD A;  1CDP A;  1UUS A;  1S36 A;  1QXP A;  3FWC A;  1IJ6 A;  1MWN A;  1QTX A;  4WQ3 A;  4YRU A;  1QX5 B;  1WRL A;  2H61 C;  1KK8 C;  3I5H C;  1EH2 A;  2JOJ A;  4YGD B;  3EK8 A;  2A4J A;  1XFU O;  1UHI A;  2NZ0 A;  2KAV A;  2KI6 C;  2M0R A;  2OS8 B;  3DF0 B;  1CM4 A;  2BE4 A;  2ISD A;  3VGO A;  3DVJ A;  2M7L A;  3AAK A;  3VRQ A;  3K21 A;  5PAL A;  1AHR A;  2M49 B;  1BF5 A;  1K9K A;  1NSH A;  1YRT B;  2MJW B;  3BOW A;  4PHN A;  1LIN A;  3SG3 A;  2JPT A;  1JWD A;  2LLU A;  1YUU A;  5GQQ C;  1CNP A;  2BL0 C;  1SRA A;  2JC2 A;  3ICB A;  4E68 A;  1L7Z A;  3BQ3 A;  2JTT A;  3CLN A;  3JTD C;  3O4Y A;  2OTG B;  5ER4 X;  4M2P A;  1BR1 B;  1IRJ A;  1CKK A;  4QJ4 B;  3TS5 B;  3SG6 A;  2JRF A;  3OHM B;  1CFC A;  1LA0 A;  4PE7 A;  2K8M B;  2HF5 A;  3I5I C;  1W7J B;  3SIA A;  2MLE C;  1BOC A;  5CPV A;  1ZFS A;  1AJ5 A;  4OKH A;  1JBA A;  1DJI A;  4MZK A;  1IKU A;  1W7I B;  2M9G A;  2ZFD A;  1CB1 A;  3WHU B;  3HX4 A;  1S6I A;  1L2O B;  2JXL A;  4OVN F;  3CZT X;  4HRH A;  4ETO A;  1H4B A;  2HQW A;  1TTX A;  3IQO A;  3O2P A;  4GUK A;  1U5I A;  2LM5 A;  5I2L A;  3ZNI A;  1FF1 A;  3D10 A;  2I94 A;  4M2O A;  3NXA A;  4OV2 A;  1S5G Z;  3VRO A;  3EK7 A;  2L0P A;  2CXJ A;  4IL1 A;  1SCM C;  2LMT A;  1Y1U A;  2L50 A;  3TZ1 A;  4GNK B;  1NX3 A;  3OX5 A;  4NDC A;  2EC6 C;  2Y1N A;  1KQV A;  5DKN A;  5DKR A;  1RJV A;  2RGI A;  1H8B A;  3GK4 X;  1ALV A;  2QPT A;  3KPX A;  1Y1A A;  1UWO A;  5IBW A;  1BG1 A;  5CSI A;  4XJK A;  3WHT B;  1D1O A;  4YGB B;  1PVB A;  3AKA A;  2BBM A;  2D8N A;  1CLB A;  1FI6 A;  3LLE A;  4AOM A;  1K8U A;  2O5G A;  1Y6W A;  1EL4 A;  1MHO A;  5KTY A;  4ORA B;  1SCV A;  1SR6 B;  2G2B A;  1LA3 A;  2JXC A;  2WOR A;  1N0Y A;  2I7A A;  1K90 D;  3QRX A;  2LE9 B;  5D7F A;  1S6C A;  3TUY B;  4N1F A;  4YGC B;  2JU0 A;  3ZWH A;  1M45 A;  1R6P A;  1JFJ A;  1WY9 A;  1C7V A;  3PSR A;  5HLO A;  3I5F B;  3VRN A;  1XO5 A;  1DJW A;  1NCZ A;  2BKH B;  1S6J A;  3TDU A;  3OB1 B;  3C1V A;  1YRU B;  2R2I A;  4ICB A;  3EVV A;  4TNC A;  1DJH A;  1FBV A;  1KK7 Y;  1REC A;  1TRF A;  3RM1 A;  2KSP A;  2AMI A;  1K9U A;  1XYD A;  2FJU B;  1GQM A;  1SK6 D;  2L51 A;  1DT7 B;  4NDB A;  1S3P A;  1YX8 A;  3CR5 X;  1BOD A;  1QAS A;  1RRO A;  1B4C A;  5FYX A;  2H61 A;  1NUB A;  1XFV O;  1SL9 A;  2NCP A;  3NSI A;  3D0Y B;  1IWQ A;  3SIB A;  1QAT A;  5HKZ A;  2AAO A;  2KI4 B;  2KDH A;  1DJX A;  3EK4 A;  3EVR A;  3JVT B;  1SPY A;  1KK8 B;  1PSB A;  3I5H B;  2K2A A;  2V53 A;  3RLZ A;  4CFR A;  3NSL A;  1KWO B;  2K7C A;  1HQV A;  1G4Y R;  1A2X A;  2KFF A;  1JUO A;  4AQI A;  1C07 A;  4N1G A;  2O60 A;  4MZL A;  3BUW B;  1TOP A;  2ZN8 A;  1IH0 A;  1S1E A;  5KU1 A;  4HSZ A;  1LVC D;  4Q04 A;  1TCO B;  5HKW A;  1YVH A;  1TNP A;  1YX7 A;  1DTL A;  1NCX A;  2BL0 B;  1YTZ C;  3DVE A;  2BE6 A;  3I5G C;  1F71 A;  1CTR A;  2WCF A;  2JT8 A;  4WQ2 A;  4F0Z B;  2F2P A;  1M39 A;  3CTN A;  2KHN A;  1KCY A;  2Y4Q A;  1K93 D;  1YUS A;  3HCM A;  5AAN A;  1DVI A;  4PHJ A;  2G9B A;  4I5J A;  3LCP C;  4OCI A;  2JZI A;  1MQ1 A;  1F54 A;  3I5I B;  2JT0 A;  4UPG A;  1DJY A;  2ZN9 A;  3BOW B;  5KSZ A;  1YR5 A;  2NXQ A;  2GGM A;  1KK7 Z;  2KGR A;  3NSK A;  1PUL A;  1R2U A;  2CT9 A;  1UHH A;  1DF0 A;  2KOT A;  3BUO B;  4MRY A;  2F3Y A;  1G8I A;  1XA5 A;  2JWW A;  2E6W A;  2HET A;  3BYA A;  3TDZ A;  3OP0 A;  1WDC C;  2KFG A;  4ORC B;  4PE4 A;  2L4H A;  5HKY A;  1A29 A;  5CSN A;  1SCM B;  1UUR A;  4GPL B;  2LVI A;  1K94 A;  1UHJ A;  2LAN A;  1EXR A;  2LNK A;  1KSO A;  2M7N A;  4PHM A;  3A4U B;  4N5X A;  5TNC A;  1YUT A;  2EC6 B;  1TNW A;  1M46 A;  1OZS A;  1Q80 A;  2NLN A;  1WLZ A;  4L9M A;  4P2Y B;  3DVM A;  2L4I A;  2WCE A;  4NQG A;  1S26 D;  4JPZ B;  4I5N B;  2LUX A;  1J7O A;  3AAJ A;  2LP3 A;  1CMG A;  3PN7 C;  5AER A;  5I8N A;  1KFX L;  2OTG C;  4FQO A;  2NCO A;  2ZRT A;  1U5I B;  1RWY A;  4C0L A;  1V1F A;  2IS9 A;  3TS5 C;  4P5O E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...