1QLSA

S100c (s100a11),or calgizzarin, in complex with annexin i n-terminus
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
95
structure length
95
Chain Sequence
PTETERCIESLIAIFQKHAGRDGNNTKISKTEFLIFMNTELAAFTQNQKDPGVLDRMMKKLDLDSDGQLDFQEFLNLIGGLAIACHDSFIKSTQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal-binding protein/inhibitor
molecule keywords S100C PROTEIN
publication title Structural Basis of the Ca2+ Dependent Association between S100C (S100A11) and its Target, the N-Terminal Part of Annexin I
pubmed doi rcsb
source organism Sus scrofa
total genus 37
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 1999-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1qlsA00
1XFYO 5J3XA 5JJGA 2PRUA 4CLNA 1UHKA 2K2AA 2JTTA 3MSEB 2JZIA 3SG4A 1YTZC 2O60A 3EVVA 2OTGB 1ZFSA 2KI4B 3QRXA 4MRXA 3OX5A 4MEWA 2KFFA 2BBNA 1DF0A 1SYMA 1FW4A 1LKJA 1WY9A 1BR1B 1EG4A 2M7NA 1NIWA 3BYAA 3NSIA 2L50A 2Y1NA 3DVKA 3BXKA 1BODA 1KFXL 1CMGA 5CSIA 1M45A 5I8NA 1C7VA 2CTNA 5K89A 4I5NB 1M31A 2L4HA 1CM1A 1JUOA 4OV2A 1S6CA 1W7IB 2AAOA 3TDUA 1SR6C 2B1UA 4PE1A 5I2LA 2LCPA 4PHJA 3NXAA 1K93D 3TZ1A 2F3YA 4NDDA 3CR2A 4UPGA 1BG1A 1A29A 1PALA 3PFVA 4DCKA 3AAKA 1YRUB 4HRGA 4GFTA 1QVIY 3D0YA 1KCYA 1B8CA 2K7BA 1PVBA 1MR8A 2EC6C 2JT0A 1UWOA 5DKQA 4JWQA 1XO5A 1Y0VH 3LL8B 4PHMA 3ZNIA 3ICBA 2G2BA 5KU1A 1K94A 1ODBA 1DJWA 4USLA 5HLVA 1B8LA 2KAYA 2G9BA 5AFPA 2LUCA 1QATA 3SJSA 2FCEA 4YRUA 4YI9A 1CKKA 2VRGA 3VROA 5D7FA 1DF0B 4MZJA 5ER5A 1AVSA 1RJVA 5BPJA 3GK2A 2I94A 1XFZO 1DGUA 2NZ0A 2MHHA 2BKHB 3TS5C 1F54A 1XFXO 4HRHA 1M46A 3BOWB 3FIAA 1ZACA 3E3RA 2WCFA 3AKAA 2BE6A 3LK0A 2KBMA 1JC2A 4M2OA 4A4BA 3TUYB 3CWGA 2MA2A 2HF5A 2Q4UA 1SK6D 1TTXA 4FQOA 1K96A 4GAOA 3I5HC 1MWNA 2SCPA 3NSKA 3WNXB 1OQPA 3GOFA 2KGRA 1S3PA 2JQ6A 1SPYA 1DT7B 1QX2A 3CR4X 2JNFA 5HKYA 1TOPA 2GGMA 2M8UA 1YVHA 3M0WA 1V1FA 1F70A 1YUUA 1GGZA 3D0YB 1PSRA 2OS8C 4PALA 1SCVA 3OX6A 4N5XA 1UHNA 1BR4B 1D1OA 1JBAA 2K8MB 3H4SE 2P6BB 5CSFA 3DF0A 3LK1A 2V53A 1CFCA 5AERA 3KEVA 1YR5A 3I5IC 4QJ3B 5G08A 3CGAA 1SR6B 2GGZA 2ZRTA 1RROA 2MLEC 1DJXA 1FF1A 4MRYA 1QLKA 1IG5A 3HCMA 1XFWO 1PSBA 1PVAA 1MXLC 3O6BA 1SW8A 3BUMB 1FBVA 1SL7A 1IJ5A 2NCOA 3EVUA 3TDIA 4GNKB 1N65A 2LP2A 4MZLA 3BUNB 1BJFA 3DVEA 1LA0A 2NLNA 4M2PA 2EC6B 1S36A 1SBJA 2HPSA 2KAXA 3LLEA 3SIBA 3PALA 1VRKA 4WRIA 3CZTX 2PASA 4PE7A 1QASA 3BUWB 4NDBA 1UP5A 4U8DA 1XA5A 1J55A 4CFQA 1QLSA 1SKTA 2ZN9A 1CDPA 4YBHB 1J1DA 2CT9A 2JTZA 3IQQA 4DS7A 1Y1XA 3SG7A 1MF8B 4C0JA 2M3WA 1L7ZA 1GQMA 2ZN8A 2JC2A 4Q04A 4PDZA 2LP3A 3DVMA 1OOJA 3TS5B 5IBWA 2TN4A 5HYDA 4GUKA 2F33A 1FI5A 2MAZA 3DF0B 2L2EA 1SL8A 3FS7A 5AXIA 2JRFA 1A75A 4P5OE 1TNXA 3I5HB 2LNKA 5CSJA 1QTXA 1XFVO 2QACA 1A4PA 1RFJA 4JQ0D 2MJWB 1YX7A 4XJKA 1A03A 1S6JA 3BOWA 4IL1A 4AQIA 2M1KB 3WHUB 1OZOA 5AANA 1B4CA 1K95A 1KFUL 2ISDA 2F3ZA 1F8HA 2F8PA 1UHJA 2OS8B 1AUIB 2LVKA 4WQ2A 1RECA 1JF0A 3A8RA 3O4YA 2LVIA 1ALWA 2K61A 3FWCA 1NX0A 1AJ4A 1NSHA 1SCMC 2KQ6A 3D10A 1S5GZ 3I5IB 1OMDA 4OCIA 2MRDA 2WCEA 3O2PA 4BY5A 1YUSA 1H4BA 2E6WA 1DJIA 2LLSA 2LMUA 1RWYA 2KI6C 4QJ4B 1KQVA 3VRQA 1UHIA 2M29A 3GK4X 1BLQA 1K9PA 1EJ3A 1KK7Y 2KFGA 3FWBA 3PLFB 4OR9B 1LXFC 1NWDA 2I7AA 2OPOA 1WLMA 2AMIA 4ICBA 1PK0D 1IH0A 1NX3A 5PALA 2KYFA 1CLMA 1QIVA 2LHIA 3BQ3A 3PN7C 2K7CA 2JT8A 4GBAA 2O5GA 4YGAA 5B8IB 1A75B 2HQ8A 1OZSA 2I18A 4PE0A 1AHRA 2Y1MA 2COLB 1CDLA 2LUXA 1EXRA 3TDZA 1WLZA 3I5GC 1J7RA 1NPQA 3EK7A 3KPXA 1K9KA 4XJKB 3BUOB 1R2UA 1JWDA 2HQWA 2KNEA 3C1VA 1OMVA 2KHNA 2BCXA 5FYXA 1WRKA 1QX5B 2K2FA 2ZNDA 1CM4A 3EKJA 1QX7A 3PM8A 2L5XB 1CLLA 1IRJA 4PCWA 1JSAA 2QPTA 1QVIZ 1AP4A 1DJZA 1NX2A 1S1EA 1NCZA 2E30A 2PALA 1TIZA 1KK7Z 1U5IA 3CR5X 1GGWA 1CFPA 1EL4A 1WDCC 2KAVA 1OSAA 2R2IA 3F45A 1TNWA 2F2PA 1RTP1 1SL9A 2ZNEA 3OB2B 3VRPA 3VRRA 1MUXA 1B8RA 1BMOA 1LVCD 2JU0A 1F4OA 5I2QA 1XVJA 4PHKA 1ZMZA 2CCMA 1KK8C 4TNCA 4YGDB 4C0LA 1L2OC 5DKRA 1NYAA 3OHMB 2HETA 5AEQA 1DJYA 1C07A 1FI6A 1DGVA 1SCMB 1Y6WA 4YGBB 2AUCA 1B1GA 1IKUA 1XK4C 4E68A 1HQVA 2ZRSA 5HKWA 3VGOA 2FOTA 1TNPA 4DIRA 2Y5IA 1SNLA 2EGDA 1J1EA 4CFRA 1ZUZA 4CPVA 2K7OA 3I5FC 3NSLA 5D69A 1J7QA 1QS7A 4N1GA 1Y1AA 3SG3A 3WXAA 2M49B 1QV1A 2BE4A 2I2RE 1U5IB 2LHLA 2PSRA 2FCDA 1MXEA 1TCFA 4D1EA 1XK4A 2NXQA 1DMOA 1KSOA 2IS9A 3BUXB 2RGIA 1A2XA 1YRTB 1ZOTB 3I5GB 3OB1B 1KQMC 2KYCA 2NCPA 4MSPA 2M9GA 4DRWA 3JTDC 4MN0A 1B9AA 3LCPC 1XYDA 1YUTA 1ALVA 1Q80A 4PHNA 1J7OA 3WHTB 4P2YB 3DVJA 1NUBA 5KTYA 1KFXS 3EK4A 1CTRA 2PMYA 2A4JA 2MLFC 4ORBB 1UUSA 2KFHA 1QXPA 4PE4A 1WDCB 3GK1A 1K2HA 1RK9A 1IQ5A 1TCOB 1IJ6A 4MBEA 3OP0A 2BL0C 4L9MA 5KSZA 4DUQA 1CB1A 2LANA 2CBLA 1YX8A 3PSRA 1W7JB 2LMTA 4ZCUA 2KDHA 3CLNA 4I5LB 1KK8B 4HSZA 1CFFA 1L2OB 4XYNA 2DOQA 4ETOA 2LM5A 1CLBA 1MHOA 2JT3A 4ORAB 2H61C 2BBMA 1YVLA 3IF7A 1N0YA 1AK8A 1B7TY 1EG3A 1G33A 5DKNA 4OVNF 2CXJA 2L51A 2K0JA 4WQ3A 3K21A 1H8BA 1V1GA 1S26D 4MLWA 1SMGA 2L98A 3VRNA 1BF5A 2JXLA 2JWWA 4GPLB 1N2DA 3I5FB 1JFJA 2M1UA 1LA3A 1EH2A 1HT9A 1M63B 4ORCB 4I5JA 2K7DA 4AQJA 1NCXA 4QJ5B 3SIAA 1C7WA 1IWQA 4YGEB 3AAJA 1GJYA 2H61A 3KHEA 3JVTC 4AOMA 2JPTA 2LC5A 2LV7A 1WRZA 5ER4X 1YURA 2PVBA 2EHBA 5JOLA 2LMVA 3RLZA 1KQMB 1G4YR 4CIDA 1KWOC 3JTDB 2MBXA 2L0PA 2KSPA 1G8IA 4M2QA 2KBIA 4MVFA 1CFDA 2M0RA 4FTGA 4BY4A 3EKHA 1IQ3A 1B7TZ 2D8NA 2H2KA 5HLOA 5I2OA 1TRFA 3PATA 3HX4A 5CPVA 4I5KA 3SG2A 1DVIA 5F6TA 2Q91A 1NX1A 2JNXA 2FJUB 1F55A 1DJGA 1PRWA 1R6PA 2KI4C 2OTGC 2BECA 1BOCA 3EVRA 1WRLA 4HREE 2CNPA 5CSNA 3KF9A 5HKZA 1XFUO 3AKBA 2KGBC 1OE9B 2BL0B 2JOJA 2JXCA 2KQYA 4MZKA 5TNCA 4NQGA 2LE9B 4OKHA 2GV5A 4R1EA 1CDMA 4ZCVA 2JULA 4GGFC 1MQ1A 2BCBA 2ZFDA 4NDCA 2M7LA 3ZWHA 2WORA 1UURA 2BKIB 2KOTA 2Y4QA 1LINA 2LLUA 2WOSA 3CTNA 3A4UB 3SG6A 1PULA 1SRAA 3CS1A 4N1FA 5GQQC 1OMRA 4C0KA 3O78A 4YI8A 3SG5A 1J7PA 4GGNA 1E8AA 1M39A 1BT6A 2LVVA 1K8UA 2SASA 3PN7B 1S6IA 1QJTA 1BU3A 1UHHA 1Y1UA 4F0ZB 2LVJA 1X02A 1SY9A 1QIWA 1CDNA 2WNDA 4GGFA 3NSOA 2LLTA 1AJ5A 2M97A 1JFKA 1IGVA 2KI6D 4A4CA 2LAPA 1NP8A 1CNPA 1F4QA 2WCBA 3JVTB 2WC8A 1K90D 1F71A 1QV0A 2F2OA 3KO0A 3IQOA 2L4IA 3RM1A 3DD4A 1KWOB 1CMFA 1KSMA 1TN4A 2ZKMX 1FPWA 4JPZB 4YGCB 1K9UA 3EK8A 1S5GY 1NCYA 1B47A 1JF2A 3TUYC 1DJHA 1KFUS 2BCAA 1DTLA 1TNQA
chains in the Genus database with same CATH superfamily
3NGVA 1XFYO 5J3XA 5JJGA 1OOHA 3DXLA 2WCJA 2PRUA 4CLNA 1UHKA 2K2AA 2JTTA 3MSEB 2WCKA 2JZIA 3SG4A 1YTZC 2O60A 3EVVA 2OTGB 1ZFSA 2KI4B 3QRXA 4MRXA 3OX5A 4MEWA 2KFFA 2BBNA 1DF0A 3B88A 1SYMA 3CABA 1FW4A 1LKJA 1WY9A 1BR1B 1EG4A 2M7NA 1NIWA 3BYAA 3NSIA 2L50A 2Y1NA 3DVKA 3BXKA 1BODA 1KFXL 1CMGA 5CSIA 1M45A 5I8NA 1C7VA 2CTNA 5K89A 4I5NB 1M31A 2L4HA 1CM1A 1JUOA 4OV2A 3BJHA 1S6CA 1W7IB 2AAOA 3TDUA 1SR6C 2B1UA 4PE1A 5I2LA 2LCPA 4PHJA 3NXAA 1K93D 3TZ1A 2F3YA 4NDDA 3CR2A 4UPGA 1BG1A 1A29A 1PALA 3PFVA 4DCKA 3AAKA 1YRUB 4HRGA 4GFTA 1QVIY 3D0YA 1KCYA 1B8CA 2K7BA 1PVBA 1MR8A 2EC6C 2JT0A 1UWOA 5DKQA 4JWQA 3S0DA 1XO5A 1Y0VH 3LL8B 4PHMA 3ZNIA 3ICBA 2G2BA 5KU1A 1K94A 1ODBA 1DJWA 4USLA 5HLVA 1B8LA 2KAYA 2G9BA 5AFPA 2LUCA 1QATA 1C3ZA 3SJSA 2FCEA 4YRUA 4YI9A 1CKKA 2VRGA 3VROA 5D7FA 1DF0B 4MZJA 5ER5A 1AVSA 1RJVA 5BPJA 3GK2A 2I94A 1XFZO 3L47A 3BFHA 1DGUA 2NZ0A 2MHHA 2BKHB 3TS5C 1DQEA 1F54A 1XFXO 3K1EA 1M46A 4HRHA 3BOWB 3FIAA 1ZACA 3E3RA 2WCFA 3AKAA 2BE6A 3LK0A 2KBMA 1JC2A 4M2OA 4A4BA 3TUYB 3CWGA 2MA2A 2HF5A 2Q4UA 1SK6D 1TTXA 4FQOA 1K96A 4GAOA 3I5HC 1MWNA 2SCPA 3VB1A 3NSKA 3WNXB 1OQPA 3GOFA 2KGRA 1S3PA 2JQ6A 1SPYA 1DT7B 1QX2A 3CR4X 2JNFA 5HKYA 1TOPA 2GGMA 2M8UA 1YVHA 3M0WA 1V1FA 1F70A 1YUUA 1GGZA 3D0YB 1PSRA 2OS8C 4PALA 1SCVA 3OX6A 4N5XA 1SSEB 1UHNA 1BR4B 1D1OA 1JBAA 2K8MB 3H4SE 2P6BB 5CSFA 3FE6A 3DF0A 3LK1A 2V53A 1CFCA 5AERA 3KEVA 1YR5A 3I5IC 4QJ3B 5G08A 3CGAA 3N7HA 1SR6B 2GGZA 2ZRTA 1RROA 2MLEC 1DJXA 3DYEA 3V2LA 3B87A 1FF1A 4MRYA 1QLKA 1IG5A 3HCMA 1XFWO 3OGNA 1PSBA 1PVAA 1MXLC 3O6BA 1SW8A 3BUMB 1FBVA 1SL7A 1IJ5A 2NCOA 3EVUA 3TDIA 4GNKB 1N65A 2LP2A 4MZLA 3BUNB 1BJFA 5EL2A 3DVEA 1LA0A 2NLNA 4M2PA 2JPOA 2EC6B 1S36A 1SBJA 2HPSA 2KAXA 3LLEA 3SIBA 3PALA 1VRKA 4WRIA 3CZ1A 3CZTX 2PASA 4PE7A 1QASA 3BUWB 4NDBA 1UP5A 4U8DA 1XA5A 1J55A 4CFQA 1QLSA 1SKTA 2ZN9A 1CDPA 4YBHB 1J1DA 2CT9A 2JTZA 3IQQA 4DS7A 2L2CA 1Y1XA 2WCLA 1MF8B 3PJIA 3SG7A 4C0JA 2M3WA 1L7ZA 1GQMA 2ZN8A 2JC2A 4Q04A 4PDZA 2LP3A 3DVMA 1OOJA 3TS5B 1Z2CB 5IBWA 2TN4A 2WC5A 5HYDA 4GUKA 2F33A 1FI5A 2MAZA 3DF0B 2P70A 2L2EA 1SL8A 3FS7A 5AXIA 2JRFA 1A75A 3UNWA 4P5OE 1TNXA 3I5HB 2LNKA 5CSJA 1QTXA 1XFVO 2QACA 1A4PA 2QDIA 1RFJA 4JQ0D 2MJWB 1YX7A 4XJKA 3S0EA 1S6JA 3BOWA 4IL1A 1A03A 4AQIA 2M1KB 3WHUB 1OZOA 5AANA 1B4CA 1K95A 1KFUL 2ISDA 1DEKA 2F3ZA 3Q8IA 3R72A 2F8PA 1UHJA 4IJ7A 3SS3A 2OS8B 1AUIB 2LVKA 3DZTA 4WQ2A 1RECA 1JF0A 3A8RA 3L4AA 3O4YA 2LVIA 2QEOA 1ALWA 2K61A 3FWCA 1NX0A 1AJ4A 1NSHA 1SCMC 2KQ6A 3D10A 5FI7A 2KPHA 1S5GZ 3I5IB 1OMDA 4OCIA 2MRDA 3D78A 2WCEA 3O2PA 4BY5A 1YUSA 1H4BA 2E6WA 1DJIA 2LLSA 2LMUA 1RWYA 2KI6C 2PQLA 4QJ4B 1KQVA 3VRQA 1UHIA 2M29A 3GK4X 1BLQA 1K9PA 1EJ3A 1KK7Y 2KFGA 3FWBA 3PLFB 3PM2A 1LXFC 1NWDA 2ERBA 2I7AA 4OR9B 5FI2A 2OPOA 1WLMA 2AMIA 4ICBA 1PK0D 1IH0A 1NX3A 5PALA 2KYFA 1CLMA 1QIVA 2LHIA 3BQ3A 3PN7C 2K7CA 2JT8A 4GBAA 2O5GA 4YGAA 5B8IB 1A75B 2HQ8A 1OZSA 2I18A 3S0BA 4PE0A 1AHRA 2Y1MA 2COLB 1CDLA 2LUXA 1EXRA 2KLEA 3TDZA 2BAPA 1WLZA 3I5GC 4F7FA 3CYZA 1J7RA 1NPQA 1W9ZA 3EK7A 1K9KA 3KPXA 3BUOB 1R2UA 4XJKB 3UO9A 4INXA 2HQWA 2KNEA 3C1VA 1OMVA 2KHNA 2K60A 2BCXA 5FYXA 1WRKA 1QX5B 2K2FA 1T14A 1CM4A 2ZNDA 3EKJA 3CZ2A 3S0AA 1QX7A 3PM8A 2L5XB 1CLLA 1IRJA 4PCWA 1JSAA 2QPTA 1QVIZ 1AP4A 1DJZA 1NX2A 1S1EA 1NCZA 2E30A 2PALA 4PT1A 1TIZA 1KK7Z 1U5IA 3CR5X 1GGWA 1CFPA 1EL4A 1WDCC 2KAVA 1OSAA 2R2IA 3FE8A 3F45A 1TNWA 2F2PA 3RZSA 3CDNA 1RTP1 1SL9A 2ZNEA 3OB2B 3VRPA 3VRRA 1MUXA 1B8RA 1BMOA 1LVCD 2JU0A 1F4OA 3D76A 1XVJA 4PHKA 5I2QA 1ZMZA 2CCMA 1KK8C 4TNCA 1C3YA 4YGDB 4C0LA 1L2OC 5DKRA 1NYAA 3OHMB 2HETA 5AEQA 2YGUA 1DJYA 2PYQA 1C07A 1FI6A 1DGVA 1SCMB 1Y6WA 4YGBB 2AUCA 1B1GA 1IKUA 1XK4C 3BFAA 1HQVA 4E68A 2ZRSA 5HKWA 3VGOA 2FJYA 2FOTA 1TNPA 3B6XA 4DIRA 2Y5IA 3QMEA 1SNLA 2EGDA 1J1EA 4CFRA 1ZUZA 4CPVA 3D77A 2K7OA 3I5FC 3NSLA 5D69A 1J7QA 1QS7A 4N1GA 1OOFA 1Y1AA 3SG3A 3WXAA 2M49B 1QV1A 2BE4A 2I2RE 3R1PA 1GM0A 5I94A 3R1VA 1U5IB 2LHLA 2PSRA 2FCDA 2WCHA 2GTEA 1MXEA 1TCFA 3SS4A 4D1EA 1XK4A 2NXQA 1DMOA 1KSOA 2IS9A 3BUXB 2RGIA 1A2XA 1YRTB 1ZOTB 3I5GB 3OB1B 3S0GA 1KQMC 2BNXA 2KYCA 2NCPA 4MSPA 2M9GA 4DRWA 3JTDC 1Z4HA 4MN0A 1B9AA 3LCPC 3NHIA 1XYDA 3SS5A 1YUTA 1ALVA 1Q80A 4PHNA 1J7OA 3WHTB 4INWA 4P2YB 3DVJA 1NUBA 3BFBA 5KTYA 1KFXS 5HL1A 3EK4A 1CTRA 2PMYA 2A4JA 2MLFC 3OBVA 1OOIX 4ORBB 1UUSA 2KFHA 1QXPA 4PE4A 1WDCB 3GK1A 1K2HA 1RK9A 1IQ5A 1TCOB 4OZDA 1IJ6A 4MBEA 3OP0A 2BL0C 4L9MA 5KSZA 4DUQA 1CB1A 2LANA 2CBLA 1YX8A 3PSRA 1W7JB 2LMTA 4ZCUA 2KDHA 3CLNA 4I5LB 1KK8B 4HSZA 1CFFA 1L2OB 4XYNA 2DOQA 5FI6A 5DICA 4ETOA 2LM5A 1CLBA 3D74A 1MHOA 2JT3A 4ORAB 2H61C 2BBMA 1YVLA 3IF7A 2L5YA 1IIOA 1N0YA 1AK8A 1B7TY 1EG3A 1G33A 5DKNA 4OVNF 2CXJA 2L51A 2K0JA 4WQ3A 3FE9A 3K21A 1H8BA 1V1GA 1ORGA 1S26D 3DY9A 4MLWA 1QWVA 1SMGA 3CZ0A 2L98A 3VRNA 1JWDA 1BF5A 2JXLA 3D75A 2JWWA 4GPLB 1N2DA 3I5FB 1JFJA 2M1UA 1LA3A 1EH2A 1HT9A 1M63B 1OW4A 4ORCB 1OOGA 2K7DA 4I5JA 4AQJA 1NCXA 4QJ5B 3SIAA 1C7WA 1IWQA 4YGEB 3AAJA 1GJYA 2H61A 3KHEA 3JVTC 4AOMA 2JPTA 2LC5A 2LV7A 1WRZA 5ER4X 1YURA 2PVBA 2EHBA 5JOLA 2LMVA 2KLDA 4KYNA 3RLZA 1KQMB 3R1OA 1G4YR 4CIDA 1KWOC 1DELA 3JTDB 2MBXA 2L0PA 2KSPA 3O4XA 1G8IA 4M2QA 2KBIA 4JD9A 4MVFA 1CFDA 2M0RA 3D73A 4FTGA 4BY4A 1DC1A 3EKHA 2QEHA 1B7TZ 2D8NA 1IQ3A 2H2KA 5HLOA 1LS8A 5I2OA 1TRFA 3PATA 3HX4A 5CPVA 4I5KA 3SG2A 2WCMA 1DVIA 5F6TA 2Q91A 1NX1A 2JNXA 2FJUB 1P28A 1F55A 1DJGA 1PRWA 1R6PA 2KI4C 2OTGC 2BECA 1BOCA 3EVRA 1WRLA 4HREE 2CNPA 5CSNA 3KF9A 5HKZA 1XFRA 1XFUO 2QEBA 2KGBC 1OE9B 2BL0B 2JOJA 2JXCA 2KQYA 3AKBA 3EG5B 4MZKA 2WC6A 2H8VA 5D3OA 5TNCA 4NQGA 2LE9B 4OKHA 2GV5A 4R1EA 1CDMA 4ZCVA 2JULA 4GGFC 1MQ1A 2BCBA 2ZFDA 4NDCA 2M7LA 3ZWHA 2WORA 1UURA 2BKIB 2KOTA 2Y4QA 1LINA 2LLUA 2WOSA 3CTNA 3A4UB 3SG6A 1PULA 1SRAA 3CS1A 4N1FA 5GQQC 1OMRA 3IVTA 4C0KA 3L4LA 3O78A 4YI8A 3SG5A 2QEVA 1TUZA 1J7PA 4GGNA 1E8AA 1M39A 1BT6A 1TUJA 2LVVA 1K8UA 2SASA 3PN7B 1S6IA 1QJTA 1BU3A 1UHHA 2P71A 1Y1UA 4F0ZB 1F8HA 3S0FA 2LVJA 1X02A 1SY9A 1QIWA 1CDNA 2WNDA 4GGFA 3NSOA 2LLTA 1AJ5A 2M97A 1JFKA 1IGVA 3B86A 2KI6D 4A4CA 2LAPA 1NP8A 1CNPA 1F4QA 2WCBA 3JVTB 2WC8A 1K90D 1F71A 1QV0A 2F2OA 4JKTA 1TWOA 3KO0A 3IQOA 2L4IA 3RM1A 3DD4A 3B7AA 1KWOB 1CMFA 1KSMA 1TN4A 2ZKMX 1FPWA 4JPZB 4YGCB 1K9UA 3EK8A 1S5GY 3NHTA 1NCYA 4FQTA 1B47A 1JF2A 3TUYC 1DJHA 1KFUS 2BCAA 1DTLA 1TNQA
chains in the Genus database with same CATH topology
1XFYO 5J3XA 5JJGA 2PRUA 4CLNA 1UHKA 2K2AA 2JTTA 3MSEB 2JZIA 3SG4A 1YTZC 2O60A 3EVVA 2OTGB 1ZFSA 2KI4B 3QRXA 4MRXA 3OX5A 4MEWA 2KFFA 2BBNA 1DF0A 1SYMA 1FW4A 1LKJA 1WY9A 1BR1B 1EG4A 2M7NA 1NIWA 3BYAA 3NSIA 2L50A 2Y1NA 3DVKA 3BXKA 1BODA 1KFXL 1CMGA 5CSIA 1M45A 5I8NA 1C7VA 2CTNA 5K89A 4I5NB 1M31A 2L4HA 1CM1A 1JUOA 4OV2A 1S6CA 1W7IB 2AAOA 3TDUA 1SR6C 2B1UA 4PE1A 5I2LA 2LCPA 4PHJA 3NXAA 1K93D 3TZ1A 2F3YA 4NDDA 3CR2A 4UPGA 1BG1A 1A29A 1PALA 3PFVA 4DCKA 3AAKA 1YRUB 4HRGA 4GFTA 1QVIY 3D0YA 1KCYA 1B8CA 2K7BA 1PVBA 1MR8A 2EC6C 2JT0A 1UWOA 5DKQA 4JWQA 1XO5A 1Y0VH 3LL8B 4PHMA 3ZNIA 3ICBA 2G2BA 5KU1A 1K94A 1ODBA 1DJWA 4USLA 5HLVA 1B8LA 2KAYA 2G9BA 5AFPA 2LUCA 1QATA 3SJSA 2FCEA 4YRUA 4YI9A 1CKKA 2VRGA 3VROA 5D7FA 1DF0B 4MZJA 5ER5A 1AVSA 1RJVA 5BPJA 3GK2A 2I94A 1XFZO 1DGUA 2NZ0A 2MHHA 2BKHB 3TS5C 1F54A 1XFXO 4HRHA 1M46A 3BOWB 3FIAA 1ZACA 3E3RA 2WCFA 3AKAA 2BE6A 3LK0A 2KBMA 1JC2A 4M2OA 4A4BA 3TUYB 3CWGA 2MA2A 2HF5A 2Q4UA 1SK6D 1TTXA 4FQOA 1K96A 4GAOA 3I5HC 1MWNA 2SCPA 3NSKA 3WNXB 1OQPA 3GOFA 2KGRA 1S3PA 2JQ6A 1SPYA 1DT7B 1QX2A 3CR4X 2JNFA 5HKYA 1TOPA 2GGMA 2M8UA 1YVHA 3M0WA 1V1FA 1F70A 1YUUA 1GGZA 3D0YB 1PSRA 2OS8C 4PALA 1SCVA 3OX6A 4N5XA 1UHNA 1BR4B 1D1OA 1JBAA 2K8MB 3H4SE 2P6BB 5CSFA 3DF0A 3LK1A 2V53A 1CFCA 5AERA 3KEVA 1YR5A 3I5IC 4QJ3B 5G08A 3CGAA 1SR6B 2GGZA 2ZRTA 1RROA 2MLEC 1DJXA 1FF1A 4MRYA 1QLKA 1IG5A 3HCMA 1XFWO 1PSBA 1PVAA 1MXLC 3O6BA 1SW8A 3BUMB 1FBVA 1SL7A 1IJ5A 2NCOA 3EVUA 3TDIA 4GNKB 1N65A 2LP2A 4MZLA 3BUNB 1BJFA 3DVEA 1LA0A 2NLNA 4M2PA 2EC6B 1S36A 1SBJA 2HPSA 2KAXA 3LLEA 3SIBA 3PALA 1VRKA 4WRIA 3CZTX 2PASA 4PE7A 1QASA 3BUWB 4NDBA 1UP5A 4U8DA 1XA5A 1J55A 4CFQA 1QLSA 1SKTA 2ZN9A 1CDPA 4YBHB 1J1DA 2CT9A 2JTZA 3IQQA 4DS7A 1Y1XA 3SG7A 1MF8B 4C0JA 2M3WA 1L7ZA 1GQMA 2ZN8A 2JC2A 4Q04A 4PDZA 2LP3A 3DVMA 1OOJA 3TS5B 5IBWA 2TN4A 5HYDA 4GUKA 2F33A 1FI5A 2MAZA 3DF0B 2L2EA 1SL8A 3FS7A 5AXIA 2JRFA 1A75A 4P5OE 1TNXA 3I5HB 2LNKA 5CSJA 1QTXA 1XFVO 2QACA 1A4PA 1RFJA 4JQ0D 2MJWB 1YX7A 4XJKA 1A03A 1S6JA 3BOWA 4IL1A 4AQIA 2M1KB 3WHUB 1OZOA 5AANA 1B4CA 1K95A 1KFUL 2ISDA 2F3ZA 1F8HA 2F8PA 1UHJA 2OS8B 1AUIB 2LVKA 4WQ2A 1RECA 1JF0A 3A8RA 3O4YA 2LVIA 1ALWA 2K61A 3FWCA 1NX0A 1AJ4A 1NSHA 1SCMC 2KQ6A 3D10A 1S5GZ 3I5IB 1OMDA 4OCIA 2MRDA 2WCEA 3O2PA 4BY5A 1YUSA 1H4BA 2E6WA 1DJIA 2LLSA 2LMUA 1RWYA 2KI6C 4QJ4B 1KQVA 3VRQA 1UHIA 2M29A 3GK4X 1BLQA 1K9PA 1EJ3A 1KK7Y 2KFGA 3FWBA 3PLFB 4OR9B 1LXFC 1NWDA 2I7AA 2OPOA 1WLMA 2AMIA 4ICBA 1PK0D 1IH0A 1NX3A 5PALA 2KYFA 1CLMA 1QIVA 2LHIA 3BQ3A 3PN7C 2K7CA 2JT8A 4GBAA 2O5GA 4YGAA 5B8IB 1A75B 2HQ8A 1OZSA 2I18A 4PE0A 1AHRA 2Y1MA 2COLB 1CDLA 2LUXA 1EXRA 3TDZA 1WLZA 3I5GC 1J7RA 1NPQA 3EK7A 3KPXA 1K9KA 4XJKB 3BUOB 1R2UA 1JWDA 2HQWA 2KNEA 3C1VA 1OMVA 2KHNA 2BCXA 5FYXA 1WRKA 1QX5B 2K2FA 2ZNDA 1CM4A 3EKJA 1QX7A 3PM8A 2L5XB 1CLLA 1IRJA 4PCWA 1JSAA 2QPTA 1QVIZ 1AP4A 1DJZA 1NX2A 1S1EA 1NCZA 2E30A 2PALA 1TIZA 1KK7Z 1U5IA 3CR5X 1GGWA 1CFPA 1EL4A 1WDCC 2KAVA 1OSAA 2R2IA 3F45A 1TNWA 2F2PA 1RTP1 1SL9A 2ZNEA 3OB2B 3VRPA 3VRRA 1MUXA 1B8RA 1BMOA 1LVCD 2JU0A 1F4OA 5I2QA 1XVJA 4PHKA 1ZMZA 2CCMA 1KK8C 4TNCA 4YGDB 4C0LA 1L2OC 5DKRA 1NYAA 3OHMB 2HETA 5AEQA 1DJYA 1C07A 1FI6A 1DGVA 1SCMB 1Y6WA 4YGBB 2AUCA 1B1GA 1IKUA 1XK4C 4E68A 1HQVA 2ZRSA 5HKWA 3VGOA 2FOTA 1TNPA 4DIRA 2Y5IA 1SNLA 2EGDA 1J1EA 4CFRA 1ZUZA 4CPVA 2K7OA 3I5FC 3NSLA 5D69A 1J7QA 1QS7A 4N1GA 1Y1AA 3SG3A 3WXAA 2M49B 1QV1A 2BE4A 2I2RE 1U5IB 2LHLA 2PSRA 2FCDA 1MXEA 1TCFA 4D1EA 1XK4A 2NXQA 1DMOA 1KSOA 2IS9A 3BUXB 2RGIA 1A2XA 1YRTB 1ZOTB 3I5GB 3OB1B 1KQMC 2KYCA 2NCPA 4MSPA 2M9GA 4DRWA 3JTDC 4MN0A 1B9AA 3LCPC 1XYDA 1YUTA 1ALVA 1Q80A 4PHNA 1J7OA 3WHTB 4P2YB 3DVJA 1NUBA 5KTYA 1KFXS 3EK4A 1CTRA 2PMYA 2A4JA 2MLFC 4ORBB 1UUSA 2KFHA 1QXPA 4PE4A 1WDCB 3GK1A 1K2HA 1RK9A 1IQ5A 1TCOB 1IJ6A 4MBEA 3OP0A 2BL0C 4L9MA 5KSZA 4DUQA 1CB1A 2LANA 2CBLA 1YX8A 3PSRA 1W7JB 2LMTA 4ZCUA 2KDHA 3CLNA 4I5LB 1KK8B 4HSZA 1CFFA 1L2OB 4XYNA 2DOQA 4ETOA 2LM5A 1CLBA 1MHOA 2JT3A 4ORAB 2H61C 2BBMA 1YVLA 3IF7A 1N0YA 1AK8A 1B7TY 1EG3A 1G33A 5DKNA 4OVNF 2CXJA 2L51A 2K0JA 4WQ3A 3K21A 1H8BA 1V1GA 1S26D 4MLWA 1SMGA 2L98A 3VRNA 1BF5A 2JXLA 2JWWA 4GPLB 1N2DA 3I5FB 1JFJA 2M1UA 1LA3A 1EH2A 1HT9A 1M63B 4ORCB 4I5JA 2K7DA 4AQJA 1NCXA 4QJ5B 3SIAA 1C7WA 1IWQA 4YGEB 3AAJA 1GJYA 2H61A 3KHEA 3JVTC 4AOMA 2JPTA 2LC5A 2LV7A 1WRZA 5ER4X 1YURA 2PVBA 2EHBA 5JOLA 2LMVA 3RLZA 1KQMB 1G4YR 4CIDA 1KWOC 3JTDB 2MBXA 2L0PA 2KSPA 1G8IA 4M2QA 2KBIA 4MVFA 1CFDA 2M0RA 4FTGA 4BY4A 3EKHA 1IQ3A 1B7TZ 2D8NA 2H2KA 5HLOA 5I2OA 1TRFA 3PATA 3HX4A 5CPVA 4I5KA 3SG2A 1DVIA 5F6TA 2Q91A 1NX1A 2JNXA 2FJUB 1F55A 1DJGA 1PRWA 1R6PA 2KI4C 2OTGC 2BECA 1BOCA 3EVRA 1WRLA 4HREE 2CNPA 5CSNA 3KF9A 5HKZA 1XFUO 3AKBA 2KGBC 1OE9B 2BL0B 2JOJA 2JXCA 2KQYA 4MZKA 5TNCA 4NQGA 2LE9B 4OKHA 2GV5A 4R1EA 1CDMA 4ZCVA 2JULA 4GGFC 1MQ1A 2BCBA 2ZFDA 4NDCA 2M7LA 3ZWHA 2WORA 1UURA 2BKIB 2KOTA 2Y4QA 1LINA 2LLUA 2WOSA 3CTNA 3A4UB 3SG6A 1PULA 1SRAA 3CS1A 4N1FA 5GQQC 1OMRA 4C0KA 3O78A 4YI8A 3SG5A 1J7PA 4GGNA 1E8AA 1M39A 1BT6A 2LVVA 1K8UA 2SASA 3PN7B 1S6IA 1QJTA 1BU3A 1UHHA 1Y1UA 4F0ZB 2LVJA 1X02A 1SY9A 1QIWA 1CDNA 2WNDA 4GGFA 3NSOA 2LLTA 1AJ5A 2M97A 1JFKA 1IGVA 2KI6D 4A4CA 2LAPA 1NP8A 1CNPA 1F4QA 2WCBA 3JVTB 2WC8A 1K90D 1F71A 1QV0A 2F2OA 3KO0A 3IQOA 2L4IA 3RM1A 3DD4A 1KWOB 1CMFA 1KSMA 1TN4A 2ZKMX 1FPWA 4JPZB 4YGCB 1K9UA 3EK8A 1S5GY 1NCYA 1B47A 1JF2A 3TUYC 1DJHA 1KFUS 2BCAA 1DTLA 1TNQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XFY O;  5J3X A;  5JJG A;  2PRU A;  4CLN A;  1UHK A;  2K2A A;  2JTT A;  3MSE B;  2JZI A;  3SG4 A;  1YTZ C;  2O60 A;  3EVV A;  2OTG B;  1ZFS A;  2KI4 B;  3QRX A;  4MRX A;  3OX5 A;  4MEW A;  2KFF A;  2BBN A;  1DF0 A;  1SYM A;  1FW4 A;  1LKJ A;  1WY9 A;  1BR1 B;  1EG4 A;  2M7N A;  1NIW A;  3BYA A;  3NSI A;  2L50 A;  2Y1N A;  3DVK A;  3BXK A;  1BOD A;  1KFX L;  1CMG A;  5CSI A;  1M45 A;  5I8N A;  1C7V A;  2CTN A;  5K89 A;  4I5N B;  1M31 A;  2L4H A;  1CM1 A;  1JUO A;  4OV2 A;  1S6C A;  1W7I B;  2AAO A;  3TDU A;  1SR6 C;  2B1U A;  4PE1 A;  5I2L A;  2LCP A;  4PHJ A;  3NXA A;  1K93 D;  3TZ1 A;  2F3Y A;  4NDD A;  3CR2 A;  4UPG A;  1BG1 A;  1A29 A;  1PAL A;  3PFV A;  4DCK A;  3AAK A;  1YRU B;  4HRG A;  4GFT A;  1QVI Y;  3D0Y A;  1KCY A;  1B8C A;  2K7B A;  1PVB A;  1MR8 A;  2EC6 C;  2JT0 A;  1UWO A;  5DKQ A;  4JWQ A;  1XO5 A;  1Y0V H;  3LL8 B;  4PHM A;  3ZNI A;  3ICB A;  2G2B A;  5KU1 A;  1K94 A;  1ODB A;  1DJW A;  4USL A;  5HLV A;  1B8L A;  2KAY A;  2G9B A;  5AFP A;  2LUC A;  1QAT A;  3SJS A;  2FCE A;  4YRU A;  4YI9 A;  1CKK A;  2VRG A;  3VRO A;  5D7F A;  1DF0 B;  4MZJ A;  5ER5 A;  1AVS A;  1RJV A;  5BPJ A;  3GK2 A;  2I94 A;  1XFZ O;  1DGU A;  2NZ0 A;  2MHH A;  2BKH B;  3TS5 C;  1F54 A;  1XFX O;  4HRH A;  1M46 A;  3BOW B;  3FIA A;  1ZAC A;  3E3R A;  2WCF A;  3AKA A;  2BE6 A;  3LK0 A;  2KBM A;  1JC2 A;  4M2O A;  4A4B A;  3TUY B;  3CWG A;  2MA2 A;  2HF5 A;  2Q4U A;  1SK6 D;  1TTX A;  4FQO A;  1K96 A;  4GAO A;  3I5H C;  1MWN A;  2SCP A;  3NSK A;  3WNX B;  1OQP A;  3GOF A;  2KGR A;  1S3P A;  2JQ6 A;  1SPY A;  1DT7 B;  1QX2 A;  3CR4 X;  2JNF A;  5HKY A;  1TOP A;  2GGM A;  2M8U A;  1YVH A;  3M0W A;  1V1F A;  1F70 A;  1YUU A;  1GGZ A;  3D0Y B;  1PSR A;  2OS8 C;  4PAL A;  1SCV A;  3OX6 A;  4N5X A;  1UHN A;  1BR4 B;  1D1O A;  1JBA A;  2K8M B;  3H4S E;  2P6B B;  5CSF A;  3DF0 A;  3LK1 A;  2V53 A;  1CFC A;  5AER A;  3KEV A;  1YR5 A;  3I5I C;  4QJ3 B;  5G08 A;  3CGA A;  1SR6 B;  2GGZ A;  2ZRT A;  1RRO A;  2MLE C;  1DJX A;  1FF1 A;  4MRY A;  1QLK A;  1IG5 A;  3HCM A;  1XFW O;  1PSB A;  1PVA A;  1MXL C;  3O6B A;  1SW8 A;  3BUM B;  1FBV A;  1SL7 A;  1IJ5 A;  2NCO A;  3EVU A;  3TDI A;  4GNK B;  1N65 A;  2LP2 A;  4MZL A;  3BUN B;  1BJF A;  3DVE A;  1LA0 A;  2NLN A;  4M2P A;  2EC6 B;  1S36 A;  1SBJ A;  2HPS A;  2KAX A;  3LLE A;  3SIB A;  3PAL A;  1VRK A;  4WRI A;  3CZT X;  2PAS A;  4PE7 A;  1QAS A;  3BUW B;  4NDB A;  1UP5 A;  4U8D A;  1XA5 A;  1J55 A;  4CFQ A;  1QLS A;  1SKT A;  2ZN9 A;  1CDP A;  4YBH B;  1J1D A;  2CT9 A;  2JTZ A;  3IQQ A;  4DS7 A;  1Y1X A;  3SG7 A;  1MF8 B;  4C0J A;  2M3W A;  1L7Z A;  1GQM A;  2ZN8 A;  2JC2 A;  4Q04 A;  4PDZ A;  2LP3 A;  3DVM A;  1OOJ A;  3TS5 B;  5IBW A;  2TN4 A;  5HYD A;  4GUK A;  2F33 A;  1FI5 A;  2MAZ A;  3DF0 B;  2L2E A;  1SL8 A;  3FS7 A;  5AXI A;  2JRF A;  1A75 A;  4P5O E;  1TNX A;  3I5H B;  2LNK A;  5CSJ A;  1QTX A;  1XFV O;  2QAC A;  1A4P A;  1RFJ A;  4JQ0 D;  2MJW B;  1YX7 A;  4XJK A;  1A03 A;  1S6J A;  3BOW A;  4IL1 A;  4AQI A;  2M1K B;  3WHU B;  1OZO A;  5AAN A;  1B4C A;  1K95 A;  1KFU L;  2ISD A;  2F3Z A;  1F8H A;  2F8P A;  1UHJ A;  2OS8 B;  1AUI B;  2LVK A;  4WQ2 A;  1REC A;  1JF0 A;  3A8R A;  3O4Y A;  2LVI A;  1ALW A;  2K61 A;  3FWC A;  1NX0 A;  1AJ4 A;  1NSH A;  1SCM C;  2KQ6 A;  3D10 A;  1S5G Z;  3I5I B;  1OMD A;  4OCI A;  2MRD A;  2WCE A;  3O2P A;  4BY5 A;  1YUS A;  1H4B A;  2E6W A;  1DJI A;  2LLS A;  2LMU A;  1RWY A;  2KI6 C;  4QJ4 B;  1KQV A;  3VRQ A;  1UHI A;  2M29 A;  3GK4 X;  1BLQ A;  1K9P A;  1EJ3 A;  1KK7 Y;  2KFG A;  3FWB A;  3PLF B;  4OR9 B;  1LXF C;  1NWD A;  2I7A A;  2OPO A;  1WLM A;  2AMI A;  4ICB A;  1PK0 D;  1IH0 A;  1NX3 A;  5PAL A;  2KYF A;  1CLM A;  1QIV A;  2LHI A;  3BQ3 A;  3PN7 C;  2K7C A;  2JT8 A;  4GBA A;  2O5G A;  4YGA A;  5B8I B;  1A75 B;  2HQ8 A;  1OZS A;  2I18 A;  4PE0 A;  1AHR A;  2Y1M A;  2COL B;  1CDL A;  2LUX A;  1EXR A;  3TDZ A;  1WLZ A;  3I5G C;  1J7R A;  1NPQ A;  3EK7 A;  3KPX A;  1K9K A;  4XJK B;  3BUO B;  1R2U A;  1JWD A;  2HQW A;  2KNE A;  3C1V A;  1OMV A;  2KHN A;  2BCX A;  5FYX A;  1WRK A;  1QX5 B;  2K2F A;  2ZND A;  1CM4 A;  3EKJ A;  1QX7 A;  3PM8 A;  2L5X B;  1CLL A;  1IRJ A;  4PCW A;  1JSA A;  2QPT A;  1QVI Z;  1AP4 A;  1DJZ A;  1NX2 A;  1S1E A;  1NCZ A;  2E30 A;  2PAL A;  1TIZ A;  1KK7 Z;  1U5I A;  3CR5 X;  1GGW A;  1CFP A;  1EL4 A;  1WDC C;  2KAV A;  1OSA A;  2R2I A;  3F45 A;  1TNW A;  2F2P A;  1RTP 1;  1SL9 A;  2ZNE A;  3OB2 B;  3VRP A;  3VRR A;  1MUX A;  1B8R A;  1BMO A;  1LVC D;  2JU0 A;  1F4O A;  5I2Q A;  1XVJ A;  4PHK A;  1ZMZ A;  2CCM A;  1KK8 C;  4TNC A;  4YGD B;  4C0L A;  1L2O C;  5DKR A;  1NYA A;  3OHM B;  2HET A;  5AEQ A;  1DJY A;  1C07 A;  1FI6 A;  1DGV A;  1SCM B;  1Y6W A;  4YGB B;  2AUC A;  1B1G A;  1IKU A;  1XK4 C;  4E68 A;  1HQV A;  2ZRS A;  5HKW A;  3VGO A;  2FOT A;  1TNP A;  4DIR A;  2Y5I A;  1SNL A;  2EGD A;  1J1E A;  4CFR A;  1ZUZ A;  4CPV A;  2K7O A;  3I5F C;  3NSL A;  5D69 A;  1J7Q A;  1QS7 A;  4N1G A;  1Y1A A;  3SG3 A;  3WXA A;  2M49 B;  1QV1 A;  2BE4 A;  2I2R E;  1U5I B;  2LHL A;  2PSR A;  2FCD A;  1MXE A;  1TCF A;  4D1E A;  1XK4 A;  2NXQ A;  1DMO A;  1KSO A;  2IS9 A;  3BUX B;  2RGI A;  1A2X A;  1YRT B;  1ZOT B;  3I5G B;  3OB1 B;  1KQM C;  2KYC A;  2NCP A;  4MSP A;  2M9G A;  4DRW A;  3JTD C;  4MN0 A;  1B9A A;  3LCP C;  1XYD A;  1YUT A;  1ALV A;  1Q80 A;  4PHN A;  1J7O A;  3WHT B;  4P2Y B;  3DVJ A;  1NUB A;  5KTY A;  1KFX S;  3EK4 A;  1CTR A;  2PMY A;  2A4J A;  2MLF C;  4ORB B;  1UUS A;  2KFH A;  1QXP A;  4PE4 A;  1WDC B;  3GK1 A;  1K2H A;  1RK9 A;  1IQ5 A;  1TCO B;  1IJ6 A;  4MBE A;  3OP0 A;  2BL0 C;  4L9M A;  5KSZ A;  4DUQ A;  1CB1 A;  2LAN A;  2CBL A;  1YX8 A;  3PSR A;  1W7J B;  2LMT A;  4ZCU A;  2KDH A;  3CLN A;  4I5L B;  1KK8 B;  4HSZ A;  1CFF A;  1L2O B;  4XYN A;  2DOQ A;  4ETO A;  2LM5 A;  1CLB A;  1MHO A;  2JT3 A;  4ORA B;  2H61 C;  2BBM A;  1YVL A;  3IF7 A;  1N0Y A;  1AK8 A;  1B7T Y;  1EG3 A;  1G33 A;  5DKN A;  4OVN F;  2CXJ A;  2L51 A;  2K0J A;  4WQ3 A;  3K21 A;  1H8B A;  1V1G A;  1S26 D;  4MLW A;  1SMG A;  2L98 A;  3VRN A;  1BF5 A;  2JXL A;  2JWW A;  4GPL B;  1N2D A;  3I5F B;  1JFJ A;  2M1U A;  1LA3 A;  1EH2 A;  1HT9 A;  1M63 B;  4ORC B;  4I5J A;  2K7D A;  4AQJ A;  1NCX A;  4QJ5 B;  3SIA A;  1C7W A;  1IWQ A;  4YGE B;  3AAJ A;  1GJY A;  2H61 A;  3KHE A;  3JVT C;  4AOM A;  2JPT A;  2LC5 A;  2LV7 A;  1WRZ A;  5ER4 X;  1YUR A;  2PVB A;  2EHB A;  5JOL A;  2LMV A;  3RLZ A;  1KQM B;  1G4Y R;  4CID A;  1KWO C;  3JTD B;  2MBX A;  2L0P A;  2KSP A;  1G8I A;  4M2Q A;  2KBI A;  4MVF A;  1CFD A;  2M0R A;  4FTG A;  4BY4 A;  3EKH A;  1IQ3 A;  1B7T Z;  2D8N A;  2H2K A;  5HLO A;  5I2O A;  1TRF A;  3PAT A;  3HX4 A;  5CPV A;  4I5K A;  3SG2 A;  1DVI A;  5F6T A;  2Q91 A;  1NX1 A;  2JNX A;  2FJU B;  1F55 A;  1DJG A;  1PRW A;  1R6P A;  2KI4 C;  2OTG C;  2BEC A;  1BOC A;  3EVR A;  1WRL A;  4HRE E;  2CNP A;  5CSN A;  3KF9 A;  5HKZ A;  1XFU O;  3AKB A;  2KGB C;  1OE9 B;  2BL0 B;  2JOJ A;  2JXC A;  2KQY A;  4MZK A;  5TNC A;  4NQG A;  2LE9 B;  4OKH A;  2GV5 A;  4R1E A;  1CDM A;  4ZCV A;  2JUL A;  4GGF C;  1MQ1 A;  2BCB A;  2ZFD A;  4NDC A;  2M7L A;  3ZWH A;  2WOR A;  1UUR A;  2BKI B;  2KOT A;  2Y4Q A;  1LIN A;  2LLU A;  2WOS A;  3CTN A;  3A4U B;  3SG6 A;  1PUL A;  1SRA A;  3CS1 A;  4N1F A;  5GQQ C;  1OMR A;  4C0K A;  3O78 A;  4YI8 A;  3SG5 A;  1J7P A;  4GGN A;  1E8A A;  1M39 A;  1BT6 A;  2LVV A;  1K8U A;  2SAS A;  3PN7 B;  1S6I A;  1QJT A;  1BU3 A;  1UHH A;  1Y1U A;  4F0Z B;  2LVJ A;  1X02 A;  1SY9 A;  1QIW A;  1CDN A;  2WND A;  4GGF A;  3NSO A;  2LLT A;  1AJ5 A;  2M97 A;  1JFK A;  1IGV A;  2KI6 D;  4A4C A;  2LAP A;  1NP8 A;  1CNP A;  1F4Q A;  2WCB A;  3JVT B;  2WC8 A;  1K90 D;  1F71 A;  1QV0 A;  2F2O A;  3KO0 A;  3IQO A;  2L4I A;  3RM1 A;  3DD4 A;  1KWO B;  1CMF A;  1KSM A;  1TN4 A;  2ZKM X;  1FPW A;  4JPZ B;  4YGC B;  1K9U A;  3EK8 A;  1S5G Y;  1NCY A;  1B47 A;  1JF2 A;  3TUY C;  1DJH A;  1KFU S;  2BCA A;  1DTL A;  1TNQ A; 
#chains in the Genus database with same CATH topology
 3NGV A;  1XFY O;  5J3X A;  5JJG A;  1OOH A;  3DXL A;  2WCJ A;  2PRU A;  4CLN A;  1UHK A;  2K2A A;  2JTT A;  3MSE B;  2WCK A;  2JZI A;  3SG4 A;  1YTZ C;  2O60 A;  3EVV A;  2OTG B;  1ZFS A;  2KI4 B;  3QRX A;  4MRX A;  3OX5 A;  4MEW A;  2KFF A;  2BBN A;  1DF0 A;  3B88 A;  1SYM A;  3CAB A;  1FW4 A;  1LKJ A;  1WY9 A;  1BR1 B;  1EG4 A;  2M7N A;  1NIW A;  3BYA A;  3NSI A;  2L50 A;  2Y1N A;  3DVK A;  3BXK A;  1BOD A;  1KFX L;  1CMG A;  5CSI A;  1M45 A;  5I8N A;  1C7V A;  2CTN A;  5K89 A;  4I5N B;  1M31 A;  2L4H A;  1CM1 A;  1JUO A;  4OV2 A;  3BJH A;  1S6C A;  1W7I B;  2AAO A;  3TDU A;  1SR6 C;  2B1U A;  4PE1 A;  5I2L A;  2LCP A;  4PHJ A;  3NXA A;  1K93 D;  3TZ1 A;  2F3Y A;  4NDD A;  3CR2 A;  4UPG A;  1BG1 A;  1A29 A;  1PAL A;  3PFV A;  4DCK A;  3AAK A;  1YRU B;  4HRG A;  4GFT A;  1QVI Y;  3D0Y A;  1KCY A;  1B8C A;  2K7B A;  1PVB A;  1MR8 A;  2EC6 C;  2JT0 A;  1UWO A;  5DKQ A;  4JWQ A;  3S0D A;  1XO5 A;  1Y0V H;  3LL8 B;  4PHM A;  3ZNI A;  3ICB A;  2G2B A;  5KU1 A;  1K94 A;  1ODB A;  1DJW A;  4USL A;  5HLV A;  1B8L A;  2KAY A;  2G9B A;  5AFP A;  2LUC A;  1QAT A;  1C3Z A;  3SJS A;  2FCE A;  4YRU A;  4YI9 A;  1CKK A;  2VRG A;  3VRO A;  5D7F A;  1DF0 B;  4MZJ A;  5ER5 A;  1AVS A;  1RJV A;  5BPJ A;  3GK2 A;  2I94 A;  1XFZ O;  3L47 A;  3BFH A;  1DGU A;  2NZ0 A;  2MHH A;  2BKH B;  3TS5 C;  1DQE A;  1F54 A;  1XFX O;  3K1E A;  1M46 A;  4HRH A;  3BOW B;  3FIA A;  1ZAC A;  3E3R A;  2WCF A;  3AKA A;  2BE6 A;  3LK0 A;  2KBM A;  1JC2 A;  4M2O A;  4A4B A;  3TUY B;  3CWG A;  2MA2 A;  2HF5 A;  2Q4U A;  1SK6 D;  1TTX A;  4FQO A;  1K96 A;  4GAO A;  3I5H C;  1MWN A;  2SCP A;  3VB1 A;  3NSK A;  3WNX B;  1OQP A;  3GOF A;  2KGR A;  1S3P A;  2JQ6 A;  1SPY A;  1DT7 B;  1QX2 A;  3CR4 X;  2JNF A;  5HKY A;  1TOP A;  2GGM A;  2M8U A;  1YVH A;  3M0W A;  1V1F A;  1F70 A;  1YUU A;  1GGZ A;  3D0Y B;  1PSR A;  2OS8 C;  4PAL A;  1SCV A;  3OX6 A;  4N5X A;  1SSE B;  1UHN A;  1BR4 B;  1D1O A;  1JBA A;  2K8M B;  3H4S E;  2P6B B;  5CSF A;  3FE6 A;  3DF0 A;  3LK1 A;  2V53 A;  1CFC A;  5AER A;  3KEV A;  1YR5 A;  3I5I C;  4QJ3 B;  5G08 A;  3CGA A;  3N7H A;  1SR6 B;  2GGZ A;  2ZRT A;  1RRO A;  2MLE C;  1DJX A;  3DYE A;  3V2L A;  3B87 A;  1FF1 A;  4MRY A;  1QLK A;  1IG5 A;  3HCM A;  1XFW O;  3OGN A;  1PSB A;  1PVA A;  1MXL C;  3O6B A;  1SW8 A;  3BUM B;  1FBV A;  1SL7 A;  1IJ5 A;  2NCO A;  3EVU A;  3TDI A;  4GNK B;  1N65 A;  2LP2 A;  4MZL A;  3BUN B;  1BJF A;  5EL2 A;  3DVE A;  1LA0 A;  2NLN A;  4M2P A;  2JPO A;  2EC6 B;  1S36 A;  1SBJ A;  2HPS A;  2KAX A;  3LLE A;  3SIB A;  3PAL A;  1VRK A;  4WRI A;  3CZ1 A;  3CZT X;  2PAS A;  4PE7 A;  1QAS A;  3BUW B;  4NDB A;  1UP5 A;  4U8D A;  1XA5 A;  1J55 A;  4CFQ A;  1QLS A;  1SKT A;  2ZN9 A;  1CDP A;  4YBH B;  1J1D A;  2CT9 A;  2JTZ A;  3IQQ A;  4DS7 A;  2L2C A;  1Y1X A;  2WCL A;  1MF8 B;  3PJI A;  3SG7 A;  4C0J A;  2M3W A;  1L7Z A;  1GQM A;  2ZN8 A;  2JC2 A;  4Q04 A;  4PDZ A;  2LP3 A;  3DVM A;  1OOJ A;  3TS5 B;  1Z2C B;  5IBW A;  2TN4 A;  2WC5 A;  5HYD A;  4GUK A;  2F33 A;  1FI5 A;  2MAZ A;  3DF0 B;  2P70 A;  2L2E A;  1SL8 A;  3FS7 A;  5AXI A;  2JRF A;  1A75 A;  3UNW A;  4P5O E;  1TNX A;  3I5H B;  2LNK A;  5CSJ A;  1QTX A;  1XFV O;  2QAC A;  1A4P A;  2QDI A;  1RFJ A;  4JQ0 D;  2MJW B;  1YX7 A;  4XJK A;  3S0E A;  1S6J A;  3BOW A;  4IL1 A;  1A03 A;  4AQI A;  2M1K B;  3WHU B;  1OZO A;  5AAN A;  1B4C A;  1K95 A;  1KFU L;  2ISD A;  1DEK A;  2F3Z A;  3Q8I A;  3R72 A;  2F8P A;  1UHJ A;  4IJ7 A;  3SS3 A;  2OS8 B;  1AUI B;  2LVK A;  3DZT A;  4WQ2 A;  1REC A;  1JF0 A;  3A8R A;  3L4A A;  3O4Y A;  2LVI A;  2QEO A;  1ALW A;  2K61 A;  3FWC A;  1NX0 A;  1AJ4 A;  1NSH A;  1SCM C;  2KQ6 A;  3D10 A;  5FI7 A;  2KPH A;  1S5G Z;  3I5I B;  1OMD A;  4OCI A;  2MRD A;  3D78 A;  2WCE A;  3O2P A;  4BY5 A;  1YUS A;  1H4B A;  2E6W A;  1DJI A;  2LLS A;  2LMU A;  1RWY A;  2KI6 C;  2PQL A;  4QJ4 B;  1KQV A;  3VRQ A;  1UHI A;  2M29 A;  3GK4 X;  1BLQ A;  1K9P A;  1EJ3 A;  1KK7 Y;  2KFG A;  3FWB A;  3PLF B;  3PM2 A;  1LXF C;  1NWD A;  2ERB A;  2I7A A;  4OR9 B;  5FI2 A;  2OPO A;  1WLM A;  2AMI A;  4ICB A;  1PK0 D;  1IH0 A;  1NX3 A;  5PAL A;  2KYF A;  1CLM A;  1QIV A;  2LHI A;  3BQ3 A;  3PN7 C;  2K7C A;  2JT8 A;  4GBA A;  2O5G A;  4YGA A;  5B8I B;  1A75 B;  2HQ8 A;  1OZS A;  2I18 A;  3S0B A;  4PE0 A;  1AHR A;  2Y1M A;  2COL B;  1CDL A;  2LUX A;  1EXR A;  2KLE A;  3TDZ A;  2BAP A;  1WLZ A;  3I5G C;  4F7F A;  3CYZ A;  1J7R A;  1NPQ A;  1W9Z A;  3EK7 A;  1K9K A;  3KPX A;  3BUO B;  1R2U A;  4XJK B;  3UO9 A;  4INX A;  2HQW A;  2KNE A;  3C1V A;  1OMV A;  2KHN A;  2K60 A;  2BCX A;  5FYX A;  1WRK A;  1QX5 B;  2K2F A;  1T14 A;  1CM4 A;  2ZND A;  3EKJ A;  3CZ2 A;  3S0A A;  1QX7 A;  3PM8 A;  2L5X B;  1CLL A;  1IRJ A;  4PCW A;  1JSA A;  2QPT A;  1QVI Z;  1AP4 A;  1DJZ A;  1NX2 A;  1S1E A;  1NCZ A;  2E30 A;  2PAL A;  4PT1 A;  1TIZ A;  1KK7 Z;  1U5I A;  3CR5 X;  1GGW A;  1CFP A;  1EL4 A;  1WDC C;  2KAV A;  1OSA A;  2R2I A;  3FE8 A;  3F45 A;  1TNW A;  2F2P A;  3RZS A;  3CDN A;  1RTP 1;  1SL9 A;  2ZNE A;  3OB2 B;  3VRP A;  3VRR A;  1MUX A;  1B8R A;  1BMO A;  1LVC D;  2JU0 A;  1F4O A;  3D76 A;  1XVJ A;  4PHK A;  5I2Q A;  1ZMZ A;  2CCM A;  1KK8 C;  4TNC A;  1C3Y A;  4YGD B;  4C0L A;  1L2O C;  5DKR A;  1NYA A;  3OHM B;  2HET A;  5AEQ A;  2YGU A;  1DJY A;  2PYQ A;  1C07 A;  1FI6 A;  1DGV A;  1SCM B;  1Y6W A;  4YGB B;  2AUC A;  1B1G A;  1IKU A;  1XK4 C;  3BFA A;  1HQV A;  4E68 A;  2ZRS A;  5HKW A;  3VGO A;  2FJY A;  2FOT A;  1TNP A;  3B6X A;  4DIR A;  2Y5I A;  3QME A;  1SNL A;  2EGD A;  1J1E A;  4CFR A;  1ZUZ A;  4CPV A;  3D77 A;  2K7O A;  3I5F C;  3NSL A;  5D69 A;  1J7Q A;  1QS7 A;  4N1G A;  1OOF A;  1Y1A A;  3SG3 A;  3WXA A;  2M49 B;  1QV1 A;  2BE4 A;  2I2R E;  3R1P A;  1GM0 A;  5I94 A;  3R1V A;  1U5I B;  2LHL A;  2PSR A;  2FCD A;  2WCH A;  2GTE A;  1MXE A;  1TCF A;  3SS4 A;  4D1E A;  1XK4 A;  2NXQ A;  1DMO A;  1KSO A;  2IS9 A;  3BUX B;  2RGI A;  1A2X A;  1YRT B;  1ZOT B;  3I5G B;  3OB1 B;  3S0G A;  1KQM C;  2BNX A;  2KYC A;  2NCP A;  4MSP A;  2M9G A;  4DRW A;  3JTD C;  1Z4H A;  4MN0 A;  1B9A A;  3LCP C;  3NHI A;  1XYD A;  3SS5 A;  1YUT A;  1ALV A;  1Q80 A;  4PHN A;  1J7O A;  3WHT B;  4INW A;  4P2Y B;  3DVJ A;  1NUB A;  3BFB A;  5KTY A;  1KFX S;  5HL1 A;  3EK4 A;  1CTR A;  2PMY A;  2A4J A;  2MLF C;  3OBV A;  1OOI X;  4ORB B;  1UUS A;  2KFH A;  1QXP A;  4PE4 A;  1WDC B;  3GK1 A;  1K2H A;  1RK9 A;  1IQ5 A;  1TCO B;  4OZD A;  1IJ6 A;  4MBE A;  3OP0 A;  2BL0 C;  4L9M A;  5KSZ A;  4DUQ A;  1CB1 A;  2LAN A;  2CBL A;  1YX8 A;  3PSR A;  1W7J B;  2LMT A;  4ZCU A;  2KDH A;  3CLN A;  4I5L B;  1KK8 B;  4HSZ A;  1CFF A;  1L2O B;  4XYN A;  2DOQ A;  5FI6 A;  5DIC A;  4ETO A;  2LM5 A;  1CLB A;  3D74 A;  1MHO A;  2JT3 A;  4ORA B;  2H61 C;  2BBM A;  1YVL A;  3IF7 A;  2L5Y A;  1IIO A;  1N0Y A;  1AK8 A;  1B7T Y;  1EG3 A;  1G33 A;  5DKN A;  4OVN F;  2CXJ A;  2L51 A;  2K0J A;  4WQ3 A;  3FE9 A;  3K21 A;  1H8B A;  1V1G A;  1ORG A;  1S26 D;  3DY9 A;  4MLW A;  1QWV A;  1SMG A;  3CZ0 A;  2L98 A;  3VRN A;  1JWD A;  1BF5 A;  2JXL A;  3D75 A;  2JWW A;  4GPL B;  1N2D A;  3I5F B;  1JFJ A;  2M1U A;  1LA3 A;  1EH2 A;  1HT9 A;  1M63 B;  1OW4 A;  4ORC B;  1OOG A;  2K7D A;  4I5J A;  4AQJ A;  1NCX A;  4QJ5 B;  3SIA A;  1C7W A;  1IWQ A;  4YGE B;  3AAJ A;  1GJY A;  2H61 A;  3KHE A;  3JVT C;  4AOM A;  2JPT A;  2LC5 A;  2LV7 A;  1WRZ A;  5ER4 X;  1YUR A;  2PVB A;  2EHB A;  5JOL A;  2LMV A;  2KLD A;  4KYN A;  3RLZ A;  1KQM B;  3R1O A;  1G4Y R;  4CID A;  1KWO C;  1DEL A;  3JTD B;  2MBX A;  2L0P A;  2KSP A;  3O4X A;  1G8I A;  4M2Q A;  2KBI A;  4JD9 A;  4MVF A;  1CFD A;  2M0R A;  3D73 A;  4FTG A;  4BY4 A;  1DC1 A;  3EKH A;  2QEH A;  1B7T Z;  2D8N A;  1IQ3 A;  2H2K A;  5HLO A;  1LS8 A;  5I2O A;  1TRF A;  3PAT A;  3HX4 A;  5CPV A;  4I5K A;  3SG2 A;  2WCM A;  1DVI A;  5F6T A;  2Q91 A;  1NX1 A;  2JNX A;  2FJU B;  1P28 A;  1F55 A;  1DJG A;  1PRW A;  1R6P A;  2KI4 C;  2OTG C;  2BEC A;  1BOC A;  3EVR A;  1WRL A;  4HRE E;  2CNP A;  5CSN A;  3KF9 A;  5HKZ A;  1XFR A;  1XFU O;  2QEB A;  2KGB C;  1OE9 B;  2BL0 B;  2JOJ A;  2JXC A;  2KQY A;  3AKB A;  3EG5 B;  4MZK A;  2WC6 A;  2H8V A;  5D3O A;  5TNC A;  4NQG A;  2LE9 B;  4OKH A;  2GV5 A;  4R1E A;  1CDM A;  4ZCV A;  2JUL A;  4GGF C;  1MQ1 A;  2BCB A;  2ZFD A;  4NDC A;  2M7L A;  3ZWH A;  2WOR A;  1UUR A;  2BKI B;  2KOT A;  2Y4Q A;  1LIN A;  2LLU A;  2WOS A;  3CTN A;  3A4U B;  3SG6 A;  1PUL A;  1SRA A;  3CS1 A;  4N1F A;  5GQQ C;  1OMR A;  3IVT A;  4C0K A;  3L4L A;  3O78 A;  4YI8 A;  3SG5 A;  2QEV A;  1TUZ A;  1J7P A;  4GGN A;  1E8A A;  1M39 A;  1BT6 A;  1TUJ A;  2LVV A;  1K8U A;  2SAS A;  3PN7 B;  1S6I A;  1QJT A;  1BU3 A;  1UHH A;  2P71 A;  1Y1U A;  4F0Z B;  1F8H A;  3S0F A;  2LVJ A;  1X02 A;  1SY9 A;  1QIW A;  1CDN A;  2WND A;  4GGF A;  3NSO A;  2LLT A;  1AJ5 A;  2M97 A;  1JFK A;  1IGV A;  3B86 A;  2KI6 D;  4A4C A;  2LAP A;  1NP8 A;  1CNP A;  1F4Q A;  2WCB A;  3JVT B;  2WC8 A;  1K90 D;  1F71 A;  1QV0 A;  2F2O A;  4JKT A;  1TWO A;  3KO0 A;  3IQO A;  2L4I A;  3RM1 A;  3DD4 A;  3B7A A;  1KWO B;  1CMF A;  1KSM A;  1TN4 A;  2ZKM X;  1FPW A;  4JPZ B;  4YGC B;  1K9U A;  3EK8 A;  1S5G Y;  3NHT A;  1NCY A;  4FQT A;  1B47 A;  1JF2 A;  3TUY C;  1DJH A;  1KFU S;  2BCA A;  1DTL A;  1TNQ A; 
#chains in the Genus database with same CATH homology
 1XFY O;  5J3X A;  5JJG A;  2PRU A;  4CLN A;  1UHK A;  2K2A A;  2JTT A;  3MSE B;  2JZI A;  3SG4 A;  1YTZ C;  2O60 A;  3EVV A;  2OTG B;  1ZFS A;  2KI4 B;  3QRX A;  4MRX A;  3OX5 A;  4MEW A;  2KFF A;  2BBN A;  1DF0 A;  1SYM A;  1FW4 A;  1LKJ A;  1WY9 A;  1BR1 B;  1EG4 A;  2M7N A;  1NIW A;  3BYA A;  3NSI A;  2L50 A;  2Y1N A;  3DVK A;  3BXK A;  1BOD A;  1KFX L;  1CMG A;  5CSI A;  1M45 A;  5I8N A;  1C7V A;  2CTN A;  5K89 A;  4I5N B;  1M31 A;  2L4H A;  1CM1 A;  1JUO A;  4OV2 A;  1S6C A;  1W7I B;  2AAO A;  3TDU A;  1SR6 C;  2B1U A;  4PE1 A;  5I2L A;  2LCP A;  4PHJ A;  3NXA A;  1K93 D;  3TZ1 A;  2F3Y A;  4NDD A;  3CR2 A;  4UPG A;  1BG1 A;  1A29 A;  1PAL A;  3PFV A;  4DCK A;  3AAK A;  1YRU B;  4HRG A;  4GFT A;  1QVI Y;  3D0Y A;  1KCY A;  1B8C A;  2K7B A;  1PVB A;  1MR8 A;  2EC6 C;  2JT0 A;  1UWO A;  5DKQ A;  4JWQ A;  1XO5 A;  1Y0V H;  3LL8 B;  4PHM A;  3ZNI A;  3ICB A;  2G2B A;  5KU1 A;  1K94 A;  1ODB A;  1DJW A;  4USL A;  5HLV A;  1B8L A;  2KAY A;  2G9B A;  5AFP A;  2LUC A;  1QAT A;  3SJS A;  2FCE A;  4YRU A;  4YI9 A;  1CKK A;  2VRG A;  3VRO A;  5D7F A;  1DF0 B;  4MZJ A;  5ER5 A;  1AVS A;  1RJV A;  5BPJ A;  3GK2 A;  2I94 A;  1XFZ O;  1DGU A;  2NZ0 A;  2MHH A;  2BKH B;  3TS5 C;  1F54 A;  1XFX O;  4HRH A;  1M46 A;  3BOW B;  3FIA A;  1ZAC A;  3E3R A;  2WCF A;  3AKA A;  2BE6 A;  3LK0 A;  2KBM A;  1JC2 A;  4M2O A;  4A4B A;  3TUY B;  3CWG A;  2MA2 A;  2HF5 A;  2Q4U A;  1SK6 D;  1TTX A;  4FQO A;  1K96 A;  4GAO A;  3I5H C;  1MWN A;  2SCP A;  3NSK A;  3WNX B;  1OQP A;  3GOF A;  2KGR A;  1S3P A;  2JQ6 A;  1SPY A;  1DT7 B;  1QX2 A;  3CR4 X;  2JNF A;  5HKY A;  1TOP A;  2GGM A;  2M8U A;  1YVH A;  3M0W A;  1V1F A;  1F70 A;  1YUU A;  1GGZ A;  3D0Y B;  1PSR A;  2OS8 C;  4PAL A;  1SCV A;  3OX6 A;  4N5X A;  1UHN A;  1BR4 B;  1D1O A;  1JBA A;  2K8M B;  3H4S E;  2P6B B;  5CSF A;  3DF0 A;  3LK1 A;  2V53 A;  1CFC A;  5AER A;  3KEV A;  1YR5 A;  3I5I C;  4QJ3 B;  5G08 A;  3CGA A;  1SR6 B;  2GGZ A;  2ZRT A;  1RRO A;  2MLE C;  1DJX A;  1FF1 A;  4MRY A;  1QLK A;  1IG5 A;  3HCM A;  1XFW O;  1PSB A;  1PVA A;  1MXL C;  3O6B A;  1SW8 A;  3BUM B;  1FBV A;  1SL7 A;  1IJ5 A;  2NCO A;  3EVU A;  3TDI A;  4GNK B;  1N65 A;  2LP2 A;  4MZL A;  3BUN B;  1BJF A;  3DVE A;  1LA0 A;  2NLN A;  4M2P A;  2EC6 B;  1S36 A;  1SBJ A;  2HPS A;  2KAX A;  3LLE A;  3SIB A;  3PAL A;  1VRK A;  4WRI A;  3CZT X;  2PAS A;  4PE7 A;  1QAS A;  3BUW B;  4NDB A;  1UP5 A;  4U8D A;  1XA5 A;  1J55 A;  4CFQ A;  1QLS A;  1SKT A;  2ZN9 A;  1CDP A;  4YBH B;  1J1D A;  2CT9 A;  2JTZ A;  3IQQ A;  4DS7 A;  1Y1X A;  3SG7 A;  1MF8 B;  4C0J A;  2M3W A;  1L7Z A;  1GQM A;  2ZN8 A;  2JC2 A;  4Q04 A;  4PDZ A;  2LP3 A;  3DVM A;  1OOJ A;  3TS5 B;  5IBW A;  2TN4 A;  5HYD A;  4GUK A;  2F33 A;  1FI5 A;  2MAZ A;  3DF0 B;  2L2E A;  1SL8 A;  3FS7 A;  5AXI A;  2JRF A;  1A75 A;  4P5O E;  1TNX A;  3I5H B;  2LNK A;  5CSJ A;  1QTX A;  1XFV O;  2QAC A;  1A4P A;  1RFJ A;  4JQ0 D;  2MJW B;  1YX7 A;  4XJK A;  1A03 A;  1S6J A;  3BOW A;  4IL1 A;  4AQI A;  2M1K B;  3WHU B;  1OZO A;  5AAN A;  1B4C A;  1K95 A;  1KFU L;  2ISD A;  2F3Z A;  1F8H A;  2F8P A;  1UHJ A;  2OS8 B;  1AUI B;  2LVK A;  4WQ2 A;  1REC A;  1JF0 A;  3A8R A;  3O4Y A;  2LVI A;  1ALW A;  2K61 A;  3FWC A;  1NX0 A;  1AJ4 A;  1NSH A;  1SCM C;  2KQ6 A;  3D10 A;  1S5G Z;  3I5I B;  1OMD A;  4OCI A;  2MRD A;  2WCE A;  3O2P A;  4BY5 A;  1YUS A;  1H4B A;  2E6W A;  1DJI A;  2LLS A;  2LMU A;  1RWY A;  2KI6 C;  4QJ4 B;  1KQV A;  3VRQ A;  1UHI A;  2M29 A;  3GK4 X;  1BLQ A;  1K9P A;  1EJ3 A;  1KK7 Y;  2KFG A;  3FWB A;  3PLF B;  4OR9 B;  1LXF C;  1NWD A;  2I7A A;  2OPO A;  1WLM A;  2AMI A;  4ICB A;  1PK0 D;  1IH0 A;  1NX3 A;  5PAL A;  2KYF A;  1CLM A;  1QIV A;  2LHI A;  3BQ3 A;  3PN7 C;  2K7C A;  2JT8 A;  4GBA A;  2O5G A;  4YGA A;  5B8I B;  1A75 B;  2HQ8 A;  1OZS A;  2I18 A;  4PE0 A;  1AHR A;  2Y1M A;  2COL B;  1CDL A;  2LUX A;  1EXR A;  3TDZ A;  1WLZ A;  3I5G C;  1J7R A;  1NPQ A;  3EK7 A;  3KPX A;  1K9K A;  4XJK B;  3BUO B;  1R2U A;  1JWD A;  2HQW A;  2KNE A;  3C1V A;  1OMV A;  2KHN A;  2BCX A;  5FYX A;  1WRK A;  1QX5 B;  2K2F A;  2ZND A;  1CM4 A;  3EKJ A;  1QX7 A;  3PM8 A;  2L5X B;  1CLL A;  1IRJ A;  4PCW A;  1JSA A;  2QPT A;  1QVI Z;  1AP4 A;  1DJZ A;  1NX2 A;  1S1E A;  1NCZ A;  2E30 A;  2PAL A;  1TIZ A;  1KK7 Z;  1U5I A;  3CR5 X;  1GGW A;  1CFP A;  1EL4 A;  1WDC C;  2KAV A;  1OSA A;  2R2I A;  3F45 A;  1TNW A;  2F2P A;  1RTP 1;  1SL9 A;  2ZNE A;  3OB2 B;  3VRP A;  3VRR A;  1MUX A;  1B8R A;  1BMO A;  1LVC D;  2JU0 A;  1F4O A;  5I2Q A;  1XVJ A;  4PHK A;  1ZMZ A;  2CCM A;  1KK8 C;  4TNC A;  4YGD B;  4C0L A;  1L2O C;  5DKR A;  1NYA A;  3OHM B;  2HET A;  5AEQ A;  1DJY A;  1C07 A;  1FI6 A;  1DGV A;  1SCM B;  1Y6W A;  4YGB B;  2AUC A;  1B1G A;  1IKU A;  1XK4 C;  4E68 A;  1HQV A;  2ZRS A;  5HKW A;  3VGO A;  2FOT A;  1TNP A;  4DIR A;  2Y5I A;  1SNL A;  2EGD A;  1J1E A;  4CFR A;  1ZUZ A;  4CPV A;  2K7O A;  3I5F C;  3NSL A;  5D69 A;  1J7Q A;  1QS7 A;  4N1G A;  1Y1A A;  3SG3 A;  3WXA A;  2M49 B;  1QV1 A;  2BE4 A;  2I2R E;  1U5I B;  2LHL A;  2PSR A;  2FCD A;  1MXE A;  1TCF A;  4D1E A;  1XK4 A;  2NXQ A;  1DMO A;  1KSO A;  2IS9 A;  3BUX B;  2RGI A;  1A2X A;  1YRT B;  1ZOT B;  3I5G B;  3OB1 B;  1KQM C;  2KYC A;  2NCP A;  4MSP A;  2M9G A;  4DRW A;  3JTD C;  4MN0 A;  1B9A A;  3LCP C;  1XYD A;  1YUT A;  1ALV A;  1Q80 A;  4PHN A;  1J7O A;  3WHT B;  4P2Y B;  3DVJ A;  1NUB A;  5KTY A;  1KFX S;  3EK4 A;  1CTR A;  2PMY A;  2A4J A;  2MLF C;  4ORB B;  1UUS A;  2KFH A;  1QXP A;  4PE4 A;  1WDC B;  3GK1 A;  1K2H A;  1RK9 A;  1IQ5 A;  1TCO B;  1IJ6 A;  4MBE A;  3OP0 A;  2BL0 C;  4L9M A;  5KSZ A;  4DUQ A;  1CB1 A;  2LAN A;  2CBL A;  1YX8 A;  3PSR A;  1W7J B;  2LMT A;  4ZCU A;  2KDH A;  3CLN A;  4I5L B;  1KK8 B;  4HSZ A;  1CFF A;  1L2O B;  4XYN A;  2DOQ A;  4ETO A;  2LM5 A;  1CLB A;  1MHO A;  2JT3 A;  4ORA B;  2H61 C;  2BBM A;  1YVL A;  3IF7 A;  1N0Y A;  1AK8 A;  1B7T Y;  1EG3 A;  1G33 A;  5DKN A;  4OVN F;  2CXJ A;  2L51 A;  2K0J A;  4WQ3 A;  3K21 A;  1H8B A;  1V1G A;  1S26 D;  4MLW A;  1SMG A;  2L98 A;  3VRN A;  1BF5 A;  2JXL A;  2JWW A;  4GPL B;  1N2D A;  3I5F B;  1JFJ A;  2M1U A;  1LA3 A;  1EH2 A;  1HT9 A;  1M63 B;  4ORC B;  4I5J A;  2K7D A;  4AQJ A;  1NCX A;  4QJ5 B;  3SIA A;  1C7W A;  1IWQ A;  4YGE B;  3AAJ A;  1GJY A;  2H61 A;  3KHE A;  3JVT C;  4AOM A;  2JPT A;  2LC5 A;  2LV7 A;  1WRZ A;  5ER4 X;  1YUR A;  2PVB A;  2EHB A;  5JOL A;  2LMV A;  3RLZ A;  1KQM B;  1G4Y R;  4CID A;  1KWO C;  3JTD B;  2MBX A;  2L0P A;  2KSP A;  1G8I A;  4M2Q A;  2KBI A;  4MVF A;  1CFD A;  2M0R A;  4FTG A;  4BY4 A;  3EKH A;  1IQ3 A;  1B7T Z;  2D8N A;  2H2K A;  5HLO A;  5I2O A;  1TRF A;  3PAT A;  3HX4 A;  5CPV A;  4I5K A;  3SG2 A;  1DVI A;  5F6T A;  2Q91 A;  1NX1 A;  2JNX A;  2FJU B;  1F55 A;  1DJG A;  1PRW A;  1R6P A;  2KI4 C;  2OTG C;  2BEC A;  1BOC A;  3EVR A;  1WRL A;  4HRE E;  2CNP A;  5CSN A;  3KF9 A;  5HKZ A;  1XFU O;  3AKB A;  2KGB C;  1OE9 B;  2BL0 B;  2JOJ A;  2JXC A;  2KQY A;  4MZK A;  5TNC A;  4NQG A;  2LE9 B;  4OKH A;  2GV5 A;  4R1E A;  1CDM A;  4ZCV A;  2JUL A;  4GGF C;  1MQ1 A;  2BCB A;  2ZFD A;  4NDC A;  2M7L A;  3ZWH A;  2WOR A;  1UUR A;  2BKI B;  2KOT A;  2Y4Q A;  1LIN A;  2LLU A;  2WOS A;  3CTN A;  3A4U B;  3SG6 A;  1PUL A;  1SRA A;  3CS1 A;  4N1F A;  5GQQ C;  1OMR A;  4C0K A;  3O78 A;  4YI8 A;  3SG5 A;  1J7P A;  4GGN A;  1E8A A;  1M39 A;  1BT6 A;  2LVV A;  1K8U A;  2SAS A;  3PN7 B;  1S6I A;  1QJT A;  1BU3 A;  1UHH A;  1Y1U A;  4F0Z B;  2LVJ A;  1X02 A;  1SY9 A;  1QIW A;  1CDN A;  2WND A;  4GGF A;  3NSO A;  2LLT A;  1AJ5 A;  2M97 A;  1JFK A;  1IGV A;  2KI6 D;  4A4C A;  2LAP A;  1NP8 A;  1CNP A;  1F4Q A;  2WCB A;  3JVT B;  2WC8 A;  1K90 D;  1F71 A;  1QV0 A;  2F2O A;  3KO0 A;  3IQO A;  2L4I A;  3RM1 A;  3DD4 A;  1KWO B;  1CMF A;  1KSM A;  1TN4 A;  2ZKM X;  1FPW A;  4JPZ B;  4YGC B;  1K9U A;  3EK8 A;  1S5G Y;  1NCY A;  1B47 A;  1JF2 A;  3TUY C;  1DJH A;  1KFU S;  2BCA A;  1DTL A;  1TNQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...