1C7VA

Nmr solution structure of the calcium-bound c-terminal domain (w81-s161) of calcium vector protein from amphioxus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
68
structure length
68
Chain Sequence
EEEILRAFKVFDANGDGVIDFDEFKFIMQKVGEEPLTDAEVEEAMKEADEDGNGVIDIPEFMDLIKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CALCIUM VECTOR PROTEIN
publication title Sequential calcium binding to the regulatory domain of calcium vector protein reveals functional asymmetry and a novel mode of structural rearrangement.
pubmed doi rcsb
source organism Branchiostoma lanceolatum
molecule tags Metal binding protein
total genus 19
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2000-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1c7vA00
1BMOA 1PK0D 1NUBA 1XFYO 2B1UA 2JULA 4PHKA 1WDCB 1E8AA 1OMRA 1CTRA 4ETOA 3KPXA 2ZN8A 3DF0B 5DKRA 1TNXA 1JSAA 5CSFA 1FF1A 3BUMB 3D10A 4I5JA 1U5IB 2WCBA 2MLFC 1QATA 2WCEA 1JBAA 2JXCA 1XYDA 4C0JA 1NCYA 1X02A 1PVBA 3D0YB 2JC2A 2LNKA 3AKBA 2LMUA 1R2UA 1ODBA 1KK7Z 4AQJA 1ALWA 2G9BA 5AANA 2GGMA 3DVMA 2KAYA 1CDPA 1IJ5A 1WLMA 5HKZA 3BXKA 2JNXA 1IQ3A 1AJ5A 2JU0A 2BE4A 1NX1A 2BKHB 1M46A 1XK4C 4GGNA 4Q04A 3SG7A 1UHHA 1YUTA 1SY9A 1KSMA 4YRUA 2F3ZA 3C1VA 3VRRA 3K21A 4PE7A 1OQPA 4ORAB 2KDHA 1EXRA 2ZNEA 5HYDA 1XO5A 2JT8A 2JXLA 1OZOA 1MXEA 5AXIA 1EJ3A 5J3XA 1ZOTB 2LP3A 4ICBA 1M45A 2LVIA 1H8BA 1SNLA 1Y1AA 2LP2A 1BR1B 3JVTB 3PN7C 1J7QA 3EK8A 1UHKA 5BPJA 3O78A 2Q91A 2ZRSA 2F8PA 1DF0A 2LE9B 1YUUA 2COLB 2G2BA 1DVIA 3GK4X 1CLBA 3BYAA 5HLOA 2JTZA 2L51A 2CCMA 4P5OE 2GGZA 5HKWA 5D69A 2BE6A 1XK4A 2MAZA 4XYNA 1PALA 2FJUB 1SYMA 3I5IB 4GAOA 1PVAA 1DJXA 5HKYA 2F3YA 2KI4C 1XFXO 2Y5IA 2BECA 1B47A 3PATA 4QJ4B 1TNWA 4M2QA 4MLWA 4UPGA 2QACA 3I5FC 3TZ1A 2PASA 1OZSA 3BOWA 1MQ1A 1M39A 5JJGA 1Y1UA 2L50A 3VRQA 1IJ6A 3H4SE 2F33A 1BG1A 3FWCA 1RTP1 4YBHB 2BCBA 2WCFA 1SR6B 2OPOA 3NXAA 1TNQA 2HQWA 4N5XA 4GNKB 2CXJA 2LCPA 1BF5A 1B8RA 1K9PA 1WDCC 3AKAA 1SPYA 3TS5B 1J7PA 3I5HB 4I5LB 2AAOA 4JWQA 1JFJA 1QIVA 1SCMB 3TUYB 3EKHA 4PHJA 1SCVA 1MWNA 1NYAA 5I2LA 3PFVA 1C7VA 2MLEC 2BBMA 2L2EA 3KO0A 1H4BA 5CPVA 1NWDA 1JUOA 3GOFA 1S5GZ 4DIRA 1PSRA 2WC8A 3DVEA 2K2FA 4NQGA 4OKHA 1KFXS 1A4PA 4DCKA 1BOCA 1A03A 3BUNB 1BJFA 1NPQA 1F71A 2CBLA 4XJKA 1KSOA 2V53A 4GUKA 1W7JB 3PM8A 3IF7A 1C07A 2MJWB 1CM4A 2M9GA 1UHNA 3LK0A 3PLFB 1AK8A 4AQIA 1KK8B 1F54A 3ZNIA 2SCPA 2MHHA 1F4OA 1YRTB 1YX7A 1FI5A 2A4JA 4MRXA 1TCOB 2PALA 1ZMZA 1OMVA 2ZRTA 3BUWB 5I8NA 2DOQA 2FOTA 3LK1A 3DF0A 3TDZA 1GJYA 2M8UA 2L0PA 5KU1A 1SW8A 3RM1A 2CNPA 1SL9A 2MRDA 3NSLA 5FYXA 1KFUS 1U5IA 4IL1A 3I5GB 2SASA 4YGDB 2KQ6A 3FWBA 2KGBC 1JFKA 3D0YA 3JVTC 3SG5A 1CLLA 4WRIA 2PVBA 3CZTX 1CLMA 1CM1A 2EC6B 1BR4B 1BT6A 3F45A 1YR5A 1JF0A 5ER4X 1F55A 1DJWA 2KI6C 3CGAA 2ZKMX 1QIWA 4ZCUA 3KHEA 2KSPA 1CFCA 3VRNA 3CR4X 3O4YA 3I5IC 2JT3A 2H2KA 2M0RA 1CB1A 1LKJA 1NX0A 3DVJA 1F70A 3DVKA 1F8HA 1HT9A 3BUOB 4MZLA 4NDBA 2KYCA 5GQQC 1GQMA 2GV5A 2H61C 1KQVA 2KI6D 2BBNA 2OS8B 1W7IB 1QV1A 4F0ZB 2I2RE 1G4YR 1YURA 1CMGA 1YX8A 2D8NA 1RFJA 4GPLB 1S1EA 1S36A 4QJ3B 2L4IA 1AHRA 2RGIA 2O60A 1CDLA 2K2AA 4WQ3A 1SR6C 1QVIZ 1A75B 1MXLC 3M0WA 2KFGA 2M7NA 4CIDA 3BQ3A 1J7OA 1IRJA 4MSPA 3OB2B 1B1GA 1SKTA 2JZIA 3TS5C 4FTGA 2WORA 1RWYA 3I5HC 4P2YB 1S5GY 1TIZA 1CFPA 1SCMC 4PHMA 3TUYC 3WXAA 1QJTA 2LM5A 5AEQA 3SG2A 1J7RA 1RROA 2NCPA 1CNPA 3EKJA 5HLVA 1B8CA 4PDZA 4C0LA 1N2DA 2MBXA 1AVSA 4OR9B 2H61A 3GK1A 1J1EA 1FPWA 1Y6WA 2I18A 2AMIA 4NDCA 3RLZA 2K61A 1YVLA 1EH2A 3DD4A 1NP8A 2E6WA 1A29A 4YGEB 2M29A 5F6TA 2JOJA 3VGOA 1YUSA 1B4CA 4PE0A 1K2HA 2PRUA 1ZACA 1KK8C 5G08A 2R2IA 1UP5A 1S6CA 1IG5A 1EG4A 2ZNDA 2LLTA 3CLNA 3OP0A 2ISDA 4PE4A 1EL4A 1PSBA 2HETA 1S6JA 1TOPA 1A2XA 1N0YA 2M1UA 2M1KB 3OX5A 1K96A 3KEVA 1DJIA 2FCDA 1JWDA 1NSHA 2LVJA 1J55A 4R1EA 3EVUA 3I5GC 1CKKA 3NSOA 1RECA 3WNXB 1CDMA 2M97A 1GGZA 1Y1XA 2BCXA 1XVJA 4ORBB 1AJ4A 2KNEA 2E30A 3WHTB 2EC6C 3TDUA 2LVVA 1DJHA 1VRKA 5I2OA 1UUSA 4YGAA 1YTZC 3NSIA 3CTNA 4L9MA 4OV2A 3IQOA 3OX6A 2JQ6A 1K95A 3EK4A 2JTTA 3SG3A 1NX3A 2K7OA 4DUQA 1NX2A 1Y0VH 4D1EA 1CFDA 1QX7A 1BODA 1QVIY 1BLQA 2OS8C 1TCFA 5KSZA 3HCMA 1S6IA 1M31A 1S26D 1TNPA 1G8IA 1L2OB 2FCEA 2TN4A 2JRFA 1KFUL 3JTDB 1Q80A 4MBEA 1TRFA 2KOTA 3FS7A 1LINA 4GBAA 3CR5X 1SRAA 4GGFC 1QLSA 4N1GA 3AAJA 1TN4A 5TNCA 3O2PA 1OE9B 2O5GA 5PALA 3FIAA 1XFVO 2F2PA 4ZCVA 1EG3A 2EHBA 1J1DA 4JPZB 3SJSA 2KQYA 2LVKA 3OHMB 2OTGB 3GK2A 1UHJA 4MZJA 1CDNA 2L5XB 4U8DA 3LCPC 5DKNA 2LV7A 3ZWHA 4M2PA 5B8IB 5CSNA 4YGBB 1QX2A 3SIBA 2NZ0A 4C0KA 3BUXB 4CLNA 2LMVA 1K94A 1LVCD 3OB1B 1RJVA 1M63B 2JNFA 4GGFA 1A75A 1UURA 1KWOB 1K90D 4AOMA 3A4UB 1KCYA 2KGRA 1L7ZA 2BL0B 4HREE 4ORCB 2LMTA 2LAPA 3PALA 4M2OA 4PCWA 1V1FA 2KYFA 1SBJA 4OCIA 2BKIB 3WHUB 1IH0A 4MZKA 4CFQA 1QS7A 3NSKA 4HSZA 4BY4A 1MUXA 1DJYA 2KAXA 3EK7A 2Y1NA 2K7BA 5ER5A 1D1OA 1DTLA 4MRYA 1XFZO 3SIAA 1KQMB 2KAVA 1K9KA 1QLKA 4FQOA 2Y4QA 1IWQA 2P6BB 4PALA 4MVFA 1WY9A 5D7FA 5K89A 2QPTA 1B8LA 1WRKA 3EVVA 4DRWA 4GFTA 1S3PA 1QXPA 1K8UA 1OOJA 1ZFSA 2BCAA 3EVRA 5CSJA 4YGCB 2M7LA 3SG4A 1PRWA 2K7DA 4E68A 2HQ8A 1XA5A 1CMFA 2M3WA 1C7WA 1GGWA 1LXFC 1QTXA 4WQ2A 1LA3A 2M49B 1MF8B 4CFRA 4QJ5B 1CFFA 1IGVA 1SL7A 2HPSA 3PSRA 1DF0B 2KBMA 4HRHA 1AP4A 1L2OC 2ZFDA 3JTDC 2LLSA 1SMGA 2LANA 1B9AA 3VROA 1K93D 4A4CA 4JQ0D 2NXQA 4MN0A 1XFWO 2EGDA 4YI8A 1RK9A 2CTNA 1B7TY 1LA0A 2WNDA 1QASA 1SL8A 2CT9A 1UHIA 2JWWA 2LC5A 2PSRA 1G33A 3TDIA 5AFPA 1DMOA 2IS9A 3KF9A 2JPTA 4OVNF 1KFXL 1FI6A 1OMDA 4MEWA 1DGVA 3BOWB 2OTGC 2LUXA 4I5NB 1MHOA 2AUCA 1MR8A 3MSEB 5DKQA 5AERA 4BY5A 1WRZA 2K0JA 1ZUZA 2LHIA 3LL8B 4NDDA 2PMYA 2JT0A 3PN7B 1NCXA 2LUCA 5JOLA 1QV0A 5IBWA 4TNCA 1PULA 2KFFA 3CWGA 1BU3A 1TTXA 1DT7B 1KK7Y 1YVHA 2Q4UA 4HRGA 2L4HA 1YRUB 1ALVA 1WRLA 3QRXA 1XFUO 2NCOA 1SK6D 4A4BA 2WOSA 2KBIA 1KWOC 2VRGA 3AAKA 1JC2A 1WLZA 1FW4A 3HX4A 2BL0C 4PHNA 2LLUA 1UWOA 1FBVA 2K7CA 2LHLA 2L98A 3O6BA 5I2QA 4N1FA 2F2OA 1K9UA 2KI4B 2MA2A 2I94A 2NLNA 5KTYA 3LLEA 3A8RA 4I5KA 3I5FB 2I7AA 1NIWA 1DJZA 1V1GA 4XJKB 3CR2A 1NCZA 1F4QA 1R6PA 1IQ5A 4PE1A 4CPVA 1QX5B 1IKUA 2HF5A 3E3RA 3SG6A 1DGUA 1JF2A 1KQMC 2K8MB 4DS7A 2Y1MA 3IQQA 3CS1A 1OSAA 4USLA 5CSIA 3VRPA 1DJGA 1HQVA 1N65A 1B7TZ 3ICBA 2KFHA 2KHNA 4YI9A 1AUIB 2ZN9A
chains in the Genus database with same CATH superfamily
1BMOA 1PK0D 1NUBA 1XFYO 2B1UA 2JULA 4PHKA 1WDCB 1E8AA 1OMRA 1CTRA 4ETOA 3KPXA 2ZN8A 3DF0B 5DKRA 1TNXA 1JSAA 5CSFA 1FF1A 3BUMB 3D10A 4I5JA 1U5IB 2WCBA 2MLFC 1QATA 2WCEA 1JBAA 2JXCA 2WC5A 2KLEA 1XYDA 4C0JA 1NCYA 1X02A 1PVBA 3D0YB 2JC2A 3L4LA 2LNKA 3AKBA 2LMUA 1R2UA 1ODBA 1T14A 1KK7Z 4AQJA 1ALWA 1DC1A 2G9BA 5AANA 2GGMA 3DVMA 2KAYA 1CDPA 1IJ5A 1WLMA 5HKZA 3BXKA 1Z4HA 2JNXA 1AJ5A 1IQ3A 2JU0A 2BE4A 1NX1A 2BKHB 1M46A 1XK4C 4GGNA 4Q04A 3S0GA 3CABA 3SG7A 1UHHA 1YUTA 1SY9A 1OOIX 1KSMA 4YRUA 1QWVA 2F3ZA 3C1VA 3VRRA 3K21A 3R1PA 4PE7A 1OQPA 4ORAB 2KDHA 1EXRA 2ZNEA 4JD9A 1XO5A 5HYDA 2JT8A 2JXLA 1OZOA 1MXEA 5AXIA 1EJ3A 5J3XA 1ZOTB 2LP3A 4ICBA 1M45A 2LVIA 1H8BA 1SNLA 3BJHA 1Y1AA 5EL2A 2LP2A 1BR1B 3JVTB 3PN7C 1J7QA 3EK8A 1UHKA 5BPJA 3O78A 2Q91A 2ZRSA 2F8PA 1DF0A 1OW4A 2LE9B 1YUUA 2COLB 2G2BA 1DVIA 3GK4X 1CLBA 3BYAA 3CDNA 5HLOA 2JTZA 3B88A 2L51A 3NHIA 3SS3A 2CCMA 4P5OE 2GGZA 5HKWA 3O4XA 5D69A 2BE6A 1XK4A 2MAZA 3PJIA 4XYNA 1PALA 2FJUB 1SYMA 3I5IB 4GAOA 1PVAA 1DJXA 5HKYA 5FI2A 2F3YA 2KI4C 1XFXO 2Y5IA 2BECA 1B47A 3PATA 4QJ4B 1TNWA 4M2QA 4MLWA 4UPGA 2QACA 3I5FC 3S0FA 3TZ1A 2PASA 1OZSA 3BOWA 1MQ1A 1M39A 5JJGA 1Y1UA 2L50A 3SS5A 3D73A 3K1EA 1IJ6A 3H4SE 3VRQA 2F33A 1BG1A 3FWCA 1RTP1 4YBHB 2BCBA 2WCFA 1SR6B 2OPOA 3NXAA 1ORGA 1TNQA 2HQWA 4N5XA 4GNKB 2CXJA 2LCPA 1BF5A 1B8RA 1K9PA 1WDCC 3AKAA 1SPYA 3TS5B 1J7PA 3OGNA 3I5HB 2QEVA 4I5LB 2AAOA 4JWQA 1JFJA 1QIVA 1SCMB 3TUYB 3EKHA 4PHJA 1SCVA 1MWNA 1NYAA 5I2LA 3PFVA 1C7VA 2MLEC 2BBMA 2L2EA 3KO0A 1H4BA 3DY9A 5CPVA 1NWDA 1JUOA 3GOFA 1S5GZ 4DIRA 1PSRA 2WC8A 3DVEA 2K2FA 4NQGA 4OKHA 1KFXS 1A4PA 4DCKA 1BOCA 1A03A 3BUNB 1BJFA 1NPQA 1F71A 2CBLA 3R1OA 1KSOA 2QDIA 2V53A 3FE9A 1W7JB 3PM8A 4GUKA 4XJKA 3S0EA 3IF7A 1C07A 2MJWB 5DICA 1CM4A 2M9GA 1UHNA 3LK0A 3PLFB 1AK8A 2P70A 4AQIA 1KK8B 1F54A 3ZNIA 2SCPA 2MHHA 1F4OA 1YRTB 1XFRA 2H8VA 1YX7A 1FI5A 2A4JA 2QEOA 1TCOB 2PALA 4MRXA 1ZMZA 5D3OA 1OMVA 2ZRTA 3BUWB 5I8NA 2JPOA 4IJ7A 2DOQA 2FOTA 3LK1A 3DF0A 3TDZA 1GJYA 2M8UA 2L0PA 5KU1A 1SW8A 3RM1A 1SL9A 2CNPA 2MRDA 3NSLA 5FYXA 1KFUS 1TUZA 1U5IA 3I5GB 4IL1A 5FI6A 2SASA 4YGDB 2KQ6A 3FWBA 2KGBC 1JFKA 3D0YA 1OOHA 3JVTC 3SG5A 1CLLA 2K60A 3DZTA 4WRIA 2PVBA 2QEBA 3CZTX 1CLMA 1CM1A 2EC6B 1BR4B 1BT6A 3F45A 1YR5A 1JF0A 5ER4X 3FE8A 1F55A 1DJWA 2KI6C 3CGAA 3S0DA 4PT1A 2ZKMX 1QIWA 4ZCUA 3KHEA 2KSPA 1CFCA 3VRNA 3CR4X 3O4YA 3I5IC 2JT3A 2H2KA 2M0RA 1CB1A 1LKJA 1NX0A 3DVJA 3Q8IA 1F70A 3DVKA 1F8HA 1HT9A 3BUOB 4MZLA 4NDBA 2KYCA 4JKTA 5GQQC 1GQMA 2GV5A 2H61C 1KQVA 2KI6D 3S0AA 3DXLA 2BBNA 2OS8B 1W7IB 1QV1A 4F0ZB 2I2RE 1G4YR 1YURA 1CMGA 1YX8A 2D8NA 1RFJA 4GPLB 1S1EA 1S36A 4FQTA 4QJ3B 2L4IA 1AHRA 2RGIA 2O60A 1GM0A 1CDLA 3VB1A 2K2AA 4WQ3A 1SR6C 1QVIZ 1A75B 1MXLC 3M0WA 2KFGA 2M7NA 3B87A 4CIDA 3BQ3A 1J7OA 1IRJA 1TWOA 4MSPA 3B86A 3OB2B 1B1GA 1SKTA 2JZIA 3TS5C 4FTGA 2WORA 1RWYA 3I5HC 4P2YB 1S5GY 1TIZA 1CFPA 1SCMC 4PHMA 3TUYC 3WXAA 1QJTA 2LM5A 5AEQA 2FJYA 3SG2A 1J7RA 1RROA 2NCPA 1CNPA 3EKJA 5HLVA 1B8CA 4PDZA 4C0LA 1N2DA 2MBXA 1AVSA 4OR9B 2H61A 3GK1A 1J1EA 1FPWA 3B7AA 3B6XA 1Y6WA 2I18A 2AMIA 4NDCA 3D78A 3RLZA 2K61A 2L2CA 1YVLA 1EH2A 1TUJA 3DD4A 1NP8A 2E6WA 4OZDA 1A29A 4YGEB 2M29A 5F6TA 2JOJA 3VGOA 1YUSA 1B4CA 4PE0A 1K2HA 2ERBA 1ZACA 2PRUA 1KK8C 5G08A 2R2IA 1UP5A 3BFHA 5I94A 1S6CA 1IG5A 1EG4A 2ZNDA 3CZ1A 1C3ZA 3D75A 2LLTA 3CLNA 3OP0A 2ISDA 4PE4A 1EL4A 1PSBA 2HETA 1S6JA 2KPHA 1TOPA 1A2XA 1N0YA 2M1UA 2M1KB 3OX5A 1K96A 3KEVA 1DJIA 2FCDA 2GTEA 1NSHA 2LVJA 1J55A 1JWDA 4R1EA 2KLDA 3EVUA 3I5GC 2BAPA 3NSOA 1CKKA 1RECA 3WNXB 1CDMA 2M97A 3NHTA 1GGZA 1Y1XA 2BCXA 1XVJA 4ORBB 1AJ4A 2KNEA 2E30A 3D77A 1OOGA 3WHTB 2EC6C 1DELA 3TDUA 2LVVA 1DJHA 1VRKA 5I2OA 1UUSA 4YGAA 1YTZC 3NSIA 2YGUA 3CTNA 4L9MA 3EG5B 4OV2A 3IQOA 3OX6A 3SS4A 2JQ6A 1K95A 3EK4A 2JTTA 3SG3A 1NX3A 3R1VA 2K7OA 4DUQA 1NX2A 1Y0VH 1IIOA 4D1EA 1CFDA 1QX7A 2WCHA 1BODA 1QVIY 1BLQA 2OS8C 1TCFA 5KSZA 3HCMA 1S6IA 1M31A 1S26D 1TNPA 1G8IA 1L2OB 2FCEA 2TN4A 2JRFA 1DEKA 1KFUL 3JTDB 1Q80A 4MBEA 1TRFA 2KOTA 3FS7A 1LINA 4GBAA 3CR5X 1SRAA 4GGFC 3S0BA 1QLSA 4N1GA 3AAJA 1TN4A 3OBVA 3O2PA 4KYNA 1OE9B 5TNCA 2O5GA 5PALA 2PYQA 3FIAA 1XFVO 2F2PA 4ZCVA 3CYZA 1EG3A 2EHBA 1J1DA 4JPZB 1C3YA 3SJSA 2KQYA 2LVKA 3OHMB 2OTGB 3GK2A 1UHJA 4MZJA 1CDNA 2WCJA 2WCMA 2L5XB 4U8DA 3LCPC 5DKNA 2LV7A 3ZWHA 4M2PA 5B8IB 5CSNA 4YGBB 1QX2A 3SIBA 2NZ0A 4C0KA 3BUXB 4CLNA 3PM2A 2LMVA 3D74A 1K94A 1LVCD 3OB1B 1RJVA 1M63B 2JNFA 4GGFA 1A75A 1UURA 1KWOB 1K90D 4AOMA 3A4UB 1KCYA 2KGRA 3L4AA 1L7ZA 2BL0B 4HREE 4ORCB 4INWA 2LMTA 2LAPA 3PALA 4M2OA 1LS8A 4PCWA 1V1FA 2KYFA 1SBJA 4OCIA 2BKIB 3WHUB 2BNXA 1IH0A 4MZKA 4CFQA 1QS7A 3IVTA 3NSKA 4HSZA 4BY4A 1MUXA 1DJYA 2KAXA 2L5YA 3EK7A 2Y1NA 2K7BA 3FE6A 5ER5A 1D1OA 1DTLA 4MRYA 1P28A 1XFZO 3SIAA 1KQMB 2KAVA 1K9KA 1QLKA 1Z2CB 2Y4QA 4FQOA 1IWQA 2P6BB 3D76A 1OOFA 4PALA 4MVFA 1WY9A 5D7FA 5K89A 2QPTA 1B8LA 1SSEB 1WRKA 3EVVA 5CSIA 3R72A 4DRWA 4GFTA 1DQEA 1S3PA 4F7FA 1QXPA 3V2LA 1K8UA 1OOJA 1ZFSA 2BCAA 3EVRA 5CSJA 4YGCB 2M7LA 3SG4A 1PRWA 2K7DA 4E68A 2HQ8A 1XA5A 3RZSA 1CMFA 2M3WA 1C7WA 1GGWA 1LXFC 1QTXA 4WQ2A 1LA3A 2M49B 1MF8B 4CFRA 4QJ5B 1CFFA 1IGVA 1SL7A 2HPSA 3PSRA 1DF0B 2KBMA 4HRHA 1AP4A 1L2OC 2ZFDA 2P71A 3JTDC 2LLSA 1SMGA 2LANA 5FI7A 1B9AA 3VROA 1K93D 4A4CA 4JQ0D 2NXQA 4MN0A 1XFWO 2EGDA 4YI8A 1RK9A 2CTNA 1B7TY 1LA0A 3BFBA 2WNDA 1QASA 1SL8A 2CT9A 1UHIA 2JWWA 2LC5A 2WCLA 2PSRA 1G33A 2QEHA 3TDIA 3UO9A 5AFPA 1DMOA 2IS9A 3KF9A 3UNWA 2JPTA 4OVNF 1KFXL 1FI6A 1OMDA 4MEWA 1DGVA 3BOWB 2OTGC 2LUXA 4I5NB 1MHOA 2AUCA 1MR8A 3MSEB 5DKQA 5AERA 4BY5A 1WRZA 2K0JA 1ZUZA 2LHIA 3LL8B 4NDDA 2PMYA 2JT0A 3PN7B 1NCXA 2LUCA 5JOLA 5HL1A 1QV0A 5IBWA 4TNCA 1PULA 2KFFA 3CWGA 1BU3A 1TTXA 3CZ2A 1DT7B 1KK7Y 1YVHA 2Q4UA 4HRGA 2L4HA 1W9ZA 1YRUB 1ALVA 1WRLA 3QRXA 1XFUO 2NCOA 1SK6D 4A4BA 2WOSA 2KBIA 1KWOC 3L47A 2VRGA 3CZ0A 3AAKA 3BFAA 1JC2A 1WLZA 1FW4A 3HX4A 4INXA 2BL0C 4PHNA 2LLUA 1UWOA 1FBVA 2K7CA 2LHLA 2L98A 2WCKA 3NGVA 3O6BA 4N1FA 5I2QA 2F2OA 1K9UA 2KI4B 2MA2A 2I94A 2NLNA 5KTYA 3LLEA 3A8RA 4I5KA 3I5FB 3QMEA 2I7AA 1NIWA 1DJZA 1V1GA 2WC6A 4XJKB 3CR2A 1NCZA 1F4QA 1R6PA 1IQ5A 4PE1A 4CPVA 1QX5B 1IKUA 2HF5A 3E3RA 3SG6A 1DGUA 1JF2A 1KQMC 2K8MB 4DS7A 2Y1MA 3IQQA 3CS1A 1OSAA 3N7HA 4USLA 2PQLA 1DJGA 1HQVA 1N65A 3DYEA 1B7TZ 3VRPA 3ICBA 2KFHA 2KHNA 4YI9A 1AUIB 2ZN9A
chains in the Genus database with same CATH topology
1BMOA 1PK0D 1NUBA 1XFYO 2B1UA 2JULA 4PHKA 1WDCB 1E8AA 1OMRA 1CTRA 4ETOA 3KPXA 2ZN8A 3DF0B 5DKRA 1TNXA 1JSAA 5CSFA 1FF1A 3BUMB 3D10A 4I5JA 1U5IB 2WCBA 2MLFC 1QATA 2WCEA 1JBAA 2JXCA 1XYDA 4C0JA 1NCYA 1X02A 1PVBA 3D0YB 2JC2A 2LNKA 3AKBA 2LMUA 1R2UA 1ODBA 1KK7Z 4AQJA 1ALWA 2G9BA 5AANA 2GGMA 3DVMA 2KAYA 1CDPA 1IJ5A 1WLMA 5HKZA 3BXKA 2JNXA 1IQ3A 1AJ5A 2JU0A 2BE4A 1NX1A 2BKHB 1M46A 1XK4C 4GGNA 4Q04A 3SG7A 1UHHA 1YUTA 1SY9A 1KSMA 4YRUA 2F3ZA 3C1VA 3VRRA 3K21A 4PE7A 1OQPA 4ORAB 2KDHA 1EXRA 2ZNEA 5HYDA 1XO5A 2JT8A 2JXLA 1OZOA 1MXEA 5AXIA 1EJ3A 5J3XA 1ZOTB 2LP3A 4ICBA 1M45A 2LVIA 1H8BA 1SNLA 1Y1AA 2LP2A 1BR1B 3JVTB 3PN7C 1J7QA 3EK8A 1UHKA 5BPJA 3O78A 2Q91A 2ZRSA 2F8PA 1DF0A 2LE9B 1YUUA 2COLB 2G2BA 1DVIA 3GK4X 1CLBA 3BYAA 5HLOA 2JTZA 2L51A 2CCMA 4P5OE 2GGZA 5HKWA 5D69A 2BE6A 1XK4A 2MAZA 4XYNA 1PALA 2FJUB 1SYMA 3I5IB 4GAOA 1PVAA 1DJXA 5HKYA 2F3YA 2KI4C 1XFXO 2Y5IA 2BECA 1B47A 3PATA 4QJ4B 1TNWA 4M2QA 4MLWA 4UPGA 2QACA 3I5FC 3TZ1A 2PASA 1OZSA 3BOWA 1MQ1A 1M39A 5JJGA 1Y1UA 2L50A 3VRQA 1IJ6A 3H4SE 2F33A 1BG1A 3FWCA 1RTP1 4YBHB 2BCBA 2WCFA 1SR6B 2OPOA 3NXAA 1TNQA 2HQWA 4N5XA 4GNKB 2CXJA 2LCPA 1BF5A 1B8RA 1K9PA 1WDCC 3AKAA 1SPYA 3TS5B 1J7PA 3I5HB 4I5LB 2AAOA 4JWQA 1JFJA 1QIVA 1SCMB 3TUYB 3EKHA 4PHJA 1SCVA 1MWNA 1NYAA 5I2LA 3PFVA 1C7VA 2MLEC 2BBMA 2L2EA 3KO0A 1H4BA 5CPVA 1NWDA 1JUOA 3GOFA 1S5GZ 4DIRA 1PSRA 2WC8A 3DVEA 2K2FA 4NQGA 4OKHA 1KFXS 1A4PA 4DCKA 1BOCA 1A03A 3BUNB 1BJFA 1NPQA 1F71A 2CBLA 4XJKA 1KSOA 2V53A 4GUKA 1W7JB 3PM8A 3IF7A 1C07A 2MJWB 1CM4A 2M9GA 1UHNA 3LK0A 3PLFB 1AK8A 4AQIA 1KK8B 1F54A 3ZNIA 2SCPA 2MHHA 1F4OA 1YRTB 1YX7A 1FI5A 2A4JA 4MRXA 1TCOB 2PALA 1ZMZA 1OMVA 2ZRTA 3BUWB 5I8NA 2DOQA 2FOTA 3LK1A 3DF0A 3TDZA 1GJYA 2M8UA 2L0PA 5KU1A 1SW8A 3RM1A 2CNPA 1SL9A 2MRDA 3NSLA 5FYXA 1KFUS 1U5IA 4IL1A 3I5GB 2SASA 4YGDB 2KQ6A 3FWBA 2KGBC 1JFKA 3D0YA 3JVTC 3SG5A 1CLLA 4WRIA 2PVBA 3CZTX 1CLMA 1CM1A 2EC6B 1BR4B 1BT6A 3F45A 1YR5A 1JF0A 5ER4X 1F55A 1DJWA 2KI6C 3CGAA 2ZKMX 1QIWA 4ZCUA 3KHEA 2KSPA 1CFCA 3VRNA 3CR4X 3O4YA 3I5IC 2JT3A 2H2KA 2M0RA 1CB1A 1LKJA 1NX0A 3DVJA 1F70A 3DVKA 1F8HA 1HT9A 3BUOB 4MZLA 4NDBA 2KYCA 5GQQC 1GQMA 2GV5A 2H61C 1KQVA 2KI6D 2BBNA 2OS8B 1W7IB 1QV1A 4F0ZB 2I2RE 1G4YR 1YURA 1CMGA 1YX8A 2D8NA 1RFJA 4GPLB 1S1EA 1S36A 4QJ3B 2L4IA 1AHRA 2RGIA 2O60A 1CDLA 2K2AA 4WQ3A 1SR6C 1QVIZ 1A75B 1MXLC 3M0WA 2KFGA 2M7NA 4CIDA 3BQ3A 1J7OA 1IRJA 4MSPA 3OB2B 1B1GA 1SKTA 2JZIA 3TS5C 4FTGA 2WORA 1RWYA 3I5HC 4P2YB 1S5GY 1TIZA 1CFPA 1SCMC 4PHMA 3TUYC 3WXAA 1QJTA 2LM5A 5AEQA 3SG2A 1J7RA 1RROA 2NCPA 1CNPA 3EKJA 5HLVA 1B8CA 4PDZA 4C0LA 1N2DA 2MBXA 1AVSA 4OR9B 2H61A 3GK1A 1J1EA 1FPWA 1Y6WA 2I18A 2AMIA 4NDCA 3RLZA 2K61A 1YVLA 1EH2A 3DD4A 1NP8A 2E6WA 1A29A 4YGEB 2M29A 5F6TA 2JOJA 3VGOA 1YUSA 1B4CA 4PE0A 1K2HA 2PRUA 1ZACA 1KK8C 5G08A 2R2IA 1UP5A 1S6CA 1IG5A 1EG4A 2ZNDA 2LLTA 3CLNA 3OP0A 2ISDA 4PE4A 1EL4A 1PSBA 2HETA 1S6JA 1TOPA 1A2XA 1N0YA 2M1UA 2M1KB 3OX5A 1K96A 3KEVA 1DJIA 2FCDA 1JWDA 1NSHA 2LVJA 1J55A 4R1EA 3EVUA 3I5GC 1CKKA 3NSOA 1RECA 3WNXB 1CDMA 2M97A 1GGZA 1Y1XA 2BCXA 1XVJA 4ORBB 1AJ4A 2KNEA 2E30A 3WHTB 2EC6C 3TDUA 2LVVA 1DJHA 1VRKA 5I2OA 1UUSA 4YGAA 1YTZC 3NSIA 3CTNA 4L9MA 4OV2A 3IQOA 3OX6A 2JQ6A 1K95A 3EK4A 2JTTA 3SG3A 1NX3A 2K7OA 4DUQA 1NX2A 1Y0VH 4D1EA 1CFDA 1QX7A 1BODA 1QVIY 1BLQA 2OS8C 1TCFA 5KSZA 3HCMA 1S6IA 1M31A 1S26D 1TNPA 1G8IA 1L2OB 2FCEA 2TN4A 2JRFA 1KFUL 3JTDB 1Q80A 4MBEA 1TRFA 2KOTA 3FS7A 1LINA 4GBAA 3CR5X 1SRAA 4GGFC 1QLSA 4N1GA 3AAJA 1TN4A 5TNCA 3O2PA 1OE9B 2O5GA 5PALA 3FIAA 1XFVO 2F2PA 4ZCVA 1EG3A 2EHBA 1J1DA 4JPZB 3SJSA 2KQYA 2LVKA 3OHMB 2OTGB 3GK2A 1UHJA 4MZJA 1CDNA 2L5XB 4U8DA 3LCPC 5DKNA 2LV7A 3ZWHA 4M2PA 5B8IB 5CSNA 4YGBB 1QX2A 3SIBA 2NZ0A 4C0KA 3BUXB 4CLNA 2LMVA 1K94A 1LVCD 3OB1B 1RJVA 1M63B 2JNFA 4GGFA 1A75A 1UURA 1KWOB 1K90D 4AOMA 3A4UB 1KCYA 2KGRA 1L7ZA 2BL0B 4HREE 4ORCB 2LMTA 2LAPA 3PALA 4M2OA 4PCWA 1V1FA 2KYFA 1SBJA 4OCIA 2BKIB 3WHUB 1IH0A 4MZKA 4CFQA 1QS7A 3NSKA 4HSZA 4BY4A 1MUXA 1DJYA 2KAXA 3EK7A 2Y1NA 2K7BA 5ER5A 1D1OA 1DTLA 4MRYA 1XFZO 3SIAA 1KQMB 2KAVA 1K9KA 1QLKA 4FQOA 2Y4QA 1IWQA 2P6BB 4PALA 4MVFA 1WY9A 5D7FA 5K89A 2QPTA 1B8LA 1WRKA 3EVVA 4DRWA 4GFTA 1S3PA 1QXPA 1K8UA 1OOJA 1ZFSA 2BCAA 3EVRA 5CSJA 4YGCB 2M7LA 3SG4A 1PRWA 2K7DA 4E68A 2HQ8A 1XA5A 1CMFA 2M3WA 1C7WA 1GGWA 1LXFC 1QTXA 4WQ2A 1LA3A 2M49B 1MF8B 4CFRA 4QJ5B 1CFFA 1IGVA 1SL7A 2HPSA 3PSRA 1DF0B 2KBMA 4HRHA 1AP4A 1L2OC 2ZFDA 3JTDC 2LLSA 1SMGA 2LANA 1B9AA 3VROA 1K93D 4A4CA 4JQ0D 2NXQA 4MN0A 1XFWO 2EGDA 4YI8A 1RK9A 2CTNA 1B7TY 1LA0A 2WNDA 1QASA 1SL8A 2CT9A 1UHIA 2JWWA 2LC5A 2PSRA 1G33A 3TDIA 5AFPA 1DMOA 2IS9A 3KF9A 2JPTA 4OVNF 1KFXL 1FI6A 1OMDA 4MEWA 1DGVA 3BOWB 2OTGC 2LUXA 4I5NB 1MHOA 2AUCA 1MR8A 3MSEB 5DKQA 5AERA 4BY5A 1WRZA 2K0JA 1ZUZA 2LHIA 3LL8B 4NDDA 2PMYA 2JT0A 3PN7B 1NCXA 2LUCA 5JOLA 1QV0A 5IBWA 4TNCA 1PULA 2KFFA 3CWGA 1BU3A 1TTXA 1DT7B 1KK7Y 1YVHA 2Q4UA 4HRGA 2L4HA 1YRUB 1ALVA 1WRLA 3QRXA 1XFUO 2NCOA 1SK6D 4A4BA 2WOSA 2KBIA 1KWOC 2VRGA 3AAKA 1JC2A 1WLZA 1FW4A 3HX4A 2BL0C 4PHNA 2LLUA 1UWOA 1FBVA 2K7CA 2LHLA 2L98A 3O6BA 5I2QA 4N1FA 2F2OA 1K9UA 2KI4B 2MA2A 2I94A 2NLNA 5KTYA 3LLEA 3A8RA 4I5KA 3I5FB 2I7AA 1NIWA 1DJZA 1V1GA 4XJKB 3CR2A 1NCZA 1F4QA 1R6PA 1IQ5A 4PE1A 4CPVA 1QX5B 1IKUA 2HF5A 3E3RA 3SG6A 1DGUA 1JF2A 1KQMC 2K8MB 4DS7A 2Y1MA 3IQQA 3CS1A 1OSAA 4USLA 5CSIA 3VRPA 1DJGA 1HQVA 1N65A 1B7TZ 3ICBA 2KFHA 2KHNA 4YI9A 1AUIB 2ZN9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BMO A;  1PK0 D;  1NUB A;  1XFY O;  2B1U A;  2JUL A;  4PHK A;  1WDC B;  1E8A A;  1OMR A;  1CTR A;  4ETO A;  3KPX A;  2ZN8 A;  3DF0 B;  5DKR A;  1TNX A;  1JSA A;  5CSF A;  1FF1 A;  3BUM B;  3D10 A;  4I5J A;  1U5I B;  2WCB A;  2MLF C;  1QAT A;  2WCE A;  1JBA A;  2JXC A;  1XYD A;  4C0J A;  1NCY A;  1X02 A;  1PVB A;  3D0Y B;  2JC2 A;  2LNK A;  3AKB A;  2LMU A;  1R2U A;  1ODB A;  1KK7 Z;  4AQJ A;  1ALW A;  2G9B A;  5AAN A;  2GGM A;  3DVM A;  2KAY A;  1CDP A;  1IJ5 A;  1WLM A;  5HKZ A;  3BXK A;  2JNX A;  1IQ3 A;  1AJ5 A;  2JU0 A;  2BE4 A;  1NX1 A;  2BKH B;  1M46 A;  1XK4 C;  4GGN A;  4Q04 A;  3SG7 A;  1UHH A;  1YUT A;  1SY9 A;  1KSM A;  4YRU A;  2F3Z A;  3C1V A;  3VRR A;  3K21 A;  4PE7 A;  1OQP A;  4ORA B;  2KDH A;  1EXR A;  2ZNE A;  5HYD A;  1XO5 A;  2JT8 A;  2JXL A;  1OZO A;  1MXE A;  5AXI A;  1EJ3 A;  5J3X A;  1ZOT B;  2LP3 A;  4ICB A;  1M45 A;  2LVI A;  1H8B A;  1SNL A;  1Y1A A;  2LP2 A;  1BR1 B;  3JVT B;  3PN7 C;  1J7Q A;  3EK8 A;  1UHK A;  5BPJ A;  3O78 A;  2Q91 A;  2ZRS A;  2F8P A;  1DF0 A;  2LE9 B;  1YUU A;  2COL B;  2G2B A;  1DVI A;  3GK4 X;  1CLB A;  3BYA A;  5HLO A;  2JTZ A;  2L51 A;  2CCM A;  4P5O E;  2GGZ A;  5HKW A;  5D69 A;  2BE6 A;  1XK4 A;  2MAZ A;  4XYN A;  1PAL A;  2FJU B;  1SYM A;  3I5I B;  4GAO A;  1PVA A;  1DJX A;  5HKY A;  2F3Y A;  2KI4 C;  1XFX O;  2Y5I A;  2BEC A;  1B47 A;  3PAT A;  4QJ4 B;  1TNW A;  4M2Q A;  4MLW A;  4UPG A;  2QAC A;  3I5F C;  3TZ1 A;  2PAS A;  1OZS A;  3BOW A;  1MQ1 A;  1M39 A;  5JJG A;  1Y1U A;  2L50 A;  3VRQ A;  1IJ6 A;  3H4S E;  2F33 A;  1BG1 A;  3FWC A;  1RTP 1;  4YBH B;  2BCB A;  2WCF A;  1SR6 B;  2OPO A;  3NXA A;  1TNQ A;  2HQW A;  4N5X A;  4GNK B;  2CXJ A;  2LCP A;  1BF5 A;  1B8R A;  1K9P A;  1WDC C;  3AKA A;  1SPY A;  3TS5 B;  1J7P A;  3I5H B;  4I5L B;  2AAO A;  4JWQ A;  1JFJ A;  1QIV A;  1SCM B;  3TUY B;  3EKH A;  4PHJ A;  1SCV A;  1MWN A;  1NYA A;  5I2L A;  3PFV A;  1C7V A;  2MLE C;  2BBM A;  2L2E A;  3KO0 A;  1H4B A;  5CPV A;  1NWD A;  1JUO A;  3GOF A;  1S5G Z;  4DIR A;  1PSR A;  2WC8 A;  3DVE A;  2K2F A;  4NQG A;  4OKH A;  1KFX S;  1A4P A;  4DCK A;  1BOC A;  1A03 A;  3BUN B;  1BJF A;  1NPQ A;  1F71 A;  2CBL A;  4XJK A;  1KSO A;  2V53 A;  4GUK A;  1W7J B;  3PM8 A;  3IF7 A;  1C07 A;  2MJW B;  1CM4 A;  2M9G A;  1UHN A;  3LK0 A;  3PLF B;  1AK8 A;  4AQI A;  1KK8 B;  1F54 A;  3ZNI A;  2SCP A;  2MHH A;  1F4O A;  1YRT B;  1YX7 A;  1FI5 A;  2A4J A;  4MRX A;  1TCO B;  2PAL A;  1ZMZ A;  1OMV A;  2ZRT A;  3BUW B;  5I8N A;  2DOQ A;  2FOT A;  3LK1 A;  3DF0 A;  3TDZ A;  1GJY A;  2M8U A;  2L0P A;  5KU1 A;  1SW8 A;  3RM1 A;  2CNP A;  1SL9 A;  2MRD A;  3NSL A;  5FYX A;  1KFU S;  1U5I A;  4IL1 A;  3I5G B;  2SAS A;  4YGD B;  2KQ6 A;  3FWB A;  2KGB C;  1JFK A;  3D0Y A;  3JVT C;  3SG5 A;  1CLL A;  4WRI A;  2PVB A;  3CZT X;  1CLM A;  1CM1 A;  2EC6 B;  1BR4 B;  1BT6 A;  3F45 A;  1YR5 A;  1JF0 A;  5ER4 X;  1F55 A;  1DJW A;  2KI6 C;  3CGA A;  2ZKM X;  1QIW A;  4ZCU A;  3KHE A;  2KSP A;  1CFC A;  3VRN A;  3CR4 X;  3O4Y A;  3I5I C;  2JT3 A;  2H2K A;  2M0R A;  1CB1 A;  1LKJ A;  1NX0 A;  3DVJ A;  1F70 A;  3DVK A;  1F8H A;  1HT9 A;  3BUO B;  4MZL A;  4NDB A;  2KYC A;  5GQQ C;  1GQM A;  2GV5 A;  2H61 C;  1KQV A;  2KI6 D;  2BBN A;  2OS8 B;  1W7I B;  1QV1 A;  4F0Z B;  2I2R E;  1G4Y R;  1YUR A;  1CMG A;  1YX8 A;  2D8N A;  1RFJ A;  4GPL B;  1S1E A;  1S36 A;  4QJ3 B;  2L4I A;  1AHR A;  2RGI A;  2O60 A;  1CDL A;  2K2A A;  4WQ3 A;  1SR6 C;  1QVI Z;  1A75 B;  1MXL C;  3M0W A;  2KFG A;  2M7N A;  4CID A;  3BQ3 A;  1J7O A;  1IRJ A;  4MSP A;  3OB2 B;  1B1G A;  1SKT A;  2JZI A;  3TS5 C;  4FTG A;  2WOR A;  1RWY A;  3I5H C;  4P2Y B;  1S5G Y;  1TIZ A;  1CFP A;  1SCM C;  4PHM A;  3TUY C;  3WXA A;  1QJT A;  2LM5 A;  5AEQ A;  3SG2 A;  1J7R A;  1RRO A;  2NCP A;  1CNP A;  3EKJ A;  5HLV A;  1B8C A;  4PDZ A;  4C0L A;  1N2D A;  2MBX A;  1AVS A;  4OR9 B;  2H61 A;  3GK1 A;  1J1E A;  1FPW A;  1Y6W A;  2I18 A;  2AMI A;  4NDC A;  3RLZ A;  2K61 A;  1YVL A;  1EH2 A;  3DD4 A;  1NP8 A;  2E6W A;  1A29 A;  4YGE B;  2M29 A;  5F6T A;  2JOJ A;  3VGO A;  1YUS A;  1B4C A;  4PE0 A;  1K2H A;  2PRU A;  1ZAC A;  1KK8 C;  5G08 A;  2R2I A;  1UP5 A;  1S6C A;  1IG5 A;  1EG4 A;  2ZND A;  2LLT A;  3CLN A;  3OP0 A;  2ISD A;  4PE4 A;  1EL4 A;  1PSB A;  2HET A;  1S6J A;  1TOP A;  1A2X A;  1N0Y A;  2M1U A;  2M1K B;  3OX5 A;  1K96 A;  3KEV A;  1DJI A;  2FCD A;  1JWD A;  1NSH A;  2LVJ A;  1J55 A;  4R1E A;  3EVU A;  3I5G C;  1CKK A;  3NSO A;  1REC A;  3WNX B;  1CDM A;  2M97 A;  1GGZ A;  1Y1X A;  2BCX A;  1XVJ A;  4ORB B;  1AJ4 A;  2KNE A;  2E30 A;  3WHT B;  2EC6 C;  3TDU A;  2LVV A;  1DJH A;  1VRK A;  5I2O A;  1UUS A;  4YGA A;  1YTZ C;  3NSI A;  3CTN A;  4L9M A;  4OV2 A;  3IQO A;  3OX6 A;  2JQ6 A;  1K95 A;  3EK4 A;  2JTT A;  3SG3 A;  1NX3 A;  2K7O A;  4DUQ A;  1NX2 A;  1Y0V H;  4D1E A;  1CFD A;  1QX7 A;  1BOD A;  1QVI Y;  1BLQ A;  2OS8 C;  1TCF A;  5KSZ A;  3HCM A;  1S6I A;  1M31 A;  1S26 D;  1TNP A;  1G8I A;  1L2O B;  2FCE A;  2TN4 A;  2JRF A;  1KFU L;  3JTD B;  1Q80 A;  4MBE A;  1TRF A;  2KOT A;  3FS7 A;  1LIN A;  4GBA A;  3CR5 X;  1SRA A;  4GGF C;  1QLS A;  4N1G A;  3AAJ A;  1TN4 A;  5TNC A;  3O2P A;  1OE9 B;  2O5G A;  5PAL A;  3FIA A;  1XFV O;  2F2P A;  4ZCV A;  1EG3 A;  2EHB A;  1J1D A;  4JPZ B;  3SJS A;  2KQY A;  2LVK A;  3OHM B;  2OTG B;  3GK2 A;  1UHJ A;  4MZJ A;  1CDN A;  2L5X B;  4U8D A;  3LCP C;  5DKN A;  2LV7 A;  3ZWH A;  4M2P A;  5B8I B;  5CSN A;  4YGB B;  1QX2 A;  3SIB A;  2NZ0 A;  4C0K A;  3BUX B;  4CLN A;  2LMV A;  1K94 A;  1LVC D;  3OB1 B;  1RJV A;  1M63 B;  2JNF A;  4GGF A;  1A75 A;  1UUR A;  1KWO B;  1K90 D;  4AOM A;  3A4U B;  1KCY A;  2KGR A;  1L7Z A;  2BL0 B;  4HRE E;  4ORC B;  2LMT A;  2LAP A;  3PAL A;  4M2O A;  4PCW A;  1V1F A;  2KYF A;  1SBJ A;  4OCI A;  2BKI B;  3WHU B;  1IH0 A;  4MZK A;  4CFQ A;  1QS7 A;  3NSK A;  4HSZ A;  4BY4 A;  1MUX A;  1DJY A;  2KAX A;  3EK7 A;  2Y1N A;  2K7B A;  5ER5 A;  1D1O A;  1DTL A;  4MRY A;  1XFZ O;  3SIA A;  1KQM B;  2KAV A;  1K9K A;  1QLK A;  4FQO A;  2Y4Q A;  1IWQ A;  2P6B B;  4PAL A;  4MVF A;  1WY9 A;  5D7F A;  5K89 A;  2QPT A;  1B8L A;  1WRK A;  3EVV A;  4DRW A;  4GFT A;  1S3P A;  1QXP A;  1K8U A;  1OOJ A;  1ZFS A;  2BCA A;  3EVR A;  5CSJ A;  4YGC B;  2M7L A;  3SG4 A;  1PRW A;  2K7D A;  4E68 A;  2HQ8 A;  1XA5 A;  1CMF A;  2M3W A;  1C7W A;  1GGW A;  1LXF C;  1QTX A;  4WQ2 A;  1LA3 A;  2M49 B;  1MF8 B;  4CFR A;  4QJ5 B;  1CFF A;  1IGV A;  1SL7 A;  2HPS A;  3PSR A;  1DF0 B;  2KBM A;  4HRH A;  1AP4 A;  1L2O C;  2ZFD A;  3JTD C;  2LLS A;  1SMG A;  2LAN A;  1B9A A;  3VRO A;  1K93 D;  4A4C A;  4JQ0 D;  2NXQ A;  4MN0 A;  1XFW O;  2EGD A;  4YI8 A;  1RK9 A;  2CTN A;  1B7T Y;  1LA0 A;  2WND A;  1QAS A;  1SL8 A;  2CT9 A;  1UHI A;  2JWW A;  2LC5 A;  2PSR A;  1G33 A;  3TDI A;  5AFP A;  1DMO A;  2IS9 A;  3KF9 A;  2JPT A;  4OVN F;  1KFX L;  1FI6 A;  1OMD A;  4MEW A;  1DGV A;  3BOW B;  2OTG C;  2LUX A;  4I5N B;  1MHO A;  2AUC A;  1MR8 A;  3MSE B;  5DKQ A;  5AER A;  4BY5 A;  1WRZ A;  2K0J A;  1ZUZ A;  2LHI A;  3LL8 B;  4NDD A;  2PMY A;  2JT0 A;  3PN7 B;  1NCX A;  2LUC A;  5JOL A;  1QV0 A;  5IBW A;  4TNC A;  1PUL A;  2KFF A;  3CWG A;  1BU3 A;  1TTX A;  1DT7 B;  1KK7 Y;  1YVH A;  2Q4U A;  4HRG A;  2L4H A;  1YRU B;  1ALV A;  1WRL A;  3QRX A;  1XFU O;  2NCO A;  1SK6 D;  4A4B A;  2WOS A;  2KBI A;  1KWO C;  2VRG A;  3AAK A;  1JC2 A;  1WLZ A;  1FW4 A;  3HX4 A;  2BL0 C;  4PHN A;  2LLU A;  1UWO A;  1FBV A;  2K7C A;  2LHL A;  2L98 A;  3O6B A;  5I2Q A;  4N1F A;  2F2O A;  1K9U A;  2KI4 B;  2MA2 A;  2I94 A;  2NLN A;  5KTY A;  3LLE A;  3A8R A;  4I5K A;  3I5F B;  2I7A A;  1NIW A;  1DJZ A;  1V1G A;  4XJK B;  3CR2 A;  1NCZ A;  1F4Q A;  1R6P A;  1IQ5 A;  4PE1 A;  4CPV A;  1QX5 B;  1IKU A;  2HF5 A;  3E3R A;  3SG6 A;  1DGU A;  1JF2 A;  1KQM C;  2K8M B;  4DS7 A;  2Y1M A;  3IQQ A;  3CS1 A;  1OSA A;  4USL A;  5CSI A;  3VRP A;  1DJG A;  1HQV A;  1N65 A;  1B7T Z;  3ICB A;  2KFH A;  2KHN A;  4YI9 A;  1AUI B;  2ZN9 A; 
#chains in the Genus database with same CATH topology
 1BMO A;  1PK0 D;  1NUB A;  1XFY O;  2B1U A;  2JUL A;  4PHK A;  1WDC B;  1E8A A;  1OMR A;  1CTR A;  4ETO A;  3KPX A;  2ZN8 A;  3DF0 B;  5DKR A;  1TNX A;  1JSA A;  5CSF A;  1FF1 A;  3BUM B;  3D10 A;  4I5J A;  1U5I B;  2WCB A;  2MLF C;  1QAT A;  2WCE A;  1JBA A;  2JXC A;  2WC5 A;  2KLE A;  1XYD A;  4C0J A;  1NCY A;  1X02 A;  1PVB A;  3D0Y B;  2JC2 A;  3L4L A;  2LNK A;  3AKB A;  2LMU A;  1R2U A;  1ODB A;  1T14 A;  1KK7 Z;  4AQJ A;  1ALW A;  1DC1 A;  2G9B A;  5AAN A;  2GGM A;  3DVM A;  2KAY A;  1CDP A;  1IJ5 A;  1WLM A;  5HKZ A;  3BXK A;  1Z4H A;  2JNX A;  1AJ5 A;  1IQ3 A;  2JU0 A;  2BE4 A;  1NX1 A;  2BKH B;  1M46 A;  1XK4 C;  4GGN A;  4Q04 A;  3S0G A;  3CAB A;  3SG7 A;  1UHH A;  1YUT A;  1SY9 A;  1OOI X;  1KSM A;  4YRU A;  1QWV A;  2F3Z A;  3C1V A;  3VRR A;  3K21 A;  3R1P A;  4PE7 A;  1OQP A;  4ORA B;  2KDH A;  1EXR A;  2ZNE A;  4JD9 A;  1XO5 A;  5HYD A;  2JT8 A;  2JXL A;  1OZO A;  1MXE A;  5AXI A;  1EJ3 A;  5J3X A;  1ZOT B;  2LP3 A;  4ICB A;  1M45 A;  2LVI A;  1H8B A;  1SNL A;  3BJH A;  1Y1A A;  5EL2 A;  2LP2 A;  1BR1 B;  3JVT B;  3PN7 C;  1J7Q A;  3EK8 A;  1UHK A;  5BPJ A;  3O78 A;  2Q91 A;  2ZRS A;  2F8P A;  1DF0 A;  1OW4 A;  2LE9 B;  1YUU A;  2COL B;  2G2B A;  1DVI A;  3GK4 X;  1CLB A;  3BYA A;  3CDN A;  5HLO A;  2JTZ A;  3B88 A;  2L51 A;  3NHI A;  3SS3 A;  2CCM A;  4P5O E;  2GGZ A;  5HKW A;  3O4X A;  5D69 A;  2BE6 A;  1XK4 A;  2MAZ A;  3PJI A;  4XYN A;  1PAL A;  2FJU B;  1SYM A;  3I5I B;  4GAO A;  1PVA A;  1DJX A;  5HKY A;  5FI2 A;  2F3Y A;  2KI4 C;  1XFX O;  2Y5I A;  2BEC A;  1B47 A;  3PAT A;  4QJ4 B;  1TNW A;  4M2Q A;  4MLW A;  4UPG A;  2QAC A;  3I5F C;  3S0F A;  3TZ1 A;  2PAS A;  1OZS A;  3BOW A;  1MQ1 A;  1M39 A;  5JJG A;  1Y1U A;  2L50 A;  3SS5 A;  3D73 A;  3K1E A;  1IJ6 A;  3H4S E;  3VRQ A;  2F33 A;  1BG1 A;  3FWC A;  1RTP 1;  4YBH B;  2BCB A;  2WCF A;  1SR6 B;  2OPO A;  3NXA A;  1ORG A;  1TNQ A;  2HQW A;  4N5X A;  4GNK B;  2CXJ A;  2LCP A;  1BF5 A;  1B8R A;  1K9P A;  1WDC C;  3AKA A;  1SPY A;  3TS5 B;  1J7P A;  3OGN A;  3I5H B;  2QEV A;  4I5L B;  2AAO A;  4JWQ A;  1JFJ A;  1QIV A;  1SCM B;  3TUY B;  3EKH A;  4PHJ A;  1SCV A;  1MWN A;  1NYA A;  5I2L A;  3PFV A;  1C7V A;  2MLE C;  2BBM A;  2L2E A;  3KO0 A;  1H4B A;  3DY9 A;  5CPV A;  1NWD A;  1JUO A;  3GOF A;  1S5G Z;  4DIR A;  1PSR A;  2WC8 A;  3DVE A;  2K2F A;  4NQG A;  4OKH A;  1KFX S;  1A4P A;  4DCK A;  1BOC A;  1A03 A;  3BUN B;  1BJF A;  1NPQ A;  1F71 A;  2CBL A;  3R1O A;  1KSO A;  2QDI A;  2V53 A;  3FE9 A;  1W7J B;  3PM8 A;  4GUK A;  4XJK A;  3S0E A;  3IF7 A;  1C07 A;  2MJW B;  5DIC A;  1CM4 A;  2M9G A;  1UHN A;  3LK0 A;  3PLF B;  1AK8 A;  2P70 A;  4AQI A;  1KK8 B;  1F54 A;  3ZNI A;  2SCP A;  2MHH A;  1F4O A;  1YRT B;  1XFR A;  2H8V A;  1YX7 A;  1FI5 A;  2A4J A;  2QEO A;  1TCO B;  2PAL A;  4MRX A;  1ZMZ A;  5D3O A;  1OMV A;  2ZRT A;  3BUW B;  5I8N A;  2JPO A;  4IJ7 A;  2DOQ A;  2FOT A;  3LK1 A;  3DF0 A;  3TDZ A;  1GJY A;  2M8U A;  2L0P A;  5KU1 A;  1SW8 A;  3RM1 A;  1SL9 A;  2CNP A;  2MRD A;  3NSL A;  5FYX A;  1KFU S;  1TUZ A;  1U5I A;  3I5G B;  4IL1 A;  5FI6 A;  2SAS A;  4YGD B;  2KQ6 A;  3FWB A;  2KGB C;  1JFK A;  3D0Y A;  1OOH A;  3JVT C;  3SG5 A;  1CLL A;  2K60 A;  3DZT A;  4WRI A;  2PVB A;  2QEB A;  3CZT X;  1CLM A;  1CM1 A;  2EC6 B;  1BR4 B;  1BT6 A;  3F45 A;  1YR5 A;  1JF0 A;  5ER4 X;  3FE8 A;  1F55 A;  1DJW A;  2KI6 C;  3CGA A;  3S0D A;  4PT1 A;  2ZKM X;  1QIW A;  4ZCU A;  3KHE A;  2KSP A;  1CFC A;  3VRN A;  3CR4 X;  3O4Y A;  3I5I C;  2JT3 A;  2H2K A;  2M0R A;  1CB1 A;  1LKJ A;  1NX0 A;  3DVJ A;  3Q8I A;  1F70 A;  3DVK A;  1F8H A;  1HT9 A;  3BUO B;  4MZL A;  4NDB A;  2KYC A;  4JKT A;  5GQQ C;  1GQM A;  2GV5 A;  2H61 C;  1KQV A;  2KI6 D;  3S0A A;  3DXL A;  2BBN A;  2OS8 B;  1W7I B;  1QV1 A;  4F0Z B;  2I2R E;  1G4Y R;  1YUR A;  1CMG A;  1YX8 A;  2D8N A;  1RFJ A;  4GPL B;  1S1E A;  1S36 A;  4FQT A;  4QJ3 B;  2L4I A;  1AHR A;  2RGI A;  2O60 A;  1GM0 A;  1CDL A;  3VB1 A;  2K2A A;  4WQ3 A;  1SR6 C;  1QVI Z;  1A75 B;  1MXL C;  3M0W A;  2KFG A;  2M7N A;  3B87 A;  4CID A;  3BQ3 A;  1J7O A;  1IRJ A;  1TWO A;  4MSP A;  3B86 A;  3OB2 B;  1B1G A;  1SKT A;  2JZI A;  3TS5 C;  4FTG A;  2WOR A;  1RWY A;  3I5H C;  4P2Y B;  1S5G Y;  1TIZ A;  1CFP A;  1SCM C;  4PHM A;  3TUY C;  3WXA A;  1QJT A;  2LM5 A;  5AEQ A;  2FJY A;  3SG2 A;  1J7R A;  1RRO A;  2NCP A;  1CNP A;  3EKJ A;  5HLV A;  1B8C A;  4PDZ A;  4C0L A;  1N2D A;  2MBX A;  1AVS A;  4OR9 B;  2H61 A;  3GK1 A;  1J1E A;  1FPW A;  3B7A A;  3B6X A;  1Y6W A;  2I18 A;  2AMI A;  4NDC A;  3D78 A;  3RLZ A;  2K61 A;  2L2C A;  1YVL A;  1EH2 A;  1TUJ A;  3DD4 A;  1NP8 A;  2E6W A;  4OZD A;  1A29 A;  4YGE B;  2M29 A;  5F6T A;  2JOJ A;  3VGO A;  1YUS A;  1B4C A;  4PE0 A;  1K2H A;  2ERB A;  1ZAC A;  2PRU A;  1KK8 C;  5G08 A;  2R2I A;  1UP5 A;  3BFH A;  5I94 A;  1S6C A;  1IG5 A;  1EG4 A;  2ZND A;  3CZ1 A;  1C3Z A;  3D75 A;  2LLT A;  3CLN A;  3OP0 A;  2ISD A;  4PE4 A;  1EL4 A;  1PSB A;  2HET A;  1S6J A;  2KPH A;  1TOP A;  1A2X A;  1N0Y A;  2M1U A;  2M1K B;  3OX5 A;  1K96 A;  3KEV A;  1DJI A;  2FCD A;  2GTE A;  1NSH A;  2LVJ A;  1J55 A;  1JWD A;  4R1E A;  2KLD A;  3EVU A;  3I5G C;  2BAP A;  3NSO A;  1CKK A;  1REC A;  3WNX B;  1CDM A;  2M97 A;  3NHT A;  1GGZ A;  1Y1X A;  2BCX A;  1XVJ A;  4ORB B;  1AJ4 A;  2KNE A;  2E30 A;  3D77 A;  1OOG A;  3WHT B;  2EC6 C;  1DEL A;  3TDU A;  2LVV A;  1DJH A;  1VRK A;  5I2O A;  1UUS A;  4YGA A;  1YTZ C;  3NSI A;  2YGU A;  3CTN A;  4L9M A;  3EG5 B;  4OV2 A;  3IQO A;  3OX6 A;  3SS4 A;  2JQ6 A;  1K95 A;  3EK4 A;  2JTT A;  3SG3 A;  1NX3 A;  3R1V A;  2K7O A;  4DUQ A;  1NX2 A;  1Y0V H;  1IIO A;  4D1E A;  1CFD A;  1QX7 A;  2WCH A;  1BOD A;  1QVI Y;  1BLQ A;  2OS8 C;  1TCF A;  5KSZ A;  3HCM A;  1S6I A;  1M31 A;  1S26 D;  1TNP A;  1G8I A;  1L2O B;  2FCE A;  2TN4 A;  2JRF A;  1DEK A;  1KFU L;  3JTD B;  1Q80 A;  4MBE A;  1TRF A;  2KOT A;  3FS7 A;  1LIN A;  4GBA A;  3CR5 X;  1SRA A;  4GGF C;  3S0B A;  1QLS A;  4N1G A;  3AAJ A;  1TN4 A;  3OBV A;  3O2P A;  4KYN A;  1OE9 B;  5TNC A;  2O5G A;  5PAL A;  2PYQ A;  3FIA A;  1XFV O;  2F2P A;  4ZCV A;  3CYZ A;  1EG3 A;  2EHB A;  1J1D A;  4JPZ B;  1C3Y A;  3SJS A;  2KQY A;  2LVK A;  3OHM B;  2OTG B;  3GK2 A;  1UHJ A;  4MZJ A;  1CDN A;  2WCJ A;  2WCM A;  2L5X B;  4U8D A;  3LCP C;  5DKN A;  2LV7 A;  3ZWH A;  4M2P A;  5B8I B;  5CSN A;  4YGB B;  1QX2 A;  3SIB A;  2NZ0 A;  4C0K A;  3BUX B;  4CLN A;  3PM2 A;  2LMV A;  3D74 A;  1K94 A;  1LVC D;  3OB1 B;  1RJV A;  1M63 B;  2JNF A;  4GGF A;  1A75 A;  1UUR A;  1KWO B;  1K90 D;  4AOM A;  3A4U B;  1KCY A;  2KGR A;  3L4A A;  1L7Z A;  2BL0 B;  4HRE E;  4ORC B;  4INW A;  2LMT A;  2LAP A;  3PAL A;  4M2O A;  1LS8 A;  4PCW A;  1V1F A;  2KYF A;  1SBJ A;  4OCI A;  2BKI B;  3WHU B;  2BNX A;  1IH0 A;  4MZK A;  4CFQ A;  1QS7 A;  3IVT A;  3NSK A;  4HSZ A;  4BY4 A;  1MUX A;  1DJY A;  2KAX A;  2L5Y A;  3EK7 A;  2Y1N A;  2K7B A;  3FE6 A;  5ER5 A;  1D1O A;  1DTL A;  4MRY A;  1P28 A;  1XFZ O;  3SIA A;  1KQM B;  2KAV A;  1K9K A;  1QLK A;  1Z2C B;  2Y4Q A;  4FQO A;  1IWQ A;  2P6B B;  3D76 A;  1OOF A;  4PAL A;  4MVF A;  1WY9 A;  5D7F A;  5K89 A;  2QPT A;  1B8L A;  1SSE B;  1WRK A;  3EVV A;  5CSI A;  3R72 A;  4DRW A;  4GFT A;  1DQE A;  1S3P A;  4F7F A;  1QXP A;  3V2L A;  1K8U A;  1OOJ A;  1ZFS A;  2BCA A;  3EVR A;  5CSJ A;  4YGC B;  2M7L A;  3SG4 A;  1PRW A;  2K7D A;  4E68 A;  2HQ8 A;  1XA5 A;  3RZS A;  1CMF A;  2M3W A;  1C7W A;  1GGW A;  1LXF C;  1QTX A;  4WQ2 A;  1LA3 A;  2M49 B;  1MF8 B;  4CFR A;  4QJ5 B;  1CFF A;  1IGV A;  1SL7 A;  2HPS A;  3PSR A;  1DF0 B;  2KBM A;  4HRH A;  1AP4 A;  1L2O C;  2ZFD A;  2P71 A;  3JTD C;  2LLS A;  1SMG A;  2LAN A;  5FI7 A;  1B9A A;  3VRO A;  1K93 D;  4A4C A;  4JQ0 D;  2NXQ A;  4MN0 A;  1XFW O;  2EGD A;  4YI8 A;  1RK9 A;  2CTN A;  1B7T Y;  1LA0 A;  3BFB A;  2WND A;  1QAS A;  1SL8 A;  2CT9 A;  1UHI A;  2JWW A;  2LC5 A;  2WCL A;  2PSR A;  1G33 A;  2QEH A;  3TDI A;  3UO9 A;  5AFP A;  1DMO A;  2IS9 A;  3KF9 A;  3UNW A;  2JPT A;  4OVN F;  1KFX L;  1FI6 A;  1OMD A;  4MEW A;  1DGV A;  3BOW B;  2OTG C;  2LUX A;  4I5N B;  1MHO A;  2AUC A;  1MR8 A;  3MSE B;  5DKQ A;  5AER A;  4BY5 A;  1WRZ A;  2K0J A;  1ZUZ A;  2LHI A;  3LL8 B;  4NDD A;  2PMY A;  2JT0 A;  3PN7 B;  1NCX A;  2LUC A;  5JOL A;  5HL1 A;  1QV0 A;  5IBW A;  4TNC A;  1PUL A;  2KFF A;  3CWG A;  1BU3 A;  1TTX A;  3CZ2 A;  1DT7 B;  1KK7 Y;  1YVH A;  2Q4U A;  4HRG A;  2L4H A;  1W9Z A;  1YRU B;  1ALV A;  1WRL A;  3QRX A;  1XFU O;  2NCO A;  1SK6 D;  4A4B A;  2WOS A;  2KBI A;  1KWO C;  3L47 A;  2VRG A;  3CZ0 A;  3AAK A;  3BFA A;  1JC2 A;  1WLZ A;  1FW4 A;  3HX4 A;  4INX A;  2BL0 C;  4PHN A;  2LLU A;  1UWO A;  1FBV A;  2K7C A;  2LHL A;  2L98 A;  2WCK A;  3NGV A;  3O6B A;  4N1F A;  5I2Q A;  2F2O A;  1K9U A;  2KI4 B;  2MA2 A;  2I94 A;  2NLN A;  5KTY A;  3LLE A;  3A8R A;  4I5K A;  3I5F B;  3QME A;  2I7A A;  1NIW A;  1DJZ A;  1V1G A;  2WC6 A;  4XJK B;  3CR2 A;  1NCZ A;  1F4Q A;  1R6P A;  1IQ5 A;  4PE1 A;  4CPV A;  1QX5 B;  1IKU A;  2HF5 A;  3E3R A;  3SG6 A;  1DGU A;  1JF2 A;  1KQM C;  2K8M B;  4DS7 A;  2Y1M A;  3IQQ A;  3CS1 A;  1OSA A;  3N7H A;  4USL A;  2PQL A;  1DJG A;  1HQV A;  1N65 A;  3DYE A;  1B7T Z;  3VRP A;  3ICB A;  2KFH A;  2KHN A;  4YI9 A;  1AUI B;  2ZN9 A; 
#chains in the Genus database with same CATH homology
 1BMO A;  1PK0 D;  1NUB A;  1XFY O;  2B1U A;  2JUL A;  4PHK A;  1WDC B;  1E8A A;  1OMR A;  1CTR A;  4ETO A;  3KPX A;  2ZN8 A;  3DF0 B;  5DKR A;  1TNX A;  1JSA A;  5CSF A;  1FF1 A;  3BUM B;  3D10 A;  4I5J A;  1U5I B;  2WCB A;  2MLF C;  1QAT A;  2WCE A;  1JBA A;  2JXC A;  1XYD A;  4C0J A;  1NCY A;  1X02 A;  1PVB A;  3D0Y B;  2JC2 A;  2LNK A;  3AKB A;  2LMU A;  1R2U A;  1ODB A;  1KK7 Z;  4AQJ A;  1ALW A;  2G9B A;  5AAN A;  2GGM A;  3DVM A;  2KAY A;  1CDP A;  1IJ5 A;  1WLM A;  5HKZ A;  3BXK A;  2JNX A;  1IQ3 A;  1AJ5 A;  2JU0 A;  2BE4 A;  1NX1 A;  2BKH B;  1M46 A;  1XK4 C;  4GGN A;  4Q04 A;  3SG7 A;  1UHH A;  1YUT A;  1SY9 A;  1KSM A;  4YRU A;  2F3Z A;  3C1V A;  3VRR A;  3K21 A;  4PE7 A;  1OQP A;  4ORA B;  2KDH A;  1EXR A;  2ZNE A;  5HYD A;  1XO5 A;  2JT8 A;  2JXL A;  1OZO A;  1MXE A;  5AXI A;  1EJ3 A;  5J3X A;  1ZOT B;  2LP3 A;  4ICB A;  1M45 A;  2LVI A;  1H8B A;  1SNL A;  1Y1A A;  2LP2 A;  1BR1 B;  3JVT B;  3PN7 C;  1J7Q A;  3EK8 A;  1UHK A;  5BPJ A;  3O78 A;  2Q91 A;  2ZRS A;  2F8P A;  1DF0 A;  2LE9 B;  1YUU A;  2COL B;  2G2B A;  1DVI A;  3GK4 X;  1CLB A;  3BYA A;  5HLO A;  2JTZ A;  2L51 A;  2CCM A;  4P5O E;  2GGZ A;  5HKW A;  5D69 A;  2BE6 A;  1XK4 A;  2MAZ A;  4XYN A;  1PAL A;  2FJU B;  1SYM A;  3I5I B;  4GAO A;  1PVA A;  1DJX A;  5HKY A;  2F3Y A;  2KI4 C;  1XFX O;  2Y5I A;  2BEC A;  1B47 A;  3PAT A;  4QJ4 B;  1TNW A;  4M2Q A;  4MLW A;  4UPG A;  2QAC A;  3I5F C;  3TZ1 A;  2PAS A;  1OZS A;  3BOW A;  1MQ1 A;  1M39 A;  5JJG A;  1Y1U A;  2L50 A;  3VRQ A;  1IJ6 A;  3H4S E;  2F33 A;  1BG1 A;  3FWC A;  1RTP 1;  4YBH B;  2BCB A;  2WCF A;  1SR6 B;  2OPO A;  3NXA A;  1TNQ A;  2HQW A;  4N5X A;  4GNK B;  2CXJ A;  2LCP A;  1BF5 A;  1B8R A;  1K9P A;  1WDC C;  3AKA A;  1SPY A;  3TS5 B;  1J7P A;  3I5H B;  4I5L B;  2AAO A;  4JWQ A;  1JFJ A;  1QIV A;  1SCM B;  3TUY B;  3EKH A;  4PHJ A;  1SCV A;  1MWN A;  1NYA A;  5I2L A;  3PFV A;  1C7V A;  2MLE C;  2BBM A;  2L2E A;  3KO0 A;  1H4B A;  5CPV A;  1NWD A;  1JUO A;  3GOF A;  1S5G Z;  4DIR A;  1PSR A;  2WC8 A;  3DVE A;  2K2F A;  4NQG A;  4OKH A;  1KFX S;  1A4P A;  4DCK A;  1BOC A;  1A03 A;  3BUN B;  1BJF A;  1NPQ A;  1F71 A;  2CBL A;  4XJK A;  1KSO A;  2V53 A;  4GUK A;  1W7J B;  3PM8 A;  3IF7 A;  1C07 A;  2MJW B;  1CM4 A;  2M9G A;  1UHN A;  3LK0 A;  3PLF B;  1AK8 A;  4AQI A;  1KK8 B;  1F54 A;  3ZNI A;  2SCP A;  2MHH A;  1F4O A;  1YRT B;  1YX7 A;  1FI5 A;  2A4J A;  4MRX A;  1TCO B;  2PAL A;  1ZMZ A;  1OMV A;  2ZRT A;  3BUW B;  5I8N A;  2DOQ A;  2FOT A;  3LK1 A;  3DF0 A;  3TDZ A;  1GJY A;  2M8U A;  2L0P A;  5KU1 A;  1SW8 A;  3RM1 A;  2CNP A;  1SL9 A;  2MRD A;  3NSL A;  5FYX A;  1KFU S;  1U5I A;  4IL1 A;  3I5G B;  2SAS A;  4YGD B;  2KQ6 A;  3FWB A;  2KGB C;  1JFK A;  3D0Y A;  3JVT C;  3SG5 A;  1CLL A;  4WRI A;  2PVB A;  3CZT X;  1CLM A;  1CM1 A;  2EC6 B;  1BR4 B;  1BT6 A;  3F45 A;  1YR5 A;  1JF0 A;  5ER4 X;  1F55 A;  1DJW A;  2KI6 C;  3CGA A;  2ZKM X;  1QIW A;  4ZCU A;  3KHE A;  2KSP A;  1CFC A;  3VRN A;  3CR4 X;  3O4Y A;  3I5I C;  2JT3 A;  2H2K A;  2M0R A;  1CB1 A;  1LKJ A;  1NX0 A;  3DVJ A;  1F70 A;  3DVK A;  1F8H A;  1HT9 A;  3BUO B;  4MZL A;  4NDB A;  2KYC A;  5GQQ C;  1GQM A;  2GV5 A;  2H61 C;  1KQV A;  2KI6 D;  2BBN A;  2OS8 B;  1W7I B;  1QV1 A;  4F0Z B;  2I2R E;  1G4Y R;  1YUR A;  1CMG A;  1YX8 A;  2D8N A;  1RFJ A;  4GPL B;  1S1E A;  1S36 A;  4QJ3 B;  2L4I A;  1AHR A;  2RGI A;  2O60 A;  1CDL A;  2K2A A;  4WQ3 A;  1SR6 C;  1QVI Z;  1A75 B;  1MXL C;  3M0W A;  2KFG A;  2M7N A;  4CID A;  3BQ3 A;  1J7O A;  1IRJ A;  4MSP A;  3OB2 B;  1B1G A;  1SKT A;  2JZI A;  3TS5 C;  4FTG A;  2WOR A;  1RWY A;  3I5H C;  4P2Y B;  1S5G Y;  1TIZ A;  1CFP A;  1SCM C;  4PHM A;  3TUY C;  3WXA A;  1QJT A;  2LM5 A;  5AEQ A;  3SG2 A;  1J7R A;  1RRO A;  2NCP A;  1CNP A;  3EKJ A;  5HLV A;  1B8C A;  4PDZ A;  4C0L A;  1N2D A;  2MBX A;  1AVS A;  4OR9 B;  2H61 A;  3GK1 A;  1J1E A;  1FPW A;  1Y6W A;  2I18 A;  2AMI A;  4NDC A;  3RLZ A;  2K61 A;  1YVL A;  1EH2 A;  3DD4 A;  1NP8 A;  2E6W A;  1A29 A;  4YGE B;  2M29 A;  5F6T A;  2JOJ A;  3VGO A;  1YUS A;  1B4C A;  4PE0 A;  1K2H A;  2PRU A;  1ZAC A;  1KK8 C;  5G08 A;  2R2I A;  1UP5 A;  1S6C A;  1IG5 A;  1EG4 A;  2ZND A;  2LLT A;  3CLN A;  3OP0 A;  2ISD A;  4PE4 A;  1EL4 A;  1PSB A;  2HET A;  1S6J A;  1TOP A;  1A2X A;  1N0Y A;  2M1U A;  2M1K B;  3OX5 A;  1K96 A;  3KEV A;  1DJI A;  2FCD A;  1JWD A;  1NSH A;  2LVJ A;  1J55 A;  4R1E A;  3EVU A;  3I5G C;  1CKK A;  3NSO A;  1REC A;  3WNX B;  1CDM A;  2M97 A;  1GGZ A;  1Y1X A;  2BCX A;  1XVJ A;  4ORB B;  1AJ4 A;  2KNE A;  2E30 A;  3WHT B;  2EC6 C;  3TDU A;  2LVV A;  1DJH A;  1VRK A;  5I2O A;  1UUS A;  4YGA A;  1YTZ C;  3NSI A;  3CTN A;  4L9M A;  4OV2 A;  3IQO A;  3OX6 A;  2JQ6 A;  1K95 A;  3EK4 A;  2JTT A;  3SG3 A;  1NX3 A;  2K7O A;  4DUQ A;  1NX2 A;  1Y0V H;  4D1E A;  1CFD A;  1QX7 A;  1BOD A;  1QVI Y;  1BLQ A;  2OS8 C;  1TCF A;  5KSZ A;  3HCM A;  1S6I A;  1M31 A;  1S26 D;  1TNP A;  1G8I A;  1L2O B;  2FCE A;  2TN4 A;  2JRF A;  1KFU L;  3JTD B;  1Q80 A;  4MBE A;  1TRF A;  2KOT A;  3FS7 A;  1LIN A;  4GBA A;  3CR5 X;  1SRA A;  4GGF C;  1QLS A;  4N1G A;  3AAJ A;  1TN4 A;  5TNC A;  3O2P A;  1OE9 B;  2O5G A;  5PAL A;  3FIA A;  1XFV O;  2F2P A;  4ZCV A;  1EG3 A;  2EHB A;  1J1D A;  4JPZ B;  3SJS A;  2KQY A;  2LVK A;  3OHM B;  2OTG B;  3GK2 A;  1UHJ A;  4MZJ A;  1CDN A;  2L5X B;  4U8D A;  3LCP C;  5DKN A;  2LV7 A;  3ZWH A;  4M2P A;  5B8I B;  5CSN A;  4YGB B;  1QX2 A;  3SIB A;  2NZ0 A;  4C0K A;  3BUX B;  4CLN A;  2LMV A;  1K94 A;  1LVC D;  3OB1 B;  1RJV A;  1M63 B;  2JNF A;  4GGF A;  1A75 A;  1UUR A;  1KWO B;  1K90 D;  4AOM A;  3A4U B;  1KCY A;  2KGR A;  1L7Z A;  2BL0 B;  4HRE E;  4ORC B;  2LMT A;  2LAP A;  3PAL A;  4M2O A;  4PCW A;  1V1F A;  2KYF A;  1SBJ A;  4OCI A;  2BKI B;  3WHU B;  1IH0 A;  4MZK A;  4CFQ A;  1QS7 A;  3NSK A;  4HSZ A;  4BY4 A;  1MUX A;  1DJY A;  2KAX A;  3EK7 A;  2Y1N A;  2K7B A;  5ER5 A;  1D1O A;  1DTL A;  4MRY A;  1XFZ O;  3SIA A;  1KQM B;  2KAV A;  1K9K A;  1QLK A;  4FQO A;  2Y4Q A;  1IWQ A;  2P6B B;  4PAL A;  4MVF A;  1WY9 A;  5D7F A;  5K89 A;  2QPT A;  1B8L A;  1WRK A;  3EVV A;  4DRW A;  4GFT A;  1S3P A;  1QXP A;  1K8U A;  1OOJ A;  1ZFS A;  2BCA A;  3EVR A;  5CSJ A;  4YGC B;  2M7L A;  3SG4 A;  1PRW A;  2K7D A;  4E68 A;  2HQ8 A;  1XA5 A;  1CMF A;  2M3W A;  1C7W A;  1GGW A;  1LXF C;  1QTX A;  4WQ2 A;  1LA3 A;  2M49 B;  1MF8 B;  4CFR A;  4QJ5 B;  1CFF A;  1IGV A;  1SL7 A;  2HPS A;  3PSR A;  1DF0 B;  2KBM A;  4HRH A;  1AP4 A;  1L2O C;  2ZFD A;  3JTD C;  2LLS A;  1SMG A;  2LAN A;  1B9A A;  3VRO A;  1K93 D;  4A4C A;  4JQ0 D;  2NXQ A;  4MN0 A;  1XFW O;  2EGD A;  4YI8 A;  1RK9 A;  2CTN A;  1B7T Y;  1LA0 A;  2WND A;  1QAS A;  1SL8 A;  2CT9 A;  1UHI A;  2JWW A;  2LC5 A;  2PSR A;  1G33 A;  3TDI A;  5AFP A;  1DMO A;  2IS9 A;  3KF9 A;  2JPT A;  4OVN F;  1KFX L;  1FI6 A;  1OMD A;  4MEW A;  1DGV A;  3BOW B;  2OTG C;  2LUX A;  4I5N B;  1MHO A;  2AUC A;  1MR8 A;  3MSE B;  5DKQ A;  5AER A;  4BY5 A;  1WRZ A;  2K0J A;  1ZUZ A;  2LHI A;  3LL8 B;  4NDD A;  2PMY A;  2JT0 A;  3PN7 B;  1NCX A;  2LUC A;  5JOL A;  1QV0 A;  5IBW A;  4TNC A;  1PUL A;  2KFF A;  3CWG A;  1BU3 A;  1TTX A;  1DT7 B;  1KK7 Y;  1YVH A;  2Q4U A;  4HRG A;  2L4H A;  1YRU B;  1ALV A;  1WRL A;  3QRX A;  1XFU O;  2NCO A;  1SK6 D;  4A4B A;  2WOS A;  2KBI A;  1KWO C;  2VRG A;  3AAK A;  1JC2 A;  1WLZ A;  1FW4 A;  3HX4 A;  2BL0 C;  4PHN A;  2LLU A;  1UWO A;  1FBV A;  2K7C A;  2LHL A;  2L98 A;  3O6B A;  5I2Q A;  4N1F A;  2F2O A;  1K9U A;  2KI4 B;  2MA2 A;  2I94 A;  2NLN A;  5KTY A;  3LLE A;  3A8R A;  4I5K A;  3I5F B;  2I7A A;  1NIW A;  1DJZ A;  1V1G A;  4XJK B;  3CR2 A;  1NCZ A;  1F4Q A;  1R6P A;  1IQ5 A;  4PE1 A;  4CPV A;  1QX5 B;  1IKU A;  2HF5 A;  3E3R A;  3SG6 A;  1DGU A;  1JF2 A;  1KQM C;  2K8M B;  4DS7 A;  2Y1M A;  3IQQ A;  3CS1 A;  1OSA A;  4USL A;  5CSI A;  3VRP A;  1DJG A;  1HQV A;  1N65 A;  1B7T Z;  3ICB A;  2KFH A;  2KHN A;  4YI9 A;  1AUI B;  2ZN9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...