1C7VA

Nmr solution structure of the calcium-bound c-terminal domain (w81-s161) of calcium vector protein from amphioxus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
68
structure length
68
Chain Sequence
EEEILRAFKVFDANGDGVIDFDEFKFIMQKVGEEPLTDAEVEEAMKEADEDGNGVIDIPEFMDLIKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords CALCIUM VECTOR PROTEIN
publication title Sequential calcium binding to the regulatory domain of calcium vector protein reveals functional asymmetry and a novel mode of structural rearrangement.
pubmed doi rcsb
source organism Branchiostoma lanceolatum
total genus 19
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2000-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1c7vA00
5G08A 1XK4C 1QATA 1WY9A 3LL8B 4GGNA 1QX5B 3D0YB 3NSKA 1QIVA 1X02A 1PULA 2LLSA 4MVFA 1CM1A 4OV2A 1HQVA 2I2RE 2JOJA 2BKIB 2KI6D 2PSRA 3M0WA 1WRKA 2I94A 2IS9A 2M29A 1FBVA 1NCZA 1ODBA 1RROA 2L4IA 3BUOB 2EC6C 4F0ZB 2TN4A 1IKUA 1DJGA 2ISDA 1KQMB 5I2LA 2K8MB 1ZACA 4C0LA 1QLSA 1RK9A 1DT7B 1RECA 4AOMA 1L7ZA 1M45A 3BOWA 1EL4A 3DF0A 1YTZC 1TCFA 1TNXA 1UURA 1S26D 1CLBA 4I5JA 1S3PA 1SL9A 3BQ3A 1IRJA 2F2OA 4NDDA 1OMVA 4QJ5B 1K9KA 2K61A 2JXLA 2L50A 2ZNEA 2COLB 3SG4A 2KI6C 3DVJA 2I18A 1B7TY 1CDMA 3BXKA 3TDIA 1CM4A 2OTGC 5DKQA 1J7OA 1AHRA 2JXCA 1GJYA 1JSAA 2F8PA 4QJ4B 2KQYA 3LK0A 1YUUA 2G9BA 1FI5A 5BPJA 1C7WA 2NXQA 1SRAA 3OX5A 4N1FA 1XFVO 2EC6B 5KTYA 1UWOA 1DF0B 1DJXA 2FOTA 1KK7Z 1A75A 1LA3A 1Y6WA 1YR5A 2M3WA 1QJTA 1Y1UA 1YVLA 3VRQA 4PE7A 1AVSA 4MEWA 2KAVA 4GUKA 4MRXA 2LV7A 1E8AA 2MBXA 4A4BA 1IJ6A 3JTDC 4YGCB 2H61C 3BUWB 5K89A 3CR5X 2CBLA 3LK1A 1F8HA 1CLLA 1UHNA 1UUSA 1B8CA 4USLA 1DGVA 1K9UA 2G2BA 2OTGB 2ZN9A 2GGZA 4FTGA 1QV0A 1SR6C 1Y1AA 1XA5A 4I5LB 2LMUA 1AJ4A 4JQ0D 1OSAA 4PALA 2LVVA 2LE9B 3VGOA 2HQ8A 2KGRA 3PALA 3EKJA 3GK1A 4DRWA 4ORBB 1IQ5A 1KFXL 2K7OA 4M2QA 4MLWA 4HRGA 3ICBA 2PASA 1CFDA 3SJSA 4CFQA 5J3XA 3EK8A 4ZCUA 1CLMA 2JULA 1AK8A 3SIAA 1JF0A 1CNPA 3JVTC 5B8IB 5HLOA 3JTDB 1XFWO 1QX7A 1KK7Y 1M39A 4M2OA 1EH2A 1UP5A 2BCAA 3K21A 3WHUB 4GFTA 1XVJA 1BR4B 4UPGA 2WCBA 4YGBB 4NDBA 1SR6B 3H4SE 1CDNA 3VRPA 2CCMA 3KO0A 3HX4A 1KK8C 1DTLA 1QTXA 1YRUB 1KSMA 2L5XB 4I5KA 1K9PA 1SCVA 2OS8C 4A4CA 4ZCVA 1B8LA 2BCXA 4P5OE 3PM8A 3GK2A 1OOJA 1BODA 1F71A 1IH0A 1VRKA 2V53A 4CPVA 1J7QA 1K8UA 1BMOA 2PRUA 3DVKA 4MSPA 2L4HA 1HT9A 3JVTB 1YRTB 2E6WA 3CWGA 1NPQA 2BL0C 3I5IC 5D69A 1KWOC 2L98A 3VROA 2ZNDA 3TDZA 1XK4A 1RFJA 2KFGA 2KNEA 3EVVA 4R1EA 1OQPA 5CSJA 1OZSA 1SNLA 1J55A 1TNWA 4YBHB 5HKWA 4PHNA 2K7BA 3PN7C 4OCIA 5FYXA 2AAOA 3CS1A 1KK8B 1YX7A 2LHIA 1KSOA 3OB1B 2MRDA 1G8IA 3A4UB 4PCWA 1QXPA 3IQOA 4L9MA 2OS8B 5JOLA 3GOFA 4DS7A 3I5HC 2JNXA 2GGMA 1JC2A 4PE4A 2CT9A 1EG3A 1DJZA 2JT3A 1K96A 4XYNA 2L0PA 3BYAA 1MXLC 1JFJA 5PALA 2WCFA 5I8NA 2KYFA 1IJ5A 1MQ1A 1SBJA 1TNPA 1XFYO 3DVEA 1JFKA 2HF5A 2BL0B 1U5IB 3I5IB 2NCPA 1F54A 1KWOB 2K2AA 1KQVA 1DJHA 2E30A 2VRGA 3FIAA 1B47A 4MZKA 2M1UA 2M9GA 1QIWA 4PDZA 2MAZA 3VRRA 3EVRA 3FWBA 3OB2B 1CTRA 2JTZA 5KU1A 2O60A 1DJIA 4GGFC 1XYDA 3PN7B 3WHTB 1NCXA 4E68A 2KGBC 3TZ1A 2LUCA 1FF1A 2QPTA 4ETOA 1CFPA 2M7LA 1AJ5A 3AAKA 2MA2A 4ORCB 3MSEB 3AAJA 1MR8A 2LMVA 3I5HB 3RLZA 5HKYA 3EK7A 1BF5A 4YI8A 1C07A 2OPOA 3ZWHA 4NQGA 4PHMA 4YRUA 2H2KA 1YX8A 2BKHB 1OMDA 1S6CA 1SCMC 4XJKA 1C7VA 2ZRSA 1SL8A 1FW4A 4CLNA 4JWQA 3BOWB 2CNPA 3DF0B 2ZRTA 2BCBA 1PVBA 3KF9A 1KFXS 4AQIA 1TRFA 2H61A 1YUTA 2KDHA 3I5FC 4PHKA 3OP0A 3CLNA 2LVKA 4OVNF 4WRIA 3O2PA 2BBNA 2KHNA 1A4PA 1GGWA 2CXJA 3GK4X 2MJWB 1BOCA 1CDLA 2WNDA 1A03A 4WQ2A 5AFPA 1N0YA 3CGAA 1B4CA 1ZFSA 1H4BA 1R6PA 1S6JA 1K90D 2F3ZA 1ALVA 2RGIA 4BY4A 2KYCA 1SMGA 2L51A 4OKHA 3IQQA 1TNQA 1BG1A 2BECA 1MUXA 2NZ0A 2WCEA 2LLTA 3BUXB 3CR2A 2JWWA 3I5GC 1CDPA 2L2EA 1XO5A 2KAXA 1EJ3A 1SCMB 2WORA 1GGZA 3KHEA 2BE6A 1S5GZ 1KCYA 5CSIA 2LHLA 1TOPA 1A75B 2AUCA 2B1UA 1QLKA 3FS7A 2FJUB 3SG7A 1WRZA 1M31A 3BUNB 4YGAA 4I5NB 5HYDA 1A29A 1XFZO 3D0YA 1PSRA 4C0JA 1BLQA 1MHOA 1SK6D 1TTXA 3E3RA 3I5FB 3SG6A 4YGDB 4CIDA 2Y5IA 3EKHA 1MF8B 2LM5A 1NUBA 2HPSA 1TN4A 1AP4A 1NWDA 5IBWA 1UHHA 1JWDA 1L2OC 1N65A 1J1EA 5AXIA 4PE1A 2LVJA 1F55A 4PE0A 1ZOTB 2JPTA 4GPLB 2JNFA 3C1VA 1JBAA 1UHIA 2K7DA 1SW8A 3I5GB 1QVIZ 5CSNA 3KPXA 3QRXA 2F2PA 2MLEC 3DD4A 1NIWA 3NSIA 3DVMA 4MRYA 4MBEA 4YI9A 3AKBA 1RJVA 2P6BB 1PALA 2LVIA 3CZTX 4HRHA 4ORAB 4C0KA 3FWCA 2NLNA 1V1GA 1U5IA 1IQ3A 1PSBA 1XFUO 1NX2A 3TDUA 2KBMA 2I7AA 3CR4X 4D1EA 4GBAA 1N2DA 1BR1B 5AERA 1IG5A 2JQ6A 2K2FA 1NYAA 1WLMA 1L2OB 2M0RA 1B9AA 3IF7A 3O78A 1Q80A 3SG2A 2D8NA 1XFXO 2JT8A 1OMRA 2JZIA 4N5XA 2Y4QA 2ZFDA 1K94A 1G33A 1PK0D 1DF0A 2KOTA 1QV1A 4WQ3A 2LNKA 1S1EA 4JPZB 1MWNA 1SL7A 1H8BA 1ALWA 2BBMA 1GQMA 1CFCA 2Q91A 4N1GA 1NX0A 2KBIA 1BJFA 1FI6A 1LA0A 4YGEB 1RWYA 4DIRA 3NSLA 2LP2A 2LAPA 4DUQA 1YVHA 1QVIY 2SASA 1LXFC 1G4YR 2R2IA 3OHMB 2HETA 2WOSA 1NCYA 3NSOA 5GQQC 2O5GA 3NXAA 5I2QA 2MHHA 1SY9A 1Y0VH 2KI4C 4GGFA 2LUXA 2M1KB 5DKNA 2NCOA 2ZN8A 4M2PA 3TUYC 1W7IB 4PHJA 2KQ6A 1R2UA 4QJ3B 1MXEA 2PVBA 2FCDA 5D7FA 1K93D 1SKTA 1QX2A 2KSPA 4HREE 2KAYA 3F45A 1F4QA 3TS5C 2M49B 1V1FA 3SG3A 2EHBA 2DOQA 5CSFA 1AUIB 2FCEA 1CFFA 2JT0A 2QACA 3SG5A 1F70A 2Y1NA 1J7RA 2JC2A 1W7JB 2K7CA 1CB1A 1DJYA 1WDCC 5HKZA 1EG4A 2HQWA 5CPVA 1IWQA 2JTTA 3ZNIA 1QASA 3PSRA 2WC8A 3A8RA 1ZUZA 3RM1A 1DMOA 1SPYA 5KSZA 1NX1A 2M8UA 4IL1A 2KI4B 1NSHA 3SIBA 1LVCD 3TUYB 1OE9B 1ZMZA 4HSZA 1LKJA 2SCPA 5HLVA 4AQJA 2BE4A 1BT6A 1BU3A 1CMGA 2EGDA 1Y1XA 1DJWA 2LC5A 4NDCA 2LANA 5JJGA 1JUOA 3BUMB 3TS5B 1JF2A 2LCPA 3KEVA 1KFUS 4FQOA 5ER5A 1YUSA 5I2OA 1S36A 2KFFA 5DKRA 5AEQA 3PLFB 1NP8A 1IGVA 1EXRA 1UHJA 2LLUA 1WDCB 1OZOA 3PATA 4XJKB 1RTP1 1LINA 2PMYA 4MZLA 1K2HA 1B1GA 1B8RA 1DVIA 1KFUL 1SYMA 1TIZA 4Q04A 2K0JA 3LCPC 2F33A 4GNKB 1CKKA 1D1OA 4OR9B 1PRWA 2MLFC 2F3YA 1NX3A 1FPWA 1WRLA 1QS7A 3VRNA 3LLEA 1UHKA 2CTNA 1A2XA 1M63B 2JU0A 4GAOA 5TNCA 2LP3A 3D10A 2Y1MA 1J7PA 1TCOB 2LMTA 3O6BA 2JRFA 4MZJA 2M7NA 3CTNA 3WNXB 2AMIA 1WLZA 5F6TA 4P2YB 2ZKMX 2PALA 5AANA 4DCKA 3HCMA 3PFVA 1PVAA 1S6IA 4MN0A 3EK4A 2A4JA 4U8DA 2M97A 4ICBA 1CMFA 5ER4X 1F4OA 1KQMC 1YURA 2KFHA 2Q4UA 1J1DA 4TNCA 1K95A 3O4YA 3EVUA 4CFRA 1S5GY 1B7TZ 3WXAA 4BY5A 2GV5A 1DGUA 3OX6A 3AKAA 1M46A
chains in the Genus database with same CATH superfamily
2KLEA 1XK4C 3CZ2A 5G08A 1QATA 1WY9A 3DY9A 4F7FA 3LL8B 4GGNA 1QX5B 3D0YB 3NSKA 1QIVA 1X02A 1PULA 2LLSA 3SS4A 4MVFA 1CM1A 4OV2A 1HQVA 2I2RE 2JOJA 2BKIB 2KI6D 2PSRA 3M0WA 2WCJA 1WRKA 2I94A 2IS9A 2M29A 3FE6A 1FBVA 1NCZA 1ODBA 1RROA 2L4IA 2WCHA 3BUOB 3B7AA 2EC6C 1QWVA 3B86A 2TN4A 4F0ZB 1IKUA 1DJGA 3N7HA 2ISDA 1KQMB 5I2LA 2K8MB 1ZACA 4C0LA 3RZSA 1QLSA 1IIOA 1RK9A 1DT7B 1RECA 4AOMA 1L7ZA 1M45A 3BOWA 1EL4A 3DF0A 3R72A 1YTZC 5I94A 1TCFA 1TNXA 1UURA 1S26D 1CLBA 3CYZA 4I5JA 1S3PA 1SL9A 3BQ3A 1IRJA 2F2OA 4NDDA 1OMVA 4QJ5B 1K9KA 2K61A 2JXLA 2L50A 2ZNEA 2COLB 3SG4A 2KI6C 3DVJA 2I18A 1B7TY 1CDMA 3BXKA 3TDIA 1CM4A 2OTGC 1DQEA 5DKQA 1AHRA 2JXCA 1J7OA 1GJYA 1JSAA 2F8PA 2KPHA 4QJ4B 2KQYA 3LK0A 1YUUA 2G9BA 1FI5A 5BPJA 1C7WA 1P28A 5EL2A 2NXQA 3V2LA 1SRAA 3OX5A 4N1FA 1XFVO 2EC6B 2QEVA 1UWOA 3UNWA 5KTYA 1DF0B 1DJXA 2FOTA 3D75A 1KK7Z 1A75A 1LA3A 1Y6WA 3B6XA 1YR5A 3CZ0A 2M3WA 1QJTA 1Y1UA 1YVLA 3VRQA 4PE7A 1AVSA 4MEWA 2KAVA 4GUKA 4MRXA 2LV7A 1E8AA 2MBXA 4A4BA 1IJ6A 3JTDC 4YGCB 3BFHA 2H61C 3BUWB 5K89A 3CR5X 2CBLA 3LK1A 1F8HA 1CLLA 1UHNA 1UUSA 1B8CA 4USLA 1DGVA 1K9UA 1SSEB 2G2BA 2OTGB 2ZN9A 3EG5B 2GGZA 4FTGA 1QV0A 1SR6C 3D77A 1Y1AA 1XA5A 4I5LB 2LMUA 1AJ4A 4JQ0D 1OSAA 2QEHA 2LVVA 2LE9B 4PALA 2HQ8A 2KGRA 3PALA 3VGOA 1OOHA 3EKJA 3GK1A 4DRWA 4ORBB 1IQ5A 1DELA 1KFXL 2K7OA 4M2QA 4HRGA 4MLWA 3ICBA 2PASA 1CFDA 4KYNA 3SJSA 4CFQA 1ORGA 3EK8A 5J3XA 4ZCUA 1CLMA 2JULA 1AK8A 3SIAA 1JF0A 1CNPA 3JVTC 5B8IB 3S0FA 5HLOA 2K60A 3JTDB 1XFWO 2BNXA 1OOIX 1QX7A 3S0GA 1KK7Y 1M39A 4M2OA 1EH2A 1UP5A 2BCAA 3CABA 3K21A 3WHUB 4GFTA 1XVJA 1BR4B 4UPGA 2WCBA 3BFBA 3CZ1A 4YGBB 4NDBA 1SR6B 3H4SE 1CDNA 3VRPA 2CCMA 3KO0A 3HX4A 1KK8C 1DTLA 1QTXA 1YRUB 1KSMA 2L5XB 4I5KA 1K9PA 1SCVA 2OS8C 4A4CA 4ZCVA 1B8LA 2BCXA 4P5OE 3PM8A 3GK2A 1OOJA 1BODA 3SS5A 1F71A 1IH0A 1VRKA 2V53A 4CPVA 1J7QA 1K8UA 5HL1A 1BMOA 2PRUA 3DVKA 4MSPA 2L4HA 4JD9A 4PT1A 3VB1A 1HT9A 3JVTB 1YRTB 4INXA 2E6WA 3CWGA 1NPQA 2BL0C 3I5IC 5D69A 1KWOC 2L98A 1DEKA 3VROA 3DZTA 2ZNDA 3TDZA 2P71A 1XK4A 1RFJA 2KFGA 2KNEA 1W9ZA 3EVVA 1OQPA 4R1EA 1OZSA 5CSJA 1SNLA 1J55A 1TNWA 4YBHB 5HKWA 4PHNA 2K7BA 3PN7C 4OCIA 5FYXA 2WCMA 2AAOA 3CS1A 1KK8B 1YX7A 2LHIA 1KSOA 3OB1B 2MRDA 1G8IA 3A4UB 4PCWA 1QXPA 3IQOA 4L9MA 2OS8B 3FE8A 5JOLA 3GOFA 4DS7A 3I5HC 2JNXA 2GGMA 1JC2A 4PE4A 2CT9A 1EG3A 1DJZA 2JT3A 3O4XA 1K96A 4XYNA 2L0PA 3BYAA 1MXLC 1JFJA 5PALA 2WCFA 2L2CA 5I8NA 2KYFA 1IJ5A 1MQ1A 1SBJA 1TNPA 1XFYO 3DVEA 1JFKA 2HF5A 2BL0B 1U5IB 3I5IB 2NCPA 1F54A 1KWOB 2K2AA 1KQVA 1DJHA 2E30A 2VRGA 3FIAA 1B47A 4MZKA 2M1UA 2M9GA 1QIWA 4PDZA 2MAZA 3VRRA 3EVRA 3FWBA 3OB2B 4INWA 1C3ZA 1CTRA 2JTZA 3OGNA 2O60A 5KU1A 1DJIA 4GGFC 1XYDA 3PN7B 3WHTB 1NCXA 4E68A 2KGBC 3TZ1A 2LUCA 1FF1A 2QPTA 4ETOA 1CFPA 1XFRA 2PQLA 1AJ5A 3AAKA 2MA2A 3NHTA 3MSEB 4ORCB 2M7LA 3R1OA 3AAJA 1DC1A 3R1VA 1MR8A 2LMVA 3I5HB 3RLZA 5HKYA 3EK7A 1LS8A 1BF5A 4YI8A 1C07A 2OPOA 3ZWHA 4NQGA 4PHMA 4YRUA 2H2KA 1YX8A 2BKHB 1OMDA 1S6CA 1SCMC 4XJKA 1C7VA 2ZRSA 1SL8A 1FW4A 4CLNA 2QDIA 3BJHA 4JWQA 3BOWB 2CNPA 3DF0B 2ZRTA 2BCBA 1PVBA 3KF9A 1KFXS 4AQIA 1TRFA 2H61A 1YUTA 2KDHA 3I5FC 4PHKA 3OP0A 3CLNA 2LVKA 4OVNF 4WRIA 5FI6A 3O2PA 2BBNA 1OW4A 2KHNA 1A4PA 2L5YA 1GGWA 2CXJA 3GK4X 2MJWB 1BOCA 1CDLA 2WNDA 1A03A 4WQ2A 5AFPA 1N0YA 3CGAA 1B4CA 1ZFSA 1H4BA 1R6PA 1S6JA 1K90D 2F3ZA 1ALVA 2RGIA 4BY4A 2KYCA 1SMGA 2L51A 4OKHA 3IQQA 1TNQA 1BG1A 4JKTA 2BECA 1MUXA 2NZ0A 2WCEA 2LLTA 3BUXB 3CR2A 2JWWA 3I5GC 1CDPA 1Z4HA 3PM2A 2L2EA 1XO5A 2QEBA 2KAXA 1EJ3A 1SCMB 2WORA 1GGZA 3KHEA 2BE6A 1S5GZ 3FE9A 5CSIA 1KCYA 2LHLA 1TOPA 1A75B 2AUCA 2B1UA 1QLKA 3FS7A 2FJUB 3Q8IA 1WRZA 1M31A 3BUNB 3SG7A 4YGAA 4I5NB 5HYDA 1A29A 1XFZO 3D0YA 1PSRA 3UO9A 4C0JA 1BLQA 1MHOA 1SK6D 1TTXA 3E3RA 3I5FB 3SG6A 4YGDB 4CIDA 2Y5IA 4FQTA 3EKHA 1MF8B 2LM5A 3D78A 1NUBA 2HPSA 1TN4A 1AP4A 1NWDA 5IBWA 1UHHA 1JWDA 1L2OC 1N65A 2ERBA 1J1EA 5AXIA 4PE1A 2LVJA 1F55A 4PE0A 3S0AA 1ZOTB 3S0DA 2JPTA 4GPLB 2JNFA 1TWOA 3C1VA 1JBAA 3DYEA 4OZDA 1UHIA 2K7DA 1SW8A 2WC6A 1QVIZ 3I5GB 5CSNA 2FJYA 3KPXA 3QRXA 2F2PA 2MLEC 2GTEA 3DD4A 1NIWA 3NSIA 3DVMA 4MRYA 4MBEA 4YI9A 2YGUA 3AKBA 3L4LA 1RJVA 2P6BB 1PALA 2LVIA 3CZTX 4HRHA 4ORAB 4C0KA 3FWCA 2NLNA 1V1GA 1U5IA 1IQ3A 1PSBA 1XFUO 1NX2A 2BAPA 2KBMA 2KLDA 3TDUA 3L4AA 1OOFA 2I7AA 3CR4X 4D1EA 4GBAA 1N2DA 1BR1B 5AERA 1IG5A 2JQ6A 2K2FA 1NYAA 1WLMA 1L2OB 2M0RA 1B9AA 3BFAA 3IF7A 3O78A 1Q80A 3SG2A 2D8NA 1XFXO 3NGVA 2JT8A 1OMRA 2JZIA 4N5XA 2Y4QA 2ZFDA 2WCLA 1K94A 1G33A 1PK0D 1DF0A 2KOTA 1QV1A 4WQ3A 1GM0A 2LNKA 1S1EA 4JPZB 1MWNA 1SL7A 1H8BA 1ALWA 2BBMA 1GQMA 3B87A 4IJ7A 1CFCA 2Q91A 4N1GA 1NX0A 2KBIA 3DXLA 1BJFA 1FI6A 1LA0A 4YGEB 1RWYA 4DIRA 3NSLA 2LP2A 2LAPA 4DUQA 1YVHA 2P70A 1QVIY 2SASA 1LXFC 1G4YR 2R2IA 3S0EA 1C3YA 3OHMB 2HETA 2WOSA 1TUZA 1NCYA 3NSOA 5GQQC 2O5GA 3IVTA 3NXAA 5I2QA 2MHHA 3PJIA 1SY9A 1Y0VH 2H8VA 2KI4C 2LUXA 3OBVA 4GGFA 2M1KB 5DKNA 2NCOA 2ZN8A 3L47A 3QMEA 4M2PA 3TUYC 1W7IB 2PYQA 4PHJA 2KQ6A 1R2UA 3D74A 4QJ3B 1MXEA 2PVBA 2WC5A 2FCDA 5D7FA 1K93D 1SKTA 1QX2A 2KSPA 2QEOA 4HREE 2KAYA 3F45A 5FI7A 1F4QA 3TS5C 2M49B 1V1FA 3K1EA 3SG3A 2EHBA 2DOQA 5CSFA 3D76A 1AUIB 2FCEA 1CFFA 2JT0A 2QACA 3SG5A 1F70A 2Y1NA 1J7RA 2JC2A 1W7JB 2K7CA 1CB1A 1DJYA 1WDCC 3D73A 1EG4A 5HKZA 2HQWA 5CPVA 5D3OA 1IWQA 2JTTA 3ZNIA 1QASA 3PSRA 2WC8A 3A8RA 1ZUZA 3RM1A 1DMOA 1SPYA 1OOGA 5KSZA 1NX1A 2M8UA 4IL1A 2KI4B 1NSHA 3R1PA 5FI2A 3SIBA 1LVCD 3TUYB 1OE9B 1ZMZA 4HSZA 1LKJA 2SCPA 5HLVA 4AQJA 2BE4A 1BT6A 1BU3A 1CMGA 1T14A 1Y1XA 2EGDA 1DJWA 2LC5A 4NDCA 2LANA 5JJGA 1JUOA 3BUMB 3TS5B 1JF2A 2LCPA 3KEVA 1KFUS 1Z2CB 4FQOA 5ER5A 1YUSA 5I2OA 1S36A 2KFFA 3SS3A 5DKRA 5AEQA 3PLFB 1NP8A 1IGVA 1EXRA 1TUJA 1UHJA 1WDCB 1OZOA 2LLUA 3PATA 4XJKB 1RTP1 1LINA 2PMYA 4MZLA 1K2HA 1B1GA 3NHIA 1B8RA 1DVIA 1KFUL 1SYMA 1TIZA 4Q04A 2K0JA 3LCPC 2F33A 4GNKB 1CKKA 1D1OA 4OR9B 1PRWA 2MLFC 2F3YA 1NX3A 1FPWA 1WRLA 1QS7A 3VRNA 3LLEA 1UHKA 2CTNA 1A2XA 1M63B 2JU0A 4GAOA 5TNCA 2LP3A 3D10A 2Y1MA 1J7PA 1TCOB 2LMTA 3O6BA 2JRFA 4MZJA 2M7NA 3CTNA 3WNXB 2AMIA 1WLZA 5F6TA 4P2YB 2ZKMX 2PALA 5AANA 4DCKA 3HCMA 3B88A 1PVAA 3PFVA 1S6IA 4MN0A 3EK4A 2A4JA 4U8DA 5DICA 3S0BA 2M97A 4ICBA 1CMFA 5ER4X 1F4OA 1KQMC 1YURA 2KFHA 2Q4UA 1J1DA 4TNCA 2WCKA 1K95A 3O4YA 2JPOA 3EVUA 4CFRA 1S5GY 1B7TZ 3WXAA 3CDNA 4BY5A 2GV5A 1DGUA 3OX6A 3AKAA 1M46A
chains in the Genus database with same CATH topology
5G08A 1XK4C 1QATA 1WY9A 3LL8B 4GGNA 1QX5B 3D0YB 3NSKA 1QIVA 1X02A 1PULA 2LLSA 4MVFA 1CM1A 4OV2A 1HQVA 2I2RE 2JOJA 2BKIB 2KI6D 2PSRA 3M0WA 1WRKA 2I94A 2IS9A 2M29A 1FBVA 1NCZA 1ODBA 1RROA 2L4IA 3BUOB 2EC6C 4F0ZB 2TN4A 1IKUA 1DJGA 2ISDA 1KQMB 5I2LA 2K8MB 1ZACA 4C0LA 1QLSA 1RK9A 1DT7B 1RECA 4AOMA 1L7ZA 1M45A 3BOWA 1EL4A 3DF0A 1YTZC 1TCFA 1TNXA 1UURA 1S26D 1CLBA 4I5JA 1S3PA 1SL9A 3BQ3A 1IRJA 2F2OA 4NDDA 1OMVA 4QJ5B 1K9KA 2K61A 2JXLA 2L50A 2ZNEA 2COLB 3SG4A 2KI6C 3DVJA 2I18A 1B7TY 1CDMA 3BXKA 3TDIA 1CM4A 2OTGC 5DKQA 1J7OA 1AHRA 2JXCA 1GJYA 1JSAA 2F8PA 4QJ4B 2KQYA 3LK0A 1YUUA 2G9BA 1FI5A 5BPJA 1C7WA 2NXQA 1SRAA 3OX5A 4N1FA 1XFVO 2EC6B 5KTYA 1UWOA 1DF0B 1DJXA 2FOTA 1KK7Z 1A75A 1LA3A 1Y6WA 1YR5A 2M3WA 1QJTA 1Y1UA 1YVLA 3VRQA 4PE7A 1AVSA 4MEWA 2KAVA 4GUKA 4MRXA 2LV7A 1E8AA 2MBXA 4A4BA 1IJ6A 3JTDC 4YGCB 2H61C 3BUWB 5K89A 3CR5X 2CBLA 3LK1A 1F8HA 1CLLA 1UHNA 1UUSA 1B8CA 4USLA 1DGVA 1K9UA 2G2BA 2OTGB 2ZN9A 2GGZA 4FTGA 1QV0A 1SR6C 1Y1AA 1XA5A 4I5LB 2LMUA 1AJ4A 4JQ0D 1OSAA 4PALA 2LVVA 2LE9B 3VGOA 2HQ8A 2KGRA 3PALA 3EKJA 3GK1A 4DRWA 4ORBB 1IQ5A 1KFXL 2K7OA 4M2QA 4MLWA 4HRGA 3ICBA 2PASA 1CFDA 3SJSA 4CFQA 5J3XA 3EK8A 4ZCUA 1CLMA 2JULA 1AK8A 3SIAA 1JF0A 1CNPA 3JVTC 5B8IB 5HLOA 3JTDB 1XFWO 1QX7A 1KK7Y 1M39A 4M2OA 1EH2A 1UP5A 2BCAA 3K21A 3WHUB 4GFTA 1XVJA 1BR4B 4UPGA 2WCBA 4YGBB 4NDBA 1SR6B 3H4SE 1CDNA 3VRPA 2CCMA 3KO0A 3HX4A 1KK8C 1DTLA 1QTXA 1YRUB 1KSMA 2L5XB 4I5KA 1K9PA 1SCVA 2OS8C 4A4CA 4ZCVA 1B8LA 2BCXA 4P5OE 3PM8A 3GK2A 1OOJA 1BODA 1F71A 1IH0A 1VRKA 2V53A 4CPVA 1J7QA 1K8UA 1BMOA 2PRUA 3DVKA 4MSPA 2L4HA 1HT9A 3JVTB 1YRTB 2E6WA 3CWGA 1NPQA 2BL0C 3I5IC 5D69A 1KWOC 2L98A 3VROA 2ZNDA 3TDZA 1XK4A 1RFJA 2KFGA 2KNEA 3EVVA 4R1EA 1OQPA 5CSJA 1OZSA 1SNLA 1J55A 1TNWA 4YBHB 5HKWA 4PHNA 2K7BA 3PN7C 4OCIA 5FYXA 2AAOA 3CS1A 1KK8B 1YX7A 2LHIA 1KSOA 3OB1B 2MRDA 1G8IA 3A4UB 4PCWA 1QXPA 3IQOA 4L9MA 2OS8B 5JOLA 3GOFA 4DS7A 3I5HC 2JNXA 2GGMA 1JC2A 4PE4A 2CT9A 1EG3A 1DJZA 2JT3A 1K96A 4XYNA 2L0PA 3BYAA 1MXLC 1JFJA 5PALA 2WCFA 5I8NA 2KYFA 1IJ5A 1MQ1A 1SBJA 1TNPA 1XFYO 3DVEA 1JFKA 2HF5A 2BL0B 1U5IB 3I5IB 2NCPA 1F54A 1KWOB 2K2AA 1KQVA 1DJHA 2E30A 2VRGA 3FIAA 1B47A 4MZKA 2M1UA 2M9GA 1QIWA 4PDZA 2MAZA 3VRRA 3EVRA 3FWBA 3OB2B 1CTRA 2JTZA 5KU1A 2O60A 1DJIA 4GGFC 1XYDA 3PN7B 3WHTB 1NCXA 4E68A 2KGBC 3TZ1A 2LUCA 1FF1A 2QPTA 4ETOA 1CFPA 2M7LA 1AJ5A 3AAKA 2MA2A 4ORCB 3MSEB 3AAJA 1MR8A 2LMVA 3I5HB 3RLZA 5HKYA 3EK7A 1BF5A 4YI8A 1C07A 2OPOA 3ZWHA 4NQGA 4PHMA 4YRUA 2H2KA 1YX8A 2BKHB 1OMDA 1S6CA 1SCMC 4XJKA 1C7VA 2ZRSA 1SL8A 1FW4A 4CLNA 4JWQA 3BOWB 2CNPA 3DF0B 2ZRTA 2BCBA 1PVBA 3KF9A 1KFXS 4AQIA 1TRFA 2H61A 1YUTA 2KDHA 3I5FC 4PHKA 3OP0A 3CLNA 2LVKA 4OVNF 4WRIA 3O2PA 2BBNA 2KHNA 1A4PA 1GGWA 2CXJA 3GK4X 2MJWB 1BOCA 1CDLA 2WNDA 1A03A 4WQ2A 5AFPA 1N0YA 3CGAA 1B4CA 1ZFSA 1H4BA 1R6PA 1S6JA 1K90D 2F3ZA 1ALVA 2RGIA 4BY4A 2KYCA 1SMGA 2L51A 4OKHA 3IQQA 1TNQA 1BG1A 2BECA 1MUXA 2NZ0A 2WCEA 2LLTA 3BUXB 3CR2A 2JWWA 3I5GC 1CDPA 2L2EA 1XO5A 2KAXA 1EJ3A 1SCMB 2WORA 1GGZA 3KHEA 2BE6A 1S5GZ 1KCYA 5CSIA 2LHLA 1TOPA 1A75B 2AUCA 2B1UA 1QLKA 3FS7A 2FJUB 3SG7A 1WRZA 1M31A 3BUNB 4YGAA 4I5NB 5HYDA 1A29A 1XFZO 3D0YA 1PSRA 4C0JA 1BLQA 1MHOA 1SK6D 1TTXA 3E3RA 3I5FB 3SG6A 4YGDB 4CIDA 2Y5IA 3EKHA 1MF8B 2LM5A 1NUBA 2HPSA 1TN4A 1AP4A 1NWDA 5IBWA 1UHHA 1JWDA 1L2OC 1N65A 1J1EA 5AXIA 4PE1A 2LVJA 1F55A 4PE0A 1ZOTB 2JPTA 4GPLB 2JNFA 3C1VA 1JBAA 1UHIA 2K7DA 1SW8A 3I5GB 1QVIZ 5CSNA 3KPXA 3QRXA 2F2PA 2MLEC 3DD4A 1NIWA 3NSIA 3DVMA 4MRYA 4MBEA 4YI9A 3AKBA 1RJVA 2P6BB 1PALA 2LVIA 3CZTX 4HRHA 4ORAB 4C0KA 3FWCA 2NLNA 1V1GA 1U5IA 1IQ3A 1PSBA 1XFUO 1NX2A 3TDUA 2KBMA 2I7AA 3CR4X 4D1EA 4GBAA 1N2DA 1BR1B 5AERA 1IG5A 2JQ6A 2K2FA 1NYAA 1WLMA 1L2OB 2M0RA 1B9AA 3IF7A 3O78A 1Q80A 3SG2A 2D8NA 1XFXO 2JT8A 1OMRA 2JZIA 4N5XA 2Y4QA 2ZFDA 1K94A 1G33A 1PK0D 1DF0A 2KOTA 1QV1A 4WQ3A 2LNKA 1S1EA 4JPZB 1MWNA 1SL7A 1H8BA 1ALWA 2BBMA 1GQMA 1CFCA 2Q91A 4N1GA 1NX0A 2KBIA 1BJFA 1FI6A 1LA0A 4YGEB 1RWYA 4DIRA 3NSLA 2LP2A 2LAPA 4DUQA 1YVHA 1QVIY 2SASA 1LXFC 1G4YR 2R2IA 3OHMB 2HETA 2WOSA 1NCYA 3NSOA 5GQQC 2O5GA 3NXAA 5I2QA 2MHHA 1SY9A 1Y0VH 2KI4C 4GGFA 2LUXA 2M1KB 5DKNA 2NCOA 2ZN8A 4M2PA 3TUYC 1W7IB 4PHJA 2KQ6A 1R2UA 4QJ3B 1MXEA 2PVBA 2FCDA 5D7FA 1K93D 1SKTA 1QX2A 2KSPA 4HREE 2KAYA 3F45A 1F4QA 3TS5C 2M49B 1V1FA 3SG3A 2EHBA 2DOQA 5CSFA 1AUIB 2FCEA 1CFFA 2JT0A 2QACA 3SG5A 1F70A 2Y1NA 1J7RA 2JC2A 1W7JB 2K7CA 1CB1A 1DJYA 1WDCC 5HKZA 1EG4A 2HQWA 5CPVA 1IWQA 2JTTA 3ZNIA 1QASA 3PSRA 2WC8A 3A8RA 1ZUZA 3RM1A 1DMOA 1SPYA 5KSZA 1NX1A 2M8UA 4IL1A 2KI4B 1NSHA 3SIBA 1LVCD 3TUYB 1OE9B 1ZMZA 4HSZA 1LKJA 2SCPA 5HLVA 4AQJA 2BE4A 1BT6A 1BU3A 1CMGA 2EGDA 1Y1XA 1DJWA 2LC5A 4NDCA 2LANA 5JJGA 1JUOA 3BUMB 3TS5B 1JF2A 2LCPA 3KEVA 1KFUS 4FQOA 5ER5A 1YUSA 5I2OA 1S36A 2KFFA 5DKRA 5AEQA 3PLFB 1NP8A 1IGVA 1EXRA 1UHJA 2LLUA 1WDCB 1OZOA 3PATA 4XJKB 1RTP1 1LINA 2PMYA 4MZLA 1K2HA 1B1GA 1B8RA 1DVIA 1KFUL 1SYMA 1TIZA 4Q04A 2K0JA 3LCPC 2F33A 4GNKB 1CKKA 1D1OA 4OR9B 1PRWA 2MLFC 2F3YA 1NX3A 1FPWA 1WRLA 1QS7A 3VRNA 3LLEA 1UHKA 2CTNA 1A2XA 1M63B 2JU0A 4GAOA 5TNCA 2LP3A 3D10A 2Y1MA 1J7PA 1TCOB 2LMTA 3O6BA 2JRFA 4MZJA 2M7NA 3CTNA 3WNXB 2AMIA 1WLZA 5F6TA 4P2YB 2ZKMX 2PALA 5AANA 4DCKA 3HCMA 3PFVA 1PVAA 1S6IA 4MN0A 3EK4A 2A4JA 4U8DA 2M97A 4ICBA 1CMFA 5ER4X 1F4OA 1KQMC 1YURA 2KFHA 2Q4UA 1J1DA 4TNCA 1K95A 3O4YA 3EVUA 4CFRA 1S5GY 1B7TZ 3WXAA 4BY5A 2GV5A 1DGUA 3OX6A 3AKAA 1M46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G08 A;  1XK4 C;  1QAT A;  1WY9 A;  3LL8 B;  4GGN A;  1QX5 B;  3D0Y B;  3NSK A;  1QIV A;  1X02 A;  1PUL A;  2LLS A;  4MVF A;  1CM1 A;  4OV2 A;  1HQV A;  2I2R E;  2JOJ A;  2BKI B;  2KI6 D;  2PSR A;  3M0W A;  1WRK A;  2I94 A;  2IS9 A;  2M29 A;  1FBV A;  1NCZ A;  1ODB A;  1RRO A;  2L4I A;  3BUO B;  2EC6 C;  4F0Z B;  2TN4 A;  1IKU A;  1DJG A;  2ISD A;  1KQM B;  5I2L A;  2K8M B;  1ZAC A;  4C0L A;  1QLS A;  1RK9 A;  1DT7 B;  1REC A;  4AOM A;  1L7Z A;  1M45 A;  3BOW A;  1EL4 A;  3DF0 A;  1YTZ C;  1TCF A;  1TNX A;  1UUR A;  1S26 D;  1CLB A;  4I5J A;  1S3P A;  1SL9 A;  3BQ3 A;  1IRJ A;  2F2O A;  4NDD A;  1OMV A;  4QJ5 B;  1K9K A;  2K61 A;  2JXL A;  2L50 A;  2ZNE A;  2COL B;  3SG4 A;  2KI6 C;  3DVJ A;  2I18 A;  1B7T Y;  1CDM A;  3BXK A;  3TDI A;  1CM4 A;  2OTG C;  5DKQ A;  1J7O A;  1AHR A;  2JXC A;  1GJY A;  1JSA A;  2F8P A;  4QJ4 B;  2KQY A;  3LK0 A;  1YUU A;  2G9B A;  1FI5 A;  5BPJ A;  1C7W A;  2NXQ A;  1SRA A;  3OX5 A;  4N1F A;  1XFV O;  2EC6 B;  5KTY A;  1UWO A;  1DF0 B;  1DJX A;  2FOT A;  1KK7 Z;  1A75 A;  1LA3 A;  1Y6W A;  1YR5 A;  2M3W A;  1QJT A;  1Y1U A;  1YVL A;  3VRQ A;  4PE7 A;  1AVS A;  4MEW A;  2KAV A;  4GUK A;  4MRX A;  2LV7 A;  1E8A A;  2MBX A;  4A4B A;  1IJ6 A;  3JTD C;  4YGC B;  2H61 C;  3BUW B;  5K89 A;  3CR5 X;  2CBL A;  3LK1 A;  1F8H A;  1CLL A;  1UHN A;  1UUS A;  1B8C A;  4USL A;  1DGV A;  1K9U A;  2G2B A;  2OTG B;  2ZN9 A;  2GGZ A;  4FTG A;  1QV0 A;  1SR6 C;  1Y1A A;  1XA5 A;  4I5L B;  2LMU A;  1AJ4 A;  4JQ0 D;  1OSA A;  4PAL A;  2LVV A;  2LE9 B;  3VGO A;  2HQ8 A;  2KGR A;  3PAL A;  3EKJ A;  3GK1 A;  4DRW A;  4ORB B;  1IQ5 A;  1KFX L;  2K7O A;  4M2Q A;  4MLW A;  4HRG A;  3ICB A;  2PAS A;  1CFD A;  3SJS A;  4CFQ A;  5J3X A;  3EK8 A;  4ZCU A;  1CLM A;  2JUL A;  1AK8 A;  3SIA A;  1JF0 A;  1CNP A;  3JVT C;  5B8I B;  5HLO A;  3JTD B;  1XFW O;  1QX7 A;  1KK7 Y;  1M39 A;  4M2O A;  1EH2 A;  1UP5 A;  2BCA A;  3K21 A;  3WHU B;  4GFT A;  1XVJ A;  1BR4 B;  4UPG A;  2WCB A;  4YGB B;  4NDB A;  1SR6 B;  3H4S E;  1CDN A;  3VRP A;  2CCM A;  3KO0 A;  3HX4 A;  1KK8 C;  1DTL A;  1QTX A;  1YRU B;  1KSM A;  2L5X B;  4I5K A;  1K9P A;  1SCV A;  2OS8 C;  4A4C A;  4ZCV A;  1B8L A;  2BCX A;  4P5O E;  3PM8 A;  3GK2 A;  1OOJ A;  1BOD A;  1F71 A;  1IH0 A;  1VRK A;  2V53 A;  4CPV A;  1J7Q A;  1K8U A;  1BMO A;  2PRU A;  3DVK A;  4MSP A;  2L4H A;  1HT9 A;  3JVT B;  1YRT B;  2E6W A;  3CWG A;  1NPQ A;  2BL0 C;  3I5I C;  5D69 A;  1KWO C;  2L98 A;  3VRO A;  2ZND A;  3TDZ A;  1XK4 A;  1RFJ A;  2KFG A;  2KNE A;  3EVV A;  4R1E A;  1OQP A;  5CSJ A;  1OZS A;  1SNL A;  1J55 A;  1TNW A;  4YBH B;  5HKW A;  4PHN A;  2K7B A;  3PN7 C;  4OCI A;  5FYX A;  2AAO A;  3CS1 A;  1KK8 B;  1YX7 A;  2LHI A;  1KSO A;  3OB1 B;  2MRD A;  1G8I A;  3A4U B;  4PCW A;  1QXP A;  3IQO A;  4L9M A;  2OS8 B;  5JOL A;  3GOF A;  4DS7 A;  3I5H C;  2JNX A;  2GGM A;  1JC2 A;  4PE4 A;  2CT9 A;  1EG3 A;  1DJZ A;  2JT3 A;  1K96 A;  4XYN A;  2L0P A;  3BYA A;  1MXL C;  1JFJ A;  5PAL A;  2WCF A;  5I8N A;  2KYF A;  1IJ5 A;  1MQ1 A;  1SBJ A;  1TNP A;  1XFY O;  3DVE A;  1JFK A;  2HF5 A;  2BL0 B;  1U5I B;  3I5I B;  2NCP A;  1F54 A;  1KWO B;  2K2A A;  1KQV A;  1DJH A;  2E30 A;  2VRG A;  3FIA A;  1B47 A;  4MZK A;  2M1U A;  2M9G A;  1QIW A;  4PDZ A;  2MAZ A;  3VRR A;  3EVR A;  3FWB A;  3OB2 B;  1CTR A;  2JTZ A;  5KU1 A;  2O60 A;  1DJI A;  4GGF C;  1XYD A;  3PN7 B;  3WHT B;  1NCX A;  4E68 A;  2KGB C;  3TZ1 A;  2LUC A;  1FF1 A;  2QPT A;  4ETO A;  1CFP A;  2M7L A;  1AJ5 A;  3AAK A;  2MA2 A;  4ORC B;  3MSE B;  3AAJ A;  1MR8 A;  2LMV A;  3I5H B;  3RLZ A;  5HKY A;  3EK7 A;  1BF5 A;  4YI8 A;  1C07 A;  2OPO A;  3ZWH A;  4NQG A;  4PHM A;  4YRU A;  2H2K A;  1YX8 A;  2BKH B;  1OMD A;  1S6C A;  1SCM C;  4XJK A;  1C7V A;  2ZRS A;  1SL8 A;  1FW4 A;  4CLN A;  4JWQ A;  3BOW B;  2CNP A;  3DF0 B;  2ZRT A;  2BCB A;  1PVB A;  3KF9 A;  1KFX S;  4AQI A;  1TRF A;  2H61 A;  1YUT A;  2KDH A;  3I5F C;  4PHK A;  3OP0 A;  3CLN A;  2LVK A;  4OVN F;  4WRI A;  3O2P A;  2BBN A;  2KHN A;  1A4P A;  1GGW A;  2CXJ A;  3GK4 X;  2MJW B;  1BOC A;  1CDL A;  2WND A;  1A03 A;  4WQ2 A;  5AFP A;  1N0Y A;  3CGA A;  1B4C A;  1ZFS A;  1H4B A;  1R6P A;  1S6J A;  1K90 D;  2F3Z A;  1ALV A;  2RGI A;  4BY4 A;  2KYC A;  1SMG A;  2L51 A;  4OKH A;  3IQQ A;  1TNQ A;  1BG1 A;  2BEC A;  1MUX A;  2NZ0 A;  2WCE A;  2LLT A;  3BUX B;  3CR2 A;  2JWW A;  3I5G C;  1CDP A;  2L2E A;  1XO5 A;  2KAX A;  1EJ3 A;  1SCM B;  2WOR A;  1GGZ A;  3KHE A;  2BE6 A;  1S5G Z;  1KCY A;  5CSI A;  2LHL A;  1TOP A;  1A75 B;  2AUC A;  2B1U A;  1QLK A;  3FS7 A;  2FJU B;  3SG7 A;  1WRZ A;  1M31 A;  3BUN B;  4YGA A;  4I5N B;  5HYD A;  1A29 A;  1XFZ O;  3D0Y A;  1PSR A;  4C0J A;  1BLQ A;  1MHO A;  1SK6 D;  1TTX A;  3E3R A;  3I5F B;  3SG6 A;  4YGD B;  4CID A;  2Y5I A;  3EKH A;  1MF8 B;  2LM5 A;  1NUB A;  2HPS A;  1TN4 A;  1AP4 A;  1NWD A;  5IBW A;  1UHH A;  1JWD A;  1L2O C;  1N65 A;  1J1E A;  5AXI A;  4PE1 A;  2LVJ A;  1F55 A;  4PE0 A;  1ZOT B;  2JPT A;  4GPL B;  2JNF A;  3C1V A;  1JBA A;  1UHI A;  2K7D A;  1SW8 A;  3I5G B;  1QVI Z;  5CSN A;  3KPX A;  3QRX A;  2F2P A;  2MLE C;  3DD4 A;  1NIW A;  3NSI A;  3DVM A;  4MRY A;  4MBE A;  4YI9 A;  3AKB A;  1RJV A;  2P6B B;  1PAL A;  2LVI A;  3CZT X;  4HRH A;  4ORA B;  4C0K A;  3FWC A;  2NLN A;  1V1G A;  1U5I A;  1IQ3 A;  1PSB A;  1XFU O;  1NX2 A;  3TDU A;  2KBM A;  2I7A A;  3CR4 X;  4D1E A;  4GBA A;  1N2D A;  1BR1 B;  5AER A;  1IG5 A;  2JQ6 A;  2K2F A;  1NYA A;  1WLM A;  1L2O B;  2M0R A;  1B9A A;  3IF7 A;  3O78 A;  1Q80 A;  3SG2 A;  2D8N A;  1XFX O;  2JT8 A;  1OMR A;  2JZI A;  4N5X A;  2Y4Q A;  2ZFD A;  1K94 A;  1G33 A;  1PK0 D;  1DF0 A;  2KOT A;  1QV1 A;  4WQ3 A;  2LNK A;  1S1E A;  4JPZ B;  1MWN A;  1SL7 A;  1H8B A;  1ALW A;  2BBM A;  1GQM A;  1CFC A;  2Q91 A;  4N1G A;  1NX0 A;  2KBI A;  1BJF A;  1FI6 A;  1LA0 A;  4YGE B;  1RWY A;  4DIR A;  3NSL A;  2LP2 A;  2LAP A;  4DUQ A;  1YVH A;  1QVI Y;  2SAS A;  1LXF C;  1G4Y R;  2R2I A;  3OHM B;  2HET A;  2WOS A;  1NCY A;  3NSO A;  5GQQ C;  2O5G A;  3NXA A;  5I2Q A;  2MHH A;  1SY9 A;  1Y0V H;  2KI4 C;  4GGF A;  2LUX A;  2M1K B;  5DKN A;  2NCO A;  2ZN8 A;  4M2P A;  3TUY C;  1W7I B;  4PHJ A;  2KQ6 A;  1R2U A;  4QJ3 B;  1MXE A;  2PVB A;  2FCD A;  5D7F A;  1K93 D;  1SKT A;  1QX2 A;  2KSP A;  4HRE E;  2KAY A;  3F45 A;  1F4Q A;  3TS5 C;  2M49 B;  1V1F A;  3SG3 A;  2EHB A;  2DOQ A;  5CSF A;  1AUI B;  2FCE A;  1CFF A;  2JT0 A;  2QAC A;  3SG5 A;  1F70 A;  2Y1N A;  1J7R A;  2JC2 A;  1W7J B;  2K7C A;  1CB1 A;  1DJY A;  1WDC C;  5HKZ A;  1EG4 A;  2HQW A;  5CPV A;  1IWQ A;  2JTT A;  3ZNI A;  1QAS A;  3PSR A;  2WC8 A;  3A8R A;  1ZUZ A;  3RM1 A;  1DMO A;  1SPY A;  5KSZ A;  1NX1 A;  2M8U A;  4IL1 A;  2KI4 B;  1NSH A;  3SIB A;  1LVC D;  3TUY B;  1OE9 B;  1ZMZ A;  4HSZ A;  1LKJ A;  2SCP A;  5HLV A;  4AQJ A;  2BE4 A;  1BT6 A;  1BU3 A;  1CMG A;  2EGD A;  1Y1X A;  1DJW A;  2LC5 A;  4NDC A;  2LAN A;  5JJG A;  1JUO A;  3BUM B;  3TS5 B;  1JF2 A;  2LCP A;  3KEV A;  1KFU S;  4FQO A;  5ER5 A;  1YUS A;  5I2O A;  1S36 A;  2KFF A;  5DKR A;  5AEQ A;  3PLF B;  1NP8 A;  1IGV A;  1EXR A;  1UHJ A;  2LLU A;  1WDC B;  1OZO A;  3PAT A;  4XJK B;  1RTP 1;  1LIN A;  2PMY A;  4MZL A;  1K2H A;  1B1G A;  1B8R A;  1DVI A;  1KFU L;  1SYM A;  1TIZ A;  4Q04 A;  2K0J A;  3LCP C;  2F33 A;  4GNK B;  1CKK A;  1D1O A;  4OR9 B;  1PRW A;  2MLF C;  2F3Y A;  1NX3 A;  1FPW A;  1WRL A;  1QS7 A;  3VRN A;  3LLE A;  1UHK A;  2CTN A;  1A2X A;  1M63 B;  2JU0 A;  4GAO A;  5TNC A;  2LP3 A;  3D10 A;  2Y1M A;  1J7P A;  1TCO B;  2LMT A;  3O6B A;  2JRF A;  4MZJ A;  2M7N A;  3CTN A;  3WNX B;  2AMI A;  1WLZ A;  5F6T A;  4P2Y B;  2ZKM X;  2PAL A;  5AAN A;  4DCK A;  3HCM A;  3PFV A;  1PVA A;  1S6I A;  4MN0 A;  3EK4 A;  2A4J A;  4U8D A;  2M97 A;  4ICB A;  1CMF A;  5ER4 X;  1F4O A;  1KQM C;  1YUR A;  2KFH A;  2Q4U A;  1J1D A;  4TNC A;  1K95 A;  3O4Y A;  3EVU A;  4CFR A;  1S5G Y;  1B7T Z;  3WXA A;  4BY5 A;  2GV5 A;  1DGU A;  3OX6 A;  3AKA A;  1M46 A; 
#chains in the Genus database with same CATH topology
 2KLE A;  1XK4 C;  3CZ2 A;  5G08 A;  1QAT A;  1WY9 A;  3DY9 A;  4F7F A;  3LL8 B;  4GGN A;  1QX5 B;  3D0Y B;  3NSK A;  1QIV A;  1X02 A;  1PUL A;  2LLS A;  3SS4 A;  4MVF A;  1CM1 A;  4OV2 A;  1HQV A;  2I2R E;  2JOJ A;  2BKI B;  2KI6 D;  2PSR A;  3M0W A;  2WCJ A;  1WRK A;  2I94 A;  2IS9 A;  2M29 A;  3FE6 A;  1FBV A;  1NCZ A;  1ODB A;  1RRO A;  2L4I A;  2WCH A;  3BUO B;  3B7A A;  2EC6 C;  1QWV A;  3B86 A;  2TN4 A;  4F0Z B;  1IKU A;  1DJG A;  3N7H A;  2ISD A;  1KQM B;  5I2L A;  2K8M B;  1ZAC A;  4C0L A;  3RZS A;  1QLS A;  1IIO A;  1RK9 A;  1DT7 B;  1REC A;  4AOM A;  1L7Z A;  1M45 A;  3BOW A;  1EL4 A;  3DF0 A;  3R72 A;  1YTZ C;  5I94 A;  1TCF A;  1TNX A;  1UUR A;  1S26 D;  1CLB A;  3CYZ A;  4I5J A;  1S3P A;  1SL9 A;  3BQ3 A;  1IRJ A;  2F2O A;  4NDD A;  1OMV A;  4QJ5 B;  1K9K A;  2K61 A;  2JXL A;  2L50 A;  2ZNE A;  2COL B;  3SG4 A;  2KI6 C;  3DVJ A;  2I18 A;  1B7T Y;  1CDM A;  3BXK A;  3TDI A;  1CM4 A;  2OTG C;  1DQE A;  5DKQ A;  1AHR A;  2JXC A;  1J7O A;  1GJY A;  1JSA A;  2F8P A;  2KPH A;  4QJ4 B;  2KQY A;  3LK0 A;  1YUU A;  2G9B A;  1FI5 A;  5BPJ A;  1C7W A;  1P28 A;  5EL2 A;  2NXQ A;  3V2L A;  1SRA A;  3OX5 A;  4N1F A;  1XFV O;  2EC6 B;  2QEV A;  1UWO A;  3UNW A;  5KTY A;  1DF0 B;  1DJX A;  2FOT A;  3D75 A;  1KK7 Z;  1A75 A;  1LA3 A;  1Y6W A;  3B6X A;  1YR5 A;  3CZ0 A;  2M3W A;  1QJT A;  1Y1U A;  1YVL A;  3VRQ A;  4PE7 A;  1AVS A;  4MEW A;  2KAV A;  4GUK A;  4MRX A;  2LV7 A;  1E8A A;  2MBX A;  4A4B A;  1IJ6 A;  3JTD C;  4YGC B;  3BFH A;  2H61 C;  3BUW B;  5K89 A;  3CR5 X;  2CBL A;  3LK1 A;  1F8H A;  1CLL A;  1UHN A;  1UUS A;  1B8C A;  4USL A;  1DGV A;  1K9U A;  1SSE B;  2G2B A;  2OTG B;  2ZN9 A;  3EG5 B;  2GGZ A;  4FTG A;  1QV0 A;  1SR6 C;  3D77 A;  1Y1A A;  1XA5 A;  4I5L B;  2LMU A;  1AJ4 A;  4JQ0 D;  1OSA A;  2QEH A;  2LVV A;  2LE9 B;  4PAL A;  2HQ8 A;  2KGR A;  3PAL A;  3VGO A;  1OOH A;  3EKJ A;  3GK1 A;  4DRW A;  4ORB B;  1IQ5 A;  1DEL A;  1KFX L;  2K7O A;  4M2Q A;  4HRG A;  4MLW A;  3ICB A;  2PAS A;  1CFD A;  4KYN A;  3SJS A;  4CFQ A;  1ORG A;  3EK8 A;  5J3X A;  4ZCU A;  1CLM A;  2JUL A;  1AK8 A;  3SIA A;  1JF0 A;  1CNP A;  3JVT C;  5B8I B;  3S0F A;  5HLO A;  2K60 A;  3JTD B;  1XFW O;  2BNX A;  1OOI X;  1QX7 A;  3S0G A;  1KK7 Y;  1M39 A;  4M2O A;  1EH2 A;  1UP5 A;  2BCA A;  3CAB A;  3K21 A;  3WHU B;  4GFT A;  1XVJ A;  1BR4 B;  4UPG A;  2WCB A;  3BFB A;  3CZ1 A;  4YGB B;  4NDB A;  1SR6 B;  3H4S E;  1CDN A;  3VRP A;  2CCM A;  3KO0 A;  3HX4 A;  1KK8 C;  1DTL A;  1QTX A;  1YRU B;  1KSM A;  2L5X B;  4I5K A;  1K9P A;  1SCV A;  2OS8 C;  4A4C A;  4ZCV A;  1B8L A;  2BCX A;  4P5O E;  3PM8 A;  3GK2 A;  1OOJ A;  1BOD A;  3SS5 A;  1F71 A;  1IH0 A;  1VRK A;  2V53 A;  4CPV A;  1J7Q A;  1K8U A;  5HL1 A;  1BMO A;  2PRU A;  3DVK A;  4MSP A;  2L4H A;  4JD9 A;  4PT1 A;  3VB1 A;  1HT9 A;  3JVT B;  1YRT B;  4INX A;  2E6W A;  3CWG A;  1NPQ A;  2BL0 C;  3I5I C;  5D69 A;  1KWO C;  2L98 A;  1DEK A;  3VRO A;  3DZT A;  2ZND A;  3TDZ A;  2P71 A;  1XK4 A;  1RFJ A;  2KFG A;  2KNE A;  1W9Z A;  3EVV A;  1OQP A;  4R1E A;  1OZS A;  5CSJ A;  1SNL A;  1J55 A;  1TNW A;  4YBH B;  5HKW A;  4PHN A;  2K7B A;  3PN7 C;  4OCI A;  5FYX A;  2WCM A;  2AAO A;  3CS1 A;  1KK8 B;  1YX7 A;  2LHI A;  1KSO A;  3OB1 B;  2MRD A;  1G8I A;  3A4U B;  4PCW A;  1QXP A;  3IQO A;  4L9M A;  2OS8 B;  3FE8 A;  5JOL A;  3GOF A;  4DS7 A;  3I5H C;  2JNX A;  2GGM A;  1JC2 A;  4PE4 A;  2CT9 A;  1EG3 A;  1DJZ A;  2JT3 A;  3O4X A;  1K96 A;  4XYN A;  2L0P A;  3BYA A;  1MXL C;  1JFJ A;  5PAL A;  2WCF A;  2L2C A;  5I8N A;  2KYF A;  1IJ5 A;  1MQ1 A;  1SBJ A;  1TNP A;  1XFY O;  3DVE A;  1JFK A;  2HF5 A;  2BL0 B;  1U5I B;  3I5I B;  2NCP A;  1F54 A;  1KWO B;  2K2A A;  1KQV A;  1DJH A;  2E30 A;  2VRG A;  3FIA A;  1B47 A;  4MZK A;  2M1U A;  2M9G A;  1QIW A;  4PDZ A;  2MAZ A;  3VRR A;  3EVR A;  3FWB A;  3OB2 B;  4INW A;  1C3Z A;  1CTR A;  2JTZ A;  3OGN A;  2O60 A;  5KU1 A;  1DJI A;  4GGF C;  1XYD A;  3PN7 B;  3WHT B;  1NCX A;  4E68 A;  2KGB C;  3TZ1 A;  2LUC A;  1FF1 A;  2QPT A;  4ETO A;  1CFP A;  1XFR A;  2PQL A;  1AJ5 A;  3AAK A;  2MA2 A;  3NHT A;  3MSE B;  4ORC B;  2M7L A;  3R1O A;  3AAJ A;  1DC1 A;  3R1V A;  1MR8 A;  2LMV A;  3I5H B;  3RLZ A;  5HKY A;  3EK7 A;  1LS8 A;  1BF5 A;  4YI8 A;  1C07 A;  2OPO A;  3ZWH A;  4NQG A;  4PHM A;  4YRU A;  2H2K A;  1YX8 A;  2BKH B;  1OMD A;  1S6C A;  1SCM C;  4XJK A;  1C7V A;  2ZRS A;  1SL8 A;  1FW4 A;  4CLN A;  2QDI A;  3BJH A;  4JWQ A;  3BOW B;  2CNP A;  3DF0 B;  2ZRT A;  2BCB A;  1PVB A;  3KF9 A;  1KFX S;  4AQI A;  1TRF A;  2H61 A;  1YUT A;  2KDH A;  3I5F C;  4PHK A;  3OP0 A;  3CLN A;  2LVK A;  4OVN F;  4WRI A;  5FI6 A;  3O2P A;  2BBN A;  1OW4 A;  2KHN A;  1A4P A;  2L5Y A;  1GGW A;  2CXJ A;  3GK4 X;  2MJW B;  1BOC A;  1CDL A;  2WND A;  1A03 A;  4WQ2 A;  5AFP A;  1N0Y A;  3CGA A;  1B4C A;  1ZFS A;  1H4B A;  1R6P A;  1S6J A;  1K90 D;  2F3Z A;  1ALV A;  2RGI A;  4BY4 A;  2KYC A;  1SMG A;  2L51 A;  4OKH A;  3IQQ A;  1TNQ A;  1BG1 A;  4JKT A;  2BEC A;  1MUX A;  2NZ0 A;  2WCE A;  2LLT A;  3BUX B;  3CR2 A;  2JWW A;  3I5G C;  1CDP A;  1Z4H A;  3PM2 A;  2L2E A;  1XO5 A;  2QEB A;  2KAX A;  1EJ3 A;  1SCM B;  2WOR A;  1GGZ A;  3KHE A;  2BE6 A;  1S5G Z;  3FE9 A;  5CSI A;  1KCY A;  2LHL A;  1TOP A;  1A75 B;  2AUC A;  2B1U A;  1QLK A;  3FS7 A;  2FJU B;  3Q8I A;  1WRZ A;  1M31 A;  3BUN B;  3SG7 A;  4YGA A;  4I5N B;  5HYD A;  1A29 A;  1XFZ O;  3D0Y A;  1PSR A;  3UO9 A;  4C0J A;  1BLQ A;  1MHO A;  1SK6 D;  1TTX A;  3E3R A;  3I5F B;  3SG6 A;  4YGD B;  4CID A;  2Y5I A;  4FQT A;  3EKH A;  1MF8 B;  2LM5 A;  3D78 A;  1NUB A;  2HPS A;  1TN4 A;  1AP4 A;  1NWD A;  5IBW A;  1UHH A;  1JWD A;  1L2O C;  1N65 A;  2ERB A;  1J1E A;  5AXI A;  4PE1 A;  2LVJ A;  1F55 A;  4PE0 A;  3S0A A;  1ZOT B;  3S0D A;  2JPT A;  4GPL B;  2JNF A;  1TWO A;  3C1V A;  1JBA A;  3DYE A;  4OZD A;  1UHI A;  2K7D A;  1SW8 A;  2WC6 A;  1QVI Z;  3I5G B;  5CSN A;  2FJY A;  3KPX A;  3QRX A;  2F2P A;  2MLE C;  2GTE A;  3DD4 A;  1NIW A;  3NSI A;  3DVM A;  4MRY A;  4MBE A;  4YI9 A;  2YGU A;  3AKB A;  3L4L A;  1RJV A;  2P6B B;  1PAL A;  2LVI A;  3CZT X;  4HRH A;  4ORA B;  4C0K A;  3FWC A;  2NLN A;  1V1G A;  1U5I A;  1IQ3 A;  1PSB A;  1XFU O;  1NX2 A;  2BAP A;  2KBM A;  2KLD A;  3TDU A;  3L4A A;  1OOF A;  2I7A A;  3CR4 X;  4D1E A;  4GBA A;  1N2D A;  1BR1 B;  5AER A;  1IG5 A;  2JQ6 A;  2K2F A;  1NYA A;  1WLM A;  1L2O B;  2M0R A;  1B9A A;  3BFA A;  3IF7 A;  3O78 A;  1Q80 A;  3SG2 A;  2D8N A;  1XFX O;  3NGV A;  2JT8 A;  1OMR A;  2JZI A;  4N5X A;  2Y4Q A;  2ZFD A;  2WCL A;  1K94 A;  1G33 A;  1PK0 D;  1DF0 A;  2KOT A;  1QV1 A;  4WQ3 A;  1GM0 A;  2LNK A;  1S1E A;  4JPZ B;  1MWN A;  1SL7 A;  1H8B A;  1ALW A;  2BBM A;  1GQM A;  3B87 A;  4IJ7 A;  1CFC A;  2Q91 A;  4N1G A;  1NX0 A;  2KBI A;  3DXL A;  1BJF A;  1FI6 A;  1LA0 A;  4YGE B;  1RWY A;  4DIR A;  3NSL A;  2LP2 A;  2LAP A;  4DUQ A;  1YVH A;  2P70 A;  1QVI Y;  2SAS A;  1LXF C;  1G4Y R;  2R2I A;  3S0E A;  1C3Y A;  3OHM B;  2HET A;  2WOS A;  1TUZ A;  1NCY A;  3NSO A;  5GQQ C;  2O5G A;  3IVT A;  3NXA A;  5I2Q A;  2MHH A;  3PJI A;  1SY9 A;  1Y0V H;  2H8V A;  2KI4 C;  2LUX A;  3OBV A;  4GGF A;  2M1K B;  5DKN A;  2NCO A;  2ZN8 A;  3L47 A;  3QME A;  4M2P A;  3TUY C;  1W7I B;  2PYQ A;  4PHJ A;  2KQ6 A;  1R2U A;  3D74 A;  4QJ3 B;  1MXE A;  2PVB A;  2WC5 A;  2FCD A;  5D7F A;  1K93 D;  1SKT A;  1QX2 A;  2KSP A;  2QEO A;  4HRE E;  2KAY A;  3F45 A;  5FI7 A;  1F4Q A;  3TS5 C;  2M49 B;  1V1F A;  3K1E A;  3SG3 A;  2EHB A;  2DOQ A;  5CSF A;  3D76 A;  1AUI B;  2FCE A;  1CFF A;  2JT0 A;  2QAC A;  3SG5 A;  1F70 A;  2Y1N A;  1J7R A;  2JC2 A;  1W7J B;  2K7C A;  1CB1 A;  1DJY A;  1WDC C;  3D73 A;  1EG4 A;  5HKZ A;  2HQW A;  5CPV A;  5D3O A;  1IWQ A;  2JTT A;  3ZNI A;  1QAS A;  3PSR A;  2WC8 A;  3A8R A;  1ZUZ A;  3RM1 A;  1DMO A;  1SPY A;  1OOG A;  5KSZ A;  1NX1 A;  2M8U A;  4IL1 A;  2KI4 B;  1NSH A;  3R1P A;  5FI2 A;  3SIB A;  1LVC D;  3TUY B;  1OE9 B;  1ZMZ A;  4HSZ A;  1LKJ A;  2SCP A;  5HLV A;  4AQJ A;  2BE4 A;  1BT6 A;  1BU3 A;  1CMG A;  1T14 A;  1Y1X A;  2EGD A;  1DJW A;  2LC5 A;  4NDC A;  2LAN A;  5JJG A;  1JUO A;  3BUM B;  3TS5 B;  1JF2 A;  2LCP A;  3KEV A;  1KFU S;  1Z2C B;  4FQO A;  5ER5 A;  1YUS A;  5I2O A;  1S36 A;  2KFF A;  3SS3 A;  5DKR A;  5AEQ A;  3PLF B;  1NP8 A;  1IGV A;  1EXR A;  1TUJ A;  1UHJ A;  1WDC B;  1OZO A;  2LLU A;  3PAT A;  4XJK B;  1RTP 1;  1LIN A;  2PMY A;  4MZL A;  1K2H A;  1B1G A;  3NHI A;  1B8R A;  1DVI A;  1KFU L;  1SYM A;  1TIZ A;  4Q04 A;  2K0J A;  3LCP C;  2F33 A;  4GNK B;  1CKK A;  1D1O A;  4OR9 B;  1PRW A;  2MLF C;  2F3Y A;  1NX3 A;  1FPW A;  1WRL A;  1QS7 A;  3VRN A;  3LLE A;  1UHK A;  2CTN A;  1A2X A;  1M63 B;  2JU0 A;  4GAO A;  5TNC A;  2LP3 A;  3D10 A;  2Y1M A;  1J7P A;  1TCO B;  2LMT A;  3O6B A;  2JRF A;  4MZJ A;  2M7N A;  3CTN A;  3WNX B;  2AMI A;  1WLZ A;  5F6T A;  4P2Y B;  2ZKM X;  2PAL A;  5AAN A;  4DCK A;  3HCM A;  3B88 A;  1PVA A;  3PFV A;  1S6I A;  4MN0 A;  3EK4 A;  2A4J A;  4U8D A;  5DIC A;  3S0B A;  2M97 A;  4ICB A;  1CMF A;  5ER4 X;  1F4O A;  1KQM C;  1YUR A;  2KFH A;  2Q4U A;  1J1D A;  4TNC A;  2WCK A;  1K95 A;  3O4Y A;  2JPO A;  3EVU A;  4CFR A;  1S5G Y;  1B7T Z;  3WXA A;  3CDN A;  4BY5 A;  2GV5 A;  1DGU A;  3OX6 A;  3AKA A;  1M46 A; 
#chains in the Genus database with same CATH homology
 5G08 A;  1XK4 C;  1QAT A;  1WY9 A;  3LL8 B;  4GGN A;  1QX5 B;  3D0Y B;  3NSK A;  1QIV A;  1X02 A;  1PUL A;  2LLS A;  4MVF A;  1CM1 A;  4OV2 A;  1HQV A;  2I2R E;  2JOJ A;  2BKI B;  2KI6 D;  2PSR A;  3M0W A;  1WRK A;  2I94 A;  2IS9 A;  2M29 A;  1FBV A;  1NCZ A;  1ODB A;  1RRO A;  2L4I A;  3BUO B;  2EC6 C;  4F0Z B;  2TN4 A;  1IKU A;  1DJG A;  2ISD A;  1KQM B;  5I2L A;  2K8M B;  1ZAC A;  4C0L A;  1QLS A;  1RK9 A;  1DT7 B;  1REC A;  4AOM A;  1L7Z A;  1M45 A;  3BOW A;  1EL4 A;  3DF0 A;  1YTZ C;  1TCF A;  1TNX A;  1UUR A;  1S26 D;  1CLB A;  4I5J A;  1S3P A;  1SL9 A;  3BQ3 A;  1IRJ A;  2F2O A;  4NDD A;  1OMV A;  4QJ5 B;  1K9K A;  2K61 A;  2JXL A;  2L50 A;  2ZNE A;  2COL B;  3SG4 A;  2KI6 C;  3DVJ A;  2I18 A;  1B7T Y;  1CDM A;  3BXK A;  3TDI A;  1CM4 A;  2OTG C;  5DKQ A;  1J7O A;  1AHR A;  2JXC A;  1GJY A;  1JSA A;  2F8P A;  4QJ4 B;  2KQY A;  3LK0 A;  1YUU A;  2G9B A;  1FI5 A;  5BPJ A;  1C7W A;  2NXQ A;  1SRA A;  3OX5 A;  4N1F A;  1XFV O;  2EC6 B;  5KTY A;  1UWO A;  1DF0 B;  1DJX A;  2FOT A;  1KK7 Z;  1A75 A;  1LA3 A;  1Y6W A;  1YR5 A;  2M3W A;  1QJT A;  1Y1U A;  1YVL A;  3VRQ A;  4PE7 A;  1AVS A;  4MEW A;  2KAV A;  4GUK A;  4MRX A;  2LV7 A;  1E8A A;  2MBX A;  4A4B A;  1IJ6 A;  3JTD C;  4YGC B;  2H61 C;  3BUW B;  5K89 A;  3CR5 X;  2CBL A;  3LK1 A;  1F8H A;  1CLL A;  1UHN A;  1UUS A;  1B8C A;  4USL A;  1DGV A;  1K9U A;  2G2B A;  2OTG B;  2ZN9 A;  2GGZ A;  4FTG A;  1QV0 A;  1SR6 C;  1Y1A A;  1XA5 A;  4I5L B;  2LMU A;  1AJ4 A;  4JQ0 D;  1OSA A;  4PAL A;  2LVV A;  2LE9 B;  3VGO A;  2HQ8 A;  2KGR A;  3PAL A;  3EKJ A;  3GK1 A;  4DRW A;  4ORB B;  1IQ5 A;  1KFX L;  2K7O A;  4M2Q A;  4MLW A;  4HRG A;  3ICB A;  2PAS A;  1CFD A;  3SJS A;  4CFQ A;  5J3X A;  3EK8 A;  4ZCU A;  1CLM A;  2JUL A;  1AK8 A;  3SIA A;  1JF0 A;  1CNP A;  3JVT C;  5B8I B;  5HLO A;  3JTD B;  1XFW O;  1QX7 A;  1KK7 Y;  1M39 A;  4M2O A;  1EH2 A;  1UP5 A;  2BCA A;  3K21 A;  3WHU B;  4GFT A;  1XVJ A;  1BR4 B;  4UPG A;  2WCB A;  4YGB B;  4NDB A;  1SR6 B;  3H4S E;  1CDN A;  3VRP A;  2CCM A;  3KO0 A;  3HX4 A;  1KK8 C;  1DTL A;  1QTX A;  1YRU B;  1KSM A;  2L5X B;  4I5K A;  1K9P A;  1SCV A;  2OS8 C;  4A4C A;  4ZCV A;  1B8L A;  2BCX A;  4P5O E;  3PM8 A;  3GK2 A;  1OOJ A;  1BOD A;  1F71 A;  1IH0 A;  1VRK A;  2V53 A;  4CPV A;  1J7Q A;  1K8U A;  1BMO A;  2PRU A;  3DVK A;  4MSP A;  2L4H A;  1HT9 A;  3JVT B;  1YRT B;  2E6W A;  3CWG A;  1NPQ A;  2BL0 C;  3I5I C;  5D69 A;  1KWO C;  2L98 A;  3VRO A;  2ZND A;  3TDZ A;  1XK4 A;  1RFJ A;  2KFG A;  2KNE A;  3EVV A;  4R1E A;  1OQP A;  5CSJ A;  1OZS A;  1SNL A;  1J55 A;  1TNW A;  4YBH B;  5HKW A;  4PHN A;  2K7B A;  3PN7 C;  4OCI A;  5FYX A;  2AAO A;  3CS1 A;  1KK8 B;  1YX7 A;  2LHI A;  1KSO A;  3OB1 B;  2MRD A;  1G8I A;  3A4U B;  4PCW A;  1QXP A;  3IQO A;  4L9M A;  2OS8 B;  5JOL A;  3GOF A;  4DS7 A;  3I5H C;  2JNX A;  2GGM A;  1JC2 A;  4PE4 A;  2CT9 A;  1EG3 A;  1DJZ A;  2JT3 A;  1K96 A;  4XYN A;  2L0P A;  3BYA A;  1MXL C;  1JFJ A;  5PAL A;  2WCF A;  5I8N A;  2KYF A;  1IJ5 A;  1MQ1 A;  1SBJ A;  1TNP A;  1XFY O;  3DVE A;  1JFK A;  2HF5 A;  2BL0 B;  1U5I B;  3I5I B;  2NCP A;  1F54 A;  1KWO B;  2K2A A;  1KQV A;  1DJH A;  2E30 A;  2VRG A;  3FIA A;  1B47 A;  4MZK A;  2M1U A;  2M9G A;  1QIW A;  4PDZ A;  2MAZ A;  3VRR A;  3EVR A;  3FWB A;  3OB2 B;  1CTR A;  2JTZ A;  5KU1 A;  2O60 A;  1DJI A;  4GGF C;  1XYD A;  3PN7 B;  3WHT B;  1NCX A;  4E68 A;  2KGB C;  3TZ1 A;  2LUC A;  1FF1 A;  2QPT A;  4ETO A;  1CFP A;  2M7L A;  1AJ5 A;  3AAK A;  2MA2 A;  4ORC B;  3MSE B;  3AAJ A;  1MR8 A;  2LMV A;  3I5H B;  3RLZ A;  5HKY A;  3EK7 A;  1BF5 A;  4YI8 A;  1C07 A;  2OPO A;  3ZWH A;  4NQG A;  4PHM A;  4YRU A;  2H2K A;  1YX8 A;  2BKH B;  1OMD A;  1S6C A;  1SCM C;  4XJK A;  1C7V A;  2ZRS A;  1SL8 A;  1FW4 A;  4CLN A;  4JWQ A;  3BOW B;  2CNP A;  3DF0 B;  2ZRT A;  2BCB A;  1PVB A;  3KF9 A;  1KFX S;  4AQI A;  1TRF A;  2H61 A;  1YUT A;  2KDH A;  3I5F C;  4PHK A;  3OP0 A;  3CLN A;  2LVK A;  4OVN F;  4WRI A;  3O2P A;  2BBN A;  2KHN A;  1A4P A;  1GGW A;  2CXJ A;  3GK4 X;  2MJW B;  1BOC A;  1CDL A;  2WND A;  1A03 A;  4WQ2 A;  5AFP A;  1N0Y A;  3CGA A;  1B4C A;  1ZFS A;  1H4B A;  1R6P A;  1S6J A;  1K90 D;  2F3Z A;  1ALV A;  2RGI A;  4BY4 A;  2KYC A;  1SMG A;  2L51 A;  4OKH A;  3IQQ A;  1TNQ A;  1BG1 A;  2BEC A;  1MUX A;  2NZ0 A;  2WCE A;  2LLT A;  3BUX B;  3CR2 A;  2JWW A;  3I5G C;  1CDP A;  2L2E A;  1XO5 A;  2KAX A;  1EJ3 A;  1SCM B;  2WOR A;  1GGZ A;  3KHE A;  2BE6 A;  1S5G Z;  1KCY A;  5CSI A;  2LHL A;  1TOP A;  1A75 B;  2AUC A;  2B1U A;  1QLK A;  3FS7 A;  2FJU B;  3SG7 A;  1WRZ A;  1M31 A;  3BUN B;  4YGA A;  4I5N B;  5HYD A;  1A29 A;  1XFZ O;  3D0Y A;  1PSR A;  4C0J A;  1BLQ A;  1MHO A;  1SK6 D;  1TTX A;  3E3R A;  3I5F B;  3SG6 A;  4YGD B;  4CID A;  2Y5I A;  3EKH A;  1MF8 B;  2LM5 A;  1NUB A;  2HPS A;  1TN4 A;  1AP4 A;  1NWD A;  5IBW A;  1UHH A;  1JWD A;  1L2O C;  1N65 A;  1J1E A;  5AXI A;  4PE1 A;  2LVJ A;  1F55 A;  4PE0 A;  1ZOT B;  2JPT A;  4GPL B;  2JNF A;  3C1V A;  1JBA A;  1UHI A;  2K7D A;  1SW8 A;  3I5G B;  1QVI Z;  5CSN A;  3KPX A;  3QRX A;  2F2P A;  2MLE C;  3DD4 A;  1NIW A;  3NSI A;  3DVM A;  4MRY A;  4MBE A;  4YI9 A;  3AKB A;  1RJV A;  2P6B B;  1PAL A;  2LVI A;  3CZT X;  4HRH A;  4ORA B;  4C0K A;  3FWC A;  2NLN A;  1V1G A;  1U5I A;  1IQ3 A;  1PSB A;  1XFU O;  1NX2 A;  3TDU A;  2KBM A;  2I7A A;  3CR4 X;  4D1E A;  4GBA A;  1N2D A;  1BR1 B;  5AER A;  1IG5 A;  2JQ6 A;  2K2F A;  1NYA A;  1WLM A;  1L2O B;  2M0R A;  1B9A A;  3IF7 A;  3O78 A;  1Q80 A;  3SG2 A;  2D8N A;  1XFX O;  2JT8 A;  1OMR A;  2JZI A;  4N5X A;  2Y4Q A;  2ZFD A;  1K94 A;  1G33 A;  1PK0 D;  1DF0 A;  2KOT A;  1QV1 A;  4WQ3 A;  2LNK A;  1S1E A;  4JPZ B;  1MWN A;  1SL7 A;  1H8B A;  1ALW A;  2BBM A;  1GQM A;  1CFC A;  2Q91 A;  4N1G A;  1NX0 A;  2KBI A;  1BJF A;  1FI6 A;  1LA0 A;  4YGE B;  1RWY A;  4DIR A;  3NSL A;  2LP2 A;  2LAP A;  4DUQ A;  1YVH A;  1QVI Y;  2SAS A;  1LXF C;  1G4Y R;  2R2I A;  3OHM B;  2HET A;  2WOS A;  1NCY A;  3NSO A;  5GQQ C;  2O5G A;  3NXA A;  5I2Q A;  2MHH A;  1SY9 A;  1Y0V H;  2KI4 C;  4GGF A;  2LUX A;  2M1K B;  5DKN A;  2NCO A;  2ZN8 A;  4M2P A;  3TUY C;  1W7I B;  4PHJ A;  2KQ6 A;  1R2U A;  4QJ3 B;  1MXE A;  2PVB A;  2FCD A;  5D7F A;  1K93 D;  1SKT A;  1QX2 A;  2KSP A;  4HRE E;  2KAY A;  3F45 A;  1F4Q A;  3TS5 C;  2M49 B;  1V1F A;  3SG3 A;  2EHB A;  2DOQ A;  5CSF A;  1AUI B;  2FCE A;  1CFF A;  2JT0 A;  2QAC A;  3SG5 A;  1F70 A;  2Y1N A;  1J7R A;  2JC2 A;  1W7J B;  2K7C A;  1CB1 A;  1DJY A;  1WDC C;  5HKZ A;  1EG4 A;  2HQW A;  5CPV A;  1IWQ A;  2JTT A;  3ZNI A;  1QAS A;  3PSR A;  2WC8 A;  3A8R A;  1ZUZ A;  3RM1 A;  1DMO A;  1SPY A;  5KSZ A;  1NX1 A;  2M8U A;  4IL1 A;  2KI4 B;  1NSH A;  3SIB A;  1LVC D;  3TUY B;  1OE9 B;  1ZMZ A;  4HSZ A;  1LKJ A;  2SCP A;  5HLV A;  4AQJ A;  2BE4 A;  1BT6 A;  1BU3 A;  1CMG A;  2EGD A;  1Y1X A;  1DJW A;  2LC5 A;  4NDC A;  2LAN A;  5JJG A;  1JUO A;  3BUM B;  3TS5 B;  1JF2 A;  2LCP A;  3KEV A;  1KFU S;  4FQO A;  5ER5 A;  1YUS A;  5I2O A;  1S36 A;  2KFF A;  5DKR A;  5AEQ A;  3PLF B;  1NP8 A;  1IGV A;  1EXR A;  1UHJ A;  2LLU A;  1WDC B;  1OZO A;  3PAT A;  4XJK B;  1RTP 1;  1LIN A;  2PMY A;  4MZL A;  1K2H A;  1B1G A;  1B8R A;  1DVI A;  1KFU L;  1SYM A;  1TIZ A;  4Q04 A;  2K0J A;  3LCP C;  2F33 A;  4GNK B;  1CKK A;  1D1O A;  4OR9 B;  1PRW A;  2MLF C;  2F3Y A;  1NX3 A;  1FPW A;  1WRL A;  1QS7 A;  3VRN A;  3LLE A;  1UHK A;  2CTN A;  1A2X A;  1M63 B;  2JU0 A;  4GAO A;  5TNC A;  2LP3 A;  3D10 A;  2Y1M A;  1J7P A;  1TCO B;  2LMT A;  3O6B A;  2JRF A;  4MZJ A;  2M7N A;  3CTN A;  3WNX B;  2AMI A;  1WLZ A;  5F6T A;  4P2Y B;  2ZKM X;  2PAL A;  5AAN A;  4DCK A;  3HCM A;  3PFV A;  1PVA A;  1S6I A;  4MN0 A;  3EK4 A;  2A4J A;  4U8D A;  2M97 A;  4ICB A;  1CMF A;  5ER4 X;  1F4O A;  1KQM C;  1YUR A;  2KFH A;  2Q4U A;  1J1D A;  4TNC A;  1K95 A;  3O4Y A;  3EVU A;  4CFR A;  1S5G Y;  1B7T Z;  3WXA A;  4BY5 A;  2GV5 A;  1DGU A;  3OX6 A;  3AKA A;  1M46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...