4ZCUA

Structure of calcium-bound regulatory domain of the human atp-mg/pi carrier in the p2 form
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
153
structure length
152
Chain Sequence
TRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTTGDVNKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLQTLGLTISEQQAELILQSIDVDGTTVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Calcium-induced conformational changes in the regulatory domain of the human mitochondrial ATP-Mg/Pi carrier.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Calcium-binding mitochondrial carrier protein SCaMC-1
total genus 51
structure length 152
sequence length 153
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4zcuA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4zcuA02
1N65A 3PALA 3WHTB 3RM1A 1XFYO 2KQYA 2ZRSA 2MLEC 2I2RE 1AK8A 1BT6A 4P5OE 1LINA 2KAVA 1A29A 2SCPA 1K93D 3H4SE 2KI4C 2LV7A 1WRLA 1OQPA 3HX4A 4D1EA 2H61A 3VRQA 5KTYA 2BL0B 1JC2A 1AJ4A 3BOWA 3OB1B 3EKHA 5G08A 2D8NA 1F55A 1XFXO 3EVVA 4OV2A 2LVKA 1XO5A 1A4PA 1MF8B 4PCWA 1WRZA 2JT3A 4JWQA 3RLZA 3SIBA 1QLKA 1QS7A 1QV1A 2LVVA 4OKHA 4I5KA 2HETA 2JTZA 2M9GA 1JBAA 1YX7A 1NWDA 1OMVA 1U5IB 1SPYA 2DOQA 2L51A 2JXLA 2SASA 2LMVA 3AKBA 2WCBA 5B8IB 1YUSA 2JXCA 3BYAA 1SMGA 5J3XA 1QTXA 1ZOTB 2I18A 2K2AA 3CLNA 5CSNA 1CB1A 1FW4A 1SRAA 1LVCD 1FBVA 4ICBA 1TNPA 2F3ZA 1FI5A 2KFFA 1G4YR 1MWNA 3O6BA 4NDDA 2Y1MA 4ORCB 5F6TA 1N0YA 1KFXS 1BR4B 4YI8A 1TNXA 3PFVA 1OMDA 1HT9A 4I5NB 4JPZB 5AANA 3SG2A 1F8HA 3JVTB 5DKNA 5AEQA 1TTXA 5CSFA 1S6IA 1Y1XA 1F54A 2OS8B 1OZSA 4I5JA 1A03A 1CMFA 1S1EA 1DJYA 1B47A 1DJHA 1KSOA 5AFPA 1XVJA 2NXQA 1FF1A 1PULA 2NZ0A 1JF2A 2LUCA 4YBHB 5I2LA 4YGEB 4ORBB 1PVAA 4R1EA 5TNCA 2M7NA 2F3YA 5HLVA 2L4HA 2F2OA 1B4CA 1QIWA 1QJTA 1YUUA 1TCFA 1V1FA 4AQJA 1H8BA 1KK7Z 1S3PA 1EG3A 2BKIB 1DF0B 1K96A 1WRKA 5HLOA 4C0KA 3BUWB 3NSIA 5DKQA 4NQGA 5ER5A 3GOFA 3DVJA 2QACA 2JT0A 3NSLA 1S36A 2KAXA 1A75A 3BUMB 3EK7A 1GQMA 3PM8A 2L4IA 2M1KB 1S26D 1BOCA 1UP5A 1OMRA 2ZNDA 3I5GB 3IQOA 4HRGA 3VRRA 2F33A 3DF0A 2LHLA 1QX2A 1SW8A 4YGBB 1NX0A 3DVEA 2EC6C 3VROA 1M39A 3QRXA 4ORAB 2GGMA 2LLTA 4BY4A 2PSRA 1AUIB 1WDCB 3TS5C 4I5LB 5KSZA 1KQMB 2BBNA 2KSPA 4FQOA 1B8CA 4MEWA 1M45A 1YUTA 2JU0A 4WRIA 2WOSA 2MHHA 1JFJA 4MVFA 3EVRA 3O78A 1DTLA 2K2FA 1QX5B 2M0RA 3OP0A 2M49B 3CR2A 2FOTA 1IWQA 1SY9A 1EG4A 2HF5A 5JJGA 2HPSA 2PASA 3TDUA 3AAJA 1WDCC 3TS5B 5D7FA 1YR5A 1ZMZA 2WORA 1J7PA 1UWOA 2KFGA 3FWBA 5DKRA 2LMTA 1TN4A 2CXJA 1NIWA 1KQVA 1KSMA 2KGRA 2JTTA 2MRDA 5BPJA 1MHOA 1GGZA 1TRFA 1NX2A 1XFUO 2BKHB 4CFQA 4YGCB 2M29A 1PSRA 1MQ1A 3I5GC 1RTP1 3LK0A 2M7LA 1KK8B 2M97A 2AUCA 2BCXA 4MZJA 1SCVA 4QJ4B 1NSHA 2ISDA 2FCEA 3WNXB 1K2HA 2K8MB 1UUSA 3DF0B 3SG4A 3TZ1A 4PALA 3K21A 3C1VA 1G8IA 4GGNA 3SG3A 1CKKA 2JRFA 2BE4A 3LK1A 1A75B 2NCPA 1PALA 4CLNA 2K61A 1QVIY 1H4BA 1NCYA 2JZIA 4UPGA 4CIDA 2KI6D 1K95A 2JNFA 5K89A 4TNCA 1YVLA 1RK9A 1Y6WA 1SYMA 2K7CA 1QLSA 4DRWA 2GV5A 4MBEA 3FS7A 1L2OC 1QX7A 1SCMC 2CCMA 1F71A 1SR6C 1JUOA 2OS8C 1CFFA 3PN7C 3TUYB 2EHBA 3I5HC 2P6BB 1AVSA 2MA2A 3E3RA 1B7TZ 1IJ5A 1DGUA 1XK4C 3CR4X 3OX6A 1J7QA 1SR6B 1OE9B 2QPTA 2E6WA 1JF0A 2K0JA 2KYFA 1DVIA 5HKZA 1PK0D 1X02A 1V1GA 1L7ZA 4GUKA 1PSBA 2LLUA 1XFWO 1MUXA 2H61C 5I8NA 1QATA 4MLWA 2ZFDA 1LXFC 1BG1A 3KPXA 1UURA 3EK4A 1RWYA 2CBLA 2BCBA 1RJVA 1DJGA 1YURA 2L2EA 4WQ3A 4GPLB 1F4OA 1Y0VH 3TDIA 2LAPA 3KEVA 2Y1NA 1K8UA 2AMIA 1NPQA 2KHNA 1QASA 1ODBA 4AOMA 4PE4A 1KFXL 2CNPA 4A4BA 3OB2B 4YGDB 2OTGC 1J7RA 2O5GA 3GK4X 1NYAA 3LCPC 1S5GY 1RROA 2HQ8A 4GAOA 1IGVA 1U5IA 4OCIA 4HREE 1Y1AA 2M1UA 2BL0C 1CTRA 1JSAA 4HSZA 3KHEA 5HKWA 1F70A 1E8AA 1TCOB 1YRUB 4ZCVA 2GGZA 2COLB 1BODA 1IQ3A 5D69A 2FCDA 4GGFA 2M3WA 4USLA 4AQIA 1TIZA 1TNQA 1W7IB 4CPVA 2JQ6A 1CMGA 1CLLA 3SIAA 1FPWA 1AHRA 2AAOA 2MJWB 1N2DA 4ETOA 1QVIZ 1CDPA 1K9KA 1NX3A 1ZACA 2NLNA 2TN4A 2JNXA 1NP8A 2LUXA 4N5XA 3SJSA 3VRNA 1WLZA 1EXRA 2FJUB 2O60A 1B9AA 4DUQA 5I2OA 4QJ3B 1XYDA 5CSJA 1OSAA 1C07A 2CTNA 3CS1A 1KQMC 3I5IB 4XJKB 3TDZA 5ER4X 4JQ0D 1J1DA 2IS9A 3CZTX 1UHNA 2KI6C 2KAYA 1SL9A 3I5IC 1CFPA 3PATA 5AXIA 1MXEA 1CFCA 4N1FA 1M31A 1PVBA 1IJ6A 1WLMA 2MBXA 1R2UA 2BBMA 4DS7A 2LMUA 5HKYA 2BE6A 1UHHA 1RFJA 1SCMB 1BMOA 4XJKA 3SG6A 1DF0A 2E30A 1TOPA 1WY9A 1CDNA 1SL7A 2L0PA 4HRHA 4YRUA 4M2OA 1J1EA 1ZFSA 3CWGA 2KBIA 4MZLA 4A4CA 2WC8A 4L9MA 1AJ5A 2JC2A 2K7OA 4NDCA 5GQQC 1BR1B 1IG5A 1RECA 1IKUA 2EGDA 2R2IA 2ZRTA 2L5XB 2MLFC 3PSRA 1K90D 2KNEA 3DD4A 2PRUA 4MZKA 2OPOA 3BQ3A 2KFHA 4N1GA 4NDBA 4C0JA 3BUOB 5AERA 1D1OA 1HQVA 5IBWA 1XFZO 2LANA 4DIRA 1KK8C 2LNKA 1KFUS 3WXAA 5HYDA 2WCFA 4FTGA 1K9PA 4ZCUA 2H2KA 1KFUL 3OHMB 4E68A 3GK2A 1CDLA 1CDMA 1M46A 1SBJA 4CFRA 2NCOA 1NX1A 4PDZA 1CM1A 1PRWA 4P2YB 1QV0A 1UHIA 4PE1A 1MR8A 3D0YB 1VRKA 2KQ6A 4MSPA 1FI6A 1C7WA 3HCMA 1NCXA 2PVBA 4PHKA 1LA0A 4C0LA 1DJZA 1CLBA 1M63B 1F4QA 4MRXA 3SG7A 1YX8A 2L98A 3M0WA 5CPVA 3KF9A 3VGOA 1SK6D 1DJIA 2KOTA 1YRTB 3CR5X 4OVNF 3WHUB 1LKJA 2KYCA 3BOWB 3ZWHA 1GGWA 1BJFA 1L2OB 1NCZA 1BU3A 2LHIA 4GGFC 2Q91A 4WQ2A 1R6PA 4GNKB 1EJ3A 2KDHA 4YI9A 3O2PA 1S6JA 2I94A 3BUNB 1UHJA 3EKJA 3TUYC 2Y5IA 2KI4B 3EVUA 4IL1A 4BY5A 1YTZC 2LM5A 1DJXA 4PE7A 3AKAA 1B1GA 1DGVA 2K7DA 3F45A 2RGIA 2JWWA 1TNWA 2Q4UA 3IQQA 1W7JB 5I2QA 2KGBC 2G9BA 2LP3A 1OZOA 1XK4A 1IRJA 3JTDB 1OOJA 1SKTA 3LLEA 2ZN8A 4MN0A 2Y4QA 4M2QA 1YVHA 1BF5A 2JPTA 3D0YA 1Q80A 2ZN9A 2L50A 3FIAA 3JVTC 3NXAA 2WNDA 4PHJA 2G2BA 2PMYA 1S6CA 2VRGA 2KBMA 2I7AA 1XFVO 3OX5A 4GBAA 1KWOC 4GFTA 1CLMA 5KU1A 3ICBA 4DCKA 1C7VA 1ALWA 1NUBA 3NSKA 2BCAA 2JT8A 2LVIA 5FYXA 1B7TY 1J7OA 3AAKA 4Q04A 2LE9B 3DVKA 2LVJA 3ZNIA 5JOLA 3NSOA 3I5FC 1AP4A 1UHKA 3BUXB 3EK8A 1ZUZA 1GJYA 1DJWA 1KK7Y 3IF7A 2ZKMX 2BECA 2OTGB 1G33A 1B8RA 1Y1UA 3CGAA 3GK1A 1B8LA 4PHMA 4M2PA 2V53A 3BXKA 4OR9B 4QJ5B 4MRYA 3DVMA 1JWDA 2F8PA 2ZNEA 2HQWA 1QXPA 2JOJA 2MAZA 1IH0A 1EL4A 3I5FB 2EC6B 1BLQA 3KO0A 1IQ5A 1XA5A 3I5HB 3LL8B 1DMOA 3O4YA 1QIVA 3PN7B 5PALA 1JFKA 4YGAA 5CSIA 2K7BA 2F2PA 1CM4A 1S5GZ 1ALVA 1KWOB 2WCEA 4F0ZB 1K9UA 1CFDA 2CT9A 1EH2A 3SG5A 1DT7B 2A4JA 2LP2A 4U8DA 3CTNA 2LCPA 2B1UA 1LA3A 2JULA 1K94A 1CNPA 2M8UA 2LLSA 2PALA 3A4UB 4XYNA 3D10A 4PHNA 3PLFB 1SL8A 4PE0A 1KCYA 3VRPA 1A2XA 2LC5A 3A8RA 3FWCA 1SNLA 3JTDC 3MSEB 1J55A 1MXLC
chains in the Genus database with same CATH superfamily
1N65A 3PALA 3WHTB 3RM1A 1XFYO 2KQYA 2ZRSA 2MLEC 3V2LA 1P28A 2I2RE 1AK8A 1BT6A 3OBVA 4P5OE 3UO9A 1LINA 2KAVA 1A29A 2SCPA 1K93D 3H4SE 2KI4C 2LV7A 1WRLA 1OQPA 3HX4A 4D1EA 2H61A 3R1PA 4INWA 2BL0B 3VRQA 5KTYA 1AJ4A 3BOWA 3OB1B 3EKHA 5G08A 2D8NA 1F55A 1XFXO 3EVVA 4OV2A 2LVKA 1XO5A 1A4PA 1MF8B 4PCWA 1WRZA 2JT3A 4JWQA 3RLZA 3SIBA 1QLKA 1QS7A 1QV1A 2LVVA 4OKHA 4I5KA 2HETA 2JTZA 2M9GA 1JBAA 3PM2A 1YX7A 1NWDA 1OMVA 3CZ2A 1U5IB 1SPYA 2DOQA 2L51A 2JXLA 2SASA 2LMVA 3AKBA 2WCBA 5B8IB 1YUSA 2JXCA 3BYAA 1SMGA 5J3XA 1QTXA 1ZOTB 2I18A 2K2AA 3D76A 3CLNA 5CSNA 1CB1A 1FW4A 1SRAA 1LVCD 1FBVA 4ICBA 1TNPA 2F3ZA 1FI5A 2KFFA 1G4YR 1MWNA 3O6BA 4NDDA 2Y1MA 4ORCB 5F6TA 1C3YA 3SS4A 1N0YA 1KFXS 1BR4B 4YI8A 1TNXA 3O4XA 3PFVA 1OMDA 1DELA 1HT9A 4I5NB 4JPZB 5AANA 3SG2A 1F8HA 2WCJA 3JVTB 5DKNA 4FQTA 5AEQA 1TTXA 5CSFA 1S6IA 1Y1XA 1F54A 2OS8B 1OZSA 4I5JA 3R1OA 1A03A 1CMFA 1S1EA 1DJYA 1B47A 1DJHA 1KSOA 5AFPA 1XVJA 2L5YA 2NXQA 1PULA 1FF1A 2NZ0A 1JF2A 2LUCA 4YBHB 5I2LA 4YGEB 4ORBB 1PVAA 4R1EA 5TNCA 2M7NA 2F3YA 5HLVA 2L4HA 2F2OA 1B4CA 1QIWA 1QJTA 1YUUA 1TCFA 1V1FA 4AQJA 3SS5A 1H8BA 1KK7Z 1S3PA 1EG3A 2BKIB 1TUZA 1DF0B 1K96A 1WRKA 5HLOA 1TUJA 4C0KA 3BUWB 3NSIA 3SS3A 5DKQA 4NQGA 5ER5A 3GOFA 3DVJA 3BFBA 2QACA 2JT0A 3NSLA 1S36A 2KAXA 1A75A 3BUMB 3EK7A 3BJHA 1GQMA 3PM8A 2L4IA 2M1KB 3S0DA 1QWVA 1S26D 4JD9A 3CZ1A 1BOCA 1UP5A 1OMRA 2ZNDA 3I5GB 3IQOA 4HRGA 5FI6A 3VRRA 2F33A 3DF0A 2LHLA 2K60A 1QX2A 2P70A 1SW8A 3S0FA 4YGBB 1NX0A 3DVEA 2EC6C 3VROA 1M39A 3QRXA 4ORAB 2GGMA 3FE6A 2LLTA 4BY4A 3NHTA 5FI2A 2PSRA 1AUIB 1WDCB 3TS5C 4I5LB 5KSZA 1KQMB 2BBNA 2KSPA 4FQOA 1B8CA 4MEWA 1M45A 1YUTA 2JU0A 3BFAA 4WRIA 2WOSA 3L4AA 2MHHA 3NGVA 1JFJA 4MVFA 3EVRA 3O78A 1DTLA 2K2FA 1QX5B 2M0RA 2P71A 3OGNA 1IIOA 3OP0A 2M49B 3CR2A 3R1VA 2FOTA 1IWQA 1SY9A 1EG4A 2KLDA 2HF5A 5I94A 5JJGA 2HPSA 2PASA 3TDUA 2YGUA 3AAJA 1WDCC 3TS5B 5D7FA 1YR5A 1ZMZA 2WORA 1J7PA 1UWOA 2KFGA 3FWBA 5DKRA 5FI7A 3CYZA 2LMTA 1TN4A 2CXJA 3DY9A 1NIWA 2KPHA 3FE8A 1KSMA 2QEVA 2KGRA 1KQVA 2JTTA 2MRDA 5BPJA 2BAPA 1MHOA 1GGZA 1TRFA 1NX2A 1XFUO 2BKHB 4CFQA 4YGCB 2M29A 1PSRA 1MQ1A 2WC5A 1RTP1 3I5GC 3LK0A 2M7LA 1KK8B 2M97A 2AUCA 2BCXA 4MZJA 2H8VA 1SCVA 4QJ4B 1NSHA 2ISDA 2FCEA 3WNXB 1K2HA 2K8MB 1UUSA 2WCKA 3DF0B 3SG4A 3TZ1A 4PALA 3K21A 3C1VA 1G8IA 4GGNA 3SG3A 1CKKA 2JRFA 2BE4A 3LK1A 4C0JA 1LS8A 1A75B 2NCPA 1PALA 4CLNA 2K61A 3L4LA 1QVIY 1H4BA 1NCYA 2JPOA 1XFRA 2JZIA 4UPGA 4CIDA 2KI6D 1K95A 2JNFA 5K89A 4TNCA 1YVLA 1RK9A 1Y6WA 1SYMA 2K7CA 1QLSA 4DRWA 1Z4HA 5EL2A 2GV5A 4MBEA 3FS7A 1L2OC 1QX7A 1SCMC 2CCMA 1F71A 1SR6C 1JUOA 2OS8C 1CFFA 3PN7C 3TUYB 2EHBA 3I5HC 2P6BB 1AVSA 2MA2A 3E3RA 1B7TZ 1IJ5A 1DGUA 1XK4C 1C3ZA 3CR4X 3OX6A 1J7QA 1SR6B 1OE9B 3R72A 2QPTA 2E6WA 1JF0A 2K0JA 2KYFA 1DVIA 2WCMA 3IVTA 5HKZA 1PK0D 1X02A 1V1GA 1L7ZA 4GUKA 1PSBA 2LLUA 1XFWO 1MUXA 2H61C 5I8NA 1QATA 4MLWA 2ZFDA 1LXFC 1BG1A 3KPXA 1UURA 3EK4A 1RWYA 2CBLA 2BCBA 1RJVA 2PQLA 1DJGA 1YURA 2L2EA 4WQ3A 4GPLB 1DEKA 1F4OA 1Y0VH 2ERBA 3TDIA 2LAPA 3KEVA 2Y1NA 1K8UA 2AMIA 1NPQA 2KHNA 1QASA 1ODBA 4AOMA 4PE4A 1KFXL 2CNPA 4A4BA 3OB2B 4YGDB 2OTGC 1J7RA 2O5GA 3GK4X 1NYAA 3LCPC 1S5GY 1Z2CB 1RROA 2HQ8A 4GAOA 1IGVA 1GM0A 3BFHA 1U5IA 4OCIA 4HREE 1Y1AA 2M1UA 3QMEA 2BL0C 1CTRA 1JSAA 4HSZA 3KHEA 5HKWA 1F70A 1E8AA 1TCOB 1YRUB 4ZCVA 2GGZA 2COLB 1BODA 2GTEA 1IQ3A 5D69A 2FCDA 4GGFA 2M3WA 4USLA 4AQIA 2WCHA 1TIZA 1TNQA 1W7IB 4CPVA 2JQ6A 1CMGA 1CLLA 3SIAA 1FPWA 1AHRA 2AAOA 2MJWB 1N2DA 4ETOA 1QVIZ 1CDPA 1K9KA 3S0EA 1NX3A 1ZACA 2NLNA 2TN4A 2JNXA 1NP8A 2LUXA 1SSEB 4N5XA 3SJSA 1WLZA 3VRNA 5HL1A 1EXRA 2FJUB 2O60A 1B9AA 4DUQA 5I2OA 4QJ3B 1XYDA 3Q8IA 1OSAA 4KYNA 5CSJA 1C07A 2CTNA 3CS1A 1KQMC 3FE9A 3I5IB 4XJKB 3TDZA 5ER4X 4JQ0D 1J1DA 2IS9A 3CZTX 1UHNA 2KI6C 3S0BA 2KAYA 1SL9A 3S0AA 3I5IC 1CFPA 3PATA 5AXIA 1MXEA 3N7HA 4N1FA 1M31A 4PT1A 1PVBA 3CZ0A 1CFCA 1IJ6A 1WLMA 3B86A 2MBXA 1R2UA 2BBMA 4DS7A 2LMUA 5HKYA 2BE6A 1UHHA 1RFJA 1SCMB 1BMOA 4XJKA 3SG6A 1DF0A 2E30A 1TOPA 1WY9A 1CDNA 1SL7A 2L0PA 4HRHA 4YRUA 4M2OA 1J1EA 1ZFSA 3CWGA 2KBIA 4MZLA 4A4CA 2WC8A 4L9MA 1AJ5A 2JC2A 2K7OA 4NDCA 5GQQC 1BR1B 1IG5A 1RECA 1IKUA 2EGDA 2R2IA 2ZRTA 2L5XB 2MLFC 3PSRA 1K90D 2BNXA 2KNEA 3DD4A 1DC1A 1JC2A 3DXLA 2PRUA 3D78A 2OPOA 3BQ3A 2KFHA 4MZKA 4N1GA 4NDBA 3BUOB 4OZDA 5AERA 1D1OA 1HQVA 1OW4A 1XFZO 2LANA 5IBWA 4DIRA 2QEHA 1KK8C 2LNKA 1KFUS 3WXAA 5HYDA 2WCFA 4FTGA 1K9PA 4ZCUA 2H2KA 1KFUL 3EG5B 3OHMB 3RZSA 1OOHA 4E68A 3GK2A 1CDLA 1CDMA 1M46A 1SBJA 4CFRA 2NCOA 1NX1A 4PDZA 1CM1A 1PRWA 1OOGA 4P2YB 2KLEA 3D73A 1QV0A 1UHIA 4PE1A 1MR8A 3D0YB 1VRKA 2KQ6A 4MSPA 3CDNA 1FI6A 1C7WA 3HCMA 1NCXA 2PVBA 4PHKA 2QEBA 5DICA 1LA0A 4C0LA 1DJZA 1CLBA 1M63B 1F4QA 4MRXA 3SG7A 1YX8A 3B6XA 2L98A 3M0WA 5CPVA 3KF9A 3VGOA 1SK6D 1DJIA 2KOTA 1YRTB 3CR5X 2WCLA 4OVNF 1LKJA 2KYCA 3BOWB 3WHUB 3ZWHA 1GGWA 1BJFA 2QDIA 1L2OB 1NCZA 1BU3A 2LHIA 3NHIA 4GGFC 2Q91A 4WQ2A 1R6PA 4GNKB 1EJ3A 2KDHA 4YI9A 2FJYA 3O2PA 1ORGA 1S6JA 2I94A 3BUNB 1UHJA 3EKJA 3TUYC 2Y5IA 2KI4B 3EVUA 4IJ7A 4IL1A 1YTZC 4BY5A 2L2CA 3DZTA 2LM5A 3B87A 1DJXA 4PE7A 3AKAA 3VB1A 1B1GA 1DGVA 2K7DA 3F45A 2RGIA 2JWWA 1TNWA 2Q4UA 3IQQA 1W7JB 5I2QA 2KGBC 2G9BA 2LP3A 1OZOA 3L47A 1XK4A 1IRJA 3JTDB 1OOJA 1SKTA 3LLEA 2PYQA 2ZN8A 4MN0A 1W9ZA 2Y4QA 4M2QA 1YVHA 1BF5A 2JPTA 3D0YA 1Q80A 2ZN9A 2L50A 3FIAA 3JVTC 3NXAA 2WNDA 3D74A 4PHJA 2G2BA 2PMYA 1S6CA 2VRGA 2KBMA 2I7AA 1XFVO 3OX5A 4GBAA 1KWOC 4GFTA 1CLMA 5KU1A 1OOFA 3ICBA 4DCKA 1C7VA 1ALWA 1NUBA 3NSKA 2BCAA 2JT8A 2LVIA 3CABA 5FYXA 4F7FA 1B7TY 1J7OA 3AAKA 4Q04A 3S0GA 2LE9B 3DVKA 2LVJA 4JKTA 3ZNIA 5JOLA 3NSOA 3I5FC 1AP4A 1UHKA 3BUXB 3EK8A 1ZUZA 1GJYA 1DJWA 1KK7Y 3IF7A 2ZKMX 2BECA 2WC6A 4INXA 2OTGB 1G33A 1B8RA 1Y1UA 3CGAA 3DYEA 1B8LA 3GK1A 4PHMA 3UNWA 4M2PA 2V53A 2QEOA 3BXKA 4OR9B 4QJ5B 4MRYA 3DVMA 1JWDA 2F8PA 2ZNEA 2HQWA 1QXPA 2JOJA 2MAZA 1TWOA 1IH0A 1EL4A 3I5FB 2EC6B 1BLQA 3KO0A 1IQ5A 1XA5A 3I5HB 3LL8B 3PJIA 1DMOA 3O4YA 1QIVA 3PN7B 5PALA 1JFKA 4YGAA 1DQEA 5CSIA 2K7BA 2F2PA 1CM4A 1S5GZ 3B7AA 1ALVA 1KWOB 5D3OA 2WCEA 4F0ZB 1K9UA 1CFDA 1T14A 2CT9A 1EH2A 3SG5A 1DT7B 2A4JA 2LP2A 3B88A 4U8DA 3CTNA 2LCPA 2B1UA 3D77A 1LA3A 3D75A 1OOIX 2JULA 1K94A 1CNPA 2M8UA 2LLSA 2PALA 3A4UB 4XYNA 3D10A 4PHNA 3K1EA 3PLFB 1SL8A 4PE0A 1KCYA 3VRPA 1A2XA 2LC5A 3A8RA 3FWCA 1SNLA 3JTDC 3MSEB 1J55A 1MXLC
chains in the Genus database with same CATH topology
1N65A 3PALA 3WHTB 3RM1A 1XFYO 2KQYA 2ZRSA 2MLEC 2I2RE 1AK8A 1BT6A 4P5OE 1LINA 2KAVA 1A29A 2SCPA 1K93D 3H4SE 2KI4C 2LV7A 1WRLA 1OQPA 3HX4A 4D1EA 2H61A 3VRQA 5KTYA 2BL0B 1JC2A 1AJ4A 3BOWA 3OB1B 3EKHA 5G08A 2D8NA 1F55A 1XFXO 3EVVA 4OV2A 2LVKA 1XO5A 1A4PA 1MF8B 4PCWA 1WRZA 2JT3A 4JWQA 3RLZA 3SIBA 1QLKA 1QS7A 1QV1A 2LVVA 4OKHA 4I5KA 2HETA 2JTZA 2M9GA 1JBAA 1YX7A 1NWDA 1OMVA 1U5IB 1SPYA 2DOQA 2L51A 2JXLA 2SASA 2LMVA 3AKBA 2WCBA 5B8IB 1YUSA 2JXCA 3BYAA 1SMGA 5J3XA 1QTXA 1ZOTB 2I18A 2K2AA 3CLNA 5CSNA 1CB1A 1FW4A 1SRAA 1LVCD 1FBVA 4ICBA 1TNPA 2F3ZA 1FI5A 2KFFA 1G4YR 1MWNA 3O6BA 4NDDA 2Y1MA 4ORCB 5F6TA 1N0YA 1KFXS 1BR4B 4YI8A 1TNXA 3PFVA 1OMDA 1HT9A 4I5NB 4JPZB 5AANA 3SG2A 1F8HA 3JVTB 5DKNA 5AEQA 1TTXA 5CSFA 1S6IA 1Y1XA 1F54A 2OS8B 1OZSA 4I5JA 1A03A 1CMFA 1S1EA 1DJYA 1B47A 1DJHA 1KSOA 5AFPA 1XVJA 2NXQA 1FF1A 1PULA 2NZ0A 1JF2A 2LUCA 4YBHB 5I2LA 4YGEB 4ORBB 1PVAA 4R1EA 5TNCA 2M7NA 2F3YA 5HLVA 2L4HA 2F2OA 1B4CA 1QIWA 1QJTA 1YUUA 1TCFA 1V1FA 4AQJA 1H8BA 1KK7Z 1S3PA 1EG3A 2BKIB 1DF0B 1K96A 1WRKA 5HLOA 4C0KA 3BUWB 3NSIA 5DKQA 4NQGA 5ER5A 3GOFA 3DVJA 2QACA 2JT0A 3NSLA 1S36A 2KAXA 1A75A 3BUMB 3EK7A 1GQMA 3PM8A 2L4IA 2M1KB 1S26D 1BOCA 1UP5A 1OMRA 2ZNDA 3I5GB 3IQOA 4HRGA 3VRRA 2F33A 3DF0A 2LHLA 1QX2A 1SW8A 4YGBB 1NX0A 3DVEA 2EC6C 3VROA 1M39A 3QRXA 4ORAB 2GGMA 2LLTA 4BY4A 2PSRA 1AUIB 1WDCB 3TS5C 4I5LB 5KSZA 1KQMB 2BBNA 2KSPA 4FQOA 1B8CA 4MEWA 1M45A 1YUTA 2JU0A 4WRIA 2WOSA 2MHHA 1JFJA 4MVFA 3EVRA 3O78A 1DTLA 2K2FA 1QX5B 2M0RA 3OP0A 2M49B 3CR2A 2FOTA 1IWQA 1SY9A 1EG4A 2HF5A 5JJGA 2HPSA 2PASA 3TDUA 3AAJA 1WDCC 3TS5B 5D7FA 1YR5A 1ZMZA 2WORA 1J7PA 1UWOA 2KFGA 3FWBA 5DKRA 2LMTA 1TN4A 2CXJA 1NIWA 1KQVA 1KSMA 2KGRA 2JTTA 2MRDA 5BPJA 1MHOA 1GGZA 1TRFA 1NX2A 1XFUO 2BKHB 4CFQA 4YGCB 2M29A 1PSRA 1MQ1A 3I5GC 1RTP1 3LK0A 2M7LA 1KK8B 2M97A 2AUCA 2BCXA 4MZJA 1SCVA 4QJ4B 1NSHA 2ISDA 2FCEA 3WNXB 1K2HA 2K8MB 1UUSA 3DF0B 3SG4A 3TZ1A 4PALA 3K21A 3C1VA 1G8IA 4GGNA 3SG3A 1CKKA 2JRFA 2BE4A 3LK1A 1A75B 2NCPA 1PALA 4CLNA 2K61A 1QVIY 1H4BA 1NCYA 2JZIA 4UPGA 4CIDA 2KI6D 1K95A 2JNFA 5K89A 4TNCA 1YVLA 1RK9A 1Y6WA 1SYMA 2K7CA 1QLSA 4DRWA 2GV5A 4MBEA 3FS7A 1L2OC 1QX7A 1SCMC 2CCMA 1F71A 1SR6C 1JUOA 2OS8C 1CFFA 3PN7C 3TUYB 2EHBA 3I5HC 2P6BB 1AVSA 2MA2A 3E3RA 1B7TZ 1IJ5A 1DGUA 1XK4C 3CR4X 3OX6A 1J7QA 1SR6B 1OE9B 2QPTA 2E6WA 1JF0A 2K0JA 2KYFA 1DVIA 5HKZA 1PK0D 1X02A 1V1GA 1L7ZA 4GUKA 1PSBA 2LLUA 1XFWO 1MUXA 2H61C 5I8NA 1QATA 4MLWA 2ZFDA 1LXFC 1BG1A 3KPXA 1UURA 3EK4A 1RWYA 2CBLA 2BCBA 1RJVA 1DJGA 1YURA 2L2EA 4WQ3A 4GPLB 1F4OA 1Y0VH 3TDIA 2LAPA 3KEVA 2Y1NA 1K8UA 2AMIA 1NPQA 2KHNA 1QASA 1ODBA 4AOMA 4PE4A 1KFXL 2CNPA 4A4BA 3OB2B 4YGDB 2OTGC 1J7RA 2O5GA 3GK4X 1NYAA 3LCPC 1S5GY 1RROA 2HQ8A 4GAOA 1IGVA 1U5IA 4OCIA 4HREE 1Y1AA 2M1UA 2BL0C 1CTRA 1JSAA 4HSZA 3KHEA 5HKWA 1F70A 1E8AA 1TCOB 1YRUB 4ZCVA 2GGZA 2COLB 1BODA 1IQ3A 5D69A 2FCDA 4GGFA 2M3WA 4USLA 4AQIA 1TIZA 1TNQA 1W7IB 4CPVA 2JQ6A 1CMGA 1CLLA 3SIAA 1FPWA 1AHRA 2AAOA 2MJWB 1N2DA 4ETOA 1QVIZ 1CDPA 1K9KA 1NX3A 1ZACA 2NLNA 2TN4A 2JNXA 1NP8A 2LUXA 4N5XA 3SJSA 3VRNA 1WLZA 1EXRA 2FJUB 2O60A 1B9AA 4DUQA 5I2OA 4QJ3B 1XYDA 5CSJA 1OSAA 1C07A 2CTNA 3CS1A 1KQMC 3I5IB 4XJKB 3TDZA 5ER4X 4JQ0D 1J1DA 2IS9A 3CZTX 1UHNA 2KI6C 2KAYA 1SL9A 3I5IC 1CFPA 3PATA 5AXIA 1MXEA 1CFCA 4N1FA 1M31A 1PVBA 1IJ6A 1WLMA 2MBXA 1R2UA 2BBMA 4DS7A 2LMUA 5HKYA 2BE6A 1UHHA 1RFJA 1SCMB 1BMOA 4XJKA 3SG6A 1DF0A 2E30A 1TOPA 1WY9A 1CDNA 1SL7A 2L0PA 4HRHA 4YRUA 4M2OA 1J1EA 1ZFSA 3CWGA 2KBIA 4MZLA 4A4CA 2WC8A 4L9MA 1AJ5A 2JC2A 2K7OA 4NDCA 5GQQC 1BR1B 1IG5A 1RECA 1IKUA 2EGDA 2R2IA 2ZRTA 2L5XB 2MLFC 3PSRA 1K90D 2KNEA 3DD4A 2PRUA 4MZKA 2OPOA 3BQ3A 2KFHA 4N1GA 4NDBA 4C0JA 3BUOB 5AERA 1D1OA 1HQVA 5IBWA 1XFZO 2LANA 4DIRA 1KK8C 2LNKA 1KFUS 3WXAA 5HYDA 2WCFA 4FTGA 1K9PA 4ZCUA 2H2KA 1KFUL 3OHMB 4E68A 3GK2A 1CDLA 1CDMA 1M46A 1SBJA 4CFRA 2NCOA 1NX1A 4PDZA 1CM1A 1PRWA 4P2YB 1QV0A 1UHIA 4PE1A 1MR8A 3D0YB 1VRKA 2KQ6A 4MSPA 1FI6A 1C7WA 3HCMA 1NCXA 2PVBA 4PHKA 1LA0A 4C0LA 1DJZA 1CLBA 1M63B 1F4QA 4MRXA 3SG7A 1YX8A 2L98A 3M0WA 5CPVA 3KF9A 3VGOA 1SK6D 1DJIA 2KOTA 1YRTB 3CR5X 4OVNF 3WHUB 1LKJA 2KYCA 3BOWB 3ZWHA 1GGWA 1BJFA 1L2OB 1NCZA 1BU3A 2LHIA 4GGFC 2Q91A 4WQ2A 1R6PA 4GNKB 1EJ3A 2KDHA 4YI9A 3O2PA 1S6JA 2I94A 3BUNB 1UHJA 3EKJA 3TUYC 2Y5IA 2KI4B 3EVUA 4IL1A 4BY5A 1YTZC 2LM5A 1DJXA 4PE7A 3AKAA 1B1GA 1DGVA 2K7DA 3F45A 2RGIA 2JWWA 1TNWA 2Q4UA 3IQQA 1W7JB 5I2QA 2KGBC 2G9BA 2LP3A 1OZOA 1XK4A 1IRJA 3JTDB 1OOJA 1SKTA 3LLEA 2ZN8A 4MN0A 2Y4QA 4M2QA 1YVHA 1BF5A 2JPTA 3D0YA 1Q80A 2ZN9A 2L50A 3FIAA 3JVTC 3NXAA 2WNDA 4PHJA 2G2BA 2PMYA 1S6CA 2VRGA 2KBMA 2I7AA 1XFVO 3OX5A 4GBAA 1KWOC 4GFTA 1CLMA 5KU1A 3ICBA 4DCKA 1C7VA 1ALWA 1NUBA 3NSKA 2BCAA 2JT8A 2LVIA 5FYXA 1B7TY 1J7OA 3AAKA 4Q04A 2LE9B 3DVKA 2LVJA 3ZNIA 5JOLA 3NSOA 3I5FC 1AP4A 1UHKA 3BUXB 3EK8A 1ZUZA 1GJYA 1DJWA 1KK7Y 3IF7A 2ZKMX 2BECA 2OTGB 1G33A 1B8RA 1Y1UA 3CGAA 3GK1A 1B8LA 4PHMA 4M2PA 2V53A 3BXKA 4OR9B 4QJ5B 4MRYA 3DVMA 1JWDA 2F8PA 2ZNEA 2HQWA 1QXPA 2JOJA 2MAZA 1IH0A 1EL4A 3I5FB 2EC6B 1BLQA 3KO0A 1IQ5A 1XA5A 3I5HB 3LL8B 1DMOA 3O4YA 1QIVA 3PN7B 5PALA 1JFKA 4YGAA 5CSIA 2K7BA 2F2PA 1CM4A 1S5GZ 1ALVA 1KWOB 2WCEA 4F0ZB 1K9UA 1CFDA 2CT9A 1EH2A 3SG5A 1DT7B 2A4JA 2LP2A 4U8DA 3CTNA 2LCPA 2B1UA 1LA3A 2JULA 1K94A 1CNPA 2M8UA 2LLSA 2PALA 3A4UB 4XYNA 3D10A 4PHNA 3PLFB 1SL8A 4PE0A 1KCYA 3VRPA 1A2XA 2LC5A 3A8RA 3FWCA 1SNLA 3JTDC 3MSEB 1J55A 1MXLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N65 A;  3PAL A;  3WHT B;  3RM1 A;  1XFY O;  2KQY A;  2ZRS A;  2MLE C;  2I2R E;  1AK8 A;  1BT6 A;  4P5O E;  1LIN A;  2KAV A;  1A29 A;  2SCP A;  1K93 D;  3H4S E;  2KI4 C;  2LV7 A;  1WRL A;  1OQP A;  3HX4 A;  4D1E A;  2H61 A;  3VRQ A;  5KTY A;  2BL0 B;  1JC2 A;  1AJ4 A;  3BOW A;  3OB1 B;  3EKH A;  5G08 A;  2D8N A;  1F55 A;  1XFX O;  3EVV A;  4OV2 A;  2LVK A;  1XO5 A;  1A4P A;  1MF8 B;  4PCW A;  1WRZ A;  2JT3 A;  4JWQ A;  3RLZ A;  3SIB A;  1QLK A;  1QS7 A;  1QV1 A;  2LVV A;  4OKH A;  4I5K A;  2HET A;  2JTZ A;  2M9G A;  1JBA A;  1YX7 A;  1NWD A;  1OMV A;  1U5I B;  1SPY A;  2DOQ A;  2L51 A;  2JXL A;  2SAS A;  2LMV A;  3AKB A;  2WCB A;  5B8I B;  1YUS A;  2JXC A;  3BYA A;  1SMG A;  5J3X A;  1QTX A;  1ZOT B;  2I18 A;  2K2A A;  3CLN A;  5CSN A;  1CB1 A;  1FW4 A;  1SRA A;  1LVC D;  1FBV A;  4ICB A;  1TNP A;  2F3Z A;  1FI5 A;  2KFF A;  1G4Y R;  1MWN A;  3O6B A;  4NDD A;  2Y1M A;  4ORC B;  5F6T A;  1N0Y A;  1KFX S;  1BR4 B;  4YI8 A;  1TNX A;  3PFV A;  1OMD A;  1HT9 A;  4I5N B;  4JPZ B;  5AAN A;  3SG2 A;  1F8H A;  3JVT B;  5DKN A;  5AEQ A;  1TTX A;  5CSF A;  1S6I A;  1Y1X A;  1F54 A;  2OS8 B;  1OZS A;  4I5J A;  1A03 A;  1CMF A;  1S1E A;  1DJY A;  1B47 A;  1DJH A;  1KSO A;  5AFP A;  1XVJ A;  2NXQ A;  1FF1 A;  1PUL A;  2NZ0 A;  1JF2 A;  2LUC A;  4YBH B;  5I2L A;  4YGE B;  4ORB B;  1PVA A;  4R1E A;  5TNC A;  2M7N A;  2F3Y A;  5HLV A;  2L4H A;  2F2O A;  1B4C A;  1QIW A;  1QJT A;  1YUU A;  1TCF A;  1V1F A;  4AQJ A;  1H8B A;  1KK7 Z;  1S3P A;  1EG3 A;  2BKI B;  1DF0 B;  1K96 A;  1WRK A;  5HLO A;  4C0K A;  3BUW B;  3NSI A;  5DKQ A;  4NQG A;  5ER5 A;  3GOF A;  3DVJ A;  2QAC A;  2JT0 A;  3NSL A;  1S36 A;  2KAX A;  1A75 A;  3BUM B;  3EK7 A;  1GQM A;  3PM8 A;  2L4I A;  2M1K B;  1S26 D;  1BOC A;  1UP5 A;  1OMR A;  2ZND A;  3I5G B;  3IQO A;  4HRG A;  3VRR A;  2F33 A;  3DF0 A;  2LHL A;  1QX2 A;  1SW8 A;  4YGB B;  1NX0 A;  3DVE A;  2EC6 C;  3VRO A;  1M39 A;  3QRX A;  4ORA B;  2GGM A;  2LLT A;  4BY4 A;  2PSR A;  1AUI B;  1WDC B;  3TS5 C;  4I5L B;  5KSZ A;  1KQM B;  2BBN A;  2KSP A;  4FQO A;  1B8C A;  4MEW A;  1M45 A;  1YUT A;  2JU0 A;  4WRI A;  2WOS A;  2MHH A;  1JFJ A;  4MVF A;  3EVR A;  3O78 A;  1DTL A;  2K2F A;  1QX5 B;  2M0R A;  3OP0 A;  2M49 B;  3CR2 A;  2FOT A;  1IWQ A;  1SY9 A;  1EG4 A;  2HF5 A;  5JJG A;  2HPS A;  2PAS A;  3TDU A;  3AAJ A;  1WDC C;  3TS5 B;  5D7F A;  1YR5 A;  1ZMZ A;  2WOR A;  1J7P A;  1UWO A;  2KFG A;  3FWB A;  5DKR A;  2LMT A;  1TN4 A;  2CXJ A;  1NIW A;  1KQV A;  1KSM A;  2KGR A;  2JTT A;  2MRD A;  5BPJ A;  1MHO A;  1GGZ A;  1TRF A;  1NX2 A;  1XFU O;  2BKH B;  4CFQ A;  4YGC B;  2M29 A;  1PSR A;  1MQ1 A;  3I5G C;  1RTP 1;  3LK0 A;  2M7L A;  1KK8 B;  2M97 A;  2AUC A;  2BCX A;  4MZJ A;  1SCV A;  4QJ4 B;  1NSH A;  2ISD A;  2FCE A;  3WNX B;  1K2H A;  2K8M B;  1UUS A;  3DF0 B;  3SG4 A;  3TZ1 A;  4PAL A;  3K21 A;  3C1V A;  1G8I A;  4GGN A;  3SG3 A;  1CKK A;  2JRF A;  2BE4 A;  3LK1 A;  1A75 B;  2NCP A;  1PAL A;  4CLN A;  2K61 A;  1QVI Y;  1H4B A;  1NCY A;  2JZI A;  4UPG A;  4CID A;  2KI6 D;  1K95 A;  2JNF A;  5K89 A;  4TNC A;  1YVL A;  1RK9 A;  1Y6W A;  1SYM A;  2K7C A;  1QLS A;  4DRW A;  2GV5 A;  4MBE A;  3FS7 A;  1L2O C;  1QX7 A;  1SCM C;  2CCM A;  1F71 A;  1SR6 C;  1JUO A;  2OS8 C;  1CFF A;  3PN7 C;  3TUY B;  2EHB A;  3I5H C;  2P6B B;  1AVS A;  2MA2 A;  3E3R A;  1B7T Z;  1IJ5 A;  1DGU A;  1XK4 C;  3CR4 X;  3OX6 A;  1J7Q A;  1SR6 B;  1OE9 B;  2QPT A;  2E6W A;  1JF0 A;  2K0J A;  2KYF A;  1DVI A;  5HKZ A;  1PK0 D;  1X02 A;  1V1G A;  1L7Z A;  4GUK A;  1PSB A;  2LLU A;  1XFW O;  1MUX A;  2H61 C;  5I8N A;  1QAT A;  4MLW A;  2ZFD A;  1LXF C;  1BG1 A;  3KPX A;  1UUR A;  3EK4 A;  1RWY A;  2CBL A;  2BCB A;  1RJV A;  1DJG A;  1YUR A;  2L2E A;  4WQ3 A;  4GPL B;  1F4O A;  1Y0V H;  3TDI A;  2LAP A;  3KEV A;  2Y1N A;  1K8U A;  2AMI A;  1NPQ A;  2KHN A;  1QAS A;  1ODB A;  4AOM A;  4PE4 A;  1KFX L;  2CNP A;  4A4B A;  3OB2 B;  4YGD B;  2OTG C;  1J7R A;  2O5G A;  3GK4 X;  1NYA A;  3LCP C;  1S5G Y;  1RRO A;  2HQ8 A;  4GAO A;  1IGV A;  1U5I A;  4OCI A;  4HRE E;  1Y1A A;  2M1U A;  2BL0 C;  1CTR A;  1JSA A;  4HSZ A;  3KHE A;  5HKW A;  1F70 A;  1E8A A;  1TCO B;  1YRU B;  4ZCV A;  2GGZ A;  2COL B;  1BOD A;  1IQ3 A;  5D69 A;  2FCD A;  4GGF A;  2M3W A;  4USL A;  4AQI A;  1TIZ A;  1TNQ A;  1W7I B;  4CPV A;  2JQ6 A;  1CMG A;  1CLL A;  3SIA A;  1FPW A;  1AHR A;  2AAO A;  2MJW B;  1N2D A;  4ETO A;  1QVI Z;  1CDP A;  1K9K A;  1NX3 A;  1ZAC A;  2NLN A;  2TN4 A;  2JNX A;  1NP8 A;  2LUX A;  4N5X A;  3SJS A;  3VRN A;  1WLZ A;  1EXR A;  2FJU B;  2O60 A;  1B9A A;  4DUQ A;  5I2O A;  4QJ3 B;  1XYD A;  5CSJ A;  1OSA A;  1C07 A;  2CTN A;  3CS1 A;  1KQM C;  3I5I B;  4XJK B;  3TDZ A;  5ER4 X;  4JQ0 D;  1J1D A;  2IS9 A;  3CZT X;  1UHN A;  2KI6 C;  2KAY A;  1SL9 A;  3I5I C;  1CFP A;  3PAT A;  5AXI A;  1MXE A;  1CFC A;  4N1F A;  1M31 A;  1PVB A;  1IJ6 A;  1WLM A;  2MBX A;  1R2U A;  2BBM A;  4DS7 A;  2LMU A;  5HKY A;  2BE6 A;  1UHH A;  1RFJ A;  1SCM B;  1BMO A;  4XJK A;  3SG6 A;  1DF0 A;  2E30 A;  1TOP A;  1WY9 A;  1CDN A;  1SL7 A;  2L0P A;  4HRH A;  4YRU A;  4M2O A;  1J1E A;  1ZFS A;  3CWG A;  2KBI A;  4MZL A;  4A4C A;  2WC8 A;  4L9M A;  1AJ5 A;  2JC2 A;  2K7O A;  4NDC A;  5GQQ C;  1BR1 B;  1IG5 A;  1REC A;  1IKU A;  2EGD A;  2R2I A;  2ZRT A;  2L5X B;  2MLF C;  3PSR A;  1K90 D;  2KNE A;  3DD4 A;  2PRU A;  4MZK A;  2OPO A;  3BQ3 A;  2KFH A;  4N1G A;  4NDB A;  4C0J A;  3BUO B;  5AER A;  1D1O A;  1HQV A;  5IBW A;  1XFZ O;  2LAN A;  4DIR A;  1KK8 C;  2LNK A;  1KFU S;  3WXA A;  5HYD A;  2WCF A;  4FTG A;  1K9P A;  4ZCU A;  2H2K A;  1KFU L;  3OHM B;  4E68 A;  3GK2 A;  1CDL A;  1CDM A;  1M46 A;  1SBJ A;  4CFR A;  2NCO A;  1NX1 A;  4PDZ A;  1CM1 A;  1PRW A;  4P2Y B;  1QV0 A;  1UHI A;  4PE1 A;  1MR8 A;  3D0Y B;  1VRK A;  2KQ6 A;  4MSP A;  1FI6 A;  1C7W A;  3HCM A;  1NCX A;  2PVB A;  4PHK A;  1LA0 A;  4C0L A;  1DJZ A;  1CLB A;  1M63 B;  1F4Q A;  4MRX A;  3SG7 A;  1YX8 A;  2L98 A;  3M0W A;  5CPV A;  3KF9 A;  3VGO A;  1SK6 D;  1DJI A;  2KOT A;  1YRT B;  3CR5 X;  4OVN F;  3WHU B;  1LKJ A;  2KYC A;  3BOW B;  3ZWH A;  1GGW A;  1BJF A;  1L2O B;  1NCZ A;  1BU3 A;  2LHI A;  4GGF C;  2Q91 A;  4WQ2 A;  1R6P A;  4GNK B;  1EJ3 A;  2KDH A;  4YI9 A;  3O2P A;  1S6J A;  2I94 A;  3BUN B;  1UHJ A;  3EKJ A;  3TUY C;  2Y5I A;  2KI4 B;  3EVU A;  4IL1 A;  4BY5 A;  1YTZ C;  2LM5 A;  1DJX A;  4PE7 A;  3AKA A;  1B1G A;  1DGV A;  2K7D A;  3F45 A;  2RGI A;  2JWW A;  1TNW A;  2Q4U A;  3IQQ A;  1W7J B;  5I2Q A;  2KGB C;  2G9B A;  2LP3 A;  1OZO A;  1XK4 A;  1IRJ A;  3JTD B;  1OOJ A;  1SKT A;  3LLE A;  2ZN8 A;  4MN0 A;  2Y4Q A;  4M2Q A;  1YVH A;  1BF5 A;  2JPT A;  3D0Y A;  1Q80 A;  2ZN9 A;  2L50 A;  3FIA A;  3JVT C;  3NXA A;  2WND A;  4PHJ A;  2G2B A;  2PMY A;  1S6C A;  2VRG A;  2KBM A;  2I7A A;  1XFV O;  3OX5 A;  4GBA A;  1KWO C;  4GFT A;  1CLM A;  5KU1 A;  3ICB A;  4DCK A;  1C7V A;  1ALW A;  1NUB A;  3NSK A;  2BCA A;  2JT8 A;  2LVI A;  5FYX A;  1B7T Y;  1J7O A;  3AAK A;  4Q04 A;  2LE9 B;  3DVK A;  2LVJ A;  3ZNI A;  5JOL A;  3NSO A;  3I5F C;  1AP4 A;  1UHK A;  3BUX B;  3EK8 A;  1ZUZ A;  1GJY A;  1DJW A;  1KK7 Y;  3IF7 A;  2ZKM X;  2BEC A;  2OTG B;  1G33 A;  1B8R A;  1Y1U A;  3CGA A;  3GK1 A;  1B8L A;  4PHM A;  4M2P A;  2V53 A;  3BXK A;  4OR9 B;  4QJ5 B;  4MRY A;  3DVM A;  1JWD A;  2F8P A;  2ZNE A;  2HQW A;  1QXP A;  2JOJ A;  2MAZ A;  1IH0 A;  1EL4 A;  3I5F B;  2EC6 B;  1BLQ A;  3KO0 A;  1IQ5 A;  1XA5 A;  3I5H B;  3LL8 B;  1DMO A;  3O4Y A;  1QIV A;  3PN7 B;  5PAL A;  1JFK A;  4YGA A;  5CSI A;  2K7B A;  2F2P A;  1CM4 A;  1S5G Z;  1ALV A;  1KWO B;  2WCE A;  4F0Z B;  1K9U A;  1CFD A;  2CT9 A;  1EH2 A;  3SG5 A;  1DT7 B;  2A4J A;  2LP2 A;  4U8D A;  3CTN A;  2LCP A;  2B1U A;  1LA3 A;  2JUL A;  1K94 A;  1CNP A;  2M8U A;  2LLS A;  2PAL A;  3A4U B;  4XYN A;  3D10 A;  4PHN A;  3PLF B;  1SL8 A;  4PE0 A;  1KCY A;  3VRP A;  1A2X A;  2LC5 A;  3A8R A;  3FWC A;  1SNL A;  3JTD C;  3MSE B;  1J55 A;  1MXL C; 
#chains in the Genus database with same CATH topology
 1N65 A;  3PAL A;  3WHT B;  3RM1 A;  1XFY O;  2KQY A;  2ZRS A;  2MLE C;  3V2L A;  1P28 A;  2I2R E;  1AK8 A;  1BT6 A;  3OBV A;  4P5O E;  3UO9 A;  1LIN A;  2KAV A;  1A29 A;  2SCP A;  1K93 D;  3H4S E;  2KI4 C;  2LV7 A;  1WRL A;  1OQP A;  3HX4 A;  4D1E A;  2H61 A;  3R1P A;  4INW A;  2BL0 B;  3VRQ A;  5KTY A;  1AJ4 A;  3BOW A;  3OB1 B;  3EKH A;  5G08 A;  2D8N A;  1F55 A;  1XFX O;  3EVV A;  4OV2 A;  2LVK A;  1XO5 A;  1A4P A;  1MF8 B;  4PCW A;  1WRZ A;  2JT3 A;  4JWQ A;  3RLZ A;  3SIB A;  1QLK A;  1QS7 A;  1QV1 A;  2LVV A;  4OKH A;  4I5K A;  2HET A;  2JTZ A;  2M9G A;  1JBA A;  3PM2 A;  1YX7 A;  1NWD A;  1OMV A;  3CZ2 A;  1U5I B;  1SPY A;  2DOQ A;  2L51 A;  2JXL A;  2SAS A;  2LMV A;  3AKB A;  2WCB A;  5B8I B;  1YUS A;  2JXC A;  3BYA A;  1SMG A;  5J3X A;  1QTX A;  1ZOT B;  2I18 A;  2K2A A;  3D76 A;  3CLN A;  5CSN A;  1CB1 A;  1FW4 A;  1SRA A;  1LVC D;  1FBV A;  4ICB A;  1TNP A;  2F3Z A;  1FI5 A;  2KFF A;  1G4Y R;  1MWN A;  3O6B A;  4NDD A;  2Y1M A;  4ORC B;  5F6T A;  1C3Y A;  3SS4 A;  1N0Y A;  1KFX S;  1BR4 B;  4YI8 A;  1TNX A;  3O4X A;  3PFV A;  1OMD A;  1DEL A;  1HT9 A;  4I5N B;  4JPZ B;  5AAN A;  3SG2 A;  1F8H A;  2WCJ A;  3JVT B;  5DKN A;  4FQT A;  5AEQ A;  1TTX A;  5CSF A;  1S6I A;  1Y1X A;  1F54 A;  2OS8 B;  1OZS A;  4I5J A;  3R1O A;  1A03 A;  1CMF A;  1S1E A;  1DJY A;  1B47 A;  1DJH A;  1KSO A;  5AFP A;  1XVJ A;  2L5Y A;  2NXQ A;  1PUL A;  1FF1 A;  2NZ0 A;  1JF2 A;  2LUC A;  4YBH B;  5I2L A;  4YGE B;  4ORB B;  1PVA A;  4R1E A;  5TNC A;  2M7N A;  2F3Y A;  5HLV A;  2L4H A;  2F2O A;  1B4C A;  1QIW A;  1QJT A;  1YUU A;  1TCF A;  1V1F A;  4AQJ A;  3SS5 A;  1H8B A;  1KK7 Z;  1S3P A;  1EG3 A;  2BKI B;  1TUZ A;  1DF0 B;  1K96 A;  1WRK A;  5HLO A;  1TUJ A;  4C0K A;  3BUW B;  3NSI A;  3SS3 A;  5DKQ A;  4NQG A;  5ER5 A;  3GOF A;  3DVJ A;  3BFB A;  2QAC A;  2JT0 A;  3NSL A;  1S36 A;  2KAX A;  1A75 A;  3BUM B;  3EK7 A;  3BJH A;  1GQM A;  3PM8 A;  2L4I A;  2M1K B;  3S0D A;  1QWV A;  1S26 D;  4JD9 A;  3CZ1 A;  1BOC A;  1UP5 A;  1OMR A;  2ZND A;  3I5G B;  3IQO A;  4HRG A;  5FI6 A;  3VRR A;  2F33 A;  3DF0 A;  2LHL A;  2K60 A;  1QX2 A;  2P70 A;  1SW8 A;  3S0F A;  4YGB B;  1NX0 A;  3DVE A;  2EC6 C;  3VRO A;  1M39 A;  3QRX A;  4ORA B;  2GGM A;  3FE6 A;  2LLT A;  4BY4 A;  3NHT A;  5FI2 A;  2PSR A;  1AUI B;  1WDC B;  3TS5 C;  4I5L B;  5KSZ A;  1KQM B;  2BBN A;  2KSP A;  4FQO A;  1B8C A;  4MEW A;  1M45 A;  1YUT A;  2JU0 A;  3BFA A;  4WRI A;  2WOS A;  3L4A A;  2MHH A;  3NGV A;  1JFJ A;  4MVF A;  3EVR A;  3O78 A;  1DTL A;  2K2F A;  1QX5 B;  2M0R A;  2P71 A;  3OGN A;  1IIO A;  3OP0 A;  2M49 B;  3CR2 A;  3R1V A;  2FOT A;  1IWQ A;  1SY9 A;  1EG4 A;  2KLD A;  2HF5 A;  5I94 A;  5JJG A;  2HPS A;  2PAS A;  3TDU A;  2YGU A;  3AAJ A;  1WDC C;  3TS5 B;  5D7F A;  1YR5 A;  1ZMZ A;  2WOR A;  1J7P A;  1UWO A;  2KFG A;  3FWB A;  5DKR A;  5FI7 A;  3CYZ A;  2LMT A;  1TN4 A;  2CXJ A;  3DY9 A;  1NIW A;  2KPH A;  3FE8 A;  1KSM A;  2QEV A;  2KGR A;  1KQV A;  2JTT A;  2MRD A;  5BPJ A;  2BAP A;  1MHO A;  1GGZ A;  1TRF A;  1NX2 A;  1XFU O;  2BKH B;  4CFQ A;  4YGC B;  2M29 A;  1PSR A;  1MQ1 A;  2WC5 A;  1RTP 1;  3I5G C;  3LK0 A;  2M7L A;  1KK8 B;  2M97 A;  2AUC A;  2BCX A;  4MZJ A;  2H8V A;  1SCV A;  4QJ4 B;  1NSH A;  2ISD A;  2FCE A;  3WNX B;  1K2H A;  2K8M B;  1UUS A;  2WCK A;  3DF0 B;  3SG4 A;  3TZ1 A;  4PAL A;  3K21 A;  3C1V A;  1G8I A;  4GGN A;  3SG3 A;  1CKK A;  2JRF A;  2BE4 A;  3LK1 A;  4C0J A;  1LS8 A;  1A75 B;  2NCP A;  1PAL A;  4CLN A;  2K61 A;  3L4L A;  1QVI Y;  1H4B A;  1NCY A;  2JPO A;  1XFR A;  2JZI A;  4UPG A;  4CID A;  2KI6 D;  1K95 A;  2JNF A;  5K89 A;  4TNC A;  1YVL A;  1RK9 A;  1Y6W A;  1SYM A;  2K7C A;  1QLS A;  4DRW A;  1Z4H A;  5EL2 A;  2GV5 A;  4MBE A;  3FS7 A;  1L2O C;  1QX7 A;  1SCM C;  2CCM A;  1F71 A;  1SR6 C;  1JUO A;  2OS8 C;  1CFF A;  3PN7 C;  3TUY B;  2EHB A;  3I5H C;  2P6B B;  1AVS A;  2MA2 A;  3E3R A;  1B7T Z;  1IJ5 A;  1DGU A;  1XK4 C;  1C3Z A;  3CR4 X;  3OX6 A;  1J7Q A;  1SR6 B;  1OE9 B;  3R72 A;  2QPT A;  2E6W A;  1JF0 A;  2K0J A;  2KYF A;  1DVI A;  2WCM A;  3IVT A;  5HKZ A;  1PK0 D;  1X02 A;  1V1G A;  1L7Z A;  4GUK A;  1PSB A;  2LLU A;  1XFW O;  1MUX A;  2H61 C;  5I8N A;  1QAT A;  4MLW A;  2ZFD A;  1LXF C;  1BG1 A;  3KPX A;  1UUR A;  3EK4 A;  1RWY A;  2CBL A;  2BCB A;  1RJV A;  2PQL A;  1DJG A;  1YUR A;  2L2E A;  4WQ3 A;  4GPL B;  1DEK A;  1F4O A;  1Y0V H;  2ERB A;  3TDI A;  2LAP A;  3KEV A;  2Y1N A;  1K8U A;  2AMI A;  1NPQ A;  2KHN A;  1QAS A;  1ODB A;  4AOM A;  4PE4 A;  1KFX L;  2CNP A;  4A4B A;  3OB2 B;  4YGD B;  2OTG C;  1J7R A;  2O5G A;  3GK4 X;  1NYA A;  3LCP C;  1S5G Y;  1Z2C B;  1RRO A;  2HQ8 A;  4GAO A;  1IGV A;  1GM0 A;  3BFH A;  1U5I A;  4OCI A;  4HRE E;  1Y1A A;  2M1U A;  3QME A;  2BL0 C;  1CTR A;  1JSA A;  4HSZ A;  3KHE A;  5HKW A;  1F70 A;  1E8A A;  1TCO B;  1YRU B;  4ZCV A;  2GGZ A;  2COL B;  1BOD A;  2GTE A;  1IQ3 A;  5D69 A;  2FCD A;  4GGF A;  2M3W A;  4USL A;  4AQI A;  2WCH A;  1TIZ A;  1TNQ A;  1W7I B;  4CPV A;  2JQ6 A;  1CMG A;  1CLL A;  3SIA A;  1FPW A;  1AHR A;  2AAO A;  2MJW B;  1N2D A;  4ETO A;  1QVI Z;  1CDP A;  1K9K A;  3S0E A;  1NX3 A;  1ZAC A;  2NLN A;  2TN4 A;  2JNX A;  1NP8 A;  2LUX A;  1SSE B;  4N5X A;  3SJS A;  1WLZ A;  3VRN A;  5HL1 A;  1EXR A;  2FJU B;  2O60 A;  1B9A A;  4DUQ A;  5I2O A;  4QJ3 B;  1XYD A;  3Q8I A;  1OSA A;  4KYN A;  5CSJ A;  1C07 A;  2CTN A;  3CS1 A;  1KQM C;  3FE9 A;  3I5I B;  4XJK B;  3TDZ A;  5ER4 X;  4JQ0 D;  1J1D A;  2IS9 A;  3CZT X;  1UHN A;  2KI6 C;  3S0B A;  2KAY A;  1SL9 A;  3S0A A;  3I5I C;  1CFP A;  3PAT A;  5AXI A;  1MXE A;  3N7H A;  4N1F A;  1M31 A;  4PT1 A;  1PVB A;  3CZ0 A;  1CFC A;  1IJ6 A;  1WLM A;  3B86 A;  2MBX A;  1R2U A;  2BBM A;  4DS7 A;  2LMU A;  5HKY A;  2BE6 A;  1UHH A;  1RFJ A;  1SCM B;  1BMO A;  4XJK A;  3SG6 A;  1DF0 A;  2E30 A;  1TOP A;  1WY9 A;  1CDN A;  1SL7 A;  2L0P A;  4HRH A;  4YRU A;  4M2O A;  1J1E A;  1ZFS A;  3CWG A;  2KBI A;  4MZL A;  4A4C A;  2WC8 A;  4L9M A;  1AJ5 A;  2JC2 A;  2K7O A;  4NDC A;  5GQQ C;  1BR1 B;  1IG5 A;  1REC A;  1IKU A;  2EGD A;  2R2I A;  2ZRT A;  2L5X B;  2MLF C;  3PSR A;  1K90 D;  2BNX A;  2KNE A;  3DD4 A;  1DC1 A;  1JC2 A;  3DXL A;  2PRU A;  3D78 A;  2OPO A;  3BQ3 A;  2KFH A;  4MZK A;  4N1G A;  4NDB A;  3BUO B;  4OZD A;  5AER A;  1D1O A;  1HQV A;  1OW4 A;  1XFZ O;  2LAN A;  5IBW A;  4DIR A;  2QEH A;  1KK8 C;  2LNK A;  1KFU S;  3WXA A;  5HYD A;  2WCF A;  4FTG A;  1K9P A;  4ZCU A;  2H2K A;  1KFU L;  3EG5 B;  3OHM B;  3RZS A;  1OOH A;  4E68 A;  3GK2 A;  1CDL A;  1CDM A;  1M46 A;  1SBJ A;  4CFR A;  2NCO A;  1NX1 A;  4PDZ A;  1CM1 A;  1PRW A;  1OOG A;  4P2Y B;  2KLE A;  3D73 A;  1QV0 A;  1UHI A;  4PE1 A;  1MR8 A;  3D0Y B;  1VRK A;  2KQ6 A;  4MSP A;  3CDN A;  1FI6 A;  1C7W A;  3HCM A;  1NCX A;  2PVB A;  4PHK A;  2QEB A;  5DIC A;  1LA0 A;  4C0L A;  1DJZ A;  1CLB A;  1M63 B;  1F4Q A;  4MRX A;  3SG7 A;  1YX8 A;  3B6X A;  2L98 A;  3M0W A;  5CPV A;  3KF9 A;  3VGO A;  1SK6 D;  1DJI A;  2KOT A;  1YRT B;  3CR5 X;  2WCL A;  4OVN F;  1LKJ A;  2KYC A;  3BOW B;  3WHU B;  3ZWH A;  1GGW A;  1BJF A;  2QDI A;  1L2O B;  1NCZ A;  1BU3 A;  2LHI A;  3NHI A;  4GGF C;  2Q91 A;  4WQ2 A;  1R6P A;  4GNK B;  1EJ3 A;  2KDH A;  4YI9 A;  2FJY A;  3O2P A;  1ORG A;  1S6J A;  2I94 A;  3BUN B;  1UHJ A;  3EKJ A;  3TUY C;  2Y5I A;  2KI4 B;  3EVU A;  4IJ7 A;  4IL1 A;  1YTZ C;  4BY5 A;  2L2C A;  3DZT A;  2LM5 A;  3B87 A;  1DJX A;  4PE7 A;  3AKA A;  3VB1 A;  1B1G A;  1DGV A;  2K7D A;  3F45 A;  2RGI A;  2JWW A;  1TNW A;  2Q4U A;  3IQQ A;  1W7J B;  5I2Q A;  2KGB C;  2G9B A;  2LP3 A;  1OZO A;  3L47 A;  1XK4 A;  1IRJ A;  3JTD B;  1OOJ A;  1SKT A;  3LLE A;  2PYQ A;  2ZN8 A;  4MN0 A;  1W9Z A;  2Y4Q A;  4M2Q A;  1YVH A;  1BF5 A;  2JPT A;  3D0Y A;  1Q80 A;  2ZN9 A;  2L50 A;  3FIA A;  3JVT C;  3NXA A;  2WND A;  3D74 A;  4PHJ A;  2G2B A;  2PMY A;  1S6C A;  2VRG A;  2KBM A;  2I7A A;  1XFV O;  3OX5 A;  4GBA A;  1KWO C;  4GFT A;  1CLM A;  5KU1 A;  1OOF A;  3ICB A;  4DCK A;  1C7V A;  1ALW A;  1NUB A;  3NSK A;  2BCA A;  2JT8 A;  2LVI A;  3CAB A;  5FYX A;  4F7F A;  1B7T Y;  1J7O A;  3AAK A;  4Q04 A;  3S0G A;  2LE9 B;  3DVK A;  2LVJ A;  4JKT A;  3ZNI A;  5JOL A;  3NSO A;  3I5F C;  1AP4 A;  1UHK A;  3BUX B;  3EK8 A;  1ZUZ A;  1GJY A;  1DJW A;  1KK7 Y;  3IF7 A;  2ZKM X;  2BEC A;  2WC6 A;  4INX A;  2OTG B;  1G33 A;  1B8R A;  1Y1U A;  3CGA A;  3DYE A;  1B8L A;  3GK1 A;  4PHM A;  3UNW A;  4M2P A;  2V53 A;  2QEO A;  3BXK A;  4OR9 B;  4QJ5 B;  4MRY A;  3DVM A;  1JWD A;  2F8P A;  2ZNE A;  2HQW A;  1QXP A;  2JOJ A;  2MAZ A;  1TWO A;  1IH0 A;  1EL4 A;  3I5F B;  2EC6 B;  1BLQ A;  3KO0 A;  1IQ5 A;  1XA5 A;  3I5H B;  3LL8 B;  3PJI A;  1DMO A;  3O4Y A;  1QIV A;  3PN7 B;  5PAL A;  1JFK A;  4YGA A;  1DQE A;  5CSI A;  2K7B A;  2F2P A;  1CM4 A;  1S5G Z;  3B7A A;  1ALV A;  1KWO B;  5D3O A;  2WCE A;  4F0Z B;  1K9U A;  1CFD A;  1T14 A;  2CT9 A;  1EH2 A;  3SG5 A;  1DT7 B;  2A4J A;  2LP2 A;  3B88 A;  4U8D A;  3CTN A;  2LCP A;  2B1U A;  3D77 A;  1LA3 A;  3D75 A;  1OOI X;  2JUL A;  1K94 A;  1CNP A;  2M8U A;  2LLS A;  2PAL A;  3A4U B;  4XYN A;  3D10 A;  4PHN A;  3K1E A;  3PLF B;  1SL8 A;  4PE0 A;  1KCY A;  3VRP A;  1A2X A;  2LC5 A;  3A8R A;  3FWC A;  1SNL A;  3JTD C;  3MSE B;  1J55 A;  1MXL C; 
#chains in the Genus database with same CATH homology
 1N65 A;  3PAL A;  3WHT B;  3RM1 A;  1XFY O;  2KQY A;  2ZRS A;  2MLE C;  2I2R E;  1AK8 A;  1BT6 A;  4P5O E;  1LIN A;  2KAV A;  1A29 A;  2SCP A;  1K93 D;  3H4S E;  2KI4 C;  2LV7 A;  1WRL A;  1OQP A;  3HX4 A;  4D1E A;  2H61 A;  3VRQ A;  5KTY A;  2BL0 B;  1JC2 A;  1AJ4 A;  3BOW A;  3OB1 B;  3EKH A;  5G08 A;  2D8N A;  1F55 A;  1XFX O;  3EVV A;  4OV2 A;  2LVK A;  1XO5 A;  1A4P A;  1MF8 B;  4PCW A;  1WRZ A;  2JT3 A;  4JWQ A;  3RLZ A;  3SIB A;  1QLK A;  1QS7 A;  1QV1 A;  2LVV A;  4OKH A;  4I5K A;  2HET A;  2JTZ A;  2M9G A;  1JBA A;  1YX7 A;  1NWD A;  1OMV A;  1U5I B;  1SPY A;  2DOQ A;  2L51 A;  2JXL A;  2SAS A;  2LMV A;  3AKB A;  2WCB A;  5B8I B;  1YUS A;  2JXC A;  3BYA A;  1SMG A;  5J3X A;  1QTX A;  1ZOT B;  2I18 A;  2K2A A;  3CLN A;  5CSN A;  1CB1 A;  1FW4 A;  1SRA A;  1LVC D;  1FBV A;  4ICB A;  1TNP A;  2F3Z A;  1FI5 A;  2KFF A;  1G4Y R;  1MWN A;  3O6B A;  4NDD A;  2Y1M A;  4ORC B;  5F6T A;  1N0Y A;  1KFX S;  1BR4 B;  4YI8 A;  1TNX A;  3PFV A;  1OMD A;  1HT9 A;  4I5N B;  4JPZ B;  5AAN A;  3SG2 A;  1F8H A;  3JVT B;  5DKN A;  5AEQ A;  1TTX A;  5CSF A;  1S6I A;  1Y1X A;  1F54 A;  2OS8 B;  1OZS A;  4I5J A;  1A03 A;  1CMF A;  1S1E A;  1DJY A;  1B47 A;  1DJH A;  1KSO A;  5AFP A;  1XVJ A;  2NXQ A;  1FF1 A;  1PUL A;  2NZ0 A;  1JF2 A;  2LUC A;  4YBH B;  5I2L A;  4YGE B;  4ORB B;  1PVA A;  4R1E A;  5TNC A;  2M7N A;  2F3Y A;  5HLV A;  2L4H A;  2F2O A;  1B4C A;  1QIW A;  1QJT A;  1YUU A;  1TCF A;  1V1F A;  4AQJ A;  1H8B A;  1KK7 Z;  1S3P A;  1EG3 A;  2BKI B;  1DF0 B;  1K96 A;  1WRK A;  5HLO A;  4C0K A;  3BUW B;  3NSI A;  5DKQ A;  4NQG A;  5ER5 A;  3GOF A;  3DVJ A;  2QAC A;  2JT0 A;  3NSL A;  1S36 A;  2KAX A;  1A75 A;  3BUM B;  3EK7 A;  1GQM A;  3PM8 A;  2L4I A;  2M1K B;  1S26 D;  1BOC A;  1UP5 A;  1OMR A;  2ZND A;  3I5G B;  3IQO A;  4HRG A;  3VRR A;  2F33 A;  3DF0 A;  2LHL A;  1QX2 A;  1SW8 A;  4YGB B;  1NX0 A;  3DVE A;  2EC6 C;  3VRO A;  1M39 A;  3QRX A;  4ORA B;  2GGM A;  2LLT A;  4BY4 A;  2PSR A;  1AUI B;  1WDC B;  3TS5 C;  4I5L B;  5KSZ A;  1KQM B;  2BBN A;  2KSP A;  4FQO A;  1B8C A;  4MEW A;  1M45 A;  1YUT A;  2JU0 A;  4WRI A;  2WOS A;  2MHH A;  1JFJ A;  4MVF A;  3EVR A;  3O78 A;  1DTL A;  2K2F A;  1QX5 B;  2M0R A;  3OP0 A;  2M49 B;  3CR2 A;  2FOT A;  1IWQ A;  1SY9 A;  1EG4 A;  2HF5 A;  5JJG A;  2HPS A;  2PAS A;  3TDU A;  3AAJ A;  1WDC C;  3TS5 B;  5D7F A;  1YR5 A;  1ZMZ A;  2WOR A;  1J7P A;  1UWO A;  2KFG A;  3FWB A;  5DKR A;  2LMT A;  1TN4 A;  2CXJ A;  1NIW A;  1KQV A;  1KSM A;  2KGR A;  2JTT A;  2MRD A;  5BPJ A;  1MHO A;  1GGZ A;  1TRF A;  1NX2 A;  1XFU O;  2BKH B;  4CFQ A;  4YGC B;  2M29 A;  1PSR A;  1MQ1 A;  3I5G C;  1RTP 1;  3LK0 A;  2M7L A;  1KK8 B;  2M97 A;  2AUC A;  2BCX A;  4MZJ A;  1SCV A;  4QJ4 B;  1NSH A;  2ISD A;  2FCE A;  3WNX B;  1K2H A;  2K8M B;  1UUS A;  3DF0 B;  3SG4 A;  3TZ1 A;  4PAL A;  3K21 A;  3C1V A;  1G8I A;  4GGN A;  3SG3 A;  1CKK A;  2JRF A;  2BE4 A;  3LK1 A;  1A75 B;  2NCP A;  1PAL A;  4CLN A;  2K61 A;  1QVI Y;  1H4B A;  1NCY A;  2JZI A;  4UPG A;  4CID A;  2KI6 D;  1K95 A;  2JNF A;  5K89 A;  4TNC A;  1YVL A;  1RK9 A;  1Y6W A;  1SYM A;  2K7C A;  1QLS A;  4DRW A;  2GV5 A;  4MBE A;  3FS7 A;  1L2O C;  1QX7 A;  1SCM C;  2CCM A;  1F71 A;  1SR6 C;  1JUO A;  2OS8 C;  1CFF A;  3PN7 C;  3TUY B;  2EHB A;  3I5H C;  2P6B B;  1AVS A;  2MA2 A;  3E3R A;  1B7T Z;  1IJ5 A;  1DGU A;  1XK4 C;  3CR4 X;  3OX6 A;  1J7Q A;  1SR6 B;  1OE9 B;  2QPT A;  2E6W A;  1JF0 A;  2K0J A;  2KYF A;  1DVI A;  5HKZ A;  1PK0 D;  1X02 A;  1V1G A;  1L7Z A;  4GUK A;  1PSB A;  2LLU A;  1XFW O;  1MUX A;  2H61 C;  5I8N A;  1QAT A;  4MLW A;  2ZFD A;  1LXF C;  1BG1 A;  3KPX A;  1UUR A;  3EK4 A;  1RWY A;  2CBL A;  2BCB A;  1RJV A;  1DJG A;  1YUR A;  2L2E A;  4WQ3 A;  4GPL B;  1F4O A;  1Y0V H;  3TDI A;  2LAP A;  3KEV A;  2Y1N A;  1K8U A;  2AMI A;  1NPQ A;  2KHN A;  1QAS A;  1ODB A;  4AOM A;  4PE4 A;  1KFX L;  2CNP A;  4A4B A;  3OB2 B;  4YGD B;  2OTG C;  1J7R A;  2O5G A;  3GK4 X;  1NYA A;  3LCP C;  1S5G Y;  1RRO A;  2HQ8 A;  4GAO A;  1IGV A;  1U5I A;  4OCI A;  4HRE E;  1Y1A A;  2M1U A;  2BL0 C;  1CTR A;  1JSA A;  4HSZ A;  3KHE A;  5HKW A;  1F70 A;  1E8A A;  1TCO B;  1YRU B;  4ZCV A;  2GGZ A;  2COL B;  1BOD A;  1IQ3 A;  5D69 A;  2FCD A;  4GGF A;  2M3W A;  4USL A;  4AQI A;  1TIZ A;  1TNQ A;  1W7I B;  4CPV A;  2JQ6 A;  1CMG A;  1CLL A;  3SIA A;  1FPW A;  1AHR A;  2AAO A;  2MJW B;  1N2D A;  4ETO A;  1QVI Z;  1CDP A;  1K9K A;  1NX3 A;  1ZAC A;  2NLN A;  2TN4 A;  2JNX A;  1NP8 A;  2LUX A;  4N5X A;  3SJS A;  3VRN A;  1WLZ A;  1EXR A;  2FJU B;  2O60 A;  1B9A A;  4DUQ A;  5I2O A;  4QJ3 B;  1XYD A;  5CSJ A;  1OSA A;  1C07 A;  2CTN A;  3CS1 A;  1KQM C;  3I5I B;  4XJK B;  3TDZ A;  5ER4 X;  4JQ0 D;  1J1D A;  2IS9 A;  3CZT X;  1UHN A;  2KI6 C;  2KAY A;  1SL9 A;  3I5I C;  1CFP A;  3PAT A;  5AXI A;  1MXE A;  1CFC A;  4N1F A;  1M31 A;  1PVB A;  1IJ6 A;  1WLM A;  2MBX A;  1R2U A;  2BBM A;  4DS7 A;  2LMU A;  5HKY A;  2BE6 A;  1UHH A;  1RFJ A;  1SCM B;  1BMO A;  4XJK A;  3SG6 A;  1DF0 A;  2E30 A;  1TOP A;  1WY9 A;  1CDN A;  1SL7 A;  2L0P A;  4HRH A;  4YRU A;  4M2O A;  1J1E A;  1ZFS A;  3CWG A;  2KBI A;  4MZL A;  4A4C A;  2WC8 A;  4L9M A;  1AJ5 A;  2JC2 A;  2K7O A;  4NDC A;  5GQQ C;  1BR1 B;  1IG5 A;  1REC A;  1IKU A;  2EGD A;  2R2I A;  2ZRT A;  2L5X B;  2MLF C;  3PSR A;  1K90 D;  2KNE A;  3DD4 A;  2PRU A;  4MZK A;  2OPO A;  3BQ3 A;  2KFH A;  4N1G A;  4NDB A;  4C0J A;  3BUO B;  5AER A;  1D1O A;  1HQV A;  5IBW A;  1XFZ O;  2LAN A;  4DIR A;  1KK8 C;  2LNK A;  1KFU S;  3WXA A;  5HYD A;  2WCF A;  4FTG A;  1K9P A;  4ZCU A;  2H2K A;  1KFU L;  3OHM B;  4E68 A;  3GK2 A;  1CDL A;  1CDM A;  1M46 A;  1SBJ A;  4CFR A;  2NCO A;  1NX1 A;  4PDZ A;  1CM1 A;  1PRW A;  4P2Y B;  1QV0 A;  1UHI A;  4PE1 A;  1MR8 A;  3D0Y B;  1VRK A;  2KQ6 A;  4MSP A;  1FI6 A;  1C7W A;  3HCM A;  1NCX A;  2PVB A;  4PHK A;  1LA0 A;  4C0L A;  1DJZ A;  1CLB A;  1M63 B;  1F4Q A;  4MRX A;  3SG7 A;  1YX8 A;  2L98 A;  3M0W A;  5CPV A;  3KF9 A;  3VGO A;  1SK6 D;  1DJI A;  2KOT A;  1YRT B;  3CR5 X;  4OVN F;  3WHU B;  1LKJ A;  2KYC A;  3BOW B;  3ZWH A;  1GGW A;  1BJF A;  1L2O B;  1NCZ A;  1BU3 A;  2LHI A;  4GGF C;  2Q91 A;  4WQ2 A;  1R6P A;  4GNK B;  1EJ3 A;  2KDH A;  4YI9 A;  3O2P A;  1S6J A;  2I94 A;  3BUN B;  1UHJ A;  3EKJ A;  3TUY C;  2Y5I A;  2KI4 B;  3EVU A;  4IL1 A;  4BY5 A;  1YTZ C;  2LM5 A;  1DJX A;  4PE7 A;  3AKA A;  1B1G A;  1DGV A;  2K7D A;  3F45 A;  2RGI A;  2JWW A;  1TNW A;  2Q4U A;  3IQQ A;  1W7J B;  5I2Q A;  2KGB C;  2G9B A;  2LP3 A;  1OZO A;  1XK4 A;  1IRJ A;  3JTD B;  1OOJ A;  1SKT A;  3LLE A;  2ZN8 A;  4MN0 A;  2Y4Q A;  4M2Q A;  1YVH A;  1BF5 A;  2JPT A;  3D0Y A;  1Q80 A;  2ZN9 A;  2L50 A;  3FIA A;  3JVT C;  3NXA A;  2WND A;  4PHJ A;  2G2B A;  2PMY A;  1S6C A;  2VRG A;  2KBM A;  2I7A A;  1XFV O;  3OX5 A;  4GBA A;  1KWO C;  4GFT A;  1CLM A;  5KU1 A;  3ICB A;  4DCK A;  1C7V A;  1ALW A;  1NUB A;  3NSK A;  2BCA A;  2JT8 A;  2LVI A;  5FYX A;  1B7T Y;  1J7O A;  3AAK A;  4Q04 A;  2LE9 B;  3DVK A;  2LVJ A;  3ZNI A;  5JOL A;  3NSO A;  3I5F C;  1AP4 A;  1UHK A;  3BUX B;  3EK8 A;  1ZUZ A;  1GJY A;  1DJW A;  1KK7 Y;  3IF7 A;  2ZKM X;  2BEC A;  2OTG B;  1G33 A;  1B8R A;  1Y1U A;  3CGA A;  3GK1 A;  1B8L A;  4PHM A;  4M2P A;  2V53 A;  3BXK A;  4OR9 B;  4QJ5 B;  4MRY A;  3DVM A;  1JWD A;  2F8P A;  2ZNE A;  2HQW A;  1QXP A;  2JOJ A;  2MAZ A;  1IH0 A;  1EL4 A;  3I5F B;  2EC6 B;  1BLQ A;  3KO0 A;  1IQ5 A;  1XA5 A;  3I5H B;  3LL8 B;  1DMO A;  3O4Y A;  1QIV A;  3PN7 B;  5PAL A;  1JFK A;  4YGA A;  5CSI A;  2K7B A;  2F2P A;  1CM4 A;  1S5G Z;  1ALV A;  1KWO B;  2WCE A;  4F0Z B;  1K9U A;  1CFD A;  2CT9 A;  1EH2 A;  3SG5 A;  1DT7 B;  2A4J A;  2LP2 A;  4U8D A;  3CTN A;  2LCP A;  2B1U A;  1LA3 A;  2JUL A;  1K94 A;  1CNP A;  2M8U A;  2LLS A;  2PAL A;  3A4U B;  4XYN A;  3D10 A;  4PHN A;  3PLF B;  1SL8 A;  4PE0 A;  1KCY A;  3VRP A;  1A2X A;  2LC5 A;  3A8R A;  3FWC A;  1SNL A;  3JTD C;  3MSE B;  1J55 A;  1MXL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...