1KWOB

Scallop myosin s1-atpgammas-p-pdm in the actin-detached conformation
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
142
structure length
142
Chain Sequence
PQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKGSGEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYOSIN HEAVY CHAIN
publication title Crystallographic findings on the internally uncoupled and near-rigor states of myosin: Further insights into the mechanics of the motor
pubmed doi rcsb
molecule tags Contractile protein
total genus 26
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2002-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kwoB01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kwoB02
1A03A 1XFZO 2LM5A 3CTNA 2ZNEA 4I5NB 1KQMB 1IG5A 1CFDA 1W7IB 1QVIZ 3TS5C 2BCAA 1AVSA 2KBIA 3LCPC 1KK7Z 5DKNA 2JQ6A 2PALA 5J3XA 1WRZA 4DS7A 2JT8A 3LK0A 1KFUS 5AXIA 1FBVA 3MSEB 1DJHA 2M1UA 4YGEB 1TRFA 1G33A 2LLUA 1L7ZA 2B1UA 1L2OC 3EKJA 1DF0B 3BUOB 4OV2A 3CLNA 2M1KB 1QV0A 1QX7A 4CIDA 1AUIB 1F55A 4M2OA 4YI9A 1BF5A 2PMYA 1C7WA 2K7OA 3E3RA 2L51A 1J7OA 4CFRA 1A2XA 1XK4C 1F70A 1QIWA 5HKYA 1IKUA 2KDHA 2OPOA 4C0KA 1QX5B 1EG4A 2GGMA 2JOJA 1CMGA 2KI4C 1WRLA 5D7FA 2KFFA 4PE4A 1Y6WA 1ZUZA 2O60A 3EK8A 3OP0A 1JUOA 1B1GA 2M7NA 2KAYA 1YVHA 1B7TZ 1EXRA 2L50A 2D8NA 5CSJA 2LE9B 3LL8B 3HCMA 4YBHB 1NCXA 5CSFA 3CR5X 5CSNA 1HQVA 3FWBA 1JFJA 2PSRA 2Y1NA 4JQ0D 5I2LA 2KSPA 2KBMA 3FS7A 1CM4A 4D1EA 2HPSA 1RK9A 2NCOA 4BY4A 4PHJA 1MF8B 1H4BA 2P6BB 4GBAA 3NSOA 3IQQA 1B8LA 1X02A 2K7DA 4YGBB 2LNKA 3EVVA 5I2QA 1CDNA 1AJ4A 3I5IB 5ER5A 2BL0C 1NX2A 3CGAA 2K2FA 1J7RA 1B9AA 2MA2A 2Q91A 1DJZA 4YGCB 4OKHA 3TDIA 1QTXA 2EC6C 1BLQA 1S5GZ 2JXCA 2KYCA 2LHLA 1C7VA 3BQ3A 3F45A 1D1OA 4OCIA 2MJWB 3TUYC 1B8CA 1GGZA 4NDBA 3DF0B 2JTTA 4CFQA 1SL7A 2PRUA 1DTLA 2KAVA 2NCPA 2F3ZA 1UURA 2M49B 1LKJA 3D0YB 3GK2A 3PFVA 3O2PA 1F4QA 2O5GA 4PCWA 1RJVA 4C0JA 3KEVA 1SPYA 4GGFC 1XK4A 1PSRA 5IBWA 2EHBA 1N65A 1SR6C 2K61A 1IJ6A 1OZOA 2Y4QA 2CNPA 4MZJA 1BT6A 2I7AA 4ORBB 4N5XA 1OZSA 1IGVA 4OR9B 4I5KA 1WLMA 1J1EA 1S36A 4A4CA 1GQMA 3ZNIA 1FI5A 1DVIA 3GK1A 2M8UA 2V53A 4MZKA 1QLSA 1S6JA 3PN7C 1TN4A 2I2RE 1HT9A 1NX0A 2JWWA 2NXQA 3OHMB 3IF7A 1SNLA 4A4BA 4WRIA 1MWNA 2ISDA 1K90D 1TNPA 2LVKA 2WORA 1WDCC 1RROA 1WY9A 2I94A 3I5GC 1CFPA 1CLMA 1J7QA 2OTGB 1IRJA 4PHKA 2F3YA 1ALVA 2ZRSA 5F6TA 1IQ5A 1EG3A 4IL1A 1B4CA 1J55A 4PE0A 1SKTA 2L0PA 3TDZA 5DKQA 3RM1A 1A29A 4YGAA 4AQJA 2KAXA 3TDUA 4AOMA 1SCMC 4PHNA 1F8HA 4XYNA 1YUSA 2K8MB 1ALWA 1CDLA 2DOQA 3PATA 1CDPA 4PDZA 1KFXL 1YVLA 4WQ2A 4GNKB 1Y1UA 2MLFC 1OE9B 2A4JA 2LVJA 4YGDB 4MEWA 1RFJA 1PSBA 2LMTA 3BYAA 3TS5B 3BXKA 1AP4A 1YURA 1SL8A 3BUMB 1OOJA 1TIZA 1CKKA 1S3PA 2KGBC 3CWGA 1RECA 1SCVA 5AANA 1KQVA 2BE4A 3SG7A 2L2EA 3EVRA 4UPGA 3LLEA 1L2OB 1RTP1 1F71A 1DJWA 3PM8A 4GGFA 1ZACA 2E30A 3BOWB 1M31A 1AJ5A 3PLFB 2LUXA 3FIAA 2BECA 1SY9A 2JRFA 1A75A 3PALA 1JBAA 1LA3A 1XFVO 2KNEA 4DUQA 2RGIA 2VRGA 4MZLA 2KI4B 2F33A 2LP2A 1G8IA 2K0JA 5AERA 1QX2A 2F2PA 2KI6C 4DIRA 2E6WA 2BKIB 1XFUO 4FTGA 4NQGA 1CTRA 1Y1AA 1YUTA 2HETA 2WOSA 2FOTA 4ICBA 1PVBA 3GOFA 4DCKA 2LVIA 2MLEC 3A8RA 2JNXA 2NLNA 5CPVA 1PRWA 1CLLA 5KU1A 4NDCA 1EH2A 1DT7B 3BUWB 1M45A 1MXEA 4N1GA 1S26D 4P5OE 2ZN8A 3H4SE 4USLA 1BJFA 1QJTA 2H2KA 2CT9A 3EK4A 4MBEA 4R1EA 2FCDA 2LMUA 2M97A 3EKHA 3SG5A 2JPTA 2LHIA 2BL0B 3JVTC 3EK7A 4PHMA 3JTDB 4E68A 1ZOTB 3SG3A 2HQ8A 3VROA 1U5IA 2EC6B 2LANA 2MAZA 1MXLC 5BPJA 2ZRTA 2L98A 1CFCA 4XJKB 1E8AA 3CS1A 1KWOC 3TUYB 4CPVA 1GJYA 1QXPA 2LLTA 3VRPA 2KI6D 1QS7A 2MHHA 4PALA 5FYXA 1EJ3A 1TNXA 2Y1MA 3NSLA 1ZMZA 1KCYA 1K8UA 2EGDA 2K2AA 2LV7A 3BUXB 2HF5A 4ORAB 1RWYA 1BR1B 5ER4X 5I8NA 2PVBA 4NDDA 5KSZA 1UP5A 1SR6B 2CXJA 4PE7A 4TNCA 3SIAA 2SCPA 4Q04A 1ODBA 5HKZA 1IJ5A 1SK6D 4C0LA 3WHTB 1PVAA 4GGNA 3KO0A 1GGWA 3O6BA 2KHNA 2M7LA 2AUCA 4N1FA 3EVUA 4I5LB 4MRXA 3PN7B 3ICBA 3CR4X 3VRQA 3PSRA 1NX1A 1J1DA 4QJ4B 2I18A 3DD4A 1FF1A 2PASA 1TCFA 2KGRA 3I5HC 2QPTA 1R2UA 3ZWHA 1WLZA 1IQ3A 1WDCB 1K96A 3I5GB 2OS8C 1DF0A 2ZNDA 3OB1B 4ETOA 1M39A 1CLBA 4CLNA 1KK8C 1YRUB 2QACA 1B8RA 3HX4A 1SBJA 2JXLA 2LMVA 4ORCB 2Q4UA 5JJGA 1SCMB 4MVFA 1JWDA 2KYFA 2BCBA 1IWQA 4GUKA 2BE6A 5G08A 3SJSA 5HLOA 2JZIA 3SG2A 2AMIA 2KFGA 5K89A 1JSAA 3CR2A 2JU0A 3I5FC 1KSMA 1FW4A 2CBLA 1MR8A 1A4PA 1VRKA 1KFUL 2MBXA 1DGVA 1YRTB 1JF0A 1YTZC 4DRWA 5DKRA 1FPWA 5B8IB 4I5JA 1F4OA 3M0WA 1PK0D 1JFKA 1KSOA 1W7JB 1UHHA 4JWQA 1YUUA 1XO5A 5JOLA 1TTXA 3O78A 2ZKMX 2KOTA 1BU3A 1WRKA 2R2IA 2WCFA 1G4YR 2OTGC 4HSZA 2GGZA 1NP8A 5CSIA 2G9BA 1OSAA 1ZFSA 1DJXA 3D10A 1NX3A 2LP3A 4WQ3A 3SG6A 1UWOA 4MRYA 1MHOA 2CCMA 1AHRA 1NCZA 1M46A 1Q80A 1EL4A 1MUXA 3AKBA 2BBMA 3VGOA 2LAPA 2TN4A 4U8DA 2M0RA 2F8PA 3O4YA 1Y1XA 2LC5A 1TNQA 4FQOA 4QJ5B 3SIBA 2WCBA 1N0YA 2KQ6A 1KQMC 1NSHA 3C1VA 4ZCVA 3DF0A 1J7PA 1SW8A 1KFXS 2LVVA 1JC2A 3OX6A 2JULA 4MSPA 2K7CA 1UHIA 3D0YA 4ZCUA 1S6CA 2M3WA 1OMVA 1V1FA 1DMOA 4OVNF 3AKAA 2JNFA 4BY5A 3A4UB 2AAOA 1LXFC 2JTZA 4QJ3B 3RLZA 3VRRA 5PALA 4HREE 1BODA 1NUBA 2CTNA 2NZ0A 3JVTB 2L4HA 2JC2A 1K94A 1SRAA 1UHKA 3FWCA 5HYDA 1DGUA 3NXAA 1CMFA 1KWOB 1C07A 1XA5A 2H61A 2GV5A 1NWDA 1CNPA 1S1EA 4MLWA 1NCYA 1NPQA 1H8BA 4GAOA 5TNCA 5I2OA 1DJIA 3QRXA 1LA0A 5AEQA 2K7BA 2M29A 1V1GA 5KTYA 1SL9A 1SYMA 3AAKA 1DJGA 1QATA 1QVIY 1XFWO 4YI8A 1BR4B 1B47A 1Y0VH 3VRNA 2LUCA 1TNWA 2L5XB 1KK7Y 2M9GA 1A75B 1TCOB 3LK1A 3JTDC 1AK8A 1TOPA 1YR5A 4MN0A 1K9KA 1K95A 3NSKA 1QASA 1BG1A 3I5IC 2LCPA 2SASA 5AFPA 2F2OA 3CZTX 4GPLB 1FI6A 1OQPA 1BMOA 2BKHB 3I5HB 3WHUB 1CB1A 2BCXA 1F54A 1XFXO 2JT3A 2OS8B 3K21A 3TZ1A 1KK8B 1QIVA 2WC8A 2HQWA 3KHEA 1JF2A 3BOWA 1IH0A 3SG4A 3AAJA 1NIWA 1QLKA 1UUSA 1K9PA 3BUNB 4PE1A 1LINA 3KPXA 2L4IA 3OX5A 1K2HA 2WNDA 4M2QA 1CDMA 1YX8A 1CM1A 1B7TY 1XYDA 2WCEA 1PULA 1XVJA 1PALA 3I5FB 1QV1A 1MQ1A 3IQOA 4GFTA 5HKWA 3OB2B 4AQIA 3DVEA 1S6IA 4YRUA 1YX7A 2G2BA 1LVCD 3KF9A 1U5IB 4F0ZB 1DJYA 1UHJA 1K9UA 2IS9A 4HRGA 2MRDA 1XFYO 1NYAA 2JT0A 2H61C 1OMDA 2Y5IA 3GK4X 4L9MA 1CFFA 1SMGA 5D69A 1UHNA 3NSIA 3DVKA 2FJUB 3DVJA 2KFHA 4M2PA 1K93D 1S5GY 3DVMA 4HRHA 1OMRA 2KQYA 2FCEA 5GQQC 1N2DA 2ZN9A 2BBNA 2LLSA 3WXAA 4P2YB 2COLB 1R6PA 4JPZB 5HLVA 3WNXB 1M63B 2ZFDA 4XJKA 1BOCA
chains in the Genus database with same CATH superfamily
1A03A 1XFZO 2LM5A 3CTNA 2ZNEA 4I5NB 1KQMB 1IG5A 1DC1A 1CFDA 1W7IB 1QVIZ 1IIOA 3TS5C 2BCAA 1AVSA 2KBIA 3LCPC 1KK7Z 5DKNA 2JQ6A 2PALA 5J3XA 1W9ZA 1WRZA 4DS7A 2JT8A 2KLDA 3LK0A 1KFUS 5AXIA 1FBVA 3MSEB 1DJHA 2K60A 2M1UA 1TRFA 1G33A 2LLUA 4YGEB 5FI2A 2L2CA 1L7ZA 2B1UA 1L2OC 3EKJA 1DF0B 3BUOB 4OV2A 3CLNA 2M1KB 1QV0A 1QX7A 3D74A 4CIDA 1AUIB 1F55A 4M2OA 4YI9A 1BF5A 1C3YA 2WCKA 2PMYA 1C7WA 2K7OA 3E3RA 2L51A 3L4LA 4CFRA 1J7OA 1A2XA 1XK4C 1F70A 1QIWA 5HKYA 1IKUA 2KDHA 2OPOA 4C0KA 3SS4A 1QX5B 1EG4A 1OOFA 2GGMA 2JOJA 1CMGA 2KI4C 1WRLA 5D7FA 2KFFA 1OW4A 4PE4A 1Y6WA 1ZUZA 2O60A 3EK8A 3OP0A 1JUOA 1B1GA 2M7NA 2KAYA 1YVHA 1B7TZ 1EXRA 2L50A 1Z2CB 2D8NA 3R1VA 5CSJA 2LE9B 3LL8B 3HCMA 4YBHB 1NCXA 5CSFA 3CR5X 5CSNA 1HQVA 3FWBA 1JFJA 2PSRA 2Y1NA 4JQ0D 5I2LA 2KSPA 2KBMA 3FS7A 1CM4A 5I94A 4D1EA 2HPSA 2L5YA 1RK9A 2NCOA 4BY4A 1DEKA 4PHJA 1MF8B 1H4BA 2JPOA 2P6BB 3N7HA 4GBAA 3NSOA 3IQQA 1B8LA 1X02A 2K7DA 4YGBB 2LNKA 3EVVA 5I2QA 1CDNA 1AJ4A 3D73A 3I5IB 3D78A 5ER5A 2BL0C 1NX2A 3CGAA 2K2FA 1J7RA 1B9AA 2MA2A 2Q91A 1DJZA 2FJYA 4YGCB 4OKHA 3TDIA 3CYZA 1QTXA 2EC6C 1BLQA 1S5GZ 2JXCA 2KYCA 2LHLA 1C7VA 3BQ3A 3F45A 1D1OA 4OCIA 3NHTA 2MJWB 3TUYC 1B8CA 1GGZA 4NDBA 3DF0B 2JTTA 4CFQA 1SL7A 2PRUA 1DTLA 2KAVA 2NCPA 2F3ZA 1UURA 2M49B 1LKJA 1QWVA 3D0YB 3GK2A 3PFVA 3O2PA 1F4QA 2O5GA 4FQTA 4PCWA 1RJVA 4C0JA 3KEVA 1SPYA 4GGFC 1XK4A 1PSRA 5IBWA 2EHBA 1N65A 1SR6C 2K61A 1IJ6A 1OZOA 2Y4QA 2CNPA 4MZJA 1BT6A 2I7AA 4ORBB 4N5XA 1OZSA 1IGVA 4OR9B 4I5KA 1WLMA 1J1EA 1S36A 4A4CA 1GQMA 3ZNIA 1FI5A 1DVIA 2WCMA 3GK1A 2M8UA 2V53A 2QEHA 4MZKA 1QLSA 1S6JA 3PN7C 2QEVA 1Z4HA 1TN4A 2I2RE 1HT9A 1NX0A 2BAPA 2JWWA 3UNWA 2NXQA 3OHMB 3IF7A 1SNLA 4A4BA 4WRIA 1MWNA 2ISDA 1K90D 1TNPA 3UO9A 2LVKA 2WORA 1WDCC 1RROA 1WY9A 2I94A 3I5GC 1CFPA 1CLMA 3FE9A 1J7QA 2OTGB 1IRJA 4PHKA 2F3YA 1ALVA 2ZRSA 5F6TA 1IQ5A 1EG3A 1TUZA 4IL1A 1B4CA 1J55A 4PE0A 1SKTA 2L0PA 3L47A 3TDZA 5DKQA 3RM1A 1A29A 4YGAA 4AQJA 2KAXA 3TDUA 4AOMA 2GTEA 3B87A 3CDNA 1SCMC 4PHNA 1F8HA 4XYNA 1YUSA 2K8MB 1ALWA 1CDLA 3BFHA 2DOQA 3PATA 1CDPA 4PDZA 3BFBA 1KFXL 1YVLA 4WQ2A 4GNKB 2WCLA 1Y1UA 2MLFC 1OE9B 2A4JA 2LVJA 4YGDB 4MEWA 1RFJA 1PSBA 2LMTA 3BYAA 3TS5B 3BXKA 3R1PA 3FE8A 1AP4A 4OZDA 1YURA 1SL8A 3BUMB 1OOJA 1TIZA 1CKKA 1S3PA 2KGBC 3CWGA 3CZ2A 1RECA 1SCVA 5AANA 1KQVA 2BE4A 3SG7A 2L2EA 3EVRA 4UPGA 3LLEA 1L2OB 1RTP1 1F71A 1DJWA 3PM8A 4GGFA 1ZACA 2E30A 3BOWB 1M31A 1AJ5A 3PLFB 2LUXA 3FIAA 2BECA 1SY9A 3B88A 2JRFA 1A75A 3PALA 1JBAA 1LA3A 1XFVO 2KNEA 4DUQA 5FI7A 2RGIA 4PT1A 2VRGA 4MZLA 1OOHA 2KI4B 2F33A 2LP2A 1G8IA 1C3ZA 2K0JA 5AERA 1QX2A 2F2PA 2KI6C 4DIRA 2E6WA 2BKIB 3S0EA 1XFUO 4FTGA 4NQGA 1CTRA 1Y1AA 1YUTA 2HETA 2WOSA 2FOTA 4ICBA 1PVBA 3GOFA 3S0BA 2LVIA 2MLEC 3A8RA 4DCKA 2JNXA 2NLNA 5CPVA 1PRWA 1CLLA 5KU1A 4NDCA 1EH2A 1DT7B 3BUWB 3S0AA 1M45A 3L4AA 1MXEA 4N1GA 1S26D 4P5OE 1SSEB 2ZN8A 3H4SE 4USLA 1BJFA 1QJTA 2H2KA 2CT9A 3EK4A 4MBEA 4R1EA 3S0DA 2FCDA 1ORGA 2LMUA 2M97A 3EKHA 3SG5A 2JPTA 2LHIA 2BL0B 3JVTC 3EK7A 4PHMA 3JTDB 4E68A 1ZOTB 2BNXA 3SG3A 2HQ8A 3B86A 1U5IA 2EC6B 2LANA 2MAZA 1MXLC 3VROA 2ZRTA 5BPJA 2L98A 1CFCA 4XJKB 1E8AA 3CS1A 1KWOC 3TUYB 4CPVA 1GJYA 1QXPA 2LLTA 3VRPA 2KI6D 2P71A 1QS7A 2MHHA 3K1EA 4PALA 5FYXA 1EJ3A 1TNXA 2Y1MA 3NSLA 1ZMZA 1KCYA 1K8UA 2EGDA 2K2AA 2LV7A 3BUXB 2HF5A 4ORAB 1RWYA 1BR1B 5ER4X 5HL1A 5I8NA 2PVBA 1LS8A 4NDDA 5KSZA 1UP5A 1SR6B 2CXJA 4PE7A 4TNCA 3SIAA 2SCPA 4Q04A 1ODBA 5HKZA 4F7FA 3DXLA 1IJ5A 1SK6D 4C0LA 2P70A 3WHTB 1PVAA 4GGNA 3KO0A 1GGWA 3O6BA 2KHNA 1DELA 2M7LA 2AUCA 4N1FA 3EVUA 4I5LB 4MRXA 3PN7B 3ICBA 3CR4X 3CABA 3VRQA 3PSRA 1NX1A 1J1DA 4QJ4B 2I18A 3DD4A 1FF1A 2PASA 1TCFA 2KGRA 2WC6A 3I5HC 2QPTA 1R2UA 3ZWHA 1WLZA 1IQ3A 1WDCB 1K96A 3I5GB 2OS8C 1DF0A 2ZNDA 3OB1B 4ETOA 1M39A 1TUJA 1CLBA 4CLNA 1KK8C 1YRUB 3B6XA 1DQEA 2QACA 2WC5A 1B8RA 3HX4A 2ERBA 1SBJA 3Q8IA 2JXLA 2LMVA 4ORCB 2Q4UA 3OBVA 1SCMB 4MVFA 5JJGA 1JWDA 2KYFA 2BCBA 1IWQA 4GUKA 2BE6A 5G08A 3SJSA 3V2LA 5HLOA 3SS3A 2JZIA 3SG2A 2AMIA 2KFGA 5K89A 1JSAA 3CR2A 2JU0A 3I5FC 1KSMA 1FW4A 2CBLA 1MR8A 3DYEA 1A4PA 1P28A 1VRKA 1KFUL 2WCJA 2MBXA 1DGVA 1YRTB 1JF0A 1YTZC 4DRWA 5DKRA 1FPWA 5B8IB 4I5JA 1F4OA 3M0WA 1PK0D 3PJIA 2QDIA 1JFKA 1KSOA 1W7JB 1UHHA 4JWQA 1YUUA 1XO5A 5JOLA 3BJHA 1TTXA 3O78A 2ZKMX 2KOTA 1BU3A 1WRKA 2R2IA 2WCFA 1G4YR 2OTGC 4HSZA 1XFRA 2GGZA 1NP8A 5CSIA 4INWA 2G9BA 1OSAA 1ZFSA 1DJXA 3D10A 1NX3A 3DY9A 2LP3A 4WQ3A 1T14A 3SG6A 1UWOA 4MRYA 1MHOA 1NCZA 1AHRA 2CCMA 1M46A 1Q80A 1EL4A 1MUXA 3AKBA 2BBMA 3CZ1A 3VGOA 2LAPA 2TN4A 4U8DA 2M0RA 2F8PA 3O4YA 1Y1XA 2LC5A 1TNQA 4JD9A 4FQOA 4QJ5B 3SIBA 2WCBA 1N0YA 2KQ6A 1KQMC 1NSHA 3C1VA 4ZCVA 3D75A 3DF0A 1J7PA 1SW8A 3S0GA 1KFXS 2LVVA 1JC2A 1OOGA 3EG5B 3OX6A 2KPHA 4KYNA 2JULA 4MSPA 2K7CA 1UHIA 3D0YA 3OGNA 4ZCUA 1GM0A 1S6CA 2M3WA 4JKTA 1OMVA 1V1FA 1DMOA 2H8VA 1OOIX 4OVNF 3AKAA 4INXA 2JNFA 4BY5A 3A4UB 2AAOA 1LXFC 2JTZA 4QJ3B 3RLZA 3VRRA 5PALA 4HREE 1BODA 1NUBA 2CTNA 2NZ0A 3R1OA 3JVTB 2L4HA 2JC2A 1K94A 1SRAA 1UHKA 3FWCA 5HYDA 1DGUA 3S0FA 3NXAA 2WCHA 1CMFA 1KWOB 5FI6A 1C07A 1XA5A 3R72A 2PYQA 2H61A 2GV5A 1NWDA 1CNPA 1S1EA 4MLWA 1NCYA 1NPQA 1H8BA 3DZTA 4GAOA 5TNCA 5I2OA 1DJIA 3QRXA 1LA0A 5AEQA 2K7BA 2M29A 1V1GA 5KTYA 1SL9A 1SYMA 3AAKA 1DJGA 1QATA 2PQLA 1QVIY 1XFWO 4YI8A 1BR4B 1B47A 1Y0VH 3O4XA 4IJ7A 3VRNA 2LUCA 3CZ0A 1TNWA 2L5XB 1KK7Y 2M9GA 1A75B 1TCOB 2YGUA 3JTDC 3LK1A 3PM2A 1AK8A 1TOPA 1YR5A 4MN0A 1K9KA 1K95A 3NSKA 1QASA 5DICA 3RZSA 1BG1A 3I5IC 2LCPA 3SS5A 2SASA 5AFPA 2F2OA 3CZTX 4GPLB 1FI6A 3D77A 1OQPA 1BMOA 2BKHB 3I5HB 2QEOA 3WHUB 1CB1A 2BCXA 1F54A 1XFXO 2JT3A 2OS8B 3NHIA 2KLEA 3K21A 3TZ1A 3D76A 1KK8B 1QIVA 2WC8A 2HQWA 3KHEA 1JF2A 3BOWA 1IH0A 3FE6A 3SG4A 3AAJA 5EL2A 1NIWA 1QLKA 1UUSA 1K9PA 3BUNB 4PE1A 1LINA 3KPXA 5D3OA 2L4IA 3OX5A 1K2HA 2WNDA 4M2QA 1CDMA 1YX8A 1CM1A 1B7TY 1XYDA 2WCEA 1PULA 1XVJA 1PALA 3I5FB 1QV1A 1MQ1A 3IQOA 4GFTA 5HKWA 3OB2B 1TWOA 3B7AA 3QMEA 4AQIA 3DVEA 1S6IA 4YRUA 1YX7A 2G2BA 1LVCD 3KF9A 1U5IB 4F0ZB 3NGVA 1DJYA 1UHJA 1K9UA 2IS9A 4HRGA 2MRDA 1XFYO 3VB1A 1NYAA 2JT0A 2H61C 3IVTA 1OMDA 2Y5IA 3GK4X 4L9MA 1CFFA 1SMGA 5D69A 1UHNA 3NSIA 3DVKA 2FJUB 3BFAA 3DVJA 2KFHA 4M2PA 1K93D 1S5GY 3DVMA 4HRHA 1OMRA 2KQYA 2FCEA 5GQQC 1N2DA 2ZN9A 2BBNA 2LLSA 3WXAA 4P2YB 2COLB 2QEBA 1R6PA 4JPZB 5HLVA 3WNXB 1M63B 2ZFDA 4XJKA 1BOCA
chains in the Genus database with same CATH topology
1A03A 1XFZO 2LM5A 3CTNA 2ZNEA 4I5NB 1KQMB 1IG5A 1CFDA 1W7IB 1QVIZ 3TS5C 2BCAA 1AVSA 2KBIA 3LCPC 1KK7Z 5DKNA 2JQ6A 2PALA 5J3XA 1WRZA 4DS7A 2JT8A 3LK0A 1KFUS 5AXIA 1FBVA 3MSEB 1DJHA 2M1UA 4YGEB 1TRFA 1G33A 2LLUA 1L7ZA 2B1UA 1L2OC 3EKJA 1DF0B 3BUOB 4OV2A 3CLNA 2M1KB 1QV0A 1QX7A 4CIDA 1AUIB 1F55A 4M2OA 4YI9A 1BF5A 2PMYA 1C7WA 2K7OA 3E3RA 2L51A 1J7OA 4CFRA 1A2XA 1XK4C 1F70A 1QIWA 5HKYA 1IKUA 2KDHA 2OPOA 4C0KA 1QX5B 1EG4A 2GGMA 2JOJA 1CMGA 2KI4C 1WRLA 5D7FA 2KFFA 4PE4A 1Y6WA 1ZUZA 2O60A 3EK8A 3OP0A 1JUOA 1B1GA 2M7NA 2KAYA 1YVHA 1B7TZ 1EXRA 2L50A 2D8NA 5CSJA 2LE9B 3LL8B 3HCMA 4YBHB 1NCXA 5CSFA 3CR5X 5CSNA 1HQVA 3FWBA 1JFJA 2PSRA 2Y1NA 4JQ0D 5I2LA 2KSPA 2KBMA 3FS7A 1CM4A 4D1EA 2HPSA 1RK9A 2NCOA 4BY4A 4PHJA 1MF8B 1H4BA 2P6BB 4GBAA 3NSOA 3IQQA 1B8LA 1X02A 2K7DA 4YGBB 2LNKA 3EVVA 5I2QA 1CDNA 1AJ4A 3I5IB 5ER5A 2BL0C 1NX2A 3CGAA 2K2FA 1J7RA 1B9AA 2MA2A 2Q91A 1DJZA 4YGCB 4OKHA 3TDIA 1QTXA 2EC6C 1BLQA 1S5GZ 2JXCA 2KYCA 2LHLA 1C7VA 3BQ3A 3F45A 1D1OA 4OCIA 2MJWB 3TUYC 1B8CA 1GGZA 4NDBA 3DF0B 2JTTA 4CFQA 1SL7A 2PRUA 1DTLA 2KAVA 2NCPA 2F3ZA 1UURA 2M49B 1LKJA 3D0YB 3GK2A 3PFVA 3O2PA 1F4QA 2O5GA 4PCWA 1RJVA 4C0JA 3KEVA 1SPYA 4GGFC 1XK4A 1PSRA 5IBWA 2EHBA 1N65A 1SR6C 2K61A 1IJ6A 1OZOA 2Y4QA 2CNPA 4MZJA 1BT6A 2I7AA 4ORBB 4N5XA 1OZSA 1IGVA 4OR9B 4I5KA 1WLMA 1J1EA 1S36A 4A4CA 1GQMA 3ZNIA 1FI5A 1DVIA 3GK1A 2M8UA 2V53A 4MZKA 1QLSA 1S6JA 3PN7C 1TN4A 2I2RE 1HT9A 1NX0A 2JWWA 2NXQA 3OHMB 3IF7A 1SNLA 4A4BA 4WRIA 1MWNA 2ISDA 1K90D 1TNPA 2LVKA 2WORA 1WDCC 1RROA 1WY9A 2I94A 3I5GC 1CFPA 1CLMA 1J7QA 2OTGB 1IRJA 4PHKA 2F3YA 1ALVA 2ZRSA 5F6TA 1IQ5A 1EG3A 4IL1A 1B4CA 1J55A 4PE0A 1SKTA 2L0PA 3TDZA 5DKQA 3RM1A 1A29A 4YGAA 4AQJA 2KAXA 3TDUA 4AOMA 1SCMC 4PHNA 1F8HA 4XYNA 1YUSA 2K8MB 1ALWA 1CDLA 2DOQA 3PATA 1CDPA 4PDZA 1KFXL 1YVLA 4WQ2A 4GNKB 1Y1UA 2MLFC 1OE9B 2A4JA 2LVJA 4YGDB 4MEWA 1RFJA 1PSBA 2LMTA 3BYAA 3TS5B 3BXKA 1AP4A 1YURA 1SL8A 3BUMB 1OOJA 1TIZA 1CKKA 1S3PA 2KGBC 3CWGA 1RECA 1SCVA 5AANA 1KQVA 2BE4A 3SG7A 2L2EA 3EVRA 4UPGA 3LLEA 1L2OB 1RTP1 1F71A 1DJWA 3PM8A 4GGFA 1ZACA 2E30A 3BOWB 1M31A 1AJ5A 3PLFB 2LUXA 3FIAA 2BECA 1SY9A 2JRFA 1A75A 3PALA 1JBAA 1LA3A 1XFVO 2KNEA 4DUQA 2RGIA 2VRGA 4MZLA 2KI4B 2F33A 2LP2A 1G8IA 2K0JA 5AERA 1QX2A 2F2PA 2KI6C 4DIRA 2E6WA 2BKIB 1XFUO 4FTGA 4NQGA 1CTRA 1Y1AA 1YUTA 2HETA 2WOSA 2FOTA 4ICBA 1PVBA 3GOFA 4DCKA 2LVIA 2MLEC 3A8RA 2JNXA 2NLNA 5CPVA 1PRWA 1CLLA 5KU1A 4NDCA 1EH2A 1DT7B 3BUWB 1M45A 1MXEA 4N1GA 1S26D 4P5OE 2ZN8A 3H4SE 4USLA 1BJFA 1QJTA 2H2KA 2CT9A 3EK4A 4MBEA 4R1EA 2FCDA 2LMUA 2M97A 3EKHA 3SG5A 2JPTA 2LHIA 2BL0B 3JVTC 3EK7A 4PHMA 3JTDB 4E68A 1ZOTB 3SG3A 2HQ8A 3VROA 1U5IA 2EC6B 2LANA 2MAZA 1MXLC 5BPJA 2ZRTA 2L98A 1CFCA 4XJKB 1E8AA 3CS1A 1KWOC 3TUYB 4CPVA 1GJYA 1QXPA 2LLTA 3VRPA 2KI6D 1QS7A 2MHHA 4PALA 5FYXA 1EJ3A 1TNXA 2Y1MA 3NSLA 1ZMZA 1KCYA 1K8UA 2EGDA 2K2AA 2LV7A 3BUXB 2HF5A 4ORAB 1RWYA 1BR1B 5ER4X 5I8NA 2PVBA 4NDDA 5KSZA 1UP5A 1SR6B 2CXJA 4PE7A 4TNCA 3SIAA 2SCPA 4Q04A 1ODBA 5HKZA 1IJ5A 1SK6D 4C0LA 3WHTB 1PVAA 4GGNA 3KO0A 1GGWA 3O6BA 2KHNA 2M7LA 2AUCA 4N1FA 3EVUA 4I5LB 4MRXA 3PN7B 3ICBA 3CR4X 3VRQA 3PSRA 1NX1A 1J1DA 4QJ4B 2I18A 3DD4A 1FF1A 2PASA 1TCFA 2KGRA 3I5HC 2QPTA 1R2UA 3ZWHA 1WLZA 1IQ3A 1WDCB 1K96A 3I5GB 2OS8C 1DF0A 2ZNDA 3OB1B 4ETOA 1M39A 1CLBA 4CLNA 1KK8C 1YRUB 2QACA 1B8RA 3HX4A 1SBJA 2JXLA 2LMVA 4ORCB 2Q4UA 5JJGA 1SCMB 4MVFA 1JWDA 2KYFA 2BCBA 1IWQA 4GUKA 2BE6A 5G08A 3SJSA 5HLOA 2JZIA 3SG2A 2AMIA 2KFGA 5K89A 1JSAA 3CR2A 2JU0A 3I5FC 1KSMA 1FW4A 2CBLA 1MR8A 1A4PA 1VRKA 1KFUL 2MBXA 1DGVA 1YRTB 1JF0A 1YTZC 4DRWA 5DKRA 1FPWA 5B8IB 4I5JA 1F4OA 3M0WA 1PK0D 1JFKA 1KSOA 1W7JB 1UHHA 4JWQA 1YUUA 1XO5A 5JOLA 1TTXA 3O78A 2ZKMX 2KOTA 1BU3A 1WRKA 2R2IA 2WCFA 1G4YR 2OTGC 4HSZA 2GGZA 1NP8A 5CSIA 2G9BA 1OSAA 1ZFSA 1DJXA 3D10A 1NX3A 2LP3A 4WQ3A 3SG6A 1UWOA 4MRYA 1MHOA 2CCMA 1AHRA 1NCZA 1M46A 1Q80A 1EL4A 1MUXA 3AKBA 2BBMA 3VGOA 2LAPA 2TN4A 4U8DA 2M0RA 2F8PA 3O4YA 1Y1XA 2LC5A 1TNQA 4FQOA 4QJ5B 3SIBA 2WCBA 1N0YA 2KQ6A 1KQMC 1NSHA 3C1VA 4ZCVA 3DF0A 1J7PA 1SW8A 1KFXS 2LVVA 1JC2A 3OX6A 2JULA 4MSPA 2K7CA 1UHIA 3D0YA 4ZCUA 1S6CA 2M3WA 1OMVA 1V1FA 1DMOA 4OVNF 3AKAA 2JNFA 4BY5A 3A4UB 2AAOA 1LXFC 2JTZA 4QJ3B 3RLZA 3VRRA 5PALA 4HREE 1BODA 1NUBA 2CTNA 2NZ0A 3JVTB 2L4HA 2JC2A 1K94A 1SRAA 1UHKA 3FWCA 5HYDA 1DGUA 3NXAA 1CMFA 1KWOB 1C07A 1XA5A 2H61A 2GV5A 1NWDA 1CNPA 1S1EA 4MLWA 1NCYA 1NPQA 1H8BA 4GAOA 5TNCA 5I2OA 1DJIA 3QRXA 1LA0A 5AEQA 2K7BA 2M29A 1V1GA 5KTYA 1SL9A 1SYMA 3AAKA 1DJGA 1QATA 1QVIY 1XFWO 4YI8A 1BR4B 1B47A 1Y0VH 3VRNA 2LUCA 1TNWA 2L5XB 1KK7Y 2M9GA 1A75B 1TCOB 3LK1A 3JTDC 1AK8A 1TOPA 1YR5A 4MN0A 1K9KA 1K95A 3NSKA 1QASA 1BG1A 3I5IC 2LCPA 2SASA 5AFPA 2F2OA 3CZTX 4GPLB 1FI6A 1OQPA 1BMOA 2BKHB 3I5HB 3WHUB 1CB1A 2BCXA 1F54A 1XFXO 2JT3A 2OS8B 3K21A 3TZ1A 1KK8B 1QIVA 2WC8A 2HQWA 3KHEA 1JF2A 3BOWA 1IH0A 3SG4A 3AAJA 1NIWA 1QLKA 1UUSA 1K9PA 3BUNB 4PE1A 1LINA 3KPXA 2L4IA 3OX5A 1K2HA 2WNDA 4M2QA 1CDMA 1YX8A 1CM1A 1B7TY 1XYDA 2WCEA 1PULA 1XVJA 1PALA 3I5FB 1QV1A 1MQ1A 3IQOA 4GFTA 5HKWA 3OB2B 4AQIA 3DVEA 1S6IA 4YRUA 1YX7A 2G2BA 1LVCD 3KF9A 1U5IB 4F0ZB 1DJYA 1UHJA 1K9UA 2IS9A 4HRGA 2MRDA 1XFYO 1NYAA 2JT0A 2H61C 1OMDA 2Y5IA 3GK4X 4L9MA 1CFFA 1SMGA 5D69A 1UHNA 3NSIA 3DVKA 2FJUB 3DVJA 2KFHA 4M2PA 1K93D 1S5GY 3DVMA 4HRHA 1OMRA 2KQYA 2FCEA 5GQQC 1N2DA 2ZN9A 2BBNA 2LLSA 3WXAA 4P2YB 2COLB 1R6PA 4JPZB 5HLVA 3WNXB 1M63B 2ZFDA 4XJKA 1BOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A03 A;  1XFZ O;  2LM5 A;  3CTN A;  2ZNE A;  4I5N B;  1KQM B;  1IG5 A;  1CFD A;  1W7I B;  1QVI Z;  3TS5 C;  2BCA A;  1AVS A;  2KBI A;  3LCP C;  1KK7 Z;  5DKN A;  2JQ6 A;  2PAL A;  5J3X A;  1WRZ A;  4DS7 A;  2JT8 A;  3LK0 A;  1KFU S;  5AXI A;  1FBV A;  3MSE B;  1DJH A;  2M1U A;  4YGE B;  1TRF A;  1G33 A;  2LLU A;  1L7Z A;  2B1U A;  1L2O C;  3EKJ A;  1DF0 B;  3BUO B;  4OV2 A;  3CLN A;  2M1K B;  1QV0 A;  1QX7 A;  4CID A;  1AUI B;  1F55 A;  4M2O A;  4YI9 A;  1BF5 A;  2PMY A;  1C7W A;  2K7O A;  3E3R A;  2L51 A;  1J7O A;  4CFR A;  1A2X A;  1XK4 C;  1F70 A;  1QIW A;  5HKY A;  1IKU A;  2KDH A;  2OPO A;  4C0K A;  1QX5 B;  1EG4 A;  2GGM A;  2JOJ A;  1CMG A;  2KI4 C;  1WRL A;  5D7F A;  2KFF A;  4PE4 A;  1Y6W A;  1ZUZ A;  2O60 A;  3EK8 A;  3OP0 A;  1JUO A;  1B1G A;  2M7N A;  2KAY A;  1YVH A;  1B7T Z;  1EXR A;  2L50 A;  2D8N A;  5CSJ A;  2LE9 B;  3LL8 B;  3HCM A;  4YBH B;  1NCX A;  5CSF A;  3CR5 X;  5CSN A;  1HQV A;  3FWB A;  1JFJ A;  2PSR A;  2Y1N A;  4JQ0 D;  5I2L A;  2KSP A;  2KBM A;  3FS7 A;  1CM4 A;  4D1E A;  2HPS A;  1RK9 A;  2NCO A;  4BY4 A;  4PHJ A;  1MF8 B;  1H4B A;  2P6B B;  4GBA A;  3NSO A;  3IQQ A;  1B8L A;  1X02 A;  2K7D A;  4YGB B;  2LNK A;  3EVV A;  5I2Q A;  1CDN A;  1AJ4 A;  3I5I B;  5ER5 A;  2BL0 C;  1NX2 A;  3CGA A;  2K2F A;  1J7R A;  1B9A A;  2MA2 A;  2Q91 A;  1DJZ A;  4YGC B;  4OKH A;  3TDI A;  1QTX A;  2EC6 C;  1BLQ A;  1S5G Z;  2JXC A;  2KYC A;  2LHL A;  1C7V A;  3BQ3 A;  3F45 A;  1D1O A;  4OCI A;  2MJW B;  3TUY C;  1B8C A;  1GGZ A;  4NDB A;  3DF0 B;  2JTT A;  4CFQ A;  1SL7 A;  2PRU A;  1DTL A;  2KAV A;  2NCP A;  2F3Z A;  1UUR A;  2M49 B;  1LKJ A;  3D0Y B;  3GK2 A;  3PFV A;  3O2P A;  1F4Q A;  2O5G A;  4PCW A;  1RJV A;  4C0J A;  3KEV A;  1SPY A;  4GGF C;  1XK4 A;  1PSR A;  5IBW A;  2EHB A;  1N65 A;  1SR6 C;  2K61 A;  1IJ6 A;  1OZO A;  2Y4Q A;  2CNP A;  4MZJ A;  1BT6 A;  2I7A A;  4ORB B;  4N5X A;  1OZS A;  1IGV A;  4OR9 B;  4I5K A;  1WLM A;  1J1E A;  1S36 A;  4A4C A;  1GQM A;  3ZNI A;  1FI5 A;  1DVI A;  3GK1 A;  2M8U A;  2V53 A;  4MZK A;  1QLS A;  1S6J A;  3PN7 C;  1TN4 A;  2I2R E;  1HT9 A;  1NX0 A;  2JWW A;  2NXQ A;  3OHM B;  3IF7 A;  1SNL A;  4A4B A;  4WRI A;  1MWN A;  2ISD A;  1K90 D;  1TNP A;  2LVK A;  2WOR A;  1WDC C;  1RRO A;  1WY9 A;  2I94 A;  3I5G C;  1CFP A;  1CLM A;  1J7Q A;  2OTG B;  1IRJ A;  4PHK A;  2F3Y A;  1ALV A;  2ZRS A;  5F6T A;  1IQ5 A;  1EG3 A;  4IL1 A;  1B4C A;  1J55 A;  4PE0 A;  1SKT A;  2L0P A;  3TDZ A;  5DKQ A;  3RM1 A;  1A29 A;  4YGA A;  4AQJ A;  2KAX A;  3TDU A;  4AOM A;  1SCM C;  4PHN A;  1F8H A;  4XYN A;  1YUS A;  2K8M B;  1ALW A;  1CDL A;  2DOQ A;  3PAT A;  1CDP A;  4PDZ A;  1KFX L;  1YVL A;  4WQ2 A;  4GNK B;  1Y1U A;  2MLF C;  1OE9 B;  2A4J A;  2LVJ A;  4YGD B;  4MEW A;  1RFJ A;  1PSB A;  2LMT A;  3BYA A;  3TS5 B;  3BXK A;  1AP4 A;  1YUR A;  1SL8 A;  3BUM B;  1OOJ A;  1TIZ A;  1CKK A;  1S3P A;  2KGB C;  3CWG A;  1REC A;  1SCV A;  5AAN A;  1KQV A;  2BE4 A;  3SG7 A;  2L2E A;  3EVR A;  4UPG A;  3LLE A;  1L2O B;  1RTP 1;  1F71 A;  1DJW A;  3PM8 A;  4GGF A;  1ZAC A;  2E30 A;  3BOW B;  1M31 A;  1AJ5 A;  3PLF B;  2LUX A;  3FIA A;  2BEC A;  1SY9 A;  2JRF A;  1A75 A;  3PAL A;  1JBA A;  1LA3 A;  1XFV O;  2KNE A;  4DUQ A;  2RGI A;  2VRG A;  4MZL A;  2KI4 B;  2F33 A;  2LP2 A;  1G8I A;  2K0J A;  5AER A;  1QX2 A;  2F2P A;  2KI6 C;  4DIR A;  2E6W A;  2BKI B;  1XFU O;  4FTG A;  4NQG A;  1CTR A;  1Y1A A;  1YUT A;  2HET A;  2WOS A;  2FOT A;  4ICB A;  1PVB A;  3GOF A;  4DCK A;  2LVI A;  2MLE C;  3A8R A;  2JNX A;  2NLN A;  5CPV A;  1PRW A;  1CLL A;  5KU1 A;  4NDC A;  1EH2 A;  1DT7 B;  3BUW B;  1M45 A;  1MXE A;  4N1G A;  1S26 D;  4P5O E;  2ZN8 A;  3H4S E;  4USL A;  1BJF A;  1QJT A;  2H2K A;  2CT9 A;  3EK4 A;  4MBE A;  4R1E A;  2FCD A;  2LMU A;  2M97 A;  3EKH A;  3SG5 A;  2JPT A;  2LHI A;  2BL0 B;  3JVT C;  3EK7 A;  4PHM A;  3JTD B;  4E68 A;  1ZOT B;  3SG3 A;  2HQ8 A;  3VRO A;  1U5I A;  2EC6 B;  2LAN A;  2MAZ A;  1MXL C;  5BPJ A;  2ZRT A;  2L98 A;  1CFC A;  4XJK B;  1E8A A;  3CS1 A;  1KWO C;  3TUY B;  4CPV A;  1GJY A;  1QXP A;  2LLT A;  3VRP A;  2KI6 D;  1QS7 A;  2MHH A;  4PAL A;  5FYX A;  1EJ3 A;  1TNX A;  2Y1M A;  3NSL A;  1ZMZ A;  1KCY A;  1K8U A;  2EGD A;  2K2A A;  2LV7 A;  3BUX B;  2HF5 A;  4ORA B;  1RWY A;  1BR1 B;  5ER4 X;  5I8N A;  2PVB A;  4NDD A;  5KSZ A;  1UP5 A;  1SR6 B;  2CXJ A;  4PE7 A;  4TNC A;  3SIA A;  2SCP A;  4Q04 A;  1ODB A;  5HKZ A;  1IJ5 A;  1SK6 D;  4C0L A;  3WHT B;  1PVA A;  4GGN A;  3KO0 A;  1GGW A;  3O6B A;  2KHN A;  2M7L A;  2AUC A;  4N1F A;  3EVU A;  4I5L B;  4MRX A;  3PN7 B;  3ICB A;  3CR4 X;  3VRQ A;  3PSR A;  1NX1 A;  1J1D A;  4QJ4 B;  2I18 A;  3DD4 A;  1FF1 A;  2PAS A;  1TCF A;  2KGR A;  3I5H C;  2QPT A;  1R2U A;  3ZWH A;  1WLZ A;  1IQ3 A;  1WDC B;  1K96 A;  3I5G B;  2OS8 C;  1DF0 A;  2ZND A;  3OB1 B;  4ETO A;  1M39 A;  1CLB A;  4CLN A;  1KK8 C;  1YRU B;  2QAC A;  1B8R A;  3HX4 A;  1SBJ A;  2JXL A;  2LMV A;  4ORC B;  2Q4U A;  5JJG A;  1SCM B;  4MVF A;  1JWD A;  2KYF A;  2BCB A;  1IWQ A;  4GUK A;  2BE6 A;  5G08 A;  3SJS A;  5HLO A;  2JZI A;  3SG2 A;  2AMI A;  2KFG A;  5K89 A;  1JSA A;  3CR2 A;  2JU0 A;  3I5F C;  1KSM A;  1FW4 A;  2CBL A;  1MR8 A;  1A4P A;  1VRK A;  1KFU L;  2MBX A;  1DGV A;  1YRT B;  1JF0 A;  1YTZ C;  4DRW A;  5DKR A;  1FPW A;  5B8I B;  4I5J A;  1F4O A;  3M0W A;  1PK0 D;  1JFK A;  1KSO A;  1W7J B;  1UHH A;  4JWQ A;  1YUU A;  1XO5 A;  5JOL A;  1TTX A;  3O78 A;  2ZKM X;  2KOT A;  1BU3 A;  1WRK A;  2R2I A;  2WCF A;  1G4Y R;  2OTG C;  4HSZ A;  2GGZ A;  1NP8 A;  5CSI A;  2G9B A;  1OSA A;  1ZFS A;  1DJX A;  3D10 A;  1NX3 A;  2LP3 A;  4WQ3 A;  3SG6 A;  1UWO A;  4MRY A;  1MHO A;  2CCM A;  1AHR A;  1NCZ A;  1M46 A;  1Q80 A;  1EL4 A;  1MUX A;  3AKB A;  2BBM A;  3VGO A;  2LAP A;  2TN4 A;  4U8D A;  2M0R A;  2F8P A;  3O4Y A;  1Y1X A;  2LC5 A;  1TNQ A;  4FQO A;  4QJ5 B;  3SIB A;  2WCB A;  1N0Y A;  2KQ6 A;  1KQM C;  1NSH A;  3C1V A;  4ZCV A;  3DF0 A;  1J7P A;  1SW8 A;  1KFX S;  2LVV A;  1JC2 A;  3OX6 A;  2JUL A;  4MSP A;  2K7C A;  1UHI A;  3D0Y A;  4ZCU A;  1S6C A;  2M3W A;  1OMV A;  1V1F A;  1DMO A;  4OVN F;  3AKA A;  2JNF A;  4BY5 A;  3A4U B;  2AAO A;  1LXF C;  2JTZ A;  4QJ3 B;  3RLZ A;  3VRR A;  5PAL A;  4HRE E;  1BOD A;  1NUB A;  2CTN A;  2NZ0 A;  3JVT B;  2L4H A;  2JC2 A;  1K94 A;  1SRA A;  1UHK A;  3FWC A;  5HYD A;  1DGU A;  3NXA A;  1CMF A;  1KWO B;  1C07 A;  1XA5 A;  2H61 A;  2GV5 A;  1NWD A;  1CNP A;  1S1E A;  4MLW A;  1NCY A;  1NPQ A;  1H8B A;  4GAO A;  5TNC A;  5I2O A;  1DJI A;  3QRX A;  1LA0 A;  5AEQ A;  2K7B A;  2M29 A;  1V1G A;  5KTY A;  1SL9 A;  1SYM A;  3AAK A;  1DJG A;  1QAT A;  1QVI Y;  1XFW O;  4YI8 A;  1BR4 B;  1B47 A;  1Y0V H;  3VRN A;  2LUC A;  1TNW A;  2L5X B;  1KK7 Y;  2M9G A;  1A75 B;  1TCO B;  3LK1 A;  3JTD C;  1AK8 A;  1TOP A;  1YR5 A;  4MN0 A;  1K9K A;  1K95 A;  3NSK A;  1QAS A;  1BG1 A;  3I5I C;  2LCP A;  2SAS A;  5AFP A;  2F2O A;  3CZT X;  4GPL B;  1FI6 A;  1OQP A;  1BMO A;  2BKH B;  3I5H B;  3WHU B;  1CB1 A;  2BCX A;  1F54 A;  1XFX O;  2JT3 A;  2OS8 B;  3K21 A;  3TZ1 A;  1KK8 B;  1QIV A;  2WC8 A;  2HQW A;  3KHE A;  1JF2 A;  3BOW A;  1IH0 A;  3SG4 A;  3AAJ A;  1NIW A;  1QLK A;  1UUS A;  1K9P A;  3BUN B;  4PE1 A;  1LIN A;  3KPX A;  2L4I A;  3OX5 A;  1K2H A;  2WND A;  4M2Q A;  1CDM A;  1YX8 A;  1CM1 A;  1B7T Y;  1XYD A;  2WCE A;  1PUL A;  1XVJ A;  1PAL A;  3I5F B;  1QV1 A;  1MQ1 A;  3IQO A;  4GFT A;  5HKW A;  3OB2 B;  4AQI A;  3DVE A;  1S6I A;  4YRU A;  1YX7 A;  2G2B A;  1LVC D;  3KF9 A;  1U5I B;  4F0Z B;  1DJY A;  1UHJ A;  1K9U A;  2IS9 A;  4HRG A;  2MRD A;  1XFY O;  1NYA A;  2JT0 A;  2H61 C;  1OMD A;  2Y5I A;  3GK4 X;  4L9M A;  1CFF A;  1SMG A;  5D69 A;  1UHN A;  3NSI A;  3DVK A;  2FJU B;  3DVJ A;  2KFH A;  4M2P A;  1K93 D;  1S5G Y;  3DVM A;  4HRH A;  1OMR A;  2KQY A;  2FCE A;  5GQQ C;  1N2D A;  2ZN9 A;  2BBN A;  2LLS A;  3WXA A;  4P2Y B;  2COL B;  1R6P A;  4JPZ B;  5HLV A;  3WNX B;  1M63 B;  2ZFD A;  4XJK A;  1BOC A; 
#chains in the Genus database with same CATH topology
 1A03 A;  1XFZ O;  2LM5 A;  3CTN A;  2ZNE A;  4I5N B;  1KQM B;  1IG5 A;  1DC1 A;  1CFD A;  1W7I B;  1QVI Z;  1IIO A;  3TS5 C;  2BCA A;  1AVS A;  2KBI A;  3LCP C;  1KK7 Z;  5DKN A;  2JQ6 A;  2PAL A;  5J3X A;  1W9Z A;  1WRZ A;  4DS7 A;  2JT8 A;  2KLD A;  3LK0 A;  1KFU S;  5AXI A;  1FBV A;  3MSE B;  1DJH A;  2K60 A;  2M1U A;  1TRF A;  1G33 A;  2LLU A;  4YGE B;  5FI2 A;  2L2C A;  1L7Z A;  2B1U A;  1L2O C;  3EKJ A;  1DF0 B;  3BUO B;  4OV2 A;  3CLN A;  2M1K B;  1QV0 A;  1QX7 A;  3D74 A;  4CID A;  1AUI B;  1F55 A;  4M2O A;  4YI9 A;  1BF5 A;  1C3Y A;  2WCK A;  2PMY A;  1C7W A;  2K7O A;  3E3R A;  2L51 A;  3L4L A;  4CFR A;  1J7O A;  1A2X A;  1XK4 C;  1F70 A;  1QIW A;  5HKY A;  1IKU A;  2KDH A;  2OPO A;  4C0K A;  3SS4 A;  1QX5 B;  1EG4 A;  1OOF A;  2GGM A;  2JOJ A;  1CMG A;  2KI4 C;  1WRL A;  5D7F A;  2KFF A;  1OW4 A;  4PE4 A;  1Y6W A;  1ZUZ A;  2O60 A;  3EK8 A;  3OP0 A;  1JUO A;  1B1G A;  2M7N A;  2KAY A;  1YVH A;  1B7T Z;  1EXR A;  2L50 A;  1Z2C B;  2D8N A;  3R1V A;  5CSJ A;  2LE9 B;  3LL8 B;  3HCM A;  4YBH B;  1NCX A;  5CSF A;  3CR5 X;  5CSN A;  1HQV A;  3FWB A;  1JFJ A;  2PSR A;  2Y1N A;  4JQ0 D;  5I2L A;  2KSP A;  2KBM A;  3FS7 A;  1CM4 A;  5I94 A;  4D1E A;  2HPS A;  2L5Y A;  1RK9 A;  2NCO A;  4BY4 A;  1DEK A;  4PHJ A;  1MF8 B;  1H4B A;  2JPO A;  2P6B B;  3N7H A;  4GBA A;  3NSO A;  3IQQ A;  1B8L A;  1X02 A;  2K7D A;  4YGB B;  2LNK A;  3EVV A;  5I2Q A;  1CDN A;  1AJ4 A;  3D73 A;  3I5I B;  3D78 A;  5ER5 A;  2BL0 C;  1NX2 A;  3CGA A;  2K2F A;  1J7R A;  1B9A A;  2MA2 A;  2Q91 A;  1DJZ A;  2FJY A;  4YGC B;  4OKH A;  3TDI A;  3CYZ A;  1QTX A;  2EC6 C;  1BLQ A;  1S5G Z;  2JXC A;  2KYC A;  2LHL A;  1C7V A;  3BQ3 A;  3F45 A;  1D1O A;  4OCI A;  3NHT A;  2MJW B;  3TUY C;  1B8C A;  1GGZ A;  4NDB A;  3DF0 B;  2JTT A;  4CFQ A;  1SL7 A;  2PRU A;  1DTL A;  2KAV A;  2NCP A;  2F3Z A;  1UUR A;  2M49 B;  1LKJ A;  1QWV A;  3D0Y B;  3GK2 A;  3PFV A;  3O2P A;  1F4Q A;  2O5G A;  4FQT A;  4PCW A;  1RJV A;  4C0J A;  3KEV A;  1SPY A;  4GGF C;  1XK4 A;  1PSR A;  5IBW A;  2EHB A;  1N65 A;  1SR6 C;  2K61 A;  1IJ6 A;  1OZO A;  2Y4Q A;  2CNP A;  4MZJ A;  1BT6 A;  2I7A A;  4ORB B;  4N5X A;  1OZS A;  1IGV A;  4OR9 B;  4I5K A;  1WLM A;  1J1E A;  1S36 A;  4A4C A;  1GQM A;  3ZNI A;  1FI5 A;  1DVI A;  2WCM A;  3GK1 A;  2M8U A;  2V53 A;  2QEH A;  4MZK A;  1QLS A;  1S6J A;  3PN7 C;  2QEV A;  1Z4H A;  1TN4 A;  2I2R E;  1HT9 A;  1NX0 A;  2BAP A;  2JWW A;  3UNW A;  2NXQ A;  3OHM B;  3IF7 A;  1SNL A;  4A4B A;  4WRI A;  1MWN A;  2ISD A;  1K90 D;  1TNP A;  3UO9 A;  2LVK A;  2WOR A;  1WDC C;  1RRO A;  1WY9 A;  2I94 A;  3I5G C;  1CFP A;  1CLM A;  3FE9 A;  1J7Q A;  2OTG B;  1IRJ A;  4PHK A;  2F3Y A;  1ALV A;  2ZRS A;  5F6T A;  1IQ5 A;  1EG3 A;  1TUZ A;  4IL1 A;  1B4C A;  1J55 A;  4PE0 A;  1SKT A;  2L0P A;  3L47 A;  3TDZ A;  5DKQ A;  3RM1 A;  1A29 A;  4YGA A;  4AQJ A;  2KAX A;  3TDU A;  4AOM A;  2GTE A;  3B87 A;  3CDN A;  1SCM C;  4PHN A;  1F8H A;  4XYN A;  1YUS A;  2K8M B;  1ALW A;  1CDL A;  3BFH A;  2DOQ A;  3PAT A;  1CDP A;  4PDZ A;  3BFB A;  1KFX L;  1YVL A;  4WQ2 A;  4GNK B;  2WCL A;  1Y1U A;  2MLF C;  1OE9 B;  2A4J A;  2LVJ A;  4YGD B;  4MEW A;  1RFJ A;  1PSB A;  2LMT A;  3BYA A;  3TS5 B;  3BXK A;  3R1P A;  3FE8 A;  1AP4 A;  4OZD A;  1YUR A;  1SL8 A;  3BUM B;  1OOJ A;  1TIZ A;  1CKK A;  1S3P A;  2KGB C;  3CWG A;  3CZ2 A;  1REC A;  1SCV A;  5AAN A;  1KQV A;  2BE4 A;  3SG7 A;  2L2E A;  3EVR A;  4UPG A;  3LLE A;  1L2O B;  1RTP 1;  1F71 A;  1DJW A;  3PM8 A;  4GGF A;  1ZAC A;  2E30 A;  3BOW B;  1M31 A;  1AJ5 A;  3PLF B;  2LUX A;  3FIA A;  2BEC A;  1SY9 A;  3B88 A;  2JRF A;  1A75 A;  3PAL A;  1JBA A;  1LA3 A;  1XFV O;  2KNE A;  4DUQ A;  5FI7 A;  2RGI A;  4PT1 A;  2VRG A;  4MZL A;  1OOH A;  2KI4 B;  2F33 A;  2LP2 A;  1G8I A;  1C3Z A;  2K0J A;  5AER A;  1QX2 A;  2F2P A;  2KI6 C;  4DIR A;  2E6W A;  2BKI B;  3S0E A;  1XFU O;  4FTG A;  4NQG A;  1CTR A;  1Y1A A;  1YUT A;  2HET A;  2WOS A;  2FOT A;  4ICB A;  1PVB A;  3GOF A;  3S0B A;  2LVI A;  2MLE C;  3A8R A;  4DCK A;  2JNX A;  2NLN A;  5CPV A;  1PRW A;  1CLL A;  5KU1 A;  4NDC A;  1EH2 A;  1DT7 B;  3BUW B;  3S0A A;  1M45 A;  3L4A A;  1MXE A;  4N1G A;  1S26 D;  4P5O E;  1SSE B;  2ZN8 A;  3H4S E;  4USL A;  1BJF A;  1QJT A;  2H2K A;  2CT9 A;  3EK4 A;  4MBE A;  4R1E A;  3S0D A;  2FCD A;  1ORG A;  2LMU A;  2M97 A;  3EKH A;  3SG5 A;  2JPT A;  2LHI A;  2BL0 B;  3JVT C;  3EK7 A;  4PHM A;  3JTD B;  4E68 A;  1ZOT B;  2BNX A;  3SG3 A;  2HQ8 A;  3B86 A;  1U5I A;  2EC6 B;  2LAN A;  2MAZ A;  1MXL C;  3VRO A;  2ZRT A;  5BPJ A;  2L98 A;  1CFC A;  4XJK B;  1E8A A;  3CS1 A;  1KWO C;  3TUY B;  4CPV A;  1GJY A;  1QXP A;  2LLT A;  3VRP A;  2KI6 D;  2P71 A;  1QS7 A;  2MHH A;  3K1E A;  4PAL A;  5FYX A;  1EJ3 A;  1TNX A;  2Y1M A;  3NSL A;  1ZMZ A;  1KCY A;  1K8U A;  2EGD A;  2K2A A;  2LV7 A;  3BUX B;  2HF5 A;  4ORA B;  1RWY A;  1BR1 B;  5ER4 X;  5HL1 A;  5I8N A;  2PVB A;  1LS8 A;  4NDD A;  5KSZ A;  1UP5 A;  1SR6 B;  2CXJ A;  4PE7 A;  4TNC A;  3SIA A;  2SCP A;  4Q04 A;  1ODB A;  5HKZ A;  4F7F A;  3DXL A;  1IJ5 A;  1SK6 D;  4C0L A;  2P70 A;  3WHT B;  1PVA A;  4GGN A;  3KO0 A;  1GGW A;  3O6B A;  2KHN A;  1DEL A;  2M7L A;  2AUC A;  4N1F A;  3EVU A;  4I5L B;  4MRX A;  3PN7 B;  3ICB A;  3CR4 X;  3CAB A;  3VRQ A;  3PSR A;  1NX1 A;  1J1D A;  4QJ4 B;  2I18 A;  3DD4 A;  1FF1 A;  2PAS A;  1TCF A;  2KGR A;  2WC6 A;  3I5H C;  2QPT A;  1R2U A;  3ZWH A;  1WLZ A;  1IQ3 A;  1WDC B;  1K96 A;  3I5G B;  2OS8 C;  1DF0 A;  2ZND A;  3OB1 B;  4ETO A;  1M39 A;  1TUJ A;  1CLB A;  4CLN A;  1KK8 C;  1YRU B;  3B6X A;  1DQE A;  2QAC A;  2WC5 A;  1B8R A;  3HX4 A;  2ERB A;  1SBJ A;  3Q8I A;  2JXL A;  2LMV A;  4ORC B;  2Q4U A;  3OBV A;  1SCM B;  4MVF A;  5JJG A;  1JWD A;  2KYF A;  2BCB A;  1IWQ A;  4GUK A;  2BE6 A;  5G08 A;  3SJS A;  3V2L A;  5HLO A;  3SS3 A;  2JZI A;  3SG2 A;  2AMI A;  2KFG A;  5K89 A;  1JSA A;  3CR2 A;  2JU0 A;  3I5F C;  1KSM A;  1FW4 A;  2CBL A;  1MR8 A;  3DYE A;  1A4P A;  1P28 A;  1VRK A;  1KFU L;  2WCJ A;  2MBX A;  1DGV A;  1YRT B;  1JF0 A;  1YTZ C;  4DRW A;  5DKR A;  1FPW A;  5B8I B;  4I5J A;  1F4O A;  3M0W A;  1PK0 D;  3PJI A;  2QDI A;  1JFK A;  1KSO A;  1W7J B;  1UHH A;  4JWQ A;  1YUU A;  1XO5 A;  5JOL A;  3BJH A;  1TTX A;  3O78 A;  2ZKM X;  2KOT A;  1BU3 A;  1WRK A;  2R2I A;  2WCF A;  1G4Y R;  2OTG C;  4HSZ A;  1XFR A;  2GGZ A;  1NP8 A;  5CSI A;  4INW A;  2G9B A;  1OSA A;  1ZFS A;  1DJX A;  3D10 A;  1NX3 A;  3DY9 A;  2LP3 A;  4WQ3 A;  1T14 A;  3SG6 A;  1UWO A;  4MRY A;  1MHO A;  1NCZ A;  1AHR A;  2CCM A;  1M46 A;  1Q80 A;  1EL4 A;  1MUX A;  3AKB A;  2BBM A;  3CZ1 A;  3VGO A;  2LAP A;  2TN4 A;  4U8D A;  2M0R A;  2F8P A;  3O4Y A;  1Y1X A;  2LC5 A;  1TNQ A;  4JD9 A;  4FQO A;  4QJ5 B;  3SIB A;  2WCB A;  1N0Y A;  2KQ6 A;  1KQM C;  1NSH A;  3C1V A;  4ZCV A;  3D75 A;  3DF0 A;  1J7P A;  1SW8 A;  3S0G A;  1KFX S;  2LVV A;  1JC2 A;  1OOG A;  3EG5 B;  3OX6 A;  2KPH A;  4KYN A;  2JUL A;  4MSP A;  2K7C A;  1UHI A;  3D0Y A;  3OGN A;  4ZCU A;  1GM0 A;  1S6C A;  2M3W A;  4JKT A;  1OMV A;  1V1F A;  1DMO A;  2H8V A;  1OOI X;  4OVN F;  3AKA A;  4INX A;  2JNF A;  4BY5 A;  3A4U B;  2AAO A;  1LXF C;  2JTZ A;  4QJ3 B;  3RLZ A;  3VRR A;  5PAL A;  4HRE E;  1BOD A;  1NUB A;  2CTN A;  2NZ0 A;  3R1O A;  3JVT B;  2L4H A;  2JC2 A;  1K94 A;  1SRA A;  1UHK A;  3FWC A;  5HYD A;  1DGU A;  3S0F A;  3NXA A;  2WCH A;  1CMF A;  1KWO B;  5FI6 A;  1C07 A;  1XA5 A;  3R72 A;  2PYQ A;  2H61 A;  2GV5 A;  1NWD A;  1CNP A;  1S1E A;  4MLW A;  1NCY A;  1NPQ A;  1H8B A;  3DZT A;  4GAO A;  5TNC A;  5I2O A;  1DJI A;  3QRX A;  1LA0 A;  5AEQ A;  2K7B A;  2M29 A;  1V1G A;  5KTY A;  1SL9 A;  1SYM A;  3AAK A;  1DJG A;  1QAT A;  2PQL A;  1QVI Y;  1XFW O;  4YI8 A;  1BR4 B;  1B47 A;  1Y0V H;  3O4X A;  4IJ7 A;  3VRN A;  2LUC A;  3CZ0 A;  1TNW A;  2L5X B;  1KK7 Y;  2M9G A;  1A75 B;  1TCO B;  2YGU A;  3JTD C;  3LK1 A;  3PM2 A;  1AK8 A;  1TOP A;  1YR5 A;  4MN0 A;  1K9K A;  1K95 A;  3NSK A;  1QAS A;  5DIC A;  3RZS A;  1BG1 A;  3I5I C;  2LCP A;  3SS5 A;  2SAS A;  5AFP A;  2F2O A;  3CZT X;  4GPL B;  1FI6 A;  3D77 A;  1OQP A;  1BMO A;  2BKH B;  3I5H B;  2QEO A;  3WHU B;  1CB1 A;  2BCX A;  1F54 A;  1XFX O;  2JT3 A;  2OS8 B;  3NHI A;  2KLE A;  3K21 A;  3TZ1 A;  3D76 A;  1KK8 B;  1QIV A;  2WC8 A;  2HQW A;  3KHE A;  1JF2 A;  3BOW A;  1IH0 A;  3FE6 A;  3SG4 A;  3AAJ A;  5EL2 A;  1NIW A;  1QLK A;  1UUS A;  1K9P A;  3BUN B;  4PE1 A;  1LIN A;  3KPX A;  5D3O A;  2L4I A;  3OX5 A;  1K2H A;  2WND A;  4M2Q A;  1CDM A;  1YX8 A;  1CM1 A;  1B7T Y;  1XYD A;  2WCE A;  1PUL A;  1XVJ A;  1PAL A;  3I5F B;  1QV1 A;  1MQ1 A;  3IQO A;  4GFT A;  5HKW A;  3OB2 B;  1TWO A;  3B7A A;  3QME A;  4AQI A;  3DVE A;  1S6I A;  4YRU A;  1YX7 A;  2G2B A;  1LVC D;  3KF9 A;  1U5I B;  4F0Z B;  3NGV A;  1DJY A;  1UHJ A;  1K9U A;  2IS9 A;  4HRG A;  2MRD A;  1XFY O;  3VB1 A;  1NYA A;  2JT0 A;  2H61 C;  3IVT A;  1OMD A;  2Y5I A;  3GK4 X;  4L9M A;  1CFF A;  1SMG A;  5D69 A;  1UHN A;  3NSI A;  3DVK A;  2FJU B;  3BFA A;  3DVJ A;  2KFH A;  4M2P A;  1K93 D;  1S5G Y;  3DVM A;  4HRH A;  1OMR A;  2KQY A;  2FCE A;  5GQQ C;  1N2D A;  2ZN9 A;  2BBN A;  2LLS A;  3WXA A;  4P2Y B;  2COL B;  2QEB A;  1R6P A;  4JPZ B;  5HLV A;  3WNX B;  1M63 B;  2ZFD A;  4XJK A;  1BOC A; 
#chains in the Genus database with same CATH homology
 1A03 A;  1XFZ O;  2LM5 A;  3CTN A;  2ZNE A;  4I5N B;  1KQM B;  1IG5 A;  1CFD A;  1W7I B;  1QVI Z;  3TS5 C;  2BCA A;  1AVS A;  2KBI A;  3LCP C;  1KK7 Z;  5DKN A;  2JQ6 A;  2PAL A;  5J3X A;  1WRZ A;  4DS7 A;  2JT8 A;  3LK0 A;  1KFU S;  5AXI A;  1FBV A;  3MSE B;  1DJH A;  2M1U A;  4YGE B;  1TRF A;  1G33 A;  2LLU A;  1L7Z A;  2B1U A;  1L2O C;  3EKJ A;  1DF0 B;  3BUO B;  4OV2 A;  3CLN A;  2M1K B;  1QV0 A;  1QX7 A;  4CID A;  1AUI B;  1F55 A;  4M2O A;  4YI9 A;  1BF5 A;  2PMY A;  1C7W A;  2K7O A;  3E3R A;  2L51 A;  1J7O A;  4CFR A;  1A2X A;  1XK4 C;  1F70 A;  1QIW A;  5HKY A;  1IKU A;  2KDH A;  2OPO A;  4C0K A;  1QX5 B;  1EG4 A;  2GGM A;  2JOJ A;  1CMG A;  2KI4 C;  1WRL A;  5D7F A;  2KFF A;  4PE4 A;  1Y6W A;  1ZUZ A;  2O60 A;  3EK8 A;  3OP0 A;  1JUO A;  1B1G A;  2M7N A;  2KAY A;  1YVH A;  1B7T Z;  1EXR A;  2L50 A;  2D8N A;  5CSJ A;  2LE9 B;  3LL8 B;  3HCM A;  4YBH B;  1NCX A;  5CSF A;  3CR5 X;  5CSN A;  1HQV A;  3FWB A;  1JFJ A;  2PSR A;  2Y1N A;  4JQ0 D;  5I2L A;  2KSP A;  2KBM A;  3FS7 A;  1CM4 A;  4D1E A;  2HPS A;  1RK9 A;  2NCO A;  4BY4 A;  4PHJ A;  1MF8 B;  1H4B A;  2P6B B;  4GBA A;  3NSO A;  3IQQ A;  1B8L A;  1X02 A;  2K7D A;  4YGB B;  2LNK A;  3EVV A;  5I2Q A;  1CDN A;  1AJ4 A;  3I5I B;  5ER5 A;  2BL0 C;  1NX2 A;  3CGA A;  2K2F A;  1J7R A;  1B9A A;  2MA2 A;  2Q91 A;  1DJZ A;  4YGC B;  4OKH A;  3TDI A;  1QTX A;  2EC6 C;  1BLQ A;  1S5G Z;  2JXC A;  2KYC A;  2LHL A;  1C7V A;  3BQ3 A;  3F45 A;  1D1O A;  4OCI A;  2MJW B;  3TUY C;  1B8C A;  1GGZ A;  4NDB A;  3DF0 B;  2JTT A;  4CFQ A;  1SL7 A;  2PRU A;  1DTL A;  2KAV A;  2NCP A;  2F3Z A;  1UUR A;  2M49 B;  1LKJ A;  3D0Y B;  3GK2 A;  3PFV A;  3O2P A;  1F4Q A;  2O5G A;  4PCW A;  1RJV A;  4C0J A;  3KEV A;  1SPY A;  4GGF C;  1XK4 A;  1PSR A;  5IBW A;  2EHB A;  1N65 A;  1SR6 C;  2K61 A;  1IJ6 A;  1OZO A;  2Y4Q A;  2CNP A;  4MZJ A;  1BT6 A;  2I7A A;  4ORB B;  4N5X A;  1OZS A;  1IGV A;  4OR9 B;  4I5K A;  1WLM A;  1J1E A;  1S36 A;  4A4C A;  1GQM A;  3ZNI A;  1FI5 A;  1DVI A;  3GK1 A;  2M8U A;  2V53 A;  4MZK A;  1QLS A;  1S6J A;  3PN7 C;  1TN4 A;  2I2R E;  1HT9 A;  1NX0 A;  2JWW A;  2NXQ A;  3OHM B;  3IF7 A;  1SNL A;  4A4B A;  4WRI A;  1MWN A;  2ISD A;  1K90 D;  1TNP A;  2LVK A;  2WOR A;  1WDC C;  1RRO A;  1WY9 A;  2I94 A;  3I5G C;  1CFP A;  1CLM A;  1J7Q A;  2OTG B;  1IRJ A;  4PHK A;  2F3Y A;  1ALV A;  2ZRS A;  5F6T A;  1IQ5 A;  1EG3 A;  4IL1 A;  1B4C A;  1J55 A;  4PE0 A;  1SKT A;  2L0P A;  3TDZ A;  5DKQ A;  3RM1 A;  1A29 A;  4YGA A;  4AQJ A;  2KAX A;  3TDU A;  4AOM A;  1SCM C;  4PHN A;  1F8H A;  4XYN A;  1YUS A;  2K8M B;  1ALW A;  1CDL A;  2DOQ A;  3PAT A;  1CDP A;  4PDZ A;  1KFX L;  1YVL A;  4WQ2 A;  4GNK B;  1Y1U A;  2MLF C;  1OE9 B;  2A4J A;  2LVJ A;  4YGD B;  4MEW A;  1RFJ A;  1PSB A;  2LMT A;  3BYA A;  3TS5 B;  3BXK A;  1AP4 A;  1YUR A;  1SL8 A;  3BUM B;  1OOJ A;  1TIZ A;  1CKK A;  1S3P A;  2KGB C;  3CWG A;  1REC A;  1SCV A;  5AAN A;  1KQV A;  2BE4 A;  3SG7 A;  2L2E A;  3EVR A;  4UPG A;  3LLE A;  1L2O B;  1RTP 1;  1F71 A;  1DJW A;  3PM8 A;  4GGF A;  1ZAC A;  2E30 A;  3BOW B;  1M31 A;  1AJ5 A;  3PLF B;  2LUX A;  3FIA A;  2BEC A;  1SY9 A;  2JRF A;  1A75 A;  3PAL A;  1JBA A;  1LA3 A;  1XFV O;  2KNE A;  4DUQ A;  2RGI A;  2VRG A;  4MZL A;  2KI4 B;  2F33 A;  2LP2 A;  1G8I A;  2K0J A;  5AER A;  1QX2 A;  2F2P A;  2KI6 C;  4DIR A;  2E6W A;  2BKI B;  1XFU O;  4FTG A;  4NQG A;  1CTR A;  1Y1A A;  1YUT A;  2HET A;  2WOS A;  2FOT A;  4ICB A;  1PVB A;  3GOF A;  4DCK A;  2LVI A;  2MLE C;  3A8R A;  2JNX A;  2NLN A;  5CPV A;  1PRW A;  1CLL A;  5KU1 A;  4NDC A;  1EH2 A;  1DT7 B;  3BUW B;  1M45 A;  1MXE A;  4N1G A;  1S26 D;  4P5O E;  2ZN8 A;  3H4S E;  4USL A;  1BJF A;  1QJT A;  2H2K A;  2CT9 A;  3EK4 A;  4MBE A;  4R1E A;  2FCD A;  2LMU A;  2M97 A;  3EKH A;  3SG5 A;  2JPT A;  2LHI A;  2BL0 B;  3JVT C;  3EK7 A;  4PHM A;  3JTD B;  4E68 A;  1ZOT B;  3SG3 A;  2HQ8 A;  3VRO A;  1U5I A;  2EC6 B;  2LAN A;  2MAZ A;  1MXL C;  5BPJ A;  2ZRT A;  2L98 A;  1CFC A;  4XJK B;  1E8A A;  3CS1 A;  1KWO C;  3TUY B;  4CPV A;  1GJY A;  1QXP A;  2LLT A;  3VRP A;  2KI6 D;  1QS7 A;  2MHH A;  4PAL A;  5FYX A;  1EJ3 A;  1TNX A;  2Y1M A;  3NSL A;  1ZMZ A;  1KCY A;  1K8U A;  2EGD A;  2K2A A;  2LV7 A;  3BUX B;  2HF5 A;  4ORA B;  1RWY A;  1BR1 B;  5ER4 X;  5I8N A;  2PVB A;  4NDD A;  5KSZ A;  1UP5 A;  1SR6 B;  2CXJ A;  4PE7 A;  4TNC A;  3SIA A;  2SCP A;  4Q04 A;  1ODB A;  5HKZ A;  1IJ5 A;  1SK6 D;  4C0L A;  3WHT B;  1PVA A;  4GGN A;  3KO0 A;  1GGW A;  3O6B A;  2KHN A;  2M7L A;  2AUC A;  4N1F A;  3EVU A;  4I5L B;  4MRX A;  3PN7 B;  3ICB A;  3CR4 X;  3VRQ A;  3PSR A;  1NX1 A;  1J1D A;  4QJ4 B;  2I18 A;  3DD4 A;  1FF1 A;  2PAS A;  1TCF A;  2KGR A;  3I5H C;  2QPT A;  1R2U A;  3ZWH A;  1WLZ A;  1IQ3 A;  1WDC B;  1K96 A;  3I5G B;  2OS8 C;  1DF0 A;  2ZND A;  3OB1 B;  4ETO A;  1M39 A;  1CLB A;  4CLN A;  1KK8 C;  1YRU B;  2QAC A;  1B8R A;  3HX4 A;  1SBJ A;  2JXL A;  2LMV A;  4ORC B;  2Q4U A;  5JJG A;  1SCM B;  4MVF A;  1JWD A;  2KYF A;  2BCB A;  1IWQ A;  4GUK A;  2BE6 A;  5G08 A;  3SJS A;  5HLO A;  2JZI A;  3SG2 A;  2AMI A;  2KFG A;  5K89 A;  1JSA A;  3CR2 A;  2JU0 A;  3I5F C;  1KSM A;  1FW4 A;  2CBL A;  1MR8 A;  1A4P A;  1VRK A;  1KFU L;  2MBX A;  1DGV A;  1YRT B;  1JF0 A;  1YTZ C;  4DRW A;  5DKR A;  1FPW A;  5B8I B;  4I5J A;  1F4O A;  3M0W A;  1PK0 D;  1JFK A;  1KSO A;  1W7J B;  1UHH A;  4JWQ A;  1YUU A;  1XO5 A;  5JOL A;  1TTX A;  3O78 A;  2ZKM X;  2KOT A;  1BU3 A;  1WRK A;  2R2I A;  2WCF A;  1G4Y R;  2OTG C;  4HSZ A;  2GGZ A;  1NP8 A;  5CSI A;  2G9B A;  1OSA A;  1ZFS A;  1DJX A;  3D10 A;  1NX3 A;  2LP3 A;  4WQ3 A;  3SG6 A;  1UWO A;  4MRY A;  1MHO A;  2CCM A;  1AHR A;  1NCZ A;  1M46 A;  1Q80 A;  1EL4 A;  1MUX A;  3AKB A;  2BBM A;  3VGO A;  2LAP A;  2TN4 A;  4U8D A;  2M0R A;  2F8P A;  3O4Y A;  1Y1X A;  2LC5 A;  1TNQ A;  4FQO A;  4QJ5 B;  3SIB A;  2WCB A;  1N0Y A;  2KQ6 A;  1KQM C;  1NSH A;  3C1V A;  4ZCV A;  3DF0 A;  1J7P A;  1SW8 A;  1KFX S;  2LVV A;  1JC2 A;  3OX6 A;  2JUL A;  4MSP A;  2K7C A;  1UHI A;  3D0Y A;  4ZCU A;  1S6C A;  2M3W A;  1OMV A;  1V1F A;  1DMO A;  4OVN F;  3AKA A;  2JNF A;  4BY5 A;  3A4U B;  2AAO A;  1LXF C;  2JTZ A;  4QJ3 B;  3RLZ A;  3VRR A;  5PAL A;  4HRE E;  1BOD A;  1NUB A;  2CTN A;  2NZ0 A;  3JVT B;  2L4H A;  2JC2 A;  1K94 A;  1SRA A;  1UHK A;  3FWC A;  5HYD A;  1DGU A;  3NXA A;  1CMF A;  1KWO B;  1C07 A;  1XA5 A;  2H61 A;  2GV5 A;  1NWD A;  1CNP A;  1S1E A;  4MLW A;  1NCY A;  1NPQ A;  1H8B A;  4GAO A;  5TNC A;  5I2O A;  1DJI A;  3QRX A;  1LA0 A;  5AEQ A;  2K7B A;  2M29 A;  1V1G A;  5KTY A;  1SL9 A;  1SYM A;  3AAK A;  1DJG A;  1QAT A;  1QVI Y;  1XFW O;  4YI8 A;  1BR4 B;  1B47 A;  1Y0V H;  3VRN A;  2LUC A;  1TNW A;  2L5X B;  1KK7 Y;  2M9G A;  1A75 B;  1TCO B;  3LK1 A;  3JTD C;  1AK8 A;  1TOP A;  1YR5 A;  4MN0 A;  1K9K A;  1K95 A;  3NSK A;  1QAS A;  1BG1 A;  3I5I C;  2LCP A;  2SAS A;  5AFP A;  2F2O A;  3CZT X;  4GPL B;  1FI6 A;  1OQP A;  1BMO A;  2BKH B;  3I5H B;  3WHU B;  1CB1 A;  2BCX A;  1F54 A;  1XFX O;  2JT3 A;  2OS8 B;  3K21 A;  3TZ1 A;  1KK8 B;  1QIV A;  2WC8 A;  2HQW A;  3KHE A;  1JF2 A;  3BOW A;  1IH0 A;  3SG4 A;  3AAJ A;  1NIW A;  1QLK A;  1UUS A;  1K9P A;  3BUN B;  4PE1 A;  1LIN A;  3KPX A;  2L4I A;  3OX5 A;  1K2H A;  2WND A;  4M2Q A;  1CDM A;  1YX8 A;  1CM1 A;  1B7T Y;  1XYD A;  2WCE A;  1PUL A;  1XVJ A;  1PAL A;  3I5F B;  1QV1 A;  1MQ1 A;  3IQO A;  4GFT A;  5HKW A;  3OB2 B;  4AQI A;  3DVE A;  1S6I A;  4YRU A;  1YX7 A;  2G2B A;  1LVC D;  3KF9 A;  1U5I B;  4F0Z B;  1DJY A;  1UHJ A;  1K9U A;  2IS9 A;  4HRG A;  2MRD A;  1XFY O;  1NYA A;  2JT0 A;  2H61 C;  1OMD A;  2Y5I A;  3GK4 X;  4L9M A;  1CFF A;  1SMG A;  5D69 A;  1UHN A;  3NSI A;  3DVK A;  2FJU B;  3DVJ A;  2KFH A;  4M2P A;  1K93 D;  1S5G Y;  3DVM A;  4HRH A;  1OMR A;  2KQY A;  2FCE A;  5GQQ C;  1N2D A;  2ZN9 A;  2BBN A;  2LLS A;  3WXA A;  4P2Y B;  2COL B;  1R6P A;  4JPZ B;  5HLV A;  3WNX B;  1M63 B;  2ZFD A;  4XJK A;  1BOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...