1N2DA

Ternary complex of mlc1p bound to iq2 and iq3 of myo2p, a class v myosin
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
147
structure length
147
Chain Sequence
ATRANKDIFTLFDKKGQGAIAKDSLGDYLRAIGYNPTNQLVQDIINADSSLRDASSLTLDQITGLIEVNEKELDATTKAKTEDFVKAFQVFDKESTGKVSVGDLRYMLTGLGEKLTDAEVDELLKGVEVDSNGEIDYKKFIEDVLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin Light Chain
publication title Structure of the light chain-binding domain of myosin V.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 45
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1n2dA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1n2dA01
2BCAA 5DKRA 4PHKA 1B9AA 1CFDA 1NX1A 2M8UA 4YGEB 1RWYA 4GGNA 4HRGA 1EJ3A 1HT9A 1MUXA 1NYAA 1ZOTB 3KF9A 3NSIA 2WNDA 3TS5C 4MSPA 4N1FA 1SBJA 5HLOA 5HKWA 1BR4B 5DKQA 1DJGA 5CSNA 2WCBA 3EK8A 1SRAA 2OS8C 2Y1NA 3GK4X 1C7VA 2H2KA 1JWDA 2KDHA 1JUOA 1WDCB 1F4QA 1RFJA 1QATA 4GPLB 1F54A 2JT3A 2JXLA 2OPOA 1CLBA 2JULA 2KGBC 4I5JA 2LVJA 3CR2A 2L5XB 3SG6A 3O4YA 1QTXA 1SCMC 2MRDA 1XFZO 5BPJA 3BOWA 2M49B 3MSEB 3SG4A 1YTZC 1TNQA 4N1GA 1BOCA 1CTRA 2KI4C 2AMIA 2L98A 1DGVA 4IL1A 1NIWA 2MLFC 5PALA 5HKYA 1UWOA 1H4BA 2BKHB 4GNKB 1S36A 2KQYA 1KK8C 3CR4X 3EK7A 1CDMA 1NPQA 2FCDA 2M0RA 4YI8A 1Y1AA 1JF2A 4XYNA 1Y1XA 2KQ6A 3GK2A 1LXFC 1WLMA 2BKIB 2F33A 4M2OA 4AQIA 3DVKA 1QVIZ 2JOJA 2O60A 2JT8A 2VRGA 1B47A 2WCEA 2L2EA 3OP0A 4HSZA 1F70A 1KSMA 1QX7A 1IH0A 5AERA 4PE1A 2F2OA 1SYMA 5AANA 5I8NA 5AFPA 2WOSA 2TN4A 2K7CA 2LP2A 3CGAA 3JVTB 1L2OC 3OB2B 3C1VA 3WNXB 2EHBA 1KK7Y 2GGZA 1TNPA 2I18A 5CSIA 1CKKA 4GGFC 1N0YA 5ER4X 1S6CA 1MXEA 3VGOA 1S5GZ 4NDDA 4UPGA 2KI6C 1OZSA 1YURA 4I5KA 3VRNA 3QRXA 5D7FA 1CM1A 3OB1B 4DCKA 1V1GA 1PK0D 2KFGA 1C7WA 1OMVA 4PHNA 2CT9A 3SIBA 4MVFA 3RM1A 1R6PA 2KNEA 3SG7A 2Y5IA 4ZCVA 1NP8A 2M1KB 3PN7B 3KO0A 3TUYC 2JTZA 3VRPA 3D0YB 1K90D 1XK4C 2BBMA 2K61A 3EVVA 5I2QA 2JQ6A 2ISDA 1JSAA 1DGUA 2WORA 1XK4A 2LE9B 1GGZA 1K95A 1A4PA 4AQJA 5FYXA 3FWCA 3CWGA 4CFRA 2JT0A 1K8UA 3PATA 2KAXA 1M63B 4U8DA 1SMGA 1KSOA 3TS5B 1RTP1 2CCMA 1J1DA 1QJTA 5AXIA 4E68A 2LC5A 2HQ8A 1W7IB 1JF0A 5K89A 2Q91A 1DJWA 1BU3A 1DF0B 3EKJA 4M2QA 1J7QA 1XFWO 3DVJA 3M0WA 3I5HB 1BMOA 1PSBA 5CSJA 4CIDA 2Q4UA 1KCYA 1N2DA 1SKTA 2KBIA 1DJYA 2LVKA 2KFHA 1K9KA 2JNXA 4WQ2A 4FTGA 4ZCUA 2BECA 1EXRA 3DF0A 1ALVA 4Q04A 1DTLA 3CTNA 3I5IB 1IGVA 1ALWA 1G8IA 1GQMA 1IRJA 2CXJA 3CLNA 1K9UA 1SR6C 1M46A 1SPYA 1KQMB 5CPVA 3NSOA 5AEQA 1Y6WA 3KHEA 2LLTA 2LMUA 2LV7A 2I7AA 1CMGA 3RLZA 4C0JA 1CMFA 3D0YA 1DT7B 1KK8B 1YUTA 1AK8A 4CFQA 2NXQA 2JU0A 1AHRA 1ZMZA 3CZTX 1TN4A 1XVJA 1EG3A 3O2PA 2HQWA 2AAOA 2K7OA 1AVSA 1YUSA 3TDUA 3VRQA 3BYAA 1TCOB 1S6JA 1X02A 3JTDB 4NQGA 1TIZA 4USLA 2K0JA 1YVHA 3SG2A 2F8PA 3IQOA 2L4IA 1KWOC 4DIRA 2PRUA 1RECA 1B7TY 4GBAA 1A75B 1ODBA 2LLUA 4ETOA 1FBVA 2EC6C 1DF0A 3I5GC 3I5FB 5ER5A 5IBWA 4PE7A 1Y0VH 1PVAA 1XA5A 5HYDA 1QX5B 2BL0B 2K7DA 1MF8B 2M7NA 4YGBB 3VROA 1DJIA 4YI9A 1TNXA 5KTYA 1SNLA 1B8RA 1U5IA 1OZOA 4YGCB 3TDZA 3GK1A 1ZACA 1B1GA 2OTGB 2H61A 1MWNA 3PLFB 3AAKA 1SL9A 2D8NA 1GGWA 4N5XA 4HRHA 1LA0A 4GUKA 2M1UA 4R1EA 1AP4A 4PHMA 4QJ5B 1S3PA 1OOJA 3HX4A 3OX6A 4L9MA 1QLKA 3DVEA 4MRYA 1PALA 1CB1A 1CFCA 3IF7A 1FI6A 3K21A 3IQQA 2F3YA 1Q80A 2FJUB 1TRFA 2QPTA 2K2AA 2SCPA 1WDCC 1A2XA 1LA3A 1NX3A 1GJYA 1OMDA 1BT6A 2ZNEA 4XJKB 1EH2A 1QXPA 1J7RA 1G33A 4OV2A 2Y4QA 5HKZA 1UHNA 2JXCA 1JFKA 1YR5A 1QX2A 4MN0A 1BF5A 1BLQA 1CLMA 1J55A 1QASA 3GOFA 1AJ5A 3NSLA 2SASA 4ICBA 1IQ3A 4YRUA 1IWQA 3EVUA 1OQPA 4DRWA 1SCVA 4D1EA 1XO5A 4PCWA 1MR8A 1E8AA 2LM5A 2LANA 1CDLA 2NCOA 2MBXA 2JPTA 3OX5A 2L50A 5KSZA 2BCXA 1KFUL 1QS7A 1UP5A 1BR1B 4ORCB 1G4YR 4C0KA 1CDNA 2M3WA 1NCXA 2ZRTA 4HREE 2MA2A 1QV1A 1RK9A 2K2FA 3DD4A 3ZNIA 3WHUB 2COLB 1S6IA 3O6BA 1UHHA 3D10A 1JC2A 1Y1UA 2PASA 1R2UA 1DJHA 1XFYO 2GV5A 1LVCD 1CM4A 2KI6D 3KPXA 2ZRSA 3PM8A 4P5OE 1QIVA 1QV0A 2BCBA 1YVLA 4I5LB 2ZFDA 3BUXB 3JVTC 1DMOA 1EL4A 1JBAA 4WRIA 2ZN9A 2PSRA 2M97A 2PALA 1NX0A 4MRXA 1QVIY 2KHNA 2OS8B 3LL8B 5G08A 4QJ4B 4JQ0D 1PULA 1F4OA 1UURA 2LMTA 2CTNA 1YRUB 2JRFA 1A29A 1K93D 2A4JA 2NZ0A 3BOWB 5I2LA 1K9PA 1SCMB 3H4SE 4C0LA 1CDPA 3LK1A 1IJ6A 2LMVA 1QIWA 5JJGA 4OKHA 1J7OA 1FPWA 1MXLC 1B8CA 2MLEC 2V53A 1UHJA 2KI4B 1S1EA 2KAVA 2B1UA 1NCZA 3PN7C 1S5GY 1NWDA 1WLZA 3FWBA 1CFPA 3EK4A 4PALA 2HPSA 1YX8A 1M31A 1D1OA 1LKJA 2KFFA 1KFUS 1CFFA 2F3ZA 1KQVA 4MEWA 1SL8A 3HCMA 1PRWA 2LHLA 2LHIA 1SL7A 1YUUA 3NXAA 1SW8A 2I2RE 3VRRA 1KK7Z 1W7JB 1ZFSA 1XFVO 3SJSA 3E3RA 4PE0A 1M39A 2RGIA 4AOMA 2EGDA 3AKBA 4OVNF 4PHJA 1UHIA 2Y1MA 1TTXA 5TNCA 4CPVA 1L2OB 1PSRA 2BE4A 3TDIA 4FQOA 2JC2A 1TNWA 2L51A 5F6TA 3I5HC 4PE4A 1MHOA 1J1EA 3BQ3A 4BY5A 2NLNA 3BXKA 4JWQA 4TNCA 2HF5A 1CNPA 3LK0A 1RROA 2H61C 1OMRA 1UHKA 4ORAB 5HLVA 4OCIA 1SY9A 3SIAA 5I2OA 3BUNB 1WRZA 1MQ1A 2KOTA 1XFUO 2CBLA 3AAJA 4MZJA 5B8IB 3I5IC 3NSKA 2MHHA 3BUOB 4M2PA 3ZWHA 1BG1A 3CS1A 1EG4A 2KYCA 2LLSA 3F45A 3LLEA 1H8BA 1NCYA 2FOTA 3EKHA 1KQMC 2LUXA 2WC8A 2NCPA 4PDZA 1K2HA 1XFXO 1KFXL 1K94A 1J7PA 2JWWA 2JZIA 3TUYB 3ICBA 2QACA 2K7BA 1PVBA 2L0PA 4NDCA 1K96A 1N65A 3CR5X 1F8HA 1OSAA 1HQVA 2PMYA 2LVVA 4YGDB 3PSRA 4YBHB 2MAZA 3EVRA 5GQQC 5JOLA 4JPZB 2JTTA 2LVIA 1V1FA 1TOPA 3JTDC 2BBNA 4GAOA 4GFTA 4A4BA 1WRLA 4CLNA 1ZUZA 5CSFA 3TZ1A 4DS7A 1F71A 3PALA 2M9GA 2ZNDA 4QJ3B 1NUBA 2P6BB 5DKNA 1BJFA 1B4CA 1QLSA 4WQ3A 1L7ZA 2LNKA 2LP3A 5D69A 4OR9B 1B8LA 2LCPA 1S26D 1AJ4A 3WHTB 1A75A 3I5FC 2AUCA 2K8MB 4MZKA 1JFJA 2KGRA 4YGAA 3O78A 2BL0C 2KSPA 2ZKMX 4A4CA 1NX2A 1YRTB 1TCFA 2BE6A 2M7LA 5KU1A 4GGFA 3KEVA 3LCPC 1DJXA 2MJWB 1UUSA 2OTGC 4BY4A 3DF0B 4DUQA 3OHMB 1AUIB 2O5GA 1WRKA 3A4UB 4P2YB 2KYFA 1SR6B 2CNPA 4MBEA 2I94A 2DOQA 1FW4A 2L4HA 1YX7A 1VRKA 1IQ5A 4I5NB 1KFXS 1RJVA 1BODA 3BUMB 3FS7A 2G2BA 2LAPA 4F0ZB 1NSHA 4ORBB 1IJ5A 1F55A 2KAYA 1FI5A 2GGMA 4MLWA 2HETA 2ZN8A 1B7TZ 3PFVA 1SK6D 4XJKA 2R2IA 1DJZA 3BUWB 2E30A 1XYDA 1CLLA 2LUCA 2FCEA 1FF1A 1LINA 2M29A 4MZLA 2G9BA 2F2PA 2IS9A 4NDBA 5J3XA 1IKUA 2PVBA 1OE9B 1KWOB 1DVIA 2JNFA 3SG3A 2E6WA 1IG5A 2KBMA 3WXAA 1A03A 1WY9A 3FIAA 3DVMA 2WCFA 2EC6B 3SG5A 1M45A 3I5GB 3AKAA 1U5IB 3A8RA 1C07A
chains in the Genus database with same CATH superfamily
2BCAA 5DKRA 4PHKA 1B9AA 1CFDA 1NX1A 2M8UA 3CZ2A 3FE6A 4JKTA 4YGEB 1RWYA 4GGNA 4HRGA 1EJ3A 1HT9A 1MUXA 1NYAA 1ZOTB 3KF9A 3NSIA 2L5YA 2WNDA 2WCLA 3TS5C 1DQEA 1T14A 4MSPA 4N1FA 1SBJA 5HLOA 5HKWA 1BR4B 2ERBA 1DEKA 5DKQA 3D78A 1DJGA 5CSNA 2WCBA 3EK8A 1SRAA 2OS8C 1Z2CB 2WCKA 2Y1NA 2H2KA 3GK4X 5I94A 1C7VA 1JWDA 2KDHA 1JUOA 1WDCB 1F4QA 1RFJA 1QATA 4GPLB 1F54A 2JT3A 2JXLA 2OPOA 3V2LA 1CLBA 2JULA 2KGBC 2WCJA 2QEVA 2LVJA 4I5JA 3CR2A 2L5XB 3SG6A 3DYEA 1QTXA 3O4YA 1SCMC 2MRDA 1XFZO 5BPJA 3BOWA 2M49B 3MSEB 3SG4A 1YTZC 1TNQA 2P70A 4N1GA 1BOCA 3SS5A 1CTRA 2KI4C 2AMIA 2L98A 1DGVA 4IL1A 1NIWA 2MLFC 5PALA 5HKYA 3CZ0A 3D76A 1UWOA 1H4BA 2BKHB 4GNKB 1S36A 2KQYA 3RZSA 3B88A 1KK8C 3CR4X 3EK7A 1CDMA 1NPQA 2FCDA 2M0RA 3D77A 2KLEA 4YI8A 1Y1AA 1JF2A 1SSEB 1OOIX 4XYNA 1Y1XA 2KQ6A 3GK2A 5HL1A 1LXFC 1WLMA 2BKIB 2F33A 4M2OA 1OOFA 4AQIA 3DVKA 1QVIZ 2JOJA 2O60A 2JT8A 2VRGA 1B47A 2WCEA 2L2EA 3OP0A 4HSZA 1F70A 1KSMA 1QX7A 1IH0A 5AERA 4FQTA 4PE1A 2F2OA 1SYMA 5EL2A 5AANA 5I8NA 5AFPA 2WOSA 2TN4A 2K7CA 2LP2A 3CGAA 3JVTB 1L2OC 3NHTA 3OB2B 3C1VA 3D73A 3WNXB 1IIOA 2L2CA 3S0DA 2EHBA 1KK7Y 2GGZA 1TNPA 2I18A 5CSIA 1CKKA 4GGFC 1N0YA 5ER4X 1S6CA 3S0AA 1MXEA 3VGOA 1S5GZ 4NDDA 4UPGA 3BJHA 2KI6C 1OZSA 1YURA 4I5KA 3VRNA 3QRXA 5D7FA 1CM1A 3UNWA 3OB1B 4DCKA 1V1GA 1PK0D 2KFGA 1C7WA 1OMVA 4PHNA 2CT9A 3SIBA 4MVFA 3RM1A 1R6PA 2KNEA 3SG7A 2Y5IA 4ZCVA 3R1VA 1NP8A 2M1KB 3PN7B 3SS4A 3KO0A 3TUYC 2JTZA 3VRPA 3D0YB 1K90D 1XK4C 2BBMA 2K61A 3EVVA 5I2QA 2JQ6A 1GM0A 2ISDA 1JSAA 1DGUA 2WORA 1XK4A 2K60A 1GGZA 2LE9B 1K95A 1A4PA 4AQJA 1P28A 5FYXA 3FWCA 3OGNA 3CWGA 4CFRA 2JT0A 1K8UA 3PATA 2KAXA 3CZ1A 1M63B 4U8DA 1SMGA 2QEHA 2QDIA 1KSOA 3NGVA 3TS5B 1RTP1 3IVTA 2CCMA 1J1DA 1QJTA 5AXIA 4E68A 1OOGA 3NHIA 2LC5A 2HQ8A 1W7IB 1JF0A 5K89A 3QMEA 2KPHA 2Q91A 1DJWA 1BU3A 1DF0B 3EKJA 4M2QA 1J7QA 1XFWO 3DVJA 2FJYA 3I5HB 1BMOA 3M0WA 2P71A 3UO9A 1PSBA 5CSJA 4CIDA 2Q4UA 1KCYA 1N2DA 1SKTA 2KBIA 1DJYA 2LVKA 2KFHA 1K9KA 2JNXA 4WQ2A 4FTGA 5FI7A 4ZCUA 4F7FA 2BECA 1EXRA 3DF0A 1ALVA 1Z4HA 4Q04A 1DTLA 3CTNA 3I5IB 1IGVA 1ALWA 1G8IA 1GQMA 1IRJA 2CXJA 3CLNA 3PJIA 1K9UA 1SR6C 1M46A 1SPYA 3L47A 1KQMB 5CPVA 3NSOA 5AEQA 2WCHA 1Y6WA 3KHEA 2H8VA 5FI6A 2LLTA 2LMUA 2LV7A 2I7AA 1CMGA 3RLZA 1XFRA 4C0JA 3D0YA 1CMFA 1DT7B 1KK8B 1YUTA 1AK8A 4CFQA 2NXQA 2JU0A 1AHRA 1ZMZA 3CZTX 1TN4A 1XVJA 1EG3A 3O2PA 2HQWA 2AAOA 2K7OA 1AVSA 1TUJA 1YUSA 3TDUA 3VRQA 3BYAA 1TCOB 1S6JA 1X02A 3JTDB 4NQGA 4PT1A 1TIZA 4USLA 2K0JA 1YVHA 3SG2A 2F8PA 3IQOA 1DC1A 2L4IA 1KWOC 4DIRA 2PRUA 1RECA 1B7TY 4GBAA 1A75B 1ODBA 2LLUA 4ETOA 1FBVA 2EC6C 1DF0A 3I5GC 3I5FB 5ER5A 3K1EA 5IBWA 4PE7A 1Y0VH 1PVAA 1XA5A 2QEOA 1QX5B 2BL0B 2K7DA 1MF8B 2M7NA 4YGBB 3VROA 1DJIA 4YI9A 1TNXA 5KTYA 1SNLA 1B8RA 1U5IA 1OZOA 4YGCB 3TDZA 3GK1A 1ZACA 1B1GA 2OTGB 2H61A 1MWNA 3Q8IA 3PLFB 3AAKA 1SL9A 2D8NA 1GGWA 4N5XA 4HRHA 1LA0A 4GUKA 2M1UA 1TWOA 4R1EA 1AP4A 4PHMA 4QJ5B 1S3PA 1TUZA 1OOJA 3HX4A 3OX6A 4L9MA 1QLKA 3DVEA 4MRYA 1PALA 1CB1A 1CFCA 3IF7A 1FI6A 3K21A 3IQQA 2F3YA 1Q80A 2FJUB 3B7AA 1TRFA 2QPTA 2K2AA 2SCPA 4INXA 1WDCC 1A2XA 1LA3A 1NX3A 1GJYA 1OMDA 1BT6A 2ZNEA 4XJKB 1EH2A 1QXPA 1J7RA 3SS3A 1G33A 4OV2A 2Y4QA 5HKZA 1UHNA 2JXCA 1JFKA 1YR5A 1QX2A 4MN0A 1BF5A 1BLQA 1CLMA 1J55A 1QASA 3GOFA 1AJ5A 3NSLA 2SASA 4ICBA 1IQ3A 4YRUA 4OZDA 1IWQA 3EVUA 1OQPA 4DRWA 1SCVA 4D1EA 1XO5A 4PCWA 1MR8A 1E8AA 3D75A 2LM5A 2LANA 1CDLA 2NCOA 2MBXA 2JPTA 3OX5A 3OBVA 3FE9A 2L50A 5KSZA 2BCXA 1KFUL 1QS7A 1UP5A 1BR1B 4ORCB 1G4YR 4C0KA 1CDNA 2M3WA 1NCXA 2ZRTA 2KLDA 4HREE 2MA2A 1QV1A 1RK9A 2K2FA 3DD4A 2WC6A 3ZNIA 3WHUB 5FI2A 1OW4A 2COLB 1S6IA 3O6BA 1UHHA 3D10A 1JC2A 1Y1UA 2PASA 1R2UA 1DJHA 1XFYO 2GV5A 1LVCD 1CM4A 2KI6D 3KPXA 2ZRSA 3PM8A 4P5OE 1QIVA 3S0FA 1QV0A 2BCBA 3R72A 1YVLA 4I5LB 2ZFDA 3BUXB 3JVTC 1DMOA 1EL4A 1JBAA 4WRIA 2ZN9A 2PSRA 3FE8A 2BAPA 2M97A 2PALA 1NX0A 4MRXA 1QVIY 2KHNA 2OS8B 3LL8B 5G08A 4QJ4B 1C3ZA 4JQ0D 3S0EA 1PULA 1F4OA 1UURA 2LMTA 2CTNA 1YRUB 3B6XA 2JRFA 1A29A 1K93D 2A4JA 2NZ0A 3BOWB 5I2LA 1K9PA 1SCMB 3H4SE 4C0LA 1CDPA 3LK1A 1IJ6A 2LMVA 1QIWA 5JJGA 4OKHA 1J7OA 1FPWA 1MXLC 1B8CA 1W9ZA 2GTEA 1UHJA 2MLEC 2V53A 2KI4B 1S1EA 2KAVA 3CYZA 2B1UA 3B87A 1NCZA 3PN7C 1S5GY 1NWDA 3S0BA 1DELA 1WLZA 3FWBA 3EK4A 3L4AA 4PALA 2HPSA 1CFPA 1YX8A 1M31A 1D1OA 1LKJA 2KFFA 1KFUS 1CFFA 2F3ZA 1QWVA 1KQVA 4MEWA 1SL8A 3HCMA 1PRWA 2LHLA 2LHIA 1SL7A 1YUUA 3NXAA 1SW8A 2JPOA 2I2RE 3VRRA 4INWA 1KK7Z 1W7JB 1ZFSA 1XFVO 3SJSA 3E3RA 4PE0A 3B86A 1M39A 2RGIA 4AOMA 2EGDA 3AKBA 4OVNF 4PHJA 1UHIA 2Y1MA 1TTXA 5TNCA 4CPVA 1L2OB 1PSRA 2BE4A 3N7HA 4IJ7A 4FQOA 3TDIA 2JC2A 1TNWA 2L51A 5F6TA 3I5HC 4PE4A 5HYDA 1MHOA 1J1EA 3BQ3A 4BY5A 2NLNA 3BXKA 4JWQA 4TNCA 2HF5A 1CNPA 3LK0A 1RROA 2H61C 1OMRA 1UHKA 4ORAB 5HLVA 4OCIA 1SY9A 3SIAA 5I2OA 3BUNB 1WRZA 1MQ1A 2KOTA 1XFUO 2CBLA 3AAJA 4MZJA 5B8IB 3I5IC 3NSKA 2MHHA 3BUOB 4M2PA 3ZWHA 2WCMA 1BG1A 3CS1A 1EG4A 2KYCA 2LLSA 3F45A 3LLEA 3DZTA 3VB1A 5DICA 1H8BA 1NCYA 2FOTA 3EKHA 1KQMC 2LUXA 2WC8A 2NCPA 4PDZA 1K2HA 1XFXO 1KFXL 1K94A 3BFAA 1LS8A 1J7PA 2JWWA 2JZIA 3S0GA 3TUYB 3ICBA 3D74A 3PM2A 4JD9A 2QACA 2K7BA 1PVBA 2L0PA 4NDCA 1K96A 1N65A 3CR5X 1F8HA 1OSAA 1HQVA 2PMYA 2LVVA 4YGDB 3PSRA 4YBHB 2MAZA 3EVRA 5D3OA 5GQQC 5JOLA 4JPZB 2JTTA 2LVIA 1V1FA 1TOPA 3JTDC 2BBNA 3R1PA 4GAOA 4GFTA 4A4BA 1WRLA 4CLNA 1ZUZA 5CSFA 3TZ1A 4DS7A 1F71A 3PALA 2M9GA 2ZNDA 4QJ3B 1NUBA 2P6BB 5DKNA 1BJFA 1B4CA 1QLSA 4WQ3A 1L7ZA 2LNKA 2LP3A 5D69A 4OR9B 2PYQA 1B8LA 2LCPA 3R1OA 3DXLA 3BFBA 1S26D 1AJ4A 3O4XA 3WHTB 1A75A 3I5FC 2AUCA 2K8MB 4MZKA 1JFJA 2KGRA 4YGAA 3O78A 2BL0C 2KSPA 2ZKMX 4A4CA 1NX2A 1YRTB 1TCFA 2BE6A 2PQLA 2M7LA 5KU1A 4GGFA 3KEVA 3LCPC 1DJXA 2MJWB 3EG5B 1UUSA 2OTGC 4BY4A 2QEBA 2YGUA 3DF0B 4DUQA 3BFHA 3OHMB 1AUIB 2WC5A 2O5GA 1WRKA 3A4UB 4P2YB 1OOHA 2KYFA 1SR6B 2CNPA 4MBEA 2I94A 2DOQA 1FW4A 2L4HA 1YX7A 1VRKA 1IQ5A 4I5NB 1KFXS 1RJVA 4KYNA 1BODA 3BUMB 1ORGA 3FS7A 2G2BA 2LAPA 4F0ZB 1NSHA 3CABA 4ORBB 1IJ5A 1F55A 2KAYA 1FI5A 2GGMA 2BNXA 4MLWA 2HETA 2ZN8A 1B7TZ 3PFVA 1SK6D 4XJKA 2R2IA 1DJZA 3BUWB 2E30A 1XYDA 1CLLA 2LUCA 2FCEA 1FF1A 1LINA 2M29A 4MZLA 2G9BA 2F2PA 2IS9A 4NDBA 5J3XA 1IKUA 2PVBA 1OE9B 3DY9A 1KWOB 1DVIA 2JNFA 3SG3A 2E6WA 1IG5A 2KBMA 3WXAA 1A03A 1C3YA 1WY9A 3L4LA 3FIAA 3DVMA 2WCFA 2EC6B 3SG5A 1M45A 3CDNA 3I5GB 3AKAA 1U5IB 3A8RA 1C07A
chains in the Genus database with same CATH topology
2BCAA 5DKRA 4PHKA 1B9AA 1CFDA 1NX1A 2M8UA 4YGEB 1RWYA 4GGNA 4HRGA 1EJ3A 1HT9A 1MUXA 1NYAA 1ZOTB 3KF9A 3NSIA 2WNDA 3TS5C 4MSPA 4N1FA 1SBJA 5HLOA 5HKWA 1BR4B 5DKQA 1DJGA 5CSNA 2WCBA 3EK8A 1SRAA 2OS8C 2Y1NA 3GK4X 1C7VA 2H2KA 1JWDA 2KDHA 1JUOA 1WDCB 1F4QA 1RFJA 1QATA 4GPLB 1F54A 2JT3A 2JXLA 2OPOA 1CLBA 2JULA 2KGBC 4I5JA 2LVJA 3CR2A 2L5XB 3SG6A 3O4YA 1QTXA 1SCMC 2MRDA 1XFZO 5BPJA 3BOWA 2M49B 3MSEB 3SG4A 1YTZC 1TNQA 4N1GA 1BOCA 1CTRA 2KI4C 2AMIA 2L98A 1DGVA 4IL1A 1NIWA 2MLFC 5PALA 5HKYA 1UWOA 1H4BA 2BKHB 4GNKB 1S36A 2KQYA 1KK8C 3CR4X 3EK7A 1CDMA 1NPQA 2FCDA 2M0RA 4YI8A 1Y1AA 1JF2A 4XYNA 1Y1XA 2KQ6A 3GK2A 1LXFC 1WLMA 2BKIB 2F33A 4M2OA 4AQIA 3DVKA 1QVIZ 2JOJA 2O60A 2JT8A 2VRGA 1B47A 2WCEA 2L2EA 3OP0A 4HSZA 1F70A 1KSMA 1QX7A 1IH0A 5AERA 4PE1A 2F2OA 1SYMA 5AANA 5I8NA 5AFPA 2WOSA 2TN4A 2K7CA 2LP2A 3CGAA 3JVTB 1L2OC 3OB2B 3C1VA 3WNXB 2EHBA 1KK7Y 2GGZA 1TNPA 2I18A 5CSIA 1CKKA 4GGFC 1N0YA 5ER4X 1S6CA 1MXEA 3VGOA 1S5GZ 4NDDA 4UPGA 2KI6C 1OZSA 1YURA 4I5KA 3VRNA 3QRXA 5D7FA 1CM1A 3OB1B 4DCKA 1V1GA 1PK0D 2KFGA 1C7WA 1OMVA 4PHNA 2CT9A 3SIBA 4MVFA 3RM1A 1R6PA 2KNEA 3SG7A 2Y5IA 4ZCVA 1NP8A 2M1KB 3PN7B 3KO0A 3TUYC 2JTZA 3VRPA 3D0YB 1K90D 1XK4C 2BBMA 2K61A 3EVVA 5I2QA 2JQ6A 2ISDA 1JSAA 1DGUA 2WORA 1XK4A 2LE9B 1GGZA 1K95A 1A4PA 4AQJA 5FYXA 3FWCA 3CWGA 4CFRA 2JT0A 1K8UA 3PATA 2KAXA 1M63B 4U8DA 1SMGA 1KSOA 3TS5B 1RTP1 2CCMA 1J1DA 1QJTA 5AXIA 4E68A 2LC5A 2HQ8A 1W7IB 1JF0A 5K89A 2Q91A 1DJWA 1BU3A 1DF0B 3EKJA 4M2QA 1J7QA 1XFWO 3DVJA 3M0WA 3I5HB 1BMOA 1PSBA 5CSJA 4CIDA 2Q4UA 1KCYA 1N2DA 1SKTA 2KBIA 1DJYA 2LVKA 2KFHA 1K9KA 2JNXA 4WQ2A 4FTGA 4ZCUA 2BECA 1EXRA 3DF0A 1ALVA 4Q04A 1DTLA 3CTNA 3I5IB 1IGVA 1ALWA 1G8IA 1GQMA 1IRJA 2CXJA 3CLNA 1K9UA 1SR6C 1M46A 1SPYA 1KQMB 5CPVA 3NSOA 5AEQA 1Y6WA 3KHEA 2LLTA 2LMUA 2LV7A 2I7AA 1CMGA 3RLZA 4C0JA 1CMFA 3D0YA 1DT7B 1KK8B 1YUTA 1AK8A 4CFQA 2NXQA 2JU0A 1AHRA 1ZMZA 3CZTX 1TN4A 1XVJA 1EG3A 3O2PA 2HQWA 2AAOA 2K7OA 1AVSA 1YUSA 3TDUA 3VRQA 3BYAA 1TCOB 1S6JA 1X02A 3JTDB 4NQGA 1TIZA 4USLA 2K0JA 1YVHA 3SG2A 2F8PA 3IQOA 2L4IA 1KWOC 4DIRA 2PRUA 1RECA 1B7TY 4GBAA 1A75B 1ODBA 2LLUA 4ETOA 1FBVA 2EC6C 1DF0A 3I5GC 3I5FB 5ER5A 5IBWA 4PE7A 1Y0VH 1PVAA 1XA5A 5HYDA 1QX5B 2BL0B 2K7DA 1MF8B 2M7NA 4YGBB 3VROA 1DJIA 4YI9A 1TNXA 5KTYA 1SNLA 1B8RA 1U5IA 1OZOA 4YGCB 3TDZA 3GK1A 1ZACA 1B1GA 2OTGB 2H61A 1MWNA 3PLFB 3AAKA 1SL9A 2D8NA 1GGWA 4N5XA 4HRHA 1LA0A 4GUKA 2M1UA 4R1EA 1AP4A 4PHMA 4QJ5B 1S3PA 1OOJA 3HX4A 3OX6A 4L9MA 1QLKA 3DVEA 4MRYA 1PALA 1CB1A 1CFCA 3IF7A 1FI6A 3K21A 3IQQA 2F3YA 1Q80A 2FJUB 1TRFA 2QPTA 2K2AA 2SCPA 1WDCC 1A2XA 1LA3A 1NX3A 1GJYA 1OMDA 1BT6A 2ZNEA 4XJKB 1EH2A 1QXPA 1J7RA 1G33A 4OV2A 2Y4QA 5HKZA 1UHNA 2JXCA 1JFKA 1YR5A 1QX2A 4MN0A 1BF5A 1BLQA 1CLMA 1J55A 1QASA 3GOFA 1AJ5A 3NSLA 2SASA 4ICBA 1IQ3A 4YRUA 1IWQA 3EVUA 1OQPA 4DRWA 1SCVA 4D1EA 1XO5A 4PCWA 1MR8A 1E8AA 2LM5A 2LANA 1CDLA 2NCOA 2MBXA 2JPTA 3OX5A 2L50A 5KSZA 2BCXA 1KFUL 1QS7A 1UP5A 1BR1B 4ORCB 1G4YR 4C0KA 1CDNA 2M3WA 1NCXA 2ZRTA 4HREE 2MA2A 1QV1A 1RK9A 2K2FA 3DD4A 3ZNIA 3WHUB 2COLB 1S6IA 3O6BA 1UHHA 3D10A 1JC2A 1Y1UA 2PASA 1R2UA 1DJHA 1XFYO 2GV5A 1LVCD 1CM4A 2KI6D 3KPXA 2ZRSA 3PM8A 4P5OE 1QIVA 1QV0A 2BCBA 1YVLA 4I5LB 2ZFDA 3BUXB 3JVTC 1DMOA 1EL4A 1JBAA 4WRIA 2ZN9A 2PSRA 2M97A 2PALA 1NX0A 4MRXA 1QVIY 2KHNA 2OS8B 3LL8B 5G08A 4QJ4B 4JQ0D 1PULA 1F4OA 1UURA 2LMTA 2CTNA 1YRUB 2JRFA 1A29A 1K93D 2A4JA 2NZ0A 3BOWB 5I2LA 1K9PA 1SCMB 3H4SE 4C0LA 1CDPA 3LK1A 1IJ6A 2LMVA 1QIWA 5JJGA 4OKHA 1J7OA 1FPWA 1MXLC 1B8CA 2MLEC 2V53A 1UHJA 2KI4B 1S1EA 2KAVA 2B1UA 1NCZA 3PN7C 1S5GY 1NWDA 1WLZA 3FWBA 1CFPA 3EK4A 4PALA 2HPSA 1YX8A 1M31A 1D1OA 1LKJA 2KFFA 1KFUS 1CFFA 2F3ZA 1KQVA 4MEWA 1SL8A 3HCMA 1PRWA 2LHLA 2LHIA 1SL7A 1YUUA 3NXAA 1SW8A 2I2RE 3VRRA 1KK7Z 1W7JB 1ZFSA 1XFVO 3SJSA 3E3RA 4PE0A 1M39A 2RGIA 4AOMA 2EGDA 3AKBA 4OVNF 4PHJA 1UHIA 2Y1MA 1TTXA 5TNCA 4CPVA 1L2OB 1PSRA 2BE4A 3TDIA 4FQOA 2JC2A 1TNWA 2L51A 5F6TA 3I5HC 4PE4A 1MHOA 1J1EA 3BQ3A 4BY5A 2NLNA 3BXKA 4JWQA 4TNCA 2HF5A 1CNPA 3LK0A 1RROA 2H61C 1OMRA 1UHKA 4ORAB 5HLVA 4OCIA 1SY9A 3SIAA 5I2OA 3BUNB 1WRZA 1MQ1A 2KOTA 1XFUO 2CBLA 3AAJA 4MZJA 5B8IB 3I5IC 3NSKA 2MHHA 3BUOB 4M2PA 3ZWHA 1BG1A 3CS1A 1EG4A 2KYCA 2LLSA 3F45A 3LLEA 1H8BA 1NCYA 2FOTA 3EKHA 1KQMC 2LUXA 2WC8A 2NCPA 4PDZA 1K2HA 1XFXO 1KFXL 1K94A 1J7PA 2JWWA 2JZIA 3TUYB 3ICBA 2QACA 2K7BA 1PVBA 2L0PA 4NDCA 1K96A 1N65A 3CR5X 1F8HA 1OSAA 1HQVA 2PMYA 2LVVA 4YGDB 3PSRA 4YBHB 2MAZA 3EVRA 5GQQC 5JOLA 4JPZB 2JTTA 2LVIA 1V1FA 1TOPA 3JTDC 2BBNA 4GAOA 4GFTA 4A4BA 1WRLA 4CLNA 1ZUZA 5CSFA 3TZ1A 4DS7A 1F71A 3PALA 2M9GA 2ZNDA 4QJ3B 1NUBA 2P6BB 5DKNA 1BJFA 1B4CA 1QLSA 4WQ3A 1L7ZA 2LNKA 2LP3A 5D69A 4OR9B 1B8LA 2LCPA 1S26D 1AJ4A 3WHTB 1A75A 3I5FC 2AUCA 2K8MB 4MZKA 1JFJA 2KGRA 4YGAA 3O78A 2BL0C 2KSPA 2ZKMX 4A4CA 1NX2A 1YRTB 1TCFA 2BE6A 2M7LA 5KU1A 4GGFA 3KEVA 3LCPC 1DJXA 2MJWB 1UUSA 2OTGC 4BY4A 3DF0B 4DUQA 3OHMB 1AUIB 2O5GA 1WRKA 3A4UB 4P2YB 2KYFA 1SR6B 2CNPA 4MBEA 2I94A 2DOQA 1FW4A 2L4HA 1YX7A 1VRKA 1IQ5A 4I5NB 1KFXS 1RJVA 1BODA 3BUMB 3FS7A 2G2BA 2LAPA 4F0ZB 1NSHA 4ORBB 1IJ5A 1F55A 2KAYA 1FI5A 2GGMA 4MLWA 2HETA 2ZN8A 1B7TZ 3PFVA 1SK6D 4XJKA 2R2IA 1DJZA 3BUWB 2E30A 1XYDA 1CLLA 2LUCA 2FCEA 1FF1A 1LINA 2M29A 4MZLA 2G9BA 2F2PA 2IS9A 4NDBA 5J3XA 1IKUA 2PVBA 1OE9B 1KWOB 1DVIA 2JNFA 3SG3A 2E6WA 1IG5A 2KBMA 3WXAA 1A03A 1WY9A 3FIAA 3DVMA 2WCFA 2EC6B 3SG5A 1M45A 3I5GB 3AKAA 1U5IB 3A8RA 1C07A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BCA A;  5DKR A;  4PHK A;  1B9A A;  1CFD A;  1NX1 A;  2M8U A;  4YGE B;  1RWY A;  4GGN A;  4HRG A;  1EJ3 A;  1HT9 A;  1MUX A;  1NYA A;  1ZOT B;  3KF9 A;  3NSI A;  2WND A;  3TS5 C;  4MSP A;  4N1F A;  1SBJ A;  5HLO A;  5HKW A;  1BR4 B;  5DKQ A;  1DJG A;  5CSN A;  2WCB A;  3EK8 A;  1SRA A;  2OS8 C;  2Y1N A;  3GK4 X;  1C7V A;  2H2K A;  1JWD A;  2KDH A;  1JUO A;  1WDC B;  1F4Q A;  1RFJ A;  1QAT A;  4GPL B;  1F54 A;  2JT3 A;  2JXL A;  2OPO A;  1CLB A;  2JUL A;  2KGB C;  4I5J A;  2LVJ A;  3CR2 A;  2L5X B;  3SG6 A;  3O4Y A;  1QTX A;  1SCM C;  2MRD A;  1XFZ O;  5BPJ A;  3BOW A;  2M49 B;  3MSE B;  3SG4 A;  1YTZ C;  1TNQ A;  4N1G A;  1BOC A;  1CTR A;  2KI4 C;  2AMI A;  2L98 A;  1DGV A;  4IL1 A;  1NIW A;  2MLF C;  5PAL A;  5HKY A;  1UWO A;  1H4B A;  2BKH B;  4GNK B;  1S36 A;  2KQY A;  1KK8 C;  3CR4 X;  3EK7 A;  1CDM A;  1NPQ A;  2FCD A;  2M0R A;  4YI8 A;  1Y1A A;  1JF2 A;  4XYN A;  1Y1X A;  2KQ6 A;  3GK2 A;  1LXF C;  1WLM A;  2BKI B;  2F33 A;  4M2O A;  4AQI A;  3DVK A;  1QVI Z;  2JOJ A;  2O60 A;  2JT8 A;  2VRG A;  1B47 A;  2WCE A;  2L2E A;  3OP0 A;  4HSZ A;  1F70 A;  1KSM A;  1QX7 A;  1IH0 A;  5AER A;  4PE1 A;  2F2O A;  1SYM A;  5AAN A;  5I8N A;  5AFP A;  2WOS A;  2TN4 A;  2K7C A;  2LP2 A;  3CGA A;  3JVT B;  1L2O C;  3OB2 B;  3C1V A;  3WNX B;  2EHB A;  1KK7 Y;  2GGZ A;  1TNP A;  2I18 A;  5CSI A;  1CKK A;  4GGF C;  1N0Y A;  5ER4 X;  1S6C A;  1MXE A;  3VGO A;  1S5G Z;  4NDD A;  4UPG A;  2KI6 C;  1OZS A;  1YUR A;  4I5K A;  3VRN A;  3QRX A;  5D7F A;  1CM1 A;  3OB1 B;  4DCK A;  1V1G A;  1PK0 D;  2KFG A;  1C7W A;  1OMV A;  4PHN A;  2CT9 A;  3SIB A;  4MVF A;  3RM1 A;  1R6P A;  2KNE A;  3SG7 A;  2Y5I A;  4ZCV A;  1NP8 A;  2M1K B;  3PN7 B;  3KO0 A;  3TUY C;  2JTZ A;  3VRP A;  3D0Y B;  1K90 D;  1XK4 C;  2BBM A;  2K61 A;  3EVV A;  5I2Q A;  2JQ6 A;  2ISD A;  1JSA A;  1DGU A;  2WOR A;  1XK4 A;  2LE9 B;  1GGZ A;  1K95 A;  1A4P A;  4AQJ A;  5FYX A;  3FWC A;  3CWG A;  4CFR A;  2JT0 A;  1K8U A;  3PAT A;  2KAX A;  1M63 B;  4U8D A;  1SMG A;  1KSO A;  3TS5 B;  1RTP 1;  2CCM A;  1J1D A;  1QJT A;  5AXI A;  4E68 A;  2LC5 A;  2HQ8 A;  1W7I B;  1JF0 A;  5K89 A;  2Q91 A;  1DJW A;  1BU3 A;  1DF0 B;  3EKJ A;  4M2Q A;  1J7Q A;  1XFW O;  3DVJ A;  3M0W A;  3I5H B;  1BMO A;  1PSB A;  5CSJ A;  4CID A;  2Q4U A;  1KCY A;  1N2D A;  1SKT A;  2KBI A;  1DJY A;  2LVK A;  2KFH A;  1K9K A;  2JNX A;  4WQ2 A;  4FTG A;  4ZCU A;  2BEC A;  1EXR A;  3DF0 A;  1ALV A;  4Q04 A;  1DTL A;  3CTN A;  3I5I B;  1IGV A;  1ALW A;  1G8I A;  1GQM A;  1IRJ A;  2CXJ A;  3CLN A;  1K9U A;  1SR6 C;  1M46 A;  1SPY A;  1KQM B;  5CPV A;  3NSO A;  5AEQ A;  1Y6W A;  3KHE A;  2LLT A;  2LMU A;  2LV7 A;  2I7A A;  1CMG A;  3RLZ A;  4C0J A;  1CMF A;  3D0Y A;  1DT7 B;  1KK8 B;  1YUT A;  1AK8 A;  4CFQ A;  2NXQ A;  2JU0 A;  1AHR A;  1ZMZ A;  3CZT X;  1TN4 A;  1XVJ A;  1EG3 A;  3O2P A;  2HQW A;  2AAO A;  2K7O A;  1AVS A;  1YUS A;  3TDU A;  3VRQ A;  3BYA A;  1TCO B;  1S6J A;  1X02 A;  3JTD B;  4NQG A;  1TIZ A;  4USL A;  2K0J A;  1YVH A;  3SG2 A;  2F8P A;  3IQO A;  2L4I A;  1KWO C;  4DIR A;  2PRU A;  1REC A;  1B7T Y;  4GBA A;  1A75 B;  1ODB A;  2LLU A;  4ETO A;  1FBV A;  2EC6 C;  1DF0 A;  3I5G C;  3I5F B;  5ER5 A;  5IBW A;  4PE7 A;  1Y0V H;  1PVA A;  1XA5 A;  5HYD A;  1QX5 B;  2BL0 B;  2K7D A;  1MF8 B;  2M7N A;  4YGB B;  3VRO A;  1DJI A;  4YI9 A;  1TNX A;  5KTY A;  1SNL A;  1B8R A;  1U5I A;  1OZO A;  4YGC B;  3TDZ A;  3GK1 A;  1ZAC A;  1B1G A;  2OTG B;  2H61 A;  1MWN A;  3PLF B;  3AAK A;  1SL9 A;  2D8N A;  1GGW A;  4N5X A;  4HRH A;  1LA0 A;  4GUK A;  2M1U A;  4R1E A;  1AP4 A;  4PHM A;  4QJ5 B;  1S3P A;  1OOJ A;  3HX4 A;  3OX6 A;  4L9M A;  1QLK A;  3DVE A;  4MRY A;  1PAL A;  1CB1 A;  1CFC A;  3IF7 A;  1FI6 A;  3K21 A;  3IQQ A;  2F3Y A;  1Q80 A;  2FJU B;  1TRF A;  2QPT A;  2K2A A;  2SCP A;  1WDC C;  1A2X A;  1LA3 A;  1NX3 A;  1GJY A;  1OMD A;  1BT6 A;  2ZNE A;  4XJK B;  1EH2 A;  1QXP A;  1J7R A;  1G33 A;  4OV2 A;  2Y4Q A;  5HKZ A;  1UHN A;  2JXC A;  1JFK A;  1YR5 A;  1QX2 A;  4MN0 A;  1BF5 A;  1BLQ A;  1CLM A;  1J55 A;  1QAS A;  3GOF A;  1AJ5 A;  3NSL A;  2SAS A;  4ICB A;  1IQ3 A;  4YRU A;  1IWQ A;  3EVU A;  1OQP A;  4DRW A;  1SCV A;  4D1E A;  1XO5 A;  4PCW A;  1MR8 A;  1E8A A;  2LM5 A;  2LAN A;  1CDL A;  2NCO A;  2MBX A;  2JPT A;  3OX5 A;  2L50 A;  5KSZ A;  2BCX A;  1KFU L;  1QS7 A;  1UP5 A;  1BR1 B;  4ORC B;  1G4Y R;  4C0K A;  1CDN A;  2M3W A;  1NCX A;  2ZRT A;  4HRE E;  2MA2 A;  1QV1 A;  1RK9 A;  2K2F A;  3DD4 A;  3ZNI A;  3WHU B;  2COL B;  1S6I A;  3O6B A;  1UHH A;  3D10 A;  1JC2 A;  1Y1U A;  2PAS A;  1R2U A;  1DJH A;  1XFY O;  2GV5 A;  1LVC D;  1CM4 A;  2KI6 D;  3KPX A;  2ZRS A;  3PM8 A;  4P5O E;  1QIV A;  1QV0 A;  2BCB A;  1YVL A;  4I5L B;  2ZFD A;  3BUX B;  3JVT C;  1DMO A;  1EL4 A;  1JBA A;  4WRI A;  2ZN9 A;  2PSR A;  2M97 A;  2PAL A;  1NX0 A;  4MRX A;  1QVI Y;  2KHN A;  2OS8 B;  3LL8 B;  5G08 A;  4QJ4 B;  4JQ0 D;  1PUL A;  1F4O A;  1UUR A;  2LMT A;  2CTN A;  1YRU B;  2JRF A;  1A29 A;  1K93 D;  2A4J A;  2NZ0 A;  3BOW B;  5I2L A;  1K9P A;  1SCM B;  3H4S E;  4C0L A;  1CDP A;  3LK1 A;  1IJ6 A;  2LMV A;  1QIW A;  5JJG A;  4OKH A;  1J7O A;  1FPW A;  1MXL C;  1B8C A;  2MLE C;  2V53 A;  1UHJ A;  2KI4 B;  1S1E A;  2KAV A;  2B1U A;  1NCZ A;  3PN7 C;  1S5G Y;  1NWD A;  1WLZ A;  3FWB A;  1CFP A;  3EK4 A;  4PAL A;  2HPS A;  1YX8 A;  1M31 A;  1D1O A;  1LKJ A;  2KFF A;  1KFU S;  1CFF A;  2F3Z A;  1KQV A;  4MEW A;  1SL8 A;  3HCM A;  1PRW A;  2LHL A;  2LHI A;  1SL7 A;  1YUU A;  3NXA A;  1SW8 A;  2I2R E;  3VRR A;  1KK7 Z;  1W7J B;  1ZFS A;  1XFV O;  3SJS A;  3E3R A;  4PE0 A;  1M39 A;  2RGI A;  4AOM A;  2EGD A;  3AKB A;  4OVN F;  4PHJ A;  1UHI A;  2Y1M A;  1TTX A;  5TNC A;  4CPV A;  1L2O B;  1PSR A;  2BE4 A;  3TDI A;  4FQO A;  2JC2 A;  1TNW A;  2L51 A;  5F6T A;  3I5H C;  4PE4 A;  1MHO A;  1J1E A;  3BQ3 A;  4BY5 A;  2NLN A;  3BXK A;  4JWQ A;  4TNC A;  2HF5 A;  1CNP A;  3LK0 A;  1RRO A;  2H61 C;  1OMR A;  1UHK A;  4ORA B;  5HLV A;  4OCI A;  1SY9 A;  3SIA A;  5I2O A;  3BUN B;  1WRZ A;  1MQ1 A;  2KOT A;  1XFU O;  2CBL A;  3AAJ A;  4MZJ A;  5B8I B;  3I5I C;  3NSK A;  2MHH A;  3BUO B;  4M2P A;  3ZWH A;  1BG1 A;  3CS1 A;  1EG4 A;  2KYC A;  2LLS A;  3F45 A;  3LLE A;  1H8B A;  1NCY A;  2FOT A;  3EKH A;  1KQM C;  2LUX A;  2WC8 A;  2NCP A;  4PDZ A;  1K2H A;  1XFX O;  1KFX L;  1K94 A;  1J7P A;  2JWW A;  2JZI A;  3TUY B;  3ICB A;  2QAC A;  2K7B A;  1PVB A;  2L0P A;  4NDC A;  1K96 A;  1N65 A;  3CR5 X;  1F8H A;  1OSA A;  1HQV A;  2PMY A;  2LVV A;  4YGD B;  3PSR A;  4YBH B;  2MAZ A;  3EVR A;  5GQQ C;  5JOL A;  4JPZ B;  2JTT A;  2LVI A;  1V1F A;  1TOP A;  3JTD C;  2BBN A;  4GAO A;  4GFT A;  4A4B A;  1WRL A;  4CLN A;  1ZUZ A;  5CSF A;  3TZ1 A;  4DS7 A;  1F71 A;  3PAL A;  2M9G A;  2ZND A;  4QJ3 B;  1NUB A;  2P6B B;  5DKN A;  1BJF A;  1B4C A;  1QLS A;  4WQ3 A;  1L7Z A;  2LNK A;  2LP3 A;  5D69 A;  4OR9 B;  1B8L A;  2LCP A;  1S26 D;  1AJ4 A;  3WHT B;  1A75 A;  3I5F C;  2AUC A;  2K8M B;  4MZK A;  1JFJ A;  2KGR A;  4YGA A;  3O78 A;  2BL0 C;  2KSP A;  2ZKM X;  4A4C A;  1NX2 A;  1YRT B;  1TCF A;  2BE6 A;  2M7L A;  5KU1 A;  4GGF A;  3KEV A;  3LCP C;  1DJX A;  2MJW B;  1UUS A;  2OTG C;  4BY4 A;  3DF0 B;  4DUQ A;  3OHM B;  1AUI B;  2O5G A;  1WRK A;  3A4U B;  4P2Y B;  2KYF A;  1SR6 B;  2CNP A;  4MBE A;  2I94 A;  2DOQ A;  1FW4 A;  2L4H A;  1YX7 A;  1VRK A;  1IQ5 A;  4I5N B;  1KFX S;  1RJV A;  1BOD A;  3BUM B;  3FS7 A;  2G2B A;  2LAP A;  4F0Z B;  1NSH A;  4ORB B;  1IJ5 A;  1F55 A;  2KAY A;  1FI5 A;  2GGM A;  4MLW A;  2HET A;  2ZN8 A;  1B7T Z;  3PFV A;  1SK6 D;  4XJK A;  2R2I A;  1DJZ A;  3BUW B;  2E30 A;  1XYD A;  1CLL A;  2LUC A;  2FCE A;  1FF1 A;  1LIN A;  2M29 A;  4MZL A;  2G9B A;  2F2P A;  2IS9 A;  4NDB A;  5J3X A;  1IKU A;  2PVB A;  1OE9 B;  1KWO B;  1DVI A;  2JNF A;  3SG3 A;  2E6W A;  1IG5 A;  2KBM A;  3WXA A;  1A03 A;  1WY9 A;  3FIA A;  3DVM A;  2WCF A;  2EC6 B;  3SG5 A;  1M45 A;  3I5G B;  3AKA A;  1U5I B;  3A8R A;  1C07 A; 
#chains in the Genus database with same CATH topology
 2BCA A;  5DKR A;  4PHK A;  1B9A A;  1CFD A;  1NX1 A;  2M8U A;  3CZ2 A;  3FE6 A;  4JKT A;  4YGE B;  1RWY A;  4GGN A;  4HRG A;  1EJ3 A;  1HT9 A;  1MUX A;  1NYA A;  1ZOT B;  3KF9 A;  3NSI A;  2L5Y A;  2WND A;  2WCL A;  3TS5 C;  1DQE A;  1T14 A;  4MSP A;  4N1F A;  1SBJ A;  5HLO A;  5HKW A;  1BR4 B;  2ERB A;  1DEK A;  5DKQ A;  3D78 A;  1DJG A;  5CSN A;  2WCB A;  3EK8 A;  1SRA A;  2OS8 C;  1Z2C B;  2WCK A;  2Y1N A;  2H2K A;  3GK4 X;  5I94 A;  1C7V A;  1JWD A;  2KDH A;  1JUO A;  1WDC B;  1F4Q A;  1RFJ A;  1QAT A;  4GPL B;  1F54 A;  2JT3 A;  2JXL A;  2OPO A;  3V2L A;  1CLB A;  2JUL A;  2KGB C;  2WCJ A;  2QEV A;  2LVJ A;  4I5J A;  3CR2 A;  2L5X B;  3SG6 A;  3DYE A;  1QTX A;  3O4Y A;  1SCM C;  2MRD A;  1XFZ O;  5BPJ A;  3BOW A;  2M49 B;  3MSE B;  3SG4 A;  1YTZ C;  1TNQ A;  2P70 A;  4N1G A;  1BOC A;  3SS5 A;  1CTR A;  2KI4 C;  2AMI A;  2L98 A;  1DGV A;  4IL1 A;  1NIW A;  2MLF C;  5PAL A;  5HKY A;  3CZ0 A;  3D76 A;  1UWO A;  1H4B A;  2BKH B;  4GNK B;  1S36 A;  2KQY A;  3RZS A;  3B88 A;  1KK8 C;  3CR4 X;  3EK7 A;  1CDM A;  1NPQ A;  2FCD A;  2M0R A;  3D77 A;  2KLE A;  4YI8 A;  1Y1A A;  1JF2 A;  1SSE B;  1OOI X;  4XYN A;  1Y1X A;  2KQ6 A;  3GK2 A;  5HL1 A;  1LXF C;  1WLM A;  2BKI B;  2F33 A;  4M2O A;  1OOF A;  4AQI A;  3DVK A;  1QVI Z;  2JOJ A;  2O60 A;  2JT8 A;  2VRG A;  1B47 A;  2WCE A;  2L2E A;  3OP0 A;  4HSZ A;  1F70 A;  1KSM A;  1QX7 A;  1IH0 A;  5AER A;  4FQT A;  4PE1 A;  2F2O A;  1SYM A;  5EL2 A;  5AAN A;  5I8N A;  5AFP A;  2WOS A;  2TN4 A;  2K7C A;  2LP2 A;  3CGA A;  3JVT B;  1L2O C;  3NHT A;  3OB2 B;  3C1V A;  3D73 A;  3WNX B;  1IIO A;  2L2C A;  3S0D A;  2EHB A;  1KK7 Y;  2GGZ A;  1TNP A;  2I18 A;  5CSI A;  1CKK A;  4GGF C;  1N0Y A;  5ER4 X;  1S6C A;  3S0A A;  1MXE A;  3VGO A;  1S5G Z;  4NDD A;  4UPG A;  3BJH A;  2KI6 C;  1OZS A;  1YUR A;  4I5K A;  3VRN A;  3QRX A;  5D7F A;  1CM1 A;  3UNW A;  3OB1 B;  4DCK A;  1V1G A;  1PK0 D;  2KFG A;  1C7W A;  1OMV A;  4PHN A;  2CT9 A;  3SIB A;  4MVF A;  3RM1 A;  1R6P A;  2KNE A;  3SG7 A;  2Y5I A;  4ZCV A;  3R1V A;  1NP8 A;  2M1K B;  3PN7 B;  3SS4 A;  3KO0 A;  3TUY C;  2JTZ A;  3VRP A;  3D0Y B;  1K90 D;  1XK4 C;  2BBM A;  2K61 A;  3EVV A;  5I2Q A;  2JQ6 A;  1GM0 A;  2ISD A;  1JSA A;  1DGU A;  2WOR A;  1XK4 A;  2K60 A;  1GGZ A;  2LE9 B;  1K95 A;  1A4P A;  4AQJ A;  1P28 A;  5FYX A;  3FWC A;  3OGN A;  3CWG A;  4CFR A;  2JT0 A;  1K8U A;  3PAT A;  2KAX A;  3CZ1 A;  1M63 B;  4U8D A;  1SMG A;  2QEH A;  2QDI A;  1KSO A;  3NGV A;  3TS5 B;  1RTP 1;  3IVT A;  2CCM A;  1J1D A;  1QJT A;  5AXI A;  4E68 A;  1OOG A;  3NHI A;  2LC5 A;  2HQ8 A;  1W7I B;  1JF0 A;  5K89 A;  3QME A;  2KPH A;  2Q91 A;  1DJW A;  1BU3 A;  1DF0 B;  3EKJ A;  4M2Q A;  1J7Q A;  1XFW O;  3DVJ A;  2FJY A;  3I5H B;  1BMO A;  3M0W A;  2P71 A;  3UO9 A;  1PSB A;  5CSJ A;  4CID A;  2Q4U A;  1KCY A;  1N2D A;  1SKT A;  2KBI A;  1DJY A;  2LVK A;  2KFH A;  1K9K A;  2JNX A;  4WQ2 A;  4FTG A;  5FI7 A;  4ZCU A;  4F7F A;  2BEC A;  1EXR A;  3DF0 A;  1ALV A;  1Z4H A;  4Q04 A;  1DTL A;  3CTN A;  3I5I B;  1IGV A;  1ALW A;  1G8I A;  1GQM A;  1IRJ A;  2CXJ A;  3CLN A;  3PJI A;  1K9U A;  1SR6 C;  1M46 A;  1SPY A;  3L47 A;  1KQM B;  5CPV A;  3NSO A;  5AEQ A;  2WCH A;  1Y6W A;  3KHE A;  2H8V A;  5FI6 A;  2LLT A;  2LMU A;  2LV7 A;  2I7A A;  1CMG A;  3RLZ A;  1XFR A;  4C0J A;  3D0Y A;  1CMF A;  1DT7 B;  1KK8 B;  1YUT A;  1AK8 A;  4CFQ A;  2NXQ A;  2JU0 A;  1AHR A;  1ZMZ A;  3CZT X;  1TN4 A;  1XVJ A;  1EG3 A;  3O2P A;  2HQW A;  2AAO A;  2K7O A;  1AVS A;  1TUJ A;  1YUS A;  3TDU A;  3VRQ A;  3BYA A;  1TCO B;  1S6J A;  1X02 A;  3JTD B;  4NQG A;  4PT1 A;  1TIZ A;  4USL A;  2K0J A;  1YVH A;  3SG2 A;  2F8P A;  3IQO A;  1DC1 A;  2L4I A;  1KWO C;  4DIR A;  2PRU A;  1REC A;  1B7T Y;  4GBA A;  1A75 B;  1ODB A;  2LLU A;  4ETO A;  1FBV A;  2EC6 C;  1DF0 A;  3I5G C;  3I5F B;  5ER5 A;  3K1E A;  5IBW A;  4PE7 A;  1Y0V H;  1PVA A;  1XA5 A;  2QEO A;  1QX5 B;  2BL0 B;  2K7D A;  1MF8 B;  2M7N A;  4YGB B;  3VRO A;  1DJI A;  4YI9 A;  1TNX A;  5KTY A;  1SNL A;  1B8R A;  1U5I A;  1OZO A;  4YGC B;  3TDZ A;  3GK1 A;  1ZAC A;  1B1G A;  2OTG B;  2H61 A;  1MWN A;  3Q8I A;  3PLF B;  3AAK A;  1SL9 A;  2D8N A;  1GGW A;  4N5X A;  4HRH A;  1LA0 A;  4GUK A;  2M1U A;  1TWO A;  4R1E A;  1AP4 A;  4PHM A;  4QJ5 B;  1S3P A;  1TUZ A;  1OOJ A;  3HX4 A;  3OX6 A;  4L9M A;  1QLK A;  3DVE A;  4MRY A;  1PAL A;  1CB1 A;  1CFC A;  3IF7 A;  1FI6 A;  3K21 A;  3IQQ A;  2F3Y A;  1Q80 A;  2FJU B;  3B7A A;  1TRF A;  2QPT A;  2K2A A;  2SCP A;  4INX A;  1WDC C;  1A2X A;  1LA3 A;  1NX3 A;  1GJY A;  1OMD A;  1BT6 A;  2ZNE A;  4XJK B;  1EH2 A;  1QXP A;  1J7R A;  3SS3 A;  1G33 A;  4OV2 A;  2Y4Q A;  5HKZ A;  1UHN A;  2JXC A;  1JFK A;  1YR5 A;  1QX2 A;  4MN0 A;  1BF5 A;  1BLQ A;  1CLM A;  1J55 A;  1QAS A;  3GOF A;  1AJ5 A;  3NSL A;  2SAS A;  4ICB A;  1IQ3 A;  4YRU A;  4OZD A;  1IWQ A;  3EVU A;  1OQP A;  4DRW A;  1SCV A;  4D1E A;  1XO5 A;  4PCW A;  1MR8 A;  1E8A A;  3D75 A;  2LM5 A;  2LAN A;  1CDL A;  2NCO A;  2MBX A;  2JPT A;  3OX5 A;  3OBV A;  3FE9 A;  2L50 A;  5KSZ A;  2BCX A;  1KFU L;  1QS7 A;  1UP5 A;  1BR1 B;  4ORC B;  1G4Y R;  4C0K A;  1CDN A;  2M3W A;  1NCX A;  2ZRT A;  2KLD A;  4HRE E;  2MA2 A;  1QV1 A;  1RK9 A;  2K2F A;  3DD4 A;  2WC6 A;  3ZNI A;  3WHU B;  5FI2 A;  1OW4 A;  2COL B;  1S6I A;  3O6B A;  1UHH A;  3D10 A;  1JC2 A;  1Y1U A;  2PAS A;  1R2U A;  1DJH A;  1XFY O;  2GV5 A;  1LVC D;  1CM4 A;  2KI6 D;  3KPX A;  2ZRS A;  3PM8 A;  4P5O E;  1QIV A;  3S0F A;  1QV0 A;  2BCB A;  3R72 A;  1YVL A;  4I5L B;  2ZFD A;  3BUX B;  3JVT C;  1DMO A;  1EL4 A;  1JBA A;  4WRI A;  2ZN9 A;  2PSR A;  3FE8 A;  2BAP A;  2M97 A;  2PAL A;  1NX0 A;  4MRX A;  1QVI Y;  2KHN A;  2OS8 B;  3LL8 B;  5G08 A;  4QJ4 B;  1C3Z A;  4JQ0 D;  3S0E A;  1PUL A;  1F4O A;  1UUR A;  2LMT A;  2CTN A;  1YRU B;  3B6X A;  2JRF A;  1A29 A;  1K93 D;  2A4J A;  2NZ0 A;  3BOW B;  5I2L A;  1K9P A;  1SCM B;  3H4S E;  4C0L A;  1CDP A;  3LK1 A;  1IJ6 A;  2LMV A;  1QIW A;  5JJG A;  4OKH A;  1J7O A;  1FPW A;  1MXL C;  1B8C A;  1W9Z A;  2GTE A;  1UHJ A;  2MLE C;  2V53 A;  2KI4 B;  1S1E A;  2KAV A;  3CYZ A;  2B1U A;  3B87 A;  1NCZ A;  3PN7 C;  1S5G Y;  1NWD A;  3S0B A;  1DEL A;  1WLZ A;  3FWB A;  3EK4 A;  3L4A A;  4PAL A;  2HPS A;  1CFP A;  1YX8 A;  1M31 A;  1D1O A;  1LKJ A;  2KFF A;  1KFU S;  1CFF A;  2F3Z A;  1QWV A;  1KQV A;  4MEW A;  1SL8 A;  3HCM A;  1PRW A;  2LHL A;  2LHI A;  1SL7 A;  1YUU A;  3NXA A;  1SW8 A;  2JPO A;  2I2R E;  3VRR A;  4INW A;  1KK7 Z;  1W7J B;  1ZFS A;  1XFV O;  3SJS A;  3E3R A;  4PE0 A;  3B86 A;  1M39 A;  2RGI A;  4AOM A;  2EGD A;  3AKB A;  4OVN F;  4PHJ A;  1UHI A;  2Y1M A;  1TTX A;  5TNC A;  4CPV A;  1L2O B;  1PSR A;  2BE4 A;  3N7H A;  4IJ7 A;  4FQO A;  3TDI A;  2JC2 A;  1TNW A;  2L51 A;  5F6T A;  3I5H C;  4PE4 A;  5HYD A;  1MHO A;  1J1E A;  3BQ3 A;  4BY5 A;  2NLN A;  3BXK A;  4JWQ A;  4TNC A;  2HF5 A;  1CNP A;  3LK0 A;  1RRO A;  2H61 C;  1OMR A;  1UHK A;  4ORA B;  5HLV A;  4OCI A;  1SY9 A;  3SIA A;  5I2O A;  3BUN B;  1WRZ A;  1MQ1 A;  2KOT A;  1XFU O;  2CBL A;  3AAJ A;  4MZJ A;  5B8I B;  3I5I C;  3NSK A;  2MHH A;  3BUO B;  4M2P A;  3ZWH A;  2WCM A;  1BG1 A;  3CS1 A;  1EG4 A;  2KYC A;  2LLS A;  3F45 A;  3LLE A;  3DZT A;  3VB1 A;  5DIC A;  1H8B A;  1NCY A;  2FOT A;  3EKH A;  1KQM C;  2LUX A;  2WC8 A;  2NCP A;  4PDZ A;  1K2H A;  1XFX O;  1KFX L;  1K94 A;  3BFA A;  1LS8 A;  1J7P A;  2JWW A;  2JZI A;  3S0G A;  3TUY B;  3ICB A;  3D74 A;  3PM2 A;  4JD9 A;  2QAC A;  2K7B A;  1PVB A;  2L0P A;  4NDC A;  1K96 A;  1N65 A;  3CR5 X;  1F8H A;  1OSA A;  1HQV A;  2PMY A;  2LVV A;  4YGD B;  3PSR A;  4YBH B;  2MAZ A;  3EVR A;  5D3O A;  5GQQ C;  5JOL A;  4JPZ B;  2JTT A;  2LVI A;  1V1F A;  1TOP A;  3JTD C;  2BBN A;  3R1P A;  4GAO A;  4GFT A;  4A4B A;  1WRL A;  4CLN A;  1ZUZ A;  5CSF A;  3TZ1 A;  4DS7 A;  1F71 A;  3PAL A;  2M9G A;  2ZND A;  4QJ3 B;  1NUB A;  2P6B B;  5DKN A;  1BJF A;  1B4C A;  1QLS A;  4WQ3 A;  1L7Z A;  2LNK A;  2LP3 A;  5D69 A;  4OR9 B;  2PYQ A;  1B8L A;  2LCP A;  3R1O A;  3DXL A;  3BFB A;  1S26 D;  1AJ4 A;  3O4X A;  3WHT B;  1A75 A;  3I5F C;  2AUC A;  2K8M B;  4MZK A;  1JFJ A;  2KGR A;  4YGA A;  3O78 A;  2BL0 C;  2KSP A;  2ZKM X;  4A4C A;  1NX2 A;  1YRT B;  1TCF A;  2BE6 A;  2PQL A;  2M7L A;  5KU1 A;  4GGF A;  3KEV A;  3LCP C;  1DJX A;  2MJW B;  3EG5 B;  1UUS A;  2OTG C;  4BY4 A;  2QEB A;  2YGU A;  3DF0 B;  4DUQ A;  3BFH A;  3OHM B;  1AUI B;  2WC5 A;  2O5G A;  1WRK A;  3A4U B;  4P2Y B;  1OOH A;  2KYF A;  1SR6 B;  2CNP A;  4MBE A;  2I94 A;  2DOQ A;  1FW4 A;  2L4H A;  1YX7 A;  1VRK A;  1IQ5 A;  4I5N B;  1KFX S;  1RJV A;  4KYN A;  1BOD A;  3BUM B;  1ORG A;  3FS7 A;  2G2B A;  2LAP A;  4F0Z B;  1NSH A;  3CAB A;  4ORB B;  1IJ5 A;  1F55 A;  2KAY A;  1FI5 A;  2GGM A;  2BNX A;  4MLW A;  2HET A;  2ZN8 A;  1B7T Z;  3PFV A;  1SK6 D;  4XJK A;  2R2I A;  1DJZ A;  3BUW B;  2E30 A;  1XYD A;  1CLL A;  2LUC A;  2FCE A;  1FF1 A;  1LIN A;  2M29 A;  4MZL A;  2G9B A;  2F2P A;  2IS9 A;  4NDB A;  5J3X A;  1IKU A;  2PVB A;  1OE9 B;  3DY9 A;  1KWO B;  1DVI A;  2JNF A;  3SG3 A;  2E6W A;  1IG5 A;  2KBM A;  3WXA A;  1A03 A;  1C3Y A;  1WY9 A;  3L4L A;  3FIA A;  3DVM A;  2WCF A;  2EC6 B;  3SG5 A;  1M45 A;  3CDN A;  3I5G B;  3AKA A;  1U5I B;  3A8R A;  1C07 A; 
#chains in the Genus database with same CATH homology
 2BCA A;  5DKR A;  4PHK A;  1B9A A;  1CFD A;  1NX1 A;  2M8U A;  4YGE B;  1RWY A;  4GGN A;  4HRG A;  1EJ3 A;  1HT9 A;  1MUX A;  1NYA A;  1ZOT B;  3KF9 A;  3NSI A;  2WND A;  3TS5 C;  4MSP A;  4N1F A;  1SBJ A;  5HLO A;  5HKW A;  1BR4 B;  5DKQ A;  1DJG A;  5CSN A;  2WCB A;  3EK8 A;  1SRA A;  2OS8 C;  2Y1N A;  3GK4 X;  1C7V A;  2H2K A;  1JWD A;  2KDH A;  1JUO A;  1WDC B;  1F4Q A;  1RFJ A;  1QAT A;  4GPL B;  1F54 A;  2JT3 A;  2JXL A;  2OPO A;  1CLB A;  2JUL A;  2KGB C;  4I5J A;  2LVJ A;  3CR2 A;  2L5X B;  3SG6 A;  3O4Y A;  1QTX A;  1SCM C;  2MRD A;  1XFZ O;  5BPJ A;  3BOW A;  2M49 B;  3MSE B;  3SG4 A;  1YTZ C;  1TNQ A;  4N1G A;  1BOC A;  1CTR A;  2KI4 C;  2AMI A;  2L98 A;  1DGV A;  4IL1 A;  1NIW A;  2MLF C;  5PAL A;  5HKY A;  1UWO A;  1H4B A;  2BKH B;  4GNK B;  1S36 A;  2KQY A;  1KK8 C;  3CR4 X;  3EK7 A;  1CDM A;  1NPQ A;  2FCD A;  2M0R A;  4YI8 A;  1Y1A A;  1JF2 A;  4XYN A;  1Y1X A;  2KQ6 A;  3GK2 A;  1LXF C;  1WLM A;  2BKI B;  2F33 A;  4M2O A;  4AQI A;  3DVK A;  1QVI Z;  2JOJ A;  2O60 A;  2JT8 A;  2VRG A;  1B47 A;  2WCE A;  2L2E A;  3OP0 A;  4HSZ A;  1F70 A;  1KSM A;  1QX7 A;  1IH0 A;  5AER A;  4PE1 A;  2F2O A;  1SYM A;  5AAN A;  5I8N A;  5AFP A;  2WOS A;  2TN4 A;  2K7C A;  2LP2 A;  3CGA A;  3JVT B;  1L2O C;  3OB2 B;  3C1V A;  3WNX B;  2EHB A;  1KK7 Y;  2GGZ A;  1TNP A;  2I18 A;  5CSI A;  1CKK A;  4GGF C;  1N0Y A;  5ER4 X;  1S6C A;  1MXE A;  3VGO A;  1S5G Z;  4NDD A;  4UPG A;  2KI6 C;  1OZS A;  1YUR A;  4I5K A;  3VRN A;  3QRX A;  5D7F A;  1CM1 A;  3OB1 B;  4DCK A;  1V1G A;  1PK0 D;  2KFG A;  1C7W A;  1OMV A;  4PHN A;  2CT9 A;  3SIB A;  4MVF A;  3RM1 A;  1R6P A;  2KNE A;  3SG7 A;  2Y5I A;  4ZCV A;  1NP8 A;  2M1K B;  3PN7 B;  3KO0 A;  3TUY C;  2JTZ A;  3VRP A;  3D0Y B;  1K90 D;  1XK4 C;  2BBM A;  2K61 A;  3EVV A;  5I2Q A;  2JQ6 A;  2ISD A;  1JSA A;  1DGU A;  2WOR A;  1XK4 A;  2LE9 B;  1GGZ A;  1K95 A;  1A4P A;  4AQJ A;  5FYX A;  3FWC A;  3CWG A;  4CFR A;  2JT0 A;  1K8U A;  3PAT A;  2KAX A;  1M63 B;  4U8D A;  1SMG A;  1KSO A;  3TS5 B;  1RTP 1;  2CCM A;  1J1D A;  1QJT A;  5AXI A;  4E68 A;  2LC5 A;  2HQ8 A;  1W7I B;  1JF0 A;  5K89 A;  2Q91 A;  1DJW A;  1BU3 A;  1DF0 B;  3EKJ A;  4M2Q A;  1J7Q A;  1XFW O;  3DVJ A;  3M0W A;  3I5H B;  1BMO A;  1PSB A;  5CSJ A;  4CID A;  2Q4U A;  1KCY A;  1N2D A;  1SKT A;  2KBI A;  1DJY A;  2LVK A;  2KFH A;  1K9K A;  2JNX A;  4WQ2 A;  4FTG A;  4ZCU A;  2BEC A;  1EXR A;  3DF0 A;  1ALV A;  4Q04 A;  1DTL A;  3CTN A;  3I5I B;  1IGV A;  1ALW A;  1G8I A;  1GQM A;  1IRJ A;  2CXJ A;  3CLN A;  1K9U A;  1SR6 C;  1M46 A;  1SPY A;  1KQM B;  5CPV A;  3NSO A;  5AEQ A;  1Y6W A;  3KHE A;  2LLT A;  2LMU A;  2LV7 A;  2I7A A;  1CMG A;  3RLZ A;  4C0J A;  1CMF A;  3D0Y A;  1DT7 B;  1KK8 B;  1YUT A;  1AK8 A;  4CFQ A;  2NXQ A;  2JU0 A;  1AHR A;  1ZMZ A;  3CZT X;  1TN4 A;  1XVJ A;  1EG3 A;  3O2P A;  2HQW A;  2AAO A;  2K7O A;  1AVS A;  1YUS A;  3TDU A;  3VRQ A;  3BYA A;  1TCO B;  1S6J A;  1X02 A;  3JTD B;  4NQG A;  1TIZ A;  4USL A;  2K0J A;  1YVH A;  3SG2 A;  2F8P A;  3IQO A;  2L4I A;  1KWO C;  4DIR A;  2PRU A;  1REC A;  1B7T Y;  4GBA A;  1A75 B;  1ODB A;  2LLU A;  4ETO A;  1FBV A;  2EC6 C;  1DF0 A;  3I5G C;  3I5F B;  5ER5 A;  5IBW A;  4PE7 A;  1Y0V H;  1PVA A;  1XA5 A;  5HYD A;  1QX5 B;  2BL0 B;  2K7D A;  1MF8 B;  2M7N A;  4YGB B;  3VRO A;  1DJI A;  4YI9 A;  1TNX A;  5KTY A;  1SNL A;  1B8R A;  1U5I A;  1OZO A;  4YGC B;  3TDZ A;  3GK1 A;  1ZAC A;  1B1G A;  2OTG B;  2H61 A;  1MWN A;  3PLF B;  3AAK A;  1SL9 A;  2D8N A;  1GGW A;  4N5X A;  4HRH A;  1LA0 A;  4GUK A;  2M1U A;  4R1E A;  1AP4 A;  4PHM A;  4QJ5 B;  1S3P A;  1OOJ A;  3HX4 A;  3OX6 A;  4L9M A;  1QLK A;  3DVE A;  4MRY A;  1PAL A;  1CB1 A;  1CFC A;  3IF7 A;  1FI6 A;  3K21 A;  3IQQ A;  2F3Y A;  1Q80 A;  2FJU B;  1TRF A;  2QPT A;  2K2A A;  2SCP A;  1WDC C;  1A2X A;  1LA3 A;  1NX3 A;  1GJY A;  1OMD A;  1BT6 A;  2ZNE A;  4XJK B;  1EH2 A;  1QXP A;  1J7R A;  1G33 A;  4OV2 A;  2Y4Q A;  5HKZ A;  1UHN A;  2JXC A;  1JFK A;  1YR5 A;  1QX2 A;  4MN0 A;  1BF5 A;  1BLQ A;  1CLM A;  1J55 A;  1QAS A;  3GOF A;  1AJ5 A;  3NSL A;  2SAS A;  4ICB A;  1IQ3 A;  4YRU A;  1IWQ A;  3EVU A;  1OQP A;  4DRW A;  1SCV A;  4D1E A;  1XO5 A;  4PCW A;  1MR8 A;  1E8A A;  2LM5 A;  2LAN A;  1CDL A;  2NCO A;  2MBX A;  2JPT A;  3OX5 A;  2L50 A;  5KSZ A;  2BCX A;  1KFU L;  1QS7 A;  1UP5 A;  1BR1 B;  4ORC B;  1G4Y R;  4C0K A;  1CDN A;  2M3W A;  1NCX A;  2ZRT A;  4HRE E;  2MA2 A;  1QV1 A;  1RK9 A;  2K2F A;  3DD4 A;  3ZNI A;  3WHU B;  2COL B;  1S6I A;  3O6B A;  1UHH A;  3D10 A;  1JC2 A;  1Y1U A;  2PAS A;  1R2U A;  1DJH A;  1XFY O;  2GV5 A;  1LVC D;  1CM4 A;  2KI6 D;  3KPX A;  2ZRS A;  3PM8 A;  4P5O E;  1QIV A;  1QV0 A;  2BCB A;  1YVL A;  4I5L B;  2ZFD A;  3BUX B;  3JVT C;  1DMO A;  1EL4 A;  1JBA A;  4WRI A;  2ZN9 A;  2PSR A;  2M97 A;  2PAL A;  1NX0 A;  4MRX A;  1QVI Y;  2KHN A;  2OS8 B;  3LL8 B;  5G08 A;  4QJ4 B;  4JQ0 D;  1PUL A;  1F4O A;  1UUR A;  2LMT A;  2CTN A;  1YRU B;  2JRF A;  1A29 A;  1K93 D;  2A4J A;  2NZ0 A;  3BOW B;  5I2L A;  1K9P A;  1SCM B;  3H4S E;  4C0L A;  1CDP A;  3LK1 A;  1IJ6 A;  2LMV A;  1QIW A;  5JJG A;  4OKH A;  1J7O A;  1FPW A;  1MXL C;  1B8C A;  2MLE C;  2V53 A;  1UHJ A;  2KI4 B;  1S1E A;  2KAV A;  2B1U A;  1NCZ A;  3PN7 C;  1S5G Y;  1NWD A;  1WLZ A;  3FWB A;  1CFP A;  3EK4 A;  4PAL A;  2HPS A;  1YX8 A;  1M31 A;  1D1O A;  1LKJ A;  2KFF A;  1KFU S;  1CFF A;  2F3Z A;  1KQV A;  4MEW A;  1SL8 A;  3HCM A;  1PRW A;  2LHL A;  2LHI A;  1SL7 A;  1YUU A;  3NXA A;  1SW8 A;  2I2R E;  3VRR A;  1KK7 Z;  1W7J B;  1ZFS A;  1XFV O;  3SJS A;  3E3R A;  4PE0 A;  1M39 A;  2RGI A;  4AOM A;  2EGD A;  3AKB A;  4OVN F;  4PHJ A;  1UHI A;  2Y1M A;  1TTX A;  5TNC A;  4CPV A;  1L2O B;  1PSR A;  2BE4 A;  3TDI A;  4FQO A;  2JC2 A;  1TNW A;  2L51 A;  5F6T A;  3I5H C;  4PE4 A;  1MHO A;  1J1E A;  3BQ3 A;  4BY5 A;  2NLN A;  3BXK A;  4JWQ A;  4TNC A;  2HF5 A;  1CNP A;  3LK0 A;  1RRO A;  2H61 C;  1OMR A;  1UHK A;  4ORA B;  5HLV A;  4OCI A;  1SY9 A;  3SIA A;  5I2O A;  3BUN B;  1WRZ A;  1MQ1 A;  2KOT A;  1XFU O;  2CBL A;  3AAJ A;  4MZJ A;  5B8I B;  3I5I C;  3NSK A;  2MHH A;  3BUO B;  4M2P A;  3ZWH A;  1BG1 A;  3CS1 A;  1EG4 A;  2KYC A;  2LLS A;  3F45 A;  3LLE A;  1H8B A;  1NCY A;  2FOT A;  3EKH A;  1KQM C;  2LUX A;  2WC8 A;  2NCP A;  4PDZ A;  1K2H A;  1XFX O;  1KFX L;  1K94 A;  1J7P A;  2JWW A;  2JZI A;  3TUY B;  3ICB A;  2QAC A;  2K7B A;  1PVB A;  2L0P A;  4NDC A;  1K96 A;  1N65 A;  3CR5 X;  1F8H A;  1OSA A;  1HQV A;  2PMY A;  2LVV A;  4YGD B;  3PSR A;  4YBH B;  2MAZ A;  3EVR A;  5GQQ C;  5JOL A;  4JPZ B;  2JTT A;  2LVI A;  1V1F A;  1TOP A;  3JTD C;  2BBN A;  4GAO A;  4GFT A;  4A4B A;  1WRL A;  4CLN A;  1ZUZ A;  5CSF A;  3TZ1 A;  4DS7 A;  1F71 A;  3PAL A;  2M9G A;  2ZND A;  4QJ3 B;  1NUB A;  2P6B B;  5DKN A;  1BJF A;  1B4C A;  1QLS A;  4WQ3 A;  1L7Z A;  2LNK A;  2LP3 A;  5D69 A;  4OR9 B;  1B8L A;  2LCP A;  1S26 D;  1AJ4 A;  3WHT B;  1A75 A;  3I5F C;  2AUC A;  2K8M B;  4MZK A;  1JFJ A;  2KGR A;  4YGA A;  3O78 A;  2BL0 C;  2KSP A;  2ZKM X;  4A4C A;  1NX2 A;  1YRT B;  1TCF A;  2BE6 A;  2M7L A;  5KU1 A;  4GGF A;  3KEV A;  3LCP C;  1DJX A;  2MJW B;  1UUS A;  2OTG C;  4BY4 A;  3DF0 B;  4DUQ A;  3OHM B;  1AUI B;  2O5G A;  1WRK A;  3A4U B;  4P2Y B;  2KYF A;  1SR6 B;  2CNP A;  4MBE A;  2I94 A;  2DOQ A;  1FW4 A;  2L4H A;  1YX7 A;  1VRK A;  1IQ5 A;  4I5N B;  1KFX S;  1RJV A;  1BOD A;  3BUM B;  3FS7 A;  2G2B A;  2LAP A;  4F0Z B;  1NSH A;  4ORB B;  1IJ5 A;  1F55 A;  2KAY A;  1FI5 A;  2GGM A;  4MLW A;  2HET A;  2ZN8 A;  1B7T Z;  3PFV A;  1SK6 D;  4XJK A;  2R2I A;  1DJZ A;  3BUW B;  2E30 A;  1XYD A;  1CLL A;  2LUC A;  2FCE A;  1FF1 A;  1LIN A;  2M29 A;  4MZL A;  2G9B A;  2F2P A;  2IS9 A;  4NDB A;  5J3X A;  1IKU A;  2PVB A;  1OE9 B;  1KWO B;  1DVI A;  2JNF A;  3SG3 A;  2E6W A;  1IG5 A;  2KBM A;  3WXA A;  1A03 A;  1WY9 A;  3FIA A;  3DVM A;  2WCF A;  2EC6 B;  3SG5 A;  1M45 A;  3I5G B;  3AKA A;  1U5I B;  3A8R A;  1C07 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...