4ZCUA

Structure of calcium-bound regulatory domain of the human atp-mg/pi carrier in the p2 form
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
153
structure length
152
Chain Sequence
TRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTTGDVNKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLQTLGLTISEQQAELILQSIDVDGTTVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Calcium-induced conformational changes in the regulatory domain of the human mitochondrial ATP-Mg/Pi carrier.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Calcium-binding mitochondrial carrier protein SCaMC-1
total genus 51
structure length 152
sequence length 153
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4zcuA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4zcuA02
3EVRA 5HLOA 4P5OE 1JBAA 1PSBA 3VGOA 1JF2A 1SBJA 2ZNDA 1A2XA 3AKBA 4CIDA 2KGRA 1N65A 2H61A 1B47A 3NSKA 4MRYA 2M1KB 1OMDA 2HQ8A 2JNXA 2AAOA 2I7AA 2Q4UA 1HT9A 3BXKA 3KHEA 1M63B 3AAKA 2KQ6A 3IF7A 1JF0A 3D10A 1IQ3A 1NX2A 2KFHA 1OMRA 1IGVA 5ER5A 1J7PA 3O2PA 3PM8A 1KCYA 4FTGA 2F33A 3BUMB 1NYAA 1DF0A 2BKHB 1JC2A 2LP3A 5TNCA 1KQMB 5I2QA 2JNFA 1CMFA 1RECA 3SIAA 1K9PA 1QS7A 4YGAA 2JTTA 2JPTA 2KAVA 2LUCA 2WC8A 3I5GB 3PN7B 1B7TZ 1F54A 2CXJA 3TUYB 3OB2B 1ALWA 4PHJA 3CGAA 3TDIA 1PULA 3I5IC 1BOCA 2LLUA 3OHMB 2L0PA 2LM5A 3CS1A 1FBVA 4DRWA 3OB1B 1Y1AA 4MBEA 3PLFB 1LA0A 2KGBC 1SL7A 4HSZA 4PHMA 1C07A 3LL8B 4AQIA 1A75B 2F3ZA 3CLNA 1CDNA 2MRDA 1VRKA 1QLSA 1AUIB 4ETOA 1KFXL 1QIWA 2JXCA 3SG6A 1L2OB 1F70A 2JRFA 3BQ3A 3HCMA 4MZLA 5PALA 2HQWA 1B1GA 3DVKA 1UHNA 5J3XA 1DJIA 1J55A 1XFVO 2M97A 4GGNA 1FF1A 1OE9B 5JOLA 1XFUO 1QIVA 2JTZA 2EC6B 3BUNB 1NSHA 2LV7A 1DMOA 2NCOA 4PHNA 1M46A 1HQVA 2MAZA 3CWGA 3GK1A 2LMVA 3QRXA 1J7RA 1KFUS 1KFXS 1YVLA 1A03A 3EK4A 3LCPC 1N2DA 1YUUA 5DKQA 3WXAA 1XFZO 1B8LA 1TTXA 1QATA 1PSRA 4N5XA 1L2OC 1ODBA 3NSLA 1KFUL 5B8IB 3PFVA 4CLNA 2M1UA 1KK8B 1QV1A 4XJKB 2BL0C 1LINA 1B8CA 1CKKA 1CB1A 2ZNEA 4HRHA 1SR6C 2LHLA 3FS7A 3DVJA 4OCIA 1PK0D 1R2UA 1SNLA 5HKZA 3SG7A 4QJ4B 4YGCB 1NX0A 1TNQA 1UHIA 3TDZA 3TUYC 2LANA 1CM1A 4A4BA 2K2FA 1JFJA 1NCZA 3O6BA 3JVTC 1RWYA 2F2OA 1CTRA 4PCWA 2NCPA 4P2YB 2NLNA 1FI6A 1KWOC 2LLTA 1DF0B 1CFCA 2OS8C 1LVCD 1RTP1 1XFWO 4NDDA 1EXRA 1S3PA 1S6JA 1CFDA 1JFKA 1K93D 2BL0B 5HKYA 4PE0A 3C1VA 1SR6B 3ZNIA 5FYXA 1BMOA 1SRAA 1NWDA 1EJ3A 2MLEC 2COLB 4DIRA 4USLA 1CLBA 3DF0A 4D1EA 2WORA 1RROA 1SW8A 1IJ6A 3OX5A 4ORCB 2PMYA 4ZCVA 1YVHA 2LNKA 2Y4QA 2VRGA 4C0LA 2EC6C 2ZN9A 1DJYA 4GFTA 3TDUA 3JVTB 2H61C 1TOPA 1YRTB 2Y1MA 4ORBB 1AJ5A 1OZOA 4I5KA 1S5GY 2GV5A 1KWOB 1IRJA 3A8RA 1KK7Z 3LK1A 2HETA 2LVJA 2MJWB 3GOFA 1CFPA 1DGUA 1QASA 1IH0A 2KQYA 2KYFA 1MWNA 2K7BA 1WLZA 2CTNA 3E3RA 1CFFA 3KPXA 3SG2A 1F4QA 4U8DA 1F55A 2P6BB 1A29A 1G4YR 1K96A 2EGDA 2I2RE 2SASA 1KK8C 2K7OA 3VRRA 1TRFA 1IG5A 1S1EA 1CLMA 1R6PA 1XFYO 2OPOA 2D8NA 1JSAA 3FIAA 4YRUA 1UHKA 4GNKB 2GGMA 5DKNA 3VRPA 1XK4A 1K2HA 1YX7A 4M2QA 1E8AA 4I5NB 4C0JA 2CT9A 4QJ5B 1Q80A 1S5GZ 1NX1A 2KNEA 1L7ZA 3DVEA 3WNXB 5JJGA 2CCMA 2ZFDA 2L5XB 1H8BA 2KI6C 2AMIA 3ICBA 1Y1XA 2PALA 1SMGA 1IQ5A 2LP2A 2K2AA 2M3WA 4DCKA 4UPGA 4MN0A 1EH2A 2BE6A 2OS8B 2F2PA 1CMGA 2KAXA 2A4JA 2JT0A 3SG3A 1SL8A 1ZFSA 3BUOB 1DT7B 1F71A 3JTDC 1U5IB 3DD4A 3ZWHA 2L98A 1LKJA 2JU0A 2KBIA 1EL4A 1WRZA 1PVBA 2PRUA 1XK4C 4WQ3A 4HREE 1C7WA 4E68A 1AJ4A 3BOWA 2G9BA 3EKJA 1WDCC 5KTYA 1S36A 1AHRA 1FW4A 3M0WA 1CNPA 1K9UA 2M8UA 2JZIA 1BF5A 1G33A 2FJUB 1KSOA 1QV0A 2JT3A 2KDHA 3K21A 5ER4X 1BR1B 1XA5A 1DJHA 2LVIA 5AFPA 5KU1A 3BYAA 3CR5X 4PE4A 5GQQC 4BY5A 3IQOA 1ALVA 1MXLC 1QXPA 5DKRA 1ZMZA 3JTDB 4NDCA 2MLFC 5BPJA 2WCEA 1KSMA 4YBHB 2JT8A 1TNWA 2JQ6A 5K89A 4YGBB 1UHHA 4DS7A 3DF0B 3CTNA 5CSIA 1WY9A 1TCOB 1RJVA 1WDCB 2H2KA 4OV2A 4BY4A 5I2LA 2OTGC 2BBMA 2LHIA 5CSFA 1ZACA 1UP5A 1B8RA 1YUSA 3I5HB 1WLMA 1BU3A 2K61A 1QVIZ 2BCXA 5AANA 3FWCA 1DJWA 1EG3A 2LCPA 4JWQA 1LXFC 1Y0VH 5CSJA 1SK6D 3AAJA 1GQMA 2WCFA 4PE7A 1K95A 1GGWA 4JPZB 2O60A 3SG5A 2NXQA 4TNCA 4I5LB 2BBNA 5F6TA 4XJKA 1RK9A 3EKHA 3LLEA 1DJZA 1MQ1A 2M0RA 2L4IA 2R2IA 1J1DA 2FCEA 1TCFA 1X02A 1S6CA 1QX7A 1D1OA 2WNDA 3F45A 1CDMA 3I5FB 1AP4A 3HX4A 3I5HC 1CDPA 3CR4X 3PATA 1SKTA 2Y5IA 2I94A 3BUXB 2LVKA 2JULA 4YGDB 3CR2A 1NX3A 3GK4X 2HF5A 1BG1A 1YRUB 2AUCA 2M7NA 2JC2A 1QTXA 2WCBA 3TZ1A 1OMVA 4MLWA 4NDBA 1J7QA 2ZRSA 1FPWA 1KQVA 4GAOA 4HRGA 4PDZA 1YR5A 2MA2A 3SIBA 1NCYA 3BUWB 1SPYA 2K8MB 3KEVA 2JWWA 1H4BA 2K7DA 1UURA 3O4YA 1G8IA 2EHBA 5D69A 4CFRA 2FOTA 1J7OA 1PRWA 1MHOA 2LVVA 4WQ2A 1TNXA 4WRIA 2RGIA 1A4PA 1BT6A 5AXIA 3I5FC 1M39A 2IS9A 1B4CA 1Y1UA 1V1GA 2PVBA 1V1FA 1DJXA 1CDLA 4YI8A 2QPTA 1NP8A 4ZCUA 2KOTA 1AVSA 3FWBA 2KI4C 3VROA 1BLQA 2BCBA 2OTGB 5HYDA 1QVIY 1ZOTB 3PSRA 1SYMA 2KI6D 1DGVA 2L50A 1ZUZA 1QX2A 2BE4A 5AERA 1PVAA 1YTZC 2LLSA 4N1GA 2KFFA 1F4OA 1JUOA 1CLLA 2HPSA 4PHKA 1K9KA 2Q91A 3H4SE 1YUTA 3WHUB 3D0YA 3PALA 4OR9B 1XVJA 3O78A 4AQJA 1W7IB 1K94A 2CBLA 4MSPA 2M7LA 1NUBA 4YGEB 3OP0A 1TIZA 1WRLA 2E30A 1IWQA 4GGFC 4F0ZB 3DVMA 2ZN8A 1BR4B 1S6IA 2SCPA 2PSRA 2Y1NA 3TS5C 4ORAB 2QACA 3KF9A 4R1EA 5HKWA 2TN4A 2BECA 2LE9B 3EVVA 4C0KA 2FCDA 2BKIB 3IQQA 1QJTA 4FQOA 1FI5A 1YURA 1SCMB 3EK7A 4N1FA 4MZKA 2DOQA 4DUQA 1UHJA 3NXAA 1CM4A 5HLVA 2L4HA 3KO0A 4NQGA 2G2BA 3D0YB 4XYNA 1UWOA 5G08A 1SCVA 3SG4A 3BOWB 2E6WA 1OSAA 3NSOA 1B7TY 2JXLA 4GGFA 5I8NA 3NSIA 1MR8A 1TN4A 2GGZA 1XFXO 2KI4B 2LAPA 3WHTB 2F3YA 5AEQA 4QJ3B 1BODA 1M31A 4JQ0D 1A75A 4PE1A 5CSNA 5I2OA 2M49B 1IJ5A 3EVUA 2KBMA 1OZSA 2K0JA 2ZRTA 1SL9A 1DTLA 2M9GA 2KAYA 1K90D 3MSEB 2KSPA 3A4UB 1C7VA 3AKAA 1Y6WA 1KQMC 3EK8A 1SCMC 3OX6A 4M2PA 2LUXA 1SY9A 4OVNF 1K8UA 2KFGA 2MHHA 4CPVA 2K7CA 2KHNA 4I5JA 3RM1A 4GBAA 1W7JB 2LMUA 4MEWA 1TNPA 2MBXA 1XO5A 2O5GA 4A4CA 1JWDA 2I18A 3CZTX 3I5GC 3PN7C 2ISDA 2V53A 1LA3A 1MF8B 1PALA 1RFJA 2ZKMX 1OQPA 4MRXA 3RLZA 3LK0A 3VRNA 1N0YA 1GGZA 3I5IB 3GK2A 1DVIA 1NPQA 4CFQA 4IL1A 1NIWA 2PASA 1S26D 2CNPA 1B9AA 1M45A 1GJYA 5CPVA 1KK7Y 1OOJA 4M2OA 2L51A 4AOMA 2LMTA 4MZJA 2L2EA 4L9MA 1UUSA 1BJFA 3SJSA 2JOJA 3VRQA 1QX5B 4GPLB 4GUKA 1XYDA 5D7FA 3TS5B 1QLKA 4MVFA 5KSZA 1J1EA 1MUXA 4ICBA 4Q04A 1U5IA 2F8PA 1YX8A 1AK8A 1IKUA 5IBWA 1DJGA 1MXEA 2BCAA 2M29A 4PALA 2NZ0A 4OKHA 2WOSA 2B1UA 4YI9A 1F8HA 1EG4A 2LC5A 2KYCA 1WRKA 1NCXA
chains in the Genus database with same CATH superfamily
3EVRA 5HLOA 4P5OE 1JBAA 1PSBA 3VGOA 1JF2A 1SBJA 2ZNDA 1A2XA 3AKBA 4CIDA 2KGRA 1N65A 4PT1A 2H61A 1B47A 3NSKA 4MRYA 2M1KB 1OMDA 2HQ8A 2JNXA 2AAOA 2I7AA 2Q4UA 4INWA 1HT9A 3BXKA 3KHEA 1M63B 3AAKA 1DC1A 2KQ6A 3IF7A 1JF0A 3D10A 3S0GA 3D77A 1IQ3A 1NX2A 2KFHA 1OMRA 1IGVA 5ER5A 3S0FA 1J7PA 3O2PA 3PM8A 1KCYA 4FTGA 2F33A 3BUMB 1NYAA 1DF0A 2BKHB 3RZSA 1JC2A 2LP3A 5TNCA 1KQMB 5I2QA 2JNFA 1C3YA 1CMFA 1RECA 3SIAA 1K9PA 1QS7A 4YGAA 3S0AA 2JTTA 2JPTA 2KAVA 2LUCA 2WC8A 3Q8IA 3I5GB 3PN7B 1B7TZ 4KYNA 1F54A 2CXJA 3TUYB 3OB2B 1ALWA 4PHJA 3CYZA 3CGAA 3TDIA 1PULA 2WCLA 3I5IC 1BOCA 2LLUA 1LS8A 3OHMB 2L0PA 2LM5A 3CS1A 1FBVA 4DRWA 3OB1B 1Y1AA 4MBEA 3S0EA 3D78A 3PLFB 1LA0A 2KGBC 1SL7A 4HSZA 4PHMA 1C07A 3LL8B 4AQIA 1A75B 2F3ZA 3CLNA 1CDNA 2MRDA 1VRKA 1QLSA 1AUIB 3CZ2A 4ETOA 1KFXL 1QIWA 2JXCA 2P71A 3SG6A 1L2OB 1F70A 2JRFA 3BQ3A 3HCMA 4MZLA 2WCKA 2KLEA 5PALA 1TUJA 2HQWA 1B1GA 3DVKA 1UHNA 5J3XA 1DJIA 1J55A 1XFVO 4FQTA 2M97A 4GGNA 1FF1A 1OE9B 5JOLA 1XFUO 1OOIX 2PQLA 3R72A 1QIVA 2JTZA 2EC6B 3B6XA 3BUNB 1JWDA 1NSHA 2LV7A 2L2CA 1DMOA 2NCOA 4PHNA 1M46A 1HQVA 2MAZA 3CWGA 3GK1A 2LMVA 3QRXA 1J7RA 1KFUS 1DQEA 1KFXS 1YVLA 1A03A 3EK4A 3LCPC 1N2DA 5I94A 3S0DA 1YUUA 5DKQA 3WXAA 1XFZO 1B8LA 1TTXA 1DELA 1PSRA 1QATA 1L2OC 1ODBA 3D75A 4N5XA 3NSLA 2BNXA 1KFUL 1TUZA 5B8IB 2PYQA 3PFVA 4CLNA 2M1UA 1KK8B 4OZDA 1QV1A 4XJKB 2BL0C 1LINA 1B8CA 1CKKA 1CB1A 2ZNEA 2WCHA 4HRHA 1SR6C 3SS4A 2LHLA 3FS7A 3DVJA 4OCIA 3CZ0A 1PK0D 1R2UA 1SNLA 3BFHA 1OOFA 5HKZA 3SG7A 4QJ4B 3B87A 4YGCB 1NX0A 1TNQA 1UHIA 3TDZA 3CABA 3TUYC 2LANA 1CM1A 4A4BA 2K2FA 1JFJA 1NCZA 3O6BA 3JVTC 2KPHA 1RWYA 2F2OA 1CTRA 4PCWA 2NCPA 3B86A 4P2YB 2NLNA 1FI6A 1KWOC 2LLTA 3CZ1A 1DF0B 1CFCA 2OS8C 1LVCD 1RTP1 1XFWO 4NDDA 1EXRA 1S3PA 1S6JA 1CFDA 1JFKA 1K93D 2BL0B 5HKYA 4PE0A 3C1VA 1SR6B 3ZNIA 5FYXA 1SSEB 1BMOA 1SRAA 1NWDA 1EJ3A 2MLEC 2COLB 2JPOA 4DIRA 3SS5A 1T14A 3FE8A 4USLA 3VB1A 1CLBA 3DF0A 4D1EA 2WORA 1RROA 1SW8A 1IJ6A 3OX5A 4ORCB 2PMYA 4ZCVA 1YVHA 2H8VA 2LNKA 2Y4QA 2VRGA 4C0LA 2EC6C 2ZN9A 1DJYA 4GFTA 3TDUA 3JVTB 2H61C 1TOPA 3B7AA 1YRTB 2Y1MA 4ORBB 1AJ5A 1OZOA 4I5KA 1S5GY 2GV5A 2L5YA 1KWOB 1IRJA 2KLDA 1KK7Z 3A8RA 3UO9A 3BJHA 3LK1A 2HETA 2LVJA 2MJWB 3GOFA 1CFPA 1DGUA 1QASA 1IH0A 2KQYA 2KYFA 1MWNA 2K7BA 1WLZA 2CTNA 2QEBA 3D76A 3E3RA 3SS3A 1CFFA 3KPXA 3SG2A 1F4QA 4U8DA 1F55A 2P6BB 1A29A 1G4YR 1K96A 1W9ZA 2EGDA 2I2RE 2SASA 1KK8C 2K7OA 1DEKA 2BAPA 3VRRA 1TRFA 1IG5A 4IJ7A 1S1EA 1CLMA 1R6PA 1XFYO 2FJYA 1IIOA 2OPOA 2D8NA 1JSAA 3FIAA 4YRUA 1UHKA 4GNKB 2GGMA 5DKNA 3VRPA 1XK4A 5FI6A 1K2HA 1YX7A 4M2QA 1E8AA 4I5NB 4C0JA 2CT9A 4QJ5B 3S0BA 1Q80A 1S5GZ 1NX1A 2KNEA 1L7ZA 3DVEA 3WNXB 5JJGA 2CCMA 2ZFDA 2L5XB 1H8BA 2KI6C 2AMIA 3ICBA 1Y1XA 2PALA 1SMGA 1IQ5A 2LP2A 2K2AA 2M3WA 4DCKA 4UPGA 4MN0A 1EH2A 2BE6A 2OS8B 2F2PA 1CMGA 2KAXA 2A4JA 2JT0A 3SG3A 1SL8A 1ZFSA 3BUOB 1DT7B 1F71A 3JTDC 1U5IB 3DD4A 2QEOA 3ZWHA 2L98A 1LKJA 3L4LA 2JU0A 2KBIA 1OW4A 1EL4A 1WRZA 1PVBA 2PRUA 1XK4C 4WQ3A 4HREE 1C7WA 3IVTA 1AJ4A 4E68A 3D74A 3BOWA 2G9BA 3EKJA 1WDCC 5KTYA 1S36A 1AHRA 1FW4A 3M0WA 1XFRA 1CNPA 1K9UA 2M8UA 2JZIA 1BF5A 1G33A 2FJUB 1C3ZA 1KSOA 1QV0A 2JT3A 2KDHA 3K21A 5ER4X 1BR1B 1XA5A 1DJHA 2LVIA 5AFPA 3NHTA 5KU1A 3BYAA 3CR5X 4PE4A 5GQQC 4BY5A 3IQOA 1ALVA 1MXLC 1QXPA 5DKRA 1ZMZA 3JTDB 4NDCA 2MLFC 5BPJA 2WCEA 1KSMA 4YBHB 2JT8A 1TNWA 2JQ6A 5K89A 4YGBB 1UHHA 4DS7A 3N7HA 5FI2A 3DF0B 3CTNA 5CSIA 1WY9A 1TCOB 1RJVA 1WDCB 2H2KA 4OV2A 4BY4A 2YGUA 5I2LA 2OTGC 2BBMA 2LHIA 5CSFA 1ZACA 1UP5A 1B8RA 1YUSA 3EG5B 3I5HB 3R1VA 1WLMA 1BU3A 3QMEA 2K61A 1QVIZ 2BCXA 5AANA 3FWCA 1DJWA 1EG3A 2LCPA 4JWQA 1LXFC 1Y0VH 5CSJA 1SK6D 3AAJA 1GQMA 2WCFA 4PE7A 1K95A 1GGWA 4JPZB 2O60A 3SG5A 2NXQA 4TNCA 4I5LB 2BBNA 3NGVA 5F6TA 2WC6A 4XJKA 1RK9A 3EKHA 3L47A 1DJZA 1MQ1A 3LLEA 2M0RA 2L4IA 2R2IA 1J1DA 2FCEA 1QWVA 1TCFA 1X02A 1S6CA 1QX7A 1D1OA 2WNDA 3F45A 1CDMA 3I5FB 1ORGA 1AP4A 3HX4A 3I5HC 1CDPA 3CR4X 3PATA 1SKTA 2Y5IA 2I94A 3BUXB 2LVKA 2JULA 4YGDB 3CR2A 1NX3A 5FI7A 3GK4X 2HF5A 1BG1A 1YRUB 2AUCA 2M7NA 2JC2A 1QTXA 3DY9A 2WCBA 3NHIA 1OMVA 4MLWA 4NDBA 3TZ1A 2ZRSA 1J7QA 1FPWA 1Z2CB 1KQVA 4GAOA 4HRGA 4PDZA 5EL2A 3D73A 1YR5A 2MA2A 3SIBA 1NCYA 3BUWB 1SPYA 2K8MB 3KEVA 2JWWA 1H4BA 2K7DA 1UURA 3O4YA 1G8IA 2EHBA 5D69A 4CFRA 2FOTA 3BFBA 1J7OA 1PRWA 1MHOA 2LVVA 4WQ2A 1TNXA 4WRIA 2RGIA 1A4PA 1BT6A 5AXIA 3I5FC 1M39A 2IS9A 1B4CA 1Y1UA 1V1GA 3R1PA 2PVBA 1V1FA 1DJXA 1CDLA 4YI8A 2QPTA 1NP8A 4ZCUA 2KOTA 1AVSA 3FWBA 2KI4C 3VROA 1BLQA 2BCBA 2OTGB 2P70A 3R1OA 5HYDA 1QVIY 1ZOTB 2K60A 3PSRA 5DICA 1SYMA 2GTEA 2KI6D 1DGVA 2L50A 1ZUZA 1QX2A 2BE4A 5AERA 1PVAA 1YTZC 2LLSA 4N1GA 2KFFA 1F4OA 1JUOA 1CLLA 2HPSA 4PHKA 1K9KA 2Q91A 3H4SE 1YUTA 3WHUB 3D0YA 3PALA 4OR9B 1XVJA 3O78A 4AQJA 1W7IB 1K94A 2CBLA 4MSPA 2M7LA 1NUBA 4YGEB 3DXLA 3OP0A 3PJIA 4INXA 1GM0A 3V2LA 3DZTA 1TIZA 1WRLA 2E30A 1IWQA 4GGFC 4F0ZB 3BFAA 3DVMA 2ZN8A 1BR4B 1OOGA 1S6IA 2ERBA 4JD9A 2SCPA 2PSRA 3OGNA 5HL1A 2Y1NA 3TS5C 4ORAB 2QACA 4F7FA 3K1EA 3KF9A 4R1EA 5HKWA 2TN4A 2BECA 2LE9B 3EVVA 4C0KA 3B88A 2FCDA 2BKIB 3IQQA 1QJTA 4FQOA 1FI5A 1YURA 1SCMB 3EK7A 3OBVA 4MZKA 4N1FA 2DOQA 4DUQA 1UHJA 3NXAA 1CM4A 5HLVA 2L4HA 3KO0A 4NQGA 2G2BA 3D0YB 4XYNA 1TWOA 1UWOA 3L4AA 5G08A 1SCVA 3SG4A 3BOWB 2E6WA 1OSAA 3NSOA 1B7TY 2JXLA 4GGFA 5I8NA 3NSIA 1MR8A 1XFXO 1TN4A 2GGZA 2KI4B 2LAPA 3PM2A 3WHTB 2F3YA 5AEQA 4QJ3B 3FE6A 1BODA 1M31A 3CDNA 4JQ0D 1A75A 4PE1A 5CSNA 5I2OA 2M49B 1IJ5A 3EVUA 2KBMA 1OZSA 2K0JA 2ZRTA 1SL9A 1DTLA 2M9GA 2KAYA 1K90D 3MSEB 2KSPA 3A4UB 3FE9A 3AKAA 1Y6WA 1KQMC 2WCJA 3EK8A 1C7VA 1SCMC 3OX6A 4M2PA 1P28A 2LUXA 1SY9A 4OVNF 2WCMA 1K8UA 2KFGA 2MHHA 4CPVA 2K7CA 2KHNA 4I5JA 3RM1A 4GBAA 1W7JB 2LMUA 4MEWA 1TNPA 2MBXA 1XO5A 2O5GA 2QDIA 4A4CA 1Z4HA 2I18A 2WC5A 3CZTX 3I5GC 3PN7C 2ISDA 2V53A 1LA3A 1MF8B 1PALA 1RFJA 2ZKMX 1OQPA 4MRXA 3RLZA 3LK0A 3VRNA 1N0YA 1GGZA 2QEVA 3I5IB 3GK2A 1DVIA 1NPQA 4CFQA 4IL1A 1NIWA 2PASA 5D3OA 3UNWA 1S26D 3O4XA 2CNPA 1B9AA 1M45A 1GJYA 5CPVA 1KK7Y 1OOJA 4M2OA 2L51A 4AOMA 2LMTA 4MZJA 1OOHA 2L2EA 4L9MA 1UUSA 1BJFA 3SJSA 2JOJA 3VRQA 3DYEA 1QX5B 4GPLB 4GUKA 1XYDA 5D7FA 2QEHA 3TS5B 1QLKA 4MVFA 5KSZA 1J1EA 1MUXA 4ICBA 4Q04A 1U5IA 2F8PA 1YX8A 1AK8A 1IKUA 5IBWA 1DJGA 1MXEA 2BCAA 2M29A 4PALA 2NZ0A 4OKHA 2WOSA 2B1UA 4JKTA 4YI9A 1EG4A 2LC5A 1F8HA 2KYCA 1WRKA 1NCXA
chains in the Genus database with same CATH topology
3EVRA 5HLOA 4P5OE 1JBAA 1PSBA 3VGOA 1JF2A 1SBJA 2ZNDA 1A2XA 3AKBA 4CIDA 2KGRA 1N65A 2H61A 1B47A 3NSKA 4MRYA 2M1KB 1OMDA 2HQ8A 2JNXA 2AAOA 2I7AA 2Q4UA 1HT9A 3BXKA 3KHEA 1M63B 3AAKA 2KQ6A 3IF7A 1JF0A 3D10A 1IQ3A 1NX2A 2KFHA 1OMRA 1IGVA 5ER5A 1J7PA 3O2PA 3PM8A 1KCYA 4FTGA 2F33A 3BUMB 1NYAA 1DF0A 2BKHB 1JC2A 2LP3A 5TNCA 1KQMB 5I2QA 2JNFA 1CMFA 1RECA 3SIAA 1K9PA 1QS7A 4YGAA 2JTTA 2JPTA 2KAVA 2LUCA 2WC8A 3I5GB 3PN7B 1B7TZ 1F54A 2CXJA 3TUYB 3OB2B 1ALWA 4PHJA 3CGAA 3TDIA 1PULA 3I5IC 1BOCA 2LLUA 3OHMB 2L0PA 2LM5A 3CS1A 1FBVA 4DRWA 3OB1B 1Y1AA 4MBEA 3PLFB 1LA0A 2KGBC 1SL7A 4HSZA 4PHMA 1C07A 3LL8B 4AQIA 1A75B 2F3ZA 3CLNA 1CDNA 2MRDA 1VRKA 1QLSA 1AUIB 4ETOA 1KFXL 1QIWA 2JXCA 3SG6A 1L2OB 1F70A 2JRFA 3BQ3A 3HCMA 4MZLA 5PALA 2HQWA 1B1GA 3DVKA 1UHNA 5J3XA 1DJIA 1J55A 1XFVO 2M97A 4GGNA 1FF1A 1OE9B 5JOLA 1XFUO 1QIVA 2JTZA 2EC6B 3BUNB 1NSHA 2LV7A 1DMOA 2NCOA 4PHNA 1M46A 1HQVA 2MAZA 3CWGA 3GK1A 2LMVA 3QRXA 1J7RA 1KFUS 1KFXS 1YVLA 1A03A 3EK4A 3LCPC 1N2DA 1YUUA 5DKQA 3WXAA 1XFZO 1B8LA 1TTXA 1QATA 1PSRA 4N5XA 1L2OC 1ODBA 3NSLA 1KFUL 5B8IB 3PFVA 4CLNA 2M1UA 1KK8B 1QV1A 4XJKB 2BL0C 1LINA 1B8CA 1CKKA 1CB1A 2ZNEA 4HRHA 1SR6C 2LHLA 3FS7A 3DVJA 4OCIA 1PK0D 1R2UA 1SNLA 5HKZA 3SG7A 4QJ4B 4YGCB 1NX0A 1TNQA 1UHIA 3TDZA 3TUYC 2LANA 1CM1A 4A4BA 2K2FA 1JFJA 1NCZA 3O6BA 3JVTC 1RWYA 2F2OA 1CTRA 4PCWA 2NCPA 4P2YB 2NLNA 1FI6A 1KWOC 2LLTA 1DF0B 1CFCA 2OS8C 1LVCD 1RTP1 1XFWO 4NDDA 1EXRA 1S3PA 1S6JA 1CFDA 1JFKA 1K93D 2BL0B 5HKYA 4PE0A 3C1VA 1SR6B 3ZNIA 5FYXA 1BMOA 1SRAA 1NWDA 1EJ3A 2MLEC 2COLB 4DIRA 4USLA 1CLBA 3DF0A 4D1EA 2WORA 1RROA 1SW8A 1IJ6A 3OX5A 4ORCB 2PMYA 4ZCVA 1YVHA 2LNKA 2Y4QA 2VRGA 4C0LA 2EC6C 2ZN9A 1DJYA 4GFTA 3TDUA 3JVTB 2H61C 1TOPA 1YRTB 2Y1MA 4ORBB 1AJ5A 1OZOA 4I5KA 1S5GY 2GV5A 1KWOB 1IRJA 3A8RA 1KK7Z 3LK1A 2HETA 2LVJA 2MJWB 3GOFA 1CFPA 1DGUA 1QASA 1IH0A 2KQYA 2KYFA 1MWNA 2K7BA 1WLZA 2CTNA 3E3RA 1CFFA 3KPXA 3SG2A 1F4QA 4U8DA 1F55A 2P6BB 1A29A 1G4YR 1K96A 2EGDA 2I2RE 2SASA 1KK8C 2K7OA 3VRRA 1TRFA 1IG5A 1S1EA 1CLMA 1R6PA 1XFYO 2OPOA 2D8NA 1JSAA 3FIAA 4YRUA 1UHKA 4GNKB 2GGMA 5DKNA 3VRPA 1XK4A 1K2HA 1YX7A 4M2QA 1E8AA 4I5NB 4C0JA 2CT9A 4QJ5B 1Q80A 1S5GZ 1NX1A 2KNEA 1L7ZA 3DVEA 3WNXB 5JJGA 2CCMA 2ZFDA 2L5XB 1H8BA 2KI6C 2AMIA 3ICBA 1Y1XA 2PALA 1SMGA 1IQ5A 2LP2A 2K2AA 2M3WA 4DCKA 4UPGA 4MN0A 1EH2A 2BE6A 2OS8B 2F2PA 1CMGA 2KAXA 2A4JA 2JT0A 3SG3A 1SL8A 1ZFSA 3BUOB 1DT7B 1F71A 3JTDC 1U5IB 3DD4A 3ZWHA 2L98A 1LKJA 2JU0A 2KBIA 1EL4A 1WRZA 1PVBA 2PRUA 1XK4C 4WQ3A 4HREE 1C7WA 4E68A 1AJ4A 3BOWA 2G9BA 3EKJA 1WDCC 5KTYA 1S36A 1AHRA 1FW4A 3M0WA 1CNPA 1K9UA 2M8UA 2JZIA 1BF5A 1G33A 2FJUB 1KSOA 1QV0A 2JT3A 2KDHA 3K21A 5ER4X 1BR1B 1XA5A 1DJHA 2LVIA 5AFPA 5KU1A 3BYAA 3CR5X 4PE4A 5GQQC 4BY5A 3IQOA 1ALVA 1MXLC 1QXPA 5DKRA 1ZMZA 3JTDB 4NDCA 2MLFC 5BPJA 2WCEA 1KSMA 4YBHB 2JT8A 1TNWA 2JQ6A 5K89A 4YGBB 1UHHA 4DS7A 3DF0B 3CTNA 5CSIA 1WY9A 1TCOB 1RJVA 1WDCB 2H2KA 4OV2A 4BY4A 5I2LA 2OTGC 2BBMA 2LHIA 5CSFA 1ZACA 1UP5A 1B8RA 1YUSA 3I5HB 1WLMA 1BU3A 2K61A 1QVIZ 2BCXA 5AANA 3FWCA 1DJWA 1EG3A 2LCPA 4JWQA 1LXFC 1Y0VH 5CSJA 1SK6D 3AAJA 1GQMA 2WCFA 4PE7A 1K95A 1GGWA 4JPZB 2O60A 3SG5A 2NXQA 4TNCA 4I5LB 2BBNA 5F6TA 4XJKA 1RK9A 3EKHA 3LLEA 1DJZA 1MQ1A 2M0RA 2L4IA 2R2IA 1J1DA 2FCEA 1TCFA 1X02A 1S6CA 1QX7A 1D1OA 2WNDA 3F45A 1CDMA 3I5FB 1AP4A 3HX4A 3I5HC 1CDPA 3CR4X 3PATA 1SKTA 2Y5IA 2I94A 3BUXB 2LVKA 2JULA 4YGDB 3CR2A 1NX3A 3GK4X 2HF5A 1BG1A 1YRUB 2AUCA 2M7NA 2JC2A 1QTXA 2WCBA 3TZ1A 1OMVA 4MLWA 4NDBA 1J7QA 2ZRSA 1FPWA 1KQVA 4GAOA 4HRGA 4PDZA 1YR5A 2MA2A 3SIBA 1NCYA 3BUWB 1SPYA 2K8MB 3KEVA 2JWWA 1H4BA 2K7DA 1UURA 3O4YA 1G8IA 2EHBA 5D69A 4CFRA 2FOTA 1J7OA 1PRWA 1MHOA 2LVVA 4WQ2A 1TNXA 4WRIA 2RGIA 1A4PA 1BT6A 5AXIA 3I5FC 1M39A 2IS9A 1B4CA 1Y1UA 1V1GA 2PVBA 1V1FA 1DJXA 1CDLA 4YI8A 2QPTA 1NP8A 4ZCUA 2KOTA 1AVSA 3FWBA 2KI4C 3VROA 1BLQA 2BCBA 2OTGB 5HYDA 1QVIY 1ZOTB 3PSRA 1SYMA 2KI6D 1DGVA 2L50A 1ZUZA 1QX2A 2BE4A 5AERA 1PVAA 1YTZC 2LLSA 4N1GA 2KFFA 1F4OA 1JUOA 1CLLA 2HPSA 4PHKA 1K9KA 2Q91A 3H4SE 1YUTA 3WHUB 3D0YA 3PALA 4OR9B 1XVJA 3O78A 4AQJA 1W7IB 1K94A 2CBLA 4MSPA 2M7LA 1NUBA 4YGEB 3OP0A 1TIZA 1WRLA 2E30A 1IWQA 4GGFC 4F0ZB 3DVMA 2ZN8A 1BR4B 1S6IA 2SCPA 2PSRA 2Y1NA 3TS5C 4ORAB 2QACA 3KF9A 4R1EA 5HKWA 2TN4A 2BECA 2LE9B 3EVVA 4C0KA 2FCDA 2BKIB 3IQQA 1QJTA 4FQOA 1FI5A 1YURA 1SCMB 3EK7A 4N1FA 4MZKA 2DOQA 4DUQA 1UHJA 3NXAA 1CM4A 5HLVA 2L4HA 3KO0A 4NQGA 2G2BA 3D0YB 4XYNA 1UWOA 5G08A 1SCVA 3SG4A 3BOWB 2E6WA 1OSAA 3NSOA 1B7TY 2JXLA 4GGFA 5I8NA 3NSIA 1MR8A 1TN4A 2GGZA 1XFXO 2KI4B 2LAPA 3WHTB 2F3YA 5AEQA 4QJ3B 1BODA 1M31A 4JQ0D 1A75A 4PE1A 5CSNA 5I2OA 2M49B 1IJ5A 3EVUA 2KBMA 1OZSA 2K0JA 2ZRTA 1SL9A 1DTLA 2M9GA 2KAYA 1K90D 3MSEB 2KSPA 3A4UB 1C7VA 3AKAA 1Y6WA 1KQMC 3EK8A 1SCMC 3OX6A 4M2PA 2LUXA 1SY9A 4OVNF 1K8UA 2KFGA 2MHHA 4CPVA 2K7CA 2KHNA 4I5JA 3RM1A 4GBAA 1W7JB 2LMUA 4MEWA 1TNPA 2MBXA 1XO5A 2O5GA 4A4CA 1JWDA 2I18A 3CZTX 3I5GC 3PN7C 2ISDA 2V53A 1LA3A 1MF8B 1PALA 1RFJA 2ZKMX 1OQPA 4MRXA 3RLZA 3LK0A 3VRNA 1N0YA 1GGZA 3I5IB 3GK2A 1DVIA 1NPQA 4CFQA 4IL1A 1NIWA 2PASA 1S26D 2CNPA 1B9AA 1M45A 1GJYA 5CPVA 1KK7Y 1OOJA 4M2OA 2L51A 4AOMA 2LMTA 4MZJA 2L2EA 4L9MA 1UUSA 1BJFA 3SJSA 2JOJA 3VRQA 1QX5B 4GPLB 4GUKA 1XYDA 5D7FA 3TS5B 1QLKA 4MVFA 5KSZA 1J1EA 1MUXA 4ICBA 4Q04A 1U5IA 2F8PA 1YX8A 1AK8A 1IKUA 5IBWA 1DJGA 1MXEA 2BCAA 2M29A 4PALA 2NZ0A 4OKHA 2WOSA 2B1UA 4YI9A 1F8HA 1EG4A 2LC5A 2KYCA 1WRKA 1NCXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EVR A;  5HLO A;  4P5O E;  1JBA A;  1PSB A;  3VGO A;  1JF2 A;  1SBJ A;  2ZND A;  1A2X A;  3AKB A;  4CID A;  2KGR A;  1N65 A;  2H61 A;  1B47 A;  3NSK A;  4MRY A;  2M1K B;  1OMD A;  2HQ8 A;  2JNX A;  2AAO A;  2I7A A;  2Q4U A;  1HT9 A;  3BXK A;  3KHE A;  1M63 B;  3AAK A;  2KQ6 A;  3IF7 A;  1JF0 A;  3D10 A;  1IQ3 A;  1NX2 A;  2KFH A;  1OMR A;  1IGV A;  5ER5 A;  1J7P A;  3O2P A;  3PM8 A;  1KCY A;  4FTG A;  2F33 A;  3BUM B;  1NYA A;  1DF0 A;  2BKH B;  1JC2 A;  2LP3 A;  5TNC A;  1KQM B;  5I2Q A;  2JNF A;  1CMF A;  1REC A;  3SIA A;  1K9P A;  1QS7 A;  4YGA A;  2JTT A;  2JPT A;  2KAV A;  2LUC A;  2WC8 A;  3I5G B;  3PN7 B;  1B7T Z;  1F54 A;  2CXJ A;  3TUY B;  3OB2 B;  1ALW A;  4PHJ A;  3CGA A;  3TDI A;  1PUL A;  3I5I C;  1BOC A;  2LLU A;  3OHM B;  2L0P A;  2LM5 A;  3CS1 A;  1FBV A;  4DRW A;  3OB1 B;  1Y1A A;  4MBE A;  3PLF B;  1LA0 A;  2KGB C;  1SL7 A;  4HSZ A;  4PHM A;  1C07 A;  3LL8 B;  4AQI A;  1A75 B;  2F3Z A;  3CLN A;  1CDN A;  2MRD A;  1VRK A;  1QLS A;  1AUI B;  4ETO A;  1KFX L;  1QIW A;  2JXC A;  3SG6 A;  1L2O B;  1F70 A;  2JRF A;  3BQ3 A;  3HCM A;  4MZL A;  5PAL A;  2HQW A;  1B1G A;  3DVK A;  1UHN A;  5J3X A;  1DJI A;  1J55 A;  1XFV O;  2M97 A;  4GGN A;  1FF1 A;  1OE9 B;  5JOL A;  1XFU O;  1QIV A;  2JTZ A;  2EC6 B;  3BUN B;  1NSH A;  2LV7 A;  1DMO A;  2NCO A;  4PHN A;  1M46 A;  1HQV A;  2MAZ A;  3CWG A;  3GK1 A;  2LMV A;  3QRX A;  1J7R A;  1KFU S;  1KFX S;  1YVL A;  1A03 A;  3EK4 A;  3LCP C;  1N2D A;  1YUU A;  5DKQ A;  3WXA A;  1XFZ O;  1B8L A;  1TTX A;  1QAT A;  1PSR A;  4N5X A;  1L2O C;  1ODB A;  3NSL A;  1KFU L;  5B8I B;  3PFV A;  4CLN A;  2M1U A;  1KK8 B;  1QV1 A;  4XJK B;  2BL0 C;  1LIN A;  1B8C A;  1CKK A;  1CB1 A;  2ZNE A;  4HRH A;  1SR6 C;  2LHL A;  3FS7 A;  3DVJ A;  4OCI A;  1PK0 D;  1R2U A;  1SNL A;  5HKZ A;  3SG7 A;  4QJ4 B;  4YGC B;  1NX0 A;  1TNQ A;  1UHI A;  3TDZ A;  3TUY C;  2LAN A;  1CM1 A;  4A4B A;  2K2F A;  1JFJ A;  1NCZ A;  3O6B A;  3JVT C;  1RWY A;  2F2O A;  1CTR A;  4PCW A;  2NCP A;  4P2Y B;  2NLN A;  1FI6 A;  1KWO C;  2LLT A;  1DF0 B;  1CFC A;  2OS8 C;  1LVC D;  1RTP 1;  1XFW O;  4NDD A;  1EXR A;  1S3P A;  1S6J A;  1CFD A;  1JFK A;  1K93 D;  2BL0 B;  5HKY A;  4PE0 A;  3C1V A;  1SR6 B;  3ZNI A;  5FYX A;  1BMO A;  1SRA A;  1NWD A;  1EJ3 A;  2MLE C;  2COL B;  4DIR A;  4USL A;  1CLB A;  3DF0 A;  4D1E A;  2WOR A;  1RRO A;  1SW8 A;  1IJ6 A;  3OX5 A;  4ORC B;  2PMY A;  4ZCV A;  1YVH A;  2LNK A;  2Y4Q A;  2VRG A;  4C0L A;  2EC6 C;  2ZN9 A;  1DJY A;  4GFT A;  3TDU A;  3JVT B;  2H61 C;  1TOP A;  1YRT B;  2Y1M A;  4ORB B;  1AJ5 A;  1OZO A;  4I5K A;  1S5G Y;  2GV5 A;  1KWO B;  1IRJ A;  3A8R A;  1KK7 Z;  3LK1 A;  2HET A;  2LVJ A;  2MJW B;  3GOF A;  1CFP A;  1DGU A;  1QAS A;  1IH0 A;  2KQY A;  2KYF A;  1MWN A;  2K7B A;  1WLZ A;  2CTN A;  3E3R A;  1CFF A;  3KPX A;  3SG2 A;  1F4Q A;  4U8D A;  1F55 A;  2P6B B;  1A29 A;  1G4Y R;  1K96 A;  2EGD A;  2I2R E;  2SAS A;  1KK8 C;  2K7O A;  3VRR A;  1TRF A;  1IG5 A;  1S1E A;  1CLM A;  1R6P A;  1XFY O;  2OPO A;  2D8N A;  1JSA A;  3FIA A;  4YRU A;  1UHK A;  4GNK B;  2GGM A;  5DKN A;  3VRP A;  1XK4 A;  1K2H A;  1YX7 A;  4M2Q A;  1E8A A;  4I5N B;  4C0J A;  2CT9 A;  4QJ5 B;  1Q80 A;  1S5G Z;  1NX1 A;  2KNE A;  1L7Z A;  3DVE A;  3WNX B;  5JJG A;  2CCM A;  2ZFD A;  2L5X B;  1H8B A;  2KI6 C;  2AMI A;  3ICB A;  1Y1X A;  2PAL A;  1SMG A;  1IQ5 A;  2LP2 A;  2K2A A;  2M3W A;  4DCK A;  4UPG A;  4MN0 A;  1EH2 A;  2BE6 A;  2OS8 B;  2F2P A;  1CMG A;  2KAX A;  2A4J A;  2JT0 A;  3SG3 A;  1SL8 A;  1ZFS A;  3BUO B;  1DT7 B;  1F71 A;  3JTD C;  1U5I B;  3DD4 A;  3ZWH A;  2L98 A;  1LKJ A;  2JU0 A;  2KBI A;  1EL4 A;  1WRZ A;  1PVB A;  2PRU A;  1XK4 C;  4WQ3 A;  4HRE E;  1C7W A;  4E68 A;  1AJ4 A;  3BOW A;  2G9B A;  3EKJ A;  1WDC C;  5KTY A;  1S36 A;  1AHR A;  1FW4 A;  3M0W A;  1CNP A;  1K9U A;  2M8U A;  2JZI A;  1BF5 A;  1G33 A;  2FJU B;  1KSO A;  1QV0 A;  2JT3 A;  2KDH A;  3K21 A;  5ER4 X;  1BR1 B;  1XA5 A;  1DJH A;  2LVI A;  5AFP A;  5KU1 A;  3BYA A;  3CR5 X;  4PE4 A;  5GQQ C;  4BY5 A;  3IQO A;  1ALV A;  1MXL C;  1QXP A;  5DKR A;  1ZMZ A;  3JTD B;  4NDC A;  2MLF C;  5BPJ A;  2WCE A;  1KSM A;  4YBH B;  2JT8 A;  1TNW A;  2JQ6 A;  5K89 A;  4YGB B;  1UHH A;  4DS7 A;  3DF0 B;  3CTN A;  5CSI A;  1WY9 A;  1TCO B;  1RJV A;  1WDC B;  2H2K A;  4OV2 A;  4BY4 A;  5I2L A;  2OTG C;  2BBM A;  2LHI A;  5CSF A;  1ZAC A;  1UP5 A;  1B8R A;  1YUS A;  3I5H B;  1WLM A;  1BU3 A;  2K61 A;  1QVI Z;  2BCX A;  5AAN A;  3FWC A;  1DJW A;  1EG3 A;  2LCP A;  4JWQ A;  1LXF C;  1Y0V H;  5CSJ A;  1SK6 D;  3AAJ A;  1GQM A;  2WCF A;  4PE7 A;  1K95 A;  1GGW A;  4JPZ B;  2O60 A;  3SG5 A;  2NXQ A;  4TNC A;  4I5L B;  2BBN A;  5F6T A;  4XJK A;  1RK9 A;  3EKH A;  3LLE A;  1DJZ A;  1MQ1 A;  2M0R A;  2L4I A;  2R2I A;  1J1D A;  2FCE A;  1TCF A;  1X02 A;  1S6C A;  1QX7 A;  1D1O A;  2WND A;  3F45 A;  1CDM A;  3I5F B;  1AP4 A;  3HX4 A;  3I5H C;  1CDP A;  3CR4 X;  3PAT A;  1SKT A;  2Y5I A;  2I94 A;  3BUX B;  2LVK A;  2JUL A;  4YGD B;  3CR2 A;  1NX3 A;  3GK4 X;  2HF5 A;  1BG1 A;  1YRU B;  2AUC A;  2M7N A;  2JC2 A;  1QTX A;  2WCB A;  3TZ1 A;  1OMV A;  4MLW A;  4NDB A;  1J7Q A;  2ZRS A;  1FPW A;  1KQV A;  4GAO A;  4HRG A;  4PDZ A;  1YR5 A;  2MA2 A;  3SIB A;  1NCY A;  3BUW B;  1SPY A;  2K8M B;  3KEV A;  2JWW A;  1H4B A;  2K7D A;  1UUR A;  3O4Y A;  1G8I A;  2EHB A;  5D69 A;  4CFR A;  2FOT A;  1J7O A;  1PRW A;  1MHO A;  2LVV A;  4WQ2 A;  1TNX A;  4WRI A;  2RGI A;  1A4P A;  1BT6 A;  5AXI A;  3I5F C;  1M39 A;  2IS9 A;  1B4C A;  1Y1U A;  1V1G A;  2PVB A;  1V1F A;  1DJX A;  1CDL A;  4YI8 A;  2QPT A;  1NP8 A;  4ZCU A;  2KOT A;  1AVS A;  3FWB A;  2KI4 C;  3VRO A;  1BLQ A;  2BCB A;  2OTG B;  5HYD A;  1QVI Y;  1ZOT B;  3PSR A;  1SYM A;  2KI6 D;  1DGV A;  2L50 A;  1ZUZ A;  1QX2 A;  2BE4 A;  5AER A;  1PVA A;  1YTZ C;  2LLS A;  4N1G A;  2KFF A;  1F4O A;  1JUO A;  1CLL A;  2HPS A;  4PHK A;  1K9K A;  2Q91 A;  3H4S E;  1YUT A;  3WHU B;  3D0Y A;  3PAL A;  4OR9 B;  1XVJ A;  3O78 A;  4AQJ A;  1W7I B;  1K94 A;  2CBL A;  4MSP A;  2M7L A;  1NUB A;  4YGE B;  3OP0 A;  1TIZ A;  1WRL A;  2E30 A;  1IWQ A;  4GGF C;  4F0Z B;  3DVM A;  2ZN8 A;  1BR4 B;  1S6I A;  2SCP A;  2PSR A;  2Y1N A;  3TS5 C;  4ORA B;  2QAC A;  3KF9 A;  4R1E A;  5HKW A;  2TN4 A;  2BEC A;  2LE9 B;  3EVV A;  4C0K A;  2FCD A;  2BKI B;  3IQQ A;  1QJT A;  4FQO A;  1FI5 A;  1YUR A;  1SCM B;  3EK7 A;  4N1F A;  4MZK A;  2DOQ A;  4DUQ A;  1UHJ A;  3NXA A;  1CM4 A;  5HLV A;  2L4H A;  3KO0 A;  4NQG A;  2G2B A;  3D0Y B;  4XYN A;  1UWO A;  5G08 A;  1SCV A;  3SG4 A;  3BOW B;  2E6W A;  1OSA A;  3NSO A;  1B7T Y;  2JXL A;  4GGF A;  5I8N A;  3NSI A;  1MR8 A;  1TN4 A;  2GGZ A;  1XFX O;  2KI4 B;  2LAP A;  3WHT B;  2F3Y A;  5AEQ A;  4QJ3 B;  1BOD A;  1M31 A;  4JQ0 D;  1A75 A;  4PE1 A;  5CSN A;  5I2O A;  2M49 B;  1IJ5 A;  3EVU A;  2KBM A;  1OZS A;  2K0J A;  2ZRT A;  1SL9 A;  1DTL A;  2M9G A;  2KAY A;  1K90 D;  3MSE B;  2KSP A;  3A4U B;  1C7V A;  3AKA A;  1Y6W A;  1KQM C;  3EK8 A;  1SCM C;  3OX6 A;  4M2P A;  2LUX A;  1SY9 A;  4OVN F;  1K8U A;  2KFG A;  2MHH A;  4CPV A;  2K7C A;  2KHN A;  4I5J A;  3RM1 A;  4GBA A;  1W7J B;  2LMU A;  4MEW A;  1TNP A;  2MBX A;  1XO5 A;  2O5G A;  4A4C A;  1JWD A;  2I18 A;  3CZT X;  3I5G C;  3PN7 C;  2ISD A;  2V53 A;  1LA3 A;  1MF8 B;  1PAL A;  1RFJ A;  2ZKM X;  1OQP A;  4MRX A;  3RLZ A;  3LK0 A;  3VRN A;  1N0Y A;  1GGZ A;  3I5I B;  3GK2 A;  1DVI A;  1NPQ A;  4CFQ A;  4IL1 A;  1NIW A;  2PAS A;  1S26 D;  2CNP A;  1B9A A;  1M45 A;  1GJY A;  5CPV A;  1KK7 Y;  1OOJ A;  4M2O A;  2L51 A;  4AOM A;  2LMT A;  4MZJ A;  2L2E A;  4L9M A;  1UUS A;  1BJF A;  3SJS A;  2JOJ A;  3VRQ A;  1QX5 B;  4GPL B;  4GUK A;  1XYD A;  5D7F A;  3TS5 B;  1QLK A;  4MVF A;  5KSZ A;  1J1E A;  1MUX A;  4ICB A;  4Q04 A;  1U5I A;  2F8P A;  1YX8 A;  1AK8 A;  1IKU A;  5IBW A;  1DJG A;  1MXE A;  2BCA A;  2M29 A;  4PAL A;  2NZ0 A;  4OKH A;  2WOS A;  2B1U A;  4YI9 A;  1F8H A;  1EG4 A;  2LC5 A;  2KYC A;  1WRK A;  1NCX A; 
#chains in the Genus database with same CATH topology
 3EVR A;  5HLO A;  4P5O E;  1JBA A;  1PSB A;  3VGO A;  1JF2 A;  1SBJ A;  2ZND A;  1A2X A;  3AKB A;  4CID A;  2KGR A;  1N65 A;  4PT1 A;  2H61 A;  1B47 A;  3NSK A;  4MRY A;  2M1K B;  1OMD A;  2HQ8 A;  2JNX A;  2AAO A;  2I7A A;  2Q4U A;  4INW A;  1HT9 A;  3BXK A;  3KHE A;  1M63 B;  3AAK A;  1DC1 A;  2KQ6 A;  3IF7 A;  1JF0 A;  3D10 A;  3S0G A;  3D77 A;  1IQ3 A;  1NX2 A;  2KFH A;  1OMR A;  1IGV A;  5ER5 A;  3S0F A;  1J7P A;  3O2P A;  3PM8 A;  1KCY A;  4FTG A;  2F33 A;  3BUM B;  1NYA A;  1DF0 A;  2BKH B;  3RZS A;  1JC2 A;  2LP3 A;  5TNC A;  1KQM B;  5I2Q A;  2JNF A;  1C3Y A;  1CMF A;  1REC A;  3SIA A;  1K9P A;  1QS7 A;  4YGA A;  3S0A A;  2JTT A;  2JPT A;  2KAV A;  2LUC A;  2WC8 A;  3Q8I A;  3I5G B;  3PN7 B;  1B7T Z;  4KYN A;  1F54 A;  2CXJ A;  3TUY B;  3OB2 B;  1ALW A;  4PHJ A;  3CYZ A;  3CGA A;  3TDI A;  1PUL A;  2WCL A;  3I5I C;  1BOC A;  2LLU A;  1LS8 A;  3OHM B;  2L0P A;  2LM5 A;  3CS1 A;  1FBV A;  4DRW A;  3OB1 B;  1Y1A A;  4MBE A;  3S0E A;  3D78 A;  3PLF B;  1LA0 A;  2KGB C;  1SL7 A;  4HSZ A;  4PHM A;  1C07 A;  3LL8 B;  4AQI A;  1A75 B;  2F3Z A;  3CLN A;  1CDN A;  2MRD A;  1VRK A;  1QLS A;  1AUI B;  3CZ2 A;  4ETO A;  1KFX L;  1QIW A;  2JXC A;  2P71 A;  3SG6 A;  1L2O B;  1F70 A;  2JRF A;  3BQ3 A;  3HCM A;  4MZL A;  2WCK A;  2KLE A;  5PAL A;  1TUJ A;  2HQW A;  1B1G A;  3DVK A;  1UHN A;  5J3X A;  1DJI A;  1J55 A;  1XFV O;  4FQT A;  2M97 A;  4GGN A;  1FF1 A;  1OE9 B;  5JOL A;  1XFU O;  1OOI X;  2PQL A;  3R72 A;  1QIV A;  2JTZ A;  2EC6 B;  3B6X A;  3BUN B;  1JWD A;  1NSH A;  2LV7 A;  2L2C A;  1DMO A;  2NCO A;  4PHN A;  1M46 A;  1HQV A;  2MAZ A;  3CWG A;  3GK1 A;  2LMV A;  3QRX A;  1J7R A;  1KFU S;  1DQE A;  1KFX S;  1YVL A;  1A03 A;  3EK4 A;  3LCP C;  1N2D A;  5I94 A;  3S0D A;  1YUU A;  5DKQ A;  3WXA A;  1XFZ O;  1B8L A;  1TTX A;  1DEL A;  1PSR A;  1QAT A;  1L2O C;  1ODB A;  3D75 A;  4N5X A;  3NSL A;  2BNX A;  1KFU L;  1TUZ A;  5B8I B;  2PYQ A;  3PFV A;  4CLN A;  2M1U A;  1KK8 B;  4OZD A;  1QV1 A;  4XJK B;  2BL0 C;  1LIN A;  1B8C A;  1CKK A;  1CB1 A;  2ZNE A;  2WCH A;  4HRH A;  1SR6 C;  3SS4 A;  2LHL A;  3FS7 A;  3DVJ A;  4OCI A;  3CZ0 A;  1PK0 D;  1R2U A;  1SNL A;  3BFH A;  1OOF A;  5HKZ A;  3SG7 A;  4QJ4 B;  3B87 A;  4YGC B;  1NX0 A;  1TNQ A;  1UHI A;  3TDZ A;  3CAB A;  3TUY C;  2LAN A;  1CM1 A;  4A4B A;  2K2F A;  1JFJ A;  1NCZ A;  3O6B A;  3JVT C;  2KPH A;  1RWY A;  2F2O A;  1CTR A;  4PCW A;  2NCP A;  3B86 A;  4P2Y B;  2NLN A;  1FI6 A;  1KWO C;  2LLT A;  3CZ1 A;  1DF0 B;  1CFC A;  2OS8 C;  1LVC D;  1RTP 1;  1XFW O;  4NDD A;  1EXR A;  1S3P A;  1S6J A;  1CFD A;  1JFK A;  1K93 D;  2BL0 B;  5HKY A;  4PE0 A;  3C1V A;  1SR6 B;  3ZNI A;  5FYX A;  1SSE B;  1BMO A;  1SRA A;  1NWD A;  1EJ3 A;  2MLE C;  2COL B;  2JPO A;  4DIR A;  3SS5 A;  1T14 A;  3FE8 A;  4USL A;  3VB1 A;  1CLB A;  3DF0 A;  4D1E A;  2WOR A;  1RRO A;  1SW8 A;  1IJ6 A;  3OX5 A;  4ORC B;  2PMY A;  4ZCV A;  1YVH A;  2H8V A;  2LNK A;  2Y4Q A;  2VRG A;  4C0L A;  2EC6 C;  2ZN9 A;  1DJY A;  4GFT A;  3TDU A;  3JVT B;  2H61 C;  1TOP A;  3B7A A;  1YRT B;  2Y1M A;  4ORB B;  1AJ5 A;  1OZO A;  4I5K A;  1S5G Y;  2GV5 A;  2L5Y A;  1KWO B;  1IRJ A;  2KLD A;  1KK7 Z;  3A8R A;  3UO9 A;  3BJH A;  3LK1 A;  2HET A;  2LVJ A;  2MJW B;  3GOF A;  1CFP A;  1DGU A;  1QAS A;  1IH0 A;  2KQY A;  2KYF A;  1MWN A;  2K7B A;  1WLZ A;  2CTN A;  2QEB A;  3D76 A;  3E3R A;  3SS3 A;  1CFF A;  3KPX A;  3SG2 A;  1F4Q A;  4U8D A;  1F55 A;  2P6B B;  1A29 A;  1G4Y R;  1K96 A;  1W9Z A;  2EGD A;  2I2R E;  2SAS A;  1KK8 C;  2K7O A;  1DEK A;  2BAP A;  3VRR A;  1TRF A;  1IG5 A;  4IJ7 A;  1S1E A;  1CLM A;  1R6P A;  1XFY O;  2FJY A;  1IIO A;  2OPO A;  2D8N A;  1JSA A;  3FIA A;  4YRU A;  1UHK A;  4GNK B;  2GGM A;  5DKN A;  3VRP A;  1XK4 A;  5FI6 A;  1K2H A;  1YX7 A;  4M2Q A;  1E8A A;  4I5N B;  4C0J A;  2CT9 A;  4QJ5 B;  3S0B A;  1Q80 A;  1S5G Z;  1NX1 A;  2KNE A;  1L7Z A;  3DVE A;  3WNX B;  5JJG A;  2CCM A;  2ZFD A;  2L5X B;  1H8B A;  2KI6 C;  2AMI A;  3ICB A;  1Y1X A;  2PAL A;  1SMG A;  1IQ5 A;  2LP2 A;  2K2A A;  2M3W A;  4DCK A;  4UPG A;  4MN0 A;  1EH2 A;  2BE6 A;  2OS8 B;  2F2P A;  1CMG A;  2KAX A;  2A4J A;  2JT0 A;  3SG3 A;  1SL8 A;  1ZFS A;  3BUO B;  1DT7 B;  1F71 A;  3JTD C;  1U5I B;  3DD4 A;  2QEO A;  3ZWH A;  2L98 A;  1LKJ A;  3L4L A;  2JU0 A;  2KBI A;  1OW4 A;  1EL4 A;  1WRZ A;  1PVB A;  2PRU A;  1XK4 C;  4WQ3 A;  4HRE E;  1C7W A;  3IVT A;  1AJ4 A;  4E68 A;  3D74 A;  3BOW A;  2G9B A;  3EKJ A;  1WDC C;  5KTY A;  1S36 A;  1AHR A;  1FW4 A;  3M0W A;  1XFR A;  1CNP A;  1K9U A;  2M8U A;  2JZI A;  1BF5 A;  1G33 A;  2FJU B;  1C3Z A;  1KSO A;  1QV0 A;  2JT3 A;  2KDH A;  3K21 A;  5ER4 X;  1BR1 B;  1XA5 A;  1DJH A;  2LVI A;  5AFP A;  3NHT A;  5KU1 A;  3BYA A;  3CR5 X;  4PE4 A;  5GQQ C;  4BY5 A;  3IQO A;  1ALV A;  1MXL C;  1QXP A;  5DKR A;  1ZMZ A;  3JTD B;  4NDC A;  2MLF C;  5BPJ A;  2WCE A;  1KSM A;  4YBH B;  2JT8 A;  1TNW A;  2JQ6 A;  5K89 A;  4YGB B;  1UHH A;  4DS7 A;  3N7H A;  5FI2 A;  3DF0 B;  3CTN A;  5CSI A;  1WY9 A;  1TCO B;  1RJV A;  1WDC B;  2H2K A;  4OV2 A;  4BY4 A;  2YGU A;  5I2L A;  2OTG C;  2BBM A;  2LHI A;  5CSF A;  1ZAC A;  1UP5 A;  1B8R A;  1YUS A;  3EG5 B;  3I5H B;  3R1V A;  1WLM A;  1BU3 A;  3QME A;  2K61 A;  1QVI Z;  2BCX A;  5AAN A;  3FWC A;  1DJW A;  1EG3 A;  2LCP A;  4JWQ A;  1LXF C;  1Y0V H;  5CSJ A;  1SK6 D;  3AAJ A;  1GQM A;  2WCF A;  4PE7 A;  1K95 A;  1GGW A;  4JPZ B;  2O60 A;  3SG5 A;  2NXQ A;  4TNC A;  4I5L B;  2BBN A;  3NGV A;  5F6T A;  2WC6 A;  4XJK A;  1RK9 A;  3EKH A;  3L47 A;  1DJZ A;  1MQ1 A;  3LLE A;  2M0R A;  2L4I A;  2R2I A;  1J1D A;  2FCE A;  1QWV A;  1TCF A;  1X02 A;  1S6C A;  1QX7 A;  1D1O A;  2WND A;  3F45 A;  1CDM A;  3I5F B;  1ORG A;  1AP4 A;  3HX4 A;  3I5H C;  1CDP A;  3CR4 X;  3PAT A;  1SKT A;  2Y5I A;  2I94 A;  3BUX B;  2LVK A;  2JUL A;  4YGD B;  3CR2 A;  1NX3 A;  5FI7 A;  3GK4 X;  2HF5 A;  1BG1 A;  1YRU B;  2AUC A;  2M7N A;  2JC2 A;  1QTX A;  3DY9 A;  2WCB A;  3NHI A;  1OMV A;  4MLW A;  4NDB A;  3TZ1 A;  2ZRS A;  1J7Q A;  1FPW A;  1Z2C B;  1KQV A;  4GAO A;  4HRG A;  4PDZ A;  5EL2 A;  3D73 A;  1YR5 A;  2MA2 A;  3SIB A;  1NCY A;  3BUW B;  1SPY A;  2K8M B;  3KEV A;  2JWW A;  1H4B A;  2K7D A;  1UUR A;  3O4Y A;  1G8I A;  2EHB A;  5D69 A;  4CFR A;  2FOT A;  3BFB A;  1J7O A;  1PRW A;  1MHO A;  2LVV A;  4WQ2 A;  1TNX A;  4WRI A;  2RGI A;  1A4P A;  1BT6 A;  5AXI A;  3I5F C;  1M39 A;  2IS9 A;  1B4C A;  1Y1U A;  1V1G A;  3R1P A;  2PVB A;  1V1F A;  1DJX A;  1CDL A;  4YI8 A;  2QPT A;  1NP8 A;  4ZCU A;  2KOT A;  1AVS A;  3FWB A;  2KI4 C;  3VRO A;  1BLQ A;  2BCB A;  2OTG B;  2P70 A;  3R1O A;  5HYD A;  1QVI Y;  1ZOT B;  2K60 A;  3PSR A;  5DIC A;  1SYM A;  2GTE A;  2KI6 D;  1DGV A;  2L50 A;  1ZUZ A;  1QX2 A;  2BE4 A;  5AER A;  1PVA A;  1YTZ C;  2LLS A;  4N1G A;  2KFF A;  1F4O A;  1JUO A;  1CLL A;  2HPS A;  4PHK A;  1K9K A;  2Q91 A;  3H4S E;  1YUT A;  3WHU B;  3D0Y A;  3PAL A;  4OR9 B;  1XVJ A;  3O78 A;  4AQJ A;  1W7I B;  1K94 A;  2CBL A;  4MSP A;  2M7L A;  1NUB A;  4YGE B;  3DXL A;  3OP0 A;  3PJI A;  4INX A;  1GM0 A;  3V2L A;  3DZT A;  1TIZ A;  1WRL A;  2E30 A;  1IWQ A;  4GGF C;  4F0Z B;  3BFA A;  3DVM A;  2ZN8 A;  1BR4 B;  1OOG A;  1S6I A;  2ERB A;  4JD9 A;  2SCP A;  2PSR A;  3OGN A;  5HL1 A;  2Y1N A;  3TS5 C;  4ORA B;  2QAC A;  4F7F A;  3K1E A;  3KF9 A;  4R1E A;  5HKW A;  2TN4 A;  2BEC A;  2LE9 B;  3EVV A;  4C0K A;  3B88 A;  2FCD A;  2BKI B;  3IQQ A;  1QJT A;  4FQO A;  1FI5 A;  1YUR A;  1SCM B;  3EK7 A;  3OBV A;  4MZK A;  4N1F A;  2DOQ A;  4DUQ A;  1UHJ A;  3NXA A;  1CM4 A;  5HLV A;  2L4H A;  3KO0 A;  4NQG A;  2G2B A;  3D0Y B;  4XYN A;  1TWO A;  1UWO A;  3L4A A;  5G08 A;  1SCV A;  3SG4 A;  3BOW B;  2E6W A;  1OSA A;  3NSO A;  1B7T Y;  2JXL A;  4GGF A;  5I8N A;  3NSI A;  1MR8 A;  1XFX O;  1TN4 A;  2GGZ A;  2KI4 B;  2LAP A;  3PM2 A;  3WHT B;  2F3Y A;  5AEQ A;  4QJ3 B;  3FE6 A;  1BOD A;  1M31 A;  3CDN A;  4JQ0 D;  1A75 A;  4PE1 A;  5CSN A;  5I2O A;  2M49 B;  1IJ5 A;  3EVU A;  2KBM A;  1OZS A;  2K0J A;  2ZRT A;  1SL9 A;  1DTL A;  2M9G A;  2KAY A;  1K90 D;  3MSE B;  2KSP A;  3A4U B;  3FE9 A;  3AKA A;  1Y6W A;  1KQM C;  2WCJ A;  3EK8 A;  1C7V A;  1SCM C;  3OX6 A;  4M2P A;  1P28 A;  2LUX A;  1SY9 A;  4OVN F;  2WCM A;  1K8U A;  2KFG A;  2MHH A;  4CPV A;  2K7C A;  2KHN A;  4I5J A;  3RM1 A;  4GBA A;  1W7J B;  2LMU A;  4MEW A;  1TNP A;  2MBX A;  1XO5 A;  2O5G A;  2QDI A;  4A4C A;  1Z4H A;  2I18 A;  2WC5 A;  3CZT X;  3I5G C;  3PN7 C;  2ISD A;  2V53 A;  1LA3 A;  1MF8 B;  1PAL A;  1RFJ A;  2ZKM X;  1OQP A;  4MRX A;  3RLZ A;  3LK0 A;  3VRN A;  1N0Y A;  1GGZ A;  2QEV A;  3I5I B;  3GK2 A;  1DVI A;  1NPQ A;  4CFQ A;  4IL1 A;  1NIW A;  2PAS A;  5D3O A;  3UNW A;  1S26 D;  3O4X A;  2CNP A;  1B9A A;  1M45 A;  1GJY A;  5CPV A;  1KK7 Y;  1OOJ A;  4M2O A;  2L51 A;  4AOM A;  2LMT A;  4MZJ A;  1OOH A;  2L2E A;  4L9M A;  1UUS A;  1BJF A;  3SJS A;  2JOJ A;  3VRQ A;  3DYE A;  1QX5 B;  4GPL B;  4GUK A;  1XYD A;  5D7F A;  2QEH A;  3TS5 B;  1QLK A;  4MVF A;  5KSZ A;  1J1E A;  1MUX A;  4ICB A;  4Q04 A;  1U5I A;  2F8P A;  1YX8 A;  1AK8 A;  1IKU A;  5IBW A;  1DJG A;  1MXE A;  2BCA A;  2M29 A;  4PAL A;  2NZ0 A;  4OKH A;  2WOS A;  2B1U A;  4JKT A;  4YI9 A;  1EG4 A;  2LC5 A;  1F8H A;  2KYC A;  1WRK A;  1NCX A; 
#chains in the Genus database with same CATH homology
 3EVR A;  5HLO A;  4P5O E;  1JBA A;  1PSB A;  3VGO A;  1JF2 A;  1SBJ A;  2ZND A;  1A2X A;  3AKB A;  4CID A;  2KGR A;  1N65 A;  2H61 A;  1B47 A;  3NSK A;  4MRY A;  2M1K B;  1OMD A;  2HQ8 A;  2JNX A;  2AAO A;  2I7A A;  2Q4U A;  1HT9 A;  3BXK A;  3KHE A;  1M63 B;  3AAK A;  2KQ6 A;  3IF7 A;  1JF0 A;  3D10 A;  1IQ3 A;  1NX2 A;  2KFH A;  1OMR A;  1IGV A;  5ER5 A;  1J7P A;  3O2P A;  3PM8 A;  1KCY A;  4FTG A;  2F33 A;  3BUM B;  1NYA A;  1DF0 A;  2BKH B;  1JC2 A;  2LP3 A;  5TNC A;  1KQM B;  5I2Q A;  2JNF A;  1CMF A;  1REC A;  3SIA A;  1K9P A;  1QS7 A;  4YGA A;  2JTT A;  2JPT A;  2KAV A;  2LUC A;  2WC8 A;  3I5G B;  3PN7 B;  1B7T Z;  1F54 A;  2CXJ A;  3TUY B;  3OB2 B;  1ALW A;  4PHJ A;  3CGA A;  3TDI A;  1PUL A;  3I5I C;  1BOC A;  2LLU A;  3OHM B;  2L0P A;  2LM5 A;  3CS1 A;  1FBV A;  4DRW A;  3OB1 B;  1Y1A A;  4MBE A;  3PLF B;  1LA0 A;  2KGB C;  1SL7 A;  4HSZ A;  4PHM A;  1C07 A;  3LL8 B;  4AQI A;  1A75 B;  2F3Z A;  3CLN A;  1CDN A;  2MRD A;  1VRK A;  1QLS A;  1AUI B;  4ETO A;  1KFX L;  1QIW A;  2JXC A;  3SG6 A;  1L2O B;  1F70 A;  2JRF A;  3BQ3 A;  3HCM A;  4MZL A;  5PAL A;  2HQW A;  1B1G A;  3DVK A;  1UHN A;  5J3X A;  1DJI A;  1J55 A;  1XFV O;  2M97 A;  4GGN A;  1FF1 A;  1OE9 B;  5JOL A;  1XFU O;  1QIV A;  2JTZ A;  2EC6 B;  3BUN B;  1NSH A;  2LV7 A;  1DMO A;  2NCO A;  4PHN A;  1M46 A;  1HQV A;  2MAZ A;  3CWG A;  3GK1 A;  2LMV A;  3QRX A;  1J7R A;  1KFU S;  1KFX S;  1YVL A;  1A03 A;  3EK4 A;  3LCP C;  1N2D A;  1YUU A;  5DKQ A;  3WXA A;  1XFZ O;  1B8L A;  1TTX A;  1QAT A;  1PSR A;  4N5X A;  1L2O C;  1ODB A;  3NSL A;  1KFU L;  5B8I B;  3PFV A;  4CLN A;  2M1U A;  1KK8 B;  1QV1 A;  4XJK B;  2BL0 C;  1LIN A;  1B8C A;  1CKK A;  1CB1 A;  2ZNE A;  4HRH A;  1SR6 C;  2LHL A;  3FS7 A;  3DVJ A;  4OCI A;  1PK0 D;  1R2U A;  1SNL A;  5HKZ A;  3SG7 A;  4QJ4 B;  4YGC B;  1NX0 A;  1TNQ A;  1UHI A;  3TDZ A;  3TUY C;  2LAN A;  1CM1 A;  4A4B A;  2K2F A;  1JFJ A;  1NCZ A;  3O6B A;  3JVT C;  1RWY A;  2F2O A;  1CTR A;  4PCW A;  2NCP A;  4P2Y B;  2NLN A;  1FI6 A;  1KWO C;  2LLT A;  1DF0 B;  1CFC A;  2OS8 C;  1LVC D;  1RTP 1;  1XFW O;  4NDD A;  1EXR A;  1S3P A;  1S6J A;  1CFD A;  1JFK A;  1K93 D;  2BL0 B;  5HKY A;  4PE0 A;  3C1V A;  1SR6 B;  3ZNI A;  5FYX A;  1BMO A;  1SRA A;  1NWD A;  1EJ3 A;  2MLE C;  2COL B;  4DIR A;  4USL A;  1CLB A;  3DF0 A;  4D1E A;  2WOR A;  1RRO A;  1SW8 A;  1IJ6 A;  3OX5 A;  4ORC B;  2PMY A;  4ZCV A;  1YVH A;  2LNK A;  2Y4Q A;  2VRG A;  4C0L A;  2EC6 C;  2ZN9 A;  1DJY A;  4GFT A;  3TDU A;  3JVT B;  2H61 C;  1TOP A;  1YRT B;  2Y1M A;  4ORB B;  1AJ5 A;  1OZO A;  4I5K A;  1S5G Y;  2GV5 A;  1KWO B;  1IRJ A;  3A8R A;  1KK7 Z;  3LK1 A;  2HET A;  2LVJ A;  2MJW B;  3GOF A;  1CFP A;  1DGU A;  1QAS A;  1IH0 A;  2KQY A;  2KYF A;  1MWN A;  2K7B A;  1WLZ A;  2CTN A;  3E3R A;  1CFF A;  3KPX A;  3SG2 A;  1F4Q A;  4U8D A;  1F55 A;  2P6B B;  1A29 A;  1G4Y R;  1K96 A;  2EGD A;  2I2R E;  2SAS A;  1KK8 C;  2K7O A;  3VRR A;  1TRF A;  1IG5 A;  1S1E A;  1CLM A;  1R6P A;  1XFY O;  2OPO A;  2D8N A;  1JSA A;  3FIA A;  4YRU A;  1UHK A;  4GNK B;  2GGM A;  5DKN A;  3VRP A;  1XK4 A;  1K2H A;  1YX7 A;  4M2Q A;  1E8A A;  4I5N B;  4C0J A;  2CT9 A;  4QJ5 B;  1Q80 A;  1S5G Z;  1NX1 A;  2KNE A;  1L7Z A;  3DVE A;  3WNX B;  5JJG A;  2CCM A;  2ZFD A;  2L5X B;  1H8B A;  2KI6 C;  2AMI A;  3ICB A;  1Y1X A;  2PAL A;  1SMG A;  1IQ5 A;  2LP2 A;  2K2A A;  2M3W A;  4DCK A;  4UPG A;  4MN0 A;  1EH2 A;  2BE6 A;  2OS8 B;  2F2P A;  1CMG A;  2KAX A;  2A4J A;  2JT0 A;  3SG3 A;  1SL8 A;  1ZFS A;  3BUO B;  1DT7 B;  1F71 A;  3JTD C;  1U5I B;  3DD4 A;  3ZWH A;  2L98 A;  1LKJ A;  2JU0 A;  2KBI A;  1EL4 A;  1WRZ A;  1PVB A;  2PRU A;  1XK4 C;  4WQ3 A;  4HRE E;  1C7W A;  4E68 A;  1AJ4 A;  3BOW A;  2G9B A;  3EKJ A;  1WDC C;  5KTY A;  1S36 A;  1AHR A;  1FW4 A;  3M0W A;  1CNP A;  1K9U A;  2M8U A;  2JZI A;  1BF5 A;  1G33 A;  2FJU B;  1KSO A;  1QV0 A;  2JT3 A;  2KDH A;  3K21 A;  5ER4 X;  1BR1 B;  1XA5 A;  1DJH A;  2LVI A;  5AFP A;  5KU1 A;  3BYA A;  3CR5 X;  4PE4 A;  5GQQ C;  4BY5 A;  3IQO A;  1ALV A;  1MXL C;  1QXP A;  5DKR A;  1ZMZ A;  3JTD B;  4NDC A;  2MLF C;  5BPJ A;  2WCE A;  1KSM A;  4YBH B;  2JT8 A;  1TNW A;  2JQ6 A;  5K89 A;  4YGB B;  1UHH A;  4DS7 A;  3DF0 B;  3CTN A;  5CSI A;  1WY9 A;  1TCO B;  1RJV A;  1WDC B;  2H2K A;  4OV2 A;  4BY4 A;  5I2L A;  2OTG C;  2BBM A;  2LHI A;  5CSF A;  1ZAC A;  1UP5 A;  1B8R A;  1YUS A;  3I5H B;  1WLM A;  1BU3 A;  2K61 A;  1QVI Z;  2BCX A;  5AAN A;  3FWC A;  1DJW A;  1EG3 A;  2LCP A;  4JWQ A;  1LXF C;  1Y0V H;  5CSJ A;  1SK6 D;  3AAJ A;  1GQM A;  2WCF A;  4PE7 A;  1K95 A;  1GGW A;  4JPZ B;  2O60 A;  3SG5 A;  2NXQ A;  4TNC A;  4I5L B;  2BBN A;  5F6T A;  4XJK A;  1RK9 A;  3EKH A;  3LLE A;  1DJZ A;  1MQ1 A;  2M0R A;  2L4I A;  2R2I A;  1J1D A;  2FCE A;  1TCF A;  1X02 A;  1S6C A;  1QX7 A;  1D1O A;  2WND A;  3F45 A;  1CDM A;  3I5F B;  1AP4 A;  3HX4 A;  3I5H C;  1CDP A;  3CR4 X;  3PAT A;  1SKT A;  2Y5I A;  2I94 A;  3BUX B;  2LVK A;  2JUL A;  4YGD B;  3CR2 A;  1NX3 A;  3GK4 X;  2HF5 A;  1BG1 A;  1YRU B;  2AUC A;  2M7N A;  2JC2 A;  1QTX A;  2WCB A;  3TZ1 A;  1OMV A;  4MLW A;  4NDB A;  1J7Q A;  2ZRS A;  1FPW A;  1KQV A;  4GAO A;  4HRG A;  4PDZ A;  1YR5 A;  2MA2 A;  3SIB A;  1NCY A;  3BUW B;  1SPY A;  2K8M B;  3KEV A;  2JWW A;  1H4B A;  2K7D A;  1UUR A;  3O4Y A;  1G8I A;  2EHB A;  5D69 A;  4CFR A;  2FOT A;  1J7O A;  1PRW A;  1MHO A;  2LVV A;  4WQ2 A;  1TNX A;  4WRI A;  2RGI A;  1A4P A;  1BT6 A;  5AXI A;  3I5F C;  1M39 A;  2IS9 A;  1B4C A;  1Y1U A;  1V1G A;  2PVB A;  1V1F A;  1DJX A;  1CDL A;  4YI8 A;  2QPT A;  1NP8 A;  4ZCU A;  2KOT A;  1AVS A;  3FWB A;  2KI4 C;  3VRO A;  1BLQ A;  2BCB A;  2OTG B;  5HYD A;  1QVI Y;  1ZOT B;  3PSR A;  1SYM A;  2KI6 D;  1DGV A;  2L50 A;  1ZUZ A;  1QX2 A;  2BE4 A;  5AER A;  1PVA A;  1YTZ C;  2LLS A;  4N1G A;  2KFF A;  1F4O A;  1JUO A;  1CLL A;  2HPS A;  4PHK A;  1K9K A;  2Q91 A;  3H4S E;  1YUT A;  3WHU B;  3D0Y A;  3PAL A;  4OR9 B;  1XVJ A;  3O78 A;  4AQJ A;  1W7I B;  1K94 A;  2CBL A;  4MSP A;  2M7L A;  1NUB A;  4YGE B;  3OP0 A;  1TIZ A;  1WRL A;  2E30 A;  1IWQ A;  4GGF C;  4F0Z B;  3DVM A;  2ZN8 A;  1BR4 B;  1S6I A;  2SCP A;  2PSR A;  2Y1N A;  3TS5 C;  4ORA B;  2QAC A;  3KF9 A;  4R1E A;  5HKW A;  2TN4 A;  2BEC A;  2LE9 B;  3EVV A;  4C0K A;  2FCD A;  2BKI B;  3IQQ A;  1QJT A;  4FQO A;  1FI5 A;  1YUR A;  1SCM B;  3EK7 A;  4N1F A;  4MZK A;  2DOQ A;  4DUQ A;  1UHJ A;  3NXA A;  1CM4 A;  5HLV A;  2L4H A;  3KO0 A;  4NQG A;  2G2B A;  3D0Y B;  4XYN A;  1UWO A;  5G08 A;  1SCV A;  3SG4 A;  3BOW B;  2E6W A;  1OSA A;  3NSO A;  1B7T Y;  2JXL A;  4GGF A;  5I8N A;  3NSI A;  1MR8 A;  1TN4 A;  2GGZ A;  1XFX O;  2KI4 B;  2LAP A;  3WHT B;  2F3Y A;  5AEQ A;  4QJ3 B;  1BOD A;  1M31 A;  4JQ0 D;  1A75 A;  4PE1 A;  5CSN A;  5I2O A;  2M49 B;  1IJ5 A;  3EVU A;  2KBM A;  1OZS A;  2K0J A;  2ZRT A;  1SL9 A;  1DTL A;  2M9G A;  2KAY A;  1K90 D;  3MSE B;  2KSP A;  3A4U B;  1C7V A;  3AKA A;  1Y6W A;  1KQM C;  3EK8 A;  1SCM C;  3OX6 A;  4M2P A;  2LUX A;  1SY9 A;  4OVN F;  1K8U A;  2KFG A;  2MHH A;  4CPV A;  2K7C A;  2KHN A;  4I5J A;  3RM1 A;  4GBA A;  1W7J B;  2LMU A;  4MEW A;  1TNP A;  2MBX A;  1XO5 A;  2O5G A;  4A4C A;  1JWD A;  2I18 A;  3CZT X;  3I5G C;  3PN7 C;  2ISD A;  2V53 A;  1LA3 A;  1MF8 B;  1PAL A;  1RFJ A;  2ZKM X;  1OQP A;  4MRX A;  3RLZ A;  3LK0 A;  3VRN A;  1N0Y A;  1GGZ A;  3I5I B;  3GK2 A;  1DVI A;  1NPQ A;  4CFQ A;  4IL1 A;  1NIW A;  2PAS A;  1S26 D;  2CNP A;  1B9A A;  1M45 A;  1GJY A;  5CPV A;  1KK7 Y;  1OOJ A;  4M2O A;  2L51 A;  4AOM A;  2LMT A;  4MZJ A;  2L2E A;  4L9M A;  1UUS A;  1BJF A;  3SJS A;  2JOJ A;  3VRQ A;  1QX5 B;  4GPL B;  4GUK A;  1XYD A;  5D7F A;  3TS5 B;  1QLK A;  4MVF A;  5KSZ A;  1J1E A;  1MUX A;  4ICB A;  4Q04 A;  1U5I A;  2F8P A;  1YX8 A;  1AK8 A;  1IKU A;  5IBW A;  1DJG A;  1MXE A;  2BCA A;  2M29 A;  4PAL A;  2NZ0 A;  4OKH A;  2WOS A;  2B1U A;  4YI9 A;  1F8H A;  1EG4 A;  2LC5 A;  2KYC A;  1WRK A;  1NCX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...