1QLSA

S100c (s100a11),or calgizzarin, in complex with annexin i n-terminus
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
95
structure length
95
Chain Sequence
PTETERCIESLIAIFQKHAGRDGNNTKISKTEFLIFMNTELAAFTQNQKDPGVLDRMMKKLDLDSDGQLDFQEFLNLIGGLAIACHDSFIKSTQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S100C PROTEIN
publication title Structural Basis of the Ca2+ Dependent Association between S100C (S100A11) and its Target, the N-Terminal Part of Annexin I
pubmed doi rcsb
source organism Sus scrofa
molecule tags Metal-binding protein/inhibitor
total genus 37
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 1999-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1qlsA00
1WRKA 2NCPA 3QRXA 1TTXA 3NXAA 1YRUB 2PSRA 1K9KA 3CZTX 1SYMA 1L2OB 2JXLA 2LMUA 2ZN9A 3ZWHA 1N65A 1TOPA 1XFXO 3SIAA 1DF0B 1A2XA 2O5GA 1CNPA 2K7DA 2LVJA 4PHJA 1G4YR 2JT0A 2WCFA 3TS5C 2LLSA 1QV1A 1TCFA 2HQ8A 2D8NA 1C07A 3WHTB 3NSLA 1G33A 1XYDA 1X02A 2KFFA 3HCMA 4PHNA 2AAOA 1ZUZA 3DVKA 1TNWA 3WXAA 1EG4A 1KFXL 4DS7A 1BODA 3NSOA 5AFPA 5HKZA 1DJYA 3SG2A 1CFDA 3OB1B 3JTDC 4YGAA 4N1GA 2LAPA 1D1OA 4MVFA 4E68A 1F4OA 3EKJA 2JWWA 3DF0B 1B8LA 2I18A 4MSPA 1FF1A 2ZKMX 3GK4X 3VRNA 1N0YA 1CLLA 3BUXB 5FYXA 3IQQA 3VROA 1CMFA 1WLZA 2K2AA 2KI4C 3EVVA 3VRRA 3TDUA 3LK0A 3ICBA 1LINA 4MZJA 2M0RA 1UWOA 1S6JA 1ZMZA 2ZN8A 2OTGC 3I5GC 1KSMA 3OP0A 1YVLA 2CCMA 2KYCA 1R2UA 1IQ3A 4GGFA 4HSZA 1M31A 4M2PA 1J7RA 1JUOA 1F54A 1QX2A 2EC6C 5I2LA 2M1UA 1UHKA 4MBEA 5TNCA 2LLTA 2M97A 2Q91A 2M1KB 2M7NA 1CFPA 1OZSA 1Y1XA 1GGZA 5PALA 5JJGA 1F8HA 2JNFA 5AXIA 1AUIB 5HLVA 1CDNA 1QASA 4ICBA 4Q04A 3DVMA 1SPYA 1HT9A 3JVTC 4XYNA 2JT8A 2MAZA 4PHMA 4CIDA 1KCYA 3A4UB 3O4YA 1IJ6A 1QLSA 2LVKA 4R1EA 1B9AA 4UPGA 4CLNA 1AK8A 1SRAA 1LVCD 4YI9A 1R6PA 3PATA 5KSZA 1EL4A 4OKHA 2BKHB 3TS5B 1NPQA 1EH2A 1BR4B 1XK4C 1BT6A 2KGRA 1NX2A 1IWQA 1IGVA 1UHJA 3RLZA 4CFRA 1J7QA 2LHLA 1SK6D 1AHRA 1YX7A 2ZRSA 1CDMA 4JWQA 2CTNA 1UP5A 2LLUA 1KQVA 1WDCC 2BBMA 3JTDB 3FIAA 5CSFA 2FOTA 1PSRA 1FW4A 2E30A 1KQMC 2I7AA 2ZNDA 4GUKA 3O6BA 1LKJA 4M2QA 1F55A 1EG3A 3VRQA 3PSRA 1TNXA 1Y1UA 2FCEA 1J1DA 3TDZA 5G08A 1QX7A 2GGZA 5KTYA 1SL8A 1WLMA 1S6IA 2MA2A 1B7TY 1QS7A 1SW8A 2F3YA 2JOJA 3D0YB 2BCBA 4PCWA 4YGDB 4A4BA 1PALA 2HETA 1YURA 1TNPA 1Y1AA 3TZ1A 1IG5A 3H4SE 2LE9B 2K61A 1XFZO 2MRDA 2LNKA 1FBVA 2KNEA 2JNXA 4XJKB 2CT9A 3PN7C 4ZCUA 1OMRA 3KO0A 4PDZA 4ETOA 2F3ZA 5DKRA 2EGDA 1DF0A 2K8MB 2LANA 1CB1A 4GNKB 1KWOC 2CXJA 2H61A 4HRHA 2BECA 1A75B 1NCYA 3E3RA 1SMGA 2JRFA 1DGVA 1ZFSA 1JFJA 2JTTA 2KBMA 3BUOB 5AERA 1DVIA 2F2PA 4GBAA 4AOMA 4NDDA 4I5NB 1BLQA 1IJ5A 4MRYA 1PK0D 1SR6C 4PHKA 1L7ZA 3FWBA 1J7OA 1YX8A 1MUXA 1QVIY 1M63B 1Y6WA 1FI5A 3CLNA 5F6TA 1M39A 3DF0A 2BE4A 1FPWA 3ZNIA 2K2FA 1NYAA 3LLEA 1UUSA 2K0JA 3K21A 2KYFA 1GJYA 1IH0A 2NLNA 3AAJA 4DIRA 4DRWA 5I2OA 1PSBA 1WDCB 3I5HC 3OX5A 1S36A 1SCMC 2PRUA 2PVBA 4L9MA 4AQJA 1RK9A 3TUYC 1KQMB 2KAXA 4YRUA 2JT3A 4TNCA 1MQ1A 2M9GA 3EK8A 2KFHA 3D10A 2L2EA 5CPVA 2L51A 1NP8A 1WRZA 1OSAA 1TN4A 2KSPA 3BUMB 2AMIA 2KQ6A 5IBWA 1TRFA 2WCEA 2L4HA 1CDPA 2IS9A 1QJTA 1OQPA 5ER4X 2WOSA 3F45A 3VRPA 1K90D 2V53A 1K95A 2BE6A 4HREE 4NQGA 1DGUA 4I5LB 3C1VA 3EK4A 4ORAB 1YUTA 2M3WA 3DVJA 4QJ4B 4AQIA 4C0KA 1G8IA 1MXLC 1W7JB 1CM4A 2L0PA 1K9UA 1HQVA 1B47A 2LUCA 1YUUA 1NCZA 1YUSA 1KWOB 1XFUO 3PM8A 3FS7A 4MRXA 1ALWA 4BY4A 5DKQA 4I5KA 1KFUS 1B4CA 1JC2A 1TIZA 3O78A 2KFGA 2B1UA 1Y0VH 4JPZB 1B7TZ 1U5IB 4GAOA 5I2QA 2NCOA 3GOFA 1QIVA 2LUXA 4NDCA 4QJ5B 3IQOA 3OB2B 2KI6C 3TDIA 2OS8C 3BUNB 3SJSA 2WNDA 1OZOA 1LXFC 2M8UA 3IF7A 1JF2A 2KGBC 4PE4A 4YGEB 1DT7B 5HKWA 2BL0C 1DJGA 4N5XA 3I5IC 3D0YA 3AAKA 3CR5X 3O2PA 4QJ3B 3VGOA 1OMDA 1SCVA 3CS1A 1BG1A 1OE9B 2COLB 3CWGA 4MZKA 1F71A 3PALA 2BKIB 4YBHB 2NXQA 4MLWA 4XJKA 3BOWB 1BF5A 2LM5A 1QTXA 2KBIA 5BPJA 1JWDA 3CR4X 4YGCB 1QVIZ 3CR2A 1IRJA 5ER5A 2KI4B 1IQ5A 2LP3A 1BR1B 2L50A 5AANA 1CFCA 4OR9B 2SASA 1NCXA 1A75A 2LVVA 1BU3A 1S6CA 1XFWO 3BQ3A 2OTGB 4M2OA 3I5GB 5CSJA 1JBAA 1B8CA 4PALA 1CDLA 1QATA 1RTP1 1KK8C 2KQYA 2EC6B 1MWNA 1S5GY 2G9BA 2I94A 4P5OE 4F0ZB 4GGNA 3KHEA 1J7PA 4OVNF 1RROA 1WY9A 3RM1A 1BOCA 1YRTB 3EVUA 3SIBA 1PRWA 3GK2A 1NX3A 1ZACA 3SG6A 2L98A 1JSAA 4U8DA 2M49B 3JVTB 1MF8B 1CM1A 2K7CA 4A4CA 3MSEB 2R2IA 1NWDA 1J1EA 2QPTA 1ODBA 2KDHA 1XFVO 4CPVA 1E8AA 1SBJA 2LCPA 4C0JA 2H2KA 1XO5A 2L4IA 2BL0B 3CGAA 2JXCA 4MN0A 1DMOA 2I2RE 3CTNA 2CNPA 1NIWA 2WORA 1RFJA 4ZCVA 1OMVA 1CLBA 3SG3A 2JQ6A 1XFYO 1RJVA 5HLOA 1DTLA 1S26D 1C7WA 2LMTA 4DCKA 3WHUB 4GPLB 5D69A 1DJZA 1K9PA 1CKKA 1KFUL 5JOLA 2GGMA 2JULA 2LHIA 2LC5A 3LCPC 1SNLA 4MEWA 4DUQA 2LP2A 1A4PA 4CFQA 1F4QA 2FJUB 1NSHA 4JQ0D 1GGWA 1Q80A 1KK7Y 3KEVA 3A8RA 1K2HA 4PE0A 1NUBA 5J3XA 4GGFC 2ISDA 1YTZC 2BBNA 3DVEA 3M0WA 5K89A 3WNXB 2ZFDA 1MR8A 1U5IA 2GV5A 1KK8B 2F8PA 3NSKA 1FI6A 1V1FA 4ORCB 4FQOA 1F70A 1ZOTB 3OHMB 1PULA 3PN7B 3KF9A 1LA0A 2SCPA 1SY9A 3SG5A 1PVBA 1IKUA 1UHHA 1DJIA 2JZIA 2PASA 1ALVA 2Y1NA 2KOTA 1JFKA 2QACA 2HQWA 2ZNEA 3BUWB 2M29A 3BYAA 2MLEC 4WRIA 2WCBA 4P2YB 2LV7A 4WQ3A 1WRLA 1CMGA 1DJXA 1SR6B 1J55A 1S1EA 2KHNA 2TN4A 2F2OA 4N1FA 1XVJA 2MJWB 1K96A 3BOWA 1AVSA 1S5GZ 1SL9A 3FWCA 1XA5A 4I5JA 2ZRTA 4MZLA 1H8BA 1OOJA 3BXKA 2HF5A 1B8RA 3NSIA 1NX0A 1LA3A 2Y5IA 3DD4A 5CSNA 4HRGA 3LL8B 4YGBB 3I5HB 3TUYB 3AKAA 1SCMB 4OCIA 2BCXA 3EK7A 1C7VA 1EXRA 1QXPA 1EJ3A 1KFXS 3EVRA 4GFTA 1BJFA 1AJ4A 1UHIA 3LK1A 2MHHA 1SKTA 2KI6D 5HYDA 1RWYA 1UURA 1UHNA 1SL7A 3PFVA 3I5FC 1TCOB 1BMOA 1CLMA 2P6BB 1MHOA 2JU0A 2EHBA 4YI8A 2PMYA 4D1EA 5DKNA 1W7IB 2MBXA 1JF0A 1L2OC 4PE1A 3SG7A 1K8UA 1A03A 2F33A 4C0LA 2HPSA 2O60A 1YR5A 2H61C 1QLKA 2Y1MA 2WC8A 1V1GA 2PALA 3OX6A 4WQ2A 2JTZA 2BCAA 2LMVA 1NX1A 2DOQA 5AEQA 2OPOA 1A29A 1DJWA 1XK4A 2NZ0A 1VRKA 1QIWA 1KK7Z 3KPXA 1KSOA 1QX5B 1RECA 2LVIA 4PE7A 1YVHA 2G2BA 1GQMA 2L5XB 1H4BA 4NDBA 1B1GA 2AUCA 1CFFA 2VRGA 1QV0A 1M46A 2MLFC 1K93D 2Q4UA 3HX4A 3PLFB 1N2DA 5CSIA 2OS8B 2Y4QA 2M7LA 1S3PA 4IL1A 5GQQC 2E6WA 1CTRA 4ORBB 1AP4A 4BY5A 2RGIA 1MXEA 1M45A 2K7BA 3I5IB 4USLA 3EKHA 2KAVA 2CBLA 1K94A 1DJHA 2K7OA 1TNQA 5D7FA 3GK1A 5KU1A 3AKBA 2JPTA 5HKYA 4FTGA 4OV2A 2KAYA 3SG4A 2A4JA 2FCDA 1AJ5A 2JC2A 5B8IB 1PVAA 3I5FB 5I8NA
chains in the Genus database with same CATH superfamily
1WRKA 2NCPA 3QRXA 3FE6A 4INXA 3B6XA 1TTXA 3NXAA 1YRUB 2PSRA 1K9KA 3CZTX 1SYMA 1L2OB 2JXLA 2LMUA 2ZN9A 3ZWHA 1N65A 1TOPA 1XFXO 3SIAA 1DF0B 1A2XA 2O5GA 1CNPA 2K7DA 2LVJA 4PHJA 1G4YR 2JT0A 2WCFA 3TS5C 2LLSA 1QV1A 1TCFA 2HQ8A 2D8NA 1C07A 3WHTB 3NSLA 1G33A 1XYDA 1X02A 2KFFA 3HCMA 4PHNA 2AAOA 1ZUZA 3DVKA 1TNWA 3WXAA 1EG4A 1KFXL 4DS7A 1BODA 3NSOA 5AFPA 5HKZA 1DJYA 3SG2A 2P70A 1CFDA 3OB1B 3JTDC 4YGAA 4N1GA 2LAPA 1D1OA 4MVFA 4E68A 1F4OA 3EKJA 2JWWA 3DF0B 1B8LA 2I18A 4MSPA 1FF1A 2ZKMX 3GK4X 3VRNA 1N0YA 1CLLA 1QWVA 2L2CA 3BUXB 3K1EA 3IQQA 5FYXA 3VROA 1WLZA 2K2AA 2KI4C 3EVVA 3VRRA 1CMFA 3TDUA 3LK0A 3ICBA 1LINA 3O4XA 4MZJA 2M0RA 5FI7A 1UWOA 1S6JA 1ZMZA 2ZN8A 2OTGC 3NHTA 3I5GC 1KSMA 3OP0A 1YVLA 2CCMA 2KYCA 1R2UA 1IQ3A 4GGFA 4HSZA 1M31A 3S0BA 4M2PA 1J7RA 3D75A 1JUOA 1ORGA 2P71A 2WCJA 1F54A 1QX2A 2EC6C 5I2LA 2M1UA 1UHKA 4IJ7A 4MBEA 5TNCA 2LLTA 2M97A 2Q91A 2M1KB 2M7NA 1CFPA 1OZSA 1Y1XA 1GGZA 5PALA 5JJGA 1F8HA 2JNFA 3BFAA 5AXIA 1AUIB 5HLVA 1CDNA 1QASA 2KPHA 4ICBA 4Q04A 1OOGA 3DVMA 1SPYA 1HT9A 3JVTC 4XYNA 2JT8A 2MAZA 4PHMA 4CIDA 1KCYA 3A4UB 3O4YA 1IJ6A 3CDNA 1QLSA 2LVKA 4R1EA 1B9AA 4UPGA 4CLNA 1AK8A 1SRAA 1LVCD 4YI9A 1R6PA 2WCLA 3N7HA 3PATA 5KSZA 1EL4A 4OKHA 2BKHB 3TS5B 1NPQA 1EH2A 1BR4B 1XK4C 1BT6A 2KGRA 1NX2A 1IWQA 1IGVA 1UHJA 3RLZA 4CFRA 1J7QA 3L47A 2LHLA 1YX7A 1SK6D 1AHRA 2ZRSA 1CDMA 4JWQA 2CTNA 1UP5A 2LLUA 1KQVA 1WDCC 5D3OA 2BBMA 3JTDB 3FIAA 5CSFA 2FOTA 1PSRA 1FW4A 2E30A 1KQMC 2I7AA 2ZNDA 3FE8A 3O6BA 4GUKA 1LKJA 3QMEA 4M2QA 1F55A 1EG3A 3VRQA 3PSRA 3R1PA 3CABA 1TUJA 3D76A 2WCHA 2ERBA 1TNXA 3BJHA 1Y1UA 2FCEA 1J1DA 3TDZA 5G08A 1QX7A 2GGZA 5KTYA 1SL8A 2GTEA 1WLMA 1S6IA 2MA2A 1B7TY 1QS7A 1SW8A 2F3YA 2JOJA 3D0YB 2BCBA 4PCWA 4YGDB 4F7FA 4A4BA 1PALA 2HETA 1YURA 1TNPA 1Y1AA 3TZ1A 1IG5A 3SS3A 3H4SE 2LE9B 2K61A 1XFZO 2MRDA 2LNKA 1FBVA 2KNEA 2JNXA 4XJKB 2CT9A 3PN7C 4ZCUA 1OMRA 3KO0A 4PDZA 4ETOA 2F3ZA 5DKRA 2EGDA 1DF0A 2K8MB 2LANA 1CB1A 4GNKB 1KWOC 2CXJA 2H61A 4HRHA 2BECA 1A75B 1NCYA 3E3RA 1SMGA 2JRFA 1DGVA 1ZFSA 1JFJA 2JTTA 2KBMA 3BUOB 5AERA 1DVIA 2F2PA 4GBAA 4AOMA 4NDDA 4I5NB 1BLQA 1IJ5A 1DEKA 4MRYA 1PK0D 1SR6C 4PHKA 1L7ZA 3FWBA 1J7OA 3CZ0A 1YX8A 1MUXA 1QVIY 1M63B 1Y6WA 1FI5A 3CLNA 5F6TA 1M39A 3DF0A 2BE4A 1FPWA 3ZNIA 2K2FA 1NYAA 3LLEA 1UUSA 1SSEB 2K0JA 2KYFA 1GJYA 3K21A 3UNWA 1IH0A 3CYZA 2NLNA 3AAJA 2WCMA 4DIRA 4DRWA 5I2OA 1PSBA 1WDCB 3I5HC 3OX5A 1S36A 1SCMC 2PRUA 2PVBA 4L9MA 4AQJA 1RK9A 3TUYC 1KQMB 2KAXA 4YRUA 2JT3A 4TNCA 1MQ1A 2M9GA 3EK8A 2KFHA 3D10A 3NGVA 2L2EA 5CPVA 2L51A 1NP8A 1WRZA 3OGNA 1OSAA 1TN4A 2KSPA 3BUMB 2AMIA 2KQ6A 3PM2A 5IBWA 1TRFA 2WCEA 3S0FA 2L4HA 1CDPA 2IS9A 3Q8IA 1QJTA 3R72A 3L4LA 1OQPA 2H8VA 5ER4X 2WOSA 3F45A 3VRPA 1GM0A 1K90D 2V53A 1K95A 4FQTA 2BE6A 3DY9A 4HREE 4NQGA 1DGUA 4I5LB 3C1VA 3EK4A 4ORAB 1YUTA 2M3WA 3DVJA 4QJ4B 4AQIA 4C0KA 1G8IA 1MXLC 1W7JB 1CM4A 3PJIA 2L0PA 1K9UA 1XFRA 1HQVA 1B47A 1OOFA 2LUCA 3D74A 1YUUA 1NCZA 1YUSA 3V2LA 1KWOB 1XFUO 3PM8A 3D77A 3SS5A 3FS7A 4MRXA 1ALWA 4BY4A 5DKQA 5HL1A 4I5KA 1KFUS 3CZ1A 1B4CA 1JC2A 1TIZA 3O78A 2KFGA 2B1UA 1Y0VH 1TWOA 4JPZB 1B7TZ 1U5IB 4GAOA 2KLDA 5I2QA 2NCOA 3GOFA 1QIVA 3DXLA 5I94A 2LUXA 4NDCA 4QJ5B 3IQOA 3OB2B 2KI6C 3TDIA 2OS8C 3BUNB 3SJSA 2WNDA 1OZOA 1LXFC 2M8UA 2PYQA 3IF7A 1JF2A 2KGBC 4PE4A 4YGEB 1DT7B 5HKWA 1DJGA 2BL0C 5EL2A 4N5XA 3I5IC 3D0YA 3AAKA 3CR5X 3O2PA 4QJ3B 3VGOA 1OMDA 1SCVA 3CS1A 1BG1A 1OE9B 2COLB 3CWGA 4MZKA 1F71A 3PALA 2BKIB 4YBHB 2NXQA 4MLWA 4XJKA 3BOWB 1BF5A 2LM5A 1QTXA 2KBIA 5BPJA 1JWDA 3CR4X 4YGCB 1QVIZ 2QDIA 3CR2A 1IRJA 4OZDA 5ER5A 2KI4B 1IQ5A 2LP3A 1BR1B 2L50A 1DQEA 5AANA 1CFCA 4OR9B 2SASA 1NCXA 1A75A 2LVVA 2L5YA 1BU3A 2K60A 3OBVA 1S6CA 1XFWO 3BQ3A 2OTGB 4M2OA 3I5GB 5CSJA 1JBAA 1B8CA 3IVTA 1OOHA 5DICA 2WC6A 4PALA 1CDLA 2QEVA 1QATA 4INWA 2WCKA 1RTP1 1KK8C 2KQYA 1LS8A 2EC6B 1MWNA 1S5GY 1Z2CB 2G9BA 3NHIA 2I94A 4P5OE 3UO9A 4F0ZB 4GGNA 3KHEA 1J7PA 2KLEA 4OVNF 1RROA 1WY9A 3RM1A 1BOCA 1YRTB 3S0GA 3EVUA 3SIBA 1PRWA 3GK2A 1NX3A 1ZACA 1OW4A 3SG6A 2L98A 1JSAA 4U8DA 2M49B 3JVTB 1MF8B 1CM1A 3R1VA 2K7CA 4A4CA 3MSEB 2QEHA 2R2IA 1NWDA 1J1EA 2QPTA 1ODBA 2KDHA 1DELA 1XFVO 4CPVA 1E8AA 1SBJA 2LCPA 4C0JA 2H2KA 3D78A 1XO5A 2L4IA 2BL0B 3CGAA 2JXCA 4MN0A 1DMOA 2I2RE 1Z4HA 3CTNA 2CNPA 1NIWA 2WORA 1RFJA 4ZCVA 1C3YA 3R1OA 1OMVA 5FI2A 1CLBA 3SG3A 2JQ6A 1XFYO 1RJVA 5HLOA 1DTLA 1S26D 1C7WA 2LMTA 4DCKA 3WHUB 3RZSA 4GPLB 5D69A 1DJZA 1K9PA 1CKKA 3L4AA 1KFUL 3DYEA 5JOLA 3S0EA 2GGMA 2JULA 2LHIA 2LC5A 3LCPC 1SNLA 4MEWA 4DUQA 2LP2A 1A4PA 4CFQA 1F4QA 2FJUB 1T14A 1NSHA 4JQ0D 1GGWA 1Q80A 1KK7Y 3KEVA 3A8RA 1K2HA 4PE0A 1NUBA 5J3XA 4GGFC 2ISDA 1YTZC 2BBNA 3DVEA 3M0WA 5K89A 3WNXB 2ZFDA 1MR8A 1U5IA 2GV5A 1KK8B 2F8PA 3NSKA 1FI6A 3D73A 1V1FA 2QEBA 4ORCB 1TUZA 4FQOA 1F70A 1ZOTB 3OHMB 1PULA 3PN7B 3KF9A 2PQLA 1LA0A 2SCPA 1SY9A 3SG5A 1PVBA 1IKUA 1UHHA 1DJIA 2JZIA 2PASA 1ALVA 2Y1NA 2KOTA 1JFKA 2QACA 2HQWA 2ZNEA 3BUWB 1OOIX 2M29A 3BYAA 2MLEC 4WRIA 2WCBA 4P2YB 2LV7A 4WQ3A 1WRLA 1CMGA 1DJXA 1SR6B 1J55A 1S1EA 2KHNA 2BAPA 2TN4A 2F2OA 4N1FA 1XVJA 2MJWB 1K96A 3BOWA 1AVSA 1S5GZ 1SL9A 3FWCA 1XA5A 4I5JA 2ZRTA 4MZLA 1H8BA 1OOJA 3BXKA 3S0AA 2HF5A 1B8RA 3NSIA 1NX0A 1LA3A 2Y5IA 3DD4A 5CSNA 4HRGA 3LL8B 4YGBB 3I5HB 3TUYB 3AKAA 1SCMB 4OCIA 2BCXA 3EK7A 1C7VA 1EXRA 1QXPA 1EJ3A 1KFXS 3EVRA 4GFTA 1BJFA 3BFBA 1AJ4A 2QEOA 1UHIA 1W9ZA 3LK1A 2MHHA 1SKTA 2KI6D 5HYDA 1IIOA 4JKTA 1RWYA 1UURA 1UHNA 1SL7A 3PFVA 3I5FC 1TCOB 1BMOA 1CLMA 2FJYA 2P6BB 1MHOA 2JU0A 2EHBA 4YI8A 2PMYA 4D1EA 5DKNA 1W7IB 2MBXA 3B7AA 1JF0A 1L2OC 4PE1A 3B87A 3SG7A 1K8UA 1A03A 2F33A 4C0LA 2HPSA 2O60A 1YR5A 3B86A 2H61C 3B88A 1QLKA 2Y1MA 3SS4A 2WC8A 1V1GA 2PALA 3OX6A 4WQ2A 2JTZA 2BCAA 2LMVA 1NX1A 2DOQA 5AEQA 2OPOA 1A29A 1DJWA 1XK4A 2NZ0A 5FI6A 1VRKA 1QIWA 1KK7Z 3KPXA 1KSOA 1QX5B 1RECA 2LVIA 4PE7A 1YVHA 2G2BA 1GQMA 3S0DA 2L5XB 1H4BA 4NDBA 1B1GA 1C3ZA 4PT1A 2AUCA 1CFFA 2VRGA 3CZ2A 1QV0A 1M46A 2MLFC 1K93D 2JPOA 2Q4UA 3HX4A 3PLFB 1N2DA 5CSIA 2OS8B 2Y4QA 2M7LA 1S3PA 3BFHA 4IL1A 5GQQC 2E6WA 3DZTA 1CTRA 4JD9A 4ORBB 2WC5A 1P28A 4BY5A 1AP4A 2RGIA 1MXEA 1M45A 2K7BA 3I5IB 4USLA 3EKHA 2KAVA 2CBLA 1K94A 2YGUA 3VB1A 1DJHA 2K7OA 1TNQA 5D7FA 3FE9A 3GK1A 5KU1A 3AKBA 2JPTA 4KYNA 5HKYA 2BNXA 4FTGA 4OV2A 2KAYA 3SG4A 2A4JA 2FCDA 1AJ5A 2JC2A 5B8IB 1PVAA 3I5FB 3EG5B 1DC1A 5I8NA
chains in the Genus database with same CATH topology
1WRKA 2NCPA 3QRXA 1TTXA 3NXAA 1YRUB 2PSRA 1K9KA 3CZTX 1SYMA 1L2OB 2JXLA 2LMUA 2ZN9A 3ZWHA 1N65A 1TOPA 1XFXO 3SIAA 1DF0B 1A2XA 2O5GA 1CNPA 2K7DA 2LVJA 4PHJA 1G4YR 2JT0A 2WCFA 3TS5C 2LLSA 1QV1A 1TCFA 2HQ8A 2D8NA 1C07A 3WHTB 3NSLA 1G33A 1XYDA 1X02A 2KFFA 3HCMA 4PHNA 2AAOA 1ZUZA 3DVKA 1TNWA 3WXAA 1EG4A 1KFXL 4DS7A 1BODA 3NSOA 5AFPA 5HKZA 1DJYA 3SG2A 1CFDA 3OB1B 3JTDC 4YGAA 4N1GA 2LAPA 1D1OA 4MVFA 4E68A 1F4OA 3EKJA 2JWWA 3DF0B 1B8LA 2I18A 4MSPA 1FF1A 2ZKMX 3GK4X 3VRNA 1N0YA 1CLLA 3BUXB 5FYXA 3IQQA 3VROA 1CMFA 1WLZA 2K2AA 2KI4C 3EVVA 3VRRA 3TDUA 3LK0A 3ICBA 1LINA 4MZJA 2M0RA 1UWOA 1S6JA 1ZMZA 2ZN8A 2OTGC 3I5GC 1KSMA 3OP0A 1YVLA 2CCMA 2KYCA 1R2UA 1IQ3A 4GGFA 4HSZA 1M31A 4M2PA 1J7RA 1JUOA 1F54A 1QX2A 2EC6C 5I2LA 2M1UA 1UHKA 4MBEA 5TNCA 2LLTA 2M97A 2Q91A 2M1KB 2M7NA 1CFPA 1OZSA 1Y1XA 1GGZA 5PALA 5JJGA 1F8HA 2JNFA 5AXIA 1AUIB 5HLVA 1CDNA 1QASA 4ICBA 4Q04A 3DVMA 1SPYA 1HT9A 3JVTC 4XYNA 2JT8A 2MAZA 4PHMA 4CIDA 1KCYA 3A4UB 3O4YA 1IJ6A 1QLSA 2LVKA 4R1EA 1B9AA 4UPGA 4CLNA 1AK8A 1SRAA 1LVCD 4YI9A 1R6PA 3PATA 5KSZA 1EL4A 4OKHA 2BKHB 3TS5B 1NPQA 1EH2A 1BR4B 1XK4C 1BT6A 2KGRA 1NX2A 1IWQA 1IGVA 1UHJA 3RLZA 4CFRA 1J7QA 2LHLA 1SK6D 1AHRA 1YX7A 2ZRSA 1CDMA 4JWQA 2CTNA 1UP5A 2LLUA 1KQVA 1WDCC 2BBMA 3JTDB 3FIAA 5CSFA 2FOTA 1PSRA 1FW4A 2E30A 1KQMC 2I7AA 2ZNDA 4GUKA 3O6BA 1LKJA 4M2QA 1F55A 1EG3A 3VRQA 3PSRA 1TNXA 1Y1UA 2FCEA 1J1DA 3TDZA 5G08A 1QX7A 2GGZA 5KTYA 1SL8A 1WLMA 1S6IA 2MA2A 1B7TY 1QS7A 1SW8A 2F3YA 2JOJA 3D0YB 2BCBA 4PCWA 4YGDB 4A4BA 1PALA 2HETA 1YURA 1TNPA 1Y1AA 3TZ1A 1IG5A 3H4SE 2LE9B 2K61A 1XFZO 2MRDA 2LNKA 1FBVA 2KNEA 2JNXA 4XJKB 2CT9A 3PN7C 4ZCUA 1OMRA 3KO0A 4PDZA 4ETOA 2F3ZA 5DKRA 2EGDA 1DF0A 2K8MB 2LANA 1CB1A 4GNKB 1KWOC 2CXJA 2H61A 4HRHA 2BECA 1A75B 1NCYA 3E3RA 1SMGA 2JRFA 1DGVA 1ZFSA 1JFJA 2JTTA 2KBMA 3BUOB 5AERA 1DVIA 2F2PA 4GBAA 4AOMA 4NDDA 4I5NB 1BLQA 1IJ5A 4MRYA 1PK0D 1SR6C 4PHKA 1L7ZA 3FWBA 1J7OA 1YX8A 1MUXA 1QVIY 1M63B 1Y6WA 1FI5A 3CLNA 5F6TA 1M39A 3DF0A 2BE4A 1FPWA 3ZNIA 2K2FA 1NYAA 3LLEA 1UUSA 2K0JA 3K21A 2KYFA 1GJYA 1IH0A 2NLNA 3AAJA 4DIRA 4DRWA 5I2OA 1PSBA 1WDCB 3I5HC 3OX5A 1S36A 1SCMC 2PRUA 2PVBA 4L9MA 4AQJA 1RK9A 3TUYC 1KQMB 2KAXA 4YRUA 2JT3A 4TNCA 1MQ1A 2M9GA 3EK8A 2KFHA 3D10A 2L2EA 5CPVA 2L51A 1NP8A 1WRZA 1OSAA 1TN4A 2KSPA 3BUMB 2AMIA 2KQ6A 5IBWA 1TRFA 2WCEA 2L4HA 1CDPA 2IS9A 1QJTA 1OQPA 5ER4X 2WOSA 3F45A 3VRPA 1K90D 2V53A 1K95A 2BE6A 4HREE 4NQGA 1DGUA 4I5LB 3C1VA 3EK4A 4ORAB 1YUTA 2M3WA 3DVJA 4QJ4B 4AQIA 4C0KA 1G8IA 1MXLC 1W7JB 1CM4A 2L0PA 1K9UA 1HQVA 1B47A 2LUCA 1YUUA 1NCZA 1YUSA 1KWOB 1XFUO 3PM8A 3FS7A 4MRXA 1ALWA 4BY4A 5DKQA 4I5KA 1KFUS 1B4CA 1JC2A 1TIZA 3O78A 2KFGA 2B1UA 1Y0VH 4JPZB 1B7TZ 1U5IB 4GAOA 5I2QA 2NCOA 3GOFA 1QIVA 2LUXA 4NDCA 4QJ5B 3IQOA 3OB2B 2KI6C 3TDIA 2OS8C 3BUNB 3SJSA 2WNDA 1OZOA 1LXFC 2M8UA 3IF7A 1JF2A 2KGBC 4PE4A 4YGEB 1DT7B 5HKWA 2BL0C 1DJGA 4N5XA 3I5IC 3D0YA 3AAKA 3CR5X 3O2PA 4QJ3B 3VGOA 1OMDA 1SCVA 3CS1A 1BG1A 1OE9B 2COLB 3CWGA 4MZKA 1F71A 3PALA 2BKIB 4YBHB 2NXQA 4MLWA 4XJKA 3BOWB 1BF5A 2LM5A 1QTXA 2KBIA 5BPJA 1JWDA 3CR4X 4YGCB 1QVIZ 3CR2A 1IRJA 5ER5A 2KI4B 1IQ5A 2LP3A 1BR1B 2L50A 5AANA 1CFCA 4OR9B 2SASA 1NCXA 1A75A 2LVVA 1BU3A 1S6CA 1XFWO 3BQ3A 2OTGB 4M2OA 3I5GB 5CSJA 1JBAA 1B8CA 4PALA 1CDLA 1QATA 1RTP1 1KK8C 2KQYA 2EC6B 1MWNA 1S5GY 2G9BA 2I94A 4P5OE 4F0ZB 4GGNA 3KHEA 1J7PA 4OVNF 1RROA 1WY9A 3RM1A 1BOCA 1YRTB 3EVUA 3SIBA 1PRWA 3GK2A 1NX3A 1ZACA 3SG6A 2L98A 1JSAA 4U8DA 2M49B 3JVTB 1MF8B 1CM1A 2K7CA 4A4CA 3MSEB 2R2IA 1NWDA 1J1EA 2QPTA 1ODBA 2KDHA 1XFVO 4CPVA 1E8AA 1SBJA 2LCPA 4C0JA 2H2KA 1XO5A 2L4IA 2BL0B 3CGAA 2JXCA 4MN0A 1DMOA 2I2RE 3CTNA 2CNPA 1NIWA 2WORA 1RFJA 4ZCVA 1OMVA 1CLBA 3SG3A 2JQ6A 1XFYO 1RJVA 5HLOA 1DTLA 1S26D 1C7WA 2LMTA 4DCKA 3WHUB 4GPLB 5D69A 1DJZA 1K9PA 1CKKA 1KFUL 5JOLA 2GGMA 2JULA 2LHIA 2LC5A 3LCPC 1SNLA 4MEWA 4DUQA 2LP2A 1A4PA 4CFQA 1F4QA 2FJUB 1NSHA 4JQ0D 1GGWA 1Q80A 1KK7Y 3KEVA 3A8RA 1K2HA 4PE0A 1NUBA 5J3XA 4GGFC 2ISDA 1YTZC 2BBNA 3DVEA 3M0WA 5K89A 3WNXB 2ZFDA 1MR8A 1U5IA 2GV5A 1KK8B 2F8PA 3NSKA 1FI6A 1V1FA 4ORCB 4FQOA 1F70A 1ZOTB 3OHMB 1PULA 3PN7B 3KF9A 1LA0A 2SCPA 1SY9A 3SG5A 1PVBA 1IKUA 1UHHA 1DJIA 2JZIA 2PASA 1ALVA 2Y1NA 2KOTA 1JFKA 2QACA 2HQWA 2ZNEA 3BUWB 2M29A 3BYAA 2MLEC 4WRIA 2WCBA 4P2YB 2LV7A 4WQ3A 1WRLA 1CMGA 1DJXA 1SR6B 1J55A 1S1EA 2KHNA 2TN4A 2F2OA 4N1FA 1XVJA 2MJWB 1K96A 3BOWA 1AVSA 1S5GZ 1SL9A 3FWCA 1XA5A 4I5JA 2ZRTA 4MZLA 1H8BA 1OOJA 3BXKA 2HF5A 1B8RA 3NSIA 1NX0A 1LA3A 2Y5IA 3DD4A 5CSNA 4HRGA 3LL8B 4YGBB 3I5HB 3TUYB 3AKAA 1SCMB 4OCIA 2BCXA 3EK7A 1C7VA 1EXRA 1QXPA 1EJ3A 1KFXS 3EVRA 4GFTA 1BJFA 1AJ4A 1UHIA 3LK1A 2MHHA 1SKTA 2KI6D 5HYDA 1RWYA 1UURA 1UHNA 1SL7A 3PFVA 3I5FC 1TCOB 1BMOA 1CLMA 2P6BB 1MHOA 2JU0A 2EHBA 4YI8A 2PMYA 4D1EA 5DKNA 1W7IB 2MBXA 1JF0A 1L2OC 4PE1A 3SG7A 1K8UA 1A03A 2F33A 4C0LA 2HPSA 2O60A 1YR5A 2H61C 1QLKA 2Y1MA 2WC8A 1V1GA 2PALA 3OX6A 4WQ2A 2JTZA 2BCAA 2LMVA 1NX1A 2DOQA 5AEQA 2OPOA 1A29A 1DJWA 1XK4A 2NZ0A 1VRKA 1QIWA 1KK7Z 3KPXA 1KSOA 1QX5B 1RECA 2LVIA 4PE7A 1YVHA 2G2BA 1GQMA 2L5XB 1H4BA 4NDBA 1B1GA 2AUCA 1CFFA 2VRGA 1QV0A 1M46A 2MLFC 1K93D 2Q4UA 3HX4A 3PLFB 1N2DA 5CSIA 2OS8B 2Y4QA 2M7LA 1S3PA 4IL1A 5GQQC 2E6WA 1CTRA 4ORBB 1AP4A 4BY5A 2RGIA 1MXEA 1M45A 2K7BA 3I5IB 4USLA 3EKHA 2KAVA 2CBLA 1K94A 1DJHA 2K7OA 1TNQA 5D7FA 3GK1A 5KU1A 3AKBA 2JPTA 5HKYA 4FTGA 4OV2A 2KAYA 3SG4A 2A4JA 2FCDA 1AJ5A 2JC2A 5B8IB 1PVAA 3I5FB 5I8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WRK A;  2NCP A;  3QRX A;  1TTX A;  3NXA A;  1YRU B;  2PSR A;  1K9K A;  3CZT X;  1SYM A;  1L2O B;  2JXL A;  2LMU A;  2ZN9 A;  3ZWH A;  1N65 A;  1TOP A;  1XFX O;  3SIA A;  1DF0 B;  1A2X A;  2O5G A;  1CNP A;  2K7D A;  2LVJ A;  4PHJ A;  1G4Y R;  2JT0 A;  2WCF A;  3TS5 C;  2LLS A;  1QV1 A;  1TCF A;  2HQ8 A;  2D8N A;  1C07 A;  3WHT B;  3NSL A;  1G33 A;  1XYD A;  1X02 A;  2KFF A;  3HCM A;  4PHN A;  2AAO A;  1ZUZ A;  3DVK A;  1TNW A;  3WXA A;  1EG4 A;  1KFX L;  4DS7 A;  1BOD A;  3NSO A;  5AFP A;  5HKZ A;  1DJY A;  3SG2 A;  1CFD A;  3OB1 B;  3JTD C;  4YGA A;  4N1G A;  2LAP A;  1D1O A;  4MVF A;  4E68 A;  1F4O A;  3EKJ A;  2JWW A;  3DF0 B;  1B8L A;  2I18 A;  4MSP A;  1FF1 A;  2ZKM X;  3GK4 X;  3VRN A;  1N0Y A;  1CLL A;  3BUX B;  5FYX A;  3IQQ A;  3VRO A;  1CMF A;  1WLZ A;  2K2A A;  2KI4 C;  3EVV A;  3VRR A;  3TDU A;  3LK0 A;  3ICB A;  1LIN A;  4MZJ A;  2M0R A;  1UWO A;  1S6J A;  1ZMZ A;  2ZN8 A;  2OTG C;  3I5G C;  1KSM A;  3OP0 A;  1YVL A;  2CCM A;  2KYC A;  1R2U A;  1IQ3 A;  4GGF A;  4HSZ A;  1M31 A;  4M2P A;  1J7R A;  1JUO A;  1F54 A;  1QX2 A;  2EC6 C;  5I2L A;  2M1U A;  1UHK A;  4MBE A;  5TNC A;  2LLT A;  2M97 A;  2Q91 A;  2M1K B;  2M7N A;  1CFP A;  1OZS A;  1Y1X A;  1GGZ A;  5PAL A;  5JJG A;  1F8H A;  2JNF A;  5AXI A;  1AUI B;  5HLV A;  1CDN A;  1QAS A;  4ICB A;  4Q04 A;  3DVM A;  1SPY A;  1HT9 A;  3JVT C;  4XYN A;  2JT8 A;  2MAZ A;  4PHM A;  4CID A;  1KCY A;  3A4U B;  3O4Y A;  1IJ6 A;  1QLS A;  2LVK A;  4R1E A;  1B9A A;  4UPG A;  4CLN A;  1AK8 A;  1SRA A;  1LVC D;  4YI9 A;  1R6P A;  3PAT A;  5KSZ A;  1EL4 A;  4OKH A;  2BKH B;  3TS5 B;  1NPQ A;  1EH2 A;  1BR4 B;  1XK4 C;  1BT6 A;  2KGR A;  1NX2 A;  1IWQ A;  1IGV A;  1UHJ A;  3RLZ A;  4CFR A;  1J7Q A;  2LHL A;  1SK6 D;  1AHR A;  1YX7 A;  2ZRS A;  1CDM A;  4JWQ A;  2CTN A;  1UP5 A;  2LLU A;  1KQV A;  1WDC C;  2BBM A;  3JTD B;  3FIA A;  5CSF A;  2FOT A;  1PSR A;  1FW4 A;  2E30 A;  1KQM C;  2I7A A;  2ZND A;  4GUK A;  3O6B A;  1LKJ A;  4M2Q A;  1F55 A;  1EG3 A;  3VRQ A;  3PSR A;  1TNX A;  1Y1U A;  2FCE A;  1J1D A;  3TDZ A;  5G08 A;  1QX7 A;  2GGZ A;  5KTY A;  1SL8 A;  1WLM A;  1S6I A;  2MA2 A;  1B7T Y;  1QS7 A;  1SW8 A;  2F3Y A;  2JOJ A;  3D0Y B;  2BCB A;  4PCW A;  4YGD B;  4A4B A;  1PAL A;  2HET A;  1YUR A;  1TNP A;  1Y1A A;  3TZ1 A;  1IG5 A;  3H4S E;  2LE9 B;  2K61 A;  1XFZ O;  2MRD A;  2LNK A;  1FBV A;  2KNE A;  2JNX A;  4XJK B;  2CT9 A;  3PN7 C;  4ZCU A;  1OMR A;  3KO0 A;  4PDZ A;  4ETO A;  2F3Z A;  5DKR A;  2EGD A;  1DF0 A;  2K8M B;  2LAN A;  1CB1 A;  4GNK B;  1KWO C;  2CXJ A;  2H61 A;  4HRH A;  2BEC A;  1A75 B;  1NCY A;  3E3R A;  1SMG A;  2JRF A;  1DGV A;  1ZFS A;  1JFJ A;  2JTT A;  2KBM A;  3BUO B;  5AER A;  1DVI A;  2F2P A;  4GBA A;  4AOM A;  4NDD A;  4I5N B;  1BLQ A;  1IJ5 A;  4MRY A;  1PK0 D;  1SR6 C;  4PHK A;  1L7Z A;  3FWB A;  1J7O A;  1YX8 A;  1MUX A;  1QVI Y;  1M63 B;  1Y6W A;  1FI5 A;  3CLN A;  5F6T A;  1M39 A;  3DF0 A;  2BE4 A;  1FPW A;  3ZNI A;  2K2F A;  1NYA A;  3LLE A;  1UUS A;  2K0J A;  3K21 A;  2KYF A;  1GJY A;  1IH0 A;  2NLN A;  3AAJ A;  4DIR A;  4DRW A;  5I2O A;  1PSB A;  1WDC B;  3I5H C;  3OX5 A;  1S36 A;  1SCM C;  2PRU A;  2PVB A;  4L9M A;  4AQJ A;  1RK9 A;  3TUY C;  1KQM B;  2KAX A;  4YRU A;  2JT3 A;  4TNC A;  1MQ1 A;  2M9G A;  3EK8 A;  2KFH A;  3D10 A;  2L2E A;  5CPV A;  2L51 A;  1NP8 A;  1WRZ A;  1OSA A;  1TN4 A;  2KSP A;  3BUM B;  2AMI A;  2KQ6 A;  5IBW A;  1TRF A;  2WCE A;  2L4H A;  1CDP A;  2IS9 A;  1QJT A;  1OQP A;  5ER4 X;  2WOS A;  3F45 A;  3VRP A;  1K90 D;  2V53 A;  1K95 A;  2BE6 A;  4HRE E;  4NQG A;  1DGU A;  4I5L B;  3C1V A;  3EK4 A;  4ORA B;  1YUT A;  2M3W A;  3DVJ A;  4QJ4 B;  4AQI A;  4C0K A;  1G8I A;  1MXL C;  1W7J B;  1CM4 A;  2L0P A;  1K9U A;  1HQV A;  1B47 A;  2LUC A;  1YUU A;  1NCZ A;  1YUS A;  1KWO B;  1XFU O;  3PM8 A;  3FS7 A;  4MRX A;  1ALW A;  4BY4 A;  5DKQ A;  4I5K A;  1KFU S;  1B4C A;  1JC2 A;  1TIZ A;  3O78 A;  2KFG A;  2B1U A;  1Y0V H;  4JPZ B;  1B7T Z;  1U5I B;  4GAO A;  5I2Q A;  2NCO A;  3GOF A;  1QIV A;  2LUX A;  4NDC A;  4QJ5 B;  3IQO A;  3OB2 B;  2KI6 C;  3TDI A;  2OS8 C;  3BUN B;  3SJS A;  2WND A;  1OZO A;  1LXF C;  2M8U A;  3IF7 A;  1JF2 A;  2KGB C;  4PE4 A;  4YGE B;  1DT7 B;  5HKW A;  2BL0 C;  1DJG A;  4N5X A;  3I5I C;  3D0Y A;  3AAK A;  3CR5 X;  3O2P A;  4QJ3 B;  3VGO A;  1OMD A;  1SCV A;  3CS1 A;  1BG1 A;  1OE9 B;  2COL B;  3CWG A;  4MZK A;  1F71 A;  3PAL A;  2BKI B;  4YBH B;  2NXQ A;  4MLW A;  4XJK A;  3BOW B;  1BF5 A;  2LM5 A;  1QTX A;  2KBI A;  5BPJ A;  1JWD A;  3CR4 X;  4YGC B;  1QVI Z;  3CR2 A;  1IRJ A;  5ER5 A;  2KI4 B;  1IQ5 A;  2LP3 A;  1BR1 B;  2L50 A;  5AAN A;  1CFC A;  4OR9 B;  2SAS A;  1NCX A;  1A75 A;  2LVV A;  1BU3 A;  1S6C A;  1XFW O;  3BQ3 A;  2OTG B;  4M2O A;  3I5G B;  5CSJ A;  1JBA A;  1B8C A;  4PAL A;  1CDL A;  1QAT A;  1RTP 1;  1KK8 C;  2KQY A;  2EC6 B;  1MWN A;  1S5G Y;  2G9B A;  2I94 A;  4P5O E;  4F0Z B;  4GGN A;  3KHE A;  1J7P A;  4OVN F;  1RRO A;  1WY9 A;  3RM1 A;  1BOC A;  1YRT B;  3EVU A;  3SIB A;  1PRW A;  3GK2 A;  1NX3 A;  1ZAC A;  3SG6 A;  2L98 A;  1JSA A;  4U8D A;  2M49 B;  3JVT B;  1MF8 B;  1CM1 A;  2K7C A;  4A4C A;  3MSE B;  2R2I A;  1NWD A;  1J1E A;  2QPT A;  1ODB A;  2KDH A;  1XFV O;  4CPV A;  1E8A A;  1SBJ A;  2LCP A;  4C0J A;  2H2K A;  1XO5 A;  2L4I A;  2BL0 B;  3CGA A;  2JXC A;  4MN0 A;  1DMO A;  2I2R E;  3CTN A;  2CNP A;  1NIW A;  2WOR A;  1RFJ A;  4ZCV A;  1OMV A;  1CLB A;  3SG3 A;  2JQ6 A;  1XFY O;  1RJV A;  5HLO A;  1DTL A;  1S26 D;  1C7W A;  2LMT A;  4DCK A;  3WHU B;  4GPL B;  5D69 A;  1DJZ A;  1K9P A;  1CKK A;  1KFU L;  5JOL A;  2GGM A;  2JUL A;  2LHI A;  2LC5 A;  3LCP C;  1SNL A;  4MEW A;  4DUQ A;  2LP2 A;  1A4P A;  4CFQ A;  1F4Q A;  2FJU B;  1NSH A;  4JQ0 D;  1GGW A;  1Q80 A;  1KK7 Y;  3KEV A;  3A8R A;  1K2H A;  4PE0 A;  1NUB A;  5J3X A;  4GGF C;  2ISD A;  1YTZ C;  2BBN A;  3DVE A;  3M0W A;  5K89 A;  3WNX B;  2ZFD A;  1MR8 A;  1U5I A;  2GV5 A;  1KK8 B;  2F8P A;  3NSK A;  1FI6 A;  1V1F A;  4ORC B;  4FQO A;  1F70 A;  1ZOT B;  3OHM B;  1PUL A;  3PN7 B;  3KF9 A;  1LA0 A;  2SCP A;  1SY9 A;  3SG5 A;  1PVB A;  1IKU A;  1UHH A;  1DJI A;  2JZI A;  2PAS A;  1ALV A;  2Y1N A;  2KOT A;  1JFK A;  2QAC A;  2HQW A;  2ZNE A;  3BUW B;  2M29 A;  3BYA A;  2MLE C;  4WRI A;  2WCB A;  4P2Y B;  2LV7 A;  4WQ3 A;  1WRL A;  1CMG A;  1DJX A;  1SR6 B;  1J55 A;  1S1E A;  2KHN A;  2TN4 A;  2F2O A;  4N1F A;  1XVJ A;  2MJW B;  1K96 A;  3BOW A;  1AVS A;  1S5G Z;  1SL9 A;  3FWC A;  1XA5 A;  4I5J A;  2ZRT A;  4MZL A;  1H8B A;  1OOJ A;  3BXK A;  2HF5 A;  1B8R A;  3NSI A;  1NX0 A;  1LA3 A;  2Y5I A;  3DD4 A;  5CSN A;  4HRG A;  3LL8 B;  4YGB B;  3I5H B;  3TUY B;  3AKA A;  1SCM B;  4OCI A;  2BCX A;  3EK7 A;  1C7V A;  1EXR A;  1QXP A;  1EJ3 A;  1KFX S;  3EVR A;  4GFT A;  1BJF A;  1AJ4 A;  1UHI A;  3LK1 A;  2MHH A;  1SKT A;  2KI6 D;  5HYD A;  1RWY A;  1UUR A;  1UHN A;  1SL7 A;  3PFV A;  3I5F C;  1TCO B;  1BMO A;  1CLM A;  2P6B B;  1MHO A;  2JU0 A;  2EHB A;  4YI8 A;  2PMY A;  4D1E A;  5DKN A;  1W7I B;  2MBX A;  1JF0 A;  1L2O C;  4PE1 A;  3SG7 A;  1K8U A;  1A03 A;  2F33 A;  4C0L A;  2HPS A;  2O60 A;  1YR5 A;  2H61 C;  1QLK A;  2Y1M A;  2WC8 A;  1V1G A;  2PAL A;  3OX6 A;  4WQ2 A;  2JTZ A;  2BCA A;  2LMV A;  1NX1 A;  2DOQ A;  5AEQ A;  2OPO A;  1A29 A;  1DJW A;  1XK4 A;  2NZ0 A;  1VRK A;  1QIW A;  1KK7 Z;  3KPX A;  1KSO A;  1QX5 B;  1REC A;  2LVI A;  4PE7 A;  1YVH A;  2G2B A;  1GQM A;  2L5X B;  1H4B A;  4NDB A;  1B1G A;  2AUC A;  1CFF A;  2VRG A;  1QV0 A;  1M46 A;  2MLF C;  1K93 D;  2Q4U A;  3HX4 A;  3PLF B;  1N2D A;  5CSI A;  2OS8 B;  2Y4Q A;  2M7L A;  1S3P A;  4IL1 A;  5GQQ C;  2E6W A;  1CTR A;  4ORB B;  1AP4 A;  4BY5 A;  2RGI A;  1MXE A;  1M45 A;  2K7B A;  3I5I B;  4USL A;  3EKH A;  2KAV A;  2CBL A;  1K94 A;  1DJH A;  2K7O A;  1TNQ A;  5D7F A;  3GK1 A;  5KU1 A;  3AKB A;  2JPT A;  5HKY A;  4FTG A;  4OV2 A;  2KAY A;  3SG4 A;  2A4J A;  2FCD A;  1AJ5 A;  2JC2 A;  5B8I B;  1PVA A;  3I5F B;  5I8N A; 
#chains in the Genus database with same CATH topology
 1WRK A;  2NCP A;  3QRX A;  3FE6 A;  4INX A;  3B6X A;  1TTX A;  3NXA A;  1YRU B;  2PSR A;  1K9K A;  3CZT X;  1SYM A;  1L2O B;  2JXL A;  2LMU A;  2ZN9 A;  3ZWH A;  1N65 A;  1TOP A;  1XFX O;  3SIA A;  1DF0 B;  1A2X A;  2O5G A;  1CNP A;  2K7D A;  2LVJ A;  4PHJ A;  1G4Y R;  2JT0 A;  2WCF A;  3TS5 C;  2LLS A;  1QV1 A;  1TCF A;  2HQ8 A;  2D8N A;  1C07 A;  3WHT B;  3NSL A;  1G33 A;  1XYD A;  1X02 A;  2KFF A;  3HCM A;  4PHN A;  2AAO A;  1ZUZ A;  3DVK A;  1TNW A;  3WXA A;  1EG4 A;  1KFX L;  4DS7 A;  1BOD A;  3NSO A;  5AFP A;  5HKZ A;  1DJY A;  3SG2 A;  2P70 A;  1CFD A;  3OB1 B;  3JTD C;  4YGA A;  4N1G A;  2LAP A;  1D1O A;  4MVF A;  4E68 A;  1F4O A;  3EKJ A;  2JWW A;  3DF0 B;  1B8L A;  2I18 A;  4MSP A;  1FF1 A;  2ZKM X;  3GK4 X;  3VRN A;  1N0Y A;  1CLL A;  1QWV A;  2L2C A;  3BUX B;  3K1E A;  3IQQ A;  5FYX A;  3VRO A;  1WLZ A;  2K2A A;  2KI4 C;  3EVV A;  3VRR A;  1CMF A;  3TDU A;  3LK0 A;  3ICB A;  1LIN A;  3O4X A;  4MZJ A;  2M0R A;  5FI7 A;  1UWO A;  1S6J A;  1ZMZ A;  2ZN8 A;  2OTG C;  3NHT A;  3I5G C;  1KSM A;  3OP0 A;  1YVL A;  2CCM A;  2KYC A;  1R2U A;  1IQ3 A;  4GGF A;  4HSZ A;  1M31 A;  3S0B A;  4M2P A;  1J7R A;  3D75 A;  1JUO A;  1ORG A;  2P71 A;  2WCJ A;  1F54 A;  1QX2 A;  2EC6 C;  5I2L A;  2M1U A;  1UHK A;  4IJ7 A;  4MBE A;  5TNC A;  2LLT A;  2M97 A;  2Q91 A;  2M1K B;  2M7N A;  1CFP A;  1OZS A;  1Y1X A;  1GGZ A;  5PAL A;  5JJG A;  1F8H A;  2JNF A;  3BFA A;  5AXI A;  1AUI B;  5HLV A;  1CDN A;  1QAS A;  2KPH A;  4ICB A;  4Q04 A;  1OOG A;  3DVM A;  1SPY A;  1HT9 A;  3JVT C;  4XYN A;  2JT8 A;  2MAZ A;  4PHM A;  4CID A;  1KCY A;  3A4U B;  3O4Y A;  1IJ6 A;  3CDN A;  1QLS A;  2LVK A;  4R1E A;  1B9A A;  4UPG A;  4CLN A;  1AK8 A;  1SRA A;  1LVC D;  4YI9 A;  1R6P A;  2WCL A;  3N7H A;  3PAT A;  5KSZ A;  1EL4 A;  4OKH A;  2BKH B;  3TS5 B;  1NPQ A;  1EH2 A;  1BR4 B;  1XK4 C;  1BT6 A;  2KGR A;  1NX2 A;  1IWQ A;  1IGV A;  1UHJ A;  3RLZ A;  4CFR A;  1J7Q A;  3L47 A;  2LHL A;  1YX7 A;  1SK6 D;  1AHR A;  2ZRS A;  1CDM A;  4JWQ A;  2CTN A;  1UP5 A;  2LLU A;  1KQV A;  1WDC C;  5D3O A;  2BBM A;  3JTD B;  3FIA A;  5CSF A;  2FOT A;  1PSR A;  1FW4 A;  2E30 A;  1KQM C;  2I7A A;  2ZND A;  3FE8 A;  3O6B A;  4GUK A;  1LKJ A;  3QME A;  4M2Q A;  1F55 A;  1EG3 A;  3VRQ A;  3PSR A;  3R1P A;  3CAB A;  1TUJ A;  3D76 A;  2WCH A;  2ERB A;  1TNX A;  3BJH A;  1Y1U A;  2FCE A;  1J1D A;  3TDZ A;  5G08 A;  1QX7 A;  2GGZ A;  5KTY A;  1SL8 A;  2GTE A;  1WLM A;  1S6I A;  2MA2 A;  1B7T Y;  1QS7 A;  1SW8 A;  2F3Y A;  2JOJ A;  3D0Y B;  2BCB A;  4PCW A;  4YGD B;  4F7F A;  4A4B A;  1PAL A;  2HET A;  1YUR A;  1TNP A;  1Y1A A;  3TZ1 A;  1IG5 A;  3SS3 A;  3H4S E;  2LE9 B;  2K61 A;  1XFZ O;  2MRD A;  2LNK A;  1FBV A;  2KNE A;  2JNX A;  4XJK B;  2CT9 A;  3PN7 C;  4ZCU A;  1OMR A;  3KO0 A;  4PDZ A;  4ETO A;  2F3Z A;  5DKR A;  2EGD A;  1DF0 A;  2K8M B;  2LAN A;  1CB1 A;  4GNK B;  1KWO C;  2CXJ A;  2H61 A;  4HRH A;  2BEC A;  1A75 B;  1NCY A;  3E3R A;  1SMG A;  2JRF A;  1DGV A;  1ZFS A;  1JFJ A;  2JTT A;  2KBM A;  3BUO B;  5AER A;  1DVI A;  2F2P A;  4GBA A;  4AOM A;  4NDD A;  4I5N B;  1BLQ A;  1IJ5 A;  1DEK A;  4MRY A;  1PK0 D;  1SR6 C;  4PHK A;  1L7Z A;  3FWB A;  1J7O A;  3CZ0 A;  1YX8 A;  1MUX A;  1QVI Y;  1M63 B;  1Y6W A;  1FI5 A;  3CLN A;  5F6T A;  1M39 A;  3DF0 A;  2BE4 A;  1FPW A;  3ZNI A;  2K2F A;  1NYA A;  3LLE A;  1UUS A;  1SSE B;  2K0J A;  2KYF A;  1GJY A;  3K21 A;  3UNW A;  1IH0 A;  3CYZ A;  2NLN A;  3AAJ A;  2WCM A;  4DIR A;  4DRW A;  5I2O A;  1PSB A;  1WDC B;  3I5H C;  3OX5 A;  1S36 A;  1SCM C;  2PRU A;  2PVB A;  4L9M A;  4AQJ A;  1RK9 A;  3TUY C;  1KQM B;  2KAX A;  4YRU A;  2JT3 A;  4TNC A;  1MQ1 A;  2M9G A;  3EK8 A;  2KFH A;  3D10 A;  3NGV A;  2L2E A;  5CPV A;  2L51 A;  1NP8 A;  1WRZ A;  3OGN A;  1OSA A;  1TN4 A;  2KSP A;  3BUM B;  2AMI A;  2KQ6 A;  3PM2 A;  5IBW A;  1TRF A;  2WCE A;  3S0F A;  2L4H A;  1CDP A;  2IS9 A;  3Q8I A;  1QJT A;  3R72 A;  3L4L A;  1OQP A;  2H8V A;  5ER4 X;  2WOS A;  3F45 A;  3VRP A;  1GM0 A;  1K90 D;  2V53 A;  1K95 A;  4FQT A;  2BE6 A;  3DY9 A;  4HRE E;  4NQG A;  1DGU A;  4I5L B;  3C1V A;  3EK4 A;  4ORA B;  1YUT A;  2M3W A;  3DVJ A;  4QJ4 B;  4AQI A;  4C0K A;  1G8I A;  1MXL C;  1W7J B;  1CM4 A;  3PJI A;  2L0P A;  1K9U A;  1XFR A;  1HQV A;  1B47 A;  1OOF A;  2LUC A;  3D74 A;  1YUU A;  1NCZ A;  1YUS A;  3V2L A;  1KWO B;  1XFU O;  3PM8 A;  3D77 A;  3SS5 A;  3FS7 A;  4MRX A;  1ALW A;  4BY4 A;  5DKQ A;  5HL1 A;  4I5K A;  1KFU S;  3CZ1 A;  1B4C A;  1JC2 A;  1TIZ A;  3O78 A;  2KFG A;  2B1U A;  1Y0V H;  1TWO A;  4JPZ B;  1B7T Z;  1U5I B;  4GAO A;  2KLD A;  5I2Q A;  2NCO A;  3GOF A;  1QIV A;  3DXL A;  5I94 A;  2LUX A;  4NDC A;  4QJ5 B;  3IQO A;  3OB2 B;  2KI6 C;  3TDI A;  2OS8 C;  3BUN B;  3SJS A;  2WND A;  1OZO A;  1LXF C;  2M8U A;  2PYQ A;  3IF7 A;  1JF2 A;  2KGB C;  4PE4 A;  4YGE B;  1DT7 B;  5HKW A;  1DJG A;  2BL0 C;  5EL2 A;  4N5X A;  3I5I C;  3D0Y A;  3AAK A;  3CR5 X;  3O2P A;  4QJ3 B;  3VGO A;  1OMD A;  1SCV A;  3CS1 A;  1BG1 A;  1OE9 B;  2COL B;  3CWG A;  4MZK A;  1F71 A;  3PAL A;  2BKI B;  4YBH B;  2NXQ A;  4MLW A;  4XJK A;  3BOW B;  1BF5 A;  2LM5 A;  1QTX A;  2KBI A;  5BPJ A;  1JWD A;  3CR4 X;  4YGC B;  1QVI Z;  2QDI A;  3CR2 A;  1IRJ A;  4OZD A;  5ER5 A;  2KI4 B;  1IQ5 A;  2LP3 A;  1BR1 B;  2L50 A;  1DQE A;  5AAN A;  1CFC A;  4OR9 B;  2SAS A;  1NCX A;  1A75 A;  2LVV A;  2L5Y A;  1BU3 A;  2K60 A;  3OBV A;  1S6C A;  1XFW O;  3BQ3 A;  2OTG B;  4M2O A;  3I5G B;  5CSJ A;  1JBA A;  1B8C A;  3IVT A;  1OOH A;  5DIC A;  2WC6 A;  4PAL A;  1CDL A;  2QEV A;  1QAT A;  4INW A;  2WCK A;  1RTP 1;  1KK8 C;  2KQY A;  1LS8 A;  2EC6 B;  1MWN A;  1S5G Y;  1Z2C B;  2G9B A;  3NHI A;  2I94 A;  4P5O E;  3UO9 A;  4F0Z B;  4GGN A;  3KHE A;  1J7P A;  2KLE A;  4OVN F;  1RRO A;  1WY9 A;  3RM1 A;  1BOC A;  1YRT B;  3S0G A;  3EVU A;  3SIB A;  1PRW A;  3GK2 A;  1NX3 A;  1ZAC A;  1OW4 A;  3SG6 A;  2L98 A;  1JSA A;  4U8D A;  2M49 B;  3JVT B;  1MF8 B;  1CM1 A;  3R1V A;  2K7C A;  4A4C A;  3MSE B;  2QEH A;  2R2I A;  1NWD A;  1J1E A;  2QPT A;  1ODB A;  2KDH A;  1DEL A;  1XFV O;  4CPV A;  1E8A A;  1SBJ A;  2LCP A;  4C0J A;  2H2K A;  3D78 A;  1XO5 A;  2L4I A;  2BL0 B;  3CGA A;  2JXC A;  4MN0 A;  1DMO A;  2I2R E;  1Z4H A;  3CTN A;  2CNP A;  1NIW A;  2WOR A;  1RFJ A;  4ZCV A;  1C3Y A;  3R1O A;  1OMV A;  5FI2 A;  1CLB A;  3SG3 A;  2JQ6 A;  1XFY O;  1RJV A;  5HLO A;  1DTL A;  1S26 D;  1C7W A;  2LMT A;  4DCK A;  3WHU B;  3RZS A;  4GPL B;  5D69 A;  1DJZ A;  1K9P A;  1CKK A;  3L4A A;  1KFU L;  3DYE A;  5JOL A;  3S0E A;  2GGM A;  2JUL A;  2LHI A;  2LC5 A;  3LCP C;  1SNL A;  4MEW A;  4DUQ A;  2LP2 A;  1A4P A;  4CFQ A;  1F4Q A;  2FJU B;  1T14 A;  1NSH A;  4JQ0 D;  1GGW A;  1Q80 A;  1KK7 Y;  3KEV A;  3A8R A;  1K2H A;  4PE0 A;  1NUB A;  5J3X A;  4GGF C;  2ISD A;  1YTZ C;  2BBN A;  3DVE A;  3M0W A;  5K89 A;  3WNX B;  2ZFD A;  1MR8 A;  1U5I A;  2GV5 A;  1KK8 B;  2F8P A;  3NSK A;  1FI6 A;  3D73 A;  1V1F A;  2QEB A;  4ORC B;  1TUZ A;  4FQO A;  1F70 A;  1ZOT B;  3OHM B;  1PUL A;  3PN7 B;  3KF9 A;  2PQL A;  1LA0 A;  2SCP A;  1SY9 A;  3SG5 A;  1PVB A;  1IKU A;  1UHH A;  1DJI A;  2JZI A;  2PAS A;  1ALV A;  2Y1N A;  2KOT A;  1JFK A;  2QAC A;  2HQW A;  2ZNE A;  3BUW B;  1OOI X;  2M29 A;  3BYA A;  2MLE C;  4WRI A;  2WCB A;  4P2Y B;  2LV7 A;  4WQ3 A;  1WRL A;  1CMG A;  1DJX A;  1SR6 B;  1J55 A;  1S1E A;  2KHN A;  2BAP A;  2TN4 A;  2F2O A;  4N1F A;  1XVJ A;  2MJW B;  1K96 A;  3BOW A;  1AVS A;  1S5G Z;  1SL9 A;  3FWC A;  1XA5 A;  4I5J A;  2ZRT A;  4MZL A;  1H8B A;  1OOJ A;  3BXK A;  3S0A A;  2HF5 A;  1B8R A;  3NSI A;  1NX0 A;  1LA3 A;  2Y5I A;  3DD4 A;  5CSN A;  4HRG A;  3LL8 B;  4YGB B;  3I5H B;  3TUY B;  3AKA A;  1SCM B;  4OCI A;  2BCX A;  3EK7 A;  1C7V A;  1EXR A;  1QXP A;  1EJ3 A;  1KFX S;  3EVR A;  4GFT A;  1BJF A;  3BFB A;  1AJ4 A;  2QEO A;  1UHI A;  1W9Z A;  3LK1 A;  2MHH A;  1SKT A;  2KI6 D;  5HYD A;  1IIO A;  4JKT A;  1RWY A;  1UUR A;  1UHN A;  1SL7 A;  3PFV A;  3I5F C;  1TCO B;  1BMO A;  1CLM A;  2FJY A;  2P6B B;  1MHO A;  2JU0 A;  2EHB A;  4YI8 A;  2PMY A;  4D1E A;  5DKN A;  1W7I B;  2MBX A;  3B7A A;  1JF0 A;  1L2O C;  4PE1 A;  3B87 A;  3SG7 A;  1K8U A;  1A03 A;  2F33 A;  4C0L A;  2HPS A;  2O60 A;  1YR5 A;  3B86 A;  2H61 C;  3B88 A;  1QLK A;  2Y1M A;  3SS4 A;  2WC8 A;  1V1G A;  2PAL A;  3OX6 A;  4WQ2 A;  2JTZ A;  2BCA A;  2LMV A;  1NX1 A;  2DOQ A;  5AEQ A;  2OPO A;  1A29 A;  1DJW A;  1XK4 A;  2NZ0 A;  5FI6 A;  1VRK A;  1QIW A;  1KK7 Z;  3KPX A;  1KSO A;  1QX5 B;  1REC A;  2LVI A;  4PE7 A;  1YVH A;  2G2B A;  1GQM A;  3S0D A;  2L5X B;  1H4B A;  4NDB A;  1B1G A;  1C3Z A;  4PT1 A;  2AUC A;  1CFF A;  2VRG A;  3CZ2 A;  1QV0 A;  1M46 A;  2MLF C;  1K93 D;  2JPO A;  2Q4U A;  3HX4 A;  3PLF B;  1N2D A;  5CSI A;  2OS8 B;  2Y4Q A;  2M7L A;  1S3P A;  3BFH A;  4IL1 A;  5GQQ C;  2E6W A;  3DZT A;  1CTR A;  4JD9 A;  4ORB B;  2WC5 A;  1P28 A;  4BY5 A;  1AP4 A;  2RGI A;  1MXE A;  1M45 A;  2K7B A;  3I5I B;  4USL A;  3EKH A;  2KAV A;  2CBL A;  1K94 A;  2YGU A;  3VB1 A;  1DJH A;  2K7O A;  1TNQ A;  5D7F A;  3FE9 A;  3GK1 A;  5KU1 A;  3AKB A;  2JPT A;  4KYN A;  5HKY A;  2BNX A;  4FTG A;  4OV2 A;  2KAY A;  3SG4 A;  2A4J A;  2FCD A;  1AJ5 A;  2JC2 A;  5B8I B;  1PVA A;  3I5F B;  3EG5 B;  1DC1 A;  5I8N A; 
#chains in the Genus database with same CATH homology
 1WRK A;  2NCP A;  3QRX A;  1TTX A;  3NXA A;  1YRU B;  2PSR A;  1K9K A;  3CZT X;  1SYM A;  1L2O B;  2JXL A;  2LMU A;  2ZN9 A;  3ZWH A;  1N65 A;  1TOP A;  1XFX O;  3SIA A;  1DF0 B;  1A2X A;  2O5G A;  1CNP A;  2K7D A;  2LVJ A;  4PHJ A;  1G4Y R;  2JT0 A;  2WCF A;  3TS5 C;  2LLS A;  1QV1 A;  1TCF A;  2HQ8 A;  2D8N A;  1C07 A;  3WHT B;  3NSL A;  1G33 A;  1XYD A;  1X02 A;  2KFF A;  3HCM A;  4PHN A;  2AAO A;  1ZUZ A;  3DVK A;  1TNW A;  3WXA A;  1EG4 A;  1KFX L;  4DS7 A;  1BOD A;  3NSO A;  5AFP A;  5HKZ A;  1DJY A;  3SG2 A;  1CFD A;  3OB1 B;  3JTD C;  4YGA A;  4N1G A;  2LAP A;  1D1O A;  4MVF A;  4E68 A;  1F4O A;  3EKJ A;  2JWW A;  3DF0 B;  1B8L A;  2I18 A;  4MSP A;  1FF1 A;  2ZKM X;  3GK4 X;  3VRN A;  1N0Y A;  1CLL A;  3BUX B;  5FYX A;  3IQQ A;  3VRO A;  1CMF A;  1WLZ A;  2K2A A;  2KI4 C;  3EVV A;  3VRR A;  3TDU A;  3LK0 A;  3ICB A;  1LIN A;  4MZJ A;  2M0R A;  1UWO A;  1S6J A;  1ZMZ A;  2ZN8 A;  2OTG C;  3I5G C;  1KSM A;  3OP0 A;  1YVL A;  2CCM A;  2KYC A;  1R2U A;  1IQ3 A;  4GGF A;  4HSZ A;  1M31 A;  4M2P A;  1J7R A;  1JUO A;  1F54 A;  1QX2 A;  2EC6 C;  5I2L A;  2M1U A;  1UHK A;  4MBE A;  5TNC A;  2LLT A;  2M97 A;  2Q91 A;  2M1K B;  2M7N A;  1CFP A;  1OZS A;  1Y1X A;  1GGZ A;  5PAL A;  5JJG A;  1F8H A;  2JNF A;  5AXI A;  1AUI B;  5HLV A;  1CDN A;  1QAS A;  4ICB A;  4Q04 A;  3DVM A;  1SPY A;  1HT9 A;  3JVT C;  4XYN A;  2JT8 A;  2MAZ A;  4PHM A;  4CID A;  1KCY A;  3A4U B;  3O4Y A;  1IJ6 A;  1QLS A;  2LVK A;  4R1E A;  1B9A A;  4UPG A;  4CLN A;  1AK8 A;  1SRA A;  1LVC D;  4YI9 A;  1R6P A;  3PAT A;  5KSZ A;  1EL4 A;  4OKH A;  2BKH B;  3TS5 B;  1NPQ A;  1EH2 A;  1BR4 B;  1XK4 C;  1BT6 A;  2KGR A;  1NX2 A;  1IWQ A;  1IGV A;  1UHJ A;  3RLZ A;  4CFR A;  1J7Q A;  2LHL A;  1SK6 D;  1AHR A;  1YX7 A;  2ZRS A;  1CDM A;  4JWQ A;  2CTN A;  1UP5 A;  2LLU A;  1KQV A;  1WDC C;  2BBM A;  3JTD B;  3FIA A;  5CSF A;  2FOT A;  1PSR A;  1FW4 A;  2E30 A;  1KQM C;  2I7A A;  2ZND A;  4GUK A;  3O6B A;  1LKJ A;  4M2Q A;  1F55 A;  1EG3 A;  3VRQ A;  3PSR A;  1TNX A;  1Y1U A;  2FCE A;  1J1D A;  3TDZ A;  5G08 A;  1QX7 A;  2GGZ A;  5KTY A;  1SL8 A;  1WLM A;  1S6I A;  2MA2 A;  1B7T Y;  1QS7 A;  1SW8 A;  2F3Y A;  2JOJ A;  3D0Y B;  2BCB A;  4PCW A;  4YGD B;  4A4B A;  1PAL A;  2HET A;  1YUR A;  1TNP A;  1Y1A A;  3TZ1 A;  1IG5 A;  3H4S E;  2LE9 B;  2K61 A;  1XFZ O;  2MRD A;  2LNK A;  1FBV A;  2KNE A;  2JNX A;  4XJK B;  2CT9 A;  3PN7 C;  4ZCU A;  1OMR A;  3KO0 A;  4PDZ A;  4ETO A;  2F3Z A;  5DKR A;  2EGD A;  1DF0 A;  2K8M B;  2LAN A;  1CB1 A;  4GNK B;  1KWO C;  2CXJ A;  2H61 A;  4HRH A;  2BEC A;  1A75 B;  1NCY A;  3E3R A;  1SMG A;  2JRF A;  1DGV A;  1ZFS A;  1JFJ A;  2JTT A;  2KBM A;  3BUO B;  5AER A;  1DVI A;  2F2P A;  4GBA A;  4AOM A;  4NDD A;  4I5N B;  1BLQ A;  1IJ5 A;  4MRY A;  1PK0 D;  1SR6 C;  4PHK A;  1L7Z A;  3FWB A;  1J7O A;  1YX8 A;  1MUX A;  1QVI Y;  1M63 B;  1Y6W A;  1FI5 A;  3CLN A;  5F6T A;  1M39 A;  3DF0 A;  2BE4 A;  1FPW A;  3ZNI A;  2K2F A;  1NYA A;  3LLE A;  1UUS A;  2K0J A;  3K21 A;  2KYF A;  1GJY A;  1IH0 A;  2NLN A;  3AAJ A;  4DIR A;  4DRW A;  5I2O A;  1PSB A;  1WDC B;  3I5H C;  3OX5 A;  1S36 A;  1SCM C;  2PRU A;  2PVB A;  4L9M A;  4AQJ A;  1RK9 A;  3TUY C;  1KQM B;  2KAX A;  4YRU A;  2JT3 A;  4TNC A;  1MQ1 A;  2M9G A;  3EK8 A;  2KFH A;  3D10 A;  2L2E A;  5CPV A;  2L51 A;  1NP8 A;  1WRZ A;  1OSA A;  1TN4 A;  2KSP A;  3BUM B;  2AMI A;  2KQ6 A;  5IBW A;  1TRF A;  2WCE A;  2L4H A;  1CDP A;  2IS9 A;  1QJT A;  1OQP A;  5ER4 X;  2WOS A;  3F45 A;  3VRP A;  1K90 D;  2V53 A;  1K95 A;  2BE6 A;  4HRE E;  4NQG A;  1DGU A;  4I5L B;  3C1V A;  3EK4 A;  4ORA B;  1YUT A;  2M3W A;  3DVJ A;  4QJ4 B;  4AQI A;  4C0K A;  1G8I A;  1MXL C;  1W7J B;  1CM4 A;  2L0P A;  1K9U A;  1HQV A;  1B47 A;  2LUC A;  1YUU A;  1NCZ A;  1YUS A;  1KWO B;  1XFU O;  3PM8 A;  3FS7 A;  4MRX A;  1ALW A;  4BY4 A;  5DKQ A;  4I5K A;  1KFU S;  1B4C A;  1JC2 A;  1TIZ A;  3O78 A;  2KFG A;  2B1U A;  1Y0V H;  4JPZ B;  1B7T Z;  1U5I B;  4GAO A;  5I2Q A;  2NCO A;  3GOF A;  1QIV A;  2LUX A;  4NDC A;  4QJ5 B;  3IQO A;  3OB2 B;  2KI6 C;  3TDI A;  2OS8 C;  3BUN B;  3SJS A;  2WND A;  1OZO A;  1LXF C;  2M8U A;  3IF7 A;  1JF2 A;  2KGB C;  4PE4 A;  4YGE B;  1DT7 B;  5HKW A;  2BL0 C;  1DJG A;  4N5X A;  3I5I C;  3D0Y A;  3AAK A;  3CR5 X;  3O2P A;  4QJ3 B;  3VGO A;  1OMD A;  1SCV A;  3CS1 A;  1BG1 A;  1OE9 B;  2COL B;  3CWG A;  4MZK A;  1F71 A;  3PAL A;  2BKI B;  4YBH B;  2NXQ A;  4MLW A;  4XJK A;  3BOW B;  1BF5 A;  2LM5 A;  1QTX A;  2KBI A;  5BPJ A;  1JWD A;  3CR4 X;  4YGC B;  1QVI Z;  3CR2 A;  1IRJ A;  5ER5 A;  2KI4 B;  1IQ5 A;  2LP3 A;  1BR1 B;  2L50 A;  5AAN A;  1CFC A;  4OR9 B;  2SAS A;  1NCX A;  1A75 A;  2LVV A;  1BU3 A;  1S6C A;  1XFW O;  3BQ3 A;  2OTG B;  4M2O A;  3I5G B;  5CSJ A;  1JBA A;  1B8C A;  4PAL A;  1CDL A;  1QAT A;  1RTP 1;  1KK8 C;  2KQY A;  2EC6 B;  1MWN A;  1S5G Y;  2G9B A;  2I94 A;  4P5O E;  4F0Z B;  4GGN A;  3KHE A;  1J7P A;  4OVN F;  1RRO A;  1WY9 A;  3RM1 A;  1BOC A;  1YRT B;  3EVU A;  3SIB A;  1PRW A;  3GK2 A;  1NX3 A;  1ZAC A;  3SG6 A;  2L98 A;  1JSA A;  4U8D A;  2M49 B;  3JVT B;  1MF8 B;  1CM1 A;  2K7C A;  4A4C A;  3MSE B;  2R2I A;  1NWD A;  1J1E A;  2QPT A;  1ODB A;  2KDH A;  1XFV O;  4CPV A;  1E8A A;  1SBJ A;  2LCP A;  4C0J A;  2H2K A;  1XO5 A;  2L4I A;  2BL0 B;  3CGA A;  2JXC A;  4MN0 A;  1DMO A;  2I2R E;  3CTN A;  2CNP A;  1NIW A;  2WOR A;  1RFJ A;  4ZCV A;  1OMV A;  1CLB A;  3SG3 A;  2JQ6 A;  1XFY O;  1RJV A;  5HLO A;  1DTL A;  1S26 D;  1C7W A;  2LMT A;  4DCK A;  3WHU B;  4GPL B;  5D69 A;  1DJZ A;  1K9P A;  1CKK A;  1KFU L;  5JOL A;  2GGM A;  2JUL A;  2LHI A;  2LC5 A;  3LCP C;  1SNL A;  4MEW A;  4DUQ A;  2LP2 A;  1A4P A;  4CFQ A;  1F4Q A;  2FJU B;  1NSH A;  4JQ0 D;  1GGW A;  1Q80 A;  1KK7 Y;  3KEV A;  3A8R A;  1K2H A;  4PE0 A;  1NUB A;  5J3X A;  4GGF C;  2ISD A;  1YTZ C;  2BBN A;  3DVE A;  3M0W A;  5K89 A;  3WNX B;  2ZFD A;  1MR8 A;  1U5I A;  2GV5 A;  1KK8 B;  2F8P A;  3NSK A;  1FI6 A;  1V1F A;  4ORC B;  4FQO A;  1F70 A;  1ZOT B;  3OHM B;  1PUL A;  3PN7 B;  3KF9 A;  1LA0 A;  2SCP A;  1SY9 A;  3SG5 A;  1PVB A;  1IKU A;  1UHH A;  1DJI A;  2JZI A;  2PAS A;  1ALV A;  2Y1N A;  2KOT A;  1JFK A;  2QAC A;  2HQW A;  2ZNE A;  3BUW B;  2M29 A;  3BYA A;  2MLE C;  4WRI A;  2WCB A;  4P2Y B;  2LV7 A;  4WQ3 A;  1WRL A;  1CMG A;  1DJX A;  1SR6 B;  1J55 A;  1S1E A;  2KHN A;  2TN4 A;  2F2O A;  4N1F A;  1XVJ A;  2MJW B;  1K96 A;  3BOW A;  1AVS A;  1S5G Z;  1SL9 A;  3FWC A;  1XA5 A;  4I5J A;  2ZRT A;  4MZL A;  1H8B A;  1OOJ A;  3BXK A;  2HF5 A;  1B8R A;  3NSI A;  1NX0 A;  1LA3 A;  2Y5I A;  3DD4 A;  5CSN A;  4HRG A;  3LL8 B;  4YGB B;  3I5H B;  3TUY B;  3AKA A;  1SCM B;  4OCI A;  2BCX A;  3EK7 A;  1C7V A;  1EXR A;  1QXP A;  1EJ3 A;  1KFX S;  3EVR A;  4GFT A;  1BJF A;  1AJ4 A;  1UHI A;  3LK1 A;  2MHH A;  1SKT A;  2KI6 D;  5HYD A;  1RWY A;  1UUR A;  1UHN A;  1SL7 A;  3PFV A;  3I5F C;  1TCO B;  1BMO A;  1CLM A;  2P6B B;  1MHO A;  2JU0 A;  2EHB A;  4YI8 A;  2PMY A;  4D1E A;  5DKN A;  1W7I B;  2MBX A;  1JF0 A;  1L2O C;  4PE1 A;  3SG7 A;  1K8U A;  1A03 A;  2F33 A;  4C0L A;  2HPS A;  2O60 A;  1YR5 A;  2H61 C;  1QLK A;  2Y1M A;  2WC8 A;  1V1G A;  2PAL A;  3OX6 A;  4WQ2 A;  2JTZ A;  2BCA A;  2LMV A;  1NX1 A;  2DOQ A;  5AEQ A;  2OPO A;  1A29 A;  1DJW A;  1XK4 A;  2NZ0 A;  1VRK A;  1QIW A;  1KK7 Z;  3KPX A;  1KSO A;  1QX5 B;  1REC A;  2LVI A;  4PE7 A;  1YVH A;  2G2B A;  1GQM A;  2L5X B;  1H4B A;  4NDB A;  1B1G A;  2AUC A;  1CFF A;  2VRG A;  1QV0 A;  1M46 A;  2MLF C;  1K93 D;  2Q4U A;  3HX4 A;  3PLF B;  1N2D A;  5CSI A;  2OS8 B;  2Y4Q A;  2M7L A;  1S3P A;  4IL1 A;  5GQQ C;  2E6W A;  1CTR A;  4ORB B;  1AP4 A;  4BY5 A;  2RGI A;  1MXE A;  1M45 A;  2K7B A;  3I5I B;  4USL A;  3EKH A;  2KAV A;  2CBL A;  1K94 A;  1DJH A;  2K7O A;  1TNQ A;  5D7F A;  3GK1 A;  5KU1 A;  3AKB A;  2JPT A;  5HKY A;  4FTG A;  4OV2 A;  2KAY A;  3SG4 A;  2A4J A;  2FCD A;  1AJ5 A;  2JC2 A;  5B8I B;  1PVA A;  3I5F B;  5I8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...