4ZCUA

Structure of calcium-bound regulatory domain of the human atp-mg/pi carrier in the p2 form
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
153
structure length
152
Chain Sequence
TRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTTGDVNKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLQTLGLTISEQQAELILQSIDVDGTTVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-binding mitochondrial carrier protein SCaMC-1
publication title Calcium-induced conformational changes in the regulatory domain of the human mitochondrial ATP-Mg/Pi carrier.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 51
structure length 152
sequence length 153
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4zcuA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4zcuA02
3KEVA 2JXLA 4MEWA 1DJXA 1J7PA 3CZTX 3BUNB 1AP4A 1QX7A 5DKRA 3K21A 2BL0C 1WLMA 2M8UA 4ZCUA 1BG1A 2HF5A 4CFQA 3OP0A 1E8AA 5KSZA 1K95A 1FBVA 2LCPA 3SG2A 1PVAA 3EVVA 2JOJA 1C07A 1H8BA 2F33A 1RJVA 3NSKA 1M39A 2WORA 3BYAA 1NYAA 3I5GB 4I5JA 2L5XB 2LHIA 2E6WA 5CPVA 2BBMA 3JVTB 1B7TZ 4M2PA 1KWOB 2JXCA 1M63B 1QS7A 1CNPA 1S6JA 2FCDA 1EG3A 5F6TA 1CKKA 1CFDA 4OR9B 3I5FC 2LMUA 3NSLA 1MUXA 1KK8B 2KI6C 3SG6A 4FTGA 1SKTA 2RGIA 1SY9A 1S6CA 3ZWHA 2JULA 3GK4X 1JF0A 1DJYA 4WRIA 2G2BA 4N5XA 3DVEA 2PVBA 5HLVA 2KGRA 2KI6D 3SG4A 1X02A 1XFWO 4PE4A 1Y0VH 5CSFA 2ZN9A 5PALA 2F2PA 2LUXA 1TNQA 1WRZA 1DJWA 1OZOA 1AJ5A 1YURA 4TNCA 2EGDA 2CNPA 3BOWB 1JFKA 2JNXA 2M1UA 4WQ2A 1DF0A 1XVJA 1MXLC 1B47A 2A4JA 2WCBA 4YGEB 1YX7A 2M1KB 1ALVA 4BY4A 1LINA 2LVIA 2LMTA 3C1VA 1JC2A 2KI4B 3IF7A 1NWDA 3I5IC 2LANA 1XFUO 4GNKB 1W7IB 1CDLA 1UUSA 1J7QA 1OOJA 2WNDA 3A8RA 1WY9A 1YRUB 2FCEA 3ZNIA 1FF1A 1UHJA 2WC8A 1TIZA 2HETA 1SCMB 1N65A 1EG4A 1XYDA 3MSEB 1QIWA 3LCPC 2BE4A 2MJWB 2AUCA 4ORAB 3VRQA 4HSZA 2KYCA 1QVIY 2NCPA 1KFUS 3EK4A 5HKYA 2LC5A 4YGCB 1AJ4A 1QLKA 5AXIA 3NSOA 4M2QA 3RLZA 2GV5A 2KSPA 5HYDA 2D8NA 2GGMA 2K7CA 4PHKA 3E3RA 1UHIA 3EVRA 1KFUL 3D0YB 2K7BA 1DJGA 1ZUZA 1IGVA 1QVIZ 1SBJA 1V1GA 1XFYO 4UPGA 1PULA 2ZRTA 3EKHA 3WHUB 2HQ8A 3SIBA 2LLSA 1ZMZA 2ZNDA 3HCMA 4GUKA 1XFZO 2H61A 4IL1A 1M31A 4GGNA 1KQVA 3AKAA 4ETOA 4FQOA 1A75A 1QJTA 2ZRSA 1SPYA 1GQMA 4PDZA 1FI5A 4Q04A 4WQ3A 5IBWA 2AAOA 1SR6B 1CFCA 1KQMC 1JSAA 2AMIA 3OB1B 5D69A 1HT9A 1IJ5A 3CGAA 1BLQA 1QIVA 1SW8A 1S36A 3JTDC 1NSHA 1WLZA 5I2QA 1L2OB 1KK7Y 3LLEA 1DT7B 2JNFA 3DVJA 1MR8A 1ZFSA 2OTGC 1AUIB 2F2OA 4MZLA 1TN4A 2JU0A 2BECA 5ER4X 1JBAA 1YUSA 2CXJA 1AK8A 2JTTA 2LVKA 1G33A 1KK7Z 1J1DA 3H4SE 1UHNA 5HKWA 1EXRA 1TCFA 3BXKA 1QX5B 3PN7B 2MLFC 2BCAA 3SG3A 1WDCC 1GGWA 2K0JA 1A2XA 2CBLA 2BCXA 3OX6A 3TS5B 3PFVA 1CDMA 1XFVO 1OMDA 2L2EA 3PSRA 1YRTB 1M45A 3FWCA 2WCFA 2PSRA 4CLNA 1NX3A 3O4YA 2Y4QA 1L7ZA 1HQVA 4JWQA 1PK0D 2MA2A 2TN4A 3GK1A 4HREE 4ORBB 5DKNA 1KSMA 1QXPA 1DTLA 1BR1B 2BL0B 2K7DA 2NCOA 3DF0B 3LK1A 1JWDA 4PHJA 1SCVA 2FOTA 4OCIA 2KAVA 1YUTA 1IQ5A 2F8PA 2KAYA 1CTRA 1YTZC 1KFXS 3I5GC 1OMRA 3PM8A 1K93D 1Q80A 1R2UA 2KOTA 1SMGA 3JVTC 3TUYC 1BMOA 3AKBA 1MHOA 2BKHB 1EL4A 2M29A 3GK2A 2M3WA 2JT0A 2OS8C 5D7FA 1TRFA 1CDPA 3PLFB 5I2LA 1U5IB 1TTXA 1G8IA 1QATA 4GPLB 2K2AA 5AEQA 1ALWA 1B8RA 1RK9A 1AHRA 1BT6A 1OZSA 1S26D 1BF5A 4GGFA 1XO5A 1KCYA 4CFRA 3D10A 4YGAA 2L50A 2KNEA 3DD4A 1SL9A 2EC6C 2HPSA 4A4CA 1K94A 2VRGA 1LXFC 1TCOB 1FI6A 4I5KA 2O5GA 4C0JA 4YGDB 3TDIA 1DJHA 4MZKA 1Y1XA 4XJKA 2KQ6A 1IWQA 2SASA 3WHTB 4DS7A 1BOCA 2IS9A 4YI8A 1N0YA 1EH2A 2LLUA 2Y1MA 3PATA 2KI4C 2LP3A 2LUCA 2Y1NA 3BQ3A 2H2KA 4GGFC 2R2IA 2WCEA 4PE0A 1UHKA 1PSBA 1TNWA 1NX2A 2M49B 2BE6A 4XYNA 3FWBA 4GFTA 3A4UB 2KYFA 3EVUA 3OX5A 4MZJA 1JF2A 4AQJA 2PRUA 1LVCD 2LNKA 5AFPA 2ZFDA 4ORCB 1NP8A 4MVFA 2JPTA 1J7RA 4F0ZB 2M0RA 1PSRA 5I8NA 2K61A 1NPQA 3AAJA 4JQ0D 2MHHA 4QJ5B 5ER5A 1B1GA 5K89A 1RROA 2F3YA 2M97A 1MWNA 1V1FA 3CS1A 1XK4A 3CTNA 3O78A 1FW4A 1OMVA 1BJFA 2I2RE 1TOPA 3LL8B 1DF0B 3OHMB 1RECA 1Y6WA 3FIAA 1Y1AA 2KFFA 5HKZA 1YUUA 4DUQA 1F4OA 3HX4A 4I5NB 2JT8A 1F8HA 1MXEA 3VRNA 2COLB 4YGBB 3AAKA 1RFJA 4JPZB 2ISDA 4YI9A 2BBNA 1J1EA 3VRPA 1CFPA 1GJYA 2KBIA 1CMGA 1K90D 3I5HC 1QX2A 2MRDA 4P2YB 1SR6C 1SL8A 2I18A 2M7LA 1DGVA 5CSNA 5G08A 1CFFA 1RWYA 1DJZA 1DVIA 1EJ3A 1S1EA 2Q4UA 3OB2B 1C7WA 4MRYA 3IQOA 3CR5X 1XK4C 2KGBC 1F70A 1J55A 1W7JB 1RTP1 1QTXA 2LM5A 2NLNA 2FJUB 1IG5A 2V53A 4N1FA 2LHLA 4GAOA 1LKJA 2CT9A 5I2OA 3KHEA 1IRJA 1CLBA 1CB1A 1BR4B 5B8IB 4NDCA 1QV0A 1BODA 2K7OA 3ICBA 4YBHB 1SYMA 1TNXA 2EHBA 2L4HA 3PN7C 3SG7A 1AVSA 2LMVA 1BU3A 1IH0A 2JTZA 2ZN8A 1A4PA 1A75B 2P6BB 2QPTA 3SIAA 1CDNA 1B4CA 3TS5C 2KQYA 1XFXO 1S6IA 5TNCA 1NIWA 4D1EA 4DIRA 2HQWA 2PMYA 1F4QA 2L98A 3VGOA 1PRWA 1YVHA 4CPVA 1YVLA 1B8CA 3KF9A 4A4BA 3VRRA 2K2FA 2KBMA 2KHNA 1MF8B 3WNXB 4PCWA 1JUOA 2Q91A 3CLNA 3VROA 3GOFA 3CR2A 2OPOA 1YX8A 2LE9B 3TDUA 3BOWA 3TDZA 1KWOC 2GGZA 3SJSA 1B7TY 4PALA 4NQGA 1PVBA 4HRHA 2PASA 1KFXL 1LA0A 4NDDA 1FPWA 5BPJA 3CR4X 3SG5A 1QV1A 3BUMB 1SNLA 2NXQA 4ZCVA 1PALA 1KK8C 1UHHA 3I5FB 1A03A 1M46A 3EK7A 3O6BA 5CSJA 2F3ZA 3TUYB 2JQ6A 2LAPA 4DRWA 1NUBA 2OS8B 5AANA 2MAZA 1C7VA 1UURA 1DJIA 3DVMA 4ICBA 1TNPA 1GGZA 1QLSA 5JJGA 2JT3A 4HRGA 2L51A 1IJ6A 1S5GY 4L9MA 2LLTA 4MN0A 3LK0A 1NCXA 5FYXA 2B1UA 5DKQA 5HLOA 2QACA 3IQQA 2EC6B 1SL7A 2MBXA 2BKIB 2JC2A 5KTYA 2G9BA 1CLMA 1J7OA 1A29A 1K9KA 2KAXA 1IKUA 3TZ1A 5AERA 3RM1A 1S5GZ 2L4IA 1IQ3A 4PHNA 3D0YA 2JZIA 3F45A 2JWWA 2CCMA 1R6PA 2E30A 1K96A 1ZOTB 2NZ0A 1NX0A 1QASA 3BUWB 1SRAA 4U8DA 3NXAA 4C0LA 2LVJA 1WRKA 1OSAA 1CM1A 2KFHA 3I5IB 4NDBA 4P5OE 1UP5A 3O2PA 4QJ4B 1WRLA 2WOSA 1SCMC 1CLLA 3QRXA 3M0WA 4C0KA 1ZACA 5KU1A 3NSIA 2LVVA 2Y5IA 1ODBA 2LV7A 4N1GA 4USLA 2MLEC 4AQIA 1DMOA 2JRFA 1OE9B 1DGUA 4CIDA 1UWOA 2ZKMX 1SK6D 4OKHA 2I7AA 1CM4A 4I5LB 1JFJA 4BY5A 2O60A 1F55A 4PHMA 4AOMA 4R1EA 3BUXB 4XJKB 1LA3A 1K2HA 2CTNA 1K8UA 2L0PA 1K9PA 1G4YR 1S3PA 2DOQA 2PALA 4M2OA 1KSOA 2K8MB 4PE7A 1K9UA 2I94A 2KDHA 4E68A 1H4BA 1D1OA 1NCYA 4MRXA 1B9AA 4MLWA 3BUOB 1KQMB 1L2OC 2ZNEA 4MBEA 3I5HB 1B8LA 3JTDB 3CWGA 3DF0A 3KO0A 4OVNF 3DVKA 3EK8A 1F71A 4YRUA 2LP2A 4MSPA 4PE1A 1CMFA 2OTGB 4DCKA 3EKJA 4OV2A 5J3XA 2BCBA 1OQPA 3FS7A 4QJ3B 1VRKA 1NCZA 1N2DA 1NX1A 2M7NA 1F54A 1MQ1A 2SCPA 3KPXA 4GBAA 5JOLA 3PALA 2M9GA 1YR5A 3WXAA 1U5IA 5CSIA 1Y1UA 1XA5A 1WDCB 2H61C 5GQQC 2KFGA
chains in the Genus database with same CATH superfamily
3KEVA 2JXLA 3R1PA 4MEWA 1DJXA 3SS3A 1J7PA 3D76A 3CZTX 3BUNB 1AP4A 1QX7A 5DKRA 3K21A 2BL0C 1WLMA 3SS4A 2M8UA 4ZCUA 1BG1A 2HF5A 4CFQA 3OP0A 1E8AA 1XFRA 5KSZA 1K95A 3NHIA 1FBVA 2L5YA 2LCPA 1PVAA 3EVVA 3SG2A 2JOJA 1C07A 1H8BA 2F33A 1RJVA 3NSKA 1M39A 2WORA 3BYAA 1NYAA 3I5GB 3L47A 4I5JA 2L5XB 2LHIA 2E6WA 5CPVA 2BBMA 3JVTB 1B7TZ 3D75A 4M2PA 1KWOB 5HL1A 2JXCA 1M63B 1QS7A 1CNPA 1S6JA 2FCDA 1EG3A 5F6TA 1CKKA 3B7AA 1CFDA 4OR9B 3I5FC 2LMUA 3NSLA 1MUXA 1KK8B 2KI6C 3SG6A 2FJYA 1SKTA 4FTGA 2RGIA 1SY9A 1S6CA 3ZWHA 2JULA 3GK4X 1JF0A 1DJYA 4WRIA 2G2BA 1Z2CB 4N5XA 3DVEA 2PVBA 5HLVA 2KGRA 4INWA 2KI6D 3SG4A 1X02A 1XFWO 4PE4A 2PYQA 1Y0VH 1Z4HA 5CSFA 2ZN9A 5PALA 2F2PA 2LUXA 1TNQA 3B87A 1WRZA 1DJWA 1C3ZA 1OZOA 1AJ5A 1YURA 4TNCA 2EGDA 2CNPA 3BOWB 1JFKA 2JNXA 2M1UA 4WQ2A 1DF0A 1XVJA 2BAPA 3N7HA 1MXLC 1OOFA 3QMEA 1B47A 2A4JA 2WCBA 4YGEB 1YX7A 2M1KB 3IVTA 1ALVA 4BY4A 1LINA 2LVIA 2LMTA 3C1VA 1JC2A 2KI4B 3IF7A 1NWDA 3I5IC 2LANA 1XFUO 2QEVA 4GNKB 1W7IB 1CDLA 1UUSA 1J7QA 1OOJA 2WNDA 3A8RA 1WY9A 3R1OA 1YRUB 2FCEA 3ZNIA 1FF1A 1UHJA 2P70A 1TIZA 2WC8A 2HETA 1SCMB 1N65A 1EG4A 1XYDA 3MSEB 1QIWA 3LCPC 2BE4A 2MJWB 2AUCA 4ORAB 3VRQA 4HSZA 3VB1A 2KYCA 1QVIY 2NCPA 1KFUS 3EK4A 5HKYA 3R1VA 2LC5A 4YGCB 1AJ4A 1QLKA 5AXIA 2H8VA 3NSOA 4M2QA 3RLZA 2GV5A 3Q8IA 2KSPA 5HYDA 2D8NA 2GGMA 2K7CA 4PHKA 3E3RA 1UHIA 2PQLA 3EVRA 1KFUL 3D0YB 2K7BA 1DJGA 1ZUZA 1IGVA 1QVIZ 1SBJA 1V1GA 1XFYO 4UPGA 3FE8A 1PULA 2ZRTA 3EKHA 5FI7A 2HQ8A 3WHUB 3SIBA 2LLSA 1ZMZA 2ZNDA 3HCMA 5FI6A 4GUKA 1XFZO 2H61A 3EG5B 4IL1A 1M31A 4GGNA 1KQVA 3S0BA 3AKAA 4ETOA 4FQOA 1A75A 1QJTA 2ZRSA 1SPYA 1GQMA 4PDZA 1FI5A 4Q04A 4WQ3A 5IBWA 2AAOA 1SR6B 1CFCA 1KQMC 1JSAA 2AMIA 3OB1B 3V2LA 5D69A 1HT9A 1IJ5A 3CGAA 1BLQA 1QIVA 1SW8A 1S36A 3JTDC 1NSHA 1WLZA 5I2QA 1L2OB 1KK7Y 3CZ1A 3LLEA 1DT7B 2JNFA 3DVJA 1MR8A 4F7FA 1ZFSA 2OTGC 1AUIB 2F2OA 3BFBA 3B88A 4MZLA 1TN4A 2JU0A 2BECA 5ER4X 1OOIX 1JBAA 1YUSA 2CXJA 1AK8A 2JTTA 2LVKA 1G33A 1KK7Z 1J1DA 3H4SE 1UHNA 5HKWA 1EXRA 1TCFA 3BXKA 1QX5B 3PN7B 1P28A 2MLFC 2BCAA 3SG3A 1WDCC 1GGWA 2K0JA 1A2XA 3S0EA 2CBLA 2BCXA 3OX6A 3TS5B 3PFVA 1CDMA 1XFVO 1OMDA 2L2EA 3PSRA 1YRTB 1M45A 3FWCA 2WCFA 2PSRA 3BFHA 1ORGA 3DZTA 4CLNA 1NX3A 3O4YA 2Y4QA 1L7ZA 1HQVA 4JWQA 1PK0D 2MA2A 2TN4A 3GK1A 4HREE 4ORBB 5DKNA 1KSMA 1QXPA 1DTLA 1BR1B 2BL0B 2K7DA 2NCOA 3DF0B 3LK1A 1JWDA 4PHJA 1SCVA 2FOTA 4OCIA 2KAVA 1YUTA 1IQ5A 2F8PA 2KAYA 1CTRA 1YTZC 1KFXS 3I5GC 5EL2A 1OMRA 3PM8A 1K93D 1Q80A 1R2UA 2WC5A 2KOTA 1SMGA 3JVTC 3TUYC 1BMOA 3AKBA 1MHOA 2BKHB 1EL4A 2M29A 3GK2A 2M3WA 2JT0A 2OS8C 5D7FA 1TRFA 1CDPA 3PLFB 5I2LA 1U5IB 1TTXA 1G8IA 5DICA 1QATA 4GPLB 1GM0A 2K2AA 5AEQA 1ALWA 1B8RA 1RK9A 1AHRA 1BT6A 1OZSA 1S26D 1BF5A 2WCKA 4GGFA 1XO5A 3O78A 1KCYA 4CFRA 3D10A 4YGAA 2L50A 2KNEA 3DD4A 1SL9A 2P71A 2EC6C 2HPSA 4A4CA 3S0FA 1K94A 2VRGA 1LXFC 1TCOB 1FI6A 4I5KA 2O5GA 4C0JA 2WCLA 4YGDB 3TDIA 1TUJA 1T14A 1DJHA 4MZKA 1Y1XA 3B6XA 4XJKA 2KQ6A 1IWQA 2SASA 3WHTB 2GTEA 4DS7A 2WCMA 1BOCA 2IS9A 4YI8A 1N0YA 1EH2A 2LLUA 2Y1MA 3PATA 2KI4C 2LP3A 2LUCA 3NHTA 4PT1A 2Y1NA 3BQ3A 2H2KA 4GGFC 2R2IA 2WCEA 4JKTA 1UHKA 4OZDA 4PE0A 1PSBA 3S0DA 1TNWA 1NX2A 2M49B 2BE6A 4XYNA 3FWBA 4GFTA 3A4UB 2KYFA 3EVUA 3OX5A 4MZJA 1JF2A 4AQJA 2PRUA 1LVCD 2LNKA 5AFPA 5I94A 2ZFDA 4ORCB 1NP8A 4MVFA 3DY9A 2JPTA 1DEKA 1J7RA 4F0ZB 2M0RA 1PSRA 5I8NA 2K61A 1NPQA 3AAJA 4JQ0D 2MHHA 4QJ5B 5ER5A 1B1GA 5K89A 1RROA 2F3YA 2M97A 1MWNA 1OOGA 1V1FA 1XK4A 3CS1A 3CTNA 1FW4A 1OMVA 1BJFA 2I2RE 1TOPA 3K1EA 1DF0B 3LL8B 3OHMB 1RECA 1Y6WA 3FIAA 1Y1AA 2KFFA 5HKZA 1YUUA 4DUQA 1F4OA 2WCJA 4INXA 2WCHA 3HX4A 4I5NB 2JT8A 1F8HA 1MXEA 3VRNA 2COLB 3NGVA 4YGBB 3AAKA 1RFJA 3CZ0A 4JPZB 3CYZA 1DELA 4YI9A 2BBNA 1J1EA 2ISDA 3VRPA 1CFPA 1GJYA 2KBIA 1CMGA 1K90D 3I5HC 1QX2A 2MRDA 4P2YB 1SR6C 1SL8A 2I18A 1DC1A 1QWVA 2M7LA 1DGVA 5CSNA 5G08A 1CFFA 1RWYA 1DJZA 1DVIA 1EJ3A 1S1EA 2Q4UA 3OB2B 1C7WA 4MRYA 4KYNA 1TWOA 3CR5X 1XK4C 2KGBC 3IQOA 1F70A 1J55A 1W7JB 1W9ZA 1RTP1 1QTXA 2LM5A 2NLNA 2FJUB 1IG5A 3RZSA 2V53A 4N1FA 2LHLA 3CZ2A 4GAOA 1LKJA 2CT9A 5I2OA 3KHEA 1IRJA 1CLBA 1CB1A 1BR4B 5B8IB 4NDCA 1QV0A 1OW4A 1BODA 2K7OA 3ICBA 4YBHB 1SYMA 5FI2A 1TNXA 2EHBA 3S0AA 2L4HA 3D74A 3PN7C 3SG7A 1AVSA 2LMVA 1BU3A 1IH0A 2JTZA 2ZN8A 1A4PA 1A75B 2P6BB 2QPTA 3SIAA 1CDNA 1B4CA 3TS5C 2KQYA 1XFXO 1S6IA 5TNCA 1NIWA 1TUZA 4D1EA 4DIRA 2HQWA 2PMYA 1F4QA 2L98A 3VGOA 1PRWA 1YVHA 2BNXA 1YVLA 4CPVA 1B8CA 3KF9A 4A4BA 3OGNA 3VRRA 2K60A 2K2FA 2KBMA 2KHNA 1MF8B 3WNXB 4PCWA 1JUOA 2ERBA 2Q91A 3CLNA 3DYEA 3VROA 3GOFA 3CR2A 2OPOA 1YX8A 2LE9B 3TDUA 3BOWA 3TDZA 1KWOC 2GGZA 3SJSA 1B7TY 4PALA 4NQGA 1PVBA 4HRHA 1C3YA 2PASA 1KFXL 1LA0A 2KLDA 4NDDA 1FPWA 5BPJA 3CR4X 3SG5A 1QV1A 3BUMB 1SNLA 2NXQA 2KPHA 2YGUA 1PALA 1KK8C 4ZCVA 1UHHA 3I5FB 1A03A 1M46A 3EK7A 3O6BA 5CSJA 2F3ZA 3TUYB 2JQ6A 2LAPA 4DRWA 3SS5A 1NUBA 2OS8B 5AANA 2MAZA 1C7VA 3O4XA 1UURA 1DJIA 3DVMA 4ICBA 1TNPA 3B86A 1GGZA 1QLSA 5JJGA 2JT3A 4HRGA 2L51A 1IJ6A 2QEHA 1S5GY 4L9MA 2LLTA 4MN0A 3LK0A 5D3OA 1NCXA 5FYXA 2B1UA 5DKQA 5HLOA 2QACA 3IQQA 2EC6B 1SL7A 1OOHA 2MBXA 2BKIB 2JC2A 5KTYA 2G9BA 1CLMA 1J7OA 1A29A 1K9KA 2KAXA 1IKUA 3TZ1A 5AERA 3RM1A 1S5GZ 2L4IA 1IQ3A 4PHNA 3D0YA 2JZIA 3F45A 2JWWA 4IJ7A 4JD9A 2CCMA 1R6PA 2E30A 1K96A 1ZOTB 2NZ0A 1NX0A 1LS8A 1QASA 3BUWB 1SRAA 4U8DA 3NXAA 4C0LA 2QEOA 2LVJA 1WRKA 1OSAA 1CM1A 2KFHA 3I5IB 4NDBA 3FE6A 1UP5A 3O2PA 3DXLA 4P5OE 4QJ4B 1WRLA 2WOSA 3CABA 1SCMC 3PJIA 1CLLA 3QRXA 3M0WA 4C0KA 1ZACA 5KU1A 3NSIA 2KLEA 2LVVA 2Y5IA 1ODBA 2LV7A 4N1GA 4USLA 2MLEC 4AQIA 1DMOA 2JRFA 1OE9B 1DGUA 4CIDA 1UWOA 2ZKMX 1SK6D 4OKHA 4FQTA 2I7AA 1CM4A 1SSEB 3UO9A 3BJHA 4I5LB 1JFJA 3FE9A 4BY5A 2O60A 3S0GA 3D78A 1F55A 3D77A 4PHMA 4AOMA 4R1EA 3BUXB 1IIOA 4XJKB 1LA3A 1K2HA 2CTNA 3BFAA 3L4AA 1K8UA 2L0PA 1K9PA 1G4YR 1S3PA 2DOQA 2PALA 4M2OA 1KSOA 2K8MB 4PE7A 1K9UA 2I94A 2KDHA 2QEBA 4E68A 1H4BA 1D1OA 1NCYA 4MRXA 2JPOA 1B9AA 3R72A 4MLWA 3BUOB 1KQMB 1L2OC 2ZNEA 4MBEA 2L2CA 3I5HB 3UNWA 1B8LA 3JTDB 3PM2A 3CWGA 3DF0A 3KO0A 4OVNF 3DVKA 3EK8A 1F71A 2QDIA 4YRUA 2LP2A 4MSPA 4PE1A 1CMFA 2OTGB 4DCKA 3EKJA 4OV2A 5J3XA 3OBVA 2BCBA 1OQPA 3FS7A 4QJ3B 1VRKA 1NCZA 1N2DA 1NX1A 2M7NA 1F54A 3D73A 1DQEA 1MQ1A 2SCPA 3CDNA 3KPXA 2WC6A 4GBAA 5JOLA 3PALA 2M9GA 1YR5A 3WXAA 1U5IA 3L4LA 5CSIA 1Y1UA 1XA5A 1WDCB 2H61C 5GQQC 2KFGA
chains in the Genus database with same CATH topology
3KEVA 2JXLA 4MEWA 1DJXA 1J7PA 3CZTX 3BUNB 1AP4A 1QX7A 5DKRA 3K21A 2BL0C 1WLMA 2M8UA 4ZCUA 1BG1A 2HF5A 4CFQA 3OP0A 1E8AA 5KSZA 1K95A 1FBVA 2LCPA 3SG2A 1PVAA 3EVVA 2JOJA 1C07A 1H8BA 2F33A 1RJVA 3NSKA 1M39A 2WORA 3BYAA 1NYAA 3I5GB 4I5JA 2L5XB 2LHIA 2E6WA 5CPVA 2BBMA 3JVTB 1B7TZ 4M2PA 1KWOB 2JXCA 1M63B 1QS7A 1CNPA 1S6JA 2FCDA 1EG3A 5F6TA 1CKKA 1CFDA 4OR9B 3I5FC 2LMUA 3NSLA 1MUXA 1KK8B 2KI6C 3SG6A 4FTGA 1SKTA 2RGIA 1SY9A 1S6CA 3ZWHA 2JULA 3GK4X 1JF0A 1DJYA 4WRIA 2G2BA 4N5XA 3DVEA 2PVBA 5HLVA 2KGRA 2KI6D 3SG4A 1X02A 1XFWO 4PE4A 1Y0VH 5CSFA 2ZN9A 5PALA 2F2PA 2LUXA 1TNQA 1WRZA 1DJWA 1OZOA 1AJ5A 1YURA 4TNCA 2EGDA 2CNPA 3BOWB 1JFKA 2JNXA 2M1UA 4WQ2A 1DF0A 1XVJA 1MXLC 1B47A 2A4JA 2WCBA 4YGEB 1YX7A 2M1KB 1ALVA 4BY4A 1LINA 2LVIA 2LMTA 3C1VA 1JC2A 2KI4B 3IF7A 1NWDA 3I5IC 2LANA 1XFUO 4GNKB 1W7IB 1CDLA 1UUSA 1J7QA 1OOJA 2WNDA 3A8RA 1WY9A 1YRUB 2FCEA 3ZNIA 1FF1A 1UHJA 2WC8A 1TIZA 2HETA 1SCMB 1N65A 1EG4A 1XYDA 3MSEB 1QIWA 3LCPC 2BE4A 2MJWB 2AUCA 4ORAB 3VRQA 4HSZA 2KYCA 1QVIY 2NCPA 1KFUS 3EK4A 5HKYA 2LC5A 4YGCB 1AJ4A 1QLKA 5AXIA 3NSOA 4M2QA 3RLZA 2GV5A 2KSPA 5HYDA 2D8NA 2GGMA 2K7CA 4PHKA 3E3RA 1UHIA 3EVRA 1KFUL 3D0YB 2K7BA 1DJGA 1ZUZA 1IGVA 1QVIZ 1SBJA 1V1GA 1XFYO 4UPGA 1PULA 2ZRTA 3EKHA 3WHUB 2HQ8A 3SIBA 2LLSA 1ZMZA 2ZNDA 3HCMA 4GUKA 1XFZO 2H61A 4IL1A 1M31A 4GGNA 1KQVA 3AKAA 4ETOA 4FQOA 1A75A 1QJTA 2ZRSA 1SPYA 1GQMA 4PDZA 1FI5A 4Q04A 4WQ3A 5IBWA 2AAOA 1SR6B 1CFCA 1KQMC 1JSAA 2AMIA 3OB1B 5D69A 1HT9A 1IJ5A 3CGAA 1BLQA 1QIVA 1SW8A 1S36A 3JTDC 1NSHA 1WLZA 5I2QA 1L2OB 1KK7Y 3LLEA 1DT7B 2JNFA 3DVJA 1MR8A 1ZFSA 2OTGC 1AUIB 2F2OA 4MZLA 1TN4A 2JU0A 2BECA 5ER4X 1JBAA 1YUSA 2CXJA 1AK8A 2JTTA 2LVKA 1G33A 1KK7Z 1J1DA 3H4SE 1UHNA 5HKWA 1EXRA 1TCFA 3BXKA 1QX5B 3PN7B 2MLFC 2BCAA 3SG3A 1WDCC 1GGWA 2K0JA 1A2XA 2CBLA 2BCXA 3OX6A 3TS5B 3PFVA 1CDMA 1XFVO 1OMDA 2L2EA 3PSRA 1YRTB 1M45A 3FWCA 2WCFA 2PSRA 4CLNA 1NX3A 3O4YA 2Y4QA 1L7ZA 1HQVA 4JWQA 1PK0D 2MA2A 2TN4A 3GK1A 4HREE 4ORBB 5DKNA 1KSMA 1QXPA 1DTLA 1BR1B 2BL0B 2K7DA 2NCOA 3DF0B 3LK1A 1JWDA 4PHJA 1SCVA 2FOTA 4OCIA 2KAVA 1YUTA 1IQ5A 2F8PA 2KAYA 1CTRA 1YTZC 1KFXS 3I5GC 1OMRA 3PM8A 1K93D 1Q80A 1R2UA 2KOTA 1SMGA 3JVTC 3TUYC 1BMOA 3AKBA 1MHOA 2BKHB 1EL4A 2M29A 3GK2A 2M3WA 2JT0A 2OS8C 5D7FA 1TRFA 1CDPA 3PLFB 5I2LA 1U5IB 1TTXA 1G8IA 1QATA 4GPLB 2K2AA 5AEQA 1ALWA 1B8RA 1RK9A 1AHRA 1BT6A 1OZSA 1S26D 1BF5A 4GGFA 1XO5A 1KCYA 4CFRA 3D10A 4YGAA 2L50A 2KNEA 3DD4A 1SL9A 2EC6C 2HPSA 4A4CA 1K94A 2VRGA 1LXFC 1TCOB 1FI6A 4I5KA 2O5GA 4C0JA 4YGDB 3TDIA 1DJHA 4MZKA 1Y1XA 4XJKA 2KQ6A 1IWQA 2SASA 3WHTB 4DS7A 1BOCA 2IS9A 4YI8A 1N0YA 1EH2A 2LLUA 2Y1MA 3PATA 2KI4C 2LP3A 2LUCA 2Y1NA 3BQ3A 2H2KA 4GGFC 2R2IA 2WCEA 4PE0A 1UHKA 1PSBA 1TNWA 1NX2A 2M49B 2BE6A 4XYNA 3FWBA 4GFTA 3A4UB 2KYFA 3EVUA 3OX5A 4MZJA 1JF2A 4AQJA 2PRUA 1LVCD 2LNKA 5AFPA 2ZFDA 4ORCB 1NP8A 4MVFA 2JPTA 1J7RA 4F0ZB 2M0RA 1PSRA 5I8NA 2K61A 1NPQA 3AAJA 4JQ0D 2MHHA 4QJ5B 5ER5A 1B1GA 5K89A 1RROA 2F3YA 2M97A 1MWNA 1V1FA 3CS1A 1XK4A 3CTNA 3O78A 1FW4A 1OMVA 1BJFA 2I2RE 1TOPA 3LL8B 1DF0B 3OHMB 1RECA 1Y6WA 3FIAA 1Y1AA 2KFFA 5HKZA 1YUUA 4DUQA 1F4OA 3HX4A 4I5NB 2JT8A 1F8HA 1MXEA 3VRNA 2COLB 4YGBB 3AAKA 1RFJA 4JPZB 2ISDA 4YI9A 2BBNA 1J1EA 3VRPA 1CFPA 1GJYA 2KBIA 1CMGA 1K90D 3I5HC 1QX2A 2MRDA 4P2YB 1SR6C 1SL8A 2I18A 2M7LA 1DGVA 5CSNA 5G08A 1CFFA 1RWYA 1DJZA 1DVIA 1EJ3A 1S1EA 2Q4UA 3OB2B 1C7WA 4MRYA 3IQOA 3CR5X 1XK4C 2KGBC 1F70A 1J55A 1W7JB 1RTP1 1QTXA 2LM5A 2NLNA 2FJUB 1IG5A 2V53A 4N1FA 2LHLA 4GAOA 1LKJA 2CT9A 5I2OA 3KHEA 1IRJA 1CLBA 1CB1A 1BR4B 5B8IB 4NDCA 1QV0A 1BODA 2K7OA 3ICBA 4YBHB 1SYMA 1TNXA 2EHBA 2L4HA 3PN7C 3SG7A 1AVSA 2LMVA 1BU3A 1IH0A 2JTZA 2ZN8A 1A4PA 1A75B 2P6BB 2QPTA 3SIAA 1CDNA 1B4CA 3TS5C 2KQYA 1XFXO 1S6IA 5TNCA 1NIWA 4D1EA 4DIRA 2HQWA 2PMYA 1F4QA 2L98A 3VGOA 1PRWA 1YVHA 4CPVA 1YVLA 1B8CA 3KF9A 4A4BA 3VRRA 2K2FA 2KBMA 2KHNA 1MF8B 3WNXB 4PCWA 1JUOA 2Q91A 3CLNA 3VROA 3GOFA 3CR2A 2OPOA 1YX8A 2LE9B 3TDUA 3BOWA 3TDZA 1KWOC 2GGZA 3SJSA 1B7TY 4PALA 4NQGA 1PVBA 4HRHA 2PASA 1KFXL 1LA0A 4NDDA 1FPWA 5BPJA 3CR4X 3SG5A 1QV1A 3BUMB 1SNLA 2NXQA 4ZCVA 1PALA 1KK8C 1UHHA 3I5FB 1A03A 1M46A 3EK7A 3O6BA 5CSJA 2F3ZA 3TUYB 2JQ6A 2LAPA 4DRWA 1NUBA 2OS8B 5AANA 2MAZA 1C7VA 1UURA 1DJIA 3DVMA 4ICBA 1TNPA 1GGZA 1QLSA 5JJGA 2JT3A 4HRGA 2L51A 1IJ6A 1S5GY 4L9MA 2LLTA 4MN0A 3LK0A 1NCXA 5FYXA 2B1UA 5DKQA 5HLOA 2QACA 3IQQA 2EC6B 1SL7A 2MBXA 2BKIB 2JC2A 5KTYA 2G9BA 1CLMA 1J7OA 1A29A 1K9KA 2KAXA 1IKUA 3TZ1A 5AERA 3RM1A 1S5GZ 2L4IA 1IQ3A 4PHNA 3D0YA 2JZIA 3F45A 2JWWA 2CCMA 1R6PA 2E30A 1K96A 1ZOTB 2NZ0A 1NX0A 1QASA 3BUWB 1SRAA 4U8DA 3NXAA 4C0LA 2LVJA 1WRKA 1OSAA 1CM1A 2KFHA 3I5IB 4NDBA 4P5OE 1UP5A 3O2PA 4QJ4B 1WRLA 2WOSA 1SCMC 1CLLA 3QRXA 3M0WA 4C0KA 1ZACA 5KU1A 3NSIA 2LVVA 2Y5IA 1ODBA 2LV7A 4N1GA 4USLA 2MLEC 4AQIA 1DMOA 2JRFA 1OE9B 1DGUA 4CIDA 1UWOA 2ZKMX 1SK6D 4OKHA 2I7AA 1CM4A 4I5LB 1JFJA 4BY5A 2O60A 1F55A 4PHMA 4AOMA 4R1EA 3BUXB 4XJKB 1LA3A 1K2HA 2CTNA 1K8UA 2L0PA 1K9PA 1G4YR 1S3PA 2DOQA 2PALA 4M2OA 1KSOA 2K8MB 4PE7A 1K9UA 2I94A 2KDHA 4E68A 1H4BA 1D1OA 1NCYA 4MRXA 1B9AA 4MLWA 3BUOB 1KQMB 1L2OC 2ZNEA 4MBEA 3I5HB 1B8LA 3JTDB 3CWGA 3DF0A 3KO0A 4OVNF 3DVKA 3EK8A 1F71A 4YRUA 2LP2A 4MSPA 4PE1A 1CMFA 2OTGB 4DCKA 3EKJA 4OV2A 5J3XA 2BCBA 1OQPA 3FS7A 4QJ3B 1VRKA 1NCZA 1N2DA 1NX1A 2M7NA 1F54A 1MQ1A 2SCPA 3KPXA 4GBAA 5JOLA 3PALA 2M9GA 1YR5A 3WXAA 1U5IA 5CSIA 1Y1UA 1XA5A 1WDCB 2H61C 5GQQC 2KFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KEV A;  2JXL A;  4MEW A;  1DJX A;  1J7P A;  3CZT X;  3BUN B;  1AP4 A;  1QX7 A;  5DKR A;  3K21 A;  2BL0 C;  1WLM A;  2M8U A;  4ZCU A;  1BG1 A;  2HF5 A;  4CFQ A;  3OP0 A;  1E8A A;  5KSZ A;  1K95 A;  1FBV A;  2LCP A;  3SG2 A;  1PVA A;  3EVV A;  2JOJ A;  1C07 A;  1H8B A;  2F33 A;  1RJV A;  3NSK A;  1M39 A;  2WOR A;  3BYA A;  1NYA A;  3I5G B;  4I5J A;  2L5X B;  2LHI A;  2E6W A;  5CPV A;  2BBM A;  3JVT B;  1B7T Z;  4M2P A;  1KWO B;  2JXC A;  1M63 B;  1QS7 A;  1CNP A;  1S6J A;  2FCD A;  1EG3 A;  5F6T A;  1CKK A;  1CFD A;  4OR9 B;  3I5F C;  2LMU A;  3NSL A;  1MUX A;  1KK8 B;  2KI6 C;  3SG6 A;  4FTG A;  1SKT A;  2RGI A;  1SY9 A;  1S6C A;  3ZWH A;  2JUL A;  3GK4 X;  1JF0 A;  1DJY A;  4WRI A;  2G2B A;  4N5X A;  3DVE A;  2PVB A;  5HLV A;  2KGR A;  2KI6 D;  3SG4 A;  1X02 A;  1XFW O;  4PE4 A;  1Y0V H;  5CSF A;  2ZN9 A;  5PAL A;  2F2P A;  2LUX A;  1TNQ A;  1WRZ A;  1DJW A;  1OZO A;  1AJ5 A;  1YUR A;  4TNC A;  2EGD A;  2CNP A;  3BOW B;  1JFK A;  2JNX A;  2M1U A;  4WQ2 A;  1DF0 A;  1XVJ A;  1MXL C;  1B47 A;  2A4J A;  2WCB A;  4YGE B;  1YX7 A;  2M1K B;  1ALV A;  4BY4 A;  1LIN A;  2LVI A;  2LMT A;  3C1V A;  1JC2 A;  2KI4 B;  3IF7 A;  1NWD A;  3I5I C;  2LAN A;  1XFU O;  4GNK B;  1W7I B;  1CDL A;  1UUS A;  1J7Q A;  1OOJ A;  2WND A;  3A8R A;  1WY9 A;  1YRU B;  2FCE A;  3ZNI A;  1FF1 A;  1UHJ A;  2WC8 A;  1TIZ A;  2HET A;  1SCM B;  1N65 A;  1EG4 A;  1XYD A;  3MSE B;  1QIW A;  3LCP C;  2BE4 A;  2MJW B;  2AUC A;  4ORA B;  3VRQ A;  4HSZ A;  2KYC A;  1QVI Y;  2NCP A;  1KFU S;  3EK4 A;  5HKY A;  2LC5 A;  4YGC B;  1AJ4 A;  1QLK A;  5AXI A;  3NSO A;  4M2Q A;  3RLZ A;  2GV5 A;  2KSP A;  5HYD A;  2D8N A;  2GGM A;  2K7C A;  4PHK A;  3E3R A;  1UHI A;  3EVR A;  1KFU L;  3D0Y B;  2K7B A;  1DJG A;  1ZUZ A;  1IGV A;  1QVI Z;  1SBJ A;  1V1G A;  1XFY O;  4UPG A;  1PUL A;  2ZRT A;  3EKH A;  3WHU B;  2HQ8 A;  3SIB A;  2LLS A;  1ZMZ A;  2ZND A;  3HCM A;  4GUK A;  1XFZ O;  2H61 A;  4IL1 A;  1M31 A;  4GGN A;  1KQV A;  3AKA A;  4ETO A;  4FQO A;  1A75 A;  1QJT A;  2ZRS A;  1SPY A;  1GQM A;  4PDZ A;  1FI5 A;  4Q04 A;  4WQ3 A;  5IBW A;  2AAO A;  1SR6 B;  1CFC A;  1KQM C;  1JSA A;  2AMI A;  3OB1 B;  5D69 A;  1HT9 A;  1IJ5 A;  3CGA A;  1BLQ A;  1QIV A;  1SW8 A;  1S36 A;  3JTD C;  1NSH A;  1WLZ A;  5I2Q A;  1L2O B;  1KK7 Y;  3LLE A;  1DT7 B;  2JNF A;  3DVJ A;  1MR8 A;  1ZFS A;  2OTG C;  1AUI B;  2F2O A;  4MZL A;  1TN4 A;  2JU0 A;  2BEC A;  5ER4 X;  1JBA A;  1YUS A;  2CXJ A;  1AK8 A;  2JTT A;  2LVK A;  1G33 A;  1KK7 Z;  1J1D A;  3H4S E;  1UHN A;  5HKW A;  1EXR A;  1TCF A;  3BXK A;  1QX5 B;  3PN7 B;  2MLF C;  2BCA A;  3SG3 A;  1WDC C;  1GGW A;  2K0J A;  1A2X A;  2CBL A;  2BCX A;  3OX6 A;  3TS5 B;  3PFV A;  1CDM A;  1XFV O;  1OMD A;  2L2E A;  3PSR A;  1YRT B;  1M45 A;  3FWC A;  2WCF A;  2PSR A;  4CLN A;  1NX3 A;  3O4Y A;  2Y4Q A;  1L7Z A;  1HQV A;  4JWQ A;  1PK0 D;  2MA2 A;  2TN4 A;  3GK1 A;  4HRE E;  4ORB B;  5DKN A;  1KSM A;  1QXP A;  1DTL A;  1BR1 B;  2BL0 B;  2K7D A;  2NCO A;  3DF0 B;  3LK1 A;  1JWD A;  4PHJ A;  1SCV A;  2FOT A;  4OCI A;  2KAV A;  1YUT A;  1IQ5 A;  2F8P A;  2KAY A;  1CTR A;  1YTZ C;  1KFX S;  3I5G C;  1OMR A;  3PM8 A;  1K93 D;  1Q80 A;  1R2U A;  2KOT A;  1SMG A;  3JVT C;  3TUY C;  1BMO A;  3AKB A;  1MHO A;  2BKH B;  1EL4 A;  2M29 A;  3GK2 A;  2M3W A;  2JT0 A;  2OS8 C;  5D7F A;  1TRF A;  1CDP A;  3PLF B;  5I2L A;  1U5I B;  1TTX A;  1G8I A;  1QAT A;  4GPL B;  2K2A A;  5AEQ A;  1ALW A;  1B8R A;  1RK9 A;  1AHR A;  1BT6 A;  1OZS A;  1S26 D;  1BF5 A;  4GGF A;  1XO5 A;  1KCY A;  4CFR A;  3D10 A;  4YGA A;  2L50 A;  2KNE A;  3DD4 A;  1SL9 A;  2EC6 C;  2HPS A;  4A4C A;  1K94 A;  2VRG A;  1LXF C;  1TCO B;  1FI6 A;  4I5K A;  2O5G A;  4C0J A;  4YGD B;  3TDI A;  1DJH A;  4MZK A;  1Y1X A;  4XJK A;  2KQ6 A;  1IWQ A;  2SAS A;  3WHT B;  4DS7 A;  1BOC A;  2IS9 A;  4YI8 A;  1N0Y A;  1EH2 A;  2LLU A;  2Y1M A;  3PAT A;  2KI4 C;  2LP3 A;  2LUC A;  2Y1N A;  3BQ3 A;  2H2K A;  4GGF C;  2R2I A;  2WCE A;  4PE0 A;  1UHK A;  1PSB A;  1TNW A;  1NX2 A;  2M49 B;  2BE6 A;  4XYN A;  3FWB A;  4GFT A;  3A4U B;  2KYF A;  3EVU A;  3OX5 A;  4MZJ A;  1JF2 A;  4AQJ A;  2PRU A;  1LVC D;  2LNK A;  5AFP A;  2ZFD A;  4ORC B;  1NP8 A;  4MVF A;  2JPT A;  1J7R A;  4F0Z B;  2M0R A;  1PSR A;  5I8N A;  2K61 A;  1NPQ A;  3AAJ A;  4JQ0 D;  2MHH A;  4QJ5 B;  5ER5 A;  1B1G A;  5K89 A;  1RRO A;  2F3Y A;  2M97 A;  1MWN A;  1V1F A;  3CS1 A;  1XK4 A;  3CTN A;  3O78 A;  1FW4 A;  1OMV A;  1BJF A;  2I2R E;  1TOP A;  3LL8 B;  1DF0 B;  3OHM B;  1REC A;  1Y6W A;  3FIA A;  1Y1A A;  2KFF A;  5HKZ A;  1YUU A;  4DUQ A;  1F4O A;  3HX4 A;  4I5N B;  2JT8 A;  1F8H A;  1MXE A;  3VRN A;  2COL B;  4YGB B;  3AAK A;  1RFJ A;  4JPZ B;  2ISD A;  4YI9 A;  2BBN A;  1J1E A;  3VRP A;  1CFP A;  1GJY A;  2KBI A;  1CMG A;  1K90 D;  3I5H C;  1QX2 A;  2MRD A;  4P2Y B;  1SR6 C;  1SL8 A;  2I18 A;  2M7L A;  1DGV A;  5CSN A;  5G08 A;  1CFF A;  1RWY A;  1DJZ A;  1DVI A;  1EJ3 A;  1S1E A;  2Q4U A;  3OB2 B;  1C7W A;  4MRY A;  3IQO A;  3CR5 X;  1XK4 C;  2KGB C;  1F70 A;  1J55 A;  1W7J B;  1RTP 1;  1QTX A;  2LM5 A;  2NLN A;  2FJU B;  1IG5 A;  2V53 A;  4N1F A;  2LHL A;  4GAO A;  1LKJ A;  2CT9 A;  5I2O A;  3KHE A;  1IRJ A;  1CLB A;  1CB1 A;  1BR4 B;  5B8I B;  4NDC A;  1QV0 A;  1BOD A;  2K7O A;  3ICB A;  4YBH B;  1SYM A;  1TNX A;  2EHB A;  2L4H A;  3PN7 C;  3SG7 A;  1AVS A;  2LMV A;  1BU3 A;  1IH0 A;  2JTZ A;  2ZN8 A;  1A4P A;  1A75 B;  2P6B B;  2QPT A;  3SIA A;  1CDN A;  1B4C A;  3TS5 C;  2KQY A;  1XFX O;  1S6I A;  5TNC A;  1NIW A;  4D1E A;  4DIR A;  2HQW A;  2PMY A;  1F4Q A;  2L98 A;  3VGO A;  1PRW A;  1YVH A;  4CPV A;  1YVL A;  1B8C A;  3KF9 A;  4A4B A;  3VRR A;  2K2F A;  2KBM A;  2KHN A;  1MF8 B;  3WNX B;  4PCW A;  1JUO A;  2Q91 A;  3CLN A;  3VRO A;  3GOF A;  3CR2 A;  2OPO A;  1YX8 A;  2LE9 B;  3TDU A;  3BOW A;  3TDZ A;  1KWO C;  2GGZ A;  3SJS A;  1B7T Y;  4PAL A;  4NQG A;  1PVB A;  4HRH A;  2PAS A;  1KFX L;  1LA0 A;  4NDD A;  1FPW A;  5BPJ A;  3CR4 X;  3SG5 A;  1QV1 A;  3BUM B;  1SNL A;  2NXQ A;  4ZCV A;  1PAL A;  1KK8 C;  1UHH A;  3I5F B;  1A03 A;  1M46 A;  3EK7 A;  3O6B A;  5CSJ A;  2F3Z A;  3TUY B;  2JQ6 A;  2LAP A;  4DRW A;  1NUB A;  2OS8 B;  5AAN A;  2MAZ A;  1C7V A;  1UUR A;  1DJI A;  3DVM A;  4ICB A;  1TNP A;  1GGZ A;  1QLS A;  5JJG A;  2JT3 A;  4HRG A;  2L51 A;  1IJ6 A;  1S5G Y;  4L9M A;  2LLT A;  4MN0 A;  3LK0 A;  1NCX A;  5FYX A;  2B1U A;  5DKQ A;  5HLO A;  2QAC A;  3IQQ A;  2EC6 B;  1SL7 A;  2MBX A;  2BKI B;  2JC2 A;  5KTY A;  2G9B A;  1CLM A;  1J7O A;  1A29 A;  1K9K A;  2KAX A;  1IKU A;  3TZ1 A;  5AER A;  3RM1 A;  1S5G Z;  2L4I A;  1IQ3 A;  4PHN A;  3D0Y A;  2JZI A;  3F45 A;  2JWW A;  2CCM A;  1R6P A;  2E30 A;  1K96 A;  1ZOT B;  2NZ0 A;  1NX0 A;  1QAS A;  3BUW B;  1SRA A;  4U8D A;  3NXA A;  4C0L A;  2LVJ A;  1WRK A;  1OSA A;  1CM1 A;  2KFH A;  3I5I B;  4NDB A;  4P5O E;  1UP5 A;  3O2P A;  4QJ4 B;  1WRL A;  2WOS A;  1SCM C;  1CLL A;  3QRX A;  3M0W A;  4C0K A;  1ZAC A;  5KU1 A;  3NSI A;  2LVV A;  2Y5I A;  1ODB A;  2LV7 A;  4N1G A;  4USL A;  2MLE C;  4AQI A;  1DMO A;  2JRF A;  1OE9 B;  1DGU A;  4CID A;  1UWO A;  2ZKM X;  1SK6 D;  4OKH A;  2I7A A;  1CM4 A;  4I5L B;  1JFJ A;  4BY5 A;  2O60 A;  1F55 A;  4PHM A;  4AOM A;  4R1E A;  3BUX B;  4XJK B;  1LA3 A;  1K2H A;  2CTN A;  1K8U A;  2L0P A;  1K9P A;  1G4Y R;  1S3P A;  2DOQ A;  2PAL A;  4M2O A;  1KSO A;  2K8M B;  4PE7 A;  1K9U A;  2I94 A;  2KDH A;  4E68 A;  1H4B A;  1D1O A;  1NCY A;  4MRX A;  1B9A A;  4MLW A;  3BUO B;  1KQM B;  1L2O C;  2ZNE A;  4MBE A;  3I5H B;  1B8L A;  3JTD B;  3CWG A;  3DF0 A;  3KO0 A;  4OVN F;  3DVK A;  3EK8 A;  1F71 A;  4YRU A;  2LP2 A;  4MSP A;  4PE1 A;  1CMF A;  2OTG B;  4DCK A;  3EKJ A;  4OV2 A;  5J3X A;  2BCB A;  1OQP A;  3FS7 A;  4QJ3 B;  1VRK A;  1NCZ A;  1N2D A;  1NX1 A;  2M7N A;  1F54 A;  1MQ1 A;  2SCP A;  3KPX A;  4GBA A;  5JOL A;  3PAL A;  2M9G A;  1YR5 A;  3WXA A;  1U5I A;  5CSI A;  1Y1U A;  1XA5 A;  1WDC B;  2H61 C;  5GQQ C;  2KFG A; 
#chains in the Genus database with same CATH topology
 3KEV A;  2JXL A;  3R1P A;  4MEW A;  1DJX A;  3SS3 A;  1J7P A;  3D76 A;  3CZT X;  3BUN B;  1AP4 A;  1QX7 A;  5DKR A;  3K21 A;  2BL0 C;  1WLM A;  3SS4 A;  2M8U A;  4ZCU A;  1BG1 A;  2HF5 A;  4CFQ A;  3OP0 A;  1E8A A;  1XFR A;  5KSZ A;  1K95 A;  3NHI A;  1FBV A;  2L5Y A;  2LCP A;  1PVA A;  3EVV A;  3SG2 A;  2JOJ A;  1C07 A;  1H8B A;  2F33 A;  1RJV A;  3NSK A;  1M39 A;  2WOR A;  3BYA A;  1NYA A;  3I5G B;  3L47 A;  4I5J A;  2L5X B;  2LHI A;  2E6W A;  5CPV A;  2BBM A;  3JVT B;  1B7T Z;  3D75 A;  4M2P A;  1KWO B;  5HL1 A;  2JXC A;  1M63 B;  1QS7 A;  1CNP A;  1S6J A;  2FCD A;  1EG3 A;  5F6T A;  1CKK A;  3B7A A;  1CFD A;  4OR9 B;  3I5F C;  2LMU A;  3NSL A;  1MUX A;  1KK8 B;  2KI6 C;  3SG6 A;  2FJY A;  1SKT A;  4FTG A;  2RGI A;  1SY9 A;  1S6C A;  3ZWH A;  2JUL A;  3GK4 X;  1JF0 A;  1DJY A;  4WRI A;  2G2B A;  1Z2C B;  4N5X A;  3DVE A;  2PVB A;  5HLV A;  2KGR A;  4INW A;  2KI6 D;  3SG4 A;  1X02 A;  1XFW O;  4PE4 A;  2PYQ A;  1Y0V H;  1Z4H A;  5CSF A;  2ZN9 A;  5PAL A;  2F2P A;  2LUX A;  1TNQ A;  3B87 A;  1WRZ A;  1DJW A;  1C3Z A;  1OZO A;  1AJ5 A;  1YUR A;  4TNC A;  2EGD A;  2CNP A;  3BOW B;  1JFK A;  2JNX A;  2M1U A;  4WQ2 A;  1DF0 A;  1XVJ A;  2BAP A;  3N7H A;  1MXL C;  1OOF A;  3QME A;  1B47 A;  2A4J A;  2WCB A;  4YGE B;  1YX7 A;  2M1K B;  3IVT A;  1ALV A;  4BY4 A;  1LIN A;  2LVI A;  2LMT A;  3C1V A;  1JC2 A;  2KI4 B;  3IF7 A;  1NWD A;  3I5I C;  2LAN A;  1XFU O;  2QEV A;  4GNK B;  1W7I B;  1CDL A;  1UUS A;  1J7Q A;  1OOJ A;  2WND A;  3A8R A;  1WY9 A;  3R1O A;  1YRU B;  2FCE A;  3ZNI A;  1FF1 A;  1UHJ A;  2P70 A;  1TIZ A;  2WC8 A;  2HET A;  1SCM B;  1N65 A;  1EG4 A;  1XYD A;  3MSE B;  1QIW A;  3LCP C;  2BE4 A;  2MJW B;  2AUC A;  4ORA B;  3VRQ A;  4HSZ A;  3VB1 A;  2KYC A;  1QVI Y;  2NCP A;  1KFU S;  3EK4 A;  5HKY A;  3R1V A;  2LC5 A;  4YGC B;  1AJ4 A;  1QLK A;  5AXI A;  2H8V A;  3NSO A;  4M2Q A;  3RLZ A;  2GV5 A;  3Q8I A;  2KSP A;  5HYD A;  2D8N A;  2GGM A;  2K7C A;  4PHK A;  3E3R A;  1UHI A;  2PQL A;  3EVR A;  1KFU L;  3D0Y B;  2K7B A;  1DJG A;  1ZUZ A;  1IGV A;  1QVI Z;  1SBJ A;  1V1G A;  1XFY O;  4UPG A;  3FE8 A;  1PUL A;  2ZRT A;  3EKH A;  5FI7 A;  2HQ8 A;  3WHU B;  3SIB A;  2LLS A;  1ZMZ A;  2ZND A;  3HCM A;  5FI6 A;  4GUK A;  1XFZ O;  2H61 A;  3EG5 B;  4IL1 A;  1M31 A;  4GGN A;  1KQV A;  3S0B A;  3AKA A;  4ETO A;  4FQO A;  1A75 A;  1QJT A;  2ZRS A;  1SPY A;  1GQM A;  4PDZ A;  1FI5 A;  4Q04 A;  4WQ3 A;  5IBW A;  2AAO A;  1SR6 B;  1CFC A;  1KQM C;  1JSA A;  2AMI A;  3OB1 B;  3V2L A;  5D69 A;  1HT9 A;  1IJ5 A;  3CGA A;  1BLQ A;  1QIV A;  1SW8 A;  1S36 A;  3JTD C;  1NSH A;  1WLZ A;  5I2Q A;  1L2O B;  1KK7 Y;  3CZ1 A;  3LLE A;  1DT7 B;  2JNF A;  3DVJ A;  1MR8 A;  4F7F A;  1ZFS A;  2OTG C;  1AUI B;  2F2O A;  3BFB A;  3B88 A;  4MZL A;  1TN4 A;  2JU0 A;  2BEC A;  5ER4 X;  1OOI X;  1JBA A;  1YUS A;  2CXJ A;  1AK8 A;  2JTT A;  2LVK A;  1G33 A;  1KK7 Z;  1J1D A;  3H4S E;  1UHN A;  5HKW A;  1EXR A;  1TCF A;  3BXK A;  1QX5 B;  3PN7 B;  1P28 A;  2MLF C;  2BCA A;  3SG3 A;  1WDC C;  1GGW A;  2K0J A;  1A2X A;  3S0E A;  2CBL A;  2BCX A;  3OX6 A;  3TS5 B;  3PFV A;  1CDM A;  1XFV O;  1OMD A;  2L2E A;  3PSR A;  1YRT B;  1M45 A;  3FWC A;  2WCF A;  2PSR A;  3BFH A;  1ORG A;  3DZT A;  4CLN A;  1NX3 A;  3O4Y A;  2Y4Q A;  1L7Z A;  1HQV A;  4JWQ A;  1PK0 D;  2MA2 A;  2TN4 A;  3GK1 A;  4HRE E;  4ORB B;  5DKN A;  1KSM A;  1QXP A;  1DTL A;  1BR1 B;  2BL0 B;  2K7D A;  2NCO A;  3DF0 B;  3LK1 A;  1JWD A;  4PHJ A;  1SCV A;  2FOT A;  4OCI A;  2KAV A;  1YUT A;  1IQ5 A;  2F8P A;  2KAY A;  1CTR A;  1YTZ C;  1KFX S;  3I5G C;  5EL2 A;  1OMR A;  3PM8 A;  1K93 D;  1Q80 A;  1R2U A;  2WC5 A;  2KOT A;  1SMG A;  3JVT C;  3TUY C;  1BMO A;  3AKB A;  1MHO A;  2BKH B;  1EL4 A;  2M29 A;  3GK2 A;  2M3W A;  2JT0 A;  2OS8 C;  5D7F A;  1TRF A;  1CDP A;  3PLF B;  5I2L A;  1U5I B;  1TTX A;  1G8I A;  5DIC A;  1QAT A;  4GPL B;  1GM0 A;  2K2A A;  5AEQ A;  1ALW A;  1B8R A;  1RK9 A;  1AHR A;  1BT6 A;  1OZS A;  1S26 D;  1BF5 A;  2WCK A;  4GGF A;  1XO5 A;  3O78 A;  1KCY A;  4CFR A;  3D10 A;  4YGA A;  2L50 A;  2KNE A;  3DD4 A;  1SL9 A;  2P71 A;  2EC6 C;  2HPS A;  4A4C A;  3S0F A;  1K94 A;  2VRG A;  1LXF C;  1TCO B;  1FI6 A;  4I5K A;  2O5G A;  4C0J A;  2WCL A;  4YGD B;  3TDI A;  1TUJ A;  1T14 A;  1DJH A;  4MZK A;  1Y1X A;  3B6X A;  4XJK A;  2KQ6 A;  1IWQ A;  2SAS A;  3WHT B;  2GTE A;  4DS7 A;  2WCM A;  1BOC A;  2IS9 A;  4YI8 A;  1N0Y A;  1EH2 A;  2LLU A;  2Y1M A;  3PAT A;  2KI4 C;  2LP3 A;  2LUC A;  3NHT A;  4PT1 A;  2Y1N A;  3BQ3 A;  2H2K A;  4GGF C;  2R2I A;  2WCE A;  4JKT A;  1UHK A;  4OZD A;  4PE0 A;  1PSB A;  3S0D A;  1TNW A;  1NX2 A;  2M49 B;  2BE6 A;  4XYN A;  3FWB A;  4GFT A;  3A4U B;  2KYF A;  3EVU A;  3OX5 A;  4MZJ A;  1JF2 A;  4AQJ A;  2PRU A;  1LVC D;  2LNK A;  5AFP A;  5I94 A;  2ZFD A;  4ORC B;  1NP8 A;  4MVF A;  3DY9 A;  2JPT A;  1DEK A;  1J7R A;  4F0Z B;  2M0R A;  1PSR A;  5I8N A;  2K61 A;  1NPQ A;  3AAJ A;  4JQ0 D;  2MHH A;  4QJ5 B;  5ER5 A;  1B1G A;  5K89 A;  1RRO A;  2F3Y A;  2M97 A;  1MWN A;  1OOG A;  1V1F A;  1XK4 A;  3CS1 A;  3CTN A;  1FW4 A;  1OMV A;  1BJF A;  2I2R E;  1TOP A;  3K1E A;  1DF0 B;  3LL8 B;  3OHM B;  1REC A;  1Y6W A;  3FIA A;  1Y1A A;  2KFF A;  5HKZ A;  1YUU A;  4DUQ A;  1F4O A;  2WCJ A;  4INX A;  2WCH A;  3HX4 A;  4I5N B;  2JT8 A;  1F8H A;  1MXE A;  3VRN A;  2COL B;  3NGV A;  4YGB B;  3AAK A;  1RFJ A;  3CZ0 A;  4JPZ B;  3CYZ A;  1DEL A;  4YI9 A;  2BBN A;  1J1E A;  2ISD A;  3VRP A;  1CFP A;  1GJY A;  2KBI A;  1CMG A;  1K90 D;  3I5H C;  1QX2 A;  2MRD A;  4P2Y B;  1SR6 C;  1SL8 A;  2I18 A;  1DC1 A;  1QWV A;  2M7L A;  1DGV A;  5CSN A;  5G08 A;  1CFF A;  1RWY A;  1DJZ A;  1DVI A;  1EJ3 A;  1S1E A;  2Q4U A;  3OB2 B;  1C7W A;  4MRY A;  4KYN A;  1TWO A;  3CR5 X;  1XK4 C;  2KGB C;  3IQO A;  1F70 A;  1J55 A;  1W7J B;  1W9Z A;  1RTP 1;  1QTX A;  2LM5 A;  2NLN A;  2FJU B;  1IG5 A;  3RZS A;  2V53 A;  4N1F A;  2LHL A;  3CZ2 A;  4GAO A;  1LKJ A;  2CT9 A;  5I2O A;  3KHE A;  1IRJ A;  1CLB A;  1CB1 A;  1BR4 B;  5B8I B;  4NDC A;  1QV0 A;  1OW4 A;  1BOD A;  2K7O A;  3ICB A;  4YBH B;  1SYM A;  5FI2 A;  1TNX A;  2EHB A;  3S0A A;  2L4H A;  3D74 A;  3PN7 C;  3SG7 A;  1AVS A;  2LMV A;  1BU3 A;  1IH0 A;  2JTZ A;  2ZN8 A;  1A4P A;  1A75 B;  2P6B B;  2QPT A;  3SIA A;  1CDN A;  1B4C A;  3TS5 C;  2KQY A;  1XFX O;  1S6I A;  5TNC A;  1NIW A;  1TUZ A;  4D1E A;  4DIR A;  2HQW A;  2PMY A;  1F4Q A;  2L98 A;  3VGO A;  1PRW A;  1YVH A;  2BNX A;  1YVL A;  4CPV A;  1B8C A;  3KF9 A;  4A4B A;  3OGN A;  3VRR A;  2K60 A;  2K2F A;  2KBM A;  2KHN A;  1MF8 B;  3WNX B;  4PCW A;  1JUO A;  2ERB A;  2Q91 A;  3CLN A;  3DYE A;  3VRO A;  3GOF A;  3CR2 A;  2OPO A;  1YX8 A;  2LE9 B;  3TDU A;  3BOW A;  3TDZ A;  1KWO C;  2GGZ A;  3SJS A;  1B7T Y;  4PAL A;  4NQG A;  1PVB A;  4HRH A;  1C3Y A;  2PAS A;  1KFX L;  1LA0 A;  2KLD A;  4NDD A;  1FPW A;  5BPJ A;  3CR4 X;  3SG5 A;  1QV1 A;  3BUM B;  1SNL A;  2NXQ A;  2KPH A;  2YGU A;  1PAL A;  1KK8 C;  4ZCV A;  1UHH A;  3I5F B;  1A03 A;  1M46 A;  3EK7 A;  3O6B A;  5CSJ A;  2F3Z A;  3TUY B;  2JQ6 A;  2LAP A;  4DRW A;  3SS5 A;  1NUB A;  2OS8 B;  5AAN A;  2MAZ A;  1C7V A;  3O4X A;  1UUR A;  1DJI A;  3DVM A;  4ICB A;  1TNP A;  3B86 A;  1GGZ A;  1QLS A;  5JJG A;  2JT3 A;  4HRG A;  2L51 A;  1IJ6 A;  2QEH A;  1S5G Y;  4L9M A;  2LLT A;  4MN0 A;  3LK0 A;  5D3O A;  1NCX A;  5FYX A;  2B1U A;  5DKQ A;  5HLO A;  2QAC A;  3IQQ A;  2EC6 B;  1SL7 A;  1OOH A;  2MBX A;  2BKI B;  2JC2 A;  5KTY A;  2G9B A;  1CLM A;  1J7O A;  1A29 A;  1K9K A;  2KAX A;  1IKU A;  3TZ1 A;  5AER A;  3RM1 A;  1S5G Z;  2L4I A;  1IQ3 A;  4PHN A;  3D0Y A;  2JZI A;  3F45 A;  2JWW A;  4IJ7 A;  4JD9 A;  2CCM A;  1R6P A;  2E30 A;  1K96 A;  1ZOT B;  2NZ0 A;  1NX0 A;  1LS8 A;  1QAS A;  3BUW B;  1SRA A;  4U8D A;  3NXA A;  4C0L A;  2QEO A;  2LVJ A;  1WRK A;  1OSA A;  1CM1 A;  2KFH A;  3I5I B;  4NDB A;  3FE6 A;  1UP5 A;  3O2P A;  3DXL A;  4P5O E;  4QJ4 B;  1WRL A;  2WOS A;  3CAB A;  1SCM C;  3PJI A;  1CLL A;  3QRX A;  3M0W A;  4C0K A;  1ZAC A;  5KU1 A;  3NSI A;  2KLE A;  2LVV A;  2Y5I A;  1ODB A;  2LV7 A;  4N1G A;  4USL A;  2MLE C;  4AQI A;  1DMO A;  2JRF A;  1OE9 B;  1DGU A;  4CID A;  1UWO A;  2ZKM X;  1SK6 D;  4OKH A;  4FQT A;  2I7A A;  1CM4 A;  1SSE B;  3UO9 A;  3BJH A;  4I5L B;  1JFJ A;  3FE9 A;  4BY5 A;  2O60 A;  3S0G A;  3D78 A;  1F55 A;  3D77 A;  4PHM A;  4AOM A;  4R1E A;  3BUX B;  1IIO A;  4XJK B;  1LA3 A;  1K2H A;  2CTN A;  3BFA A;  3L4A A;  1K8U A;  2L0P A;  1K9P A;  1G4Y R;  1S3P A;  2DOQ A;  2PAL A;  4M2O A;  1KSO A;  2K8M B;  4PE7 A;  1K9U A;  2I94 A;  2KDH A;  2QEB A;  4E68 A;  1H4B A;  1D1O A;  1NCY A;  4MRX A;  2JPO A;  1B9A A;  3R72 A;  4MLW A;  3BUO B;  1KQM B;  1L2O C;  2ZNE A;  4MBE A;  2L2C A;  3I5H B;  3UNW A;  1B8L A;  3JTD B;  3PM2 A;  3CWG A;  3DF0 A;  3KO0 A;  4OVN F;  3DVK A;  3EK8 A;  1F71 A;  2QDI A;  4YRU A;  2LP2 A;  4MSP A;  4PE1 A;  1CMF A;  2OTG B;  4DCK A;  3EKJ A;  4OV2 A;  5J3X A;  3OBV A;  2BCB A;  1OQP A;  3FS7 A;  4QJ3 B;  1VRK A;  1NCZ A;  1N2D A;  1NX1 A;  2M7N A;  1F54 A;  3D73 A;  1DQE A;  1MQ1 A;  2SCP A;  3CDN A;  3KPX A;  2WC6 A;  4GBA A;  5JOL A;  3PAL A;  2M9G A;  1YR5 A;  3WXA A;  1U5I A;  3L4L A;  5CSI A;  1Y1U A;  1XA5 A;  1WDC B;  2H61 C;  5GQQ C;  2KFG A; 
#chains in the Genus database with same CATH homology
 3KEV A;  2JXL A;  4MEW A;  1DJX A;  1J7P A;  3CZT X;  3BUN B;  1AP4 A;  1QX7 A;  5DKR A;  3K21 A;  2BL0 C;  1WLM A;  2M8U A;  4ZCU A;  1BG1 A;  2HF5 A;  4CFQ A;  3OP0 A;  1E8A A;  5KSZ A;  1K95 A;  1FBV A;  2LCP A;  3SG2 A;  1PVA A;  3EVV A;  2JOJ A;  1C07 A;  1H8B A;  2F33 A;  1RJV A;  3NSK A;  1M39 A;  2WOR A;  3BYA A;  1NYA A;  3I5G B;  4I5J A;  2L5X B;  2LHI A;  2E6W A;  5CPV A;  2BBM A;  3JVT B;  1B7T Z;  4M2P A;  1KWO B;  2JXC A;  1M63 B;  1QS7 A;  1CNP A;  1S6J A;  2FCD A;  1EG3 A;  5F6T A;  1CKK A;  1CFD A;  4OR9 B;  3I5F C;  2LMU A;  3NSL A;  1MUX A;  1KK8 B;  2KI6 C;  3SG6 A;  4FTG A;  1SKT A;  2RGI A;  1SY9 A;  1S6C A;  3ZWH A;  2JUL A;  3GK4 X;  1JF0 A;  1DJY A;  4WRI A;  2G2B A;  4N5X A;  3DVE A;  2PVB A;  5HLV A;  2KGR A;  2KI6 D;  3SG4 A;  1X02 A;  1XFW O;  4PE4 A;  1Y0V H;  5CSF A;  2ZN9 A;  5PAL A;  2F2P A;  2LUX A;  1TNQ A;  1WRZ A;  1DJW A;  1OZO A;  1AJ5 A;  1YUR A;  4TNC A;  2EGD A;  2CNP A;  3BOW B;  1JFK A;  2JNX A;  2M1U A;  4WQ2 A;  1DF0 A;  1XVJ A;  1MXL C;  1B47 A;  2A4J A;  2WCB A;  4YGE B;  1YX7 A;  2M1K B;  1ALV A;  4BY4 A;  1LIN A;  2LVI A;  2LMT A;  3C1V A;  1JC2 A;  2KI4 B;  3IF7 A;  1NWD A;  3I5I C;  2LAN A;  1XFU O;  4GNK B;  1W7I B;  1CDL A;  1UUS A;  1J7Q A;  1OOJ A;  2WND A;  3A8R A;  1WY9 A;  1YRU B;  2FCE A;  3ZNI A;  1FF1 A;  1UHJ A;  2WC8 A;  1TIZ A;  2HET A;  1SCM B;  1N65 A;  1EG4 A;  1XYD A;  3MSE B;  1QIW A;  3LCP C;  2BE4 A;  2MJW B;  2AUC A;  4ORA B;  3VRQ A;  4HSZ A;  2KYC A;  1QVI Y;  2NCP A;  1KFU S;  3EK4 A;  5HKY A;  2LC5 A;  4YGC B;  1AJ4 A;  1QLK A;  5AXI A;  3NSO A;  4M2Q A;  3RLZ A;  2GV5 A;  2KSP A;  5HYD A;  2D8N A;  2GGM A;  2K7C A;  4PHK A;  3E3R A;  1UHI A;  3EVR A;  1KFU L;  3D0Y B;  2K7B A;  1DJG A;  1ZUZ A;  1IGV A;  1QVI Z;  1SBJ A;  1V1G A;  1XFY O;  4UPG A;  1PUL A;  2ZRT A;  3EKH A;  3WHU B;  2HQ8 A;  3SIB A;  2LLS A;  1ZMZ A;  2ZND A;  3HCM A;  4GUK A;  1XFZ O;  2H61 A;  4IL1 A;  1M31 A;  4GGN A;  1KQV A;  3AKA A;  4ETO A;  4FQO A;  1A75 A;  1QJT A;  2ZRS A;  1SPY A;  1GQM A;  4PDZ A;  1FI5 A;  4Q04 A;  4WQ3 A;  5IBW A;  2AAO A;  1SR6 B;  1CFC A;  1KQM C;  1JSA A;  2AMI A;  3OB1 B;  5D69 A;  1HT9 A;  1IJ5 A;  3CGA A;  1BLQ A;  1QIV A;  1SW8 A;  1S36 A;  3JTD C;  1NSH A;  1WLZ A;  5I2Q A;  1L2O B;  1KK7 Y;  3LLE A;  1DT7 B;  2JNF A;  3DVJ A;  1MR8 A;  1ZFS A;  2OTG C;  1AUI B;  2F2O A;  4MZL A;  1TN4 A;  2JU0 A;  2BEC A;  5ER4 X;  1JBA A;  1YUS A;  2CXJ A;  1AK8 A;  2JTT A;  2LVK A;  1G33 A;  1KK7 Z;  1J1D A;  3H4S E;  1UHN A;  5HKW A;  1EXR A;  1TCF A;  3BXK A;  1QX5 B;  3PN7 B;  2MLF C;  2BCA A;  3SG3 A;  1WDC C;  1GGW A;  2K0J A;  1A2X A;  2CBL A;  2BCX A;  3OX6 A;  3TS5 B;  3PFV A;  1CDM A;  1XFV O;  1OMD A;  2L2E A;  3PSR A;  1YRT B;  1M45 A;  3FWC A;  2WCF A;  2PSR A;  4CLN A;  1NX3 A;  3O4Y A;  2Y4Q A;  1L7Z A;  1HQV A;  4JWQ A;  1PK0 D;  2MA2 A;  2TN4 A;  3GK1 A;  4HRE E;  4ORB B;  5DKN A;  1KSM A;  1QXP A;  1DTL A;  1BR1 B;  2BL0 B;  2K7D A;  2NCO A;  3DF0 B;  3LK1 A;  1JWD A;  4PHJ A;  1SCV A;  2FOT A;  4OCI A;  2KAV A;  1YUT A;  1IQ5 A;  2F8P A;  2KAY A;  1CTR A;  1YTZ C;  1KFX S;  3I5G C;  1OMR A;  3PM8 A;  1K93 D;  1Q80 A;  1R2U A;  2KOT A;  1SMG A;  3JVT C;  3TUY C;  1BMO A;  3AKB A;  1MHO A;  2BKH B;  1EL4 A;  2M29 A;  3GK2 A;  2M3W A;  2JT0 A;  2OS8 C;  5D7F A;  1TRF A;  1CDP A;  3PLF B;  5I2L A;  1U5I B;  1TTX A;  1G8I A;  1QAT A;  4GPL B;  2K2A A;  5AEQ A;  1ALW A;  1B8R A;  1RK9 A;  1AHR A;  1BT6 A;  1OZS A;  1S26 D;  1BF5 A;  4GGF A;  1XO5 A;  1KCY A;  4CFR A;  3D10 A;  4YGA A;  2L50 A;  2KNE A;  3DD4 A;  1SL9 A;  2EC6 C;  2HPS A;  4A4C A;  1K94 A;  2VRG A;  1LXF C;  1TCO B;  1FI6 A;  4I5K A;  2O5G A;  4C0J A;  4YGD B;  3TDI A;  1DJH A;  4MZK A;  1Y1X A;  4XJK A;  2KQ6 A;  1IWQ A;  2SAS A;  3WHT B;  4DS7 A;  1BOC A;  2IS9 A;  4YI8 A;  1N0Y A;  1EH2 A;  2LLU A;  2Y1M A;  3PAT A;  2KI4 C;  2LP3 A;  2LUC A;  2Y1N A;  3BQ3 A;  2H2K A;  4GGF C;  2R2I A;  2WCE A;  4PE0 A;  1UHK A;  1PSB A;  1TNW A;  1NX2 A;  2M49 B;  2BE6 A;  4XYN A;  3FWB A;  4GFT A;  3A4U B;  2KYF A;  3EVU A;  3OX5 A;  4MZJ A;  1JF2 A;  4AQJ A;  2PRU A;  1LVC D;  2LNK A;  5AFP A;  2ZFD A;  4ORC B;  1NP8 A;  4MVF A;  2JPT A;  1J7R A;  4F0Z B;  2M0R A;  1PSR A;  5I8N A;  2K61 A;  1NPQ A;  3AAJ A;  4JQ0 D;  2MHH A;  4QJ5 B;  5ER5 A;  1B1G A;  5K89 A;  1RRO A;  2F3Y A;  2M97 A;  1MWN A;  1V1F A;  3CS1 A;  1XK4 A;  3CTN A;  3O78 A;  1FW4 A;  1OMV A;  1BJF A;  2I2R E;  1TOP A;  3LL8 B;  1DF0 B;  3OHM B;  1REC A;  1Y6W A;  3FIA A;  1Y1A A;  2KFF A;  5HKZ A;  1YUU A;  4DUQ A;  1F4O A;  3HX4 A;  4I5N B;  2JT8 A;  1F8H A;  1MXE A;  3VRN A;  2COL B;  4YGB B;  3AAK A;  1RFJ A;  4JPZ B;  2ISD A;  4YI9 A;  2BBN A;  1J1E A;  3VRP A;  1CFP A;  1GJY A;  2KBI A;  1CMG A;  1K90 D;  3I5H C;  1QX2 A;  2MRD A;  4P2Y B;  1SR6 C;  1SL8 A;  2I18 A;  2M7L A;  1DGV A;  5CSN A;  5G08 A;  1CFF A;  1RWY A;  1DJZ A;  1DVI A;  1EJ3 A;  1S1E A;  2Q4U A;  3OB2 B;  1C7W A;  4MRY A;  3IQO A;  3CR5 X;  1XK4 C;  2KGB C;  1F70 A;  1J55 A;  1W7J B;  1RTP 1;  1QTX A;  2LM5 A;  2NLN A;  2FJU B;  1IG5 A;  2V53 A;  4N1F A;  2LHL A;  4GAO A;  1LKJ A;  2CT9 A;  5I2O A;  3KHE A;  1IRJ A;  1CLB A;  1CB1 A;  1BR4 B;  5B8I B;  4NDC A;  1QV0 A;  1BOD A;  2K7O A;  3ICB A;  4YBH B;  1SYM A;  1TNX A;  2EHB A;  2L4H A;  3PN7 C;  3SG7 A;  1AVS A;  2LMV A;  1BU3 A;  1IH0 A;  2JTZ A;  2ZN8 A;  1A4P A;  1A75 B;  2P6B B;  2QPT A;  3SIA A;  1CDN A;  1B4C A;  3TS5 C;  2KQY A;  1XFX O;  1S6I A;  5TNC A;  1NIW A;  4D1E A;  4DIR A;  2HQW A;  2PMY A;  1F4Q A;  2L98 A;  3VGO A;  1PRW A;  1YVH A;  4CPV A;  1YVL A;  1B8C A;  3KF9 A;  4A4B A;  3VRR A;  2K2F A;  2KBM A;  2KHN A;  1MF8 B;  3WNX B;  4PCW A;  1JUO A;  2Q91 A;  3CLN A;  3VRO A;  3GOF A;  3CR2 A;  2OPO A;  1YX8 A;  2LE9 B;  3TDU A;  3BOW A;  3TDZ A;  1KWO C;  2GGZ A;  3SJS A;  1B7T Y;  4PAL A;  4NQG A;  1PVB A;  4HRH A;  2PAS A;  1KFX L;  1LA0 A;  4NDD A;  1FPW A;  5BPJ A;  3CR4 X;  3SG5 A;  1QV1 A;  3BUM B;  1SNL A;  2NXQ A;  4ZCV A;  1PAL A;  1KK8 C;  1UHH A;  3I5F B;  1A03 A;  1M46 A;  3EK7 A;  3O6B A;  5CSJ A;  2F3Z A;  3TUY B;  2JQ6 A;  2LAP A;  4DRW A;  1NUB A;  2OS8 B;  5AAN A;  2MAZ A;  1C7V A;  1UUR A;  1DJI A;  3DVM A;  4ICB A;  1TNP A;  1GGZ A;  1QLS A;  5JJG A;  2JT3 A;  4HRG A;  2L51 A;  1IJ6 A;  1S5G Y;  4L9M A;  2LLT A;  4MN0 A;  3LK0 A;  1NCX A;  5FYX A;  2B1U A;  5DKQ A;  5HLO A;  2QAC A;  3IQQ A;  2EC6 B;  1SL7 A;  2MBX A;  2BKI B;  2JC2 A;  5KTY A;  2G9B A;  1CLM A;  1J7O A;  1A29 A;  1K9K A;  2KAX A;  1IKU A;  3TZ1 A;  5AER A;  3RM1 A;  1S5G Z;  2L4I A;  1IQ3 A;  4PHN A;  3D0Y A;  2JZI A;  3F45 A;  2JWW A;  2CCM A;  1R6P A;  2E30 A;  1K96 A;  1ZOT B;  2NZ0 A;  1NX0 A;  1QAS A;  3BUW B;  1SRA A;  4U8D A;  3NXA A;  4C0L A;  2LVJ A;  1WRK A;  1OSA A;  1CM1 A;  2KFH A;  3I5I B;  4NDB A;  4P5O E;  1UP5 A;  3O2P A;  4QJ4 B;  1WRL A;  2WOS A;  1SCM C;  1CLL A;  3QRX A;  3M0W A;  4C0K A;  1ZAC A;  5KU1 A;  3NSI A;  2LVV A;  2Y5I A;  1ODB A;  2LV7 A;  4N1G A;  4USL A;  2MLE C;  4AQI A;  1DMO A;  2JRF A;  1OE9 B;  1DGU A;  4CID A;  1UWO A;  2ZKM X;  1SK6 D;  4OKH A;  2I7A A;  1CM4 A;  4I5L B;  1JFJ A;  4BY5 A;  2O60 A;  1F55 A;  4PHM A;  4AOM A;  4R1E A;  3BUX B;  4XJK B;  1LA3 A;  1K2H A;  2CTN A;  1K8U A;  2L0P A;  1K9P A;  1G4Y R;  1S3P A;  2DOQ A;  2PAL A;  4M2O A;  1KSO A;  2K8M B;  4PE7 A;  1K9U A;  2I94 A;  2KDH A;  4E68 A;  1H4B A;  1D1O A;  1NCY A;  4MRX A;  1B9A A;  4MLW A;  3BUO B;  1KQM B;  1L2O C;  2ZNE A;  4MBE A;  3I5H B;  1B8L A;  3JTD B;  3CWG A;  3DF0 A;  3KO0 A;  4OVN F;  3DVK A;  3EK8 A;  1F71 A;  4YRU A;  2LP2 A;  4MSP A;  4PE1 A;  1CMF A;  2OTG B;  4DCK A;  3EKJ A;  4OV2 A;  5J3X A;  2BCB A;  1OQP A;  3FS7 A;  4QJ3 B;  1VRK A;  1NCZ A;  1N2D A;  1NX1 A;  2M7N A;  1F54 A;  1MQ1 A;  2SCP A;  3KPX A;  4GBA A;  5JOL A;  3PAL A;  2M9G A;  1YR5 A;  3WXA A;  1U5I A;  5CSI A;  1Y1U A;  1XA5 A;  1WDC B;  2H61 C;  5GQQ C;  2KFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...