4ZCUA

Structure of calcium-bound regulatory domain of the human atp-mg/pi carrier in the p2 form
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
153
structure length
152
Chain Sequence
b'TRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTTGDVNKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLQTLGLTISEQQAELILQSIDVDGTTVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-binding mitochondrial carrier protein SCaMC-1
molecule tags Transport protein
source organism Homo sapiens
publication title Calcium-induced conformational changes in the regulatory domain of the human mitochondrial ATP-Mg/Pi carrier.
pubmed doi rcsb
total genus 51
structure length 152
sequence length 153
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4zcuA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4zcuA02
1XFZO 4PHMA 1K9UA 1IG5A 4C0JA 1XYDA 3LK0A 1KWOC 1XFWO 5D7FA 1CLLA 1K95A 1UHIA 3JTDB 2BL0C 1IJ5A 2CXJA 2LVVA 4ICBA 2BBMA 2KHNA 2LVIA 1CFPA 1ZMZA 2PRUA 1XFXO 3PM8A 2PASA 3CWGA 1SL8A 4GGFA 3SJSA 2NLNA 1K8UA 1HT9A 1S6JA 1CNPA 1L2OB 1JF2A 2EHBA 3OP0A 2F2PA 3D10A 4CIDA 2KFFA 3EVUA 1J55A 4WQ2A 2LUXA 3HCMA 3SIAA 2KI6C 3BUXB 1XA5A 1PK0D 3DVJA 4IL1A 1KFXS 2KYCA 4AOMA 2QPTA 1RTP1 1QS7A 2KNEA 2LANA 2M7NA 3FS7A 2EGDA 5HLOA 1CDPA 4C0KA 4BY5A 1M31A 5ER5A 1CFDA 1YR5A 2M9GA 3CGAA 1OZOA 4YGAA 3PFVA 5J3XA 1RK9A 3FIAA 4MZLA 1QX2A 1OOJA 1JUOA 2K8MB 1TOPA 3KF9A 2F8PA 4AQIA 2KAVA 1S26D 3H4SE 1S3PA 2KI4C 1FPWA 1FW4A 1F4QA 4ZCVA 5AEQA 2ZRTA 4TNCA 1ZACA 1QV0A 1S6CA 3AAKA 3CR4X 2LVKA 1CM1A 1PSRA 3ZWHA 1YTZC 1S5GZ 4CLNA 1FI6A 1NP8A 4GPLB 3CS1A 3IQOA 3NXAA 1YURA 2FCEA 2HQWA 1XFYO 1OMVA 2E30A 2LP2A 2M3WA 3CR2A 2G2BA 2ZKMX 5HLVA 1J7OA 2L0PA 3I5HB 2FJUB 2OS8C 1AUIB 4DCKA 1SY9A 4HSZA 4A4CA 2LLTA 2PSRA 1H8BA 3DVKA 3EKHA 1KWOB 4PALA 4MVFA 1KSMA 1EXRA 1DF0A 1NUBA 3KEVA 2D8NA 1S6IA 1F8HA 1NPQA 1GQMA 1PRWA 2BE4A 5AXIA 1KK8C 1ODBA 1SYMA 1SCVA 1SPYA 2L4IA 3OHMB 1TCFA 1PVAA 3GK2A 3VRRA 2AAOA 3EVRA 3KPXA 2PALA 1M63B 2B1UA 1UUSA 5BPJA 1KFXL 3F45A 3WNXB 5IBWA 4BY4A 1NX3A 3TS5B 3ZNIA 1DTLA 4YGBB 4WRIA 5CSIA 1QIWA 4GAOA 2LMTA 2KYFA 2LNKA 1WY9A 2OTGB 1EL4A 3K21A 2F3YA 3WHUB 3DF0B 1SCMC 1QASA 1F55A 1DF0B 1RECA 1AK8A 3RLZA 2KDHA 1FI5A 1ZUZA 1TTXA 3GOFA 1CKKA 1OMRA 2NXQA 5AERA 1G33A 1TNWA 2FOTA 3VROA 1WDCB 1PSBA 2M29A 5FYXA 5ER4X 3TUYB 4NDDA 4PE7A 1NCZA 1KSOA 1CM4A 1NWDA 2WC8A 1BT6A 1QXPA 1Y0VH 3DVEA 1K90D 2NCOA 1OMDA 2MLFC 1AHRA 5I2QA 2M49B 1NCXA 2LLUA 1KQMB 1JSAA 1DGVA 5DKRA 3SG7A 2I2RE 2BKIB 4YBHB 3SG2A 2BCAA 1QX5B 5I2OA 3CLNA 4MRYA 4MZKA 2M97A 2IS9A 1J7RA 2MJWB 3EKJA 1U5IB 2A4JA 1B8CA 4NDCA 1N2DA 2P6BB 2SCPA 1CB1A 4MEWA 4C0LA 4AQJA 1RWYA 2ZNEA 2L51A 1BF5A 3A4UB 5GQQC 1IGVA 1RROA 1UHKA 1MWNA 1QTXA 2Q91A 3I5FC 2BKHB 2JTZA 1K93D 1CDNA 3SG4A 1KQVA 1S1EA 2KAXA 4PCWA 5HYDA 2NZ0A 2GGMA 3DVMA 2WCFA 5I2LA 1SBJA 4D1EA 2M1KB 1M39A 4ETOA 1H4BA 3O2PA 3I5IC 1B1GA 2WOSA 1K9PA 1LKJA 4F0ZB 4M2QA 4PHKA 1IKUA 1OSAA 1SKTA 3PN7C 1F70A 2M0RA 4A4BA 3OX5A 1TRFA 3RM1A 5JOLA 5CSFA 5K89A 1Y1AA 1AP4A 5HKZA 3VRPA 1VRKA 2K7OA 1NSHA 1QVIZ 1SL7A 5KTYA 1CDLA 1KFUS 1Y1UA 1DJIA 3PLFB 4PHJA 1BR1B 1N0YA 1S36A 2H2KA 1WRKA 1Q80A 2H61A 2KI6D 3D0YA 3JVTB 2JOJA 2KGBC 1SL9A 1SR6C 1YX7A 4N5XA 2M7LA 1Y6WA 2AUCA 2ZN8A 1JFJA 2L4HA 5HKWA 2EC6C 4CPVA 3LK1A 2MRDA 3FWBA 3O78A 2JRFA 4DUQA 3FWCA 1S5GY 4OKHA 1PULA 1WLMA 1K9KA 5AANA 2LCPA 4CFRA 1N65A 2JZIA 2MLEC 1V1GA 3TDUA 1DGUA 4PE4A 5DKQA 5CSNA 2COLB 2ZNDA 1CMGA 1JBAA 2LHLA 1W7IB 1F71A 3BUMB 2LV7A 2Y1MA 5HKYA 1MXLC 1D1OA 2V53A 4L9MA 1B7TZ 2KBMA 1IRJA 3A8RA 1UHJA 3M0WA 5DKNA 2O5GA 2Y5IA 1SMGA 2MHHA 1ALWA 4FTGA 3LCPC 1AJ4A 1BU3A 2CBLA 3BYAA 4MRXA 4QJ4B 5KSZA 2KFHA 2PMYA 1CLMA 4YGEB 1OE9B 2KFGA 4ORBB 1GGWA 1EJ3A 1XK4A 1J1EA 3LLEA 4JQ0D 4GNKB 1F54A 1DJWA 3EK8A 2KI4B 4ORCB 3SIBA 2F2OA 2SASA 2AMIA 1MF8B 1UHNA 2K7BA 2I94A 1LXFC 4DRWA 4OCIA 1OQPA 2R2IA 1L2OC 1YRUB 1R6PA 2F33A 1ALVA 1NX2A 1E8AA 3ICBA 5F6TA 4MLWA 3DF0A 1IQ3A 4MN0A 1XFVO 1K96A 1A2XA 4M2PA 2HF5A 1B8LA 1QVIY 2CT9A 1CTRA 4QJ5B 4CFQA 1GJYA 1XVJA 2BL0B 1A75B 2LAPA 3I5HC 1YUSA 1CFFA 4ORAB 1EG3A 1FF1A 2M1UA 2MBXA 4GBAA 2LUCA 1MR8A 1WDCC 2Y1NA 3SG3A 2JNXA 3TDZA 2LMVA 1JC2A 3TS5C 1B47A 1SCMB 2O60A 1K2HA 2EC6B 1TNXA 5CPVA 1DJYA 1KK8B 1AJ5A 2CCMA 2TN4A 3BUOB 3BOWA 4R1EA 2ISDA 1IQ5A 2HETA 1TIZA 2LHIA 2LMUA 2OTGC 4I5NB 1WLZA 1WRZA 2I7AA 3BOWB 3PALA 3SG5A 1BOCA 1TCOB 1B8RA 1LVCD 1EH2A 1CFCA 4OV2A 2ZN9A 1NX1A 3OX6A 4USLA 1XK4C 3JTDC 1KK7Y 4I5JA 2WCBA 1C7VA 1BLQA 1DT7B 4GGFC 3WXAA 1IJ6A 1UHHA 1XO5A 4UPGA 4NDBA 4NQGA 1J7QA 2GGZA 2K2AA 4XJKA 1TN4A 1RJVA 4YGDB 4XJKB 3AKAA 5PALA 2VRGA 3SG6A 1B7TY 3HX4A 1A4PA 4GFTA 3MSEB 1C7WA 2JT3A 2JTTA 1GGZA 4PE0A 5D69A 2BECA 4GGNA 1J7PA 2LVJA 1DMOA 2GV5A 2ZFDA 2NCPA 1HQVA 1U5IA 3NSLA 2JQ6A 2JULA 2LLSA 3LL8B 3I5FB 1DJGA 1R2UA 3KO0A 1DVIA 2JXLA 1AVSA 1RFJA 4MBEA 3PN7B 4GUKA 1YVHA 1QIVA 1YVLA 3AKBA 3I5GB 1M45A 2KGRA 2Q4UA 3E3RA 4Q04A 1JWDA 3NSOA 4P2YB 2K7DA 3CZTX 1BR4B 1NYAA 5G08A 4JPZB 4ZCUA 2JT0A 4YI8A 3CR5X 2HPSA 1KCYA 2JNFA 4DS7A 1KFUL 3JVTC 1EG4A 1FBVA 2JPTA 2KOTA 3NSIA 3OB1B 2K7CA 1LINA 1SNLA 1B9AA 2MA2A 1BMOA 2F3ZA 2K0JA 1QJTA 1B4CA 4P5OE 1BODA 1MQ1A 2BBNA 1A29A 2CTNA 2OS8B 2KBIA 2FCDA 2L50A 1DJHA 3O6BA 1F4OA 1TNQA 1G4YR 1MUXA 1QX7A 2MAZA 3TDIA 2JXCA 1YUUA 3IF7A 2L5XB 1DJXA 3DD4A 1MXEA 1J1DA 2HQ8A 5I8NA 1SW8A 2BE6A 2DOQA 2KAYA 3CTNA 3D0YB 1TNPA 2JC2A 1BG1A 2Y4QA 1G8IA 1YUTA 1QLSA 3BXKA 1W7JB 4I5LB 1NX0A 4HRHA 4OVNF 5JJGA 2WNDA 1NCYA 3GK4X 4E68A 1YRTB 1MHOA 3EK7A 1OZSA 1M46A 4YRUA 2E6WA 2L98A 3BUNB 4HRGA 1JF0A 1NIWA 4U8DA 1LA0A 3KHEA 4MZJA 2M8UA 4HREE 1IH0A 4N1FA 2JU0A 4WQ3A 5B8IB 4FQOA 4M2OA 2CNPA 5TNCA 5AFPA 1CMFA 1X02A 1K94A 3IQQA 2ZRSA 4DIRA 3EK4A 1LA3A 2BCXA 2L2EA 1A75A 2G9BA 3GK1A 3TZ1A 1SK6D 3PATA 1UURA 2QACA 4N1GA 1V1FA 2KQ6A 2LP3A 4PHNA 2RGIA 1JFKA 1Y1XA 5KU1A 2LM5A 2WORA 2PVBA 2JWWA 4MSPA 1CLBA 2I18A 2OPOA 3VGOA 2KSPA 4PE1A 3VRNA 1KQMC 4JWQA 1C07A 1PALA 3BUWB 3O4YA 3TUYC 1WRLA 3PSRA 2LC5A 2JT8A 3OB2B 3EVVA 1BJFA 1ZFSA 3BQ3A 4OR9B 2LE9B 1SR6B 2H61C 3AAJA 2WCEA 4XYNA 1QATA 4PDZA 1XFUO 5CSJA 1ZOTB 1A03A 2K2FA 3QRXA 1SRAA 2K61A 1KK7Z 4YI9A 1PVBA 1UWOA 4QJ3B 3C1VA 1L7ZA 4YGCB 1CDMA 4I5KA 3VRQA 2BCBA 3WHTB 1QV1A 3NSKA 1IWQA 1UP5A 1QLKA 3I5IB 1YX8A 1DJZA 2KQYA 3I5GC
chains in the Genus database with same CATH superfamily
1XFZO 4PHMA 1K9UA 1IG5A 4C0JA 4KYNA 1XYDA 3LK0A 1KWOC 1XFWO 3R1OA 5D7FA 3TDIA 1CLLA 1K95A 1UHIA 2H8VA 3JTDB 2BL0C 1IJ5A 2CXJA 2LVVA 4ICBA 2BBMA 2KHNA 2LVIA 1CFPA 1ZMZA 2PRUA 1XFXO 2KPHA 3PM8A 2PASA 3CWGA 1SL8A 4GGFA 2KLEA 3SJSA 2NLNA 1K8UA 1HT9A 1S6JA 1CNPA 1L2OB 1JF2A 2EHBA 3OP0A 2F2PA 3D10A 4CIDA 2KFFA 3EVUA 1J55A 4WQ2A 3IVTA 2LUXA 3HCMA 3SIAA 2KI6C 3BUXB 1SSEB 1XA5A 1PK0D 3DVJA 1QWVA 4IL1A 1KFXS 2KYCA 4AOMA 1T14A 2QPTA 1RTP1 1QS7A 2KNEA 2LANA 2M7NA 2P71A 2EGDA 3D73A 1CDPA 3FS7A 5HLOA 4C0KA 4BY5A 1DC1A 1M31A 2WC5A 5ER5A 3PM2A 1CFDA 1YR5A 2M9GA 3CGAA 1OZOA 4YGAA 3PFVA 5J3XA 1RK9A 3FIAA 4MZLA 1QX2A 3B88A 1OOJA 1JUOA 2K8MB 1TOPA 3KF9A 2F8PA 4AQIA 2KAVA 1S26D 3H4SE 1S3PA 2KI4C 1FPWA 1FW4A 1F4QA 4ZCVA 5AEQA 2ZRTA 4TNCA 1ZACA 1QV0A 2PYQA 3QMEA 1S6CA 3AAKA 3CR4X 2LVKA 1CM1A 2P70A 1PSRA 3ZWHA 1YTZC 1S5GZ 4CLNA 1FI6A 1NP8A 4GPLB 2FJYA 3CS1A 3IQOA 3NXAA 4IJ7A 1YURA 2FCEA 5FI7A 2HQWA 1XFYO 1OMVA 2E30A 2LP2A 2M3WA 3CR2A 2G2BA 2ZKMX 3FE8A 5HLVA 1J7OA 2L0PA 3EG5B 3I5HB 2FJUB 2OS8C 1AUIB 4DCKA 1SY9A 4HSZA 4A4CA 2LLTA 2PSRA 1H8BA 3DVKA 3EKHA 1KWOB 4PALA 2WCMA 4MVFA 1KSMA 1EXRA 1DF0A 1NUBA 3KEVA 2D8NA 1S6IA 1F8HA 1NPQA 1GQMA 1PRWA 2BE4A 5AXIA 1KK8C 1ODBA 1SYMA 3D75A 1SCVA 1SPYA 3S0AA 2L4IA 3BFBA 3OHMB 1TCFA 1PVAA 3GK2A 3RZSA 3VRRA 2AAOA 3EVRA 3KPXA 2PALA 1M63B 4JKTA 2B1UA 2YGUA 1UUSA 5BPJA 1KFXL 3F45A 3WNXB 5IBWA 4BY4A 1NX3A 3TS5B 3ZNIA 1DTLA 4YGBB 4WRIA 5CSIA 1QIWA 4GAOA 2LMTA 2KYFA 2LNKA 4FQTA 1WY9A 2OTGB 1EL4A 3K21A 3K1EA 3SS3A 2F3YA 3WHUB 1W9ZA 3DF0B 1SCMC 1QASA 1F55A 1DF0B 1RECA 3DXLA 1AK8A 3RLZA 2KDHA 1FI5A 1OOFA 1ZUZA 1TTXA 3GOFA 1CKKA 1OMRA 2NXQA 5AERA 1G33A 1TNWA 2FOTA 3VROA 1WDCB 1PSBA 2M29A 5FYXA 5ER4X 3TUYB 4NDDA 4PE7A 1NCZA 1KSOA 1CM4A 1NWDA 2WC8A 3S0FA 1BT6A 1QXPA 1Y0VH 3DVEA 1K90D 2NCOA 1OMDA 2MLFC 1AHRA 5I2QA 2M49B 1NCXA 2LLUA 1KQMB 1JSAA 1DGVA 5DKRA 3D76A 3SG7A 2I2RE 2BKIB 4YBHB 3SG2A 2BCAA 1QX5B 5I2OA 3PJIA 3CLNA 4MRYA 2QEBA 2M97A 4MZKA 2IS9A 1J7RA 2MJWB 5D3OA 3EKJA 1U5IB 2A4JA 3CZ2A 1B8CA 4NDCA 1N2DA 2P6BB 2SCPA 1CB1A 4MEWA 4C0LA 4AQJA 1RWYA 2QEHA 2L51A 2ZNEA 3A4UB 3R1PA 5GQQC 1BF5A 1IGVA 1RROA 1UHKA 1MWNA 1QTXA 2Q91A 3I5FC 2BKHB 3R72A 2JTZA 1K93D 1CDNA 3SG4A 1KQVA 1S1EA 3R1VA 2KAXA 4PCWA 5HYDA 2NZ0A 2GGMA 3DVMA 2WCFA 5I2LA 1SBJA 4D1EA 2M1KB 3Q8IA 1M39A 4ETOA 1H4BA 3O2PA 3I5IC 1B1GA 3BFHA 2WOSA 1ORGA 1K9PA 1LKJA 1OOHA 1Z4HA 4M2QA 4F0ZB 4PHKA 1IKUA 1OSAA 1SKTA 3CYZA 3PN7C 5FI6A 1F70A 2M0RA 4A4BA 3OX5A 1TRFA 3RM1A 5JOLA 5CSFA 5K89A 1Y1AA 2BNXA 1AP4A 3UO9A 5HKZA 3VRPA 1VRKA 2K7OA 1NSHA 1QVIZ 2QEVA 1SL7A 5KTYA 1CDLA 2L2CA 1KFUS 1Y1UA 1DJIA 3PLFB 4PHJA 1BR1B 1N0YA 1S36A 2H2KA 1WRKA 1Q80A 2H61A 2KI6D 3D0YA 3JVTB 2JOJA 2KGBC 1SL9A 1SR6C 1YX7A 3B7AA 4N5XA 3UNWA 3BFAA 1Y6WA 2M7LA 2AUCA 2ZN8A 2KLDA 1JFJA 3D78A 2L4HA 5HKWA 2EC6C 4CPVA 3LK1A 2MRDA 3FWBA 3O78A 2JRFA 4DUQA 3FWCA 2JPOA 2QEOA 1S5GY 2PQLA 4OKHA 1PULA 1WLMA 1K9KA 3S0GA 5AANA 2LCPA 3CDNA 4CFRA 4INWA 1N65A 2JZIA 2MLEC 5HL1A 1V1GA 3B6XA 3TDUA 1DGUA 1TUJA 3CZ0A 4PE4A 5DKQA 5CSNA 2COLB 2ZNDA 1CMGA 1JBAA 2LHLA 1W7IB 1F71A 3BUMB 2LV7A 2Y1MA 5HKYA 1MXLC 1D1OA 2V53A 2BAPA 1B7TZ 4L9MA 2KBMA 1IRJA 3A8RA 1UHJA 3M0WA 5DKNA 2O5GA 2Y5IA 1SMGA 2MHHA 1ALWA 4FTGA 3LCPC 1AJ4A 1BU3A 2CBLA 3BYAA 4MRXA 4QJ4B 1GM0A 5KSZA 2KFHA 2PMYA 1CLMA 2WCKA 1OE9B 2KFGA 3DZTA 3NHIA 4ORBB 1EJ3A 1XK4A 1J1EA 3LLEA 4JQ0D 4GNKB 1F54A 5EL2A 1DJWA 3EK8A 2KI4B 4ORCB 3SIBA 1IIOA 2F2OA 2GTEA 2SASA 2AMIA 1MF8B 1UHNA 2K7BA 3FE9A 2I94A 1LXFC 4DRWA 4OCIA 1OQPA 2R2IA 1L2OC 1YRUB 1R6PA 2F33A 5I94A 1ALVA 1NX2A 1E8AA 3ICBA 5F6TA 4MLWA 3DF0A 1IQ3A 4MN0A 1XFVO 4F7FA 1K96A 1A2XA 4M2PA 2HF5A 1B8LA 1QVIY 2CT9A 1CTRA 1TWOA 4QJ5B 4CFQA 1GJYA 3SS4A 1XVJA 2BL0B 1A75B 2LAPA 3I5HC 1YUSA 1CFFA 4ORAB 1EG3A 1FF1A 2M1UA 2MBXA 4GBAA 2LUCA 1MR8A 1WDCC 2Y1NA 4YGEB 2JNXA 2L5YA 3SG3A 3L4AA 3TDZA 2LMVA 1JC2A 3TS5C 1B47A 1SCMB 2O60A 3B87A 2ISDA 1K2HA 3L4LA 2EC6B 1TNXA 5CPVA 1DJYA 1KK8B 1AJ5A 2CCMA 2TN4A 3BUOB 3BOWA 3O4XA 4R1EA 1IQ5A 2HETA 1TIZA 2LHIA 2LMUA 2OTGC 2WC6A 1WLZA 1WRZA 2I7AA 3BOWB 3PALA 4I5NB 3SG5A 1TCOB 1B8RA 1LVCD 1BOCA 1EH2A 1CFCA 4OV2A 2ZN9A 1NX1A 3OX6A 4USLA 1XK4C 3JTDC 1KK7Y 1OOGA 4I5JA 2WCBA 4INXA 1C7VA 1BLQA 1DT7B 4GGFC 3WXAA 1IJ6A 3L47A 3S0EA 5DICA 1UHHA 1XO5A 4UPGA 4NDBA 4NQGA 1J7QA 2GGZA 2K2AA 4XJKA 1TN4A 1RJVA 4YGDB 4XJKB 3AKAA 5PALA 2VRGA 3SG6A 1B7TY 3HX4A 5FI2A 1A4PA 1TUZA 4GFTA 3MSEB 1C7WA 2WCLA 2JT3A 2JTTA 1GGZA 4PE0A 5D69A 2BECA 4GGNA 1J7PA 2LVJA 1DMOA 2GV5A 2ZFDA 2NCPA 1HQVA 1U5IA 3NSLA 2JQ6A 2JULA 2LLSA 3VB1A 2WCJA 3I5FB 1DJGA 1R2UA 3LL8B 3KO0A 1DVIA 2JXLA 1AVSA 1RFJA 4MBEA 3PN7B 4GUKA 1YVHA 1QIVA 1YVLA 2K60A 3AKBA 1M45A 3I5GB 2KGRA 2ERBA 3CZ1A 1DELA 2Q4UA 3E3RA 4Q04A 1JWDA 3NSOA 4P2YB 2K7DA 3CZTX 1BR4B 3D77A 1NYAA 1Z2CB 5G08A 1DEKA 4JPZB 4ZCUA 2JT0A 4YI8A 3CR5X 2HPSA 1KCYA 2JNFA 4DS7A 4JD9A 1KFUL 3JVTC 1EG4A 1FBVA 2JPTA 2KOTA 3NSIA 3OB1B 2K7CA 1LINA 1SNLA 1B9AA 2MA2A 1BMOA 1GGWA 2F3ZA 2K0JA 1QJTA 1B4CA 4P5OE 1BODA 1MQ1A 2BBNA 1A29A 2CTNA 1OOIX 2OS8B 2KBIA 2FCDA 2L50A 1DJHA 3O6BA 1F4OA 1TNQA 1G4YR 1MUXA 1QX7A 2MAZA 3OBVA 2JXCA 1YUUA 3IF7A 2L5XB 3BJHA 1DJXA 3DD4A 1MXEA 1J1DA 2HQ8A 5I8NA 1SW8A 2BE6A 2DOQA 2KAYA 3CABA 3CTNA 3D0YB 1TNPA 2JC2A 4PT1A 1BG1A 2Y4QA 3N7HA 1G8IA 1YUTA 3DYEA 1QLSA 3NHTA 3BXKA 1W7JB 4I5LB 1NX0A 4HRHA 4OVNF 5JJGA 2WNDA 1NCYA 3GK4X 4E68A 1YRTB 1MHOA 3EK7A 1OZSA 1M46A 4YRUA 2E6WA 2L98A 3BUNB 4HRGA 1JF0A 1NIWA 4U8DA 3S0BA 1LA0A 3KHEA 1DQEA 4MZJA 2M8UA 4HREE 1C3ZA 1IH0A 4N1FA 2JU0A 4WQ3A 5B8IB 4FQOA 4M2OA 2CNPA 5TNCA 5AFPA 3OGNA 1CMFA 1X02A 1K94A 3B86A 2ZRSA 3IQQA 4DIRA 3EK4A 1LA3A 2BCXA 2L2EA 4OZDA 1A75A 2G9BA 3GK1A 3TZ1A 3S0DA 1SK6D 3PATA 1UURA 1XFRA 2QACA 1V1FA 4N1GA 2KQ6A 2LP3A 4PHNA 3SS5A 2RGIA 1JFKA 3FE6A 1Y1XA 5KU1A 2LM5A 2WORA 2PVBA 2JWWA 4MSPA 1CLBA 2I18A 2OPOA 3VGOA 2KSPA 4PE1A 3VRNA 1KQMC 4JWQA 1C07A 1PALA 3BUWB 3O4YA 3TUYC 1C3YA 1WRLA 3PSRA 2LC5A 2WCHA 2JT8A 3OB2B 3EVVA 1BJFA 1ZFSA 3BQ3A 4OR9B 2LE9B 1SR6B 2H61C 3AAJA 3DY9A 2WCEA 4XYNA 1QATA 4PDZA 1XFUO 5CSJA 1ZOTB 1A03A 2K2FA 3QRXA 1LS8A 1SRAA 2K61A 1KK7Z 4YI9A 1PVBA 1UWOA 4QJ3B 3NGVA 3C1VA 1OW4A 1L7ZA 4YGCB 1CDMA 4I5KA 3VRQA 2BCBA 3WHTB 1QV1A 3NSKA 1IWQA 1UP5A 2QDIA 1P28A 1QLKA 3D74A 3I5IB 3V2LA 1YX8A 1DJZA 2KQYA 3I5GC
chains in the Genus database with same CATH topology
1XFZO 4PHMA 1K9UA 1IG5A 4C0JA 1XYDA 3LK0A 1KWOC 1XFWO 5D7FA 1CLLA 1K95A 1UHIA 3JTDB 2BL0C 1IJ5A 2CXJA 2LVVA 4ICBA 2BBMA 2KHNA 2LVIA 1CFPA 1ZMZA 2PRUA 1XFXO 3PM8A 2PASA 3CWGA 1SL8A 4GGFA 3SJSA 2NLNA 1K8UA 1HT9A 1S6JA 1CNPA 1L2OB 1JF2A 2EHBA 3OP0A 2F2PA 3D10A 4CIDA 2KFFA 3EVUA 1J55A 4WQ2A 2LUXA 3HCMA 3SIAA 2KI6C 3BUXB 1XA5A 1PK0D 3DVJA 4IL1A 1KFXS 2KYCA 4AOMA 2QPTA 1RTP1 1QS7A 2KNEA 2LANA 2M7NA 3FS7A 2EGDA 5HLOA 1CDPA 4C0KA 4BY5A 1M31A 5ER5A 1CFDA 1YR5A 2M9GA 3CGAA 1OZOA 4YGAA 3PFVA 5J3XA 1RK9A 3FIAA 4MZLA 1QX2A 1OOJA 1JUOA 2K8MB 1TOPA 3KF9A 2F8PA 4AQIA 2KAVA 1S26D 3H4SE 1S3PA 2KI4C 1FPWA 1FW4A 1F4QA 4ZCVA 5AEQA 2ZRTA 4TNCA 1ZACA 1QV0A 1S6CA 3AAKA 3CR4X 2LVKA 1CM1A 1PSRA 3ZWHA 1YTZC 1S5GZ 4CLNA 1FI6A 1NP8A 4GPLB 3CS1A 3IQOA 3NXAA 1YURA 2FCEA 2HQWA 1XFYO 1OMVA 2E30A 2LP2A 2M3WA 3CR2A 2G2BA 2ZKMX 5HLVA 1J7OA 2L0PA 3I5HB 2FJUB 2OS8C 1AUIB 4DCKA 1SY9A 4HSZA 4A4CA 2LLTA 2PSRA 1H8BA 3DVKA 3EKHA 1KWOB 4PALA 4MVFA 1KSMA 1EXRA 1DF0A 1NUBA 3KEVA 2D8NA 1S6IA 1F8HA 1NPQA 1GQMA 1PRWA 2BE4A 5AXIA 1KK8C 1ODBA 1SYMA 1SCVA 1SPYA 2L4IA 3OHMB 1TCFA 1PVAA 3GK2A 3VRRA 2AAOA 3EVRA 3KPXA 2PALA 1M63B 2B1UA 1UUSA 5BPJA 1KFXL 3F45A 3WNXB 5IBWA 4BY4A 1NX3A 3TS5B 3ZNIA 1DTLA 4YGBB 4WRIA 5CSIA 1QIWA 4GAOA 2LMTA 2KYFA 2LNKA 1WY9A 2OTGB 1EL4A 3K21A 2F3YA 3WHUB 3DF0B 1SCMC 1QASA 1F55A 1DF0B 1RECA 1AK8A 3RLZA 2KDHA 1FI5A 1ZUZA 1TTXA 3GOFA 1CKKA 1OMRA 2NXQA 5AERA 1G33A 1TNWA 2FOTA 3VROA 1WDCB 1PSBA 2M29A 5FYXA 5ER4X 3TUYB 4NDDA 4PE7A 1NCZA 1KSOA 1CM4A 1NWDA 2WC8A 1BT6A 1QXPA 1Y0VH 3DVEA 1K90D 2NCOA 1OMDA 2MLFC 1AHRA 5I2QA 2M49B 1NCXA 2LLUA 1KQMB 1JSAA 1DGVA 5DKRA 3SG7A 2I2RE 2BKIB 4YBHB 3SG2A 2BCAA 1QX5B 5I2OA 3CLNA 4MRYA 4MZKA 2M97A 2IS9A 1J7RA 2MJWB 3EKJA 1U5IB 2A4JA 1B8CA 4NDCA 1N2DA 2P6BB 2SCPA 1CB1A 4MEWA 4C0LA 4AQJA 1RWYA 2ZNEA 2L51A 1BF5A 3A4UB 5GQQC 1IGVA 1RROA 1UHKA 1MWNA 1QTXA 2Q91A 3I5FC 2BKHB 2JTZA 1K93D 1CDNA 3SG4A 1KQVA 1S1EA 2KAXA 4PCWA 5HYDA 2NZ0A 2GGMA 3DVMA 2WCFA 5I2LA 1SBJA 4D1EA 2M1KB 1M39A 4ETOA 1H4BA 3O2PA 3I5IC 1B1GA 2WOSA 1K9PA 1LKJA 4F0ZB 4M2QA 4PHKA 1IKUA 1OSAA 1SKTA 3PN7C 1F70A 2M0RA 4A4BA 3OX5A 1TRFA 3RM1A 5JOLA 5CSFA 5K89A 1Y1AA 1AP4A 5HKZA 3VRPA 1VRKA 2K7OA 1NSHA 1QVIZ 1SL7A 5KTYA 1CDLA 1KFUS 1Y1UA 1DJIA 3PLFB 4PHJA 1BR1B 1N0YA 1S36A 2H2KA 1WRKA 1Q80A 2H61A 2KI6D 3D0YA 3JVTB 2JOJA 2KGBC 1SL9A 1SR6C 1YX7A 4N5XA 2M7LA 1Y6WA 2AUCA 2ZN8A 1JFJA 2L4HA 5HKWA 2EC6C 4CPVA 3LK1A 2MRDA 3FWBA 3O78A 2JRFA 4DUQA 3FWCA 1S5GY 4OKHA 1PULA 1WLMA 1K9KA 5AANA 2LCPA 4CFRA 1N65A 2JZIA 2MLEC 1V1GA 3TDUA 1DGUA 4PE4A 5DKQA 5CSNA 2COLB 2ZNDA 1CMGA 1JBAA 2LHLA 1W7IB 1F71A 3BUMB 2LV7A 2Y1MA 5HKYA 1MXLC 1D1OA 2V53A 4L9MA 1B7TZ 2KBMA 1IRJA 3A8RA 1UHJA 3M0WA 5DKNA 2O5GA 2Y5IA 1SMGA 2MHHA 1ALWA 4FTGA 3LCPC 1AJ4A 1BU3A 2CBLA 3BYAA 4MRXA 4QJ4B 5KSZA 2KFHA 2PMYA 1CLMA 4YGEB 1OE9B 2KFGA 4ORBB 1GGWA 1EJ3A 1XK4A 1J1EA 3LLEA 4JQ0D 4GNKB 1F54A 1DJWA 3EK8A 2KI4B 4ORCB 3SIBA 2F2OA 2SASA 2AMIA 1MF8B 1UHNA 2K7BA 2I94A 1LXFC 4DRWA 4OCIA 1OQPA 2R2IA 1L2OC 1YRUB 1R6PA 2F33A 1ALVA 1NX2A 1E8AA 3ICBA 5F6TA 4MLWA 3DF0A 1IQ3A 4MN0A 1XFVO 1K96A 1A2XA 4M2PA 2HF5A 1B8LA 1QVIY 2CT9A 1CTRA 4QJ5B 4CFQA 1GJYA 1XVJA 2BL0B 1A75B 2LAPA 3I5HC 1YUSA 1CFFA 4ORAB 1EG3A 1FF1A 2M1UA 2MBXA 4GBAA 2LUCA 1MR8A 1WDCC 2Y1NA 3SG3A 2JNXA 3TDZA 2LMVA 1JC2A 3TS5C 1B47A 1SCMB 2O60A 1K2HA 2EC6B 1TNXA 5CPVA 1DJYA 1KK8B 1AJ5A 2CCMA 2TN4A 3BUOB 3BOWA 4R1EA 2ISDA 1IQ5A 2HETA 1TIZA 2LHIA 2LMUA 2OTGC 4I5NB 1WLZA 1WRZA 2I7AA 3BOWB 3PALA 3SG5A 1BOCA 1TCOB 1B8RA 1LVCD 1EH2A 1CFCA 4OV2A 2ZN9A 1NX1A 3OX6A 4USLA 1XK4C 3JTDC 1KK7Y 4I5JA 2WCBA 1C7VA 1BLQA 1DT7B 4GGFC 3WXAA 1IJ6A 1UHHA 1XO5A 4UPGA 4NDBA 4NQGA 1J7QA 2GGZA 2K2AA 4XJKA 1TN4A 1RJVA 4YGDB 4XJKB 3AKAA 5PALA 2VRGA 3SG6A 1B7TY 3HX4A 1A4PA 4GFTA 3MSEB 1C7WA 2JT3A 2JTTA 1GGZA 4PE0A 5D69A 2BECA 4GGNA 1J7PA 2LVJA 1DMOA 2GV5A 2ZFDA 2NCPA 1HQVA 1U5IA 3NSLA 2JQ6A 2JULA 2LLSA 3LL8B 3I5FB 1DJGA 1R2UA 3KO0A 1DVIA 2JXLA 1AVSA 1RFJA 4MBEA 3PN7B 4GUKA 1YVHA 1QIVA 1YVLA 3AKBA 3I5GB 1M45A 2KGRA 2Q4UA 3E3RA 4Q04A 1JWDA 3NSOA 4P2YB 2K7DA 3CZTX 1BR4B 1NYAA 5G08A 4JPZB 4ZCUA 2JT0A 4YI8A 3CR5X 2HPSA 1KCYA 2JNFA 4DS7A 1KFUL 3JVTC 1EG4A 1FBVA 2JPTA 2KOTA 3NSIA 3OB1B 2K7CA 1LINA 1SNLA 1B9AA 2MA2A 1BMOA 2F3ZA 2K0JA 1QJTA 1B4CA 4P5OE 1BODA 1MQ1A 2BBNA 1A29A 2CTNA 2OS8B 2KBIA 2FCDA 2L50A 1DJHA 3O6BA 1F4OA 1TNQA 1G4YR 1MUXA 1QX7A 2MAZA 3TDIA 2JXCA 1YUUA 3IF7A 2L5XB 1DJXA 3DD4A 1MXEA 1J1DA 2HQ8A 5I8NA 1SW8A 2BE6A 2DOQA 2KAYA 3CTNA 3D0YB 1TNPA 2JC2A 1BG1A 2Y4QA 1G8IA 1YUTA 1QLSA 3BXKA 1W7JB 4I5LB 1NX0A 4HRHA 4OVNF 5JJGA 2WNDA 1NCYA 3GK4X 4E68A 1YRTB 1MHOA 3EK7A 1OZSA 1M46A 4YRUA 2E6WA 2L98A 3BUNB 4HRGA 1JF0A 1NIWA 4U8DA 1LA0A 3KHEA 4MZJA 2M8UA 4HREE 1IH0A 4N1FA 2JU0A 4WQ3A 5B8IB 4FQOA 4M2OA 2CNPA 5TNCA 5AFPA 1CMFA 1X02A 1K94A 3IQQA 2ZRSA 4DIRA 3EK4A 1LA3A 2BCXA 2L2EA 1A75A 2G9BA 3GK1A 3TZ1A 1SK6D 3PATA 1UURA 2QACA 4N1GA 1V1FA 2KQ6A 2LP3A 4PHNA 2RGIA 1JFKA 1Y1XA 5KU1A 2LM5A 2WORA 2PVBA 2JWWA 4MSPA 1CLBA 2I18A 2OPOA 3VGOA 2KSPA 4PE1A 3VRNA 1KQMC 4JWQA 1C07A 1PALA 3BUWB 3O4YA 3TUYC 1WRLA 3PSRA 2LC5A 2JT8A 3OB2B 3EVVA 1BJFA 1ZFSA 3BQ3A 4OR9B 2LE9B 1SR6B 2H61C 3AAJA 2WCEA 4XYNA 1QATA 4PDZA 1XFUO 5CSJA 1ZOTB 1A03A 2K2FA 3QRXA 1SRAA 2K61A 1KK7Z 4YI9A 1PVBA 1UWOA 4QJ3B 3C1VA 1L7ZA 4YGCB 1CDMA 4I5KA 3VRQA 2BCBA 3WHTB 1QV1A 3NSKA 1IWQA 1UP5A 1QLKA 3I5IB 1YX8A 1DJZA 2KQYA 3I5GC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XFZ O;  4PHM A;  1K9U A;  1IG5 A;  4C0J A;  1XYD A;  3LK0 A;  1KWO C;  1XFW O;  5D7F A;  1CLL A;  1K95 A;  1UHI A;  3JTD B;  2BL0 C;  1IJ5 A;  2CXJ A;  2LVV A;  4ICB A;  2BBM A;  2KHN A;  2LVI A;  1CFP A;  1ZMZ A;  2PRU A;  1XFX O;  3PM8 A;  2PAS A;  3CWG A;  1SL8 A;  4GGF A;  3SJS A;  2NLN A;  1K8U A;  1HT9 A;  1S6J A;  1CNP A;  1L2O B;  1JF2 A;  2EHB A;  3OP0 A;  2F2P A;  3D10 A;  4CID A;  2KFF A;  3EVU A;  1J55 A;  4WQ2 A;  2LUX A;  3HCM A;  3SIA A;  2KI6 C;  3BUX B;  1XA5 A;  1PK0 D;  3DVJ A;  4IL1 A;  1KFX S;  2KYC A;  4AOM A;  2QPT A;  1RTP 1;  1QS7 A;  2KNE A;  2LAN A;  2M7N A;  3FS7 A;  2EGD A;  5HLO A;  1CDP A;  4C0K A;  4BY5 A;  1M31 A;  5ER5 A;  1CFD A;  1YR5 A;  2M9G A;  3CGA A;  1OZO A;  4YGA A;  3PFV A;  5J3X A;  1RK9 A;  3FIA A;  4MZL A;  1QX2 A;  1OOJ A;  1JUO A;  2K8M B;  1TOP A;  3KF9 A;  2F8P A;  4AQI A;  2KAV A;  1S26 D;  3H4S E;  1S3P A;  2KI4 C;  1FPW A;  1FW4 A;  1F4Q A;  4ZCV A;  5AEQ A;  2ZRT A;  4TNC A;  1ZAC A;  1QV0 A;  1S6C A;  3AAK A;  3CR4 X;  2LVK A;  1CM1 A;  1PSR A;  3ZWH A;  1YTZ C;  1S5G Z;  4CLN A;  1FI6 A;  1NP8 A;  4GPL B;  3CS1 A;  3IQO A;  3NXA A;  1YUR A;  2FCE A;  2HQW A;  1XFY O;  1OMV A;  2E30 A;  2LP2 A;  2M3W A;  3CR2 A;  2G2B A;  2ZKM X;  5HLV A;  1J7O A;  2L0P A;  3I5H B;  2FJU B;  2OS8 C;  1AUI B;  4DCK A;  1SY9 A;  4HSZ A;  4A4C A;  2LLT A;  2PSR A;  1H8B A;  3DVK A;  3EKH A;  1KWO B;  4PAL A;  4MVF A;  1KSM A;  1EXR A;  1DF0 A;  1NUB A;  3KEV A;  2D8N A;  1S6I A;  1F8H A;  1NPQ A;  1GQM A;  1PRW A;  2BE4 A;  5AXI A;  1KK8 C;  1ODB A;  1SYM A;  1SCV A;  1SPY A;  2L4I A;  3OHM B;  1TCF A;  1PVA A;  3GK2 A;  3VRR A;  2AAO A;  3EVR A;  3KPX A;  2PAL A;  1M63 B;  2B1U A;  1UUS A;  5BPJ A;  1KFX L;  3F45 A;  3WNX B;  5IBW A;  4BY4 A;  1NX3 A;  3TS5 B;  3ZNI A;  1DTL A;  4YGB B;  4WRI A;  5CSI A;  1QIW A;  4GAO A;  2LMT A;  2KYF A;  2LNK A;  1WY9 A;  2OTG B;  1EL4 A;  3K21 A;  2F3Y A;  3WHU B;  3DF0 B;  1SCM C;  1QAS A;  1F55 A;  1DF0 B;  1REC A;  1AK8 A;  3RLZ A;  2KDH A;  1FI5 A;  1ZUZ A;  1TTX A;  3GOF A;  1CKK A;  1OMR A;  2NXQ A;  5AER A;  1G33 A;  1TNW A;  2FOT A;  3VRO A;  1WDC B;  1PSB A;  2M29 A;  5FYX A;  5ER4 X;  3TUY B;  4NDD A;  4PE7 A;  1NCZ A;  1KSO A;  1CM4 A;  1NWD A;  2WC8 A;  1BT6 A;  1QXP A;  1Y0V H;  3DVE A;  1K90 D;  2NCO A;  1OMD A;  2MLF C;  1AHR A;  5I2Q A;  2M49 B;  1NCX A;  2LLU A;  1KQM B;  1JSA A;  1DGV A;  5DKR A;  3SG7 A;  2I2R E;  2BKI B;  4YBH B;  3SG2 A;  2BCA A;  1QX5 B;  5I2O A;  3CLN A;  4MRY A;  4MZK A;  2M97 A;  2IS9 A;  1J7R A;  2MJW B;  3EKJ A;  1U5I B;  2A4J A;  1B8C A;  4NDC A;  1N2D A;  2P6B B;  2SCP A;  1CB1 A;  4MEW A;  4C0L A;  4AQJ A;  1RWY A;  2ZNE A;  2L51 A;  1BF5 A;  3A4U B;  5GQQ C;  1IGV A;  1RRO A;  1UHK A;  1MWN A;  1QTX A;  2Q91 A;  3I5F C;  2BKH B;  2JTZ A;  1K93 D;  1CDN A;  3SG4 A;  1KQV A;  1S1E A;  2KAX A;  4PCW A;  5HYD A;  2NZ0 A;  2GGM A;  3DVM A;  2WCF A;  5I2L A;  1SBJ A;  4D1E A;  2M1K B;  1M39 A;  4ETO A;  1H4B A;  3O2P A;  3I5I C;  1B1G A;  2WOS A;  1K9P A;  1LKJ A;  4F0Z B;  4M2Q A;  4PHK A;  1IKU A;  1OSA A;  1SKT A;  3PN7 C;  1F70 A;  2M0R A;  4A4B A;  3OX5 A;  1TRF A;  3RM1 A;  5JOL A;  5CSF A;  5K89 A;  1Y1A A;  1AP4 A;  5HKZ A;  3VRP A;  1VRK A;  2K7O A;  1NSH A;  1QVI Z;  1SL7 A;  5KTY A;  1CDL A;  1KFU S;  1Y1U A;  1DJI A;  3PLF B;  4PHJ A;  1BR1 B;  1N0Y A;  1S36 A;  2H2K A;  1WRK A;  1Q80 A;  2H61 A;  2KI6 D;  3D0Y A;  3JVT B;  2JOJ A;  2KGB C;  1SL9 A;  1SR6 C;  1YX7 A;  4N5X A;  2M7L A;  1Y6W A;  2AUC A;  2ZN8 A;  1JFJ A;  2L4H A;  5HKW A;  2EC6 C;  4CPV A;  3LK1 A;  2MRD A;  3FWB A;  3O78 A;  2JRF A;  4DUQ A;  3FWC A;  1S5G Y;  4OKH A;  1PUL A;  1WLM A;  1K9K A;  5AAN A;  2LCP A;  4CFR A;  1N65 A;  2JZI A;  2MLE C;  1V1G A;  3TDU A;  1DGU A;  4PE4 A;  5DKQ A;  5CSN A;  2COL B;  2ZND A;  1CMG A;  1JBA A;  2LHL A;  1W7I B;  1F71 A;  3BUM B;  2LV7 A;  2Y1M A;  5HKY A;  1MXL C;  1D1O A;  2V53 A;  4L9M A;  1B7T Z;  2KBM A;  1IRJ A;  3A8R A;  1UHJ A;  3M0W A;  5DKN A;  2O5G A;  2Y5I A;  1SMG A;  2MHH A;  1ALW A;  4FTG A;  3LCP C;  1AJ4 A;  1BU3 A;  2CBL A;  3BYA A;  4MRX A;  4QJ4 B;  5KSZ A;  2KFH A;  2PMY A;  1CLM A;  4YGE B;  1OE9 B;  2KFG A;  4ORB B;  1GGW A;  1EJ3 A;  1XK4 A;  1J1E A;  3LLE A;  4JQ0 D;  4GNK B;  1F54 A;  1DJW A;  3EK8 A;  2KI4 B;  4ORC B;  3SIB A;  2F2O A;  2SAS A;  2AMI A;  1MF8 B;  1UHN A;  2K7B A;  2I94 A;  1LXF C;  4DRW A;  4OCI A;  1OQP A;  2R2I A;  1L2O C;  1YRU B;  1R6P A;  2F33 A;  1ALV A;  1NX2 A;  1E8A A;  3ICB A;  5F6T A;  4MLW A;  3DF0 A;  1IQ3 A;  4MN0 A;  1XFV O;  1K96 A;  1A2X A;  4M2P A;  2HF5 A;  1B8L A;  1QVI Y;  2CT9 A;  1CTR A;  4QJ5 B;  4CFQ A;  1GJY A;  1XVJ A;  2BL0 B;  1A75 B;  2LAP A;  3I5H C;  1YUS A;  1CFF A;  4ORA B;  1EG3 A;  1FF1 A;  2M1U A;  2MBX A;  4GBA A;  2LUC A;  1MR8 A;  1WDC C;  2Y1N A;  3SG3 A;  2JNX A;  3TDZ A;  2LMV A;  1JC2 A;  3TS5 C;  1B47 A;  1SCM B;  2O60 A;  1K2H A;  2EC6 B;  1TNX A;  5CPV A;  1DJY A;  1KK8 B;  1AJ5 A;  2CCM A;  2TN4 A;  3BUO B;  3BOW A;  4R1E A;  2ISD A;  1IQ5 A;  2HET A;  1TIZ A;  2LHI A;  2LMU A;  2OTG C;  4I5N B;  1WLZ A;  1WRZ A;  2I7A A;  3BOW B;  3PAL A;  3SG5 A;  1BOC A;  1TCO B;  1B8R A;  1LVC D;  1EH2 A;  1CFC A;  4OV2 A;  2ZN9 A;  1NX1 A;  3OX6 A;  4USL A;  1XK4 C;  3JTD C;  1KK7 Y;  4I5J A;  2WCB A;  1C7V A;  1BLQ A;  1DT7 B;  4GGF C;  3WXA A;  1IJ6 A;  1UHH A;  1XO5 A;  4UPG A;  4NDB A;  4NQG A;  1J7Q A;  2GGZ A;  2K2A A;  4XJK A;  1TN4 A;  1RJV A;  4YGD B;  4XJK B;  3AKA A;  5PAL A;  2VRG A;  3SG6 A;  1B7T Y;  3HX4 A;  1A4P A;  4GFT A;  3MSE B;  1C7W A;  2JT3 A;  2JTT A;  1GGZ A;  4PE0 A;  5D69 A;  2BEC A;  4GGN A;  1J7P A;  2LVJ A;  1DMO A;  2GV5 A;  2ZFD A;  2NCP A;  1HQV A;  1U5I A;  3NSL A;  2JQ6 A;  2JUL A;  2LLS A;  3LL8 B;  3I5F B;  1DJG A;  1R2U A;  3KO0 A;  1DVI A;  2JXL A;  1AVS A;  1RFJ A;  4MBE A;  3PN7 B;  4GUK A;  1YVH A;  1QIV A;  1YVL A;  3AKB A;  3I5G B;  1M45 A;  2KGR A;  2Q4U A;  3E3R A;  4Q04 A;  1JWD A;  3NSO A;  4P2Y B;  2K7D A;  3CZT X;  1BR4 B;  1NYA A;  5G08 A;  4JPZ B;  4ZCU A;  2JT0 A;  4YI8 A;  3CR5 X;  2HPS A;  1KCY A;  2JNF A;  4DS7 A;  1KFU L;  3JVT C;  1EG4 A;  1FBV A;  2JPT A;  2KOT A;  3NSI A;  3OB1 B;  2K7C A;  1LIN A;  1SNL A;  1B9A A;  2MA2 A;  1BMO A;  2F3Z A;  2K0J A;  1QJT A;  1B4C A;  4P5O E;  1BOD A;  1MQ1 A;  2BBN A;  1A29 A;  2CTN A;  2OS8 B;  2KBI A;  2FCD A;  2L50 A;  1DJH A;  3O6B A;  1F4O A;  1TNQ A;  1G4Y R;  1MUX A;  1QX7 A;  2MAZ A;  3TDI A;  2JXC A;  1YUU A;  3IF7 A;  2L5X B;  1DJX A;  3DD4 A;  1MXE A;  1J1D A;  2HQ8 A;  5I8N A;  1SW8 A;  2BE6 A;  2DOQ A;  2KAY A;  3CTN A;  3D0Y B;  1TNP A;  2JC2 A;  1BG1 A;  2Y4Q A;  1G8I A;  1YUT A;  1QLS A;  3BXK A;  1W7J B;  4I5L B;  1NX0 A;  4HRH A;  4OVN F;  5JJG A;  2WND A;  1NCY A;  3GK4 X;  4E68 A;  1YRT B;  1MHO A;  3EK7 A;  1OZS A;  1M46 A;  4YRU A;  2E6W A;  2L98 A;  3BUN B;  4HRG A;  1JF0 A;  1NIW A;  4U8D A;  1LA0 A;  3KHE A;  4MZJ A;  2M8U A;  4HRE E;  1IH0 A;  4N1F A;  2JU0 A;  4WQ3 A;  5B8I B;  4FQO A;  4M2O A;  2CNP A;  5TNC A;  5AFP A;  1CMF A;  1X02 A;  1K94 A;  3IQQ A;  2ZRS A;  4DIR A;  3EK4 A;  1LA3 A;  2BCX A;  2L2E A;  1A75 A;  2G9B A;  3GK1 A;  3TZ1 A;  1SK6 D;  3PAT A;  1UUR A;  2QAC A;  4N1G A;  1V1F A;  2KQ6 A;  2LP3 A;  4PHN A;  2RGI A;  1JFK A;  1Y1X A;  5KU1 A;  2LM5 A;  2WOR A;  2PVB A;  2JWW A;  4MSP A;  1CLB A;  2I18 A;  2OPO A;  3VGO A;  2KSP A;  4PE1 A;  3VRN A;  1KQM C;  4JWQ A;  1C07 A;  1PAL A;  3BUW B;  3O4Y A;  3TUY C;  1WRL A;  3PSR A;  2LC5 A;  2JT8 A;  3OB2 B;  3EVV A;  1BJF A;  1ZFS A;  3BQ3 A;  4OR9 B;  2LE9 B;  1SR6 B;  2H61 C;  3AAJ A;  2WCE A;  4XYN A;  1QAT A;  4PDZ A;  1XFU O;  5CSJ A;  1ZOT B;  1A03 A;  2K2F A;  3QRX A;  1SRA A;  2K61 A;  1KK7 Z;  4YI9 A;  1PVB A;  1UWO A;  4QJ3 B;  3C1V A;  1L7Z A;  4YGC B;  1CDM A;  4I5K A;  3VRQ A;  2BCB A;  3WHT B;  1QV1 A;  3NSK A;  1IWQ A;  1UP5 A;  1QLK A;  3I5I B;  1YX8 A;  1DJZ A;  2KQY A;  3I5G C; 
#chains in the Genus database with same CATH topology
 1XFZ O;  4PHM A;  1K9U A;  1IG5 A;  4C0J A;  4KYN A;  1XYD A;  3LK0 A;  1KWO C;  1XFW O;  3R1O A;  5D7F A;  3TDI A;  1CLL A;  1K95 A;  1UHI A;  2H8V A;  3JTD B;  2BL0 C;  1IJ5 A;  2CXJ A;  2LVV A;  4ICB A;  2BBM A;  2KHN A;  2LVI A;  1CFP A;  1ZMZ A;  2PRU A;  1XFX O;  2KPH A;  3PM8 A;  2PAS A;  3CWG A;  1SL8 A;  4GGF A;  2KLE A;  3SJS A;  2NLN A;  1K8U A;  1HT9 A;  1S6J A;  1CNP A;  1L2O B;  1JF2 A;  2EHB A;  3OP0 A;  2F2P A;  3D10 A;  4CID A;  2KFF A;  3EVU A;  1J55 A;  4WQ2 A;  3IVT A;  2LUX A;  3HCM A;  3SIA A;  2KI6 C;  3BUX B;  1SSE B;  1XA5 A;  1PK0 D;  3DVJ A;  1QWV A;  4IL1 A;  1KFX S;  2KYC A;  4AOM A;  1T14 A;  2QPT A;  1RTP 1;  1QS7 A;  2KNE A;  2LAN A;  2M7N A;  2P71 A;  2EGD A;  3D73 A;  1CDP A;  3FS7 A;  5HLO A;  4C0K A;  4BY5 A;  1DC1 A;  1M31 A;  2WC5 A;  5ER5 A;  3PM2 A;  1CFD A;  1YR5 A;  2M9G A;  3CGA A;  1OZO A;  4YGA A;  3PFV A;  5J3X A;  1RK9 A;  3FIA A;  4MZL A;  1QX2 A;  3B88 A;  1OOJ A;  1JUO A;  2K8M B;  1TOP A;  3KF9 A;  2F8P A;  4AQI A;  2KAV A;  1S26 D;  3H4S E;  1S3P A;  2KI4 C;  1FPW A;  1FW4 A;  1F4Q A;  4ZCV A;  5AEQ A;  2ZRT A;  4TNC A;  1ZAC A;  1QV0 A;  2PYQ A;  3QME A;  1S6C A;  3AAK A;  3CR4 X;  2LVK A;  1CM1 A;  2P70 A;  1PSR A;  3ZWH A;  1YTZ C;  1S5G Z;  4CLN A;  1FI6 A;  1NP8 A;  4GPL B;  2FJY A;  3CS1 A;  3IQO A;  3NXA A;  4IJ7 A;  1YUR A;  2FCE A;  5FI7 A;  2HQW A;  1XFY O;  1OMV A;  2E30 A;  2LP2 A;  2M3W A;  3CR2 A;  2G2B A;  2ZKM X;  3FE8 A;  5HLV A;  1J7O A;  2L0P A;  3EG5 B;  3I5H B;  2FJU B;  2OS8 C;  1AUI B;  4DCK A;  1SY9 A;  4HSZ A;  4A4C A;  2LLT A;  2PSR A;  1H8B A;  3DVK A;  3EKH A;  1KWO B;  4PAL A;  2WCM A;  4MVF A;  1KSM A;  1EXR A;  1DF0 A;  1NUB A;  3KEV A;  2D8N A;  1S6I A;  1F8H A;  1NPQ A;  1GQM A;  1PRW A;  2BE4 A;  5AXI A;  1KK8 C;  1ODB A;  1SYM A;  3D75 A;  1SCV A;  1SPY A;  3S0A A;  2L4I A;  3BFB A;  3OHM B;  1TCF A;  1PVA A;  3GK2 A;  3RZS A;  3VRR A;  2AAO A;  3EVR A;  3KPX A;  2PAL A;  1M63 B;  4JKT A;  2B1U A;  2YGU A;  1UUS A;  5BPJ A;  1KFX L;  3F45 A;  3WNX B;  5IBW A;  4BY4 A;  1NX3 A;  3TS5 B;  3ZNI A;  1DTL A;  4YGB B;  4WRI A;  5CSI A;  1QIW A;  4GAO A;  2LMT A;  2KYF A;  2LNK A;  4FQT A;  1WY9 A;  2OTG B;  1EL4 A;  3K21 A;  3K1E A;  3SS3 A;  2F3Y A;  3WHU B;  1W9Z A;  3DF0 B;  1SCM C;  1QAS A;  1F55 A;  1DF0 B;  1REC A;  3DXL A;  1AK8 A;  3RLZ A;  2KDH A;  1FI5 A;  1OOF A;  1ZUZ A;  1TTX A;  3GOF A;  1CKK A;  1OMR A;  2NXQ A;  5AER A;  1G33 A;  1TNW A;  2FOT A;  3VRO A;  1WDC B;  1PSB A;  2M29 A;  5FYX A;  5ER4 X;  3TUY B;  4NDD A;  4PE7 A;  1NCZ A;  1KSO A;  1CM4 A;  1NWD A;  2WC8 A;  3S0F A;  1BT6 A;  1QXP A;  1Y0V H;  3DVE A;  1K90 D;  2NCO A;  1OMD A;  2MLF C;  1AHR A;  5I2Q A;  2M49 B;  1NCX A;  2LLU A;  1KQM B;  1JSA A;  1DGV A;  5DKR A;  3D76 A;  3SG7 A;  2I2R E;  2BKI B;  4YBH B;  3SG2 A;  2BCA A;  1QX5 B;  5I2O A;  3PJI A;  3CLN A;  4MRY A;  2QEB A;  2M97 A;  4MZK A;  2IS9 A;  1J7R A;  2MJW B;  5D3O A;  3EKJ A;  1U5I B;  2A4J A;  3CZ2 A;  1B8C A;  4NDC A;  1N2D A;  2P6B B;  2SCP A;  1CB1 A;  4MEW A;  4C0L A;  4AQJ A;  1RWY A;  2QEH A;  2L51 A;  2ZNE A;  3A4U B;  3R1P A;  5GQQ C;  1BF5 A;  1IGV A;  1RRO A;  1UHK A;  1MWN A;  1QTX A;  2Q91 A;  3I5F C;  2BKH B;  3R72 A;  2JTZ A;  1K93 D;  1CDN A;  3SG4 A;  1KQV A;  1S1E A;  3R1V A;  2KAX A;  4PCW A;  5HYD A;  2NZ0 A;  2GGM A;  3DVM A;  2WCF A;  5I2L A;  1SBJ A;  4D1E A;  2M1K B;  3Q8I A;  1M39 A;  4ETO A;  1H4B A;  3O2P A;  3I5I C;  1B1G A;  3BFH A;  2WOS A;  1ORG A;  1K9P A;  1LKJ A;  1OOH A;  1Z4H A;  4M2Q A;  4F0Z B;  4PHK A;  1IKU A;  1OSA A;  1SKT A;  3CYZ A;  3PN7 C;  5FI6 A;  1F70 A;  2M0R A;  4A4B A;  3OX5 A;  1TRF A;  3RM1 A;  5JOL A;  5CSF A;  5K89 A;  1Y1A A;  2BNX A;  1AP4 A;  3UO9 A;  5HKZ A;  3VRP A;  1VRK A;  2K7O A;  1NSH A;  1QVI Z;  2QEV A;  1SL7 A;  5KTY A;  1CDL A;  2L2C A;  1KFU S;  1Y1U A;  1DJI A;  3PLF B;  4PHJ A;  1BR1 B;  1N0Y A;  1S36 A;  2H2K A;  1WRK A;  1Q80 A;  2H61 A;  2KI6 D;  3D0Y A;  3JVT B;  2JOJ A;  2KGB C;  1SL9 A;  1SR6 C;  1YX7 A;  3B7A A;  4N5X A;  3UNW A;  3BFA A;  1Y6W A;  2M7L A;  2AUC A;  2ZN8 A;  2KLD A;  1JFJ A;  3D78 A;  2L4H A;  5HKW A;  2EC6 C;  4CPV A;  3LK1 A;  2MRD A;  3FWB A;  3O78 A;  2JRF A;  4DUQ A;  3FWC A;  2JPO A;  2QEO A;  1S5G Y;  2PQL A;  4OKH A;  1PUL A;  1WLM A;  1K9K A;  3S0G A;  5AAN A;  2LCP A;  3CDN A;  4CFR A;  4INW A;  1N65 A;  2JZI A;  2MLE C;  5HL1 A;  1V1G A;  3B6X A;  3TDU A;  1DGU A;  1TUJ A;  3CZ0 A;  4PE4 A;  5DKQ A;  5CSN A;  2COL B;  2ZND A;  1CMG A;  1JBA A;  2LHL A;  1W7I B;  1F71 A;  3BUM B;  2LV7 A;  2Y1M A;  5HKY A;  1MXL C;  1D1O A;  2V53 A;  2BAP A;  1B7T Z;  4L9M A;  2KBM A;  1IRJ A;  3A8R A;  1UHJ A;  3M0W A;  5DKN A;  2O5G A;  2Y5I A;  1SMG A;  2MHH A;  1ALW A;  4FTG A;  3LCP C;  1AJ4 A;  1BU3 A;  2CBL A;  3BYA A;  4MRX A;  4QJ4 B;  1GM0 A;  5KSZ A;  2KFH A;  2PMY A;  1CLM A;  2WCK A;  1OE9 B;  2KFG A;  3DZT A;  3NHI A;  4ORB B;  1EJ3 A;  1XK4 A;  1J1E A;  3LLE A;  4JQ0 D;  4GNK B;  1F54 A;  5EL2 A;  1DJW A;  3EK8 A;  2KI4 B;  4ORC B;  3SIB A;  1IIO A;  2F2O A;  2GTE A;  2SAS A;  2AMI A;  1MF8 B;  1UHN A;  2K7B A;  3FE9 A;  2I94 A;  1LXF C;  4DRW A;  4OCI A;  1OQP A;  2R2I A;  1L2O C;  1YRU B;  1R6P A;  2F33 A;  5I94 A;  1ALV A;  1NX2 A;  1E8A A;  3ICB A;  5F6T A;  4MLW A;  3DF0 A;  1IQ3 A;  4MN0 A;  1XFV O;  4F7F A;  1K96 A;  1A2X A;  4M2P A;  2HF5 A;  1B8L A;  1QVI Y;  2CT9 A;  1CTR A;  1TWO A;  4QJ5 B;  4CFQ A;  1GJY A;  3SS4 A;  1XVJ A;  2BL0 B;  1A75 B;  2LAP A;  3I5H C;  1YUS A;  1CFF A;  4ORA B;  1EG3 A;  1FF1 A;  2M1U A;  2MBX A;  4GBA A;  2LUC A;  1MR8 A;  1WDC C;  2Y1N A;  4YGE B;  2JNX A;  2L5Y A;  3SG3 A;  3L4A A;  3TDZ A;  2LMV A;  1JC2 A;  3TS5 C;  1B47 A;  1SCM B;  2O60 A;  3B87 A;  2ISD A;  1K2H A;  3L4L A;  2EC6 B;  1TNX A;  5CPV A;  1DJY A;  1KK8 B;  1AJ5 A;  2CCM A;  2TN4 A;  3BUO B;  3BOW A;  3O4X A;  4R1E A;  1IQ5 A;  2HET A;  1TIZ A;  2LHI A;  2LMU A;  2OTG C;  2WC6 A;  1WLZ A;  1WRZ A;  2I7A A;  3BOW B;  3PAL A;  4I5N B;  3SG5 A;  1TCO B;  1B8R A;  1LVC D;  1BOC A;  1EH2 A;  1CFC A;  4OV2 A;  2ZN9 A;  1NX1 A;  3OX6 A;  4USL A;  1XK4 C;  3JTD C;  1KK7 Y;  1OOG A;  4I5J A;  2WCB A;  4INX A;  1C7V A;  1BLQ A;  1DT7 B;  4GGF C;  3WXA A;  1IJ6 A;  3L47 A;  3S0E A;  5DIC A;  1UHH A;  1XO5 A;  4UPG A;  4NDB A;  4NQG A;  1J7Q A;  2GGZ A;  2K2A A;  4XJK A;  1TN4 A;  1RJV A;  4YGD B;  4XJK B;  3AKA A;  5PAL A;  2VRG A;  3SG6 A;  1B7T Y;  3HX4 A;  5FI2 A;  1A4P A;  1TUZ A;  4GFT A;  3MSE B;  1C7W A;  2WCL A;  2JT3 A;  2JTT A;  1GGZ A;  4PE0 A;  5D69 A;  2BEC A;  4GGN A;  1J7P A;  2LVJ A;  1DMO A;  2GV5 A;  2ZFD A;  2NCP A;  1HQV A;  1U5I A;  3NSL A;  2JQ6 A;  2JUL A;  2LLS A;  3VB1 A;  2WCJ A;  3I5F B;  1DJG A;  1R2U A;  3LL8 B;  3KO0 A;  1DVI A;  2JXL A;  1AVS A;  1RFJ A;  4MBE A;  3PN7 B;  4GUK A;  1YVH A;  1QIV A;  1YVL A;  2K60 A;  3AKB A;  1M45 A;  3I5G B;  2KGR A;  2ERB A;  3CZ1 A;  1DEL A;  2Q4U A;  3E3R A;  4Q04 A;  1JWD A;  3NSO A;  4P2Y B;  2K7D A;  3CZT X;  1BR4 B;  3D77 A;  1NYA A;  1Z2C B;  5G08 A;  1DEK A;  4JPZ B;  4ZCU A;  2JT0 A;  4YI8 A;  3CR5 X;  2HPS A;  1KCY A;  2JNF A;  4DS7 A;  4JD9 A;  1KFU L;  3JVT C;  1EG4 A;  1FBV A;  2JPT A;  2KOT A;  3NSI A;  3OB1 B;  2K7C A;  1LIN A;  1SNL A;  1B9A A;  2MA2 A;  1BMO A;  1GGW A;  2F3Z A;  2K0J A;  1QJT A;  1B4C A;  4P5O E;  1BOD A;  1MQ1 A;  2BBN A;  1A29 A;  2CTN A;  1OOI X;  2OS8 B;  2KBI A;  2FCD A;  2L50 A;  1DJH A;  3O6B A;  1F4O A;  1TNQ A;  1G4Y R;  1MUX A;  1QX7 A;  2MAZ A;  3OBV A;  2JXC A;  1YUU A;  3IF7 A;  2L5X B;  3BJH A;  1DJX A;  3DD4 A;  1MXE A;  1J1D A;  2HQ8 A;  5I8N A;  1SW8 A;  2BE6 A;  2DOQ A;  2KAY A;  3CAB A;  3CTN A;  3D0Y B;  1TNP A;  2JC2 A;  4PT1 A;  1BG1 A;  2Y4Q A;  3N7H A;  1G8I A;  1YUT A;  3DYE A;  1QLS A;  3NHT A;  3BXK A;  1W7J B;  4I5L B;  1NX0 A;  4HRH A;  4OVN F;  5JJG A;  2WND A;  1NCY A;  3GK4 X;  4E68 A;  1YRT B;  1MHO A;  3EK7 A;  1OZS A;  1M46 A;  4YRU A;  2E6W A;  2L98 A;  3BUN B;  4HRG A;  1JF0 A;  1NIW A;  4U8D A;  3S0B A;  1LA0 A;  3KHE A;  1DQE A;  4MZJ A;  2M8U A;  4HRE E;  1C3Z A;  1IH0 A;  4N1F A;  2JU0 A;  4WQ3 A;  5B8I B;  4FQO A;  4M2O A;  2CNP A;  5TNC A;  5AFP A;  3OGN A;  1CMF A;  1X02 A;  1K94 A;  3B86 A;  2ZRS A;  3IQQ A;  4DIR A;  3EK4 A;  1LA3 A;  2BCX A;  2L2E A;  4OZD A;  1A75 A;  2G9B A;  3GK1 A;  3TZ1 A;  3S0D A;  1SK6 D;  3PAT A;  1UUR A;  1XFR A;  2QAC A;  1V1F A;  4N1G A;  2KQ6 A;  2LP3 A;  4PHN A;  3SS5 A;  2RGI A;  1JFK A;  3FE6 A;  1Y1X A;  5KU1 A;  2LM5 A;  2WOR A;  2PVB A;  2JWW A;  4MSP A;  1CLB A;  2I18 A;  2OPO A;  3VGO A;  2KSP A;  4PE1 A;  3VRN A;  1KQM C;  4JWQ A;  1C07 A;  1PAL A;  3BUW B;  3O4Y A;  3TUY C;  1C3Y A;  1WRL A;  3PSR A;  2LC5 A;  2WCH A;  2JT8 A;  3OB2 B;  3EVV A;  1BJF A;  1ZFS A;  3BQ3 A;  4OR9 B;  2LE9 B;  1SR6 B;  2H61 C;  3AAJ A;  3DY9 A;  2WCE A;  4XYN A;  1QAT A;  4PDZ A;  1XFU O;  5CSJ A;  1ZOT B;  1A03 A;  2K2F A;  3QRX A;  1LS8 A;  1SRA A;  2K61 A;  1KK7 Z;  4YI9 A;  1PVB A;  1UWO A;  4QJ3 B;  3NGV A;  3C1V A;  1OW4 A;  1L7Z A;  4YGC B;  1CDM A;  4I5K A;  3VRQ A;  2BCB A;  3WHT B;  1QV1 A;  3NSK A;  1IWQ A;  1UP5 A;  2QDI A;  1P28 A;  1QLK A;  3D74 A;  3I5I B;  3V2L A;  1YX8 A;  1DJZ A;  2KQY A;  3I5G C; 
#chains in the Genus database with same CATH homology
 1XFZ O;  4PHM A;  1K9U A;  1IG5 A;  4C0J A;  1XYD A;  3LK0 A;  1KWO C;  1XFW O;  5D7F A;  1CLL A;  1K95 A;  1UHI A;  3JTD B;  2BL0 C;  1IJ5 A;  2CXJ A;  2LVV A;  4ICB A;  2BBM A;  2KHN A;  2LVI A;  1CFP A;  1ZMZ A;  2PRU A;  1XFX O;  3PM8 A;  2PAS A;  3CWG A;  1SL8 A;  4GGF A;  3SJS A;  2NLN A;  1K8U A;  1HT9 A;  1S6J A;  1CNP A;  1L2O B;  1JF2 A;  2EHB A;  3OP0 A;  2F2P A;  3D10 A;  4CID A;  2KFF A;  3EVU A;  1J55 A;  4WQ2 A;  2LUX A;  3HCM A;  3SIA A;  2KI6 C;  3BUX B;  1XA5 A;  1PK0 D;  3DVJ A;  4IL1 A;  1KFX S;  2KYC A;  4AOM A;  2QPT A;  1RTP 1;  1QS7 A;  2KNE A;  2LAN A;  2M7N A;  3FS7 A;  2EGD A;  5HLO A;  1CDP A;  4C0K A;  4BY5 A;  1M31 A;  5ER5 A;  1CFD A;  1YR5 A;  2M9G A;  3CGA A;  1OZO A;  4YGA A;  3PFV A;  5J3X A;  1RK9 A;  3FIA A;  4MZL A;  1QX2 A;  1OOJ A;  1JUO A;  2K8M B;  1TOP A;  3KF9 A;  2F8P A;  4AQI A;  2KAV A;  1S26 D;  3H4S E;  1S3P A;  2KI4 C;  1FPW A;  1FW4 A;  1F4Q A;  4ZCV A;  5AEQ A;  2ZRT A;  4TNC A;  1ZAC A;  1QV0 A;  1S6C A;  3AAK A;  3CR4 X;  2LVK A;  1CM1 A;  1PSR A;  3ZWH A;  1YTZ C;  1S5G Z;  4CLN A;  1FI6 A;  1NP8 A;  4GPL B;  3CS1 A;  3IQO A;  3NXA A;  1YUR A;  2FCE A;  2HQW A;  1XFY O;  1OMV A;  2E30 A;  2LP2 A;  2M3W A;  3CR2 A;  2G2B A;  2ZKM X;  5HLV A;  1J7O A;  2L0P A;  3I5H B;  2FJU B;  2OS8 C;  1AUI B;  4DCK A;  1SY9 A;  4HSZ A;  4A4C A;  2LLT A;  2PSR A;  1H8B A;  3DVK A;  3EKH A;  1KWO B;  4PAL A;  4MVF A;  1KSM A;  1EXR A;  1DF0 A;  1NUB A;  3KEV A;  2D8N A;  1S6I A;  1F8H A;  1NPQ A;  1GQM A;  1PRW A;  2BE4 A;  5AXI A;  1KK8 C;  1ODB A;  1SYM A;  1SCV A;  1SPY A;  2L4I A;  3OHM B;  1TCF A;  1PVA A;  3GK2 A;  3VRR A;  2AAO A;  3EVR A;  3KPX A;  2PAL A;  1M63 B;  2B1U A;  1UUS A;  5BPJ A;  1KFX L;  3F45 A;  3WNX B;  5IBW A;  4BY4 A;  1NX3 A;  3TS5 B;  3ZNI A;  1DTL A;  4YGB B;  4WRI A;  5CSI A;  1QIW A;  4GAO A;  2LMT A;  2KYF A;  2LNK A;  1WY9 A;  2OTG B;  1EL4 A;  3K21 A;  2F3Y A;  3WHU B;  3DF0 B;  1SCM C;  1QAS A;  1F55 A;  1DF0 B;  1REC A;  1AK8 A;  3RLZ A;  2KDH A;  1FI5 A;  1ZUZ A;  1TTX A;  3GOF A;  1CKK A;  1OMR A;  2NXQ A;  5AER A;  1G33 A;  1TNW A;  2FOT A;  3VRO A;  1WDC B;  1PSB A;  2M29 A;  5FYX A;  5ER4 X;  3TUY B;  4NDD A;  4PE7 A;  1NCZ A;  1KSO A;  1CM4 A;  1NWD A;  2WC8 A;  1BT6 A;  1QXP A;  1Y0V H;  3DVE A;  1K90 D;  2NCO A;  1OMD A;  2MLF C;  1AHR A;  5I2Q A;  2M49 B;  1NCX A;  2LLU A;  1KQM B;  1JSA A;  1DGV A;  5DKR A;  3SG7 A;  2I2R E;  2BKI B;  4YBH B;  3SG2 A;  2BCA A;  1QX5 B;  5I2O A;  3CLN A;  4MRY A;  4MZK A;  2M97 A;  2IS9 A;  1J7R A;  2MJW B;  3EKJ A;  1U5I B;  2A4J A;  1B8C A;  4NDC A;  1N2D A;  2P6B B;  2SCP A;  1CB1 A;  4MEW A;  4C0L A;  4AQJ A;  1RWY A;  2ZNE A;  2L51 A;  1BF5 A;  3A4U B;  5GQQ C;  1IGV A;  1RRO A;  1UHK A;  1MWN A;  1QTX A;  2Q91 A;  3I5F C;  2BKH B;  2JTZ A;  1K93 D;  1CDN A;  3SG4 A;  1KQV A;  1S1E A;  2KAX A;  4PCW A;  5HYD A;  2NZ0 A;  2GGM A;  3DVM A;  2WCF A;  5I2L A;  1SBJ A;  4D1E A;  2M1K B;  1M39 A;  4ETO A;  1H4B A;  3O2P A;  3I5I C;  1B1G A;  2WOS A;  1K9P A;  1LKJ A;  4F0Z B;  4M2Q A;  4PHK A;  1IKU A;  1OSA A;  1SKT A;  3PN7 C;  1F70 A;  2M0R A;  4A4B A;  3OX5 A;  1TRF A;  3RM1 A;  5JOL A;  5CSF A;  5K89 A;  1Y1A A;  1AP4 A;  5HKZ A;  3VRP A;  1VRK A;  2K7O A;  1NSH A;  1QVI Z;  1SL7 A;  5KTY A;  1CDL A;  1KFU S;  1Y1U A;  1DJI A;  3PLF B;  4PHJ A;  1BR1 B;  1N0Y A;  1S36 A;  2H2K A;  1WRK A;  1Q80 A;  2H61 A;  2KI6 D;  3D0Y A;  3JVT B;  2JOJ A;  2KGB C;  1SL9 A;  1SR6 C;  1YX7 A;  4N5X A;  2M7L A;  1Y6W A;  2AUC A;  2ZN8 A;  1JFJ A;  2L4H A;  5HKW A;  2EC6 C;  4CPV A;  3LK1 A;  2MRD A;  3FWB A;  3O78 A;  2JRF A;  4DUQ A;  3FWC A;  1S5G Y;  4OKH A;  1PUL A;  1WLM A;  1K9K A;  5AAN A;  2LCP A;  4CFR A;  1N65 A;  2JZI A;  2MLE C;  1V1G A;  3TDU A;  1DGU A;  4PE4 A;  5DKQ A;  5CSN A;  2COL B;  2ZND A;  1CMG A;  1JBA A;  2LHL A;  1W7I B;  1F71 A;  3BUM B;  2LV7 A;  2Y1M A;  5HKY A;  1MXL C;  1D1O A;  2V53 A;  4L9M A;  1B7T Z;  2KBM A;  1IRJ A;  3A8R A;  1UHJ A;  3M0W A;  5DKN A;  2O5G A;  2Y5I A;  1SMG A;  2MHH A;  1ALW A;  4FTG A;  3LCP C;  1AJ4 A;  1BU3 A;  2CBL A;  3BYA A;  4MRX A;  4QJ4 B;  5KSZ A;  2KFH A;  2PMY A;  1CLM A;  4YGE B;  1OE9 B;  2KFG A;  4ORB B;  1GGW A;  1EJ3 A;  1XK4 A;  1J1E A;  3LLE A;  4JQ0 D;  4GNK B;  1F54 A;  1DJW A;  3EK8 A;  2KI4 B;  4ORC B;  3SIB A;  2F2O A;  2SAS A;  2AMI A;  1MF8 B;  1UHN A;  2K7B A;  2I94 A;  1LXF C;  4DRW A;  4OCI A;  1OQP A;  2R2I A;  1L2O C;  1YRU B;  1R6P A;  2F33 A;  1ALV A;  1NX2 A;  1E8A A;  3ICB A;  5F6T A;  4MLW A;  3DF0 A;  1IQ3 A;  4MN0 A;  1XFV O;  1K96 A;  1A2X A;  4M2P A;  2HF5 A;  1B8L A;  1QVI Y;  2CT9 A;  1CTR A;  4QJ5 B;  4CFQ A;  1GJY A;  1XVJ A;  2BL0 B;  1A75 B;  2LAP A;  3I5H C;  1YUS A;  1CFF A;  4ORA B;  1EG3 A;  1FF1 A;  2M1U A;  2MBX A;  4GBA A;  2LUC A;  1MR8 A;  1WDC C;  2Y1N A;  3SG3 A;  2JNX A;  3TDZ A;  2LMV A;  1JC2 A;  3TS5 C;  1B47 A;  1SCM B;  2O60 A;  1K2H A;  2EC6 B;  1TNX A;  5CPV A;  1DJY A;  1KK8 B;  1AJ5 A;  2CCM A;  2TN4 A;  3BUO B;  3BOW A;  4R1E A;  2ISD A;  1IQ5 A;  2HET A;  1TIZ A;  2LHI A;  2LMU A;  2OTG C;  4I5N B;  1WLZ A;  1WRZ A;  2I7A A;  3BOW B;  3PAL A;  3SG5 A;  1BOC A;  1TCO B;  1B8R A;  1LVC D;  1EH2 A;  1CFC A;  4OV2 A;  2ZN9 A;  1NX1 A;  3OX6 A;  4USL A;  1XK4 C;  3JTD C;  1KK7 Y;  4I5J A;  2WCB A;  1C7V A;  1BLQ A;  1DT7 B;  4GGF C;  3WXA A;  1IJ6 A;  1UHH A;  1XO5 A;  4UPG A;  4NDB A;  4NQG A;  1J7Q A;  2GGZ A;  2K2A A;  4XJK A;  1TN4 A;  1RJV A;  4YGD B;  4XJK B;  3AKA A;  5PAL A;  2VRG A;  3SG6 A;  1B7T Y;  3HX4 A;  1A4P A;  4GFT A;  3MSE B;  1C7W A;  2JT3 A;  2JTT A;  1GGZ A;  4PE0 A;  5D69 A;  2BEC A;  4GGN A;  1J7P A;  2LVJ A;  1DMO A;  2GV5 A;  2ZFD A;  2NCP A;  1HQV A;  1U5I A;  3NSL A;  2JQ6 A;  2JUL A;  2LLS A;  3LL8 B;  3I5F B;  1DJG A;  1R2U A;  3KO0 A;  1DVI A;  2JXL A;  1AVS A;  1RFJ A;  4MBE A;  3PN7 B;  4GUK A;  1YVH A;  1QIV A;  1YVL A;  3AKB A;  3I5G B;  1M45 A;  2KGR A;  2Q4U A;  3E3R A;  4Q04 A;  1JWD A;  3NSO A;  4P2Y B;  2K7D A;  3CZT X;  1BR4 B;  1NYA A;  5G08 A;  4JPZ B;  4ZCU A;  2JT0 A;  4YI8 A;  3CR5 X;  2HPS A;  1KCY A;  2JNF A;  4DS7 A;  1KFU L;  3JVT C;  1EG4 A;  1FBV A;  2JPT A;  2KOT A;  3NSI A;  3OB1 B;  2K7C A;  1LIN A;  1SNL A;  1B9A A;  2MA2 A;  1BMO A;  2F3Z A;  2K0J A;  1QJT A;  1B4C A;  4P5O E;  1BOD A;  1MQ1 A;  2BBN A;  1A29 A;  2CTN A;  2OS8 B;  2KBI A;  2FCD A;  2L50 A;  1DJH A;  3O6B A;  1F4O A;  1TNQ A;  1G4Y R;  1MUX A;  1QX7 A;  2MAZ A;  3TDI A;  2JXC A;  1YUU A;  3IF7 A;  2L5X B;  1DJX A;  3DD4 A;  1MXE A;  1J1D A;  2HQ8 A;  5I8N A;  1SW8 A;  2BE6 A;  2DOQ A;  2KAY A;  3CTN A;  3D0Y B;  1TNP A;  2JC2 A;  1BG1 A;  2Y4Q A;  1G8I A;  1YUT A;  1QLS A;  3BXK A;  1W7J B;  4I5L B;  1NX0 A;  4HRH A;  4OVN F;  5JJG A;  2WND A;  1NCY A;  3GK4 X;  4E68 A;  1YRT B;  1MHO A;  3EK7 A;  1OZS A;  1M46 A;  4YRU A;  2E6W A;  2L98 A;  3BUN B;  4HRG A;  1JF0 A;  1NIW A;  4U8D A;  1LA0 A;  3KHE A;  4MZJ A;  2M8U A;  4HRE E;  1IH0 A;  4N1F A;  2JU0 A;  4WQ3 A;  5B8I B;  4FQO A;  4M2O A;  2CNP A;  5TNC A;  5AFP A;  1CMF A;  1X02 A;  1K94 A;  3IQQ A;  2ZRS A;  4DIR A;  3EK4 A;  1LA3 A;  2BCX A;  2L2E A;  1A75 A;  2G9B A;  3GK1 A;  3TZ1 A;  1SK6 D;  3PAT A;  1UUR A;  2QAC A;  4N1G A;  1V1F A;  2KQ6 A;  2LP3 A;  4PHN A;  2RGI A;  1JFK A;  1Y1X A;  5KU1 A;  2LM5 A;  2WOR A;  2PVB A;  2JWW A;  4MSP A;  1CLB A;  2I18 A;  2OPO A;  3VGO A;  2KSP A;  4PE1 A;  3VRN A;  1KQM C;  4JWQ A;  1C07 A;  1PAL A;  3BUW B;  3O4Y A;  3TUY C;  1WRL A;  3PSR A;  2LC5 A;  2JT8 A;  3OB2 B;  3EVV A;  1BJF A;  1ZFS A;  3BQ3 A;  4OR9 B;  2LE9 B;  1SR6 B;  2H61 C;  3AAJ A;  2WCE A;  4XYN A;  1QAT A;  4PDZ A;  1XFU O;  5CSJ A;  1ZOT B;  1A03 A;  2K2F A;  3QRX A;  1SRA A;  2K61 A;  1KK7 Z;  4YI9 A;  1PVB A;  1UWO A;  4QJ3 B;  3C1V A;  1L7Z A;  4YGC B;  1CDM A;  4I5K A;  3VRQ A;  2BCB A;  3WHT B;  1QV1 A;  3NSK A;  1IWQ A;  1UP5 A;  1QLK A;  3I5I B;  1YX8 A;  1DJZ A;  2KQY A;  3I5G C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...