1KWOB

Scallop myosin s1-atpgammas-p-pdm in the actin-detached conformation
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
142
structure length
142
Chain Sequence
PQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKGSGEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic findings on the internally uncoupled and near-rigor states of myosin: Further insights into the mechanics of the motor
pubmed doi rcsb
molecule tags Contractile protein
molecule keywords MYOSIN HEAVY CHAIN
total genus 26
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2002-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kwoB01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kwoB02
1QJTA 1RWYA 1LKJA 2CXJA 2EGDA 1B8LA 1XFXO 2L2EA 2H61C 1UUSA 3SIAA 4MVFA 1XVJA 2KBMA 1TCOB 1J7PA 2SCPA 3JTDB 5I8NA 1BJFA 3LK1A 2JQ6A 4MLWA 4NQGA 1TIZA 3CWGA 3NSLA 2I94A 1QX7A 4OKHA 1BU3A 4ORAB 4A4CA 1RFJA 1B8RA 1X02A 1DJWA 1YTZC 2Q91A 2ZNEA 4CIDA 2KYCA 4ETOA 2CTNA 1YX8A 1ZACA 1JF0A 2KAXA 2L98A 4YGBB 2JT8A 1U5IA 2AAOA 2H61A 3DVKA 1TOPA 1XO5A 1F55A 5D7FA 1BODA 2ZN8A 4TNCA 1TCFA 1K95A 1OQPA 1KCYA 1E8AA 2MAZA 4PHMA 3SG3A 1B4CA 2K2FA 4DIRA 1M39A 2L4IA 1M46A 1SL7A 1R6PA 1UHJA 4N5XA 1N2DA 2LV7A 4GGFA 4R1EA 5HLOA 3PM8A 2WCBA 3SG4A 2BKIB 2KHNA 1AJ5A 4QJ5B 1DJGA 3BUNB 2M49B 3OX5A 1S6JA 1U5IB 2BBNA 1UHKA 1CFFA 3LLEA 3OB2B 2BL0B 1CMGA 1YUUA 1NX2A 1QVIY 1KFUL 3I5IC 2G9BA 1CNPA 3EK4A 2EC6C 2LMTA 2AMIA 1QX5B 2A4JA 2JWWA 2OS8B 3BOWA 3BUXB 3QRXA 2MA2A 4YI8A 5CSFA 4C0KA 4CLNA 2Y1MA 2KSPA 2K8MB 3CGAA 4MBEA 1NUBA 2KAVA 2BL0C 4FQOA 1KFUS 1SKTA 4I5LB 4YBHB 2GV5A 1OSAA 3I5IB 2M9GA 1G4YR 1Y1XA 1RTP1 4GAOA 3KPXA 2JZIA 2MLEC 3PSRA 3H4SE 5AXIA 1WRZA 2LMVA 1K9KA 1YX7A 4L9MA 1DJYA 1NP8A 3OP0A 1A75A 2M7NA 4PALA 1NIWA 3TDUA 1K96A 1GJYA 4ICBA 4GBAA 2Y1NA 2MHHA 1ALWA 1RECA 2FOTA 2LNKA 2Q4UA 4GGFC 1WLZA 1MHOA 2HQ8A 4ZCVA 1S6CA 2LANA 3BUOB 4HRHA 4JPZB 4Q04A 3DD4A 1C7VA 1CMFA 2JOJA 3AKBA 1VRKA 1S5GY 1K8UA 4PHKA 1XYDA 1J1EA 3D0YB 5DKRA 1NX1A 1BR1B 1LA0A 3DF0A 4GGNA 3FIAA 1UHHA 2KI6D 3CR4X 5ER5A 3PLFB 4FTGA 3SG6A 4AQIA 1XFZO 1PULA 2WORA 1F4OA 2WOSA 3LCPC 1J7OA 3NSIA 1DJXA 1B1GA 2AUCA 2K7CA 2ZKMX 1OZOA 2LVVA 2EC6B 3CR2A 1Y1UA 2OS8C 1M45A 1PK0D 1TNWA 2CCMA 3O78A 4MZKA 5AEQA 1OMDA 2NZ0A 1SK6D 1SMGA 1C07A 1DF0A 2O60A 1MR8A 1OOJA 1FI5A 1D1OA 3GK1A 1Y0VH 1S5GZ 1XFWO 1FI6A 4PE7A 2BCBA 5AERA 3AKAA 4HSZA 2LM5A 1HT9A 3VRRA 4P5OE 1XFUO 3FS7A 3BUWB 3O2PA 2KFFA 1IG5A 1NCYA 2PVBA 1OMVA 2KQ6A 2BCXA 2F33A 2FJUB 2SASA 4HRGA 4N1GA 1SYMA 3KHEA 4D1EA 5CPVA 5DKNA 1WLMA 1GGWA 1LXFC 4A4BA 2Y4QA 4PDZA 3WNXB 1CFCA 4PHNA 1PRWA 4YGEB 1NCZA 1J7RA 1AVSA 1JFKA 1PALA 1KQVA 1TNQA 1BR4B 2QPTA 2P6BB 1M63B 2K61A 1WDCC 1J1DA 4OCIA 1EG4A 5I2OA 3WHTB 2LE9B 3MSEB 3ZNIA 1WY9A 4NDBA 1SNLA 1B9AA 2JTZA 2NCPA 2LVKA 2KOTA 5HLVA 3GK2A 2TN4A 1QIWA 1CB1A 3VRQA 2LUXA 3FWBA 1ZMZA 3CZTX 2K7BA 1DJHA 3RLZA 1ZUZA 4YRUA 3KF9A 3KEVA 1LINA 3TS5C 1L2OB 4I5NB 3I5GB 5KSZA 1KSMA 1XFYO 3BXKA 1UHIA 2LHIA 4XYNA 1CFDA 2KDHA 4USLA 5AANA 1YUSA 3EKHA 4DRWA 3A4UB 3EVRA 1G33A 4MRYA 4PE1A 5IBWA 1IH0A 5CSJA 1KQMB 5B8IB 3DVEA 4CPVA 3VRPA 1L2OC 3EVUA 3O6BA 4WQ2A 3VGOA 3I5GC 2M97A 3CLNA 1ODBA 1SCVA 3PN7C 3LK0A 2M0RA 1CDMA 3CR5X 1PSBA 1DVIA 1F4QA 1S3PA 4YGDB 2ISDA 4NDDA 3AAKA 4OV2A 1IRJA 2COLB 2K7DA 2VRGA 1BOCA 2K7OA 4CFQA 1S36A 1KQMC 4M2QA 1SW8A 5TNCA 1LA3A 2KNEA 2JC2A 1S6IA 2E6WA 2KI4C 1JF2A 1WDCB 2B1UA 2NLNA 1SPYA 1M31A 2ZN9A 4WQ3A 1DTLA 1FW4A 1NPQA 1OMRA 2NXQA 2DOQA 1UURA 3SG7A 1N65A 4ORCB 5JOLA 3WHUB 1DMOA 3A8RA 1QTXA 1DT7B 1YR5A 4UPGA 1CTRA 1ALVA 3HCMA 3M0WA 1TTXA 1CFPA 2L51A 1L7ZA 2WCFA 3NXAA 1IKUA 1CDPA 2KYFA 2HQWA 4AOMA 1KK7Y 5PALA 2WCEA 3C1VA 3PFVA 3TS5B 3VROA 2LP2A 2PSRA 3EK7A 3BQ3A 4GFTA 1WRLA 5I2QA 1K2HA 2H2KA 1BT6A 1KFXL 2JPTA 2D8NA 2LMUA 4IL1A 1B47A 4U8DA 3OB1B 1W7IB 5CSNA 1CDLA 5ER4X 1UP5A 4DUQA 3ZWHA 4AQJA 1IJ6A 2KGBC 1F71A 1TN4A 1XK4C 3PN7B 1AJ4A 2I2RE 1SR6C 2JTTA 2KGRA 1EJ3A 1TRFA 3TUYB 1EG3A 1QX2A 4JQ0D 2KI6C 3O4YA 4C0JA 2MBXA 4E68A 1DGVA 2F3YA 2ZNDA 3KO0A 1LVCD 1SL8A 3LL8B 2KI4B 4ORBB 2WNDA 1XFVO 4DCKA 2BKHB 5K89A 3TUYC 1CKKA 1IWQA 1HQVA 1XK4A 5KTYA 2KAYA 3I5FC 1DJIA 4MZJA 3EKJA 1MXEA 1A03A 5KU1A 1Q80A 3JVTB 3NSKA 4ZCUA 2HPSA 3DVJA 1R2UA 4OR9B 3E3RA 1RK9A 4MRXA 1DJZA 2IS9A 1TNPA 2JNFA 3RM1A 2F2OA 4I5JA 3ICBA 2GGZA 3IQQA 2ZRSA 1YVHA 3GOFA 2ZRTA 2KQYA 1MF8B 2M1KB 3JVTC 5HKYA 2JULA 5JJGA 2LUCA 3TDZA 1IJ5A 1SCMB 1WRKA 4M2OA 1QLKA 3BUMB 3D0YA 1UHNA 2BECA 2LP3A 2M7LA 4DS7A 4HREE 1CM1A 2WC8A 1KK8B 1YUTA 3HX4A 2K0JA 1AK8A 1QLSA 2CBLA 1EXRA 3SIBA 5F6TA 1SR6B 4BY4A 2LHLA 3SJSA 2KFHA 1W7JB 3NSOA 2BCAA 1V1GA 1YURA 4YGCB 1JBAA 1KK8C 5BPJA 2CNPA 2JT0A 2LLUA 1F70A 1QIVA 2LVIA 4PE0A 4QJ4B 2PMYA 4CFRA 2E30A 2F8PA 5HKWA 4YGAA 1SL9A 2ZFDA 3I5HB 1EL4A 2KFGA 1K94A 1NCXA 4GPLB 1QV1A 1NX3A 4PE4A 1JFJA 1GGZA 1CLMA 3IQOA 4GUKA 2L5XB 2MJWB 3I5FB 3DVMA 4MSPA 1A29A 1QATA 2JNXA 2LVJA 2G2BA 4NDCA 3WXAA 2BE6A 1BG1A 1G8IA 4PHJA 1KSOA 1QVIZ 3CS1A 4MEWA 5HYDA 1DGUA 1Y6WA 1JSAA 2LLTA 2OTGC 2PRUA 1NSHA 1KFXS 1AUIB 1NYAA 2EHBA 3D10A 5HKZA 2JXLA 1J7QA 2CT9A 1UWOA 2PALA 5GQQC 4PCWA 1B7TY 1K9UA 4OVNF 1RROA 4MZLA 3SG2A 4WRIA 1FBVA 1YVLA 2I7AA 1SCMC 1F54A 2K2AA 1MQ1A 3PALA 1S1EA 3TDIA 1CLLA 2JT3A 3GK4X 1FF1A 2LC5A 1OE9B 3CTNA 4QJ3B 1ZOTB 4C0LA 1BF5A 1B8CA 3PATA 1CM4A 3DF0B 5D69A 5DKQA 1FPWA 2M3WA 1MUXA 3EK8A 2MLFC 1XA5A 2MRDA 3TZ1A 2F3ZA 3F45A 2JRFA 2O5GA 1JUOA 1OZSA 2NCOA 2R2IA 2QACA 1B7TZ 1RJVA 2LLSA 1EH2A 3I5HC 1NX0A 4M2PA 1H8BA 1AHRA 2I18A 1IQ3A 5CSIA 1PVBA 4F0ZB 1SRAA 1QV0A 3SG5A 1K93D 5AFPA 1PVAA 3K21A 4P2YB 3FWCA 1A75B 2HF5A 3JTDC 2M8UA 1KWOC 1QASA 1Y1AA 2JXCA 2M29A 2Y5IA 1S26D 1DF0B 1TNXA 3VRNA 3EVVA 1SY9A 2LAPA 2L4HA 3IF7A 3OX6A 4MN0A 1SBJA 2OPOA 2V53A 1H4BA 1QXPA 1YRTB 4JWQA 2OTGB 1J55A 1YRUB 1BMOA 2F2PA 1MWNA 2KBIA 2RGIA 1V1FA 1ZFSA 1KWOB 4I5KA 5I2LA 1K90D 2PASA 2BE4A 1KK7Z 5FYXA 1IGVA 2FCEA 4GNKB 1CLBA 2L0PA 3BOWB 2HETA 5J3XA 1GQMA 2GGMA 4YI9A 1NWDA 3AAJA 1F8HA 1PSRA 3OHMB 1AP4A 1K9PA 1N0YA 2BBMA 2JU0A 1C7WA 4XJKB 1JWDA 1BLQA 2FCDA 1A2XA 1MXLC 4BY5A 1CDNA 4N1FA 1A4PA 2M1UA 1IQ5A 2L50A 3BYAA 1JC2A 4XJKA 2LCPA 1QS7A 5G08A
chains in the Genus database with same CATH superfamily
1QJTA 1RWYA 1LKJA 2CXJA 2EGDA 1B8LA 2P71A 1XFXO 2L2EA 2H61C 4INXA 1UUSA 3SIAA 4MVFA 1XVJA 2KBMA 1TCOB 1LS8A 1J7PA 3D78A 3SS3A 2SCPA 4AQIA 3IVTA 3JTDB 5I8NA 1BJFA 3LK1A 2JQ6A 4MLWA 4NQGA 1XFRA 3RZSA 1TIZA 3CWGA 3NSLA 2I94A 1QX7A 4OKHA 1BU3A 2QEHA 4ORAB 4A4CA 1RFJA 1B8RA 1X02A 1DJWA 1YTZC 2Q91A 2ZNEA 4CIDA 2KYCA 4ETOA 2CTNA 1YX8A 1ZACA 1JF0A 2KAXA 2FJYA 2L98A 3CABA 3OBVA 4YGBB 2JT8A 2WCMA 3UO9A 3B88A 3PM2A 1U5IA 1C3YA 2AAOA 2H61A 3DVKA 1TOPA 1XO5A 1F55A 5D7FA 1BODA 2ZN8A 4TNCA 1TCFA 1K95A 1OQPA 1KCYA 1E8AA 2MAZA 3BFBA 4PHMA 3SG3A 1B4CA 2K2FA 4DIRA 1M39A 2L4IA 2QEBA 1M46A 2GTEA 1SL7A 1R6PA 1UHJA 4N5XA 1N2DA 4OZDA 2LV7A 3CDNA 4GGFA 4R1EA 5HLOA 3PM8A 2WCBA 3SG4A 3D76A 2BKIB 2KHNA 1AJ5A 4QJ5B 1IIOA 1DJGA 3BUNB 2M49B 3OX5A 1S6JA 1U5IB 2BBNA 1UHKA 1CFFA 3LLEA 3OB2B 1OOHA 2BL0B 1CMGA 1YUUA 1NX2A 1QVIY 1KFUL 3I5IC 2G9BA 1CNPA 3EK4A 1T14A 2EC6C 2AMIA 2LMTA 1QX5B 2A4JA 2JWWA 1C3ZA 2OS8B 3BOWA 3FE6A 3L4LA 3BUXB 3QRXA 2MA2A 4YI8A 5CSFA 4C0KA 4CLNA 2Y1MA 2KSPA 2K8MB 3CGAA 4MBEA 1NUBA 2KAVA 2BL0C 4FQOA 1KFUS 1SKTA 4I5LB 4YBHB 2GV5A 1OSAA 3I5IB 2M9GA 1G4YR 1Y1XA 1RTP1 4GAOA 3KPXA 2JZIA 2MLEC 3PSRA 3H4SE 1DEKA 2KLDA 5AXIA 1WRZA 2LMVA 1K9KA 5DICA 3UNWA 1YX7A 3DXLA 4L9MA 1DJYA 1NP8A 3OP0A 1A75A 2M7NA 4PALA 1NIWA 3TDUA 4F7FA 1K96A 1GJYA 4ICBA 4GBAA 1P28A 2Y1NA 2MHHA 1ALWA 1RECA 2FOTA 2LNKA 2Q4UA 4GGFC 1WLZA 1MHOA 2HQ8A 4ZCVA 1S6CA 2LANA 3BUOB 4HRHA 4JPZB 4Q04A 3DD4A 1C7VA 1CMFA 2JOJA 4PT1A 3K1EA 2WCKA 1VRKA 3AKBA 1S5GY 1K8UA 4PHKA 1XYDA 1J1EA 1DQEA 3D0YB 1NX1A 5DKRA 1BR1B 1LA0A 3DF0A 4GGNA 3FIAA 1UHHA 2KI6D 3CR4X 5ER5A 3CZ1A 2QEOA 2BNXA 3PLFB 1XFZO 1PULA 4FTGA 2WORA 1F4OA 2WOSA 3LCPC 1J7OA 3NSIA 1DJXA 1B1GA 2AUCA 2K7CA 2ZKMX 1OZOA 2LVVA 2EC6B 3CR2A 1Y1UA 2QEVA 2OS8C 1M45A 1PK0D 1TNWA 2CCMA 3O78A 4MZKA 5AEQA 1OMDA 2NZ0A 1SK6D 1SMGA 1C07A 1DF0A 2O60A 1MR8A 1OOJA 1FI5A 1D1OA 3GK1A 2QDIA 4INWA 1Y0VH 1S5GZ 1XFWO 1FI6A 4PE7A 2BCBA 5AERA 3AKAA 1DELA 4HSZA 2LM5A 1HT9A 3VRRA 4P5OE 1XFUO 3FS7A 3R1OA 3BUWB 3O2PA 2KFFA 1IG5A 1NCYA 2PVBA 1OMVA 2KQ6A 2BCXA 3DZTA 2F33A 2FJUB 2SASA 4HRGA 1ORGA 1SYMA 3KHEA 3B87A 4N1GA 2L2CA 4D1EA 5CPVA 3NGVA 5DKNA 1WLMA 1GGWA 1LXFC 4A4BA 2Y4QA 4PDZA 3WNXB 1CFCA 4PHNA 3S0BA 1PRWA 3B7AA 1NCZA 4YGEB 1J7RA 1AVSA 1JFKA 1PALA 1KQVA 1TNQA 1BR4B 2JPOA 2QPTA 2P6BB 1M63B 2K61A 3SS4A 1WDCC 1J1DA 4OCIA 1EG4A 2L5YA 5I2OA 3WHTB 2ERBA 2LE9B 3MSEB 3ZNIA 1WY9A 4NDBA 1SNLA 1B9AA 2JTZA 2NCPA 2LVKA 2KOTA 5HLVA 3GK2A 2TN4A 1QIWA 1CB1A 3VRQA 2LUXA 2YGUA 5I94A 3FWBA 1ZMZA 3CZTX 2K7BA 1DJHA 3RLZA 1ZUZA 1OW4A 3KF9A 3KEVA 4YRUA 1LINA 3TS5C 2P70A 1L2OB 4I5NB 3I5GB 5KSZA 1KSMA 1XFYO 3BXKA 1UHIA 2LHIA 4XYNA 1CFDA 2KDHA 4USLA 5AANA 2BAPA 1YUSA 3EKHA 4DRWA 3A4UB 3EVRA 1G33A 3N7HA 3NHTA 4MRYA 4PE1A 5CSJA 2K60A 5IBWA 1IH0A 1KQMB 5B8IB 3DVEA 4CPVA 3VRPA 1L2OC 3EVUA 3O6BA 4WQ2A 3VGOA 3I5GC 1OOIX 2M97A 3CLNA 1ODBA 1SCVA 3PN7C 3LK0A 2M0RA 1CDMA 3CR5X 1PSBA 1DVIA 1F4QA 1S3PA 4YGDB 3FE8A 4NDDA 3AAKA 2ISDA 3BJHA 4OV2A 3S0AA 1IRJA 2COLB 2K7DA 3V2LA 2VRGA 1BOCA 2K7OA 5FI7A 4CFQA 1S36A 1KQMC 4M2QA 1SW8A 5TNCA 1LA3A 2KNEA 2JC2A 1S6IA 3L4AA 2E6WA 3QMEA 2KI4C 1JF2A 1WDCB 2B1UA 2NLNA 1SPYA 1M31A 2ZN9A 4WQ3A 1DTLA 1FW4A 1NPQA 1OMRA 2NXQA 2DOQA 1UURA 3SG7A 1N65A 4JD9A 4ORCB 5JOLA 2KLEA 3WHUB 1DMOA 3A8RA 1QTXA 3CZ0A 1DT7B 1YR5A 4UPGA 1CTRA 1ALVA 1SSEB 3HCMA 3M0WA 1TTXA 1CFPA 2L51A 1L7ZA 2WCFA 3NXAA 1IKUA 1CDPA 1TWOA 2KYFA 2HQWA 4AOMA 1KK7Y 5PALA 3OGNA 2WCEA 3C1VA 3O4XA 3PFVA 1QWVA 3TS5B 3D75A 3VROA 2LP2A 3EG5B 2PSRA 3EK7A 3BQ3A 4GFTA 3SG6A 1WRLA 5I2QA 1K2HA 2H2KA 1BT6A 1KFXL 2JPTA 2D8NA 2LMUA 4IL1A 1B47A 4U8DA 3OB1B 1W7IB 5CSNA 1CDLA 3D74A 3R1VA 5ER4X 1UP5A 4DUQA 3ZWHA 4AQJA 1IJ6A 2KGBC 1F71A 1TN4A 1XK4C 3PN7B 1AJ4A 3PJIA 2I2RE 1SR6C 2JTTA 2KGRA 1EJ3A 3BFAA 1TRFA 3TUYB 1EG3A 1QX2A 4JQ0D 2KI6C 3O4YA 4C0JA 2MBXA 4E68A 1DGVA 1OOFA 2F3YA 2ZNDA 3KO0A 1LVCD 1SL8A 3LL8B 2KI4B 4ORBB 2PQLA 1XFVO 2WNDA 2BKHB 4DCKA 5K89A 3TUYC 3SS5A 3S0FA 1CKKA 1IWQA 1HQVA 1W9ZA 1XK4A 5KTYA 2KAYA 3I5FC 1DJIA 4MZJA 2WCHA 3EKJA 3CYZA 1MXEA 1A03A 5KU1A 1Q80A 3JVTB 3NSKA 3B6XA 4ZCUA 2HPSA 2WCLA 3DVJA 1R2UA 4OR9B 3E3RA 1RK9A 4MRXA 5EL2A 1DJZA 2IS9A 1TNPA 2JNFA 3RM1A 2F2OA 4I5JA 3ICBA 2GGZA 3IQQA 2ZRSA 1YVHA 3GOFA 2ZRTA 1Z4HA 2KQYA 1MF8B 2M1KB 3JVTC 5HKYA 2JULA 5JJGA 2LUCA 2WC6A 3R72A 3TDZA 1GM0A 1IJ5A 1SCMB 1WRKA 2WCJA 4M2OA 4IJ7A 4JKTA 1QLKA 3BUMB 3D0YA 1UHNA 2BECA 2LP3A 2M7LA 4FQTA 4HREE 4DS7A 1CM1A 3NHIA 2WC8A 1KK8B 1YUTA 3HX4A 2K0JA 1AK8A 1QLSA 2CBLA 1EXRA 3SIBA 5F6TA 1SR6B 4BY4A 2LHLA 3SJSA 2KFHA 1W7JB 3BFHA 3D77A 3DYEA 3NSOA 2BCAA 1V1GA 1YURA 4YGCB 1JBAA 1KK8C 5BPJA 2CNPA 2JT0A 2LLUA 2WC5A 1QIVA 2LVIA 4PE0A 4QJ4B 2PMYA 4CFRA 2E30A 2F8PA 5HKWA 4YGAA 1SL9A 2ZFDA 3I5HB 1EL4A 2KFGA 1K94A 1NCXA 4GPLB 1QV1A 5D3OA 1NX3A 4PE4A 1JFJA 1GGZA 1CLMA 3IQOA 4GUKA 2L5XB 2MJWB 3Q8IA 5FI6A 3I5FB 3DVMA 4MSPA 1A29A 1QATA 2JNXA 2KPHA 2G2BA 2LVJA 4NDCA 3WXAA 2BE6A 1BG1A 1G8IA 4PHJA 1Z2CB 1KSOA 1QVIZ 3CS1A 3VB1A 4MEWA 5HYDA 1DGUA 1Y6WA 1JSAA 2LLTA 2OTGC 2PRUA 1NSHA 1KFXS 1AUIB 1NYAA 2EHBA 3D10A 5HKZA 2JXLA 1J7QA 2CT9A 1UWOA 2PALA 5GQQC 1F70A 4PCWA 1B7TY 5HL1A 2H8VA 1K9UA 4OVNF 1RROA 4MZLA 3SG2A 3L47A 4WRIA 1FBVA 1TUZA 1YVLA 2I7AA 1SCMC 1F54A 2K2AA 1MQ1A 3PALA 1S1EA 3TDIA 1CLLA 2JT3A 3GK4X 1FF1A 2LC5A 1OE9B 3CTNA 3S0DA 4QJ3B 1ZOTB 4C0LA 1BF5A 1B8CA 3PATA 1CM4A 5FI2A 3DF0B 5D69A 1TUJA 5DKQA 1FPWA 2M3WA 1MUXA 3EK8A 2MLFC 1XA5A 2MRDA 3TZ1A 2F3ZA 3F45A 3FE9A 2PYQA 2JRFA 2O5GA 1JUOA 1OZSA 2NCOA 2R2IA 2QACA 1B7TZ 1RJVA 2LLSA 1EH2A 3I5HC 1NX0A 4M2PA 1H8BA 1AHRA 3B86A 2I18A 1IQ3A 5CSIA 1PVBA 4F0ZB 1SRAA 1QV0A 3SG5A 1K93D 5AFPA 1PVAA 3K21A 4P2YB 3FWCA 1A75B 2HF5A 3JTDC 2M8UA 1KWOC 1QASA 1Y1AA 1DC1A 2JXCA 2M29A 2Y5IA 1S26D 1DF0B 1TNXA 3VRNA 3EVVA 1SY9A 2LAPA 2L4HA 3IF7A 3OX6A 4MN0A 1SBJA 3S0EA 2OPOA 2V53A 4KYNA 1H4BA 1QXPA 1YRTB 4JWQA 2OTGB 1J55A 1YRUB 1BMOA 2F2PA 1MWNA 2KBIA 2RGIA 3R1PA 1V1FA 1ZFSA 1KWOB 4I5KA 5I2LA 1K90D 2PASA 2BE4A 1KK7Z 5FYXA 1IGVA 2FCEA 4GNKB 1CLBA 2L0PA 3BOWB 2HETA 5J3XA 1GQMA 2GGMA 4YI9A 1OOGA 1NWDA 3DY9A 3AAJA 3CZ2A 1F8HA 1PSRA 3D73A 3OHMB 1AP4A 1K9PA 1N0YA 2BBMA 2JU0A 1C7WA 4XJKB 1JWDA 1BLQA 2FCDA 1A2XA 1MXLC 4BY5A 1CDNA 4N1FA 1A4PA 2M1UA 1IQ5A 2L50A 3BYAA 1JC2A 4XJKA 2LCPA 3S0GA 1QS7A 5G08A
chains in the Genus database with same CATH topology
1QJTA 1RWYA 1LKJA 2CXJA 2EGDA 1B8LA 1XFXO 2L2EA 2H61C 1UUSA 3SIAA 4MVFA 1XVJA 2KBMA 1TCOB 1J7PA 2SCPA 3JTDB 5I8NA 1BJFA 3LK1A 2JQ6A 4MLWA 4NQGA 1TIZA 3CWGA 3NSLA 2I94A 1QX7A 4OKHA 1BU3A 4ORAB 4A4CA 1RFJA 1B8RA 1X02A 1DJWA 1YTZC 2Q91A 2ZNEA 4CIDA 2KYCA 4ETOA 2CTNA 1YX8A 1ZACA 1JF0A 2KAXA 2L98A 4YGBB 2JT8A 1U5IA 2AAOA 2H61A 3DVKA 1TOPA 1XO5A 1F55A 5D7FA 1BODA 2ZN8A 4TNCA 1TCFA 1K95A 1OQPA 1KCYA 1E8AA 2MAZA 4PHMA 3SG3A 1B4CA 2K2FA 4DIRA 1M39A 2L4IA 1M46A 1SL7A 1R6PA 1UHJA 4N5XA 1N2DA 2LV7A 4GGFA 4R1EA 5HLOA 3PM8A 2WCBA 3SG4A 2BKIB 2KHNA 1AJ5A 4QJ5B 1DJGA 3BUNB 2M49B 3OX5A 1S6JA 1U5IB 2BBNA 1UHKA 1CFFA 3LLEA 3OB2B 2BL0B 1CMGA 1YUUA 1NX2A 1QVIY 1KFUL 3I5IC 2G9BA 1CNPA 3EK4A 2EC6C 2LMTA 2AMIA 1QX5B 2A4JA 2JWWA 2OS8B 3BOWA 3BUXB 3QRXA 2MA2A 4YI8A 5CSFA 4C0KA 4CLNA 2Y1MA 2KSPA 2K8MB 3CGAA 4MBEA 1NUBA 2KAVA 2BL0C 4FQOA 1KFUS 1SKTA 4I5LB 4YBHB 2GV5A 1OSAA 3I5IB 2M9GA 1G4YR 1Y1XA 1RTP1 4GAOA 3KPXA 2JZIA 2MLEC 3PSRA 3H4SE 5AXIA 1WRZA 2LMVA 1K9KA 1YX7A 4L9MA 1DJYA 1NP8A 3OP0A 1A75A 2M7NA 4PALA 1NIWA 3TDUA 1K96A 1GJYA 4ICBA 4GBAA 2Y1NA 2MHHA 1ALWA 1RECA 2FOTA 2LNKA 2Q4UA 4GGFC 1WLZA 1MHOA 2HQ8A 4ZCVA 1S6CA 2LANA 3BUOB 4HRHA 4JPZB 4Q04A 3DD4A 1C7VA 1CMFA 2JOJA 3AKBA 1VRKA 1S5GY 1K8UA 4PHKA 1XYDA 1J1EA 3D0YB 5DKRA 1NX1A 1BR1B 1LA0A 3DF0A 4GGNA 3FIAA 1UHHA 2KI6D 3CR4X 5ER5A 3PLFB 4FTGA 3SG6A 4AQIA 1XFZO 1PULA 2WORA 1F4OA 2WOSA 3LCPC 1J7OA 3NSIA 1DJXA 1B1GA 2AUCA 2K7CA 2ZKMX 1OZOA 2LVVA 2EC6B 3CR2A 1Y1UA 2OS8C 1M45A 1PK0D 1TNWA 2CCMA 3O78A 4MZKA 5AEQA 1OMDA 2NZ0A 1SK6D 1SMGA 1C07A 1DF0A 2O60A 1MR8A 1OOJA 1FI5A 1D1OA 3GK1A 1Y0VH 1S5GZ 1XFWO 1FI6A 4PE7A 2BCBA 5AERA 3AKAA 4HSZA 2LM5A 1HT9A 3VRRA 4P5OE 1XFUO 3FS7A 3BUWB 3O2PA 2KFFA 1IG5A 1NCYA 2PVBA 1OMVA 2KQ6A 2BCXA 2F33A 2FJUB 2SASA 4HRGA 4N1GA 1SYMA 3KHEA 4D1EA 5CPVA 5DKNA 1WLMA 1GGWA 1LXFC 4A4BA 2Y4QA 4PDZA 3WNXB 1CFCA 4PHNA 1PRWA 4YGEB 1NCZA 1J7RA 1AVSA 1JFKA 1PALA 1KQVA 1TNQA 1BR4B 2QPTA 2P6BB 1M63B 2K61A 1WDCC 1J1DA 4OCIA 1EG4A 5I2OA 3WHTB 2LE9B 3MSEB 3ZNIA 1WY9A 4NDBA 1SNLA 1B9AA 2JTZA 2NCPA 2LVKA 2KOTA 5HLVA 3GK2A 2TN4A 1QIWA 1CB1A 3VRQA 2LUXA 3FWBA 1ZMZA 3CZTX 2K7BA 1DJHA 3RLZA 1ZUZA 4YRUA 3KF9A 3KEVA 1LINA 3TS5C 1L2OB 4I5NB 3I5GB 5KSZA 1KSMA 1XFYO 3BXKA 1UHIA 2LHIA 4XYNA 1CFDA 2KDHA 4USLA 5AANA 1YUSA 3EKHA 4DRWA 3A4UB 3EVRA 1G33A 4MRYA 4PE1A 5IBWA 1IH0A 5CSJA 1KQMB 5B8IB 3DVEA 4CPVA 3VRPA 1L2OC 3EVUA 3O6BA 4WQ2A 3VGOA 3I5GC 2M97A 3CLNA 1ODBA 1SCVA 3PN7C 3LK0A 2M0RA 1CDMA 3CR5X 1PSBA 1DVIA 1F4QA 1S3PA 4YGDB 2ISDA 4NDDA 3AAKA 4OV2A 1IRJA 2COLB 2K7DA 2VRGA 1BOCA 2K7OA 4CFQA 1S36A 1KQMC 4M2QA 1SW8A 5TNCA 1LA3A 2KNEA 2JC2A 1S6IA 2E6WA 2KI4C 1JF2A 1WDCB 2B1UA 2NLNA 1SPYA 1M31A 2ZN9A 4WQ3A 1DTLA 1FW4A 1NPQA 1OMRA 2NXQA 2DOQA 1UURA 3SG7A 1N65A 4ORCB 5JOLA 3WHUB 1DMOA 3A8RA 1QTXA 1DT7B 1YR5A 4UPGA 1CTRA 1ALVA 3HCMA 3M0WA 1TTXA 1CFPA 2L51A 1L7ZA 2WCFA 3NXAA 1IKUA 1CDPA 2KYFA 2HQWA 4AOMA 1KK7Y 5PALA 2WCEA 3C1VA 3PFVA 3TS5B 3VROA 2LP2A 2PSRA 3EK7A 3BQ3A 4GFTA 1WRLA 5I2QA 1K2HA 2H2KA 1BT6A 1KFXL 2JPTA 2D8NA 2LMUA 4IL1A 1B47A 4U8DA 3OB1B 1W7IB 5CSNA 1CDLA 5ER4X 1UP5A 4DUQA 3ZWHA 4AQJA 1IJ6A 2KGBC 1F71A 1TN4A 1XK4C 3PN7B 1AJ4A 2I2RE 1SR6C 2JTTA 2KGRA 1EJ3A 1TRFA 3TUYB 1EG3A 1QX2A 4JQ0D 2KI6C 3O4YA 4C0JA 2MBXA 4E68A 1DGVA 2F3YA 2ZNDA 3KO0A 1LVCD 1SL8A 3LL8B 2KI4B 4ORBB 2WNDA 1XFVO 4DCKA 2BKHB 5K89A 3TUYC 1CKKA 1IWQA 1HQVA 1XK4A 5KTYA 2KAYA 3I5FC 1DJIA 4MZJA 3EKJA 1MXEA 1A03A 5KU1A 1Q80A 3JVTB 3NSKA 4ZCUA 2HPSA 3DVJA 1R2UA 4OR9B 3E3RA 1RK9A 4MRXA 1DJZA 2IS9A 1TNPA 2JNFA 3RM1A 2F2OA 4I5JA 3ICBA 2GGZA 3IQQA 2ZRSA 1YVHA 3GOFA 2ZRTA 2KQYA 1MF8B 2M1KB 3JVTC 5HKYA 2JULA 5JJGA 2LUCA 3TDZA 1IJ5A 1SCMB 1WRKA 4M2OA 1QLKA 3BUMB 3D0YA 1UHNA 2BECA 2LP3A 2M7LA 4DS7A 4HREE 1CM1A 2WC8A 1KK8B 1YUTA 3HX4A 2K0JA 1AK8A 1QLSA 2CBLA 1EXRA 3SIBA 5F6TA 1SR6B 4BY4A 2LHLA 3SJSA 2KFHA 1W7JB 3NSOA 2BCAA 1V1GA 1YURA 4YGCB 1JBAA 1KK8C 5BPJA 2CNPA 2JT0A 2LLUA 1F70A 1QIVA 2LVIA 4PE0A 4QJ4B 2PMYA 4CFRA 2E30A 2F8PA 5HKWA 4YGAA 1SL9A 2ZFDA 3I5HB 1EL4A 2KFGA 1K94A 1NCXA 4GPLB 1QV1A 1NX3A 4PE4A 1JFJA 1GGZA 1CLMA 3IQOA 4GUKA 2L5XB 2MJWB 3I5FB 3DVMA 4MSPA 1A29A 1QATA 2JNXA 2LVJA 2G2BA 4NDCA 3WXAA 2BE6A 1BG1A 1G8IA 4PHJA 1KSOA 1QVIZ 3CS1A 4MEWA 5HYDA 1DGUA 1Y6WA 1JSAA 2LLTA 2OTGC 2PRUA 1NSHA 1KFXS 1AUIB 1NYAA 2EHBA 3D10A 5HKZA 2JXLA 1J7QA 2CT9A 1UWOA 2PALA 5GQQC 4PCWA 1B7TY 1K9UA 4OVNF 1RROA 4MZLA 3SG2A 4WRIA 1FBVA 1YVLA 2I7AA 1SCMC 1F54A 2K2AA 1MQ1A 3PALA 1S1EA 3TDIA 1CLLA 2JT3A 3GK4X 1FF1A 2LC5A 1OE9B 3CTNA 4QJ3B 1ZOTB 4C0LA 1BF5A 1B8CA 3PATA 1CM4A 3DF0B 5D69A 5DKQA 1FPWA 2M3WA 1MUXA 3EK8A 2MLFC 1XA5A 2MRDA 3TZ1A 2F3ZA 3F45A 2JRFA 2O5GA 1JUOA 1OZSA 2NCOA 2R2IA 2QACA 1B7TZ 1RJVA 2LLSA 1EH2A 3I5HC 1NX0A 4M2PA 1H8BA 1AHRA 2I18A 1IQ3A 5CSIA 1PVBA 4F0ZB 1SRAA 1QV0A 3SG5A 1K93D 5AFPA 1PVAA 3K21A 4P2YB 3FWCA 1A75B 2HF5A 3JTDC 2M8UA 1KWOC 1QASA 1Y1AA 2JXCA 2M29A 2Y5IA 1S26D 1DF0B 1TNXA 3VRNA 3EVVA 1SY9A 2LAPA 2L4HA 3IF7A 3OX6A 4MN0A 1SBJA 2OPOA 2V53A 1H4BA 1QXPA 1YRTB 4JWQA 2OTGB 1J55A 1YRUB 1BMOA 2F2PA 1MWNA 2KBIA 2RGIA 1V1FA 1ZFSA 1KWOB 4I5KA 5I2LA 1K90D 2PASA 2BE4A 1KK7Z 5FYXA 1IGVA 2FCEA 4GNKB 1CLBA 2L0PA 3BOWB 2HETA 5J3XA 1GQMA 2GGMA 4YI9A 1NWDA 3AAJA 1F8HA 1PSRA 3OHMB 1AP4A 1K9PA 1N0YA 2BBMA 2JU0A 1C7WA 4XJKB 1JWDA 1BLQA 2FCDA 1A2XA 1MXLC 4BY5A 1CDNA 4N1FA 1A4PA 2M1UA 1IQ5A 2L50A 3BYAA 1JC2A 4XJKA 2LCPA 1QS7A 5G08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QJT A;  1RWY A;  1LKJ A;  2CXJ A;  2EGD A;  1B8L A;  1XFX O;  2L2E A;  2H61 C;  1UUS A;  3SIA A;  4MVF A;  1XVJ A;  2KBM A;  1TCO B;  1J7P A;  2SCP A;  3JTD B;  5I8N A;  1BJF A;  3LK1 A;  2JQ6 A;  4MLW A;  4NQG A;  1TIZ A;  3CWG A;  3NSL A;  2I94 A;  1QX7 A;  4OKH A;  1BU3 A;  4ORA B;  4A4C A;  1RFJ A;  1B8R A;  1X02 A;  1DJW A;  1YTZ C;  2Q91 A;  2ZNE A;  4CID A;  2KYC A;  4ETO A;  2CTN A;  1YX8 A;  1ZAC A;  1JF0 A;  2KAX A;  2L98 A;  4YGB B;  2JT8 A;  1U5I A;  2AAO A;  2H61 A;  3DVK A;  1TOP A;  1XO5 A;  1F55 A;  5D7F A;  1BOD A;  2ZN8 A;  4TNC A;  1TCF A;  1K95 A;  1OQP A;  1KCY A;  1E8A A;  2MAZ A;  4PHM A;  3SG3 A;  1B4C A;  2K2F A;  4DIR A;  1M39 A;  2L4I A;  1M46 A;  1SL7 A;  1R6P A;  1UHJ A;  4N5X A;  1N2D A;  2LV7 A;  4GGF A;  4R1E A;  5HLO A;  3PM8 A;  2WCB A;  3SG4 A;  2BKI B;  2KHN A;  1AJ5 A;  4QJ5 B;  1DJG A;  3BUN B;  2M49 B;  3OX5 A;  1S6J A;  1U5I B;  2BBN A;  1UHK A;  1CFF A;  3LLE A;  3OB2 B;  2BL0 B;  1CMG A;  1YUU A;  1NX2 A;  1QVI Y;  1KFU L;  3I5I C;  2G9B A;  1CNP A;  3EK4 A;  2EC6 C;  2LMT A;  2AMI A;  1QX5 B;  2A4J A;  2JWW A;  2OS8 B;  3BOW A;  3BUX B;  3QRX A;  2MA2 A;  4YI8 A;  5CSF A;  4C0K A;  4CLN A;  2Y1M A;  2KSP A;  2K8M B;  3CGA A;  4MBE A;  1NUB A;  2KAV A;  2BL0 C;  4FQO A;  1KFU S;  1SKT A;  4I5L B;  4YBH B;  2GV5 A;  1OSA A;  3I5I B;  2M9G A;  1G4Y R;  1Y1X A;  1RTP 1;  4GAO A;  3KPX A;  2JZI A;  2MLE C;  3PSR A;  3H4S E;  5AXI A;  1WRZ A;  2LMV A;  1K9K A;  1YX7 A;  4L9M A;  1DJY A;  1NP8 A;  3OP0 A;  1A75 A;  2M7N A;  4PAL A;  1NIW A;  3TDU A;  1K96 A;  1GJY A;  4ICB A;  4GBA A;  2Y1N A;  2MHH A;  1ALW A;  1REC A;  2FOT A;  2LNK A;  2Q4U A;  4GGF C;  1WLZ A;  1MHO A;  2HQ8 A;  4ZCV A;  1S6C A;  2LAN A;  3BUO B;  4HRH A;  4JPZ B;  4Q04 A;  3DD4 A;  1C7V A;  1CMF A;  2JOJ A;  3AKB A;  1VRK A;  1S5G Y;  1K8U A;  4PHK A;  1XYD A;  1J1E A;  3D0Y B;  5DKR A;  1NX1 A;  1BR1 B;  1LA0 A;  3DF0 A;  4GGN A;  3FIA A;  1UHH A;  2KI6 D;  3CR4 X;  5ER5 A;  3PLF B;  4FTG A;  3SG6 A;  4AQI A;  1XFZ O;  1PUL A;  2WOR A;  1F4O A;  2WOS A;  3LCP C;  1J7O A;  3NSI A;  1DJX A;  1B1G A;  2AUC A;  2K7C A;  2ZKM X;  1OZO A;  2LVV A;  2EC6 B;  3CR2 A;  1Y1U A;  2OS8 C;  1M45 A;  1PK0 D;  1TNW A;  2CCM A;  3O78 A;  4MZK A;  5AEQ A;  1OMD A;  2NZ0 A;  1SK6 D;  1SMG A;  1C07 A;  1DF0 A;  2O60 A;  1MR8 A;  1OOJ A;  1FI5 A;  1D1O A;  3GK1 A;  1Y0V H;  1S5G Z;  1XFW O;  1FI6 A;  4PE7 A;  2BCB A;  5AER A;  3AKA A;  4HSZ A;  2LM5 A;  1HT9 A;  3VRR A;  4P5O E;  1XFU O;  3FS7 A;  3BUW B;  3O2P A;  2KFF A;  1IG5 A;  1NCY A;  2PVB A;  1OMV A;  2KQ6 A;  2BCX A;  2F33 A;  2FJU B;  2SAS A;  4HRG A;  4N1G A;  1SYM A;  3KHE A;  4D1E A;  5CPV A;  5DKN A;  1WLM A;  1GGW A;  1LXF C;  4A4B A;  2Y4Q A;  4PDZ A;  3WNX B;  1CFC A;  4PHN A;  1PRW A;  4YGE B;  1NCZ A;  1J7R A;  1AVS A;  1JFK A;  1PAL A;  1KQV A;  1TNQ A;  1BR4 B;  2QPT A;  2P6B B;  1M63 B;  2K61 A;  1WDC C;  1J1D A;  4OCI A;  1EG4 A;  5I2O A;  3WHT B;  2LE9 B;  3MSE B;  3ZNI A;  1WY9 A;  4NDB A;  1SNL A;  1B9A A;  2JTZ A;  2NCP A;  2LVK A;  2KOT A;  5HLV A;  3GK2 A;  2TN4 A;  1QIW A;  1CB1 A;  3VRQ A;  2LUX A;  3FWB A;  1ZMZ A;  3CZT X;  2K7B A;  1DJH A;  3RLZ A;  1ZUZ A;  4YRU A;  3KF9 A;  3KEV A;  1LIN A;  3TS5 C;  1L2O B;  4I5N B;  3I5G B;  5KSZ A;  1KSM A;  1XFY O;  3BXK A;  1UHI A;  2LHI A;  4XYN A;  1CFD A;  2KDH A;  4USL A;  5AAN A;  1YUS A;  3EKH A;  4DRW A;  3A4U B;  3EVR A;  1G33 A;  4MRY A;  4PE1 A;  5IBW A;  1IH0 A;  5CSJ A;  1KQM B;  5B8I B;  3DVE A;  4CPV A;  3VRP A;  1L2O C;  3EVU A;  3O6B A;  4WQ2 A;  3VGO A;  3I5G C;  2M97 A;  3CLN A;  1ODB A;  1SCV A;  3PN7 C;  3LK0 A;  2M0R A;  1CDM A;  3CR5 X;  1PSB A;  1DVI A;  1F4Q A;  1S3P A;  4YGD B;  2ISD A;  4NDD A;  3AAK A;  4OV2 A;  1IRJ A;  2COL B;  2K7D A;  2VRG A;  1BOC A;  2K7O A;  4CFQ A;  1S36 A;  1KQM C;  4M2Q A;  1SW8 A;  5TNC A;  1LA3 A;  2KNE A;  2JC2 A;  1S6I A;  2E6W A;  2KI4 C;  1JF2 A;  1WDC B;  2B1U A;  2NLN A;  1SPY A;  1M31 A;  2ZN9 A;  4WQ3 A;  1DTL A;  1FW4 A;  1NPQ A;  1OMR A;  2NXQ A;  2DOQ A;  1UUR A;  3SG7 A;  1N65 A;  4ORC B;  5JOL A;  3WHU B;  1DMO A;  3A8R A;  1QTX A;  1DT7 B;  1YR5 A;  4UPG A;  1CTR A;  1ALV A;  3HCM A;  3M0W A;  1TTX A;  1CFP A;  2L51 A;  1L7Z A;  2WCF A;  3NXA A;  1IKU A;  1CDP A;  2KYF A;  2HQW A;  4AOM A;  1KK7 Y;  5PAL A;  2WCE A;  3C1V A;  3PFV A;  3TS5 B;  3VRO A;  2LP2 A;  2PSR A;  3EK7 A;  3BQ3 A;  4GFT A;  1WRL A;  5I2Q A;  1K2H A;  2H2K A;  1BT6 A;  1KFX L;  2JPT A;  2D8N A;  2LMU A;  4IL1 A;  1B47 A;  4U8D A;  3OB1 B;  1W7I B;  5CSN A;  1CDL A;  5ER4 X;  1UP5 A;  4DUQ A;  3ZWH A;  4AQJ A;  1IJ6 A;  2KGB C;  1F71 A;  1TN4 A;  1XK4 C;  3PN7 B;  1AJ4 A;  2I2R E;  1SR6 C;  2JTT A;  2KGR A;  1EJ3 A;  1TRF A;  3TUY B;  1EG3 A;  1QX2 A;  4JQ0 D;  2KI6 C;  3O4Y A;  4C0J A;  2MBX A;  4E68 A;  1DGV A;  2F3Y A;  2ZND A;  3KO0 A;  1LVC D;  1SL8 A;  3LL8 B;  2KI4 B;  4ORB B;  2WND A;  1XFV O;  4DCK A;  2BKH B;  5K89 A;  3TUY C;  1CKK A;  1IWQ A;  1HQV A;  1XK4 A;  5KTY A;  2KAY A;  3I5F C;  1DJI A;  4MZJ A;  3EKJ A;  1MXE A;  1A03 A;  5KU1 A;  1Q80 A;  3JVT B;  3NSK A;  4ZCU A;  2HPS A;  3DVJ A;  1R2U A;  4OR9 B;  3E3R A;  1RK9 A;  4MRX A;  1DJZ A;  2IS9 A;  1TNP A;  2JNF A;  3RM1 A;  2F2O A;  4I5J A;  3ICB A;  2GGZ A;  3IQQ A;  2ZRS A;  1YVH A;  3GOF A;  2ZRT A;  2KQY A;  1MF8 B;  2M1K B;  3JVT C;  5HKY A;  2JUL A;  5JJG A;  2LUC A;  3TDZ A;  1IJ5 A;  1SCM B;  1WRK A;  4M2O A;  1QLK A;  3BUM B;  3D0Y A;  1UHN A;  2BEC A;  2LP3 A;  2M7L A;  4DS7 A;  4HRE E;  1CM1 A;  2WC8 A;  1KK8 B;  1YUT A;  3HX4 A;  2K0J A;  1AK8 A;  1QLS A;  2CBL A;  1EXR A;  3SIB A;  5F6T A;  1SR6 B;  4BY4 A;  2LHL A;  3SJS A;  2KFH A;  1W7J B;  3NSO A;  2BCA A;  1V1G A;  1YUR A;  4YGC B;  1JBA A;  1KK8 C;  5BPJ A;  2CNP A;  2JT0 A;  2LLU A;  1F70 A;  1QIV A;  2LVI A;  4PE0 A;  4QJ4 B;  2PMY A;  4CFR A;  2E30 A;  2F8P A;  5HKW A;  4YGA A;  1SL9 A;  2ZFD A;  3I5H B;  1EL4 A;  2KFG A;  1K94 A;  1NCX A;  4GPL B;  1QV1 A;  1NX3 A;  4PE4 A;  1JFJ A;  1GGZ A;  1CLM A;  3IQO A;  4GUK A;  2L5X B;  2MJW B;  3I5F B;  3DVM A;  4MSP A;  1A29 A;  1QAT A;  2JNX A;  2LVJ A;  2G2B A;  4NDC A;  3WXA A;  2BE6 A;  1BG1 A;  1G8I A;  4PHJ A;  1KSO A;  1QVI Z;  3CS1 A;  4MEW A;  5HYD A;  1DGU A;  1Y6W A;  1JSA A;  2LLT A;  2OTG C;  2PRU A;  1NSH A;  1KFX S;  1AUI B;  1NYA A;  2EHB A;  3D10 A;  5HKZ A;  2JXL A;  1J7Q A;  2CT9 A;  1UWO A;  2PAL A;  5GQQ C;  4PCW A;  1B7T Y;  1K9U A;  4OVN F;  1RRO A;  4MZL A;  3SG2 A;  4WRI A;  1FBV A;  1YVL A;  2I7A A;  1SCM C;  1F54 A;  2K2A A;  1MQ1 A;  3PAL A;  1S1E A;  3TDI A;  1CLL A;  2JT3 A;  3GK4 X;  1FF1 A;  2LC5 A;  1OE9 B;  3CTN A;  4QJ3 B;  1ZOT B;  4C0L A;  1BF5 A;  1B8C A;  3PAT A;  1CM4 A;  3DF0 B;  5D69 A;  5DKQ A;  1FPW A;  2M3W A;  1MUX A;  3EK8 A;  2MLF C;  1XA5 A;  2MRD A;  3TZ1 A;  2F3Z A;  3F45 A;  2JRF A;  2O5G A;  1JUO A;  1OZS A;  2NCO A;  2R2I A;  2QAC A;  1B7T Z;  1RJV A;  2LLS A;  1EH2 A;  3I5H C;  1NX0 A;  4M2P A;  1H8B A;  1AHR A;  2I18 A;  1IQ3 A;  5CSI A;  1PVB A;  4F0Z B;  1SRA A;  1QV0 A;  3SG5 A;  1K93 D;  5AFP A;  1PVA A;  3K21 A;  4P2Y B;  3FWC A;  1A75 B;  2HF5 A;  3JTD C;  2M8U A;  1KWO C;  1QAS A;  1Y1A A;  2JXC A;  2M29 A;  2Y5I A;  1S26 D;  1DF0 B;  1TNX A;  3VRN A;  3EVV A;  1SY9 A;  2LAP A;  2L4H A;  3IF7 A;  3OX6 A;  4MN0 A;  1SBJ A;  2OPO A;  2V53 A;  1H4B A;  1QXP A;  1YRT B;  4JWQ A;  2OTG B;  1J55 A;  1YRU B;  1BMO A;  2F2P A;  1MWN A;  2KBI A;  2RGI A;  1V1F A;  1ZFS A;  1KWO B;  4I5K A;  5I2L A;  1K90 D;  2PAS A;  2BE4 A;  1KK7 Z;  5FYX A;  1IGV A;  2FCE A;  4GNK B;  1CLB A;  2L0P A;  3BOW B;  2HET A;  5J3X A;  1GQM A;  2GGM A;  4YI9 A;  1NWD A;  3AAJ A;  1F8H A;  1PSR A;  3OHM B;  1AP4 A;  1K9P A;  1N0Y A;  2BBM A;  2JU0 A;  1C7W A;  4XJK B;  1JWD A;  1BLQ A;  2FCD A;  1A2X A;  1MXL C;  4BY5 A;  1CDN A;  4N1F A;  1A4P A;  2M1U A;  1IQ5 A;  2L50 A;  3BYA A;  1JC2 A;  4XJK A;  2LCP A;  1QS7 A;  5G08 A; 
#chains in the Genus database with same CATH topology
 1QJT A;  1RWY A;  1LKJ A;  2CXJ A;  2EGD A;  1B8L A;  2P71 A;  1XFX O;  2L2E A;  2H61 C;  4INX A;  1UUS A;  3SIA A;  4MVF A;  1XVJ A;  2KBM A;  1TCO B;  1LS8 A;  1J7P A;  3D78 A;  3SS3 A;  2SCP A;  4AQI A;  3IVT A;  3JTD B;  5I8N A;  1BJF A;  3LK1 A;  2JQ6 A;  4MLW A;  4NQG A;  1XFR A;  3RZS A;  1TIZ A;  3CWG A;  3NSL A;  2I94 A;  1QX7 A;  4OKH A;  1BU3 A;  2QEH A;  4ORA B;  4A4C A;  1RFJ A;  1B8R A;  1X02 A;  1DJW A;  1YTZ C;  2Q91 A;  2ZNE A;  4CID A;  2KYC A;  4ETO A;  2CTN A;  1YX8 A;  1ZAC A;  1JF0 A;  2KAX A;  2FJY A;  2L98 A;  3CAB A;  3OBV A;  4YGB B;  2JT8 A;  2WCM A;  3UO9 A;  3B88 A;  3PM2 A;  1U5I A;  1C3Y A;  2AAO A;  2H61 A;  3DVK A;  1TOP A;  1XO5 A;  1F55 A;  5D7F A;  1BOD A;  2ZN8 A;  4TNC A;  1TCF A;  1K95 A;  1OQP A;  1KCY A;  1E8A A;  2MAZ A;  3BFB A;  4PHM A;  3SG3 A;  1B4C A;  2K2F A;  4DIR A;  1M39 A;  2L4I A;  2QEB A;  1M46 A;  2GTE A;  1SL7 A;  1R6P A;  1UHJ A;  4N5X A;  1N2D A;  4OZD A;  2LV7 A;  3CDN A;  4GGF A;  4R1E A;  5HLO A;  3PM8 A;  2WCB A;  3SG4 A;  3D76 A;  2BKI B;  2KHN A;  1AJ5 A;  4QJ5 B;  1IIO A;  1DJG A;  3BUN B;  2M49 B;  3OX5 A;  1S6J A;  1U5I B;  2BBN A;  1UHK A;  1CFF A;  3LLE A;  3OB2 B;  1OOH A;  2BL0 B;  1CMG A;  1YUU A;  1NX2 A;  1QVI Y;  1KFU L;  3I5I C;  2G9B A;  1CNP A;  3EK4 A;  1T14 A;  2EC6 C;  2AMI A;  2LMT A;  1QX5 B;  2A4J A;  2JWW A;  1C3Z A;  2OS8 B;  3BOW A;  3FE6 A;  3L4L A;  3BUX B;  3QRX A;  2MA2 A;  4YI8 A;  5CSF A;  4C0K A;  4CLN A;  2Y1M A;  2KSP A;  2K8M B;  3CGA A;  4MBE A;  1NUB A;  2KAV A;  2BL0 C;  4FQO A;  1KFU S;  1SKT A;  4I5L B;  4YBH B;  2GV5 A;  1OSA A;  3I5I B;  2M9G A;  1G4Y R;  1Y1X A;  1RTP 1;  4GAO A;  3KPX A;  2JZI A;  2MLE C;  3PSR A;  3H4S E;  1DEK A;  2KLD A;  5AXI A;  1WRZ A;  2LMV A;  1K9K A;  5DIC A;  3UNW A;  1YX7 A;  3DXL A;  4L9M A;  1DJY A;  1NP8 A;  3OP0 A;  1A75 A;  2M7N A;  4PAL A;  1NIW A;  3TDU A;  4F7F A;  1K96 A;  1GJY A;  4ICB A;  4GBA A;  1P28 A;  2Y1N A;  2MHH A;  1ALW A;  1REC A;  2FOT A;  2LNK A;  2Q4U A;  4GGF C;  1WLZ A;  1MHO A;  2HQ8 A;  4ZCV A;  1S6C A;  2LAN A;  3BUO B;  4HRH A;  4JPZ B;  4Q04 A;  3DD4 A;  1C7V A;  1CMF A;  2JOJ A;  4PT1 A;  3K1E A;  2WCK A;  1VRK A;  3AKB A;  1S5G Y;  1K8U A;  4PHK A;  1XYD A;  1J1E A;  1DQE A;  3D0Y B;  1NX1 A;  5DKR A;  1BR1 B;  1LA0 A;  3DF0 A;  4GGN A;  3FIA A;  1UHH A;  2KI6 D;  3CR4 X;  5ER5 A;  3CZ1 A;  2QEO A;  2BNX A;  3PLF B;  1XFZ O;  1PUL A;  4FTG A;  2WOR A;  1F4O A;  2WOS A;  3LCP C;  1J7O A;  3NSI A;  1DJX A;  1B1G A;  2AUC A;  2K7C A;  2ZKM X;  1OZO A;  2LVV A;  2EC6 B;  3CR2 A;  1Y1U A;  2QEV A;  2OS8 C;  1M45 A;  1PK0 D;  1TNW A;  2CCM A;  3O78 A;  4MZK A;  5AEQ A;  1OMD A;  2NZ0 A;  1SK6 D;  1SMG A;  1C07 A;  1DF0 A;  2O60 A;  1MR8 A;  1OOJ A;  1FI5 A;  1D1O A;  3GK1 A;  2QDI A;  4INW A;  1Y0V H;  1S5G Z;  1XFW O;  1FI6 A;  4PE7 A;  2BCB A;  5AER A;  3AKA A;  1DEL A;  4HSZ A;  2LM5 A;  1HT9 A;  3VRR A;  4P5O E;  1XFU O;  3FS7 A;  3R1O A;  3BUW B;  3O2P A;  2KFF A;  1IG5 A;  1NCY A;  2PVB A;  1OMV A;  2KQ6 A;  2BCX A;  3DZT A;  2F33 A;  2FJU B;  2SAS A;  4HRG A;  1ORG A;  1SYM A;  3KHE A;  3B87 A;  4N1G A;  2L2C A;  4D1E A;  5CPV A;  3NGV A;  5DKN A;  1WLM A;  1GGW A;  1LXF C;  4A4B A;  2Y4Q A;  4PDZ A;  3WNX B;  1CFC A;  4PHN A;  3S0B A;  1PRW A;  3B7A A;  1NCZ A;  4YGE B;  1J7R A;  1AVS A;  1JFK A;  1PAL A;  1KQV A;  1TNQ A;  1BR4 B;  2JPO A;  2QPT A;  2P6B B;  1M63 B;  2K61 A;  3SS4 A;  1WDC C;  1J1D A;  4OCI A;  1EG4 A;  2L5Y A;  5I2O A;  3WHT B;  2ERB A;  2LE9 B;  3MSE B;  3ZNI A;  1WY9 A;  4NDB A;  1SNL A;  1B9A A;  2JTZ A;  2NCP A;  2LVK A;  2KOT A;  5HLV A;  3GK2 A;  2TN4 A;  1QIW A;  1CB1 A;  3VRQ A;  2LUX A;  2YGU A;  5I94 A;  3FWB A;  1ZMZ A;  3CZT X;  2K7B A;  1DJH A;  3RLZ A;  1ZUZ A;  1OW4 A;  3KF9 A;  3KEV A;  4YRU A;  1LIN A;  3TS5 C;  2P70 A;  1L2O B;  4I5N B;  3I5G B;  5KSZ A;  1KSM A;  1XFY O;  3BXK A;  1UHI A;  2LHI A;  4XYN A;  1CFD A;  2KDH A;  4USL A;  5AAN A;  2BAP A;  1YUS A;  3EKH A;  4DRW A;  3A4U B;  3EVR A;  1G33 A;  3N7H A;  3NHT A;  4MRY A;  4PE1 A;  5CSJ A;  2K60 A;  5IBW A;  1IH0 A;  1KQM B;  5B8I B;  3DVE A;  4CPV A;  3VRP A;  1L2O C;  3EVU A;  3O6B A;  4WQ2 A;  3VGO A;  3I5G C;  1OOI X;  2M97 A;  3CLN A;  1ODB A;  1SCV A;  3PN7 C;  3LK0 A;  2M0R A;  1CDM A;  3CR5 X;  1PSB A;  1DVI A;  1F4Q A;  1S3P A;  4YGD B;  3FE8 A;  4NDD A;  3AAK A;  2ISD A;  3BJH A;  4OV2 A;  3S0A A;  1IRJ A;  2COL B;  2K7D A;  3V2L A;  2VRG A;  1BOC A;  2K7O A;  5FI7 A;  4CFQ A;  1S36 A;  1KQM C;  4M2Q A;  1SW8 A;  5TNC A;  1LA3 A;  2KNE A;  2JC2 A;  1S6I A;  3L4A A;  2E6W A;  3QME A;  2KI4 C;  1JF2 A;  1WDC B;  2B1U A;  2NLN A;  1SPY A;  1M31 A;  2ZN9 A;  4WQ3 A;  1DTL A;  1FW4 A;  1NPQ A;  1OMR A;  2NXQ A;  2DOQ A;  1UUR A;  3SG7 A;  1N65 A;  4JD9 A;  4ORC B;  5JOL A;  2KLE A;  3WHU B;  1DMO A;  3A8R A;  1QTX A;  3CZ0 A;  1DT7 B;  1YR5 A;  4UPG A;  1CTR A;  1ALV A;  1SSE B;  3HCM A;  3M0W A;  1TTX A;  1CFP A;  2L51 A;  1L7Z A;  2WCF A;  3NXA A;  1IKU A;  1CDP A;  1TWO A;  2KYF A;  2HQW A;  4AOM A;  1KK7 Y;  5PAL A;  3OGN A;  2WCE A;  3C1V A;  3O4X A;  3PFV A;  1QWV A;  3TS5 B;  3D75 A;  3VRO A;  2LP2 A;  3EG5 B;  2PSR A;  3EK7 A;  3BQ3 A;  4GFT A;  3SG6 A;  1WRL A;  5I2Q A;  1K2H A;  2H2K A;  1BT6 A;  1KFX L;  2JPT A;  2D8N A;  2LMU A;  4IL1 A;  1B47 A;  4U8D A;  3OB1 B;  1W7I B;  5CSN A;  1CDL A;  3D74 A;  3R1V A;  5ER4 X;  1UP5 A;  4DUQ A;  3ZWH A;  4AQJ A;  1IJ6 A;  2KGB C;  1F71 A;  1TN4 A;  1XK4 C;  3PN7 B;  1AJ4 A;  3PJI A;  2I2R E;  1SR6 C;  2JTT A;  2KGR A;  1EJ3 A;  3BFA A;  1TRF A;  3TUY B;  1EG3 A;  1QX2 A;  4JQ0 D;  2KI6 C;  3O4Y A;  4C0J A;  2MBX A;  4E68 A;  1DGV A;  1OOF A;  2F3Y A;  2ZND A;  3KO0 A;  1LVC D;  1SL8 A;  3LL8 B;  2KI4 B;  4ORB B;  2PQL A;  1XFV O;  2WND A;  2BKH B;  4DCK A;  5K89 A;  3TUY C;  3SS5 A;  3S0F A;  1CKK A;  1IWQ A;  1HQV A;  1W9Z A;  1XK4 A;  5KTY A;  2KAY A;  3I5F C;  1DJI A;  4MZJ A;  2WCH A;  3EKJ A;  3CYZ A;  1MXE A;  1A03 A;  5KU1 A;  1Q80 A;  3JVT B;  3NSK A;  3B6X A;  4ZCU A;  2HPS A;  2WCL A;  3DVJ A;  1R2U A;  4OR9 B;  3E3R A;  1RK9 A;  4MRX A;  5EL2 A;  1DJZ A;  2IS9 A;  1TNP A;  2JNF A;  3RM1 A;  2F2O A;  4I5J A;  3ICB A;  2GGZ A;  3IQQ A;  2ZRS A;  1YVH A;  3GOF A;  2ZRT A;  1Z4H A;  2KQY A;  1MF8 B;  2M1K B;  3JVT C;  5HKY A;  2JUL A;  5JJG A;  2LUC A;  2WC6 A;  3R72 A;  3TDZ A;  1GM0 A;  1IJ5 A;  1SCM B;  1WRK A;  2WCJ A;  4M2O A;  4IJ7 A;  4JKT A;  1QLK A;  3BUM B;  3D0Y A;  1UHN A;  2BEC A;  2LP3 A;  2M7L A;  4FQT A;  4HRE E;  4DS7 A;  1CM1 A;  3NHI A;  2WC8 A;  1KK8 B;  1YUT A;  3HX4 A;  2K0J A;  1AK8 A;  1QLS A;  2CBL A;  1EXR A;  3SIB A;  5F6T A;  1SR6 B;  4BY4 A;  2LHL A;  3SJS A;  2KFH A;  1W7J B;  3BFH A;  3D77 A;  3DYE A;  3NSO A;  2BCA A;  1V1G A;  1YUR A;  4YGC B;  1JBA A;  1KK8 C;  5BPJ A;  2CNP A;  2JT0 A;  2LLU A;  2WC5 A;  1QIV A;  2LVI A;  4PE0 A;  4QJ4 B;  2PMY A;  4CFR A;  2E30 A;  2F8P A;  5HKW A;  4YGA A;  1SL9 A;  2ZFD A;  3I5H B;  1EL4 A;  2KFG A;  1K94 A;  1NCX A;  4GPL B;  1QV1 A;  5D3O A;  1NX3 A;  4PE4 A;  1JFJ A;  1GGZ A;  1CLM A;  3IQO A;  4GUK A;  2L5X B;  2MJW B;  3Q8I A;  5FI6 A;  3I5F B;  3DVM A;  4MSP A;  1A29 A;  1QAT A;  2JNX A;  2KPH A;  2G2B A;  2LVJ A;  4NDC A;  3WXA A;  2BE6 A;  1BG1 A;  1G8I A;  4PHJ A;  1Z2C B;  1KSO A;  1QVI Z;  3CS1 A;  3VB1 A;  4MEW A;  5HYD A;  1DGU A;  1Y6W A;  1JSA A;  2LLT A;  2OTG C;  2PRU A;  1NSH A;  1KFX S;  1AUI B;  1NYA A;  2EHB A;  3D10 A;  5HKZ A;  2JXL A;  1J7Q A;  2CT9 A;  1UWO A;  2PAL A;  5GQQ C;  1F70 A;  4PCW A;  1B7T Y;  5HL1 A;  2H8V A;  1K9U A;  4OVN F;  1RRO A;  4MZL A;  3SG2 A;  3L47 A;  4WRI A;  1FBV A;  1TUZ A;  1YVL A;  2I7A A;  1SCM C;  1F54 A;  2K2A A;  1MQ1 A;  3PAL A;  1S1E A;  3TDI A;  1CLL A;  2JT3 A;  3GK4 X;  1FF1 A;  2LC5 A;  1OE9 B;  3CTN A;  3S0D A;  4QJ3 B;  1ZOT B;  4C0L A;  1BF5 A;  1B8C A;  3PAT A;  1CM4 A;  5FI2 A;  3DF0 B;  5D69 A;  1TUJ A;  5DKQ A;  1FPW A;  2M3W A;  1MUX A;  3EK8 A;  2MLF C;  1XA5 A;  2MRD A;  3TZ1 A;  2F3Z A;  3F45 A;  3FE9 A;  2PYQ A;  2JRF A;  2O5G A;  1JUO A;  1OZS A;  2NCO A;  2R2I A;  2QAC A;  1B7T Z;  1RJV A;  2LLS A;  1EH2 A;  3I5H C;  1NX0 A;  4M2P A;  1H8B A;  1AHR A;  3B86 A;  2I18 A;  1IQ3 A;  5CSI A;  1PVB A;  4F0Z B;  1SRA A;  1QV0 A;  3SG5 A;  1K93 D;  5AFP A;  1PVA A;  3K21 A;  4P2Y B;  3FWC A;  1A75 B;  2HF5 A;  3JTD C;  2M8U A;  1KWO C;  1QAS A;  1Y1A A;  1DC1 A;  2JXC A;  2M29 A;  2Y5I A;  1S26 D;  1DF0 B;  1TNX A;  3VRN A;  3EVV A;  1SY9 A;  2LAP A;  2L4H A;  3IF7 A;  3OX6 A;  4MN0 A;  1SBJ A;  3S0E A;  2OPO A;  2V53 A;  4KYN A;  1H4B A;  1QXP A;  1YRT B;  4JWQ A;  2OTG B;  1J55 A;  1YRU B;  1BMO A;  2F2P A;  1MWN A;  2KBI A;  2RGI A;  3R1P A;  1V1F A;  1ZFS A;  1KWO B;  4I5K A;  5I2L A;  1K90 D;  2PAS A;  2BE4 A;  1KK7 Z;  5FYX A;  1IGV A;  2FCE A;  4GNK B;  1CLB A;  2L0P A;  3BOW B;  2HET A;  5J3X A;  1GQM A;  2GGM A;  4YI9 A;  1OOG A;  1NWD A;  3DY9 A;  3AAJ A;  3CZ2 A;  1F8H A;  1PSR A;  3D73 A;  3OHM B;  1AP4 A;  1K9P A;  1N0Y A;  2BBM A;  2JU0 A;  1C7W A;  4XJK B;  1JWD A;  1BLQ A;  2FCD A;  1A2X A;  1MXL C;  4BY5 A;  1CDN A;  4N1F A;  1A4P A;  2M1U A;  1IQ5 A;  2L50 A;  3BYA A;  1JC2 A;  4XJK A;  2LCP A;  3S0G A;  1QS7 A;  5G08 A; 
#chains in the Genus database with same CATH homology
 1QJT A;  1RWY A;  1LKJ A;  2CXJ A;  2EGD A;  1B8L A;  1XFX O;  2L2E A;  2H61 C;  1UUS A;  3SIA A;  4MVF A;  1XVJ A;  2KBM A;  1TCO B;  1J7P A;  2SCP A;  3JTD B;  5I8N A;  1BJF A;  3LK1 A;  2JQ6 A;  4MLW A;  4NQG A;  1TIZ A;  3CWG A;  3NSL A;  2I94 A;  1QX7 A;  4OKH A;  1BU3 A;  4ORA B;  4A4C A;  1RFJ A;  1B8R A;  1X02 A;  1DJW A;  1YTZ C;  2Q91 A;  2ZNE A;  4CID A;  2KYC A;  4ETO A;  2CTN A;  1YX8 A;  1ZAC A;  1JF0 A;  2KAX A;  2L98 A;  4YGB B;  2JT8 A;  1U5I A;  2AAO A;  2H61 A;  3DVK A;  1TOP A;  1XO5 A;  1F55 A;  5D7F A;  1BOD A;  2ZN8 A;  4TNC A;  1TCF A;  1K95 A;  1OQP A;  1KCY A;  1E8A A;  2MAZ A;  4PHM A;  3SG3 A;  1B4C A;  2K2F A;  4DIR A;  1M39 A;  2L4I A;  1M46 A;  1SL7 A;  1R6P A;  1UHJ A;  4N5X A;  1N2D A;  2LV7 A;  4GGF A;  4R1E A;  5HLO A;  3PM8 A;  2WCB A;  3SG4 A;  2BKI B;  2KHN A;  1AJ5 A;  4QJ5 B;  1DJG A;  3BUN B;  2M49 B;  3OX5 A;  1S6J A;  1U5I B;  2BBN A;  1UHK A;  1CFF A;  3LLE A;  3OB2 B;  2BL0 B;  1CMG A;  1YUU A;  1NX2 A;  1QVI Y;  1KFU L;  3I5I C;  2G9B A;  1CNP A;  3EK4 A;  2EC6 C;  2LMT A;  2AMI A;  1QX5 B;  2A4J A;  2JWW A;  2OS8 B;  3BOW A;  3BUX B;  3QRX A;  2MA2 A;  4YI8 A;  5CSF A;  4C0K A;  4CLN A;  2Y1M A;  2KSP A;  2K8M B;  3CGA A;  4MBE A;  1NUB A;  2KAV A;  2BL0 C;  4FQO A;  1KFU S;  1SKT A;  4I5L B;  4YBH B;  2GV5 A;  1OSA A;  3I5I B;  2M9G A;  1G4Y R;  1Y1X A;  1RTP 1;  4GAO A;  3KPX A;  2JZI A;  2MLE C;  3PSR A;  3H4S E;  5AXI A;  1WRZ A;  2LMV A;  1K9K A;  1YX7 A;  4L9M A;  1DJY A;  1NP8 A;  3OP0 A;  1A75 A;  2M7N A;  4PAL A;  1NIW A;  3TDU A;  1K96 A;  1GJY A;  4ICB A;  4GBA A;  2Y1N A;  2MHH A;  1ALW A;  1REC A;  2FOT A;  2LNK A;  2Q4U A;  4GGF C;  1WLZ A;  1MHO A;  2HQ8 A;  4ZCV A;  1S6C A;  2LAN A;  3BUO B;  4HRH A;  4JPZ B;  4Q04 A;  3DD4 A;  1C7V A;  1CMF A;  2JOJ A;  3AKB A;  1VRK A;  1S5G Y;  1K8U A;  4PHK A;  1XYD A;  1J1E A;  3D0Y B;  5DKR A;  1NX1 A;  1BR1 B;  1LA0 A;  3DF0 A;  4GGN A;  3FIA A;  1UHH A;  2KI6 D;  3CR4 X;  5ER5 A;  3PLF B;  4FTG A;  3SG6 A;  4AQI A;  1XFZ O;  1PUL A;  2WOR A;  1F4O A;  2WOS A;  3LCP C;  1J7O A;  3NSI A;  1DJX A;  1B1G A;  2AUC A;  2K7C A;  2ZKM X;  1OZO A;  2LVV A;  2EC6 B;  3CR2 A;  1Y1U A;  2OS8 C;  1M45 A;  1PK0 D;  1TNW A;  2CCM A;  3O78 A;  4MZK A;  5AEQ A;  1OMD A;  2NZ0 A;  1SK6 D;  1SMG A;  1C07 A;  1DF0 A;  2O60 A;  1MR8 A;  1OOJ A;  1FI5 A;  1D1O A;  3GK1 A;  1Y0V H;  1S5G Z;  1XFW O;  1FI6 A;  4PE7 A;  2BCB A;  5AER A;  3AKA A;  4HSZ A;  2LM5 A;  1HT9 A;  3VRR A;  4P5O E;  1XFU O;  3FS7 A;  3BUW B;  3O2P A;  2KFF A;  1IG5 A;  1NCY A;  2PVB A;  1OMV A;  2KQ6 A;  2BCX A;  2F33 A;  2FJU B;  2SAS A;  4HRG A;  4N1G A;  1SYM A;  3KHE A;  4D1E A;  5CPV A;  5DKN A;  1WLM A;  1GGW A;  1LXF C;  4A4B A;  2Y4Q A;  4PDZ A;  3WNX B;  1CFC A;  4PHN A;  1PRW A;  4YGE B;  1NCZ A;  1J7R A;  1AVS A;  1JFK A;  1PAL A;  1KQV A;  1TNQ A;  1BR4 B;  2QPT A;  2P6B B;  1M63 B;  2K61 A;  1WDC C;  1J1D A;  4OCI A;  1EG4 A;  5I2O A;  3WHT B;  2LE9 B;  3MSE B;  3ZNI A;  1WY9 A;  4NDB A;  1SNL A;  1B9A A;  2JTZ A;  2NCP A;  2LVK A;  2KOT A;  5HLV A;  3GK2 A;  2TN4 A;  1QIW A;  1CB1 A;  3VRQ A;  2LUX A;  3FWB A;  1ZMZ A;  3CZT X;  2K7B A;  1DJH A;  3RLZ A;  1ZUZ A;  4YRU A;  3KF9 A;  3KEV A;  1LIN A;  3TS5 C;  1L2O B;  4I5N B;  3I5G B;  5KSZ A;  1KSM A;  1XFY O;  3BXK A;  1UHI A;  2LHI A;  4XYN A;  1CFD A;  2KDH A;  4USL A;  5AAN A;  1YUS A;  3EKH A;  4DRW A;  3A4U B;  3EVR A;  1G33 A;  4MRY A;  4PE1 A;  5IBW A;  1IH0 A;  5CSJ A;  1KQM B;  5B8I B;  3DVE A;  4CPV A;  3VRP A;  1L2O C;  3EVU A;  3O6B A;  4WQ2 A;  3VGO A;  3I5G C;  2M97 A;  3CLN A;  1ODB A;  1SCV A;  3PN7 C;  3LK0 A;  2M0R A;  1CDM A;  3CR5 X;  1PSB A;  1DVI A;  1F4Q A;  1S3P A;  4YGD B;  2ISD A;  4NDD A;  3AAK A;  4OV2 A;  1IRJ A;  2COL B;  2K7D A;  2VRG A;  1BOC A;  2K7O A;  4CFQ A;  1S36 A;  1KQM C;  4M2Q A;  1SW8 A;  5TNC A;  1LA3 A;  2KNE A;  2JC2 A;  1S6I A;  2E6W A;  2KI4 C;  1JF2 A;  1WDC B;  2B1U A;  2NLN A;  1SPY A;  1M31 A;  2ZN9 A;  4WQ3 A;  1DTL A;  1FW4 A;  1NPQ A;  1OMR A;  2NXQ A;  2DOQ A;  1UUR A;  3SG7 A;  1N65 A;  4ORC B;  5JOL A;  3WHU B;  1DMO A;  3A8R A;  1QTX A;  1DT7 B;  1YR5 A;  4UPG A;  1CTR A;  1ALV A;  3HCM A;  3M0W A;  1TTX A;  1CFP A;  2L51 A;  1L7Z A;  2WCF A;  3NXA A;  1IKU A;  1CDP A;  2KYF A;  2HQW A;  4AOM A;  1KK7 Y;  5PAL A;  2WCE A;  3C1V A;  3PFV A;  3TS5 B;  3VRO A;  2LP2 A;  2PSR A;  3EK7 A;  3BQ3 A;  4GFT A;  1WRL A;  5I2Q A;  1K2H A;  2H2K A;  1BT6 A;  1KFX L;  2JPT A;  2D8N A;  2LMU A;  4IL1 A;  1B47 A;  4U8D A;  3OB1 B;  1W7I B;  5CSN A;  1CDL A;  5ER4 X;  1UP5 A;  4DUQ A;  3ZWH A;  4AQJ A;  1IJ6 A;  2KGB C;  1F71 A;  1TN4 A;  1XK4 C;  3PN7 B;  1AJ4 A;  2I2R E;  1SR6 C;  2JTT A;  2KGR A;  1EJ3 A;  1TRF A;  3TUY B;  1EG3 A;  1QX2 A;  4JQ0 D;  2KI6 C;  3O4Y A;  4C0J A;  2MBX A;  4E68 A;  1DGV A;  2F3Y A;  2ZND A;  3KO0 A;  1LVC D;  1SL8 A;  3LL8 B;  2KI4 B;  4ORB B;  2WND A;  1XFV O;  4DCK A;  2BKH B;  5K89 A;  3TUY C;  1CKK A;  1IWQ A;  1HQV A;  1XK4 A;  5KTY A;  2KAY A;  3I5F C;  1DJI A;  4MZJ A;  3EKJ A;  1MXE A;  1A03 A;  5KU1 A;  1Q80 A;  3JVT B;  3NSK A;  4ZCU A;  2HPS A;  3DVJ A;  1R2U A;  4OR9 B;  3E3R A;  1RK9 A;  4MRX A;  1DJZ A;  2IS9 A;  1TNP A;  2JNF A;  3RM1 A;  2F2O A;  4I5J A;  3ICB A;  2GGZ A;  3IQQ A;  2ZRS A;  1YVH A;  3GOF A;  2ZRT A;  2KQY A;  1MF8 B;  2M1K B;  3JVT C;  5HKY A;  2JUL A;  5JJG A;  2LUC A;  3TDZ A;  1IJ5 A;  1SCM B;  1WRK A;  4M2O A;  1QLK A;  3BUM B;  3D0Y A;  1UHN A;  2BEC A;  2LP3 A;  2M7L A;  4DS7 A;  4HRE E;  1CM1 A;  2WC8 A;  1KK8 B;  1YUT A;  3HX4 A;  2K0J A;  1AK8 A;  1QLS A;  2CBL A;  1EXR A;  3SIB A;  5F6T A;  1SR6 B;  4BY4 A;  2LHL A;  3SJS A;  2KFH A;  1W7J B;  3NSO A;  2BCA A;  1V1G A;  1YUR A;  4YGC B;  1JBA A;  1KK8 C;  5BPJ A;  2CNP A;  2JT0 A;  2LLU A;  1F70 A;  1QIV A;  2LVI A;  4PE0 A;  4QJ4 B;  2PMY A;  4CFR A;  2E30 A;  2F8P A;  5HKW A;  4YGA A;  1SL9 A;  2ZFD A;  3I5H B;  1EL4 A;  2KFG A;  1K94 A;  1NCX A;  4GPL B;  1QV1 A;  1NX3 A;  4PE4 A;  1JFJ A;  1GGZ A;  1CLM A;  3IQO A;  4GUK A;  2L5X B;  2MJW B;  3I5F B;  3DVM A;  4MSP A;  1A29 A;  1QAT A;  2JNX A;  2LVJ A;  2G2B A;  4NDC A;  3WXA A;  2BE6 A;  1BG1 A;  1G8I A;  4PHJ A;  1KSO A;  1QVI Z;  3CS1 A;  4MEW A;  5HYD A;  1DGU A;  1Y6W A;  1JSA A;  2LLT A;  2OTG C;  2PRU A;  1NSH A;  1KFX S;  1AUI B;  1NYA A;  2EHB A;  3D10 A;  5HKZ A;  2JXL A;  1J7Q A;  2CT9 A;  1UWO A;  2PAL A;  5GQQ C;  4PCW A;  1B7T Y;  1K9U A;  4OVN F;  1RRO A;  4MZL A;  3SG2 A;  4WRI A;  1FBV A;  1YVL A;  2I7A A;  1SCM C;  1F54 A;  2K2A A;  1MQ1 A;  3PAL A;  1S1E A;  3TDI A;  1CLL A;  2JT3 A;  3GK4 X;  1FF1 A;  2LC5 A;  1OE9 B;  3CTN A;  4QJ3 B;  1ZOT B;  4C0L A;  1BF5 A;  1B8C A;  3PAT A;  1CM4 A;  3DF0 B;  5D69 A;  5DKQ A;  1FPW A;  2M3W A;  1MUX A;  3EK8 A;  2MLF C;  1XA5 A;  2MRD A;  3TZ1 A;  2F3Z A;  3F45 A;  2JRF A;  2O5G A;  1JUO A;  1OZS A;  2NCO A;  2R2I A;  2QAC A;  1B7T Z;  1RJV A;  2LLS A;  1EH2 A;  3I5H C;  1NX0 A;  4M2P A;  1H8B A;  1AHR A;  2I18 A;  1IQ3 A;  5CSI A;  1PVB A;  4F0Z B;  1SRA A;  1QV0 A;  3SG5 A;  1K93 D;  5AFP A;  1PVA A;  3K21 A;  4P2Y B;  3FWC A;  1A75 B;  2HF5 A;  3JTD C;  2M8U A;  1KWO C;  1QAS A;  1Y1A A;  2JXC A;  2M29 A;  2Y5I A;  1S26 D;  1DF0 B;  1TNX A;  3VRN A;  3EVV A;  1SY9 A;  2LAP A;  2L4H A;  3IF7 A;  3OX6 A;  4MN0 A;  1SBJ A;  2OPO A;  2V53 A;  1H4B A;  1QXP A;  1YRT B;  4JWQ A;  2OTG B;  1J55 A;  1YRU B;  1BMO A;  2F2P A;  1MWN A;  2KBI A;  2RGI A;  1V1F A;  1ZFS A;  1KWO B;  4I5K A;  5I2L A;  1K90 D;  2PAS A;  2BE4 A;  1KK7 Z;  5FYX A;  1IGV A;  2FCE A;  4GNK B;  1CLB A;  2L0P A;  3BOW B;  2HET A;  5J3X A;  1GQM A;  2GGM A;  4YI9 A;  1NWD A;  3AAJ A;  1F8H A;  1PSR A;  3OHM B;  1AP4 A;  1K9P A;  1N0Y A;  2BBM A;  2JU0 A;  1C7W A;  4XJK B;  1JWD A;  1BLQ A;  2FCD A;  1A2X A;  1MXL C;  4BY5 A;  1CDN A;  4N1F A;  1A4P A;  2M1U A;  1IQ5 A;  2L50 A;  3BYA A;  1JC2 A;  4XJK A;  2LCP A;  1QS7 A;  5G08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...