1N2DA

Ternary complex of mlc1p bound to iq2 and iq3 of myo2p, a class v myosin
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
147
structure length
147
Chain Sequence
ATRANKDIFTLFDKKGQGAIAKDSLGDYLRAIGYNPTNQLVQDIINADSSLRDASSLTLDQITGLIEVNEKELDATTKAKTEDFVKAFQVFDKESTGKVSVGDLRYMLTGLGEKLTDAEVDELLKGVEVDSNGEIDYKKFIEDVLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Myosin Light Chain
publication title Structure of the light chain-binding domain of myosin V.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 45
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1n2dA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1n2dA01
1N65A 3M0WA 1D1OA 1JSAA 4D1EA 1F70A 1SL8A 4M2PA 2JC2A 4GUKA 3O6BA 2K7BA 1AJ5A 1TNXA 4WQ2A 5AANA 1QASA 2M7LA 1XK4A 4OCIA 1QXPA 3F45A 1KCYA 2JXCA 1A75A 2KFFA 2M9GA 1QX5B 1IJ6A 1A75B 3I5IB 5KSZA 4E68A 2H2KA 1DJXA 1BR1B 2K2FA 2QPTA 2JT3A 1OMDA 2L5XB 1KFUS 2LMVA 2FJUB 3HCMA 3EKHA 4NDBA 2FCEA 5PALA 2WOSA 3KO0A 4P5OE 3I5FC 2KI4B 1EG3A 1SBJA 1YRUB 2K2AA 3PLFB 2LP3A 5BPJA 3LCPC 5CSJA 1SCMC 3NSLA 4IL1A 1Q80A 2LLTA 1RJVA 4USLA 1IG5A 1EXRA 5D7FA 2JU0A 3BQ3A 3JTDB 1R6PA 3I5HC 2CNPA 1BT6A 3EVUA 1OZOA 2KDHA 1QV0A 2M29A 2I2RE 3E3RA 1ZMZA 5CPVA 1KFUL 1YRTB 1F4OA 1CDPA 4HRHA 1BG1A 3OX5A 2BECA 3K21A 2L51A 2F33A 1H4BA 2ZNDA 2FOTA 5HKZA 1AUIB 4A4CA 1B47A 2MRDA 1B4CA 1SL9A 2I94A 1SR6B 1CDLA 3TDIA 4YGDB 2KYCA 2JWWA 1RTP1 1TCFA 1IJ5A 1PRWA 2DOQA 2H61A 2CXJA 3RLZA 1K90D 3JVTC 1DJGA 1K96A 2LANA 3DD4A 1KQMB 2JPTA 2BL0B 1EJ3A 3TDZA 1F8HA 4YI8A 1CLLA 1CTRA 3BUOB 4TNCA 4BY4A 4M2QA 1K93D 2RGIA 5ER5A 1SY9A 4NDCA 1ZACA 2HQWA 1TOPA 4YRUA 1AJ4A 4C0JA 5AEQA 1L2OC 1XVJA 1NSHA 1A29A 2HPSA 3SJSA 2KAXA 1WDCC 1CNPA 2G2BA 3GOFA 2L50A 2TN4A 1OSAA 2ISDA 1FI5A 2KFGA 2F3ZA 2NCPA 1KQVA 1C7VA 4GBAA 4ICBA 1NPQA 3CS1A 1IKUA 5DKRA 2LVKA 1XO5A 3PFVA 3SIBA 4MZJA 1SYMA 1Y1AA 3H4SE 2LVVA 5ER4X 3LK1A 4NQGA 3CZTX 1TCOB 2E30A 3BUXB 4C0LA 3TUYC 1YUSA 1NWDA 2L4HA 1QVIZ 1TTXA 2LVJA 1TNQA 2M0RA 3KF9A 3PATA 2H61C 3LK0A 2JXLA 3I5GC 3ZWHA 4ORCB 1QX7A 4QJ4B 1JF0A 4DCKA 3ZNIA 2K0JA 1KFXS 1F55A 4GAOA 2OS8B 4ZCUA 1J1DA 2OPOA 1YX8A 2M1UA 3BUNB 3TS5C 2M8UA 2BBNA 4YGCB 3TZ1A 4WQ3A 1X02A 5TNCA 1CM4A 2KOTA 1F4QA 2NXQA 4DRWA 1C7WA 2MLFC 2LLUA 1DJHA 1DTLA 3VRPA 2F2OA 2WCFA 2NCOA 4GFTA 3SG7A 4JPZB 2HQ8A 4GGFC 1KFXL 2NLNA 2M3WA 2B1UA 2JT8A 1CFFA 1PVAA 1YX7A 1CM1A 2CBLA 4NDDA 5HKWA 2R2IA 4PCWA 2SASA 1KWOB 2EC6C 3PN7C 3DVKA 1DGVA 4ORAB 4AOMA 2EGDA 2BCBA 1U5IA 2PRUA 1BJFA 5AFPA 1DGUA 5KU1A 1J7QA 1U5IB 5JOLA 2GGMA 4N1FA 1BR4B 1WY9A 4N5XA 3QRXA 4I5KA 3EKJA 2K8MB 3O78A 2JTZA 1DJIA 1DMOA 3GK1A 4YGAA 1WRKA 1IH0A 4MBEA 1KK8C 1KK7Z 3VRRA 5B8IB 1V1FA 2ZRTA 2MAZA 1FI6A 2LUCA 4M2OA 1SPYA 2FCDA 4MN0A 5HLOA 2E6WA 2LMUA 1OMRA 1RECA 3CR4X 4FTGA 3LL8B 1MUXA 1UHHA 4CFQA 5KTYA 4JWQA 2LM5A 4QJ3B 1F54A 1QLKA 5I2QA 3EVRA 1MWNA 1IRJA 2Y5IA 1UP5A 1NCZA 1S1EA 2HETA 3O2PA 1B7TZ 1XFZO 3BXKA 4PHKA 1TN4A 1UHKA 3GK2A 4MEWA 5HKYA 1GQMA 1M45A 2BCXA 2ZRSA 3WHUB 1IQ3A 1RROA 2M7NA 1QS7A 1AP4A 5I8NA 4AQJA 4BY5A 1GGZA 1EH2A 1GGWA 1OE9B 1IWQA 2OTGB 4PE0A 2MHHA 3PALA 4DUQA 1RFJA 1UUSA 2WORA 4QJ5B 1HT9A 2KGRA 1XFWO 3DVMA 2COLB 3SIAA 1XK4C 1SKTA 5J3XA 1KK7Y 3CTNA 1XFVO 2L4IA 3I5IC 3WXAA 2LMTA 1LVCD 1PALA 1V1GA 1CMFA 1BU3A 1Y1XA 1M31A 4OVNF 1QV1A 3DVEA 4GGNA 1AHRA 5D69A 4ETOA 1CKKA 3OB1B 2KI4C 2MBXA 1FF1A 1HQVA 2O5GA 2Y1MA 5K89A 2GGZA 4XJKB 1XA5A 1DJYA 3SG2A 3AAKA 3PSRA 2M49B 1EG4A 3JTDC 3SG3A 3FS7A 4OV2A 5HLVA 4PE7A 2PASA 1H8BA 1JFKA 3IQOA 2AMIA 3NSIA 4GNKB 4AQIA 3FWBA 4MRXA 2JULA 3AKAA 1JWDA 1QIWA 4XYNA 2JTTA 1ZFSA 4PDZA 1CB1A 4F0ZB 1S36A 4CPVA 2KFHA 1NYAA 2Q4UA 3BYAA 3CGAA 3CWGA 4CFRA 2AUCA 2KAVA 1YVLA 3KEVA 4YGBB 1CFCA 2O60A 1XFYO 1CLBA 2Y4QA 3NSOA 2LP2A 2IS9A 2ZNEA 4I5NB 1G4YR 1AVSA 2KYFA 1Y1UA 1SR6C 3NSKA 4OR9B 4ORBB 2PMYA 2K7CA 1WRZA 2BKIB 4CIDA 2KHNA 1C07A 1PSBA 2QACA 2LLSA 1B8LA 1K9UA 1LXFC 1XFUO 1J55A 1ZOTB 4ZCVA 1J7OA 3SG6A 4HRGA 1UHIA 2KI6C 4PHNA 1RWYA 4DIRA 1YTZC 2WNDA 1KQMC 3FIAA 2KSPA 1OMVA 2BL0C 4UPGA 1N2DA 2EC6B 2AAOA 2L0PA 5G08A 1CMGA 1M46A 1SW8A 1CDMA 1QTXA 3SG4A 1QJTA 1DJWA 1N0YA 3BOWA 1QATA 1TNWA 3D10A 2BE6A 1AK8A 3BOWB 1SMGA 1Y6WA 4N1GA 4P2YB 3TDUA 1CFPA 3NXAA 1JUOA 4C0KA 1PVBA 3DF0B 1A4PA 1MXEA 3D0YA 1QLSA 4WRIA 1OQPA 2SCPA 3D0YB 2BE4A 4PHMA 5CSFA 2M1KB 1QVIY 3I5FB 3FWCA 3WHTB 2L98A 3OX6A 1IGVA 1BLQA 1FW4A 1SCMB 1SK6D 2WCEA 1J7PA 1KSOA 1WRLA 1LA3A 2LHIA 4L9MA 1BOCA 1CDNA 1BF5A 3I5HB 2BBMA 1MXLC 1NCYA 3HX4A 1K2HA 5JJGA 1K95A 1QIVA 1SCVA 3PM8A 2KBMA 5IBWA 2JRFA 3A4UB 2OS8C 4I5LB 1SL7A 3CR2A 5CSIA 1S3PA 2EHBA 3A8RA 1BMOA 1IQ5A 2LHLA 4JQ0D 3VRQA 4A4BA 1NX1A 1QX2A 1J7RA 2I18A 3LLEA 1YUTA 2F3YA 4MRYA 5GQQC 2P6BB 1W7IB 2WC8A 3KHEA 2D8NA 3EVVA 1ALVA 1TRFA 1NP8A 1OOJA 1UURA 1NX3A 4YGEB 1GJYA 4CLNA 1S6CA 2CT9A 1YR5A 2I7AA 1LA0A 1TIZA 3SG5A 2ZN9A 1M63B 1MF8B 3GK4X 2MA2A 1B9AA 1L7ZA 1W7JB 2PALA 3JVTB 3O4YA 2ZKMX 1UWOA 1B8CA 1KWOC 4MVFA 2L2EA 1NIWA 3IF7A 2JOJA 5CSNA 1JF2A 1YVHA 2VRGA 3AAJA 4GPLB 1G33A 1TNPA 4MLWA 5I2LA 3VGOA 3C1VA 2JQ6A 2CTNA 1BODA 1JFJA 5I2OA 4HREE 2HF5A 2JZIA 2KBIA 5AXIA 1KSMA 1L2OB 4PE4A 1PK0D 3CLNA 4FQOA 1WDCB 4XJKA 2LV7A 2LNKA 4U8DA 3BUWB 1WLMA 1B7TY 2KGBC 2K61A 2F2PA 3OB2B 1VRKA 1FBVA 1RK9A 1NX2A 2JNFA 4YBHB 4Q04A 3ICBA 1JBAA 3TUYB 1A03A 1SNLA 1UHNA 2Y1NA 1EL4A 1ODBA 2A4JA 2NZ0A 4MZLA 3I5GB 2OTGC 1CFDA 2PVBA 3KPXA 2BCAA 2ZN8A 1OZSA 1NX0A 2G9BA 4PALA 2KAYA 1G8IA 2LVIA 5FYXA 1DT7B 4OKHA 2LUXA 1K9KA 2Q91A 3MSEB 2ZFDA 1E8AA 1ZUZA 2JT0A 1DVIA 2MJWB 1J1EA 1MHOA 3BUMB 1Y0VH 3TS5B 1K94A 3WNXB 4YI9A 1PULA 3AKBA 1F71A 2M97A 3VROA 2CCMA 3RM1A 1NUBA 2K7DA 1MR8A 1B1GA 3EK4A 4I5JA 2WCBA 4GGFA 1S6IA 4PE1A 5DKQA 2KNEA 2LC5A 1XYDA 3OP0A 1CLMA 1DF0A 2KQ6A 2LAPA 2LE9B 4DS7A 1DF0B 1S5GZ 2GV5A 2KI6D 3PN7B 4MZKA 1NCXA 1YUUA 4HSZA 2V53A 3DF0A 1JC2A 1LKJA 4MSPA 1LINA 1S6JA 1K9PA 2PSRA 3IQQA 2KQYA 2F8PA 3VRNA 5AERA 5DKNA 1KK8B 5HYDA 1FPWA 1K8UA 1XFXO 2JNXA 3CR5X 3OHMB 1A2XA 1PSRA 1WLZA 1M39A 1MQ1A 2BKHB 2MLEC 3EK8A 1S26D 1YURA 1SRAA 1B8RA 1UHJA 3EK7A 5F6TA 2LCPA 3DVJA 4PHJA 1S5GY 4R1EA 1DJZA 2K7OA 1ALWA 1R2UA
chains in the Genus database with same CATH superfamily
3L47A 1N65A 3M0WA 1XFRA 2KLDA 1D1OA 1JSAA 4D1EA 1F70A 1SL8A 4M2PA 2JC2A 4GUKA 3O6BA 2K7BA 1AJ5A 1TNXA 4WQ2A 4JKTA 5AANA 1QASA 2M7LA 1XK4A 4OCIA 1QXPA 3F45A 1KCYA 2JXCA 1A75A 2KFFA 2M9GA 1QX5B 1IJ6A 1A75B 3S0DA 3I5IB 5KSZA 3DY9A 4E68A 2H2KA 1DJXA 1BR1B 2K2FA 3D74A 2QPTA 2JT3A 1OMDA 1DQEA 2L5XB 1KFUS 2LMVA 2FJUB 3HCMA 3EKHA 4NDBA 2FCEA 5PALA 2WOSA 3KO0A 4P5OE 3DZTA 3I5FC 2KI4B 5D3OA 1EG3A 1SBJA 3S0AA 1YRUB 4FQTA 2K2AA 4F7FA 3PLFB 2LP3A 3NHTA 5BPJA 3LCPC 5CSJA 1SCMC 3NSLA 4IL1A 1Q80A 2LLTA 1RJVA 4USLA 1IG5A 1EXRA 5D7FA 2QEBA 2KLEA 2JU0A 3BQ3A 3JTDB 1R6PA 3I5HC 2CNPA 1BT6A 1W9ZA 3EVUA 1OZOA 2KDHA 1QV0A 3BFBA 2M29A 2I2RE 3E3RA 1ZMZA 5CPVA 1KFUL 1YRTB 1F4OA 1C3ZA 1CDPA 4HRHA 1BG1A 3OX5A 2BECA 3K21A 2L51A 2F33A 1H4BA 2ZNDA 2FOTA 5HKZA 1AUIB 4A4CA 1B47A 2MRDA 1B4CA 1SL9A 2QEVA 2I94A 1SR6B 1CDLA 3TDIA 4YGDB 2KYCA 2ERBA 2JWWA 1RTP1 1TCFA 1IJ5A 2WCJA 1PRWA 2DOQA 2H61A 2CXJA 3RLZA 1K90D 2WC6A 3JVTC 1DJGA 1K96A 2LANA 3DD4A 1KQMB 2JPTA 2BL0B 1EJ3A 3TDZA 1F8HA 4YI8A 1CLLA 1CTRA 3BUOB 4TNCA 4BY4A 4M2QA 1K93D 3L4LA 2RGIA 5ER5A 1SY9A 4NDCA 1ZACA 3Q8IA 2HQWA 1TOPA 4YRUA 1AJ4A 4C0JA 5AEQA 1L2OC 3NHIA 1XVJA 1NSHA 3S0EA 1A29A 2HPSA 3SJSA 2KAXA 1WDCC 1DC1A 1CNPA 2G2BA 3GOFA 2L50A 2TN4A 1OSAA 3IVTA 2ISDA 3S0FA 2WCKA 1FI5A 2KFGA 2F3ZA 2NCPA 1KQVA 4JD9A 1C7VA 4GBAA 4ICBA 1NPQA 2PYQA 3CS1A 1IKUA 5DKRA 2LVKA 3B88A 1XO5A 3PFVA 3SIBA 4MZJA 1SYMA 3RZSA 1Y1AA 2WCMA 3H4SE 2LVVA 5ER4X 3LK1A 4NQGA 5DICA 3CZTX 1TCOB 2E30A 3BUXB 3DXLA 1T14A 4C0LA 3TUYC 1YUSA 1NWDA 5FI2A 2L4HA 1QVIZ 1TTXA 2LVJA 1TNQA 2M0RA 3KF9A 3PATA 2H61C 3LK0A 2JXLA 3I5GC 3ZWHA 4ORCB 1QX7A 4QJ4B 1JF0A 3VB1A 4DCKA 3ZNIA 2K0JA 1KFXS 1F55A 4GAOA 2OS8B 4ZCUA 1J1DA 2KPHA 1DELA 2OPOA 1YX8A 2M1UA 3BUNB 3TS5C 3B86A 2M8UA 2BBNA 3R1OA 4YGCB 3TZ1A 4WQ3A 1X02A 5TNCA 1CM4A 2KOTA 2QEOA 1F4QA 2NXQA 4DRWA 1C7WA 2MLFC 2LLUA 1Z2CB 1DJHA 1DTLA 3VRPA 2F2OA 2WCFA 2NCOA 4GFTA 3SG7A 4JPZB 2HQ8A 4GGFC 1KFXL 2NLNA 2M3WA 2B1UA 2JT8A 1CFFA 1PVAA 1YX7A 1CM1A 2CBLA 5FI7A 4NDDA 5HKWA 2R2IA 4PCWA 2SASA 1KWOB 2EC6C 3PN7C 3DVKA 3O4XA 2BNXA 1DGVA 4ORAB 4AOMA 2EGDA 2BCBA 1U5IA 2PRUA 1BJFA 5AFPA 1DGUA 5KU1A 4PT1A 1J7QA 1U5IB 5JOLA 3S0GA 2GGMA 4N1FA 1BR4B 1WY9A 4N5XA 3QRXA 4I5KA 3EKJA 2K8MB 3O78A 2JTZA 1DJIA 1DMOA 3GK1A 4YGAA 1WRKA 1IH0A 4MBEA 1KK8C 1KK7Z 3VRRA 5B8IB 1V1FA 3CZ2A 2ZRTA 2MAZA 1FI6A 2LUCA 4M2OA 1SPYA 2FCDA 2L2CA 4MN0A 5HLOA 2E6WA 2LMUA 1OMRA 1RECA 3CR4X 4FTGA 3LL8B 1MUXA 1UHHA 4CFQA 5KTYA 4JWQA 2LM5A 1TWOA 4QJ3B 1F54A 1QLKA 5I2QA 3EVRA 1MWNA 1IRJA 2Y5IA 1UP5A 3S0BA 1NCZA 1S1EA 2HETA 3O2PA 1B7TZ 1XFZO 3BXKA 4PHKA 1TN4A 1UHKA 3GK2A 4MEWA 3V2LA 1GQMA 1M45A 2BCXA 2ZRSA 5HKYA 3WHUB 1IQ3A 1RROA 2M7NA 1QS7A 1AP4A 5I8NA 4AQJA 4BY5A 1GGZA 1EH2A 1GGWA 1OE9B 1IWQA 2OTGB 4PE0A 2MHHA 3PALA 4DUQA 1RFJA 1UUSA 2WORA 4QJ5B 1HT9A 2KGRA 1XFWO 3DVMA 2COLB 3SIAA 1XK4C 1SKTA 3FE8A 5J3XA 1KK7Y 3CTNA 1XFVO 2L4IA 3I5IC 3WXAA 2LMTA 1LVCD 1PALA 1V1GA 1CMFA 3D78A 1BU3A 1Y1XA 2PQLA 1M31A 4OVNF 1QV1A 3DVEA 4GGNA 3PJIA 1AHRA 5D69A 4ETOA 1CKKA 3OB1B 2KI4C 2MBXA 1FF1A 1HQVA 2O5GA 2Y1MA 4INXA 5K89A 2GGZA 4KYNA 4XJKB 1XA5A 2QEHA 1DJYA 3BFHA 3SG2A 3AAKA 3PSRA 2M49B 1EG4A 3JTDC 3SG3A 3FS7A 4OV2A 5HLVA 4PE7A 2PASA 3CABA 1H8BA 1JFKA 3IQOA 2AMIA 3NSIA 4GNKB 4AQIA 3FWBA 4MRXA 2JULA 3AKAA 1JWDA 1TUZA 1QIWA 2WCHA 4XYNA 2JTTA 1ZFSA 3NGVA 4PDZA 1CB1A 4F0ZB 1S36A 4CPVA 2KFHA 1NYAA 2Q4UA 3BYAA 3CGAA 3CWGA 4CFRA 2AUCA 2KAVA 1YVLA 3KEVA 4YGBB 1CFCA 2O60A 3D73A 1XFYO 1CLBA 3R1VA 2Y4QA 3B87A 2LP2A 3NSOA 2IS9A 2ZNEA 4I5NB 1G4YR 1AVSA 2KYFA 1Y1UA 1SR6C 3NSKA 4OR9B 4ORBB 2PMYA 2K7CA 1WRZA 2BKIB 3OGNA 2KHNA 1C07A 1PSBA 2QACA 2LLSA 1B8LA 1K9UA 1LXFC 1XFUO 1J55A 1ZOTB 4ZCVA 1J7OA 3SG6A 4HRGA 1UHIA 2KI6C 4PHNA 1RWYA 4DIRA 1YTZC 2WNDA 1KQMC 3FIAA 2KSPA 1OMVA 2BL0C 2H8VA 4UPGA 1N2DA 4CIDA 2EC6B 2AAOA 2L0PA 3BFAA 5G08A 1CMGA 1M46A 1SW8A 1CDMA 1QTXA 3SG4A 1QJTA 3PM2A 1DJWA 1N0YA 3BOWA 1QATA 1TNWA 3D10A 2BE6A 1AK8A 3BOWB 3OHMB 1SMGA 1Y6WA 2WC5A 4N1GA 4P2YB 3TDUA 1CFPA 3NXAA 1JUOA 4C0KA 1PVBA 3CZ0A 3DF0B 1A4PA 1MXEA 2QDIA 3D0YA 1QLSA 3FE6A 4WRIA 1OQPA 2SCPA 3D0YB 2BE4A 3K1EA 4PHMA 5CSFA 1OOGA 2M1KB 1QVIY 3I5FB 3FWCA 3WHTB 3D75A 2L98A 3OX6A 1IGVA 1BLQA 1FW4A 1SCMB 1SK6D 2WCEA 1J7PA 1KSOA 1WRLA 1LA3A 2LHIA 4L9MA 1BOCA 1CDNA 1BF5A 3I5HB 2BBMA 1MXLC 1NCYA 3HX4A 1K2HA 5JJGA 1K95A 1QIVA 1SCVA 3PM8A 2KBMA 5IBWA 2JRFA 3A4UB 2OS8C 4I5LB 1SL7A 3CR2A 5CSIA 1S3PA 2EHBA 3A8RA 1BMOA 1IQ5A 2LHLA 2WCLA 4JQ0D 3VRQA 4A4BA 1GM0A 1NX1A 1QX2A 1J7RA 2I18A 3LLEA 1YUTA 2F3YA 4MRYA 5GQQC 3SS5A 2P6BB 1W7IB 2WC8A 3KHEA 2D8NA 3EVVA 1ALVA 3SS3A 1TRFA 1NP8A 1OOJA 1UURA 1NX3A 4YGEB 1GJYA 4CLNA 1S6CA 2CT9A 1YR5A 2I7AA 1LA0A 1TIZA 3SG5A 3OBVA 2ZN9A 1M63B 1MF8B 3GK4X 2MA2A 3CYZA 1B9AA 1L7ZA 3B7AA 1W7JB 2PALA 3JVTB 3O4YA 2ZKMX 1UWOA 3D77A 1B8CA 1KWOC 4MVFA 2L2EA 1NIWA 3IF7A 1ORGA 2JOJA 5CSNA 3CZ1A 1JF2A 1SSEB 1YVHA 2VRGA 3AAJA 4GPLB 1G33A 1TNPA 4MLWA 5I2LA 3VGOA 3C1VA 2JQ6A 2CTNA 1BODA 1JFJA 5I2OA 4HREE 2HF5A 2JZIA 2KBIA 5AXIA 1KSMA 3BJHA 1L2OB 4PE4A 1PK0D 5FI6A 3CLNA 3D76A 4FQOA 1WDCB 4XJKA 2LV7A 2LNKA 4U8DA 3BUWB 1WLMA 1B7TY 2KGBC 2P71A 1OOFA 3CDNA 2K61A 2F2PA 3OB2B 1VRKA 1FBVA 5EL2A 1RK9A 1NX2A 2JNFA 4YBHB 4Q04A 3L4AA 3ICBA 1JBAA 3TUYB 1A03A 1SNLA 1UHNA 2Y1NA 1EL4A 1ODBA 2A4JA 2NZ0A 4MZLA 5I94A 2FJYA 3DYEA 3I5GB 2OTGC 1CFDA 2PVBA 3KPXA 2BCAA 3B6XA 2ZN8A 1OZSA 1NX0A 2G9BA 4OZDA 4PALA 2JPOA 2KAYA 1G8IA 2LVIA 5FYXA 3UNWA 4OKHA 1DT7B 2LUXA 1K9KA 3N7HA 2Q91A 3R1PA 3MSEB 4IJ7A 2ZFDA 1E8AA 1ZUZA 2JT0A 3UO9A 1DVIA 2MJWB 1J1EA 1MHOA 3BUMB 1Y0VH 3TS5B 1K94A 3WNXB 4YI9A 1PULA 3AKBA 1F71A 2M97A 3R72A 3VROA 2CCMA 3RM1A 1NUBA 2K7DA 1MR8A 1B1GA 3EK4A 3EG5B 4I5JA 1C3YA 1OOIX 2WCBA 4GGFA 1LS8A 1S6IA 2GTEA 4PE1A 5DKQA 1OW4A 2KNEA 2LC5A 1XYDA 2BAPA 1CLMA 1DF0A 1P28A 2KQ6A 2LAPA 2LE9B 3FE9A 3OP0A 4DS7A 1DF0B 1S5GZ 2GV5A 1IIOA 2KI6D 3PN7B 4MZKA 1TUJA 1NCXA 5HL1A 1YUUA 4HSZA 2V53A 3DF0A 1JC2A 1LKJA 4MSPA 1LINA 4INWA 1S6JA 4R1EA 1K9PA 2PSRA 3IQQA 2KQYA 2F8PA 3VRNA 5AERA 5DKNA 1KK8B 3SS4A 5HYDA 1FPWA 3QMEA 1K8UA 1XFXO 2JNXA 2L5YA 3CR5X 1QWVA 1A2XA 1PSRA 1WLZA 1M39A 1MQ1A 2BKHB 2MLEC 3EK8A 1S26D 1YURA 1Z4HA 1SRAA 1OOHA 1B8RA 1UHJA 2K60A 1DEKA 3EK7A 5F6TA 2LCPA 3DVJA 4PHJA 2P70A 1S5GY 2YGUA 1DJZA 2K7OA 1ALWA 1R2UA
chains in the Genus database with same CATH topology
1N65A 3M0WA 1D1OA 1JSAA 4D1EA 1F70A 1SL8A 4M2PA 2JC2A 4GUKA 3O6BA 2K7BA 1AJ5A 1TNXA 4WQ2A 5AANA 1QASA 2M7LA 1XK4A 4OCIA 1QXPA 3F45A 1KCYA 2JXCA 1A75A 2KFFA 2M9GA 1QX5B 1IJ6A 1A75B 3I5IB 5KSZA 4E68A 2H2KA 1DJXA 1BR1B 2K2FA 2QPTA 2JT3A 1OMDA 2L5XB 1KFUS 2LMVA 2FJUB 3HCMA 3EKHA 4NDBA 2FCEA 5PALA 2WOSA 3KO0A 4P5OE 3I5FC 2KI4B 1EG3A 1SBJA 1YRUB 2K2AA 3PLFB 2LP3A 5BPJA 3LCPC 5CSJA 1SCMC 3NSLA 4IL1A 1Q80A 2LLTA 1RJVA 4USLA 1IG5A 1EXRA 5D7FA 2JU0A 3BQ3A 3JTDB 1R6PA 3I5HC 2CNPA 1BT6A 3EVUA 1OZOA 2KDHA 1QV0A 2M29A 2I2RE 3E3RA 1ZMZA 5CPVA 1KFUL 1YRTB 1F4OA 1CDPA 4HRHA 1BG1A 3OX5A 2BECA 3K21A 2L51A 2F33A 1H4BA 2ZNDA 2FOTA 5HKZA 1AUIB 4A4CA 1B47A 2MRDA 1B4CA 1SL9A 2I94A 1SR6B 1CDLA 3TDIA 4YGDB 2KYCA 2JWWA 1RTP1 1TCFA 1IJ5A 1PRWA 2DOQA 2H61A 2CXJA 3RLZA 1K90D 3JVTC 1DJGA 1K96A 2LANA 3DD4A 1KQMB 2JPTA 2BL0B 1EJ3A 3TDZA 1F8HA 4YI8A 1CLLA 1CTRA 3BUOB 4TNCA 4BY4A 4M2QA 1K93D 2RGIA 5ER5A 1SY9A 4NDCA 1ZACA 2HQWA 1TOPA 4YRUA 1AJ4A 4C0JA 5AEQA 1L2OC 1XVJA 1NSHA 1A29A 2HPSA 3SJSA 2KAXA 1WDCC 1CNPA 2G2BA 3GOFA 2L50A 2TN4A 1OSAA 2ISDA 1FI5A 2KFGA 2F3ZA 2NCPA 1KQVA 1C7VA 4GBAA 4ICBA 1NPQA 3CS1A 1IKUA 5DKRA 2LVKA 1XO5A 3PFVA 3SIBA 4MZJA 1SYMA 1Y1AA 3H4SE 2LVVA 5ER4X 3LK1A 4NQGA 3CZTX 1TCOB 2E30A 3BUXB 4C0LA 3TUYC 1YUSA 1NWDA 2L4HA 1QVIZ 1TTXA 2LVJA 1TNQA 2M0RA 3KF9A 3PATA 2H61C 3LK0A 2JXLA 3I5GC 3ZWHA 4ORCB 1QX7A 4QJ4B 1JF0A 4DCKA 3ZNIA 2K0JA 1KFXS 1F55A 4GAOA 2OS8B 4ZCUA 1J1DA 2OPOA 1YX8A 2M1UA 3BUNB 3TS5C 2M8UA 2BBNA 4YGCB 3TZ1A 4WQ3A 1X02A 5TNCA 1CM4A 2KOTA 1F4QA 2NXQA 4DRWA 1C7WA 2MLFC 2LLUA 1DJHA 1DTLA 3VRPA 2F2OA 2WCFA 2NCOA 4GFTA 3SG7A 4JPZB 2HQ8A 4GGFC 1KFXL 2NLNA 2M3WA 2B1UA 2JT8A 1CFFA 1PVAA 1YX7A 1CM1A 2CBLA 4NDDA 5HKWA 2R2IA 4PCWA 2SASA 1KWOB 2EC6C 3PN7C 3DVKA 1DGVA 4ORAB 4AOMA 2EGDA 2BCBA 1U5IA 2PRUA 1BJFA 5AFPA 1DGUA 5KU1A 1J7QA 1U5IB 5JOLA 2GGMA 4N1FA 1BR4B 1WY9A 4N5XA 3QRXA 4I5KA 3EKJA 2K8MB 3O78A 2JTZA 1DJIA 1DMOA 3GK1A 4YGAA 1WRKA 1IH0A 4MBEA 1KK8C 1KK7Z 3VRRA 5B8IB 1V1FA 2ZRTA 2MAZA 1FI6A 2LUCA 4M2OA 1SPYA 2FCDA 4MN0A 5HLOA 2E6WA 2LMUA 1OMRA 1RECA 3CR4X 4FTGA 3LL8B 1MUXA 1UHHA 4CFQA 5KTYA 4JWQA 2LM5A 4QJ3B 1F54A 1QLKA 5I2QA 3EVRA 1MWNA 1IRJA 2Y5IA 1UP5A 1NCZA 1S1EA 2HETA 3O2PA 1B7TZ 1XFZO 3BXKA 4PHKA 1TN4A 1UHKA 3GK2A 4MEWA 5HKYA 1GQMA 1M45A 2BCXA 2ZRSA 3WHUB 1IQ3A 1RROA 2M7NA 1QS7A 1AP4A 5I8NA 4AQJA 4BY5A 1GGZA 1EH2A 1GGWA 1OE9B 1IWQA 2OTGB 4PE0A 2MHHA 3PALA 4DUQA 1RFJA 1UUSA 2WORA 4QJ5B 1HT9A 2KGRA 1XFWO 3DVMA 2COLB 3SIAA 1XK4C 1SKTA 5J3XA 1KK7Y 3CTNA 1XFVO 2L4IA 3I5IC 3WXAA 2LMTA 1LVCD 1PALA 1V1GA 1CMFA 1BU3A 1Y1XA 1M31A 4OVNF 1QV1A 3DVEA 4GGNA 1AHRA 5D69A 4ETOA 1CKKA 3OB1B 2KI4C 2MBXA 1FF1A 1HQVA 2O5GA 2Y1MA 5K89A 2GGZA 4XJKB 1XA5A 1DJYA 3SG2A 3AAKA 3PSRA 2M49B 1EG4A 3JTDC 3SG3A 3FS7A 4OV2A 5HLVA 4PE7A 2PASA 1H8BA 1JFKA 3IQOA 2AMIA 3NSIA 4GNKB 4AQIA 3FWBA 4MRXA 2JULA 3AKAA 1JWDA 1QIWA 4XYNA 2JTTA 1ZFSA 4PDZA 1CB1A 4F0ZB 1S36A 4CPVA 2KFHA 1NYAA 2Q4UA 3BYAA 3CGAA 3CWGA 4CFRA 2AUCA 2KAVA 1YVLA 3KEVA 4YGBB 1CFCA 2O60A 1XFYO 1CLBA 2Y4QA 3NSOA 2LP2A 2IS9A 2ZNEA 4I5NB 1G4YR 1AVSA 2KYFA 1Y1UA 1SR6C 3NSKA 4OR9B 4ORBB 2PMYA 2K7CA 1WRZA 2BKIB 4CIDA 2KHNA 1C07A 1PSBA 2QACA 2LLSA 1B8LA 1K9UA 1LXFC 1XFUO 1J55A 1ZOTB 4ZCVA 1J7OA 3SG6A 4HRGA 1UHIA 2KI6C 4PHNA 1RWYA 4DIRA 1YTZC 2WNDA 1KQMC 3FIAA 2KSPA 1OMVA 2BL0C 4UPGA 1N2DA 2EC6B 2AAOA 2L0PA 5G08A 1CMGA 1M46A 1SW8A 1CDMA 1QTXA 3SG4A 1QJTA 1DJWA 1N0YA 3BOWA 1QATA 1TNWA 3D10A 2BE6A 1AK8A 3BOWB 1SMGA 1Y6WA 4N1GA 4P2YB 3TDUA 1CFPA 3NXAA 1JUOA 4C0KA 1PVBA 3DF0B 1A4PA 1MXEA 3D0YA 1QLSA 4WRIA 1OQPA 2SCPA 3D0YB 2BE4A 4PHMA 5CSFA 2M1KB 1QVIY 3I5FB 3FWCA 3WHTB 2L98A 3OX6A 1IGVA 1BLQA 1FW4A 1SCMB 1SK6D 2WCEA 1J7PA 1KSOA 1WRLA 1LA3A 2LHIA 4L9MA 1BOCA 1CDNA 1BF5A 3I5HB 2BBMA 1MXLC 1NCYA 3HX4A 1K2HA 5JJGA 1K95A 1QIVA 1SCVA 3PM8A 2KBMA 5IBWA 2JRFA 3A4UB 2OS8C 4I5LB 1SL7A 3CR2A 5CSIA 1S3PA 2EHBA 3A8RA 1BMOA 1IQ5A 2LHLA 4JQ0D 3VRQA 4A4BA 1NX1A 1QX2A 1J7RA 2I18A 3LLEA 1YUTA 2F3YA 4MRYA 5GQQC 2P6BB 1W7IB 2WC8A 3KHEA 2D8NA 3EVVA 1ALVA 1TRFA 1NP8A 1OOJA 1UURA 1NX3A 4YGEB 1GJYA 4CLNA 1S6CA 2CT9A 1YR5A 2I7AA 1LA0A 1TIZA 3SG5A 2ZN9A 1M63B 1MF8B 3GK4X 2MA2A 1B9AA 1L7ZA 1W7JB 2PALA 3JVTB 3O4YA 2ZKMX 1UWOA 1B8CA 1KWOC 4MVFA 2L2EA 1NIWA 3IF7A 2JOJA 5CSNA 1JF2A 1YVHA 2VRGA 3AAJA 4GPLB 1G33A 1TNPA 4MLWA 5I2LA 3VGOA 3C1VA 2JQ6A 2CTNA 1BODA 1JFJA 5I2OA 4HREE 2HF5A 2JZIA 2KBIA 5AXIA 1KSMA 1L2OB 4PE4A 1PK0D 3CLNA 4FQOA 1WDCB 4XJKA 2LV7A 2LNKA 4U8DA 3BUWB 1WLMA 1B7TY 2KGBC 2K61A 2F2PA 3OB2B 1VRKA 1FBVA 1RK9A 1NX2A 2JNFA 4YBHB 4Q04A 3ICBA 1JBAA 3TUYB 1A03A 1SNLA 1UHNA 2Y1NA 1EL4A 1ODBA 2A4JA 2NZ0A 4MZLA 3I5GB 2OTGC 1CFDA 2PVBA 3KPXA 2BCAA 2ZN8A 1OZSA 1NX0A 2G9BA 4PALA 2KAYA 1G8IA 2LVIA 5FYXA 1DT7B 4OKHA 2LUXA 1K9KA 2Q91A 3MSEB 2ZFDA 1E8AA 1ZUZA 2JT0A 1DVIA 2MJWB 1J1EA 1MHOA 3BUMB 1Y0VH 3TS5B 1K94A 3WNXB 4YI9A 1PULA 3AKBA 1F71A 2M97A 3VROA 2CCMA 3RM1A 1NUBA 2K7DA 1MR8A 1B1GA 3EK4A 4I5JA 2WCBA 4GGFA 1S6IA 4PE1A 5DKQA 2KNEA 2LC5A 1XYDA 3OP0A 1CLMA 1DF0A 2KQ6A 2LAPA 2LE9B 4DS7A 1DF0B 1S5GZ 2GV5A 2KI6D 3PN7B 4MZKA 1NCXA 1YUUA 4HSZA 2V53A 3DF0A 1JC2A 1LKJA 4MSPA 1LINA 1S6JA 1K9PA 2PSRA 3IQQA 2KQYA 2F8PA 3VRNA 5AERA 5DKNA 1KK8B 5HYDA 1FPWA 1K8UA 1XFXO 2JNXA 3CR5X 3OHMB 1A2XA 1PSRA 1WLZA 1M39A 1MQ1A 2BKHB 2MLEC 3EK8A 1S26D 1YURA 1SRAA 1B8RA 1UHJA 3EK7A 5F6TA 2LCPA 3DVJA 4PHJA 1S5GY 4R1EA 1DJZA 2K7OA 1ALWA 1R2UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N65 A;  3M0W A;  1D1O A;  1JSA A;  4D1E A;  1F70 A;  1SL8 A;  4M2P A;  2JC2 A;  4GUK A;  3O6B A;  2K7B A;  1AJ5 A;  1TNX A;  4WQ2 A;  5AAN A;  1QAS A;  2M7L A;  1XK4 A;  4OCI A;  1QXP A;  3F45 A;  1KCY A;  2JXC A;  1A75 A;  2KFF A;  2M9G A;  1QX5 B;  1IJ6 A;  1A75 B;  3I5I B;  5KSZ A;  4E68 A;  2H2K A;  1DJX A;  1BR1 B;  2K2F A;  2QPT A;  2JT3 A;  1OMD A;  2L5X B;  1KFU S;  2LMV A;  2FJU B;  3HCM A;  3EKH A;  4NDB A;  2FCE A;  5PAL A;  2WOS A;  3KO0 A;  4P5O E;  3I5F C;  2KI4 B;  1EG3 A;  1SBJ A;  1YRU B;  2K2A A;  3PLF B;  2LP3 A;  5BPJ A;  3LCP C;  5CSJ A;  1SCM C;  3NSL A;  4IL1 A;  1Q80 A;  2LLT A;  1RJV A;  4USL A;  1IG5 A;  1EXR A;  5D7F A;  2JU0 A;  3BQ3 A;  3JTD B;  1R6P A;  3I5H C;  2CNP A;  1BT6 A;  3EVU A;  1OZO A;  2KDH A;  1QV0 A;  2M29 A;  2I2R E;  3E3R A;  1ZMZ A;  5CPV A;  1KFU L;  1YRT B;  1F4O A;  1CDP A;  4HRH A;  1BG1 A;  3OX5 A;  2BEC A;  3K21 A;  2L51 A;  2F33 A;  1H4B A;  2ZND A;  2FOT A;  5HKZ A;  1AUI B;  4A4C A;  1B47 A;  2MRD A;  1B4C A;  1SL9 A;  2I94 A;  1SR6 B;  1CDL A;  3TDI A;  4YGD B;  2KYC A;  2JWW A;  1RTP 1;  1TCF A;  1IJ5 A;  1PRW A;  2DOQ A;  2H61 A;  2CXJ A;  3RLZ A;  1K90 D;  3JVT C;  1DJG A;  1K96 A;  2LAN A;  3DD4 A;  1KQM B;  2JPT A;  2BL0 B;  1EJ3 A;  3TDZ A;  1F8H A;  4YI8 A;  1CLL A;  1CTR A;  3BUO B;  4TNC A;  4BY4 A;  4M2Q A;  1K93 D;  2RGI A;  5ER5 A;  1SY9 A;  4NDC A;  1ZAC A;  2HQW A;  1TOP A;  4YRU A;  1AJ4 A;  4C0J A;  5AEQ A;  1L2O C;  1XVJ A;  1NSH A;  1A29 A;  2HPS A;  3SJS A;  2KAX A;  1WDC C;  1CNP A;  2G2B A;  3GOF A;  2L50 A;  2TN4 A;  1OSA A;  2ISD A;  1FI5 A;  2KFG A;  2F3Z A;  2NCP A;  1KQV A;  1C7V A;  4GBA A;  4ICB A;  1NPQ A;  3CS1 A;  1IKU A;  5DKR A;  2LVK A;  1XO5 A;  3PFV A;  3SIB A;  4MZJ A;  1SYM A;  1Y1A A;  3H4S E;  2LVV A;  5ER4 X;  3LK1 A;  4NQG A;  3CZT X;  1TCO B;  2E30 A;  3BUX B;  4C0L A;  3TUY C;  1YUS A;  1NWD A;  2L4H A;  1QVI Z;  1TTX A;  2LVJ A;  1TNQ A;  2M0R A;  3KF9 A;  3PAT A;  2H61 C;  3LK0 A;  2JXL A;  3I5G C;  3ZWH A;  4ORC B;  1QX7 A;  4QJ4 B;  1JF0 A;  4DCK A;  3ZNI A;  2K0J A;  1KFX S;  1F55 A;  4GAO A;  2OS8 B;  4ZCU A;  1J1D A;  2OPO A;  1YX8 A;  2M1U A;  3BUN B;  3TS5 C;  2M8U A;  2BBN A;  4YGC B;  3TZ1 A;  4WQ3 A;  1X02 A;  5TNC A;  1CM4 A;  2KOT A;  1F4Q A;  2NXQ A;  4DRW A;  1C7W A;  2MLF C;  2LLU A;  1DJH A;  1DTL A;  3VRP A;  2F2O A;  2WCF A;  2NCO A;  4GFT A;  3SG7 A;  4JPZ B;  2HQ8 A;  4GGF C;  1KFX L;  2NLN A;  2M3W A;  2B1U A;  2JT8 A;  1CFF A;  1PVA A;  1YX7 A;  1CM1 A;  2CBL A;  4NDD A;  5HKW A;  2R2I A;  4PCW A;  2SAS A;  1KWO B;  2EC6 C;  3PN7 C;  3DVK A;  1DGV A;  4ORA B;  4AOM A;  2EGD A;  2BCB A;  1U5I A;  2PRU A;  1BJF A;  5AFP A;  1DGU A;  5KU1 A;  1J7Q A;  1U5I B;  5JOL A;  2GGM A;  4N1F A;  1BR4 B;  1WY9 A;  4N5X A;  3QRX A;  4I5K A;  3EKJ A;  2K8M B;  3O78 A;  2JTZ A;  1DJI A;  1DMO A;  3GK1 A;  4YGA A;  1WRK A;  1IH0 A;  4MBE A;  1KK8 C;  1KK7 Z;  3VRR A;  5B8I B;  1V1F A;  2ZRT A;  2MAZ A;  1FI6 A;  2LUC A;  4M2O A;  1SPY A;  2FCD A;  4MN0 A;  5HLO A;  2E6W A;  2LMU A;  1OMR A;  1REC A;  3CR4 X;  4FTG A;  3LL8 B;  1MUX A;  1UHH A;  4CFQ A;  5KTY A;  4JWQ A;  2LM5 A;  4QJ3 B;  1F54 A;  1QLK A;  5I2Q A;  3EVR A;  1MWN A;  1IRJ A;  2Y5I A;  1UP5 A;  1NCZ A;  1S1E A;  2HET A;  3O2P A;  1B7T Z;  1XFZ O;  3BXK A;  4PHK A;  1TN4 A;  1UHK A;  3GK2 A;  4MEW A;  5HKY A;  1GQM A;  1M45 A;  2BCX A;  2ZRS A;  3WHU B;  1IQ3 A;  1RRO A;  2M7N A;  1QS7 A;  1AP4 A;  5I8N A;  4AQJ A;  4BY5 A;  1GGZ A;  1EH2 A;  1GGW A;  1OE9 B;  1IWQ A;  2OTG B;  4PE0 A;  2MHH A;  3PAL A;  4DUQ A;  1RFJ A;  1UUS A;  2WOR A;  4QJ5 B;  1HT9 A;  2KGR A;  1XFW O;  3DVM A;  2COL B;  3SIA A;  1XK4 C;  1SKT A;  5J3X A;  1KK7 Y;  3CTN A;  1XFV O;  2L4I A;  3I5I C;  3WXA A;  2LMT A;  1LVC D;  1PAL A;  1V1G A;  1CMF A;  1BU3 A;  1Y1X A;  1M31 A;  4OVN F;  1QV1 A;  3DVE A;  4GGN A;  1AHR A;  5D69 A;  4ETO A;  1CKK A;  3OB1 B;  2KI4 C;  2MBX A;  1FF1 A;  1HQV A;  2O5G A;  2Y1M A;  5K89 A;  2GGZ A;  4XJK B;  1XA5 A;  1DJY A;  3SG2 A;  3AAK A;  3PSR A;  2M49 B;  1EG4 A;  3JTD C;  3SG3 A;  3FS7 A;  4OV2 A;  5HLV A;  4PE7 A;  2PAS A;  1H8B A;  1JFK A;  3IQO A;  2AMI A;  3NSI A;  4GNK B;  4AQI A;  3FWB A;  4MRX A;  2JUL A;  3AKA A;  1JWD A;  1QIW A;  4XYN A;  2JTT A;  1ZFS A;  4PDZ A;  1CB1 A;  4F0Z B;  1S36 A;  4CPV A;  2KFH A;  1NYA A;  2Q4U A;  3BYA A;  3CGA A;  3CWG A;  4CFR A;  2AUC A;  2KAV A;  1YVL A;  3KEV A;  4YGB B;  1CFC A;  2O60 A;  1XFY O;  1CLB A;  2Y4Q A;  3NSO A;  2LP2 A;  2IS9 A;  2ZNE A;  4I5N B;  1G4Y R;  1AVS A;  2KYF A;  1Y1U A;  1SR6 C;  3NSK A;  4OR9 B;  4ORB B;  2PMY A;  2K7C A;  1WRZ A;  2BKI B;  4CID A;  2KHN A;  1C07 A;  1PSB A;  2QAC A;  2LLS A;  1B8L A;  1K9U A;  1LXF C;  1XFU O;  1J55 A;  1ZOT B;  4ZCV A;  1J7O A;  3SG6 A;  4HRG A;  1UHI A;  2KI6 C;  4PHN A;  1RWY A;  4DIR A;  1YTZ C;  2WND A;  1KQM C;  3FIA A;  2KSP A;  1OMV A;  2BL0 C;  4UPG A;  1N2D A;  2EC6 B;  2AAO A;  2L0P A;  5G08 A;  1CMG A;  1M46 A;  1SW8 A;  1CDM A;  1QTX A;  3SG4 A;  1QJT A;  1DJW A;  1N0Y A;  3BOW A;  1QAT A;  1TNW A;  3D10 A;  2BE6 A;  1AK8 A;  3BOW B;  1SMG A;  1Y6W A;  4N1G A;  4P2Y B;  3TDU A;  1CFP A;  3NXA A;  1JUO A;  4C0K A;  1PVB A;  3DF0 B;  1A4P A;  1MXE A;  3D0Y A;  1QLS A;  4WRI A;  1OQP A;  2SCP A;  3D0Y B;  2BE4 A;  4PHM A;  5CSF A;  2M1K B;  1QVI Y;  3I5F B;  3FWC A;  3WHT B;  2L98 A;  3OX6 A;  1IGV A;  1BLQ A;  1FW4 A;  1SCM B;  1SK6 D;  2WCE A;  1J7P A;  1KSO A;  1WRL A;  1LA3 A;  2LHI A;  4L9M A;  1BOC A;  1CDN A;  1BF5 A;  3I5H B;  2BBM A;  1MXL C;  1NCY A;  3HX4 A;  1K2H A;  5JJG A;  1K95 A;  1QIV A;  1SCV A;  3PM8 A;  2KBM A;  5IBW A;  2JRF A;  3A4U B;  2OS8 C;  4I5L B;  1SL7 A;  3CR2 A;  5CSI A;  1S3P A;  2EHB A;  3A8R A;  1BMO A;  1IQ5 A;  2LHL A;  4JQ0 D;  3VRQ A;  4A4B A;  1NX1 A;  1QX2 A;  1J7R A;  2I18 A;  3LLE A;  1YUT A;  2F3Y A;  4MRY A;  5GQQ C;  2P6B B;  1W7I B;  2WC8 A;  3KHE A;  2D8N A;  3EVV A;  1ALV A;  1TRF A;  1NP8 A;  1OOJ A;  1UUR A;  1NX3 A;  4YGE B;  1GJY A;  4CLN A;  1S6C A;  2CT9 A;  1YR5 A;  2I7A A;  1LA0 A;  1TIZ A;  3SG5 A;  2ZN9 A;  1M63 B;  1MF8 B;  3GK4 X;  2MA2 A;  1B9A A;  1L7Z A;  1W7J B;  2PAL A;  3JVT B;  3O4Y A;  2ZKM X;  1UWO A;  1B8C A;  1KWO C;  4MVF A;  2L2E A;  1NIW A;  3IF7 A;  2JOJ A;  5CSN A;  1JF2 A;  1YVH A;  2VRG A;  3AAJ A;  4GPL B;  1G33 A;  1TNP A;  4MLW A;  5I2L A;  3VGO A;  3C1V A;  2JQ6 A;  2CTN A;  1BOD A;  1JFJ A;  5I2O A;  4HRE E;  2HF5 A;  2JZI A;  2KBI A;  5AXI A;  1KSM A;  1L2O B;  4PE4 A;  1PK0 D;  3CLN A;  4FQO A;  1WDC B;  4XJK A;  2LV7 A;  2LNK A;  4U8D A;  3BUW B;  1WLM A;  1B7T Y;  2KGB C;  2K61 A;  2F2P A;  3OB2 B;  1VRK A;  1FBV A;  1RK9 A;  1NX2 A;  2JNF A;  4YBH B;  4Q04 A;  3ICB A;  1JBA A;  3TUY B;  1A03 A;  1SNL A;  1UHN A;  2Y1N A;  1EL4 A;  1ODB A;  2A4J A;  2NZ0 A;  4MZL A;  3I5G B;  2OTG C;  1CFD A;  2PVB A;  3KPX A;  2BCA A;  2ZN8 A;  1OZS A;  1NX0 A;  2G9B A;  4PAL A;  2KAY A;  1G8I A;  2LVI A;  5FYX A;  1DT7 B;  4OKH A;  2LUX A;  1K9K A;  2Q91 A;  3MSE B;  2ZFD A;  1E8A A;  1ZUZ A;  2JT0 A;  1DVI A;  2MJW B;  1J1E A;  1MHO A;  3BUM B;  1Y0V H;  3TS5 B;  1K94 A;  3WNX B;  4YI9 A;  1PUL A;  3AKB A;  1F71 A;  2M97 A;  3VRO A;  2CCM A;  3RM1 A;  1NUB A;  2K7D A;  1MR8 A;  1B1G A;  3EK4 A;  4I5J A;  2WCB A;  4GGF A;  1S6I A;  4PE1 A;  5DKQ A;  2KNE A;  2LC5 A;  1XYD A;  3OP0 A;  1CLM A;  1DF0 A;  2KQ6 A;  2LAP A;  2LE9 B;  4DS7 A;  1DF0 B;  1S5G Z;  2GV5 A;  2KI6 D;  3PN7 B;  4MZK A;  1NCX A;  1YUU A;  4HSZ A;  2V53 A;  3DF0 A;  1JC2 A;  1LKJ A;  4MSP A;  1LIN A;  1S6J A;  1K9P A;  2PSR A;  3IQQ A;  2KQY A;  2F8P A;  3VRN A;  5AER A;  5DKN A;  1KK8 B;  5HYD A;  1FPW A;  1K8U A;  1XFX O;  2JNX A;  3CR5 X;  3OHM B;  1A2X A;  1PSR A;  1WLZ A;  1M39 A;  1MQ1 A;  2BKH B;  2MLE C;  3EK8 A;  1S26 D;  1YUR A;  1SRA A;  1B8R A;  1UHJ A;  3EK7 A;  5F6T A;  2LCP A;  3DVJ A;  4PHJ A;  1S5G Y;  4R1E A;  1DJZ A;  2K7O A;  1ALW A;  1R2U A; 
#chains in the Genus database with same CATH topology
 3L47 A;  1N65 A;  3M0W A;  1XFR A;  2KLD A;  1D1O A;  1JSA A;  4D1E A;  1F70 A;  1SL8 A;  4M2P A;  2JC2 A;  4GUK A;  3O6B A;  2K7B A;  1AJ5 A;  1TNX A;  4WQ2 A;  4JKT A;  5AAN A;  1QAS A;  2M7L A;  1XK4 A;  4OCI A;  1QXP A;  3F45 A;  1KCY A;  2JXC A;  1A75 A;  2KFF A;  2M9G A;  1QX5 B;  1IJ6 A;  1A75 B;  3S0D A;  3I5I B;  5KSZ A;  3DY9 A;  4E68 A;  2H2K A;  1DJX A;  1BR1 B;  2K2F A;  3D74 A;  2QPT A;  2JT3 A;  1OMD A;  1DQE A;  2L5X B;  1KFU S;  2LMV A;  2FJU B;  3HCM A;  3EKH A;  4NDB A;  2FCE A;  5PAL A;  2WOS A;  3KO0 A;  4P5O E;  3DZT A;  3I5F C;  2KI4 B;  5D3O A;  1EG3 A;  1SBJ A;  3S0A A;  1YRU B;  4FQT A;  2K2A A;  4F7F A;  3PLF B;  2LP3 A;  3NHT A;  5BPJ A;  3LCP C;  5CSJ A;  1SCM C;  3NSL A;  4IL1 A;  1Q80 A;  2LLT A;  1RJV A;  4USL A;  1IG5 A;  1EXR A;  5D7F A;  2QEB A;  2KLE A;  2JU0 A;  3BQ3 A;  3JTD B;  1R6P A;  3I5H C;  2CNP A;  1BT6 A;  1W9Z A;  3EVU A;  1OZO A;  2KDH A;  1QV0 A;  3BFB A;  2M29 A;  2I2R E;  3E3R A;  1ZMZ A;  5CPV A;  1KFU L;  1YRT B;  1F4O A;  1C3Z A;  1CDP A;  4HRH A;  1BG1 A;  3OX5 A;  2BEC A;  3K21 A;  2L51 A;  2F33 A;  1H4B A;  2ZND A;  2FOT A;  5HKZ A;  1AUI B;  4A4C A;  1B47 A;  2MRD A;  1B4C A;  1SL9 A;  2QEV A;  2I94 A;  1SR6 B;  1CDL A;  3TDI A;  4YGD B;  2KYC A;  2ERB A;  2JWW A;  1RTP 1;  1TCF A;  1IJ5 A;  2WCJ A;  1PRW A;  2DOQ A;  2H61 A;  2CXJ A;  3RLZ A;  1K90 D;  2WC6 A;  3JVT C;  1DJG A;  1K96 A;  2LAN A;  3DD4 A;  1KQM B;  2JPT A;  2BL0 B;  1EJ3 A;  3TDZ A;  1F8H A;  4YI8 A;  1CLL A;  1CTR A;  3BUO B;  4TNC A;  4BY4 A;  4M2Q A;  1K93 D;  3L4L A;  2RGI A;  5ER5 A;  1SY9 A;  4NDC A;  1ZAC A;  3Q8I A;  2HQW A;  1TOP A;  4YRU A;  1AJ4 A;  4C0J A;  5AEQ A;  1L2O C;  3NHI A;  1XVJ A;  1NSH A;  3S0E A;  1A29 A;  2HPS A;  3SJS A;  2KAX A;  1WDC C;  1DC1 A;  1CNP A;  2G2B A;  3GOF A;  2L50 A;  2TN4 A;  1OSA A;  3IVT A;  2ISD A;  3S0F A;  2WCK A;  1FI5 A;  2KFG A;  2F3Z A;  2NCP A;  1KQV A;  4JD9 A;  1C7V A;  4GBA A;  4ICB A;  1NPQ A;  2PYQ A;  3CS1 A;  1IKU A;  5DKR A;  2LVK A;  3B88 A;  1XO5 A;  3PFV A;  3SIB A;  4MZJ A;  1SYM A;  3RZS A;  1Y1A A;  2WCM A;  3H4S E;  2LVV A;  5ER4 X;  3LK1 A;  4NQG A;  5DIC A;  3CZT X;  1TCO B;  2E30 A;  3BUX B;  3DXL A;  1T14 A;  4C0L A;  3TUY C;  1YUS A;  1NWD A;  5FI2 A;  2L4H A;  1QVI Z;  1TTX A;  2LVJ A;  1TNQ A;  2M0R A;  3KF9 A;  3PAT A;  2H61 C;  3LK0 A;  2JXL A;  3I5G C;  3ZWH A;  4ORC B;  1QX7 A;  4QJ4 B;  1JF0 A;  3VB1 A;  4DCK A;  3ZNI A;  2K0J A;  1KFX S;  1F55 A;  4GAO A;  2OS8 B;  4ZCU A;  1J1D A;  2KPH A;  1DEL A;  2OPO A;  1YX8 A;  2M1U A;  3BUN B;  3TS5 C;  3B86 A;  2M8U A;  2BBN A;  3R1O A;  4YGC B;  3TZ1 A;  4WQ3 A;  1X02 A;  5TNC A;  1CM4 A;  2KOT A;  2QEO A;  1F4Q A;  2NXQ A;  4DRW A;  1C7W A;  2MLF C;  2LLU A;  1Z2C B;  1DJH A;  1DTL A;  3VRP A;  2F2O A;  2WCF A;  2NCO A;  4GFT A;  3SG7 A;  4JPZ B;  2HQ8 A;  4GGF C;  1KFX L;  2NLN A;  2M3W A;  2B1U A;  2JT8 A;  1CFF A;  1PVA A;  1YX7 A;  1CM1 A;  2CBL A;  5FI7 A;  4NDD A;  5HKW A;  2R2I A;  4PCW A;  2SAS A;  1KWO B;  2EC6 C;  3PN7 C;  3DVK A;  3O4X A;  2BNX A;  1DGV A;  4ORA B;  4AOM A;  2EGD A;  2BCB A;  1U5I A;  2PRU A;  1BJF A;  5AFP A;  1DGU A;  5KU1 A;  4PT1 A;  1J7Q A;  1U5I B;  5JOL A;  3S0G A;  2GGM A;  4N1F A;  1BR4 B;  1WY9 A;  4N5X A;  3QRX A;  4I5K A;  3EKJ A;  2K8M B;  3O78 A;  2JTZ A;  1DJI A;  1DMO A;  3GK1 A;  4YGA A;  1WRK A;  1IH0 A;  4MBE A;  1KK8 C;  1KK7 Z;  3VRR A;  5B8I B;  1V1F A;  3CZ2 A;  2ZRT A;  2MAZ A;  1FI6 A;  2LUC A;  4M2O A;  1SPY A;  2FCD A;  2L2C A;  4MN0 A;  5HLO A;  2E6W A;  2LMU A;  1OMR A;  1REC A;  3CR4 X;  4FTG A;  3LL8 B;  1MUX A;  1UHH A;  4CFQ A;  5KTY A;  4JWQ A;  2LM5 A;  1TWO A;  4QJ3 B;  1F54 A;  1QLK A;  5I2Q A;  3EVR A;  1MWN A;  1IRJ A;  2Y5I A;  1UP5 A;  3S0B A;  1NCZ A;  1S1E A;  2HET A;  3O2P A;  1B7T Z;  1XFZ O;  3BXK A;  4PHK A;  1TN4 A;  1UHK A;  3GK2 A;  4MEW A;  3V2L A;  1GQM A;  1M45 A;  2BCX A;  2ZRS A;  5HKY A;  3WHU B;  1IQ3 A;  1RRO A;  2M7N A;  1QS7 A;  1AP4 A;  5I8N A;  4AQJ A;  4BY5 A;  1GGZ A;  1EH2 A;  1GGW A;  1OE9 B;  1IWQ A;  2OTG B;  4PE0 A;  2MHH A;  3PAL A;  4DUQ A;  1RFJ A;  1UUS A;  2WOR A;  4QJ5 B;  1HT9 A;  2KGR A;  1XFW O;  3DVM A;  2COL B;  3SIA A;  1XK4 C;  1SKT A;  3FE8 A;  5J3X A;  1KK7 Y;  3CTN A;  1XFV O;  2L4I A;  3I5I C;  3WXA A;  2LMT A;  1LVC D;  1PAL A;  1V1G A;  1CMF A;  3D78 A;  1BU3 A;  1Y1X A;  2PQL A;  1M31 A;  4OVN F;  1QV1 A;  3DVE A;  4GGN A;  3PJI A;  1AHR A;  5D69 A;  4ETO A;  1CKK A;  3OB1 B;  2KI4 C;  2MBX A;  1FF1 A;  1HQV A;  2O5G A;  2Y1M A;  4INX A;  5K89 A;  2GGZ A;  4KYN A;  4XJK B;  1XA5 A;  2QEH A;  1DJY A;  3BFH A;  3SG2 A;  3AAK A;  3PSR A;  2M49 B;  1EG4 A;  3JTD C;  3SG3 A;  3FS7 A;  4OV2 A;  5HLV A;  4PE7 A;  2PAS A;  3CAB A;  1H8B A;  1JFK A;  3IQO A;  2AMI A;  3NSI A;  4GNK B;  4AQI A;  3FWB A;  4MRX A;  2JUL A;  3AKA A;  1JWD A;  1TUZ A;  1QIW A;  2WCH A;  4XYN A;  2JTT A;  1ZFS A;  3NGV A;  4PDZ A;  1CB1 A;  4F0Z B;  1S36 A;  4CPV A;  2KFH A;  1NYA A;  2Q4U A;  3BYA A;  3CGA A;  3CWG A;  4CFR A;  2AUC A;  2KAV A;  1YVL A;  3KEV A;  4YGB B;  1CFC A;  2O60 A;  3D73 A;  1XFY O;  1CLB A;  3R1V A;  2Y4Q A;  3B87 A;  2LP2 A;  3NSO A;  2IS9 A;  2ZNE A;  4I5N B;  1G4Y R;  1AVS A;  2KYF A;  1Y1U A;  1SR6 C;  3NSK A;  4OR9 B;  4ORB B;  2PMY A;  2K7C A;  1WRZ A;  2BKI B;  3OGN A;  2KHN A;  1C07 A;  1PSB A;  2QAC A;  2LLS A;  1B8L A;  1K9U A;  1LXF C;  1XFU O;  1J55 A;  1ZOT B;  4ZCV A;  1J7O A;  3SG6 A;  4HRG A;  1UHI A;  2KI6 C;  4PHN A;  1RWY A;  4DIR A;  1YTZ C;  2WND A;  1KQM C;  3FIA A;  2KSP A;  1OMV A;  2BL0 C;  2H8V A;  4UPG A;  1N2D A;  4CID A;  2EC6 B;  2AAO A;  2L0P A;  3BFA A;  5G08 A;  1CMG A;  1M46 A;  1SW8 A;  1CDM A;  1QTX A;  3SG4 A;  1QJT A;  3PM2 A;  1DJW A;  1N0Y A;  3BOW A;  1QAT A;  1TNW A;  3D10 A;  2BE6 A;  1AK8 A;  3BOW B;  3OHM B;  1SMG A;  1Y6W A;  2WC5 A;  4N1G A;  4P2Y B;  3TDU A;  1CFP A;  3NXA A;  1JUO A;  4C0K A;  1PVB A;  3CZ0 A;  3DF0 B;  1A4P A;  1MXE A;  2QDI A;  3D0Y A;  1QLS A;  3FE6 A;  4WRI A;  1OQP A;  2SCP A;  3D0Y B;  2BE4 A;  3K1E A;  4PHM A;  5CSF A;  1OOG A;  2M1K B;  1QVI Y;  3I5F B;  3FWC A;  3WHT B;  3D75 A;  2L98 A;  3OX6 A;  1IGV A;  1BLQ A;  1FW4 A;  1SCM B;  1SK6 D;  2WCE A;  1J7P A;  1KSO A;  1WRL A;  1LA3 A;  2LHI A;  4L9M A;  1BOC A;  1CDN A;  1BF5 A;  3I5H B;  2BBM A;  1MXL C;  1NCY A;  3HX4 A;  1K2H A;  5JJG A;  1K95 A;  1QIV A;  1SCV A;  3PM8 A;  2KBM A;  5IBW A;  2JRF A;  3A4U B;  2OS8 C;  4I5L B;  1SL7 A;  3CR2 A;  5CSI A;  1S3P A;  2EHB A;  3A8R A;  1BMO A;  1IQ5 A;  2LHL A;  2WCL A;  4JQ0 D;  3VRQ A;  4A4B A;  1GM0 A;  1NX1 A;  1QX2 A;  1J7R A;  2I18 A;  3LLE A;  1YUT A;  2F3Y A;  4MRY A;  5GQQ C;  3SS5 A;  2P6B B;  1W7I B;  2WC8 A;  3KHE A;  2D8N A;  3EVV A;  1ALV A;  3SS3 A;  1TRF A;  1NP8 A;  1OOJ A;  1UUR A;  1NX3 A;  4YGE B;  1GJY A;  4CLN A;  1S6C A;  2CT9 A;  1YR5 A;  2I7A A;  1LA0 A;  1TIZ A;  3SG5 A;  3OBV A;  2ZN9 A;  1M63 B;  1MF8 B;  3GK4 X;  2MA2 A;  3CYZ A;  1B9A A;  1L7Z A;  3B7A A;  1W7J B;  2PAL A;  3JVT B;  3O4Y A;  2ZKM X;  1UWO A;  3D77 A;  1B8C A;  1KWO C;  4MVF A;  2L2E A;  1NIW A;  3IF7 A;  1ORG A;  2JOJ A;  5CSN A;  3CZ1 A;  1JF2 A;  1SSE B;  1YVH A;  2VRG A;  3AAJ A;  4GPL B;  1G33 A;  1TNP A;  4MLW A;  5I2L A;  3VGO A;  3C1V A;  2JQ6 A;  2CTN A;  1BOD A;  1JFJ A;  5I2O A;  4HRE E;  2HF5 A;  2JZI A;  2KBI A;  5AXI A;  1KSM A;  3BJH A;  1L2O B;  4PE4 A;  1PK0 D;  5FI6 A;  3CLN A;  3D76 A;  4FQO A;  1WDC B;  4XJK A;  2LV7 A;  2LNK A;  4U8D A;  3BUW B;  1WLM A;  1B7T Y;  2KGB C;  2P71 A;  1OOF A;  3CDN A;  2K61 A;  2F2P A;  3OB2 B;  1VRK A;  1FBV A;  5EL2 A;  1RK9 A;  1NX2 A;  2JNF A;  4YBH B;  4Q04 A;  3L4A A;  3ICB A;  1JBA A;  3TUY B;  1A03 A;  1SNL A;  1UHN A;  2Y1N A;  1EL4 A;  1ODB A;  2A4J A;  2NZ0 A;  4MZL A;  5I94 A;  2FJY A;  3DYE A;  3I5G B;  2OTG C;  1CFD A;  2PVB A;  3KPX A;  2BCA A;  3B6X A;  2ZN8 A;  1OZS A;  1NX0 A;  2G9B A;  4OZD A;  4PAL A;  2JPO A;  2KAY A;  1G8I A;  2LVI A;  5FYX A;  3UNW A;  4OKH A;  1DT7 B;  2LUX A;  1K9K A;  3N7H A;  2Q91 A;  3R1P A;  3MSE B;  4IJ7 A;  2ZFD A;  1E8A A;  1ZUZ A;  2JT0 A;  3UO9 A;  1DVI A;  2MJW B;  1J1E A;  1MHO A;  3BUM B;  1Y0V H;  3TS5 B;  1K94 A;  3WNX B;  4YI9 A;  1PUL A;  3AKB A;  1F71 A;  2M97 A;  3R72 A;  3VRO A;  2CCM A;  3RM1 A;  1NUB A;  2K7D A;  1MR8 A;  1B1G A;  3EK4 A;  3EG5 B;  4I5J A;  1C3Y A;  1OOI X;  2WCB A;  4GGF A;  1LS8 A;  1S6I A;  2GTE A;  4PE1 A;  5DKQ A;  1OW4 A;  2KNE A;  2LC5 A;  1XYD A;  2BAP A;  1CLM A;  1DF0 A;  1P28 A;  2KQ6 A;  2LAP A;  2LE9 B;  3FE9 A;  3OP0 A;  4DS7 A;  1DF0 B;  1S5G Z;  2GV5 A;  1IIO A;  2KI6 D;  3PN7 B;  4MZK A;  1TUJ A;  1NCX A;  5HL1 A;  1YUU A;  4HSZ A;  2V53 A;  3DF0 A;  1JC2 A;  1LKJ A;  4MSP A;  1LIN A;  4INW A;  1S6J A;  4R1E A;  1K9P A;  2PSR A;  3IQQ A;  2KQY A;  2F8P A;  3VRN A;  5AER A;  5DKN A;  1KK8 B;  3SS4 A;  5HYD A;  1FPW A;  3QME A;  1K8U A;  1XFX O;  2JNX A;  2L5Y A;  3CR5 X;  1QWV A;  1A2X A;  1PSR A;  1WLZ A;  1M39 A;  1MQ1 A;  2BKH B;  2MLE C;  3EK8 A;  1S26 D;  1YUR A;  1Z4H A;  1SRA A;  1OOH A;  1B8R A;  1UHJ A;  2K60 A;  1DEK A;  3EK7 A;  5F6T A;  2LCP A;  3DVJ A;  4PHJ A;  2P70 A;  1S5G Y;  2YGU A;  1DJZ A;  2K7O A;  1ALW A;  1R2U A; 
#chains in the Genus database with same CATH homology
 1N65 A;  3M0W A;  1D1O A;  1JSA A;  4D1E A;  1F70 A;  1SL8 A;  4M2P A;  2JC2 A;  4GUK A;  3O6B A;  2K7B A;  1AJ5 A;  1TNX A;  4WQ2 A;  5AAN A;  1QAS A;  2M7L A;  1XK4 A;  4OCI A;  1QXP A;  3F45 A;  1KCY A;  2JXC A;  1A75 A;  2KFF A;  2M9G A;  1QX5 B;  1IJ6 A;  1A75 B;  3I5I B;  5KSZ A;  4E68 A;  2H2K A;  1DJX A;  1BR1 B;  2K2F A;  2QPT A;  2JT3 A;  1OMD A;  2L5X B;  1KFU S;  2LMV A;  2FJU B;  3HCM A;  3EKH A;  4NDB A;  2FCE A;  5PAL A;  2WOS A;  3KO0 A;  4P5O E;  3I5F C;  2KI4 B;  1EG3 A;  1SBJ A;  1YRU B;  2K2A A;  3PLF B;  2LP3 A;  5BPJ A;  3LCP C;  5CSJ A;  1SCM C;  3NSL A;  4IL1 A;  1Q80 A;  2LLT A;  1RJV A;  4USL A;  1IG5 A;  1EXR A;  5D7F A;  2JU0 A;  3BQ3 A;  3JTD B;  1R6P A;  3I5H C;  2CNP A;  1BT6 A;  3EVU A;  1OZO A;  2KDH A;  1QV0 A;  2M29 A;  2I2R E;  3E3R A;  1ZMZ A;  5CPV A;  1KFU L;  1YRT B;  1F4O A;  1CDP A;  4HRH A;  1BG1 A;  3OX5 A;  2BEC A;  3K21 A;  2L51 A;  2F33 A;  1H4B A;  2ZND A;  2FOT A;  5HKZ A;  1AUI B;  4A4C A;  1B47 A;  2MRD A;  1B4C A;  1SL9 A;  2I94 A;  1SR6 B;  1CDL A;  3TDI A;  4YGD B;  2KYC A;  2JWW A;  1RTP 1;  1TCF A;  1IJ5 A;  1PRW A;  2DOQ A;  2H61 A;  2CXJ A;  3RLZ A;  1K90 D;  3JVT C;  1DJG A;  1K96 A;  2LAN A;  3DD4 A;  1KQM B;  2JPT A;  2BL0 B;  1EJ3 A;  3TDZ A;  1F8H A;  4YI8 A;  1CLL A;  1CTR A;  3BUO B;  4TNC A;  4BY4 A;  4M2Q A;  1K93 D;  2RGI A;  5ER5 A;  1SY9 A;  4NDC A;  1ZAC A;  2HQW A;  1TOP A;  4YRU A;  1AJ4 A;  4C0J A;  5AEQ A;  1L2O C;  1XVJ A;  1NSH A;  1A29 A;  2HPS A;  3SJS A;  2KAX A;  1WDC C;  1CNP A;  2G2B A;  3GOF A;  2L50 A;  2TN4 A;  1OSA A;  2ISD A;  1FI5 A;  2KFG A;  2F3Z A;  2NCP A;  1KQV A;  1C7V A;  4GBA A;  4ICB A;  1NPQ A;  3CS1 A;  1IKU A;  5DKR A;  2LVK A;  1XO5 A;  3PFV A;  3SIB A;  4MZJ A;  1SYM A;  1Y1A A;  3H4S E;  2LVV A;  5ER4 X;  3LK1 A;  4NQG A;  3CZT X;  1TCO B;  2E30 A;  3BUX B;  4C0L A;  3TUY C;  1YUS A;  1NWD A;  2L4H A;  1QVI Z;  1TTX A;  2LVJ A;  1TNQ A;  2M0R A;  3KF9 A;  3PAT A;  2H61 C;  3LK0 A;  2JXL A;  3I5G C;  3ZWH A;  4ORC B;  1QX7 A;  4QJ4 B;  1JF0 A;  4DCK A;  3ZNI A;  2K0J A;  1KFX S;  1F55 A;  4GAO A;  2OS8 B;  4ZCU A;  1J1D A;  2OPO A;  1YX8 A;  2M1U A;  3BUN B;  3TS5 C;  2M8U A;  2BBN A;  4YGC B;  3TZ1 A;  4WQ3 A;  1X02 A;  5TNC A;  1CM4 A;  2KOT A;  1F4Q A;  2NXQ A;  4DRW A;  1C7W A;  2MLF C;  2LLU A;  1DJH A;  1DTL A;  3VRP A;  2F2O A;  2WCF A;  2NCO A;  4GFT A;  3SG7 A;  4JPZ B;  2HQ8 A;  4GGF C;  1KFX L;  2NLN A;  2M3W A;  2B1U A;  2JT8 A;  1CFF A;  1PVA A;  1YX7 A;  1CM1 A;  2CBL A;  4NDD A;  5HKW A;  2R2I A;  4PCW A;  2SAS A;  1KWO B;  2EC6 C;  3PN7 C;  3DVK A;  1DGV A;  4ORA B;  4AOM A;  2EGD A;  2BCB A;  1U5I A;  2PRU A;  1BJF A;  5AFP A;  1DGU A;  5KU1 A;  1J7Q A;  1U5I B;  5JOL A;  2GGM A;  4N1F A;  1BR4 B;  1WY9 A;  4N5X A;  3QRX A;  4I5K A;  3EKJ A;  2K8M B;  3O78 A;  2JTZ A;  1DJI A;  1DMO A;  3GK1 A;  4YGA A;  1WRK A;  1IH0 A;  4MBE A;  1KK8 C;  1KK7 Z;  3VRR A;  5B8I B;  1V1F A;  2ZRT A;  2MAZ A;  1FI6 A;  2LUC A;  4M2O A;  1SPY A;  2FCD A;  4MN0 A;  5HLO A;  2E6W A;  2LMU A;  1OMR A;  1REC A;  3CR4 X;  4FTG A;  3LL8 B;  1MUX A;  1UHH A;  4CFQ A;  5KTY A;  4JWQ A;  2LM5 A;  4QJ3 B;  1F54 A;  1QLK A;  5I2Q A;  3EVR A;  1MWN A;  1IRJ A;  2Y5I A;  1UP5 A;  1NCZ A;  1S1E A;  2HET A;  3O2P A;  1B7T Z;  1XFZ O;  3BXK A;  4PHK A;  1TN4 A;  1UHK A;  3GK2 A;  4MEW A;  5HKY A;  1GQM A;  1M45 A;  2BCX A;  2ZRS A;  3WHU B;  1IQ3 A;  1RRO A;  2M7N A;  1QS7 A;  1AP4 A;  5I8N A;  4AQJ A;  4BY5 A;  1GGZ A;  1EH2 A;  1GGW A;  1OE9 B;  1IWQ A;  2OTG B;  4PE0 A;  2MHH A;  3PAL A;  4DUQ A;  1RFJ A;  1UUS A;  2WOR A;  4QJ5 B;  1HT9 A;  2KGR A;  1XFW O;  3DVM A;  2COL B;  3SIA A;  1XK4 C;  1SKT A;  5J3X A;  1KK7 Y;  3CTN A;  1XFV O;  2L4I A;  3I5I C;  3WXA A;  2LMT A;  1LVC D;  1PAL A;  1V1G A;  1CMF A;  1BU3 A;  1Y1X A;  1M31 A;  4OVN F;  1QV1 A;  3DVE A;  4GGN A;  1AHR A;  5D69 A;  4ETO A;  1CKK A;  3OB1 B;  2KI4 C;  2MBX A;  1FF1 A;  1HQV A;  2O5G A;  2Y1M A;  5K89 A;  2GGZ A;  4XJK B;  1XA5 A;  1DJY A;  3SG2 A;  3AAK A;  3PSR A;  2M49 B;  1EG4 A;  3JTD C;  3SG3 A;  3FS7 A;  4OV2 A;  5HLV A;  4PE7 A;  2PAS A;  1H8B A;  1JFK A;  3IQO A;  2AMI A;  3NSI A;  4GNK B;  4AQI A;  3FWB A;  4MRX A;  2JUL A;  3AKA A;  1JWD A;  1QIW A;  4XYN A;  2JTT A;  1ZFS A;  4PDZ A;  1CB1 A;  4F0Z B;  1S36 A;  4CPV A;  2KFH A;  1NYA A;  2Q4U A;  3BYA A;  3CGA A;  3CWG A;  4CFR A;  2AUC A;  2KAV A;  1YVL A;  3KEV A;  4YGB B;  1CFC A;  2O60 A;  1XFY O;  1CLB A;  2Y4Q A;  3NSO A;  2LP2 A;  2IS9 A;  2ZNE A;  4I5N B;  1G4Y R;  1AVS A;  2KYF A;  1Y1U A;  1SR6 C;  3NSK A;  4OR9 B;  4ORB B;  2PMY A;  2K7C A;  1WRZ A;  2BKI B;  4CID A;  2KHN A;  1C07 A;  1PSB A;  2QAC A;  2LLS A;  1B8L A;  1K9U A;  1LXF C;  1XFU O;  1J55 A;  1ZOT B;  4ZCV A;  1J7O A;  3SG6 A;  4HRG A;  1UHI A;  2KI6 C;  4PHN A;  1RWY A;  4DIR A;  1YTZ C;  2WND A;  1KQM C;  3FIA A;  2KSP A;  1OMV A;  2BL0 C;  4UPG A;  1N2D A;  2EC6 B;  2AAO A;  2L0P A;  5G08 A;  1CMG A;  1M46 A;  1SW8 A;  1CDM A;  1QTX A;  3SG4 A;  1QJT A;  1DJW A;  1N0Y A;  3BOW A;  1QAT A;  1TNW A;  3D10 A;  2BE6 A;  1AK8 A;  3BOW B;  1SMG A;  1Y6W A;  4N1G A;  4P2Y B;  3TDU A;  1CFP A;  3NXA A;  1JUO A;  4C0K A;  1PVB A;  3DF0 B;  1A4P A;  1MXE A;  3D0Y A;  1QLS A;  4WRI A;  1OQP A;  2SCP A;  3D0Y B;  2BE4 A;  4PHM A;  5CSF A;  2M1K B;  1QVI Y;  3I5F B;  3FWC A;  3WHT B;  2L98 A;  3OX6 A;  1IGV A;  1BLQ A;  1FW4 A;  1SCM B;  1SK6 D;  2WCE A;  1J7P A;  1KSO A;  1WRL A;  1LA3 A;  2LHI A;  4L9M A;  1BOC A;  1CDN A;  1BF5 A;  3I5H B;  2BBM A;  1MXL C;  1NCY A;  3HX4 A;  1K2H A;  5JJG A;  1K95 A;  1QIV A;  1SCV A;  3PM8 A;  2KBM A;  5IBW A;  2JRF A;  3A4U B;  2OS8 C;  4I5L B;  1SL7 A;  3CR2 A;  5CSI A;  1S3P A;  2EHB A;  3A8R A;  1BMO A;  1IQ5 A;  2LHL A;  4JQ0 D;  3VRQ A;  4A4B A;  1NX1 A;  1QX2 A;  1J7R A;  2I18 A;  3LLE A;  1YUT A;  2F3Y A;  4MRY A;  5GQQ C;  2P6B B;  1W7I B;  2WC8 A;  3KHE A;  2D8N A;  3EVV A;  1ALV A;  1TRF A;  1NP8 A;  1OOJ A;  1UUR A;  1NX3 A;  4YGE B;  1GJY A;  4CLN A;  1S6C A;  2CT9 A;  1YR5 A;  2I7A A;  1LA0 A;  1TIZ A;  3SG5 A;  2ZN9 A;  1M63 B;  1MF8 B;  3GK4 X;  2MA2 A;  1B9A A;  1L7Z A;  1W7J B;  2PAL A;  3JVT B;  3O4Y A;  2ZKM X;  1UWO A;  1B8C A;  1KWO C;  4MVF A;  2L2E A;  1NIW A;  3IF7 A;  2JOJ A;  5CSN A;  1JF2 A;  1YVH A;  2VRG A;  3AAJ A;  4GPL B;  1G33 A;  1TNP A;  4MLW A;  5I2L A;  3VGO A;  3C1V A;  2JQ6 A;  2CTN A;  1BOD A;  1JFJ A;  5I2O A;  4HRE E;  2HF5 A;  2JZI A;  2KBI A;  5AXI A;  1KSM A;  1L2O B;  4PE4 A;  1PK0 D;  3CLN A;  4FQO A;  1WDC B;  4XJK A;  2LV7 A;  2LNK A;  4U8D A;  3BUW B;  1WLM A;  1B7T Y;  2KGB C;  2K61 A;  2F2P A;  3OB2 B;  1VRK A;  1FBV A;  1RK9 A;  1NX2 A;  2JNF A;  4YBH B;  4Q04 A;  3ICB A;  1JBA A;  3TUY B;  1A03 A;  1SNL A;  1UHN A;  2Y1N A;  1EL4 A;  1ODB A;  2A4J A;  2NZ0 A;  4MZL A;  3I5G B;  2OTG C;  1CFD A;  2PVB A;  3KPX A;  2BCA A;  2ZN8 A;  1OZS A;  1NX0 A;  2G9B A;  4PAL A;  2KAY A;  1G8I A;  2LVI A;  5FYX A;  1DT7 B;  4OKH A;  2LUX A;  1K9K A;  2Q91 A;  3MSE B;  2ZFD A;  1E8A A;  1ZUZ A;  2JT0 A;  1DVI A;  2MJW B;  1J1E A;  1MHO A;  3BUM B;  1Y0V H;  3TS5 B;  1K94 A;  3WNX B;  4YI9 A;  1PUL A;  3AKB A;  1F71 A;  2M97 A;  3VRO A;  2CCM A;  3RM1 A;  1NUB A;  2K7D A;  1MR8 A;  1B1G A;  3EK4 A;  4I5J A;  2WCB A;  4GGF A;  1S6I A;  4PE1 A;  5DKQ A;  2KNE A;  2LC5 A;  1XYD A;  3OP0 A;  1CLM A;  1DF0 A;  2KQ6 A;  2LAP A;  2LE9 B;  4DS7 A;  1DF0 B;  1S5G Z;  2GV5 A;  2KI6 D;  3PN7 B;  4MZK A;  1NCX A;  1YUU A;  4HSZ A;  2V53 A;  3DF0 A;  1JC2 A;  1LKJ A;  4MSP A;  1LIN A;  1S6J A;  1K9P A;  2PSR A;  3IQQ A;  2KQY A;  2F8P A;  3VRN A;  5AER A;  5DKN A;  1KK8 B;  5HYD A;  1FPW A;  1K8U A;  1XFX O;  2JNX A;  3CR5 X;  3OHM B;  1A2X A;  1PSR A;  1WLZ A;  1M39 A;  1MQ1 A;  2BKH B;  2MLE C;  3EK8 A;  1S26 D;  1YUR A;  1SRA A;  1B8R A;  1UHJ A;  3EK7 A;  5F6T A;  2LCP A;  3DVJ A;  4PHJ A;  1S5G Y;  4R1E A;  1DJZ A;  2K7O A;  1ALW A;  1R2U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...