4ZCUA

Structure of calcium-bound regulatory domain of the human atp-mg/pi carrier in the p2 form
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
153
structure length
152
Chain Sequence
TRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTTGDVNKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLQTLGLTISEQQAELILQSIDVDGTTVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-binding mitochondrial carrier protein SCaMC-1
publication title Calcium-induced conformational changes in the regulatory domain of the human mitochondrial ATP-Mg/Pi carrier.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 51
structure length 152
sequence length 153
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4zcuA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4zcuA02
2LNKA 3NSLA 1XFXO 5CPVA 4N1GA 1CLLA 1DF0B 3BOWA 1WY9A 4JQ0D 4GUKA 3GOFA 2LVIA 1JBAA 1XO5A 1L2OB 1S6CA 3DF0B 1SY9A 3EVRA 1IWQA 1CDMA 1LA3A 1PK0D 1EL4A 4FTGA 1MXLC 2EHBA 4MEWA 1K94A 1C7VA 4WRIA 3CLNA 1BF5A 1LA0A 2L4IA 3AAJA 4OVNF 4WQ2A 4CPVA 1ALVA 1A29A 1UWOA 2I7AA 2L2EA 3JVTC 1F71A 2KI6D 4CLNA 1A03A 1MR8A 2KYCA 3O2PA 3WNXB 3PFVA 3E3RA 3TS5B 1B7TZ 2HQWA 1MF8B 1SCMB 2WCEA 2F8PA 2LLSA 2JOJA 1GQMA 2ZRSA 1SR6B 2G2BA 1K9KA 3C1VA 3SIBA 2Y4QA 2K7OA 1MXEA 3WHTB 1KQVA 2OS8C 1OMVA 2LVVA 1M31A 2F33A 2M9GA 2JT8A 3I5IC 3EKJA 2O5GA 2MLFC 1J1DA 1NWDA 5B8IB 2LMTA 4GGFC 4DS7A 1BG1A 1OSAA 1VRKA 4MSPA 3EK4A 1J7PA 1KK8C 3LL8B 1ZFSA 4M2PA 2ZN9A 3ICBA 3EK7A 1M45A 1YRUB 2H61A 2F3ZA 3RLZA 2NCOA 3BUWB 2PRUA 2AMIA 4C0JA 4DUQA 2KHNA 2L50A 1SNLA 3PM8A 4HSZA 1KQMC 1B8CA 2FOTA 1U5IA 4IL1A 4DRWA 1AJ4A 2LHIA 3IQOA 1XFUO 3D0YB 1DJWA 4ORCB 4PHJA 5ER5A 2L51A 1UHNA 1C7WA 2OTGC 1ZMZA 1B4CA 1CKKA 3I5GB 1A75A 4NDDA 3GK2A 2K2FA 3TZ1A 1RECA 1FW4A 2WC8A 4ZCUA 1QX5B 3CS1A 4AOMA 4MLWA 4PDZA 2I2RE 1K9UA 1WDCC 2Q4UA 4GAOA 2LUXA 1V1FA 5HKZA 1QXPA 1YURA 3VROA 4C0KA 2KI6C 1KCYA 1PULA 1SPYA 1JSAA 2KQYA 1JF2A 1CDPA 1FF1A 1BR4B 1J7QA 4HRGA 2LLTA 4OKHA 5AFPA 3I5HB 2H61C 1RK9A 4ORBB 4PE1A 2NCPA 3BQ3A 1TNWA 4UPGA 3FS7A 5BPJA 2M97A 4QJ4B 3O78A 1IH0A 3VRQA 1QV1A 2BE6A 5HLVA 3VRNA 5KU1A 1H8BA 1Y1UA 4WQ3A 1B8RA 3IF7A 3FWCA 4OCIA 2I18A 1C07A 1TIZA 1LVCD 1SL9A 2F2PA 3CR5X 2KAXA 1JFKA 4PE7A 1B8LA 1KWOC 2K0JA 1AP4A 1BMOA 2KI4B 1BU3A 4YI9A 4CIDA 1AJ5A 1DJYA 1QATA 3KPXA 1K9PA 1K2HA 1R6PA 3BUXB 1NP8A 4BY5A 1IRJA 1CFCA 5CSIA 1AUIB 2JRFA 2K8MB 2A4JA 5HKYA 1QVIY 4GGNA 3EKHA 1TNQA 2LE9B 3NSIA 1WRKA 5AANA 4R1EA 2EC6C 1S1EA 2Y5IA 2SASA 1EJ3A 2K7DA 1CTRA 2ZRTA 1DJXA 4I5KA 3WHUB 2JXLA 2KGRA 2E30A 4U8DA 2MBXA 1XVJA 2NZ0A 1DF0A 1NYAA 2PVBA 1NIWA 2PMYA 2G9BA 3SG6A 1IQ3A 1KK8B 1S3PA 2HF5A 3BOWB 2MAZA 1UUSA 1QLKA 3FIAA 1M46A 3JTDC 1NX0A 1SYMA 2K7BA 2CNPA 2DOQA 2JTZA 1IKUA 5G08A 2BCBA 1PVAA 1CMGA 2CT9A 4MVFA 2L4HA 2ZN8A 2OPOA 1BOCA 1KQMB 4A4CA 2P6BB 4A4BA 1RWYA 2MLEC 1UHJA 1SL7A 3LK0A 3OB1B 2MHHA 2B1UA 2TN4A 2LANA 3GK1A 1CFPA 1F4OA 2V53A 2KYFA 1SMGA 4YI8A 3HCMA 4P2YB 5HYDA 2OTGB 1IJ5A 4HRHA 4XYNA 2WORA 2JTTA 1DGVA 1KFUL 1BLQA 1ALWA 1AVSA 2JQ6A 2WCFA 2NXQA 4E68A 3BYAA 2M1KB 2JNFA 4DCKA 3D10A 1G8IA 1S5GY 1MUXA 1WDCB 3SIAA 5GQQC 1OZOA 2MJWB 3TUYC 1AK8A 1NX3A 2SCPA 5I2OA 2KDHA 1CDLA 1QASA 3SG2A 4AQIA 4PE4A 1WRLA 1L2OC 1YVHA 3FWBA 3TDZA 4N1FA 1CB1A 2ZNDA 1N65A 1NSHA 1KFUS 1SKTA 2JULA 1PVBA 2F3YA 2KBIA 2LMUA 2MRDA 3NSKA 2Y1NA 3DVKA 4YGCB 1K96A 3AKAA 5JJGA 2WOSA 1OOJA 1UHIA 4ICBA 1U5IB 1Y0VH 1W7JB 1B9AA 2L0PA 3D0YA 5CSNA 1MWNA 4NQGA 1KSMA 1UHHA 3ZWHA 3KO0A 1TCFA 3A4UB 3BXKA 3PN7B 5ER4X 2KFGA 5CSJA 3TDUA 4PE0A 4YRUA 5I2LA 1BJFA 1F70A 2JPTA 3LLEA 3MSEB 2RGIA 1QLSA 3I5FC 4OV2A 3PATA 1GGWA 1TN4A 4D1EA 4C0LA 1DMOA 4XJKA 4JWQA 3BUMB 4MZLA 1QIVA 3CGAA 1CLBA 4CFQA 1TRFA 1XFYO 4PHKA 5DKNA 3M0WA 4GBAA 4M2OA 5FYXA 3DD4A 2BL0B 1EXRA 2KBMA 1LINA 1WLMA 2KSPA 1AHRA 2L98A 1BR1B 1QVIZ 1IJ6A 2ZNEA 5J3XA 2EGDA 1JF0A 3NSOA 3EK8A 1KFXL 4F0ZB 1K8UA 2M7NA 3CTNA 4MRXA 4MBEA 5HKWA 2QPTA 1Y1XA 3O4YA 2H2KA 2R2IA 5F6TA 3SG3A 1XK4A 2BCAA 4PHNA 3K21A 1MHOA 1NCXA 3OP0A 2AAOA 1QIWA 2M49B 3PALA 1NX1A 1QJTA 1XFWO 3JTDB 3JVTB 3OX5A 5PALA 2K7CA 4NDCA 1BODA 2M3WA 4BY4A 1K93D 1G33A 2PASA 1XFZO 1EG3A 2LHLA 3VRRA 4OR9B 5AEQA 2ZFDA 3KHEA 1KFXS 1XFVO 1M63B 1X02A 1DJZA 2GGMA 1J55A 2CXJA 2FJUB 1J7RA 3LCPC 5K89A 1OMRA 2KQ6A 1PSRA 1QX2A 1JWDA 1FBVA 2KNEA 1PALA 2OS8B 3SG7A 1CM1A 2K61A 2WCBA 3I5IB 1V1GA 2LV7A 1JC2A 1JFJA 2LCPA 1SBJA 3PSRA 3ZNIA 2QACA 1FI6A 2JC2A 2E6WA 1UHKA 2JWWA 2O60A 4YGAA 2LVJA 4YBHB 1YVLA 1TTXA 1BT6A 2JXCA 3IQQA 4MRYA 1Q80A 4N5XA 2K2AA 2HQ8A 3DF0A 1SCVA 1S5GZ 2LC5A 2LP2A 2IS9A 2JU0A 1TOPA 2M1UA 1L7ZA 3TUYB 1NCZA 4I5LB 1QS7A 1SK6D 3CZTX 1XK4C 3TDIA 3BUOB 1CDNA 2BKHB 5DKRA 1F54A 1F55A 2KFHA 1DVIA 3LK1A 4AQJA 2Y1MA 5KSZA 1UP5A 2VRGA 3PLFB 2BCXA 1HT9A 4DIRA 1YTZC 2FCDA 1CFDA 2COLB 3KF9A 2WNDA 1OE9B 1DJIA 1YRTB 3KEVA 2LUCA 2KI4C 3SG4A 3AKBA 1YUSA 2FCEA 4NDBA 2JNXA 1KK7Y 1KSOA 2BBMA 2I94A 4JPZB 2JT0A 4MZJA 1WRZA 5D7FA 1DJGA 3OX6A 5JOLA 3CR4X 2BKIB 2LP3A 5D69A 1ZUZA 2GV5A 2M8UA 2L5XB 1NX2A 1QV0A 4QJ5B 2KGBC 1OZSA 3NXAA 3I5FB 1SRAA 4GPLB 2M29A 5IBWA 1B47A 3EVVA 1Y1AA 4M2QA 1UURA 2KAVA 5KTYA 4GNKB 1DGUA 1YUUA 1QX7A 3CWGA 4I5NB 4L9MA 3SJSA 4CFRA 1XA5A 1ODBA 3H4SE 2LAPA 1M39A 5HLOA 1IGVA 4FQOA 2MA2A 4MN0A 1YX8A 1B7TY 4TNCA 3TS5C 1GGZA 1K95A 4YGEB 1SCMC 1QTXA 2HETA 4USLA 1OQPA 1FI5A 1F8HA 3OB2B 4PCWA 1SR6C 1XYDA 3A8RA 4ORAB 3QRXA 2KAYA 1KWOB 2HPSA 1A75B 2BBNA 5AXIA 1N0YA 5TNCA 1Y6WA 2KFFA 3EVUA 1SL8A 3SG5A 1OMDA 1A2XA 1HQVA 2LVKA 1PRWA 4GFTA 5CSFA 1RJVA 4Q04A 1J1EA 4PALA 1DT7B 3RM1A 2M7LA 1YR5A 3BUNB 2BE4A 1RROA 4QJ3B 2JT3A 2CCMA 1E8AA 4XJKB 1K90D 1NUBA 2EC6B 1CFFA 1F4QA 1YX7A 2F2OA 2BECA 1CLMA 1GJYA 1NPQA 1H4BA 1ZACA 2LMVA 1LKJA 4P5OE 5I8NA 1DTLA 3AAKA 2LLUA 3WXAA 4YGDB 1DJHA 3DVEA 1IG5A 1B1GA 1D1OA 1A4PA 1RTP1 4YGBB 1J7OA 4MZKA 2Q91A 1S6IA 2ISDA 1NCYA 1JUOA 1RFJA 1TNXA 5DKQA 3OHMB 4PHMA 3GK4X 3I5GC 1TCOB 2PSRA 3DVMA 3DVJA 1TNPA 3CR2A 3PN7C 1S6JA 2NLNA 4ETOA 2JZIA 1YUTA 1FPWA 1CMFA 1G4YR 1R2UA 1ZOTB 3O6BA 2LM5A 1CM4A 2ZKMX 1N2DA 1S26D 2AUCA 2M0RA 1EG4A 4I5JA 1EH2A 2D8NA 1W7IB 1S36A 2CBLA 3VGOA 5AERA 5I2QA 1LXFC 1SW8A 3I5HC 2GGZA 2CTNA 3VRPA 2PALA 4ZCVA 1MQ1A 1KK7Z 1WLZA 1CNPA 1IQ5A 4HREE 1PSBA 2KOTA 2BL0C 3F45A 4GGFA 3HX4A
chains in the Genus database with same CATH superfamily
2LNKA 3NSLA 1XFXO 5CPVA 4N1GA 3D75A 1CLLA 1DF0B 3BOWA 1WY9A 4JQ0D 4GUKA 3GOFA 2LVIA 2QEOA 1JBAA 2WC6A 1XO5A 1L2OB 1S6CA 3DF0B 1SY9A 3EVRA 1IWQA 1CDMA 1LA3A 1PK0D 1EL4A 4FTGA 1MXLC 2EHBA 4MEWA 1K94A 2JPOA 2L5YA 1C7VA 4WRIA 3CLNA 1BF5A 2H8VA 1LA0A 2L4IA 3AAJA 4OVNF 4WQ2A 4PT1A 4CPVA 1ALVA 1A29A 1UWOA 2I7AA 2L2EA 3JVTC 1F71A 2KI6D 4CLNA 1A03A 1MR8A 2KYCA 3O2PA 3WNXB 3PFVA 3E3RA 3TS5B 1B7TZ 2HQWA 1MF8B 1SCMB 2WCEA 1OOGA 2F8PA 2LLSA 2JOJA 1GQMA 2ZRSA 1SR6B 2G2BA 1K9KA 3C1VA 3SIBA 2Y4QA 2K7OA 1MXEA 3WHTB 1TWOA 1KQVA 1DQEA 2OS8C 1OMVA 1DC1A 3D76A 2LVVA 1M31A 2F33A 2M9GA 3D78A 2JT8A 3I5IC 3EKJA 2O5GA 1TUJA 2MLFC 1J1DA 1NWDA 5B8IB 2LMTA 2WCLA 4GGFC 4DS7A 1BG1A 1T14A 3V2LA 3S0DA 1OSAA 1VRKA 4MSPA 3EK4A 1J7PA 1KK8C 3LL8B 1ZFSA 4INXA 4M2PA 2ZN9A 3VB1A 3ICBA 3EK7A 1M45A 1YRUB 2H61A 2F3ZA 3RLZA 1DEKA 2NCOA 3BUWB 2PRUA 2AMIA 4C0JA 4DUQA 2KHNA 2L50A 1SNLA 2WCKA 3PM8A 1KQMC 4HSZA 1B8CA 2FOTA 1U5IA 4IL1A 4DRWA 1AJ4A 2LHIA 3IQOA 2ERBA 1XFUO 3D0YB 1DJWA 4ORCB 4PHJA 5ER5A 2L51A 3S0GA 1UHNA 1C7WA 3FE9A 2OTGC 1ZMZA 1B4CA 1CKKA 3I5GB 1A75A 4NDDA 3GK2A 2K2FA 3TZ1A 1RECA 1FW4A 2WC8A 4ZCUA 2WC5A 1QX5B 3CS1A 4AOMA 4MLWA 4PDZA 2I2RE 1K9UA 1WDCC 2Q4UA 4GAOA 2LUXA 1V1FA 5HKZA 1QXPA 1SSEB 1YURA 4IJ7A 2KI6C 3VROA 1PULA 1SPYA 4C0KA 1KCYA 1C3YA 1JSAA 2KQYA 1JF2A 1CDPA 1FF1A 3NHTA 1BR4B 1J7QA 4HRGA 2LLTA 4OKHA 5AFPA 1OW4A 3I5HB 2H61C 1RK9A 4ORBB 4PE1A 2NCPA 3BQ3A 1TNWA 4UPGA 3FS7A 5BPJA 2M97A 4QJ4B 3O78A 1IH0A 3VRQA 1ORGA 1QV1A 2BE6A 5HLVA 3VRNA 5KU1A 1H8BA 1Y1UA 3FE6A 4WQ3A 1B8RA 3IF7A 3R1VA 4KYNA 3FWCA 1TUZA 3Q8IA 4OCIA 2I18A 1C07A 2QEBA 1TIZA 1LVCD 1SL9A 2F2PA 3CR5X 2KAXA 1JFKA 3EG5B 4PE7A 1B8LA 1DELA 1KWOC 3K1EA 1LS8A 2K0JA 1AP4A 1C3ZA 3NGVA 1BMOA 2QEHA 2KI4B 1BU3A 3OGNA 4YI9A 1AJ5A 1DJYA 1QATA 4CIDA 3KPXA 1K9PA 1K2HA 1R6PA 3BUXB 1OOHA 1NP8A 4BY5A 1IRJA 2YGUA 1CFCA 5CSIA 1AUIB 2JRFA 2K8MB 2A4JA 5HKYA 1QVIY 2QDIA 4GGNA 3EKHA 1TNQA 2LE9B 3NSIA 1WRKA 5AANA 4R1EA 2EC6C 1S1EA 2Y5IA 3S0FA 2SASA 1EJ3A 2K7DA 1CTRA 2ZRTA 1DJXA 4I5KA 3WHUB 2JXLA 2KGRA 2PQLA 2E30A 4U8DA 2MBXA 1XVJA 2NZ0A 1DF0A 1NYAA 2PVBA 1NIWA 2PMYA 2G9BA 3SG6A 1IQ3A 1KK8B 1S3PA 2HF5A 3BOWB 2MAZA 1UUSA 1QLKA 3FIAA 1M46A 3JTDC 1NX0A 3SS4A 1SYMA 2K7BA 2CNPA 2DOQA 2JTZA 2L2CA 1IKUA 5G08A 3NHIA 2BCBA 1PVAA 1CMGA 2CT9A 5DICA 4JKTA 4MVFA 2L4HA 2ZN8A 2OPOA 3O4XA 1KQMB 1BOCA 4A4CA 2P6BB 4A4BA 1RWYA 2MLEC 1UHJA 1SL7A 3LK0A 3OB1B 2MHHA 2B1UA 2TN4A 2LANA 3GK1A 1CFPA 1F4OA 2V53A 2KYFA 1SMGA 4YI8A 3HCMA 4P2YB 5HYDA 2OTGB 1IJ5A 4HRHA 4XYNA 2WORA 5HL1A 2JTTA 1DGVA 1KFUL 1BLQA 1ALWA 1AVSA 3CABA 2JQ6A 2WCFA 2NXQA 4E68A 3CYZA 3BYAA 2M1KB 2JNFA 4DCKA 3D10A 1G8IA 1S5GY 1MUXA 3CZ0A 3SS3A 1WDCB 3SIAA 5GQQC 1OZOA 2MJWB 3TUYC 1AK8A 1NX3A 2SCPA 5I2OA 2KDHA 1CDLA 1QASA 3SG2A 4AQIA 2KLDA 4PE4A 1WRLA 1L2OC 1YVHA 3FWBA 3TDZA 4N1FA 1CB1A 2ZNDA 1N65A 1NSHA 1KFUS 1SKTA 2JULA 1PVBA 2F3YA 2KBIA 2LMUA 2MRDA 3NSKA 2Y1NA 3DVKA 4YGCB 1K96A 3AKAA 5JJGA 2WOSA 1OOJA 1UHIA 4ICBA 1U5IB 1Y0VH 1W7JB 1B9AA 2L0PA 3D0YA 5CSNA 1MWNA 4NQGA 1KSMA 1UHHA 3ZWHA 3KO0A 1TCFA 3A4UB 3BXKA 3PN7B 3R1OA 5ER4X 2KFGA 5CSJA 3TDUA 4PE0A 4YRUA 5I2LA 1BJFA 2WCJA 1F70A 2JPTA 3LLEA 3MSEB 1P28A 2RGIA 1QLSA 3I5FC 4OV2A 3PATA 3B6XA 1GGWA 1TN4A 4D1EA 4C0LA 1DMOA 4XJKA 4JWQA 3BUMB 4MZLA 1QIVA 3CGAA 1CLBA 3CDNA 3B7AA 4CFQA 3OBVA 1TRFA 1XFYO 4PHKA 5DKNA 3M0WA 1GM0A 4GBAA 4M2OA 5FYXA 3DD4A 2BL0B 1EXRA 2FJYA 2KBMA 1LINA 1WLMA 2KSPA 1AHRA 2L98A 1BR1B 1QVIZ 1IJ6A 2ZNEA 3L4LA 2EGDA 5J3XA 1JF0A 3B87A 3NSOA 3EK8A 1KFXL 4F0ZB 1W9ZA 3L4AA 1K8UA 2M7NA 3CTNA 4MRXA 4MBEA 5HKWA 2QPTA 1Y1XA 3O4YA 2H2KA 2R2IA 5F6TA 3SG3A 1XK4A 2BCAA 4PHNA 3K21A 1MHOA 1NCXA 3OP0A 2AAOA 1QIWA 3DXLA 2M49B 3PALA 3DZTA 1NX1A 1QJTA 1XFWO 3JTDB 3JVTB 3OX5A 5PALA 2K7CA 4NDCA 1BODA 2M3WA 4BY4A 3R72A 1K93D 1G33A 2K60A 2PASA 3D77A 1XFZO 1EG3A 2LHLA 5D3OA 3VRRA 4OR9B 5AEQA 2ZFDA 3KHEA 1KFXS 1OOFA 1XFVO 3BJHA 1M63B 1X02A 1DJZA 2GGMA 1J55A 1Z2CB 2CXJA 1J7RA 2FJUB 3LCPC 1OMRA 5K89A 2KQ6A 1PSRA 1QX2A 1JWDA 1FBVA 2KNEA 1PALA 2OS8B 3SG7A 1CM1A 2K61A 2WCBA 2WCHA 3I5IB 1V1GA 2LV7A 1JC2A 1JFJA 2LCPA 1SBJA 3PSRA 3PJIA 2QACA 3ZNIA 1FI6A 2JC2A 2E6WA 1UHKA 2JWWA 2O60A 4YGAA 2LVJA 2GTEA 1YVLA 4YBHB 1TTXA 1BT6A 2JXCA 2KPHA 3DYEA 1Q80A 3IQQA 4MRYA 2K2AA 4N5XA 2HQ8A 3CZ2A 3DF0A 1SCVA 5I94A 1S5GZ 2LC5A 3FE8A 2LP2A 2IS9A 2JU0A 1TOPA 2M1UA 1L7ZA 3TUYB 1NCZA 4FQTA 4I5LB 1QS7A 1SK6D 3CZTX 1XK4C 2KLEA 3BUOB 3TDIA 2BKHB 1CDNA 5DKRA 1F54A 1F55A 2KFHA 1DVIA 3LK1A 4AQJA 2Y1MA 5KSZA 1UP5A 2VRGA 3PLFB 2BCXA 1HT9A 4DIRA 1YTZC 2FCDA 1CFDA 2COLB 3KF9A 5FI6A 2WNDA 1OE9B 1DJIA 1YRTB 3KEVA 2LUCA 2KI4C 3SG4A 3AKBA 1YUSA 2FCEA 2PYQA 4NDBA 2BAPA 2JNXA 1KK7Y 1KSOA 2BBMA 2I94A 3D74A 4JPZB 2JT0A 4MZJA 1WRZA 3BFAA 5D7FA 1DJGA 3OX6A 3S0AA 5JOLA 3CR4X 2BKIB 2LP3A 5D69A 1ZUZA 2GV5A 2M8UA 2L5XB 1NX2A 1QV0A 3B88A 4QJ5B 2KGBC 1OZSA 3NXAA 3I5FB 3UNWA 1SRAA 4GPLB 2M29A 3UO9A 1B47A 3EVVA 1Y1AA 5IBWA 3CZ1A 4M2QA 1UURA 2KAVA 5KTYA 4GNKB 1DGUA 1YUUA 1QX7A 3CWGA 4F7FA 3BFBA 3L47A 4I5NB 4L9MA 3SJSA 4CFRA 1XA5A 5FI7A 1Z4HA 1ODBA 3H4SE 2LAPA 1M39A 5HLOA 1OOIX 1IGVA 4FQOA 2MA2A 4MN0A 3D73A 1YX8A 1B7TY 4TNCA 4INWA 1GGZA 3TS5C 1K95A 4YGEB 1SCMC 1QTXA 2HETA 3IVTA 1OQPA 4USLA 1QWVA 5FI2A 1FI5A 1F8HA 3OB2B 4PCWA 1SR6C 1XYDA 3PM2A 3A8RA 4ORAB 3QRXA 2KAYA 1KWOB 2HPSA 1A75B 2BBNA 5AXIA 1N0YA 5TNCA 1Y6WA 2KFFA 3EVUA 1SL8A 1IIOA 3SG5A 1OMDA 3RZSA 1A2XA 1HQVA 2LVKA 1PRWA 4GFTA 5CSFA 1RJVA 4Q04A 1J1EA 4PALA 1DT7B 3BFHA 3RM1A 2M7LA 3B86A 1YR5A 2WCMA 2BE4A 1RROA 3BUNB 4QJ3B 2JT3A 2CCMA 1E8AA 4XJKB 1K90D 1NUBA 2EC6B 1CFFA 1F4QA 1YX7A 2F2OA 2BECA 1CLMA 3SS5A 1GJYA 1NPQA 1H4BA 1ZACA 2LMVA 1LKJA 4P5OE 5I8NA 1DTLA 3AAKA 2LLUA 3WXAA 4YGDB 1DJHA 2P71A 3S0BA 3DVEA 1IG5A 1B1GA 1D1OA 1A4PA 1RTP1 4YGBB 5EL2A 1J7OA 4MZKA 2Q91A 1S6IA 2ISDA 1NCYA 1JUOA 1RFJA 1TNXA 5DKQA 3OHMB 3DY9A 4OZDA 4PHMA 3GK4X 3N7HA 3I5GC 1TCOB 2P70A 2PSRA 3DVMA 3DVJA 1TNPA 3CR2A 3PN7C 1S6JA 2NLNA 2BNXA 4ETOA 2JZIA 1YUTA 3S0EA 1CMFA 1G4YR 1R2UA 4JD9A 1ZOTB 1FPWA 3O6BA 2LM5A 1CM4A 2ZKMX 1N2DA 1S26D 2AUCA 2M0RA 1EG4A 2QEVA 4I5JA 1EH2A 2D8NA 1W7IB 3R1PA 1S36A 2CBLA 3VGOA 5AERA 5I2QA 1LXFC 1SW8A 3I5HC 2GGZA 2CTNA 3VRPA 2PALA 4ZCVA 1MQ1A 1KK7Z 1XFRA 1WLZA 1CNPA 1IQ5A 3QMEA 1PSBA 4HREE 2KOTA 2BL0C 3F45A 4GGFA 3HX4A
chains in the Genus database with same CATH topology
2LNKA 3NSLA 1XFXO 5CPVA 4N1GA 1CLLA 1DF0B 3BOWA 1WY9A 4JQ0D 4GUKA 3GOFA 2LVIA 1JBAA 1XO5A 1L2OB 1S6CA 3DF0B 1SY9A 3EVRA 1IWQA 1CDMA 1LA3A 1PK0D 1EL4A 4FTGA 1MXLC 2EHBA 4MEWA 1K94A 1C7VA 4WRIA 3CLNA 1BF5A 1LA0A 2L4IA 3AAJA 4OVNF 4WQ2A 4CPVA 1ALVA 1A29A 1UWOA 2I7AA 2L2EA 3JVTC 1F71A 2KI6D 4CLNA 1A03A 1MR8A 2KYCA 3O2PA 3WNXB 3PFVA 3E3RA 3TS5B 1B7TZ 2HQWA 1MF8B 1SCMB 2WCEA 2F8PA 2LLSA 2JOJA 1GQMA 2ZRSA 1SR6B 2G2BA 1K9KA 3C1VA 3SIBA 2Y4QA 2K7OA 1MXEA 3WHTB 1KQVA 2OS8C 1OMVA 2LVVA 1M31A 2F33A 2M9GA 2JT8A 3I5IC 3EKJA 2O5GA 2MLFC 1J1DA 1NWDA 5B8IB 2LMTA 4GGFC 4DS7A 1BG1A 1OSAA 1VRKA 4MSPA 3EK4A 1J7PA 1KK8C 3LL8B 1ZFSA 4M2PA 2ZN9A 3ICBA 3EK7A 1M45A 1YRUB 2H61A 2F3ZA 3RLZA 2NCOA 3BUWB 2PRUA 2AMIA 4C0JA 4DUQA 2KHNA 2L50A 1SNLA 3PM8A 4HSZA 1KQMC 1B8CA 2FOTA 1U5IA 4IL1A 4DRWA 1AJ4A 2LHIA 3IQOA 1XFUO 3D0YB 1DJWA 4ORCB 4PHJA 5ER5A 2L51A 1UHNA 1C7WA 2OTGC 1ZMZA 1B4CA 1CKKA 3I5GB 1A75A 4NDDA 3GK2A 2K2FA 3TZ1A 1RECA 1FW4A 2WC8A 4ZCUA 1QX5B 3CS1A 4AOMA 4MLWA 4PDZA 2I2RE 1K9UA 1WDCC 2Q4UA 4GAOA 2LUXA 1V1FA 5HKZA 1QXPA 1YURA 3VROA 4C0KA 2KI6C 1KCYA 1PULA 1SPYA 1JSAA 2KQYA 1JF2A 1CDPA 1FF1A 1BR4B 1J7QA 4HRGA 2LLTA 4OKHA 5AFPA 3I5HB 2H61C 1RK9A 4ORBB 4PE1A 2NCPA 3BQ3A 1TNWA 4UPGA 3FS7A 5BPJA 2M97A 4QJ4B 3O78A 1IH0A 3VRQA 1QV1A 2BE6A 5HLVA 3VRNA 5KU1A 1H8BA 1Y1UA 4WQ3A 1B8RA 3IF7A 3FWCA 4OCIA 2I18A 1C07A 1TIZA 1LVCD 1SL9A 2F2PA 3CR5X 2KAXA 1JFKA 4PE7A 1B8LA 1KWOC 2K0JA 1AP4A 1BMOA 2KI4B 1BU3A 4YI9A 4CIDA 1AJ5A 1DJYA 1QATA 3KPXA 1K9PA 1K2HA 1R6PA 3BUXB 1NP8A 4BY5A 1IRJA 1CFCA 5CSIA 1AUIB 2JRFA 2K8MB 2A4JA 5HKYA 1QVIY 4GGNA 3EKHA 1TNQA 2LE9B 3NSIA 1WRKA 5AANA 4R1EA 2EC6C 1S1EA 2Y5IA 2SASA 1EJ3A 2K7DA 1CTRA 2ZRTA 1DJXA 4I5KA 3WHUB 2JXLA 2KGRA 2E30A 4U8DA 2MBXA 1XVJA 2NZ0A 1DF0A 1NYAA 2PVBA 1NIWA 2PMYA 2G9BA 3SG6A 1IQ3A 1KK8B 1S3PA 2HF5A 3BOWB 2MAZA 1UUSA 1QLKA 3FIAA 1M46A 3JTDC 1NX0A 1SYMA 2K7BA 2CNPA 2DOQA 2JTZA 1IKUA 5G08A 2BCBA 1PVAA 1CMGA 2CT9A 4MVFA 2L4HA 2ZN8A 2OPOA 1BOCA 1KQMB 4A4CA 2P6BB 4A4BA 1RWYA 2MLEC 1UHJA 1SL7A 3LK0A 3OB1B 2MHHA 2B1UA 2TN4A 2LANA 3GK1A 1CFPA 1F4OA 2V53A 2KYFA 1SMGA 4YI8A 3HCMA 4P2YB 5HYDA 2OTGB 1IJ5A 4HRHA 4XYNA 2WORA 2JTTA 1DGVA 1KFUL 1BLQA 1ALWA 1AVSA 2JQ6A 2WCFA 2NXQA 4E68A 3BYAA 2M1KB 2JNFA 4DCKA 3D10A 1G8IA 1S5GY 1MUXA 1WDCB 3SIAA 5GQQC 1OZOA 2MJWB 3TUYC 1AK8A 1NX3A 2SCPA 5I2OA 2KDHA 1CDLA 1QASA 3SG2A 4AQIA 4PE4A 1WRLA 1L2OC 1YVHA 3FWBA 3TDZA 4N1FA 1CB1A 2ZNDA 1N65A 1NSHA 1KFUS 1SKTA 2JULA 1PVBA 2F3YA 2KBIA 2LMUA 2MRDA 3NSKA 2Y1NA 3DVKA 4YGCB 1K96A 3AKAA 5JJGA 2WOSA 1OOJA 1UHIA 4ICBA 1U5IB 1Y0VH 1W7JB 1B9AA 2L0PA 3D0YA 5CSNA 1MWNA 4NQGA 1KSMA 1UHHA 3ZWHA 3KO0A 1TCFA 3A4UB 3BXKA 3PN7B 5ER4X 2KFGA 5CSJA 3TDUA 4PE0A 4YRUA 5I2LA 1BJFA 1F70A 2JPTA 3LLEA 3MSEB 2RGIA 1QLSA 3I5FC 4OV2A 3PATA 1GGWA 1TN4A 4D1EA 4C0LA 1DMOA 4XJKA 4JWQA 3BUMB 4MZLA 1QIVA 3CGAA 1CLBA 4CFQA 1TRFA 1XFYO 4PHKA 5DKNA 3M0WA 4GBAA 4M2OA 5FYXA 3DD4A 2BL0B 1EXRA 2KBMA 1LINA 1WLMA 2KSPA 1AHRA 2L98A 1BR1B 1QVIZ 1IJ6A 2ZNEA 5J3XA 2EGDA 1JF0A 3NSOA 3EK8A 1KFXL 4F0ZB 1K8UA 2M7NA 3CTNA 4MRXA 4MBEA 5HKWA 2QPTA 1Y1XA 3O4YA 2H2KA 2R2IA 5F6TA 3SG3A 1XK4A 2BCAA 4PHNA 3K21A 1MHOA 1NCXA 3OP0A 2AAOA 1QIWA 2M49B 3PALA 1NX1A 1QJTA 1XFWO 3JTDB 3JVTB 3OX5A 5PALA 2K7CA 4NDCA 1BODA 2M3WA 4BY4A 1K93D 1G33A 2PASA 1XFZO 1EG3A 2LHLA 3VRRA 4OR9B 5AEQA 2ZFDA 3KHEA 1KFXS 1XFVO 1M63B 1X02A 1DJZA 2GGMA 1J55A 2CXJA 2FJUB 1J7RA 3LCPC 5K89A 1OMRA 2KQ6A 1PSRA 1QX2A 1JWDA 1FBVA 2KNEA 1PALA 2OS8B 3SG7A 1CM1A 2K61A 2WCBA 3I5IB 1V1GA 2LV7A 1JC2A 1JFJA 2LCPA 1SBJA 3PSRA 3ZNIA 2QACA 1FI6A 2JC2A 2E6WA 1UHKA 2JWWA 2O60A 4YGAA 2LVJA 4YBHB 1YVLA 1TTXA 1BT6A 2JXCA 3IQQA 4MRYA 1Q80A 4N5XA 2K2AA 2HQ8A 3DF0A 1SCVA 1S5GZ 2LC5A 2LP2A 2IS9A 2JU0A 1TOPA 2M1UA 1L7ZA 3TUYB 1NCZA 4I5LB 1QS7A 1SK6D 3CZTX 1XK4C 3TDIA 3BUOB 1CDNA 2BKHB 5DKRA 1F54A 1F55A 2KFHA 1DVIA 3LK1A 4AQJA 2Y1MA 5KSZA 1UP5A 2VRGA 3PLFB 2BCXA 1HT9A 4DIRA 1YTZC 2FCDA 1CFDA 2COLB 3KF9A 2WNDA 1OE9B 1DJIA 1YRTB 3KEVA 2LUCA 2KI4C 3SG4A 3AKBA 1YUSA 2FCEA 4NDBA 2JNXA 1KK7Y 1KSOA 2BBMA 2I94A 4JPZB 2JT0A 4MZJA 1WRZA 5D7FA 1DJGA 3OX6A 5JOLA 3CR4X 2BKIB 2LP3A 5D69A 1ZUZA 2GV5A 2M8UA 2L5XB 1NX2A 1QV0A 4QJ5B 2KGBC 1OZSA 3NXAA 3I5FB 1SRAA 4GPLB 2M29A 5IBWA 1B47A 3EVVA 1Y1AA 4M2QA 1UURA 2KAVA 5KTYA 4GNKB 1DGUA 1YUUA 1QX7A 3CWGA 4I5NB 4L9MA 3SJSA 4CFRA 1XA5A 1ODBA 3H4SE 2LAPA 1M39A 5HLOA 1IGVA 4FQOA 2MA2A 4MN0A 1YX8A 1B7TY 4TNCA 3TS5C 1GGZA 1K95A 4YGEB 1SCMC 1QTXA 2HETA 4USLA 1OQPA 1FI5A 1F8HA 3OB2B 4PCWA 1SR6C 1XYDA 3A8RA 4ORAB 3QRXA 2KAYA 1KWOB 2HPSA 1A75B 2BBNA 5AXIA 1N0YA 5TNCA 1Y6WA 2KFFA 3EVUA 1SL8A 3SG5A 1OMDA 1A2XA 1HQVA 2LVKA 1PRWA 4GFTA 5CSFA 1RJVA 4Q04A 1J1EA 4PALA 1DT7B 3RM1A 2M7LA 1YR5A 3BUNB 2BE4A 1RROA 4QJ3B 2JT3A 2CCMA 1E8AA 4XJKB 1K90D 1NUBA 2EC6B 1CFFA 1F4QA 1YX7A 2F2OA 2BECA 1CLMA 1GJYA 1NPQA 1H4BA 1ZACA 2LMVA 1LKJA 4P5OE 5I8NA 1DTLA 3AAKA 2LLUA 3WXAA 4YGDB 1DJHA 3DVEA 1IG5A 1B1GA 1D1OA 1A4PA 1RTP1 4YGBB 1J7OA 4MZKA 2Q91A 1S6IA 2ISDA 1NCYA 1JUOA 1RFJA 1TNXA 5DKQA 3OHMB 4PHMA 3GK4X 3I5GC 1TCOB 2PSRA 3DVMA 3DVJA 1TNPA 3CR2A 3PN7C 1S6JA 2NLNA 4ETOA 2JZIA 1YUTA 1FPWA 1CMFA 1G4YR 1R2UA 1ZOTB 3O6BA 2LM5A 1CM4A 2ZKMX 1N2DA 1S26D 2AUCA 2M0RA 1EG4A 4I5JA 1EH2A 2D8NA 1W7IB 1S36A 2CBLA 3VGOA 5AERA 5I2QA 1LXFC 1SW8A 3I5HC 2GGZA 2CTNA 3VRPA 2PALA 4ZCVA 1MQ1A 1KK7Z 1WLZA 1CNPA 1IQ5A 4HREE 1PSBA 2KOTA 2BL0C 3F45A 4GGFA 3HX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LNK A;  3NSL A;  1XFX O;  5CPV A;  4N1G A;  1CLL A;  1DF0 B;  3BOW A;  1WY9 A;  4JQ0 D;  4GUK A;  3GOF A;  2LVI A;  1JBA A;  1XO5 A;  1L2O B;  1S6C A;  3DF0 B;  1SY9 A;  3EVR A;  1IWQ A;  1CDM A;  1LA3 A;  1PK0 D;  1EL4 A;  4FTG A;  1MXL C;  2EHB A;  4MEW A;  1K94 A;  1C7V A;  4WRI A;  3CLN A;  1BF5 A;  1LA0 A;  2L4I A;  3AAJ A;  4OVN F;  4WQ2 A;  4CPV A;  1ALV A;  1A29 A;  1UWO A;  2I7A A;  2L2E A;  3JVT C;  1F71 A;  2KI6 D;  4CLN A;  1A03 A;  1MR8 A;  2KYC A;  3O2P A;  3WNX B;  3PFV A;  3E3R A;  3TS5 B;  1B7T Z;  2HQW A;  1MF8 B;  1SCM B;  2WCE A;  2F8P A;  2LLS A;  2JOJ A;  1GQM A;  2ZRS A;  1SR6 B;  2G2B A;  1K9K A;  3C1V A;  3SIB A;  2Y4Q A;  2K7O A;  1MXE A;  3WHT B;  1KQV A;  2OS8 C;  1OMV A;  2LVV A;  1M31 A;  2F33 A;  2M9G A;  2JT8 A;  3I5I C;  3EKJ A;  2O5G A;  2MLF C;  1J1D A;  1NWD A;  5B8I B;  2LMT A;  4GGF C;  4DS7 A;  1BG1 A;  1OSA A;  1VRK A;  4MSP A;  3EK4 A;  1J7P A;  1KK8 C;  3LL8 B;  1ZFS A;  4M2P A;  2ZN9 A;  3ICB A;  3EK7 A;  1M45 A;  1YRU B;  2H61 A;  2F3Z A;  3RLZ A;  2NCO A;  3BUW B;  2PRU A;  2AMI A;  4C0J A;  4DUQ A;  2KHN A;  2L50 A;  1SNL A;  3PM8 A;  4HSZ A;  1KQM C;  1B8C A;  2FOT A;  1U5I A;  4IL1 A;  4DRW A;  1AJ4 A;  2LHI A;  3IQO A;  1XFU O;  3D0Y B;  1DJW A;  4ORC B;  4PHJ A;  5ER5 A;  2L51 A;  1UHN A;  1C7W A;  2OTG C;  1ZMZ A;  1B4C A;  1CKK A;  3I5G B;  1A75 A;  4NDD A;  3GK2 A;  2K2F A;  3TZ1 A;  1REC A;  1FW4 A;  2WC8 A;  4ZCU A;  1QX5 B;  3CS1 A;  4AOM A;  4MLW A;  4PDZ A;  2I2R E;  1K9U A;  1WDC C;  2Q4U A;  4GAO A;  2LUX A;  1V1F A;  5HKZ A;  1QXP A;  1YUR A;  3VRO A;  4C0K A;  2KI6 C;  1KCY A;  1PUL A;  1SPY A;  1JSA A;  2KQY A;  1JF2 A;  1CDP A;  1FF1 A;  1BR4 B;  1J7Q A;  4HRG A;  2LLT A;  4OKH A;  5AFP A;  3I5H B;  2H61 C;  1RK9 A;  4ORB B;  4PE1 A;  2NCP A;  3BQ3 A;  1TNW A;  4UPG A;  3FS7 A;  5BPJ A;  2M97 A;  4QJ4 B;  3O78 A;  1IH0 A;  3VRQ A;  1QV1 A;  2BE6 A;  5HLV A;  3VRN A;  5KU1 A;  1H8B A;  1Y1U A;  4WQ3 A;  1B8R A;  3IF7 A;  3FWC A;  4OCI A;  2I18 A;  1C07 A;  1TIZ A;  1LVC D;  1SL9 A;  2F2P A;  3CR5 X;  2KAX A;  1JFK A;  4PE7 A;  1B8L A;  1KWO C;  2K0J A;  1AP4 A;  1BMO A;  2KI4 B;  1BU3 A;  4YI9 A;  4CID A;  1AJ5 A;  1DJY A;  1QAT A;  3KPX A;  1K9P A;  1K2H A;  1R6P A;  3BUX B;  1NP8 A;  4BY5 A;  1IRJ A;  1CFC A;  5CSI A;  1AUI B;  2JRF A;  2K8M B;  2A4J A;  5HKY A;  1QVI Y;  4GGN A;  3EKH A;  1TNQ A;  2LE9 B;  3NSI A;  1WRK A;  5AAN A;  4R1E A;  2EC6 C;  1S1E A;  2Y5I A;  2SAS A;  1EJ3 A;  2K7D A;  1CTR A;  2ZRT A;  1DJX A;  4I5K A;  3WHU B;  2JXL A;  2KGR A;  2E30 A;  4U8D A;  2MBX A;  1XVJ A;  2NZ0 A;  1DF0 A;  1NYA A;  2PVB A;  1NIW A;  2PMY A;  2G9B A;  3SG6 A;  1IQ3 A;  1KK8 B;  1S3P A;  2HF5 A;  3BOW B;  2MAZ A;  1UUS A;  1QLK A;  3FIA A;  1M46 A;  3JTD C;  1NX0 A;  1SYM A;  2K7B A;  2CNP A;  2DOQ A;  2JTZ A;  1IKU A;  5G08 A;  2BCB A;  1PVA A;  1CMG A;  2CT9 A;  4MVF A;  2L4H A;  2ZN8 A;  2OPO A;  1BOC A;  1KQM B;  4A4C A;  2P6B B;  4A4B A;  1RWY A;  2MLE C;  1UHJ A;  1SL7 A;  3LK0 A;  3OB1 B;  2MHH A;  2B1U A;  2TN4 A;  2LAN A;  3GK1 A;  1CFP A;  1F4O A;  2V53 A;  2KYF A;  1SMG A;  4YI8 A;  3HCM A;  4P2Y B;  5HYD A;  2OTG B;  1IJ5 A;  4HRH A;  4XYN A;  2WOR A;  2JTT A;  1DGV A;  1KFU L;  1BLQ A;  1ALW A;  1AVS A;  2JQ6 A;  2WCF A;  2NXQ A;  4E68 A;  3BYA A;  2M1K B;  2JNF A;  4DCK A;  3D10 A;  1G8I A;  1S5G Y;  1MUX A;  1WDC B;  3SIA A;  5GQQ C;  1OZO A;  2MJW B;  3TUY C;  1AK8 A;  1NX3 A;  2SCP A;  5I2O A;  2KDH A;  1CDL A;  1QAS A;  3SG2 A;  4AQI A;  4PE4 A;  1WRL A;  1L2O C;  1YVH A;  3FWB A;  3TDZ A;  4N1F A;  1CB1 A;  2ZND A;  1N65 A;  1NSH A;  1KFU S;  1SKT A;  2JUL A;  1PVB A;  2F3Y A;  2KBI A;  2LMU A;  2MRD A;  3NSK A;  2Y1N A;  3DVK A;  4YGC B;  1K96 A;  3AKA A;  5JJG A;  2WOS A;  1OOJ A;  1UHI A;  4ICB A;  1U5I B;  1Y0V H;  1W7J B;  1B9A A;  2L0P A;  3D0Y A;  5CSN A;  1MWN A;  4NQG A;  1KSM A;  1UHH A;  3ZWH A;  3KO0 A;  1TCF A;  3A4U B;  3BXK A;  3PN7 B;  5ER4 X;  2KFG A;  5CSJ A;  3TDU A;  4PE0 A;  4YRU A;  5I2L A;  1BJF A;  1F70 A;  2JPT A;  3LLE A;  3MSE B;  2RGI A;  1QLS A;  3I5F C;  4OV2 A;  3PAT A;  1GGW A;  1TN4 A;  4D1E A;  4C0L A;  1DMO A;  4XJK A;  4JWQ A;  3BUM B;  4MZL A;  1QIV A;  3CGA A;  1CLB A;  4CFQ A;  1TRF A;  1XFY O;  4PHK A;  5DKN A;  3M0W A;  4GBA A;  4M2O A;  5FYX A;  3DD4 A;  2BL0 B;  1EXR A;  2KBM A;  1LIN A;  1WLM A;  2KSP A;  1AHR A;  2L98 A;  1BR1 B;  1QVI Z;  1IJ6 A;  2ZNE A;  5J3X A;  2EGD A;  1JF0 A;  3NSO A;  3EK8 A;  1KFX L;  4F0Z B;  1K8U A;  2M7N A;  3CTN A;  4MRX A;  4MBE A;  5HKW A;  2QPT A;  1Y1X A;  3O4Y A;  2H2K A;  2R2I A;  5F6T A;  3SG3 A;  1XK4 A;  2BCA A;  4PHN A;  3K21 A;  1MHO A;  1NCX A;  3OP0 A;  2AAO A;  1QIW A;  2M49 B;  3PAL A;  1NX1 A;  1QJT A;  1XFW O;  3JTD B;  3JVT B;  3OX5 A;  5PAL A;  2K7C A;  4NDC A;  1BOD A;  2M3W A;  4BY4 A;  1K93 D;  1G33 A;  2PAS A;  1XFZ O;  1EG3 A;  2LHL A;  3VRR A;  4OR9 B;  5AEQ A;  2ZFD A;  3KHE A;  1KFX S;  1XFV O;  1M63 B;  1X02 A;  1DJZ A;  2GGM A;  1J55 A;  2CXJ A;  2FJU B;  1J7R A;  3LCP C;  5K89 A;  1OMR A;  2KQ6 A;  1PSR A;  1QX2 A;  1JWD A;  1FBV A;  2KNE A;  1PAL A;  2OS8 B;  3SG7 A;  1CM1 A;  2K61 A;  2WCB A;  3I5I B;  1V1G A;  2LV7 A;  1JC2 A;  1JFJ A;  2LCP A;  1SBJ A;  3PSR A;  3ZNI A;  2QAC A;  1FI6 A;  2JC2 A;  2E6W A;  1UHK A;  2JWW A;  2O60 A;  4YGA A;  2LVJ A;  4YBH B;  1YVL A;  1TTX A;  1BT6 A;  2JXC A;  3IQQ A;  4MRY A;  1Q80 A;  4N5X A;  2K2A A;  2HQ8 A;  3DF0 A;  1SCV A;  1S5G Z;  2LC5 A;  2LP2 A;  2IS9 A;  2JU0 A;  1TOP A;  2M1U A;  1L7Z A;  3TUY B;  1NCZ A;  4I5L B;  1QS7 A;  1SK6 D;  3CZT X;  1XK4 C;  3TDI A;  3BUO B;  1CDN A;  2BKH B;  5DKR A;  1F54 A;  1F55 A;  2KFH A;  1DVI A;  3LK1 A;  4AQJ A;  2Y1M A;  5KSZ A;  1UP5 A;  2VRG A;  3PLF B;  2BCX A;  1HT9 A;  4DIR A;  1YTZ C;  2FCD A;  1CFD A;  2COL B;  3KF9 A;  2WND A;  1OE9 B;  1DJI A;  1YRT B;  3KEV A;  2LUC A;  2KI4 C;  3SG4 A;  3AKB A;  1YUS A;  2FCE A;  4NDB A;  2JNX A;  1KK7 Y;  1KSO A;  2BBM A;  2I94 A;  4JPZ B;  2JT0 A;  4MZJ A;  1WRZ A;  5D7F A;  1DJG A;  3OX6 A;  5JOL A;  3CR4 X;  2BKI B;  2LP3 A;  5D69 A;  1ZUZ A;  2GV5 A;  2M8U A;  2L5X B;  1NX2 A;  1QV0 A;  4QJ5 B;  2KGB C;  1OZS A;  3NXA A;  3I5F B;  1SRA A;  4GPL B;  2M29 A;  5IBW A;  1B47 A;  3EVV A;  1Y1A A;  4M2Q A;  1UUR A;  2KAV A;  5KTY A;  4GNK B;  1DGU A;  1YUU A;  1QX7 A;  3CWG A;  4I5N B;  4L9M A;  3SJS A;  4CFR A;  1XA5 A;  1ODB A;  3H4S E;  2LAP A;  1M39 A;  5HLO A;  1IGV A;  4FQO A;  2MA2 A;  4MN0 A;  1YX8 A;  1B7T Y;  4TNC A;  3TS5 C;  1GGZ A;  1K95 A;  4YGE B;  1SCM C;  1QTX A;  2HET A;  4USL A;  1OQP A;  1FI5 A;  1F8H A;  3OB2 B;  4PCW A;  1SR6 C;  1XYD A;  3A8R A;  4ORA B;  3QRX A;  2KAY A;  1KWO B;  2HPS A;  1A75 B;  2BBN A;  5AXI A;  1N0Y A;  5TNC A;  1Y6W A;  2KFF A;  3EVU A;  1SL8 A;  3SG5 A;  1OMD A;  1A2X A;  1HQV A;  2LVK A;  1PRW A;  4GFT A;  5CSF A;  1RJV A;  4Q04 A;  1J1E A;  4PAL A;  1DT7 B;  3RM1 A;  2M7L A;  1YR5 A;  3BUN B;  2BE4 A;  1RRO A;  4QJ3 B;  2JT3 A;  2CCM A;  1E8A A;  4XJK B;  1K90 D;  1NUB A;  2EC6 B;  1CFF A;  1F4Q A;  1YX7 A;  2F2O A;  2BEC A;  1CLM A;  1GJY A;  1NPQ A;  1H4B A;  1ZAC A;  2LMV A;  1LKJ A;  4P5O E;  5I8N A;  1DTL A;  3AAK A;  2LLU A;  3WXA A;  4YGD B;  1DJH A;  3DVE A;  1IG5 A;  1B1G A;  1D1O A;  1A4P A;  1RTP 1;  4YGB B;  1J7O A;  4MZK A;  2Q91 A;  1S6I A;  2ISD A;  1NCY A;  1JUO A;  1RFJ A;  1TNX A;  5DKQ A;  3OHM B;  4PHM A;  3GK4 X;  3I5G C;  1TCO B;  2PSR A;  3DVM A;  3DVJ A;  1TNP A;  3CR2 A;  3PN7 C;  1S6J A;  2NLN A;  4ETO A;  2JZI A;  1YUT A;  1FPW A;  1CMF A;  1G4Y R;  1R2U A;  1ZOT B;  3O6B A;  2LM5 A;  1CM4 A;  2ZKM X;  1N2D A;  1S26 D;  2AUC A;  2M0R A;  1EG4 A;  4I5J A;  1EH2 A;  2D8N A;  1W7I B;  1S36 A;  2CBL A;  3VGO A;  5AER A;  5I2Q A;  1LXF C;  1SW8 A;  3I5H C;  2GGZ A;  2CTN A;  3VRP A;  2PAL A;  4ZCV A;  1MQ1 A;  1KK7 Z;  1WLZ A;  1CNP A;  1IQ5 A;  4HRE E;  1PSB A;  2KOT A;  2BL0 C;  3F45 A;  4GGF A;  3HX4 A; 
#chains in the Genus database with same CATH topology
 2LNK A;  3NSL A;  1XFX O;  5CPV A;  4N1G A;  3D75 A;  1CLL A;  1DF0 B;  3BOW A;  1WY9 A;  4JQ0 D;  4GUK A;  3GOF A;  2LVI A;  2QEO A;  1JBA A;  2WC6 A;  1XO5 A;  1L2O B;  1S6C A;  3DF0 B;  1SY9 A;  3EVR A;  1IWQ A;  1CDM A;  1LA3 A;  1PK0 D;  1EL4 A;  4FTG A;  1MXL C;  2EHB A;  4MEW A;  1K94 A;  2JPO A;  2L5Y A;  1C7V A;  4WRI A;  3CLN A;  1BF5 A;  2H8V A;  1LA0 A;  2L4I A;  3AAJ A;  4OVN F;  4WQ2 A;  4PT1 A;  4CPV A;  1ALV A;  1A29 A;  1UWO A;  2I7A A;  2L2E A;  3JVT C;  1F71 A;  2KI6 D;  4CLN A;  1A03 A;  1MR8 A;  2KYC A;  3O2P A;  3WNX B;  3PFV A;  3E3R A;  3TS5 B;  1B7T Z;  2HQW A;  1MF8 B;  1SCM B;  2WCE A;  1OOG A;  2F8P A;  2LLS A;  2JOJ A;  1GQM A;  2ZRS A;  1SR6 B;  2G2B A;  1K9K A;  3C1V A;  3SIB A;  2Y4Q A;  2K7O A;  1MXE A;  3WHT B;  1TWO A;  1KQV A;  1DQE A;  2OS8 C;  1OMV A;  1DC1 A;  3D76 A;  2LVV A;  1M31 A;  2F33 A;  2M9G A;  3D78 A;  2JT8 A;  3I5I C;  3EKJ A;  2O5G A;  1TUJ A;  2MLF C;  1J1D A;  1NWD A;  5B8I B;  2LMT A;  2WCL A;  4GGF C;  4DS7 A;  1BG1 A;  1T14 A;  3V2L A;  3S0D A;  1OSA A;  1VRK A;  4MSP A;  3EK4 A;  1J7P A;  1KK8 C;  3LL8 B;  1ZFS A;  4INX A;  4M2P A;  2ZN9 A;  3VB1 A;  3ICB A;  3EK7 A;  1M45 A;  1YRU B;  2H61 A;  2F3Z A;  3RLZ A;  1DEK A;  2NCO A;  3BUW B;  2PRU A;  2AMI A;  4C0J A;  4DUQ A;  2KHN A;  2L50 A;  1SNL A;  2WCK A;  3PM8 A;  1KQM C;  4HSZ A;  1B8C A;  2FOT A;  1U5I A;  4IL1 A;  4DRW A;  1AJ4 A;  2LHI A;  3IQO A;  2ERB A;  1XFU O;  3D0Y B;  1DJW A;  4ORC B;  4PHJ A;  5ER5 A;  2L51 A;  3S0G A;  1UHN A;  1C7W A;  3FE9 A;  2OTG C;  1ZMZ A;  1B4C A;  1CKK A;  3I5G B;  1A75 A;  4NDD A;  3GK2 A;  2K2F A;  3TZ1 A;  1REC A;  1FW4 A;  2WC8 A;  4ZCU A;  2WC5 A;  1QX5 B;  3CS1 A;  4AOM A;  4MLW A;  4PDZ A;  2I2R E;  1K9U A;  1WDC C;  2Q4U A;  4GAO A;  2LUX A;  1V1F A;  5HKZ A;  1QXP A;  1SSE B;  1YUR A;  4IJ7 A;  2KI6 C;  3VRO A;  1PUL A;  1SPY A;  4C0K A;  1KCY A;  1C3Y A;  1JSA A;  2KQY A;  1JF2 A;  1CDP A;  1FF1 A;  3NHT A;  1BR4 B;  1J7Q A;  4HRG A;  2LLT A;  4OKH A;  5AFP A;  1OW4 A;  3I5H B;  2H61 C;  1RK9 A;  4ORB B;  4PE1 A;  2NCP A;  3BQ3 A;  1TNW A;  4UPG A;  3FS7 A;  5BPJ A;  2M97 A;  4QJ4 B;  3O78 A;  1IH0 A;  3VRQ A;  1ORG A;  1QV1 A;  2BE6 A;  5HLV A;  3VRN A;  5KU1 A;  1H8B A;  1Y1U A;  3FE6 A;  4WQ3 A;  1B8R A;  3IF7 A;  3R1V A;  4KYN A;  3FWC A;  1TUZ A;  3Q8I A;  4OCI A;  2I18 A;  1C07 A;  2QEB A;  1TIZ A;  1LVC D;  1SL9 A;  2F2P A;  3CR5 X;  2KAX A;  1JFK A;  3EG5 B;  4PE7 A;  1B8L A;  1DEL A;  1KWO C;  3K1E A;  1LS8 A;  2K0J A;  1AP4 A;  1C3Z A;  3NGV A;  1BMO A;  2QEH A;  2KI4 B;  1BU3 A;  3OGN A;  4YI9 A;  1AJ5 A;  1DJY A;  1QAT A;  4CID A;  3KPX A;  1K9P A;  1K2H A;  1R6P A;  3BUX B;  1OOH A;  1NP8 A;  4BY5 A;  1IRJ A;  2YGU A;  1CFC A;  5CSI A;  1AUI B;  2JRF A;  2K8M B;  2A4J A;  5HKY A;  1QVI Y;  2QDI A;  4GGN A;  3EKH A;  1TNQ A;  2LE9 B;  3NSI A;  1WRK A;  5AAN A;  4R1E A;  2EC6 C;  1S1E A;  2Y5I A;  3S0F A;  2SAS A;  1EJ3 A;  2K7D A;  1CTR A;  2ZRT A;  1DJX A;  4I5K A;  3WHU B;  2JXL A;  2KGR A;  2PQL A;  2E30 A;  4U8D A;  2MBX A;  1XVJ A;  2NZ0 A;  1DF0 A;  1NYA A;  2PVB A;  1NIW A;  2PMY A;  2G9B A;  3SG6 A;  1IQ3 A;  1KK8 B;  1S3P A;  2HF5 A;  3BOW B;  2MAZ A;  1UUS A;  1QLK A;  3FIA A;  1M46 A;  3JTD C;  1NX0 A;  3SS4 A;  1SYM A;  2K7B A;  2CNP A;  2DOQ A;  2JTZ A;  2L2C A;  1IKU A;  5G08 A;  3NHI A;  2BCB A;  1PVA A;  1CMG A;  2CT9 A;  5DIC A;  4JKT A;  4MVF A;  2L4H A;  2ZN8 A;  2OPO A;  3O4X A;  1KQM B;  1BOC A;  4A4C A;  2P6B B;  4A4B A;  1RWY A;  2MLE C;  1UHJ A;  1SL7 A;  3LK0 A;  3OB1 B;  2MHH A;  2B1U A;  2TN4 A;  2LAN A;  3GK1 A;  1CFP A;  1F4O A;  2V53 A;  2KYF A;  1SMG A;  4YI8 A;  3HCM A;  4P2Y B;  5HYD A;  2OTG B;  1IJ5 A;  4HRH A;  4XYN A;  2WOR A;  5HL1 A;  2JTT A;  1DGV A;  1KFU L;  1BLQ A;  1ALW A;  1AVS A;  3CAB A;  2JQ6 A;  2WCF A;  2NXQ A;  4E68 A;  3CYZ A;  3BYA A;  2M1K B;  2JNF A;  4DCK A;  3D10 A;  1G8I A;  1S5G Y;  1MUX A;  3CZ0 A;  3SS3 A;  1WDC B;  3SIA A;  5GQQ C;  1OZO A;  2MJW B;  3TUY C;  1AK8 A;  1NX3 A;  2SCP A;  5I2O A;  2KDH A;  1CDL A;  1QAS A;  3SG2 A;  4AQI A;  2KLD A;  4PE4 A;  1WRL A;  1L2O C;  1YVH A;  3FWB A;  3TDZ A;  4N1F A;  1CB1 A;  2ZND A;  1N65 A;  1NSH A;  1KFU S;  1SKT A;  2JUL A;  1PVB A;  2F3Y A;  2KBI A;  2LMU A;  2MRD A;  3NSK A;  2Y1N A;  3DVK A;  4YGC B;  1K96 A;  3AKA A;  5JJG A;  2WOS A;  1OOJ A;  1UHI A;  4ICB A;  1U5I B;  1Y0V H;  1W7J B;  1B9A A;  2L0P A;  3D0Y A;  5CSN A;  1MWN A;  4NQG A;  1KSM A;  1UHH A;  3ZWH A;  3KO0 A;  1TCF A;  3A4U B;  3BXK A;  3PN7 B;  3R1O A;  5ER4 X;  2KFG A;  5CSJ A;  3TDU A;  4PE0 A;  4YRU A;  5I2L A;  1BJF A;  2WCJ A;  1F70 A;  2JPT A;  3LLE A;  3MSE B;  1P28 A;  2RGI A;  1QLS A;  3I5F C;  4OV2 A;  3PAT A;  3B6X A;  1GGW A;  1TN4 A;  4D1E A;  4C0L A;  1DMO A;  4XJK A;  4JWQ A;  3BUM B;  4MZL A;  1QIV A;  3CGA A;  1CLB A;  3CDN A;  3B7A A;  4CFQ A;  3OBV A;  1TRF A;  1XFY O;  4PHK A;  5DKN A;  3M0W A;  1GM0 A;  4GBA A;  4M2O A;  5FYX A;  3DD4 A;  2BL0 B;  1EXR A;  2FJY A;  2KBM A;  1LIN A;  1WLM A;  2KSP A;  1AHR A;  2L98 A;  1BR1 B;  1QVI Z;  1IJ6 A;  2ZNE A;  3L4L A;  2EGD A;  5J3X A;  1JF0 A;  3B87 A;  3NSO A;  3EK8 A;  1KFX L;  4F0Z B;  1W9Z A;  3L4A A;  1K8U A;  2M7N A;  3CTN A;  4MRX A;  4MBE A;  5HKW A;  2QPT A;  1Y1X A;  3O4Y A;  2H2K A;  2R2I A;  5F6T A;  3SG3 A;  1XK4 A;  2BCA A;  4PHN A;  3K21 A;  1MHO A;  1NCX A;  3OP0 A;  2AAO A;  1QIW A;  3DXL A;  2M49 B;  3PAL A;  3DZT A;  1NX1 A;  1QJT A;  1XFW O;  3JTD B;  3JVT B;  3OX5 A;  5PAL A;  2K7C A;  4NDC A;  1BOD A;  2M3W A;  4BY4 A;  3R72 A;  1K93 D;  1G33 A;  2K60 A;  2PAS A;  3D77 A;  1XFZ O;  1EG3 A;  2LHL A;  5D3O A;  3VRR A;  4OR9 B;  5AEQ A;  2ZFD A;  3KHE A;  1KFX S;  1OOF A;  1XFV O;  3BJH A;  1M63 B;  1X02 A;  1DJZ A;  2GGM A;  1J55 A;  1Z2C B;  2CXJ A;  1J7R A;  2FJU B;  3LCP C;  1OMR A;  5K89 A;  2KQ6 A;  1PSR A;  1QX2 A;  1JWD A;  1FBV A;  2KNE A;  1PAL A;  2OS8 B;  3SG7 A;  1CM1 A;  2K61 A;  2WCB A;  2WCH A;  3I5I B;  1V1G A;  2LV7 A;  1JC2 A;  1JFJ A;  2LCP A;  1SBJ A;  3PSR A;  3PJI A;  2QAC A;  3ZNI A;  1FI6 A;  2JC2 A;  2E6W A;  1UHK A;  2JWW A;  2O60 A;  4YGA A;  2LVJ A;  2GTE A;  1YVL A;  4YBH B;  1TTX A;  1BT6 A;  2JXC A;  2KPH A;  3DYE A;  1Q80 A;  3IQQ A;  4MRY A;  2K2A A;  4N5X A;  2HQ8 A;  3CZ2 A;  3DF0 A;  1SCV A;  5I94 A;  1S5G Z;  2LC5 A;  3FE8 A;  2LP2 A;  2IS9 A;  2JU0 A;  1TOP A;  2M1U A;  1L7Z A;  3TUY B;  1NCZ A;  4FQT A;  4I5L B;  1QS7 A;  1SK6 D;  3CZT X;  1XK4 C;  2KLE A;  3BUO B;  3TDI A;  2BKH B;  1CDN A;  5DKR A;  1F54 A;  1F55 A;  2KFH A;  1DVI A;  3LK1 A;  4AQJ A;  2Y1M A;  5KSZ A;  1UP5 A;  2VRG A;  3PLF B;  2BCX A;  1HT9 A;  4DIR A;  1YTZ C;  2FCD A;  1CFD A;  2COL B;  3KF9 A;  5FI6 A;  2WND A;  1OE9 B;  1DJI A;  1YRT B;  3KEV A;  2LUC A;  2KI4 C;  3SG4 A;  3AKB A;  1YUS A;  2FCE A;  2PYQ A;  4NDB A;  2BAP A;  2JNX A;  1KK7 Y;  1KSO A;  2BBM A;  2I94 A;  3D74 A;  4JPZ B;  2JT0 A;  4MZJ A;  1WRZ A;  3BFA A;  5D7F A;  1DJG A;  3OX6 A;  3S0A A;  5JOL A;  3CR4 X;  2BKI B;  2LP3 A;  5D69 A;  1ZUZ A;  2GV5 A;  2M8U A;  2L5X B;  1NX2 A;  1QV0 A;  3B88 A;  4QJ5 B;  2KGB C;  1OZS A;  3NXA A;  3I5F B;  3UNW A;  1SRA A;  4GPL B;  2M29 A;  3UO9 A;  1B47 A;  3EVV A;  1Y1A A;  5IBW A;  3CZ1 A;  4M2Q A;  1UUR A;  2KAV A;  5KTY A;  4GNK B;  1DGU A;  1YUU A;  1QX7 A;  3CWG A;  4F7F A;  3BFB A;  3L47 A;  4I5N B;  4L9M A;  3SJS A;  4CFR A;  1XA5 A;  5FI7 A;  1Z4H A;  1ODB A;  3H4S E;  2LAP A;  1M39 A;  5HLO A;  1OOI X;  1IGV A;  4FQO A;  2MA2 A;  4MN0 A;  3D73 A;  1YX8 A;  1B7T Y;  4TNC A;  4INW A;  1GGZ A;  3TS5 C;  1K95 A;  4YGE B;  1SCM C;  1QTX A;  2HET A;  3IVT A;  1OQP A;  4USL A;  1QWV A;  5FI2 A;  1FI5 A;  1F8H A;  3OB2 B;  4PCW A;  1SR6 C;  1XYD A;  3PM2 A;  3A8R A;  4ORA B;  3QRX A;  2KAY A;  1KWO B;  2HPS A;  1A75 B;  2BBN A;  5AXI A;  1N0Y A;  5TNC A;  1Y6W A;  2KFF A;  3EVU A;  1SL8 A;  1IIO A;  3SG5 A;  1OMD A;  3RZS A;  1A2X A;  1HQV A;  2LVK A;  1PRW A;  4GFT A;  5CSF A;  1RJV A;  4Q04 A;  1J1E A;  4PAL A;  1DT7 B;  3BFH A;  3RM1 A;  2M7L A;  3B86 A;  1YR5 A;  2WCM A;  2BE4 A;  1RRO A;  3BUN B;  4QJ3 B;  2JT3 A;  2CCM A;  1E8A A;  4XJK B;  1K90 D;  1NUB A;  2EC6 B;  1CFF A;  1F4Q A;  1YX7 A;  2F2O A;  2BEC A;  1CLM A;  3SS5 A;  1GJY A;  1NPQ A;  1H4B A;  1ZAC A;  2LMV A;  1LKJ A;  4P5O E;  5I8N A;  1DTL A;  3AAK A;  2LLU A;  3WXA A;  4YGD B;  1DJH A;  2P71 A;  3S0B A;  3DVE A;  1IG5 A;  1B1G A;  1D1O A;  1A4P A;  1RTP 1;  4YGB B;  5EL2 A;  1J7O A;  4MZK A;  2Q91 A;  1S6I A;  2ISD A;  1NCY A;  1JUO A;  1RFJ A;  1TNX A;  5DKQ A;  3OHM B;  3DY9 A;  4OZD A;  4PHM A;  3GK4 X;  3N7H A;  3I5G C;  1TCO B;  2P70 A;  2PSR A;  3DVM A;  3DVJ A;  1TNP A;  3CR2 A;  3PN7 C;  1S6J A;  2NLN A;  2BNX A;  4ETO A;  2JZI A;  1YUT A;  3S0E A;  1CMF A;  1G4Y R;  1R2U A;  4JD9 A;  1ZOT B;  1FPW A;  3O6B A;  2LM5 A;  1CM4 A;  2ZKM X;  1N2D A;  1S26 D;  2AUC A;  2M0R A;  1EG4 A;  2QEV A;  4I5J A;  1EH2 A;  2D8N A;  1W7I B;  3R1P A;  1S36 A;  2CBL A;  3VGO A;  5AER A;  5I2Q A;  1LXF C;  1SW8 A;  3I5H C;  2GGZ A;  2CTN A;  3VRP A;  2PAL A;  4ZCV A;  1MQ1 A;  1KK7 Z;  1XFR A;  1WLZ A;  1CNP A;  1IQ5 A;  3QME A;  1PSB A;  4HRE E;  2KOT A;  2BL0 C;  3F45 A;  4GGF A;  3HX4 A; 
#chains in the Genus database with same CATH homology
 2LNK A;  3NSL A;  1XFX O;  5CPV A;  4N1G A;  1CLL A;  1DF0 B;  3BOW A;  1WY9 A;  4JQ0 D;  4GUK A;  3GOF A;  2LVI A;  1JBA A;  1XO5 A;  1L2O B;  1S6C A;  3DF0 B;  1SY9 A;  3EVR A;  1IWQ A;  1CDM A;  1LA3 A;  1PK0 D;  1EL4 A;  4FTG A;  1MXL C;  2EHB A;  4MEW A;  1K94 A;  1C7V A;  4WRI A;  3CLN A;  1BF5 A;  1LA0 A;  2L4I A;  3AAJ A;  4OVN F;  4WQ2 A;  4CPV A;  1ALV A;  1A29 A;  1UWO A;  2I7A A;  2L2E A;  3JVT C;  1F71 A;  2KI6 D;  4CLN A;  1A03 A;  1MR8 A;  2KYC A;  3O2P A;  3WNX B;  3PFV A;  3E3R A;  3TS5 B;  1B7T Z;  2HQW A;  1MF8 B;  1SCM B;  2WCE A;  2F8P A;  2LLS A;  2JOJ A;  1GQM A;  2ZRS A;  1SR6 B;  2G2B A;  1K9K A;  3C1V A;  3SIB A;  2Y4Q A;  2K7O A;  1MXE A;  3WHT B;  1KQV A;  2OS8 C;  1OMV A;  2LVV A;  1M31 A;  2F33 A;  2M9G A;  2JT8 A;  3I5I C;  3EKJ A;  2O5G A;  2MLF C;  1J1D A;  1NWD A;  5B8I B;  2LMT A;  4GGF C;  4DS7 A;  1BG1 A;  1OSA A;  1VRK A;  4MSP A;  3EK4 A;  1J7P A;  1KK8 C;  3LL8 B;  1ZFS A;  4M2P A;  2ZN9 A;  3ICB A;  3EK7 A;  1M45 A;  1YRU B;  2H61 A;  2F3Z A;  3RLZ A;  2NCO A;  3BUW B;  2PRU A;  2AMI A;  4C0J A;  4DUQ A;  2KHN A;  2L50 A;  1SNL A;  3PM8 A;  4HSZ A;  1KQM C;  1B8C A;  2FOT A;  1U5I A;  4IL1 A;  4DRW A;  1AJ4 A;  2LHI A;  3IQO A;  1XFU O;  3D0Y B;  1DJW A;  4ORC B;  4PHJ A;  5ER5 A;  2L51 A;  1UHN A;  1C7W A;  2OTG C;  1ZMZ A;  1B4C A;  1CKK A;  3I5G B;  1A75 A;  4NDD A;  3GK2 A;  2K2F A;  3TZ1 A;  1REC A;  1FW4 A;  2WC8 A;  4ZCU A;  1QX5 B;  3CS1 A;  4AOM A;  4MLW A;  4PDZ A;  2I2R E;  1K9U A;  1WDC C;  2Q4U A;  4GAO A;  2LUX A;  1V1F A;  5HKZ A;  1QXP A;  1YUR A;  3VRO A;  4C0K A;  2KI6 C;  1KCY A;  1PUL A;  1SPY A;  1JSA A;  2KQY A;  1JF2 A;  1CDP A;  1FF1 A;  1BR4 B;  1J7Q A;  4HRG A;  2LLT A;  4OKH A;  5AFP A;  3I5H B;  2H61 C;  1RK9 A;  4ORB B;  4PE1 A;  2NCP A;  3BQ3 A;  1TNW A;  4UPG A;  3FS7 A;  5BPJ A;  2M97 A;  4QJ4 B;  3O78 A;  1IH0 A;  3VRQ A;  1QV1 A;  2BE6 A;  5HLV A;  3VRN A;  5KU1 A;  1H8B A;  1Y1U A;  4WQ3 A;  1B8R A;  3IF7 A;  3FWC A;  4OCI A;  2I18 A;  1C07 A;  1TIZ A;  1LVC D;  1SL9 A;  2F2P A;  3CR5 X;  2KAX A;  1JFK A;  4PE7 A;  1B8L A;  1KWO C;  2K0J A;  1AP4 A;  1BMO A;  2KI4 B;  1BU3 A;  4YI9 A;  4CID A;  1AJ5 A;  1DJY A;  1QAT A;  3KPX A;  1K9P A;  1K2H A;  1R6P A;  3BUX B;  1NP8 A;  4BY5 A;  1IRJ A;  1CFC A;  5CSI A;  1AUI B;  2JRF A;  2K8M B;  2A4J A;  5HKY A;  1QVI Y;  4GGN A;  3EKH A;  1TNQ A;  2LE9 B;  3NSI A;  1WRK A;  5AAN A;  4R1E A;  2EC6 C;  1S1E A;  2Y5I A;  2SAS A;  1EJ3 A;  2K7D A;  1CTR A;  2ZRT A;  1DJX A;  4I5K A;  3WHU B;  2JXL A;  2KGR A;  2E30 A;  4U8D A;  2MBX A;  1XVJ A;  2NZ0 A;  1DF0 A;  1NYA A;  2PVB A;  1NIW A;  2PMY A;  2G9B A;  3SG6 A;  1IQ3 A;  1KK8 B;  1S3P A;  2HF5 A;  3BOW B;  2MAZ A;  1UUS A;  1QLK A;  3FIA A;  1M46 A;  3JTD C;  1NX0 A;  1SYM A;  2K7B A;  2CNP A;  2DOQ A;  2JTZ A;  1IKU A;  5G08 A;  2BCB A;  1PVA A;  1CMG A;  2CT9 A;  4MVF A;  2L4H A;  2ZN8 A;  2OPO A;  1BOC A;  1KQM B;  4A4C A;  2P6B B;  4A4B A;  1RWY A;  2MLE C;  1UHJ A;  1SL7 A;  3LK0 A;  3OB1 B;  2MHH A;  2B1U A;  2TN4 A;  2LAN A;  3GK1 A;  1CFP A;  1F4O A;  2V53 A;  2KYF A;  1SMG A;  4YI8 A;  3HCM A;  4P2Y B;  5HYD A;  2OTG B;  1IJ5 A;  4HRH A;  4XYN A;  2WOR A;  2JTT A;  1DGV A;  1KFU L;  1BLQ A;  1ALW A;  1AVS A;  2JQ6 A;  2WCF A;  2NXQ A;  4E68 A;  3BYA A;  2M1K B;  2JNF A;  4DCK A;  3D10 A;  1G8I A;  1S5G Y;  1MUX A;  1WDC B;  3SIA A;  5GQQ C;  1OZO A;  2MJW B;  3TUY C;  1AK8 A;  1NX3 A;  2SCP A;  5I2O A;  2KDH A;  1CDL A;  1QAS A;  3SG2 A;  4AQI A;  4PE4 A;  1WRL A;  1L2O C;  1YVH A;  3FWB A;  3TDZ A;  4N1F A;  1CB1 A;  2ZND A;  1N65 A;  1NSH A;  1KFU S;  1SKT A;  2JUL A;  1PVB A;  2F3Y A;  2KBI A;  2LMU A;  2MRD A;  3NSK A;  2Y1N A;  3DVK A;  4YGC B;  1K96 A;  3AKA A;  5JJG A;  2WOS A;  1OOJ A;  1UHI A;  4ICB A;  1U5I B;  1Y0V H;  1W7J B;  1B9A A;  2L0P A;  3D0Y A;  5CSN A;  1MWN A;  4NQG A;  1KSM A;  1UHH A;  3ZWH A;  3KO0 A;  1TCF A;  3A4U B;  3BXK A;  3PN7 B;  5ER4 X;  2KFG A;  5CSJ A;  3TDU A;  4PE0 A;  4YRU A;  5I2L A;  1BJF A;  1F70 A;  2JPT A;  3LLE A;  3MSE B;  2RGI A;  1QLS A;  3I5F C;  4OV2 A;  3PAT A;  1GGW A;  1TN4 A;  4D1E A;  4C0L A;  1DMO A;  4XJK A;  4JWQ A;  3BUM B;  4MZL A;  1QIV A;  3CGA A;  1CLB A;  4CFQ A;  1TRF A;  1XFY O;  4PHK A;  5DKN A;  3M0W A;  4GBA A;  4M2O A;  5FYX A;  3DD4 A;  2BL0 B;  1EXR A;  2KBM A;  1LIN A;  1WLM A;  2KSP A;  1AHR A;  2L98 A;  1BR1 B;  1QVI Z;  1IJ6 A;  2ZNE A;  5J3X A;  2EGD A;  1JF0 A;  3NSO A;  3EK8 A;  1KFX L;  4F0Z B;  1K8U A;  2M7N A;  3CTN A;  4MRX A;  4MBE A;  5HKW A;  2QPT A;  1Y1X A;  3O4Y A;  2H2K A;  2R2I A;  5F6T A;  3SG3 A;  1XK4 A;  2BCA A;  4PHN A;  3K21 A;  1MHO A;  1NCX A;  3OP0 A;  2AAO A;  1QIW A;  2M49 B;  3PAL A;  1NX1 A;  1QJT A;  1XFW O;  3JTD B;  3JVT B;  3OX5 A;  5PAL A;  2K7C A;  4NDC A;  1BOD A;  2M3W A;  4BY4 A;  1K93 D;  1G33 A;  2PAS A;  1XFZ O;  1EG3 A;  2LHL A;  3VRR A;  4OR9 B;  5AEQ A;  2ZFD A;  3KHE A;  1KFX S;  1XFV O;  1M63 B;  1X02 A;  1DJZ A;  2GGM A;  1J55 A;  2CXJ A;  2FJU B;  1J7R A;  3LCP C;  5K89 A;  1OMR A;  2KQ6 A;  1PSR A;  1QX2 A;  1JWD A;  1FBV A;  2KNE A;  1PAL A;  2OS8 B;  3SG7 A;  1CM1 A;  2K61 A;  2WCB A;  3I5I B;  1V1G A;  2LV7 A;  1JC2 A;  1JFJ A;  2LCP A;  1SBJ A;  3PSR A;  3ZNI A;  2QAC A;  1FI6 A;  2JC2 A;  2E6W A;  1UHK A;  2JWW A;  2O60 A;  4YGA A;  2LVJ A;  4YBH B;  1YVL A;  1TTX A;  1BT6 A;  2JXC A;  3IQQ A;  4MRY A;  1Q80 A;  4N5X A;  2K2A A;  2HQ8 A;  3DF0 A;  1SCV A;  1S5G Z;  2LC5 A;  2LP2 A;  2IS9 A;  2JU0 A;  1TOP A;  2M1U A;  1L7Z A;  3TUY B;  1NCZ A;  4I5L B;  1QS7 A;  1SK6 D;  3CZT X;  1XK4 C;  3TDI A;  3BUO B;  1CDN A;  2BKH B;  5DKR A;  1F54 A;  1F55 A;  2KFH A;  1DVI A;  3LK1 A;  4AQJ A;  2Y1M A;  5KSZ A;  1UP5 A;  2VRG A;  3PLF B;  2BCX A;  1HT9 A;  4DIR A;  1YTZ C;  2FCD A;  1CFD A;  2COL B;  3KF9 A;  2WND A;  1OE9 B;  1DJI A;  1YRT B;  3KEV A;  2LUC A;  2KI4 C;  3SG4 A;  3AKB A;  1YUS A;  2FCE A;  4NDB A;  2JNX A;  1KK7 Y;  1KSO A;  2BBM A;  2I94 A;  4JPZ B;  2JT0 A;  4MZJ A;  1WRZ A;  5D7F A;  1DJG A;  3OX6 A;  5JOL A;  3CR4 X;  2BKI B;  2LP3 A;  5D69 A;  1ZUZ A;  2GV5 A;  2M8U A;  2L5X B;  1NX2 A;  1QV0 A;  4QJ5 B;  2KGB C;  1OZS A;  3NXA A;  3I5F B;  1SRA A;  4GPL B;  2M29 A;  5IBW A;  1B47 A;  3EVV A;  1Y1A A;  4M2Q A;  1UUR A;  2KAV A;  5KTY A;  4GNK B;  1DGU A;  1YUU A;  1QX7 A;  3CWG A;  4I5N B;  4L9M A;  3SJS A;  4CFR A;  1XA5 A;  1ODB A;  3H4S E;  2LAP A;  1M39 A;  5HLO A;  1IGV A;  4FQO A;  2MA2 A;  4MN0 A;  1YX8 A;  1B7T Y;  4TNC A;  3TS5 C;  1GGZ A;  1K95 A;  4YGE B;  1SCM C;  1QTX A;  2HET A;  4USL A;  1OQP A;  1FI5 A;  1F8H A;  3OB2 B;  4PCW A;  1SR6 C;  1XYD A;  3A8R A;  4ORA B;  3QRX A;  2KAY A;  1KWO B;  2HPS A;  1A75 B;  2BBN A;  5AXI A;  1N0Y A;  5TNC A;  1Y6W A;  2KFF A;  3EVU A;  1SL8 A;  3SG5 A;  1OMD A;  1A2X A;  1HQV A;  2LVK A;  1PRW A;  4GFT A;  5CSF A;  1RJV A;  4Q04 A;  1J1E A;  4PAL A;  1DT7 B;  3RM1 A;  2M7L A;  1YR5 A;  3BUN B;  2BE4 A;  1RRO A;  4QJ3 B;  2JT3 A;  2CCM A;  1E8A A;  4XJK B;  1K90 D;  1NUB A;  2EC6 B;  1CFF A;  1F4Q A;  1YX7 A;  2F2O A;  2BEC A;  1CLM A;  1GJY A;  1NPQ A;  1H4B A;  1ZAC A;  2LMV A;  1LKJ A;  4P5O E;  5I8N A;  1DTL A;  3AAK A;  2LLU A;  3WXA A;  4YGD B;  1DJH A;  3DVE A;  1IG5 A;  1B1G A;  1D1O A;  1A4P A;  1RTP 1;  4YGB B;  1J7O A;  4MZK A;  2Q91 A;  1S6I A;  2ISD A;  1NCY A;  1JUO A;  1RFJ A;  1TNX A;  5DKQ A;  3OHM B;  4PHM A;  3GK4 X;  3I5G C;  1TCO B;  2PSR A;  3DVM A;  3DVJ A;  1TNP A;  3CR2 A;  3PN7 C;  1S6J A;  2NLN A;  4ETO A;  2JZI A;  1YUT A;  1FPW A;  1CMF A;  1G4Y R;  1R2U A;  1ZOT B;  3O6B A;  2LM5 A;  1CM4 A;  2ZKM X;  1N2D A;  1S26 D;  2AUC A;  2M0R A;  1EG4 A;  4I5J A;  1EH2 A;  2D8N A;  1W7I B;  1S36 A;  2CBL A;  3VGO A;  5AER A;  5I2Q A;  1LXF C;  1SW8 A;  3I5H C;  2GGZ A;  2CTN A;  3VRP A;  2PAL A;  4ZCV A;  1MQ1 A;  1KK7 Z;  1WLZ A;  1CNP A;  1IQ5 A;  4HRE E;  1PSB A;  2KOT A;  2BL0 C;  3F45 A;  4GGF A;  3HX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...