4YGDB

Crystal structure of ergic-53/mcfd2, monoclinic calcium-bound form 2
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
79
structure length
69
Chain Sequence
b'MSPQELQLHYFKMHDYDGNNLLDGLELSTAITHPLMSEDELINIIDGVLRDDDKNNDGYIDYAEFAKSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein ERGIC-53
publication title Interaction mode of coagulation factors V and VIII with the cargo receptor MCFD2/ERGIC-53 complex
rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 26
structure length 69
sequence length 79
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ygdB00
3OP0A 3PFVA 4XJKB 1SRAA 3BUNB 1B8LA 2L0PA 3CZTX 1YUSA 1MF8B 2KGBC 1J7QA 2CT9A 1FI5A 1K8UA 1QJTA 2FJUB 1UHHA 4MSPA 1CDPA 1NX2A 4GUKA 4MRXA 1J1EA 3I5IB 2IS9A 2JXCA 2B1UA 1RROA 1QLKA 1NCYA 3SIBA 1K9PA 1K95A 1MR8A 3DD4A 4ORAB 3EKHA 1SL9A 1A75A 1DJHA 4PCWA 2HQ8A 1KQMC 3O4YA 1A4PA 1CFFA 2MBXA 3BYAA 3WXAA 5I2QA 1OMRA 1AJ4A 1HT9A 2M8UA 5I2LA 1QVIZ 2JT8A 1QVIY 1CTRA 3DVEA 1GGWA 2F3ZA 1ZMZA 1R6PA 2QACA 3BXKA 3PATA 4AQIA 4MRYA 4CFQA 2V53A 4NQGA 5IBWA 1CDLA 1EL4A 3BOWB 3DF0A 1SBJA 2KI4C 2ISDA 2EC6C 5AANA 3FIAA 3GK2A 1KK7Y 1M39A 2OS8B 1KWOB 2K7DA 3KEVA 1QIWA 3CLNA 1S3PA 4QJ5B 2L50A 3JTDC 2M7LA 1UHKA 3NXAA 1MUXA 1KSMA 1A03A 4OKHA 2E6WA 4MBEA 4MN0A 1WRZA 1ZOTB 4DUQA 4XJKA 1KQVA 1KCYA 3A8RA 4MLWA 3NSLA 2BL0B 3QRXA 2HETA 4P2YB 2PSRA 1DJYA 5DKNA 3CGAA 2Y1MA 1QATA 2EHBA 1EG4A 3TS5C 1IJ6A 1NCZA 1F70A 1LVCD 3GOFA 2BBNA 4PE1A 2JNXA 2LLUA 3I5FC 4NDDA 4PHMA 1JC2A 1M46A 1FBVA 1AVSA 2Q4UA 3I5HC 1SCMB 2LVJA 1CM4A 1DF0B 2K0JA 3CS1A 2JRFA 3VROA 3AAKA 1KFXS 2TN4A 2MLFC 1WLZA 2M0RA 2L5XB 1OZOA 1QIVA 2GGZA 1RK9A 3LK0A 4GFTA 5F6TA 1QV1A 1YTZC 3GK1A 4GAOA 1NX0A 2CTNA 4CFRA 1DJZA 3VRRA 2RGIA 3BOWA 1TCFA 4PDZA 4YGAA 4IL1A 1K2HA 1Q80A 1OSAA 4GGNA 3WHUB 3EK8A 1ALWA 2LCPA 1MQ1A 1TN4A 1MHOA 3PM8A 4P5OE 1FF1A 2WORA 3SG6A 2KI6C 4OVNF 2NCOA 1KQMB 1IQ3A 4CPVA 1J7PA 4MEWA 1FI6A 3HX4A 5KSZA 1FW4A 1XO5A 2O5GA 4C0JA 1PULA 2OPOA 5CSFA 2LMVA 5G08A 1JSAA 1CLLA 1QLSA 2I2RE 2K2AA 2ZRTA 2AMIA 4YI9A 4TNCA 1DVIA 2KI4B 3D10A 4UPGA 2EC6B 1GGZA 1CMGA 5J3XA 4HSZA 1DF0A 3TDIA 2E30A 1QX2A 3BUOB 4DCKA 2BECA 1YR5A 1TNXA 3VRNA 3JTDB 1H8BA 3AKBA 1YUUA 1XVJA 2LVKA 4WRIA 1JFKA 2LHIA 3LLEA 5KU1A 1D1OA 1J55A 1K9KA 3CR5X 1CFCA 4YGCB 1AJ5A 1S6IA 1UUSA 1CM1A 1V1FA 2KYFA 2LVVA 2LLSA 4C0KA 4PHJA 1XFUO 3NSOA 3TS5B 2LMTA 3VGOA 1WRKA 1B47A 2JTZA 1F4QA 3EVUA 1CDNA 2BCXA 3I5FB 1DT7B 3I5HB 1YVHA 2NXQA 3OB1B 1K9UA 2FCEA 3I5GC 3MSEB 4N1FA 2L98A 2KGRA 2DOQA 4AOMA 2EGDA 2JQ6A 2WCFA 3KF9A 3FWBA 3C1VA 3SG7A 3ICBA 2BBMA 5PALA 1CDMA 5JJGA 3F45A 1F55A 2I7AA 2Y5IA 1LA3A 2MA2A 1C7VA 3LCPC 1TNWA 1TIZA 3TZ1A 2QPTA 2JPTA 2ZN9A 4OCIA 1SK6D 1SW8A 2JOJA 1JUOA 4DRWA 2HPSA 3A4UB 2G9BA 4N1GA 1BLQA 1B8RA 1DGUA 5ER5A 4ORBB 3EVRA 2M29A 1N0YA 3KHEA 1KK7Z 1RWYA 3DVJA 3ZWHA 1PVBA 1PALA 1DJXA 5AXIA 2F3YA 4Q04A 1XFVO 2FCDA 2JC2A 2K61A 4GGFC 1CFDA 2H2KA 5AEQA 2JXLA 1TOPA 1FPWA 4AQJA 2PMYA 1BOCA 2BE6A 1C07A 2LP2A 1BODA 2L51A 1CLBA 2MRDA 5AERA 1F54A 1IQ5A 1B8CA 2KFGA 3EVVA 2GGMA 2JNFA 2JTTA 1AHRA 1DJIA 4YGDB 5AFPA 1IKUA 3PLFB 2JT3A 2LUCA 5B8IB 1H4BA 5DKQA 5HKWA 5TNCA 1PK0D 1OMDA 4USLA 5GQQC 2M1KB 1E8AA 1B7TY 1S1EA 2A4JA 2LLTA 4QJ4B 1BF5A 1EH2A 1L2OC 1A29A 2PASA 1S26D 1G8IA 1QX7A 2Y4QA 4DIRA 2M7NA 4A4BA 1K90D 2JZIA 4MVFA 1TCOB 4CIDA 1U5IB 2M1UA 1S6JA 1XFYO 1EXRA 2SASA 2F33A 2D8NA 2BKIB 4ETOA 4QJ3B 1DMOA 1Y1UA 2JWWA 1QX5B 2KHNA 2ZKMX 1NCXA 1N65A 3I5GB 1WDCC 1XFWO 2CNPA 3BUWB 2KBMA 1JBAA 3BUMB 4HRGA 3LL8B 3FS7A 2H61C 2F2OA 4OR9B 1YX7A 5DKRA 4FTGA 2LAPA 3NSKA 3BUXB 2LMUA 2KQYA 2PRUA 2F8PA 2JU0A 1SL7A 1M31A 1SY9A 5KTYA 3KO0A 1N2DA 1SPYA 1Y0VH 3O6BA 1KK8C 3OX5A 4M2OA 4ZCUA 1KFXL 1SYMA 1XK4C 4BY5A 2LANA 1IRJA 1NYAA 1BR1B 3SG5A 1QTXA 5ER4X 3VRQA 1CLMA 1BT6A 1F4OA 1ALVA 2KAVA 2ZFDA 4NDBA 1JF0A 1X02A 4PHKA 5HLOA 5HKYA 2LC5A 3NSIA 1UURA 2L2EA 1NP8A 1TTXA 1C7WA 2LUXA 2LE9B 1SNLA 1U5IA 1L7ZA 3PSRA 1B9AA 1NX3A 1NX1A 2KAYA 2AUCA 2KYCA 2Q91A 4ORCB 4D1EA 3CTNA 4JWQA 1WY9A 3RLZA 1KSOA 1F8HA 1YUTA 1IJ5A 1UHNA 2AAOA 1R2UA 3BQ3A 1QV0A 2MJWB 4MZKA 4PE7A 1J1DA 3IQOA 3TDZA 4M2PA 1LINA 2CCMA 1VRKA 1SL8A 5CSIA 2WOSA 2BKHB 3O78A 1CNPA 1NUBA 3AKAA 4U8DA 2LP3A 1K93D 1EJ3A 1LA0A 1WRLA 1B4CA 1L2OB 3O2PA 1CB1A 2ZRSA 4L9MA 1UHJA 2M9GA 3DVKA 2ZNDA 1NPQA 1RJVA 1YX8A 2MLEC 1Y6WA 1KFUS 2NLNA 3EKJA 2LM5A 3JVTC 4OV2A 1SCVA 1LKJA 1SR6C 4I5LB 1IWQA 2FOTA 1MXEA 2LHLA 2PALA 4WQ3A 4XYNA 4YGEB 4ICBA 2KSPA 3TUYB 3WNXB 3PN7B 2F2PA 1SKTA 1G33A 1MXLC 1BU3A 1BJFA 1YURA 1NSHA 4YGBB 2BE4A 3GK4X 2L4IA 1WDCB 2M3WA 1A2XA 1LXFC 1BR4B 2JULA 5D69A 4GNKB 3IF7A 1TNPA 1S36A 1QS7A 2LV7A 4GGFA 2OTGC 1DJGA 1DGVA 4YRUA 3SJSA 1ODBA 1OZSA 4M2QA 3SG2A 1JWDA 1TRFA 2K7CA 2MAZA 2CXJA 1DJWA 1KK8B 1TNQA 2NCPA 1G4YR 4GPLB 1AP4A 1NWDA 2NZ0A 2P6BB 1J7OA 4WQ2A 3K21A 1RECA 2KOTA 1AK8A 3E3RA 5BPJA 3LK1A 2VRGA 1IG5A 1M63B 1KFUL 4C0LA 4PE0A 3SIAA 2I94A 3EK7A 2I18A 3SG4A 4R1EA 1K94A 1PSBA 1B7TZ 5K89A 2BCAA 2KFFA 2KBIA 2K7OA 3FWCA 4DS7A 5CPVA 3D0YB 1AUIB 5D7FA 2MHHA 2WCBA 2K8MB 5FYXA 1MWNA 4PALA 4PE4A 1S5GZ 1YRTB 1S5GY 4YI8A 3TUYC 2H61A 3KPXA 5HLVA 1UHIA 2KFHA 1K96A 3PN7C 1PVAA 2WC8A 1OE9B 1OMVA 3JVTB 1CKKA 2LNKA 1RTP1 4I5KA 3PALA 1S6CA 1SR6B 3I5IC 5CSJA 1IH0A 2M49B 3OB2B 1OQPA 2KAXA 2KNEA 2WNDA 1YRUB 1JFJA 4JQ0D 2K7BA 4MZLA 1XFXO 1XK4A 1HQVA 3WHTB 3OX6A 4I5JA 1QASA 2GV5A 2Y1NA 1W7IB 2CBLA 4MZJA 3M0WA 4YBHB 1GJYA 1QXPA 2COLB 2OTGB 2LVIA 1ZACA 2BCBA 3CWGA 1XA5A 4F0ZB 3CR4X 4PHNA 1GQMA 3HCMA 2O60A 2L4HA 2WCEA 1B1GA 2G2BA 3D0YA 1PSRA 2ZN8A 3VRPA 2KDHA 1UP5A 2OS8C 1F71A 1KWOC 1YVLA 1CMFA 1PRWA 3H4SE 2M97A 1UWOA 1A75B 3DVMA 4FQOA 5I2OA 3RM1A 1WLMA 1ZFSA 1Y1AA 1DTLA 2HF5A 5HYDA 1JF2A 3EK4A 2ZNEA 4E68A 1CFPA 4A4CA 1EG3A 2BL0C 1J7RA 4HRHA 2JT0A 4GBAA 4I5NB 3IQQA 4ZCVA 4CLNA 1M45A 1RFJA 5CSNA 1BMOA 3AAJA 3DF0B 2PVBA 1NIWA 3TDUA 2HQWA 5I8NA 2KI6D 4NDCA 1V1GA 1ZUZA 3SG3A 1W7JB 1SCMC 3CR2A 1XYDA 2KQ6A 2SCPA 4N5XA 2R2IA 4HREE 5JOLA 4JPZB 4BY4A 1XFZO 1BG1A 2K2FA 1SMGA 5HKZA 3OHMB 1OOJA 1IGVA 1Y1XA 3ZNIA
chains in the Genus database with same CATH superfamily
3OP0A 3PFVA 1OW4A 4XJKB 1SRAA 3BUNB 1B8LA 2L0PA 3CZTX 1YUSA 1MF8B 2KGBC 1J7QA 1GM0A 2CT9A 3NHIA 1FI5A 1K8UA 1QJTA 2FJUB 1UHHA 4MSPA 1CDPA 1NX2A 4GUKA 4MRXA 1J1EA 2KPHA 3I5IB 2IS9A 2JXCA 2B1UA 1RROA 1QLKA 1NCYA 3R1VA 1K9PA 3SIBA 1K95A 3D76A 2QEVA 1MR8A 3DD4A 4ORAB 3EKHA 1SL9A 1A75A 1DJHA 4OZDA 4PCWA 2HQ8A 1KQMC 3O4YA 1A4PA 1CFFA 2MBXA 3BYAA 3WXAA 5I2QA 1OMRA 1AJ4A 1HT9A 2M8UA 5I2LA 1QVIZ 2JT8A 1QVIY 4KYNA 3D75A 2KLEA 1CTRA 3SS5A 2QEOA 3DVEA 1GGWA 2F3ZA 1ZMZA 3CZ2A 1R6PA 2QACA 3BXKA 3PATA 4AQIA 4MRYA 4CFQA 2V53A 4NQGA 5IBWA 1CDLA 1EL4A 3BOWB 3DF0A 1SBJA 2KI4C 4INWA 3K1EA 2ISDA 2EC6C 5AANA 3FIAA 3GK2A 1KK7Y 4JKTA 1M39A 1QWVA 3FE6A 2PYQA 3FE8A 2OS8B 1KWOB 2K7DA 3KEVA 1QIWA 3CLNA 1S3PA 4JD9A 4QJ5B 2L50A 3JTDC 2M7LA 1UHKA 3NXAA 1MUXA 1KSMA 1A03A 4OKHA 2E6WA 4MBEA 4MN0A 1WRZA 1ZOTB 4DUQA 4XJKA 1KQVA 1KCYA 3A8RA 4MLWA 3NSLA 2BL0B 3QRXA 2HETA 4P2YB 2PSRA 1DJYA 5DKNA 3CGAA 3DXLA 2Y1MA 1QATA 2EHBA 1EG4A 3TS5C 1IJ6A 1NCZA 1F70A 1LVCD 3GOFA 2BBNA 4PE1A 2JNXA 3Q8IA 2LLUA 3CABA 3I5FC 4NDDA 4PHMA 1JC2A 1M46A 1FBVA 1AVSA 2Q4UA 3I5HC 1SCMB 2LVJA 1CM4A 1DF0B 2K0JA 3CS1A 2JRFA 3VROA 3AAKA 1KFXS 2TN4A 2MLFC 1WLZA 2M0RA 2L5XB 1OZOA 1QIVA 2GGZA 1RK9A 3LK0A 4GFTA 5F6TA 1QV1A 1YTZC 3GK1A 4GAOA 1NX0A 2CTNA 4CFRA 1DEKA 1DJZA 3VRRA 2RGIA 3BOWA 1TCFA 4PDZA 4YGAA 4IL1A 1K2HA 1Q80A 1OSAA 4GGNA 3WHUB 3EK8A 1ALWA 2LCPA 1MQ1A 1TN4A 1MHOA 3PM8A 4P5OE 1FF1A 2WORA 3S0BA 3SG6A 3BFBA 2KI6C 4OVNF 2NCOA 1KQMB 1IQ3A 2QEBA 4CPVA 1J7PA 4MEWA 4F7FA 1FI6A 3B7AA 3HX4A 5KSZA 1FW4A 1XO5A 2O5GA 4C0JA 1PULA 2OPOA 5CSFA 2LMVA 5G08A 1SSEB 1JSAA 1CLLA 1QLSA 1W9ZA 2I2RE 2K2AA 2AMIA 2ZRTA 4YI9A 1C3YA 4TNCA 1DVIA 2KI4B 3D10A 4UPGA 2EC6B 1GGZA 1CMGA 5J3XA 4HSZA 1DF0A 2JPOA 3TDIA 3DY9A 2E30A 1QX2A 3BUOB 4DCKA 2BECA 1OOFA 1YR5A 1TNXA 3VRNA 3JTDB 1H8BA 3AKBA 1YUUA 1XVJA 2LVKA 4WRIA 1JFKA 2LHIA 3LLEA 5KU1A 1D1OA 1TWOA 1J55A 1K9KA 3CR5X 1CFCA 4YGCB 1AJ5A 1S6IA 1UUSA 1CM1A 1V1FA 2KYFA 2LVVA 2LLSA 4C0KA 4PHJA 1XFUO 3FE9A 3NSOA 3TS5B 2LMTA 3VGOA 1WRKA 2P70A 1B47A 2JTZA 1F4QA 3EVUA 1CDNA 2BCXA 3I5FB 1DT7B 3I5HB 1YVHA 2NXQA 2K60A 1Z4HA 4FQTA 3OB1B 3D77A 1K9UA 2FCEA 3I5GC 3MSEB 4N1FA 2L98A 2KGRA 3UNWA 5HL1A 2DOQA 4AOMA 2EGDA 2JQ6A 2WCFA 3KF9A 3FWBA 3C1VA 3SG7A 3ICBA 2BBMA 5PALA 1CDMA 5JJGA 3F45A 1F55A 2QEHA 2I7AA 2Y5IA 1LA3A 2MA2A 1C7VA 3LCPC 1TNWA 1TIZA 3TZ1A 2QPTA 2JPTA 2ZN9A 4OCIA 1SK6D 1SW8A 2JOJA 1JUOA 4DRWA 2HPSA 3A4UB 2G9BA 4IJ7A 4N1GA 1BLQA 1B8RA 1DGUA 5ER5A 4ORBB 3EVRA 2M29A 1N0YA 3KHEA 1KK7Z 1RWYA 3DVJA 3ZWHA 1PVBA 1PALA 3S0EA 1DJXA 3NGVA 5AXIA 2F3YA 3L47A 4Q04A 1XFVO 2FCDA 2JC2A 2WCLA 2K61A 4GGFC 1CFDA 2H2KA 5AEQA 2JXLA 1TOPA 1FPWA 3DZTA 3S0GA 4AQJA 2PMYA 1BOCA 2BE6A 1C07A 2LP2A 1BODA 2L51A 1CLBA 2MRDA 2P71A 5AERA 1F54A 1IQ5A 1B8CA 2KFGA 1XFRA 2GGMA 3EVVA 2JNFA 2JTTA 1AHRA 1DJIA 4YGDB 5AFPA 1IKUA 3PLFB 2JT3A 2LUCA 5B8IB 1H4BA 5DKQA 5HKWA 3R1PA 5TNCA 1PK0D 1OMDA 4USLA 5GQQC 2M1KB 1E8AA 1B7TY 1OOIX 1S1EA 2A4JA 2LLTA 4QJ4B 1BF5A 1EH2A 1L2OC 2GTEA 1A29A 2PASA 1S26D 1G8IA 1QX7A 2Y4QA 3BFAA 4DIRA 2M7NA 4A4BA 1K90D 2JZIA 4MVFA 1TCOB 4CIDA 1U5IB 2M1UA 1S6JA 1XFYO 1EXRA 2SASA 2F33A 2D8NA 2BKIB 3D78A 1TUZA 4ETOA 4QJ3B 1DMOA 1Y1UA 2JWWA 1QX5B 2KHNA 2ZKMX 1NCXA 1N65A 3O4XA 3I5GB 1WDCC 3V2LA 1XFWO 3EG5B 2CNPA 3BUWB 2KBMA 1P28A 1JBAA 3BUMB 4HRGA 3LL8B 3FS7A 1DC1A 2H61C 2F2OA 4OR9B 1YX7A 5DKRA 4FTGA 2LAPA 3NSKA 3BUXB 2LMUA 2KQYA 2PRUA 2F8PA 2JU0A 1SL7A 3VB1A 1M31A 1SY9A 5KTYA 3KO0A 3BFHA 1N2DA 1ORGA 1SPYA 1Y0VH 3O6BA 3B88A 3UO9A 1KK8C 3OX5A 4M2OA 4ZCUA 1KFXL 1SYMA 1XK4C 4BY5A 2LANA 1IRJA 1NYAA 1BR1B 3SG5A 1QTXA 5ER4X 3VRQA 1CLMA 1BT6A 1F4OA 1ALVA 2KAVA 2ZFDA 4NDBA 1JF0A 1X02A 4PHKA 5HLOA 5HKYA 2LC5A 3NSIA 1UURA 2L2EA 1NP8A 1TTXA 1C7WA 2LUXA 2LE9B 1SNLA 1U5IA 2L5YA 1L7ZA 3PSRA 3D73A 1B9AA 1NX3A 1NX1A 2KAYA 2AUCA 2KYCA 2Q91A 3CZ1A 4ORCB 4D1EA 3CTNA 4JWQA 1WY9A 3B6XA 1KSOA 3PJIA 1YUTA 3RLZA 1F8HA 1IJ5A 1UHNA 2AAOA 1R2UA 3BQ3A 1QV0A 2MJWB 4MZKA 5DICA 3IVTA 3CYZA 4PE7A 1J1DA 3IQOA 3TDZA 4M2PA 1LINA 2CCMA 1VRKA 1OOHA 1SL8A 5CSIA 2WOSA 2BKHB 3O78A 3SS4A 1CNPA 1NUBA 3AKAA 2WCMA 2LP3A 4U8DA 1K93D 1EJ3A 1LA0A 1WRLA 1B4CA 1L2OB 3O2PA 1CB1A 2ZRSA 3DYEA 4L9MA 1UHJA 2M9GA 3DVKA 2ZNDA 3N7HA 1NPQA 5D3OA 1RJVA 1YX8A 2MLEC 1Y6WA 1KFUS 2NLNA 3EKJA 2LM5A 2FJYA 3JVTC 4OV2A 1SCVA 1LKJA 1SR6C 4I5LB 1IWQA 2FOTA 1MXEA 2LHLA 2PALA 4WQ3A 4XYNA 4YGEB 4ICBA 2KSPA 3TUYB 3WNXB 3PN7B 2F2PA 1SKTA 1G33A 1MXLC 1BU3A 1BJFA 1YURA 3B86A 1NSHA 4YGBB 2BE4A 3GK4X 2L4IA 4INXA 1OOGA 1WDCB 2M3WA 1A2XA 1LXFC 1BR4B 2JULA 5D69A 4GNKB 3IF7A 1TNPA 1S36A 1QS7A 2LV7A 4GGFA 2ERBA 2OTGC 1T14A 1DJGA 4PT1A 1DGVA 4YRUA 3OBVA 3SJSA 1ODBA 1OZSA 4M2QA 3OGNA 3SG2A 1JWDA 1TRFA 2K7CA 2MAZA 2CXJA 2WC5A 3R1OA 1DJWA 1KK8B 5I94A 1TNQA 2NCPA 1G4YR 2KLDA 2BNXA 2QDIA 4GPLB 1AP4A 1NWDA 2NZ0A 2P6BB 1J7OA 4WQ2A 3K21A 1RECA 2KOTA 1AK8A 3E3RA 5BPJA 3LK1A 2VRGA 1IG5A 1M63B 1KFUL 4C0LA 5EL2A 4PE0A 3SIAA 2I94A 3EK7A 2I18A 3SG4A 2H8VA 1K94A 1PSBA 4R1EA 3S0DA 1B7TZ 5K89A 1C3ZA 2BCAA 2KFFA 2KBIA 2K7OA 3FWCA 4DS7A 3L4AA 5CPVA 3D0YB 1AUIB 5D7FA 2MHHA 2WCBA 2K8MB 3S0FA 5FYXA 1MWNA 4PALA 4PE4A 1S5GZ 2WCKA 1YRTB 1S5GY 4YI8A 3TUYC 2H61A 3KPXA 5HLVA 1UHIA 5FI2A 2KFHA 1K96A 3PN7C 1PVAA 3D74A 1LS8A 2WC8A 1OE9B 1OMVA 3R72A 3JVTB 1CKKA 5FI6A 2WCHA 2LNKA 1RTP1 4I5KA 3PALA 1S6CA 1SR6B 3I5IC 5CSJA 1IH0A 2M49B 3OB2B 1OQPA 2L2CA 2KAXA 2KNEA 2WNDA 1YRUB 1JFJA 4JQ0D 2K7BA 4MZLA 1XFXO 1XK4A 1HQVA 3WHTB 3OX6A 4I5JA 3L4LA 1QASA 1DQEA 2GV5A 2Y1NA 3CDNA 2YGUA 1W7IB 2CBLA 4MZJA 3M0WA 4YBHB 1GJYA 1QXPA 2COLB 2OTGB 2LVIA 1ZACA 2BCBA 1DELA 5FI7A 3CWGA 1XA5A 4F0ZB 3CR4X 3SS3A 4PHNA 1GQMA 3HCMA 2O60A 2L4HA 2WCEA 1TUJA 1B1GA 2G2BA 3D0YA 2WC6A 1PSRA 2ZN8A 3VRPA 2KDHA 1UP5A 2OS8C 1F71A 1KWOC 1YVLA 1CMFA 3NHTA 1PRWA 3QMEA 3H4SE 2M97A 1UWOA 1Z2CB 1A75B 3DVMA 4FQOA 5I2OA 3RM1A 2PQLA 3CZ0A 1WLMA 1ZFSA 1Y1AA 1DTLA 2HF5A 1IIOA 5HYDA 1JF2A 3EK4A 2ZNEA 4E68A 1CFPA 4A4CA 1EG3A 2BL0C 1J7RA 4HRHA 2JT0A 3S0AA 4GBAA 4I5NB 3IQQA 4ZCVA 4CLNA 1M45A 1RFJA 3PM2A 3RZSA 5CSNA 1BMOA 3AAJA 3DF0B 2PVBA 1NIWA 2WCJA 2HQWA 3TDUA 2KI6D 5I8NA 2BAPA 4NDCA 1V1GA 1ZUZA 3SG3A 1W7JB 1SCMC 3CR2A 1XYDA 2KQ6A 2SCPA 4N5XA 2R2IA 4HREE 5JOLA 4JPZB 4BY4A 1XFZO 1BG1A 2K2FA 1SMGA 3BJHA 5HKZA 3OHMB 1OOJA 1IGVA 1Y1XA 3B87A 3ZNIA
chains in the Genus database with same CATH topology
3OP0A 3PFVA 4XJKB 1SRAA 3BUNB 1B8LA 2L0PA 3CZTX 1YUSA 1MF8B 2KGBC 1J7QA 2CT9A 1FI5A 1K8UA 1QJTA 2FJUB 1UHHA 4MSPA 1CDPA 1NX2A 4GUKA 4MRXA 1J1EA 3I5IB 2IS9A 2JXCA 2B1UA 1RROA 1QLKA 1NCYA 3SIBA 1K9PA 1K95A 1MR8A 3DD4A 4ORAB 3EKHA 1SL9A 1A75A 1DJHA 4PCWA 2HQ8A 1KQMC 3O4YA 1A4PA 1CFFA 2MBXA 3BYAA 3WXAA 5I2QA 1OMRA 1AJ4A 1HT9A 2M8UA 5I2LA 1QVIZ 2JT8A 1QVIY 1CTRA 3DVEA 1GGWA 2F3ZA 1ZMZA 1R6PA 2QACA 3BXKA 3PATA 4AQIA 4MRYA 4CFQA 2V53A 4NQGA 5IBWA 1CDLA 1EL4A 3BOWB 3DF0A 1SBJA 2KI4C 2ISDA 2EC6C 5AANA 3FIAA 3GK2A 1KK7Y 1M39A 2OS8B 1KWOB 2K7DA 3KEVA 1QIWA 3CLNA 1S3PA 4QJ5B 2L50A 3JTDC 2M7LA 1UHKA 3NXAA 1MUXA 1KSMA 1A03A 4OKHA 2E6WA 4MBEA 4MN0A 1WRZA 1ZOTB 4DUQA 4XJKA 1KQVA 1KCYA 3A8RA 4MLWA 3NSLA 2BL0B 3QRXA 2HETA 4P2YB 2PSRA 1DJYA 5DKNA 3CGAA 2Y1MA 1QATA 2EHBA 1EG4A 3TS5C 1IJ6A 1NCZA 1F70A 1LVCD 3GOFA 2BBNA 4PE1A 2JNXA 2LLUA 3I5FC 4NDDA 4PHMA 1JC2A 1M46A 1FBVA 1AVSA 2Q4UA 3I5HC 1SCMB 2LVJA 1CM4A 1DF0B 2K0JA 3CS1A 2JRFA 3VROA 3AAKA 1KFXS 2TN4A 2MLFC 1WLZA 2M0RA 2L5XB 1OZOA 1QIVA 2GGZA 1RK9A 3LK0A 4GFTA 5F6TA 1QV1A 1YTZC 3GK1A 4GAOA 1NX0A 2CTNA 4CFRA 1DJZA 3VRRA 2RGIA 3BOWA 1TCFA 4PDZA 4YGAA 4IL1A 1K2HA 1Q80A 1OSAA 4GGNA 3WHUB 3EK8A 1ALWA 2LCPA 1MQ1A 1TN4A 1MHOA 3PM8A 4P5OE 1FF1A 2WORA 3SG6A 2KI6C 4OVNF 2NCOA 1KQMB 1IQ3A 4CPVA 1J7PA 4MEWA 1FI6A 3HX4A 5KSZA 1FW4A 1XO5A 2O5GA 4C0JA 1PULA 2OPOA 5CSFA 2LMVA 5G08A 1JSAA 1CLLA 1QLSA 2I2RE 2K2AA 2ZRTA 2AMIA 4YI9A 4TNCA 1DVIA 2KI4B 3D10A 4UPGA 2EC6B 1GGZA 1CMGA 5J3XA 4HSZA 1DF0A 3TDIA 2E30A 1QX2A 3BUOB 4DCKA 2BECA 1YR5A 1TNXA 3VRNA 3JTDB 1H8BA 3AKBA 1YUUA 1XVJA 2LVKA 4WRIA 1JFKA 2LHIA 3LLEA 5KU1A 1D1OA 1J55A 1K9KA 3CR5X 1CFCA 4YGCB 1AJ5A 1S6IA 1UUSA 1CM1A 1V1FA 2KYFA 2LVVA 2LLSA 4C0KA 4PHJA 1XFUO 3NSOA 3TS5B 2LMTA 3VGOA 1WRKA 1B47A 2JTZA 1F4QA 3EVUA 1CDNA 2BCXA 3I5FB 1DT7B 3I5HB 1YVHA 2NXQA 3OB1B 1K9UA 2FCEA 3I5GC 3MSEB 4N1FA 2L98A 2KGRA 2DOQA 4AOMA 2EGDA 2JQ6A 2WCFA 3KF9A 3FWBA 3C1VA 3SG7A 3ICBA 2BBMA 5PALA 1CDMA 5JJGA 3F45A 1F55A 2I7AA 2Y5IA 1LA3A 2MA2A 1C7VA 3LCPC 1TNWA 1TIZA 3TZ1A 2QPTA 2JPTA 2ZN9A 4OCIA 1SK6D 1SW8A 2JOJA 1JUOA 4DRWA 2HPSA 3A4UB 2G9BA 4N1GA 1BLQA 1B8RA 1DGUA 5ER5A 4ORBB 3EVRA 2M29A 1N0YA 3KHEA 1KK7Z 1RWYA 3DVJA 3ZWHA 1PVBA 1PALA 1DJXA 5AXIA 2F3YA 4Q04A 1XFVO 2FCDA 2JC2A 2K61A 4GGFC 1CFDA 2H2KA 5AEQA 2JXLA 1TOPA 1FPWA 4AQJA 2PMYA 1BOCA 2BE6A 1C07A 2LP2A 1BODA 2L51A 1CLBA 2MRDA 5AERA 1F54A 1IQ5A 1B8CA 2KFGA 3EVVA 2GGMA 2JNFA 2JTTA 1AHRA 1DJIA 4YGDB 5AFPA 1IKUA 3PLFB 2JT3A 2LUCA 5B8IB 1H4BA 5DKQA 5HKWA 5TNCA 1PK0D 1OMDA 4USLA 5GQQC 2M1KB 1E8AA 1B7TY 1S1EA 2A4JA 2LLTA 4QJ4B 1BF5A 1EH2A 1L2OC 1A29A 2PASA 1S26D 1G8IA 1QX7A 2Y4QA 4DIRA 2M7NA 4A4BA 1K90D 2JZIA 4MVFA 1TCOB 4CIDA 1U5IB 2M1UA 1S6JA 1XFYO 1EXRA 2SASA 2F33A 2D8NA 2BKIB 4ETOA 4QJ3B 1DMOA 1Y1UA 2JWWA 1QX5B 2KHNA 2ZKMX 1NCXA 1N65A 3I5GB 1WDCC 1XFWO 2CNPA 3BUWB 2KBMA 1JBAA 3BUMB 4HRGA 3LL8B 3FS7A 2H61C 2F2OA 4OR9B 1YX7A 5DKRA 4FTGA 2LAPA 3NSKA 3BUXB 2LMUA 2KQYA 2PRUA 2F8PA 2JU0A 1SL7A 1M31A 1SY9A 5KTYA 3KO0A 1N2DA 1SPYA 1Y0VH 3O6BA 1KK8C 3OX5A 4M2OA 4ZCUA 1KFXL 1SYMA 1XK4C 4BY5A 2LANA 1IRJA 1NYAA 1BR1B 3SG5A 1QTXA 5ER4X 3VRQA 1CLMA 1BT6A 1F4OA 1ALVA 2KAVA 2ZFDA 4NDBA 1JF0A 1X02A 4PHKA 5HLOA 5HKYA 2LC5A 3NSIA 1UURA 2L2EA 1NP8A 1TTXA 1C7WA 2LUXA 2LE9B 1SNLA 1U5IA 1L7ZA 3PSRA 1B9AA 1NX3A 1NX1A 2KAYA 2AUCA 2KYCA 2Q91A 4ORCB 4D1EA 3CTNA 4JWQA 1WY9A 3RLZA 1KSOA 1F8HA 1YUTA 1IJ5A 1UHNA 2AAOA 1R2UA 3BQ3A 1QV0A 2MJWB 4MZKA 4PE7A 1J1DA 3IQOA 3TDZA 4M2PA 1LINA 2CCMA 1VRKA 1SL8A 5CSIA 2WOSA 2BKHB 3O78A 1CNPA 1NUBA 3AKAA 4U8DA 2LP3A 1K93D 1EJ3A 1LA0A 1WRLA 1B4CA 1L2OB 3O2PA 1CB1A 2ZRSA 4L9MA 1UHJA 2M9GA 3DVKA 2ZNDA 1NPQA 1RJVA 1YX8A 2MLEC 1Y6WA 1KFUS 2NLNA 3EKJA 2LM5A 3JVTC 4OV2A 1SCVA 1LKJA 1SR6C 4I5LB 1IWQA 2FOTA 1MXEA 2LHLA 2PALA 4WQ3A 4XYNA 4YGEB 4ICBA 2KSPA 3TUYB 3WNXB 3PN7B 2F2PA 1SKTA 1G33A 1MXLC 1BU3A 1BJFA 1YURA 1NSHA 4YGBB 2BE4A 3GK4X 2L4IA 1WDCB 2M3WA 1A2XA 1LXFC 1BR4B 2JULA 5D69A 4GNKB 3IF7A 1TNPA 1S36A 1QS7A 2LV7A 4GGFA 2OTGC 1DJGA 1DGVA 4YRUA 3SJSA 1ODBA 1OZSA 4M2QA 3SG2A 1JWDA 1TRFA 2K7CA 2MAZA 2CXJA 1DJWA 1KK8B 1TNQA 2NCPA 1G4YR 4GPLB 1AP4A 1NWDA 2NZ0A 2P6BB 1J7OA 4WQ2A 3K21A 1RECA 2KOTA 1AK8A 3E3RA 5BPJA 3LK1A 2VRGA 1IG5A 1M63B 1KFUL 4C0LA 4PE0A 3SIAA 2I94A 3EK7A 2I18A 3SG4A 4R1EA 1K94A 1PSBA 1B7TZ 5K89A 2BCAA 2KFFA 2KBIA 2K7OA 3FWCA 4DS7A 5CPVA 3D0YB 1AUIB 5D7FA 2MHHA 2WCBA 2K8MB 5FYXA 1MWNA 4PALA 4PE4A 1S5GZ 1YRTB 1S5GY 4YI8A 3TUYC 2H61A 3KPXA 5HLVA 1UHIA 2KFHA 1K96A 3PN7C 1PVAA 2WC8A 1OE9B 1OMVA 3JVTB 1CKKA 2LNKA 1RTP1 4I5KA 3PALA 1S6CA 1SR6B 3I5IC 5CSJA 1IH0A 2M49B 3OB2B 1OQPA 2KAXA 2KNEA 2WNDA 1YRUB 1JFJA 4JQ0D 2K7BA 4MZLA 1XFXO 1XK4A 1HQVA 3WHTB 3OX6A 4I5JA 1QASA 2GV5A 2Y1NA 1W7IB 2CBLA 4MZJA 3M0WA 4YBHB 1GJYA 1QXPA 2COLB 2OTGB 2LVIA 1ZACA 2BCBA 3CWGA 1XA5A 4F0ZB 3CR4X 4PHNA 1GQMA 3HCMA 2O60A 2L4HA 2WCEA 1B1GA 2G2BA 3D0YA 1PSRA 2ZN8A 3VRPA 2KDHA 1UP5A 2OS8C 1F71A 1KWOC 1YVLA 1CMFA 1PRWA 3H4SE 2M97A 1UWOA 1A75B 3DVMA 4FQOA 5I2OA 3RM1A 1WLMA 1ZFSA 1Y1AA 1DTLA 2HF5A 5HYDA 1JF2A 3EK4A 2ZNEA 4E68A 1CFPA 4A4CA 1EG3A 2BL0C 1J7RA 4HRHA 2JT0A 4GBAA 4I5NB 3IQQA 4ZCVA 4CLNA 1M45A 1RFJA 5CSNA 1BMOA 3AAJA 3DF0B 2PVBA 1NIWA 3TDUA 2HQWA 5I8NA 2KI6D 4NDCA 1V1GA 1ZUZA 3SG3A 1W7JB 1SCMC 3CR2A 1XYDA 2KQ6A 2SCPA 4N5XA 2R2IA 4HREE 5JOLA 4JPZB 4BY4A 1XFZO 1BG1A 2K2FA 1SMGA 5HKZA 3OHMB 1OOJA 1IGVA 1Y1XA 3ZNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OP0 A;  3PFV A;  4XJK B;  1SRA A;  3BUN B;  1B8L A;  2L0P A;  3CZT X;  1YUS A;  1MF8 B;  2KGB C;  1J7Q A;  2CT9 A;  1FI5 A;  1K8U A;  1QJT A;  2FJU B;  1UHH A;  4MSP A;  1CDP A;  1NX2 A;  4GUK A;  4MRX A;  1J1E A;  3I5I B;  2IS9 A;  2JXC A;  2B1U A;  1RRO A;  1QLK A;  1NCY A;  3SIB A;  1K9P A;  1K95 A;  1MR8 A;  3DD4 A;  4ORA B;  3EKH A;  1SL9 A;  1A75 A;  1DJH A;  4PCW A;  2HQ8 A;  1KQM C;  3O4Y A;  1A4P A;  1CFF A;  2MBX A;  3BYA A;  3WXA A;  5I2Q A;  1OMR A;  1AJ4 A;  1HT9 A;  2M8U A;  5I2L A;  1QVI Z;  2JT8 A;  1QVI Y;  1CTR A;  3DVE A;  1GGW A;  2F3Z A;  1ZMZ A;  1R6P A;  2QAC A;  3BXK A;  3PAT A;  4AQI A;  4MRY A;  4CFQ A;  2V53 A;  4NQG A;  5IBW A;  1CDL A;  1EL4 A;  3BOW B;  3DF0 A;  1SBJ A;  2KI4 C;  2ISD A;  2EC6 C;  5AAN A;  3FIA A;  3GK2 A;  1KK7 Y;  1M39 A;  2OS8 B;  1KWO B;  2K7D A;  3KEV A;  1QIW A;  3CLN A;  1S3P A;  4QJ5 B;  2L50 A;  3JTD C;  2M7L A;  1UHK A;  3NXA A;  1MUX A;  1KSM A;  1A03 A;  4OKH A;  2E6W A;  4MBE A;  4MN0 A;  1WRZ A;  1ZOT B;  4DUQ A;  4XJK A;  1KQV A;  1KCY A;  3A8R A;  4MLW A;  3NSL A;  2BL0 B;  3QRX A;  2HET A;  4P2Y B;  2PSR A;  1DJY A;  5DKN A;  3CGA A;  2Y1M A;  1QAT A;  2EHB A;  1EG4 A;  3TS5 C;  1IJ6 A;  1NCZ A;  1F70 A;  1LVC D;  3GOF A;  2BBN A;  4PE1 A;  2JNX A;  2LLU A;  3I5F C;  4NDD A;  4PHM A;  1JC2 A;  1M46 A;  1FBV A;  1AVS A;  2Q4U A;  3I5H C;  1SCM B;  2LVJ A;  1CM4 A;  1DF0 B;  2K0J A;  3CS1 A;  2JRF A;  3VRO A;  3AAK A;  1KFX S;  2TN4 A;  2MLF C;  1WLZ A;  2M0R A;  2L5X B;  1OZO A;  1QIV A;  2GGZ A;  1RK9 A;  3LK0 A;  4GFT A;  5F6T A;  1QV1 A;  1YTZ C;  3GK1 A;  4GAO A;  1NX0 A;  2CTN A;  4CFR A;  1DJZ A;  3VRR A;  2RGI A;  3BOW A;  1TCF A;  4PDZ A;  4YGA A;  4IL1 A;  1K2H A;  1Q80 A;  1OSA A;  4GGN A;  3WHU B;  3EK8 A;  1ALW A;  2LCP A;  1MQ1 A;  1TN4 A;  1MHO A;  3PM8 A;  4P5O E;  1FF1 A;  2WOR A;  3SG6 A;  2KI6 C;  4OVN F;  2NCO A;  1KQM B;  1IQ3 A;  4CPV A;  1J7P A;  4MEW A;  1FI6 A;  3HX4 A;  5KSZ A;  1FW4 A;  1XO5 A;  2O5G A;  4C0J A;  1PUL A;  2OPO A;  5CSF A;  2LMV A;  5G08 A;  1JSA A;  1CLL A;  1QLS A;  2I2R E;  2K2A A;  2ZRT A;  2AMI A;  4YI9 A;  4TNC A;  1DVI A;  2KI4 B;  3D10 A;  4UPG A;  2EC6 B;  1GGZ A;  1CMG A;  5J3X A;  4HSZ A;  1DF0 A;  3TDI A;  2E30 A;  1QX2 A;  3BUO B;  4DCK A;  2BEC A;  1YR5 A;  1TNX A;  3VRN A;  3JTD B;  1H8B A;  3AKB A;  1YUU A;  1XVJ A;  2LVK A;  4WRI A;  1JFK A;  2LHI A;  3LLE A;  5KU1 A;  1D1O A;  1J55 A;  1K9K A;  3CR5 X;  1CFC A;  4YGC B;  1AJ5 A;  1S6I A;  1UUS A;  1CM1 A;  1V1F A;  2KYF A;  2LVV A;  2LLS A;  4C0K A;  4PHJ A;  1XFU O;  3NSO A;  3TS5 B;  2LMT A;  3VGO A;  1WRK A;  1B47 A;  2JTZ A;  1F4Q A;  3EVU A;  1CDN A;  2BCX A;  3I5F B;  1DT7 B;  3I5H B;  1YVH A;  2NXQ A;  3OB1 B;  1K9U A;  2FCE A;  3I5G C;  3MSE B;  4N1F A;  2L98 A;  2KGR A;  2DOQ A;  4AOM A;  2EGD A;  2JQ6 A;  2WCF A;  3KF9 A;  3FWB A;  3C1V A;  3SG7 A;  3ICB A;  2BBM A;  5PAL A;  1CDM A;  5JJG A;  3F45 A;  1F55 A;  2I7A A;  2Y5I A;  1LA3 A;  2MA2 A;  1C7V A;  3LCP C;  1TNW A;  1TIZ A;  3TZ1 A;  2QPT A;  2JPT A;  2ZN9 A;  4OCI A;  1SK6 D;  1SW8 A;  2JOJ A;  1JUO A;  4DRW A;  2HPS A;  3A4U B;  2G9B A;  4N1G A;  1BLQ A;  1B8R A;  1DGU A;  5ER5 A;  4ORB B;  3EVR A;  2M29 A;  1N0Y A;  3KHE A;  1KK7 Z;  1RWY A;  3DVJ A;  3ZWH A;  1PVB A;  1PAL A;  1DJX A;  5AXI A;  2F3Y A;  4Q04 A;  1XFV O;  2FCD A;  2JC2 A;  2K61 A;  4GGF C;  1CFD A;  2H2K A;  5AEQ A;  2JXL A;  1TOP A;  1FPW A;  4AQJ A;  2PMY A;  1BOC A;  2BE6 A;  1C07 A;  2LP2 A;  1BOD A;  2L51 A;  1CLB A;  2MRD A;  5AER A;  1F54 A;  1IQ5 A;  1B8C A;  2KFG A;  3EVV A;  2GGM A;  2JNF A;  2JTT A;  1AHR A;  1DJI A;  4YGD B;  5AFP A;  1IKU A;  3PLF B;  2JT3 A;  2LUC A;  5B8I B;  1H4B A;  5DKQ A;  5HKW A;  5TNC A;  1PK0 D;  1OMD A;  4USL A;  5GQQ C;  2M1K B;  1E8A A;  1B7T Y;  1S1E A;  2A4J A;  2LLT A;  4QJ4 B;  1BF5 A;  1EH2 A;  1L2O C;  1A29 A;  2PAS A;  1S26 D;  1G8I A;  1QX7 A;  2Y4Q A;  4DIR A;  2M7N A;  4A4B A;  1K90 D;  2JZI A;  4MVF A;  1TCO B;  4CID A;  1U5I B;  2M1U A;  1S6J A;  1XFY O;  1EXR A;  2SAS A;  2F33 A;  2D8N A;  2BKI B;  4ETO A;  4QJ3 B;  1DMO A;  1Y1U A;  2JWW A;  1QX5 B;  2KHN A;  2ZKM X;  1NCX A;  1N65 A;  3I5G B;  1WDC C;  1XFW O;  2CNP A;  3BUW B;  2KBM A;  1JBA A;  3BUM B;  4HRG A;  3LL8 B;  3FS7 A;  2H61 C;  2F2O A;  4OR9 B;  1YX7 A;  5DKR A;  4FTG A;  2LAP A;  3NSK A;  3BUX B;  2LMU A;  2KQY A;  2PRU A;  2F8P A;  2JU0 A;  1SL7 A;  1M31 A;  1SY9 A;  5KTY A;  3KO0 A;  1N2D A;  1SPY A;  1Y0V H;  3O6B A;  1KK8 C;  3OX5 A;  4M2O A;  4ZCU A;  1KFX L;  1SYM A;  1XK4 C;  4BY5 A;  2LAN A;  1IRJ A;  1NYA A;  1BR1 B;  3SG5 A;  1QTX A;  5ER4 X;  3VRQ A;  1CLM A;  1BT6 A;  1F4O A;  1ALV A;  2KAV A;  2ZFD A;  4NDB A;  1JF0 A;  1X02 A;  4PHK A;  5HLO A;  5HKY A;  2LC5 A;  3NSI A;  1UUR A;  2L2E A;  1NP8 A;  1TTX A;  1C7W A;  2LUX A;  2LE9 B;  1SNL A;  1U5I A;  1L7Z A;  3PSR A;  1B9A A;  1NX3 A;  1NX1 A;  2KAY A;  2AUC A;  2KYC A;  2Q91 A;  4ORC B;  4D1E A;  3CTN A;  4JWQ A;  1WY9 A;  3RLZ A;  1KSO A;  1F8H A;  1YUT A;  1IJ5 A;  1UHN A;  2AAO A;  1R2U A;  3BQ3 A;  1QV0 A;  2MJW B;  4MZK A;  4PE7 A;  1J1D A;  3IQO A;  3TDZ A;  4M2P A;  1LIN A;  2CCM A;  1VRK A;  1SL8 A;  5CSI A;  2WOS A;  2BKH B;  3O78 A;  1CNP A;  1NUB A;  3AKA A;  4U8D A;  2LP3 A;  1K93 D;  1EJ3 A;  1LA0 A;  1WRL A;  1B4C A;  1L2O B;  3O2P A;  1CB1 A;  2ZRS A;  4L9M A;  1UHJ A;  2M9G A;  3DVK A;  2ZND A;  1NPQ A;  1RJV A;  1YX8 A;  2MLE C;  1Y6W A;  1KFU S;  2NLN A;  3EKJ A;  2LM5 A;  3JVT C;  4OV2 A;  1SCV A;  1LKJ A;  1SR6 C;  4I5L B;  1IWQ A;  2FOT A;  1MXE A;  2LHL A;  2PAL A;  4WQ3 A;  4XYN A;  4YGE B;  4ICB A;  2KSP A;  3TUY B;  3WNX B;  3PN7 B;  2F2P A;  1SKT A;  1G33 A;  1MXL C;  1BU3 A;  1BJF A;  1YUR A;  1NSH A;  4YGB B;  2BE4 A;  3GK4 X;  2L4I A;  1WDC B;  2M3W A;  1A2X A;  1LXF C;  1BR4 B;  2JUL A;  5D69 A;  4GNK B;  3IF7 A;  1TNP A;  1S36 A;  1QS7 A;  2LV7 A;  4GGF A;  2OTG C;  1DJG A;  1DGV A;  4YRU A;  3SJS A;  1ODB A;  1OZS A;  4M2Q A;  3SG2 A;  1JWD A;  1TRF A;  2K7C A;  2MAZ A;  2CXJ A;  1DJW A;  1KK8 B;  1TNQ A;  2NCP A;  1G4Y R;  4GPL B;  1AP4 A;  1NWD A;  2NZ0 A;  2P6B B;  1J7O A;  4WQ2 A;  3K21 A;  1REC A;  2KOT A;  1AK8 A;  3E3R A;  5BPJ A;  3LK1 A;  2VRG A;  1IG5 A;  1M63 B;  1KFU L;  4C0L A;  4PE0 A;  3SIA A;  2I94 A;  3EK7 A;  2I18 A;  3SG4 A;  4R1E A;  1K94 A;  1PSB A;  1B7T Z;  5K89 A;  2BCA A;  2KFF A;  2KBI A;  2K7O A;  3FWC A;  4DS7 A;  5CPV A;  3D0Y B;  1AUI B;  5D7F A;  2MHH A;  2WCB A;  2K8M B;  5FYX A;  1MWN A;  4PAL A;  4PE4 A;  1S5G Z;  1YRT B;  1S5G Y;  4YI8 A;  3TUY C;  2H61 A;  3KPX A;  5HLV A;  1UHI A;  2KFH A;  1K96 A;  3PN7 C;  1PVA A;  2WC8 A;  1OE9 B;  1OMV A;  3JVT B;  1CKK A;  2LNK A;  1RTP 1;  4I5K A;  3PAL A;  1S6C A;  1SR6 B;  3I5I C;  5CSJ A;  1IH0 A;  2M49 B;  3OB2 B;  1OQP A;  2KAX A;  2KNE A;  2WND A;  1YRU B;  1JFJ A;  4JQ0 D;  2K7B A;  4MZL A;  1XFX O;  1XK4 A;  1HQV A;  3WHT B;  3OX6 A;  4I5J A;  1QAS A;  2GV5 A;  2Y1N A;  1W7I B;  2CBL A;  4MZJ A;  3M0W A;  4YBH B;  1GJY A;  1QXP A;  2COL B;  2OTG B;  2LVI A;  1ZAC A;  2BCB A;  3CWG A;  1XA5 A;  4F0Z B;  3CR4 X;  4PHN A;  1GQM A;  3HCM A;  2O60 A;  2L4H A;  2WCE A;  1B1G A;  2G2B A;  3D0Y A;  1PSR A;  2ZN8 A;  3VRP A;  2KDH A;  1UP5 A;  2OS8 C;  1F71 A;  1KWO C;  1YVL A;  1CMF A;  1PRW A;  3H4S E;  2M97 A;  1UWO A;  1A75 B;  3DVM A;  4FQO A;  5I2O A;  3RM1 A;  1WLM A;  1ZFS A;  1Y1A A;  1DTL A;  2HF5 A;  5HYD A;  1JF2 A;  3EK4 A;  2ZNE A;  4E68 A;  1CFP A;  4A4C A;  1EG3 A;  2BL0 C;  1J7R A;  4HRH A;  2JT0 A;  4GBA A;  4I5N B;  3IQQ A;  4ZCV A;  4CLN A;  1M45 A;  1RFJ A;  5CSN A;  1BMO A;  3AAJ A;  3DF0 B;  2PVB A;  1NIW A;  3TDU A;  2HQW A;  5I8N A;  2KI6 D;  4NDC A;  1V1G A;  1ZUZ A;  3SG3 A;  1W7J B;  1SCM C;  3CR2 A;  1XYD A;  2KQ6 A;  2SCP A;  4N5X A;  2R2I A;  4HRE E;  5JOL A;  4JPZ B;  4BY4 A;  1XFZ O;  1BG1 A;  2K2F A;  1SMG A;  5HKZ A;  3OHM B;  1OOJ A;  1IGV A;  1Y1X A;  3ZNI A; 
#chains in the Genus database with same CATH topology
 3OP0 A;  3PFV A;  1OW4 A;  4XJK B;  1SRA A;  3BUN B;  1B8L A;  2L0P A;  3CZT X;  1YUS A;  1MF8 B;  2KGB C;  1J7Q A;  1GM0 A;  2CT9 A;  3NHI A;  1FI5 A;  1K8U A;  1QJT A;  2FJU B;  1UHH A;  4MSP A;  1CDP A;  1NX2 A;  4GUK A;  4MRX A;  1J1E A;  2KPH A;  3I5I B;  2IS9 A;  2JXC A;  2B1U A;  1RRO A;  1QLK A;  1NCY A;  3R1V A;  1K9P A;  3SIB A;  1K95 A;  3D76 A;  2QEV A;  1MR8 A;  3DD4 A;  4ORA B;  3EKH A;  1SL9 A;  1A75 A;  1DJH A;  4OZD A;  4PCW A;  2HQ8 A;  1KQM C;  3O4Y A;  1A4P A;  1CFF A;  2MBX A;  3BYA A;  3WXA A;  5I2Q A;  1OMR A;  1AJ4 A;  1HT9 A;  2M8U A;  5I2L A;  1QVI Z;  2JT8 A;  1QVI Y;  4KYN A;  3D75 A;  2KLE A;  1CTR A;  3SS5 A;  2QEO A;  3DVE A;  1GGW A;  2F3Z A;  1ZMZ A;  3CZ2 A;  1R6P A;  2QAC A;  3BXK A;  3PAT A;  4AQI A;  4MRY A;  4CFQ A;  2V53 A;  4NQG A;  5IBW A;  1CDL A;  1EL4 A;  3BOW B;  3DF0 A;  1SBJ A;  2KI4 C;  4INW A;  3K1E A;  2ISD A;  2EC6 C;  5AAN A;  3FIA A;  3GK2 A;  1KK7 Y;  4JKT A;  1M39 A;  1QWV A;  3FE6 A;  2PYQ A;  3FE8 A;  2OS8 B;  1KWO B;  2K7D A;  3KEV A;  1QIW A;  3CLN A;  1S3P A;  4JD9 A;  4QJ5 B;  2L50 A;  3JTD C;  2M7L A;  1UHK A;  3NXA A;  1MUX A;  1KSM A;  1A03 A;  4OKH A;  2E6W A;  4MBE A;  4MN0 A;  1WRZ A;  1ZOT B;  4DUQ A;  4XJK A;  1KQV A;  1KCY A;  3A8R A;  4MLW A;  3NSL A;  2BL0 B;  3QRX A;  2HET A;  4P2Y B;  2PSR A;  1DJY A;  5DKN A;  3CGA A;  3DXL A;  2Y1M A;  1QAT A;  2EHB A;  1EG4 A;  3TS5 C;  1IJ6 A;  1NCZ A;  1F70 A;  1LVC D;  3GOF A;  2BBN A;  4PE1 A;  2JNX A;  3Q8I A;  2LLU A;  3CAB A;  3I5F C;  4NDD A;  4PHM A;  1JC2 A;  1M46 A;  1FBV A;  1AVS A;  2Q4U A;  3I5H C;  1SCM B;  2LVJ A;  1CM4 A;  1DF0 B;  2K0J A;  3CS1 A;  2JRF A;  3VRO A;  3AAK A;  1KFX S;  2TN4 A;  2MLF C;  1WLZ A;  2M0R A;  2L5X B;  1OZO A;  1QIV A;  2GGZ A;  1RK9 A;  3LK0 A;  4GFT A;  5F6T A;  1QV1 A;  1YTZ C;  3GK1 A;  4GAO A;  1NX0 A;  2CTN A;  4CFR A;  1DEK A;  1DJZ A;  3VRR A;  2RGI A;  3BOW A;  1TCF A;  4PDZ A;  4YGA A;  4IL1 A;  1K2H A;  1Q80 A;  1OSA A;  4GGN A;  3WHU B;  3EK8 A;  1ALW A;  2LCP A;  1MQ1 A;  1TN4 A;  1MHO A;  3PM8 A;  4P5O E;  1FF1 A;  2WOR A;  3S0B A;  3SG6 A;  3BFB A;  2KI6 C;  4OVN F;  2NCO A;  1KQM B;  1IQ3 A;  2QEB A;  4CPV A;  1J7P A;  4MEW A;  4F7F A;  1FI6 A;  3B7A A;  3HX4 A;  5KSZ A;  1FW4 A;  1XO5 A;  2O5G A;  4C0J A;  1PUL A;  2OPO A;  5CSF A;  2LMV A;  5G08 A;  1SSE B;  1JSA A;  1CLL A;  1QLS A;  1W9Z A;  2I2R E;  2K2A A;  2AMI A;  2ZRT A;  4YI9 A;  1C3Y A;  4TNC A;  1DVI A;  2KI4 B;  3D10 A;  4UPG A;  2EC6 B;  1GGZ A;  1CMG A;  5J3X A;  4HSZ A;  1DF0 A;  2JPO A;  3TDI A;  3DY9 A;  2E30 A;  1QX2 A;  3BUO B;  4DCK A;  2BEC A;  1OOF A;  1YR5 A;  1TNX A;  3VRN A;  3JTD B;  1H8B A;  3AKB A;  1YUU A;  1XVJ A;  2LVK A;  4WRI A;  1JFK A;  2LHI A;  3LLE A;  5KU1 A;  1D1O A;  1TWO A;  1J55 A;  1K9K A;  3CR5 X;  1CFC A;  4YGC B;  1AJ5 A;  1S6I A;  1UUS A;  1CM1 A;  1V1F A;  2KYF A;  2LVV A;  2LLS A;  4C0K A;  4PHJ A;  1XFU O;  3FE9 A;  3NSO A;  3TS5 B;  2LMT A;  3VGO A;  1WRK A;  2P70 A;  1B47 A;  2JTZ A;  1F4Q A;  3EVU A;  1CDN A;  2BCX A;  3I5F B;  1DT7 B;  3I5H B;  1YVH A;  2NXQ A;  2K60 A;  1Z4H A;  4FQT A;  3OB1 B;  3D77 A;  1K9U A;  2FCE A;  3I5G C;  3MSE B;  4N1F A;  2L98 A;  2KGR A;  3UNW A;  5HL1 A;  2DOQ A;  4AOM A;  2EGD A;  2JQ6 A;  2WCF A;  3KF9 A;  3FWB A;  3C1V A;  3SG7 A;  3ICB A;  2BBM A;  5PAL A;  1CDM A;  5JJG A;  3F45 A;  1F55 A;  2QEH A;  2I7A A;  2Y5I A;  1LA3 A;  2MA2 A;  1C7V A;  3LCP C;  1TNW A;  1TIZ A;  3TZ1 A;  2QPT A;  2JPT A;  2ZN9 A;  4OCI A;  1SK6 D;  1SW8 A;  2JOJ A;  1JUO A;  4DRW A;  2HPS A;  3A4U B;  2G9B A;  4IJ7 A;  4N1G A;  1BLQ A;  1B8R A;  1DGU A;  5ER5 A;  4ORB B;  3EVR A;  2M29 A;  1N0Y A;  3KHE A;  1KK7 Z;  1RWY A;  3DVJ A;  3ZWH A;  1PVB A;  1PAL A;  3S0E A;  1DJX A;  3NGV A;  5AXI A;  2F3Y A;  3L47 A;  4Q04 A;  1XFV O;  2FCD A;  2JC2 A;  2WCL A;  2K61 A;  4GGF C;  1CFD A;  2H2K A;  5AEQ A;  2JXL A;  1TOP A;  1FPW A;  3DZT A;  3S0G A;  4AQJ A;  2PMY A;  1BOC A;  2BE6 A;  1C07 A;  2LP2 A;  1BOD A;  2L51 A;  1CLB A;  2MRD A;  2P71 A;  5AER A;  1F54 A;  1IQ5 A;  1B8C A;  2KFG A;  1XFR A;  2GGM A;  3EVV A;  2JNF A;  2JTT A;  1AHR A;  1DJI A;  4YGD B;  5AFP A;  1IKU A;  3PLF B;  2JT3 A;  2LUC A;  5B8I B;  1H4B A;  5DKQ A;  5HKW A;  3R1P A;  5TNC A;  1PK0 D;  1OMD A;  4USL A;  5GQQ C;  2M1K B;  1E8A A;  1B7T Y;  1OOI X;  1S1E A;  2A4J A;  2LLT A;  4QJ4 B;  1BF5 A;  1EH2 A;  1L2O C;  2GTE A;  1A29 A;  2PAS A;  1S26 D;  1G8I A;  1QX7 A;  2Y4Q A;  3BFA A;  4DIR A;  2M7N A;  4A4B A;  1K90 D;  2JZI A;  4MVF A;  1TCO B;  4CID A;  1U5I B;  2M1U A;  1S6J A;  1XFY O;  1EXR A;  2SAS A;  2F33 A;  2D8N A;  2BKI B;  3D78 A;  1TUZ A;  4ETO A;  4QJ3 B;  1DMO A;  1Y1U A;  2JWW A;  1QX5 B;  2KHN A;  2ZKM X;  1NCX A;  1N65 A;  3O4X A;  3I5G B;  1WDC C;  3V2L A;  1XFW O;  3EG5 B;  2CNP A;  3BUW B;  2KBM A;  1P28 A;  1JBA A;  3BUM B;  4HRG A;  3LL8 B;  3FS7 A;  1DC1 A;  2H61 C;  2F2O A;  4OR9 B;  1YX7 A;  5DKR A;  4FTG A;  2LAP A;  3NSK A;  3BUX B;  2LMU A;  2KQY A;  2PRU A;  2F8P A;  2JU0 A;  1SL7 A;  3VB1 A;  1M31 A;  1SY9 A;  5KTY A;  3KO0 A;  3BFH A;  1N2D A;  1ORG A;  1SPY A;  1Y0V H;  3O6B A;  3B88 A;  3UO9 A;  1KK8 C;  3OX5 A;  4M2O A;  4ZCU A;  1KFX L;  1SYM A;  1XK4 C;  4BY5 A;  2LAN A;  1IRJ A;  1NYA A;  1BR1 B;  3SG5 A;  1QTX A;  5ER4 X;  3VRQ A;  1CLM A;  1BT6 A;  1F4O A;  1ALV A;  2KAV A;  2ZFD A;  4NDB A;  1JF0 A;  1X02 A;  4PHK A;  5HLO A;  5HKY A;  2LC5 A;  3NSI A;  1UUR A;  2L2E A;  1NP8 A;  1TTX A;  1C7W A;  2LUX A;  2LE9 B;  1SNL A;  1U5I A;  2L5Y A;  1L7Z A;  3PSR A;  3D73 A;  1B9A A;  1NX3 A;  1NX1 A;  2KAY A;  2AUC A;  2KYC A;  2Q91 A;  3CZ1 A;  4ORC B;  4D1E A;  3CTN A;  4JWQ A;  1WY9 A;  3B6X A;  1KSO A;  3PJI A;  1YUT A;  3RLZ A;  1F8H A;  1IJ5 A;  1UHN A;  2AAO A;  1R2U A;  3BQ3 A;  1QV0 A;  2MJW B;  4MZK A;  5DIC A;  3IVT A;  3CYZ A;  4PE7 A;  1J1D A;  3IQO A;  3TDZ A;  4M2P A;  1LIN A;  2CCM A;  1VRK A;  1OOH A;  1SL8 A;  5CSI A;  2WOS A;  2BKH B;  3O78 A;  3SS4 A;  1CNP A;  1NUB A;  3AKA A;  2WCM A;  2LP3 A;  4U8D A;  1K93 D;  1EJ3 A;  1LA0 A;  1WRL A;  1B4C A;  1L2O B;  3O2P A;  1CB1 A;  2ZRS A;  3DYE A;  4L9M A;  1UHJ A;  2M9G A;  3DVK A;  2ZND A;  3N7H A;  1NPQ A;  5D3O A;  1RJV A;  1YX8 A;  2MLE C;  1Y6W A;  1KFU S;  2NLN A;  3EKJ A;  2LM5 A;  2FJY A;  3JVT C;  4OV2 A;  1SCV A;  1LKJ A;  1SR6 C;  4I5L B;  1IWQ A;  2FOT A;  1MXE A;  2LHL A;  2PAL A;  4WQ3 A;  4XYN A;  4YGE B;  4ICB A;  2KSP A;  3TUY B;  3WNX B;  3PN7 B;  2F2P A;  1SKT A;  1G33 A;  1MXL C;  1BU3 A;  1BJF A;  1YUR A;  3B86 A;  1NSH A;  4YGB B;  2BE4 A;  3GK4 X;  2L4I A;  4INX A;  1OOG A;  1WDC B;  2M3W A;  1A2X A;  1LXF C;  1BR4 B;  2JUL A;  5D69 A;  4GNK B;  3IF7 A;  1TNP A;  1S36 A;  1QS7 A;  2LV7 A;  4GGF A;  2ERB A;  2OTG C;  1T14 A;  1DJG A;  4PT1 A;  1DGV A;  4YRU A;  3OBV A;  3SJS A;  1ODB A;  1OZS A;  4M2Q A;  3OGN A;  3SG2 A;  1JWD A;  1TRF A;  2K7C A;  2MAZ A;  2CXJ A;  2WC5 A;  3R1O A;  1DJW A;  1KK8 B;  5I94 A;  1TNQ A;  2NCP A;  1G4Y R;  2KLD A;  2BNX A;  2QDI A;  4GPL B;  1AP4 A;  1NWD A;  2NZ0 A;  2P6B B;  1J7O A;  4WQ2 A;  3K21 A;  1REC A;  2KOT A;  1AK8 A;  3E3R A;  5BPJ A;  3LK1 A;  2VRG A;  1IG5 A;  1M63 B;  1KFU L;  4C0L A;  5EL2 A;  4PE0 A;  3SIA A;  2I94 A;  3EK7 A;  2I18 A;  3SG4 A;  2H8V A;  1K94 A;  1PSB A;  4R1E A;  3S0D A;  1B7T Z;  5K89 A;  1C3Z A;  2BCA A;  2KFF A;  2KBI A;  2K7O A;  3FWC A;  4DS7 A;  3L4A A;  5CPV A;  3D0Y B;  1AUI B;  5D7F A;  2MHH A;  2WCB A;  2K8M B;  3S0F A;  5FYX A;  1MWN A;  4PAL A;  4PE4 A;  1S5G Z;  2WCK A;  1YRT B;  1S5G Y;  4YI8 A;  3TUY C;  2H61 A;  3KPX A;  5HLV A;  1UHI A;  5FI2 A;  2KFH A;  1K96 A;  3PN7 C;  1PVA A;  3D74 A;  1LS8 A;  2WC8 A;  1OE9 B;  1OMV A;  3R72 A;  3JVT B;  1CKK A;  5FI6 A;  2WCH A;  2LNK A;  1RTP 1;  4I5K A;  3PAL A;  1S6C A;  1SR6 B;  3I5I C;  5CSJ A;  1IH0 A;  2M49 B;  3OB2 B;  1OQP A;  2L2C A;  2KAX A;  2KNE A;  2WND A;  1YRU B;  1JFJ A;  4JQ0 D;  2K7B A;  4MZL A;  1XFX O;  1XK4 A;  1HQV A;  3WHT B;  3OX6 A;  4I5J A;  3L4L A;  1QAS A;  1DQE A;  2GV5 A;  2Y1N A;  3CDN A;  2YGU A;  1W7I B;  2CBL A;  4MZJ A;  3M0W A;  4YBH B;  1GJY A;  1QXP A;  2COL B;  2OTG B;  2LVI A;  1ZAC A;  2BCB A;  1DEL A;  5FI7 A;  3CWG A;  1XA5 A;  4F0Z B;  3CR4 X;  3SS3 A;  4PHN A;  1GQM A;  3HCM A;  2O60 A;  2L4H A;  2WCE A;  1TUJ A;  1B1G A;  2G2B A;  3D0Y A;  2WC6 A;  1PSR A;  2ZN8 A;  3VRP A;  2KDH A;  1UP5 A;  2OS8 C;  1F71 A;  1KWO C;  1YVL A;  1CMF A;  3NHT A;  1PRW A;  3QME A;  3H4S E;  2M97 A;  1UWO A;  1Z2C B;  1A75 B;  3DVM A;  4FQO A;  5I2O A;  3RM1 A;  2PQL A;  3CZ0 A;  1WLM A;  1ZFS A;  1Y1A A;  1DTL A;  2HF5 A;  1IIO A;  5HYD A;  1JF2 A;  3EK4 A;  2ZNE A;  4E68 A;  1CFP A;  4A4C A;  1EG3 A;  2BL0 C;  1J7R A;  4HRH A;  2JT0 A;  3S0A A;  4GBA A;  4I5N B;  3IQQ A;  4ZCV A;  4CLN A;  1M45 A;  1RFJ A;  3PM2 A;  3RZS A;  5CSN A;  1BMO A;  3AAJ A;  3DF0 B;  2PVB A;  1NIW A;  2WCJ A;  2HQW A;  3TDU A;  2KI6 D;  5I8N A;  2BAP A;  4NDC A;  1V1G A;  1ZUZ A;  3SG3 A;  1W7J B;  1SCM C;  3CR2 A;  1XYD A;  2KQ6 A;  2SCP A;  4N5X A;  2R2I A;  4HRE E;  5JOL A;  4JPZ B;  4BY4 A;  1XFZ O;  1BG1 A;  2K2F A;  1SMG A;  3BJH A;  5HKZ A;  3OHM B;  1OOJ A;  1IGV A;  1Y1X A;  3B87 A;  3ZNI A; 
#chains in the Genus database with same CATH homology
 3OP0 A;  3PFV A;  4XJK B;  1SRA A;  3BUN B;  1B8L A;  2L0P A;  3CZT X;  1YUS A;  1MF8 B;  2KGB C;  1J7Q A;  2CT9 A;  1FI5 A;  1K8U A;  1QJT A;  2FJU B;  1UHH A;  4MSP A;  1CDP A;  1NX2 A;  4GUK A;  4MRX A;  1J1E A;  3I5I B;  2IS9 A;  2JXC A;  2B1U A;  1RRO A;  1QLK A;  1NCY A;  3SIB A;  1K9P A;  1K95 A;  1MR8 A;  3DD4 A;  4ORA B;  3EKH A;  1SL9 A;  1A75 A;  1DJH A;  4PCW A;  2HQ8 A;  1KQM C;  3O4Y A;  1A4P A;  1CFF A;  2MBX A;  3BYA A;  3WXA A;  5I2Q A;  1OMR A;  1AJ4 A;  1HT9 A;  2M8U A;  5I2L A;  1QVI Z;  2JT8 A;  1QVI Y;  1CTR A;  3DVE A;  1GGW A;  2F3Z A;  1ZMZ A;  1R6P A;  2QAC A;  3BXK A;  3PAT A;  4AQI A;  4MRY A;  4CFQ A;  2V53 A;  4NQG A;  5IBW A;  1CDL A;  1EL4 A;  3BOW B;  3DF0 A;  1SBJ A;  2KI4 C;  2ISD A;  2EC6 C;  5AAN A;  3FIA A;  3GK2 A;  1KK7 Y;  1M39 A;  2OS8 B;  1KWO B;  2K7D A;  3KEV A;  1QIW A;  3CLN A;  1S3P A;  4QJ5 B;  2L50 A;  3JTD C;  2M7L A;  1UHK A;  3NXA A;  1MUX A;  1KSM A;  1A03 A;  4OKH A;  2E6W A;  4MBE A;  4MN0 A;  1WRZ A;  1ZOT B;  4DUQ A;  4XJK A;  1KQV A;  1KCY A;  3A8R A;  4MLW A;  3NSL A;  2BL0 B;  3QRX A;  2HET A;  4P2Y B;  2PSR A;  1DJY A;  5DKN A;  3CGA A;  2Y1M A;  1QAT A;  2EHB A;  1EG4 A;  3TS5 C;  1IJ6 A;  1NCZ A;  1F70 A;  1LVC D;  3GOF A;  2BBN A;  4PE1 A;  2JNX A;  2LLU A;  3I5F C;  4NDD A;  4PHM A;  1JC2 A;  1M46 A;  1FBV A;  1AVS A;  2Q4U A;  3I5H C;  1SCM B;  2LVJ A;  1CM4 A;  1DF0 B;  2K0J A;  3CS1 A;  2JRF A;  3VRO A;  3AAK A;  1KFX S;  2TN4 A;  2MLF C;  1WLZ A;  2M0R A;  2L5X B;  1OZO A;  1QIV A;  2GGZ A;  1RK9 A;  3LK0 A;  4GFT A;  5F6T A;  1QV1 A;  1YTZ C;  3GK1 A;  4GAO A;  1NX0 A;  2CTN A;  4CFR A;  1DJZ A;  3VRR A;  2RGI A;  3BOW A;  1TCF A;  4PDZ A;  4YGA A;  4IL1 A;  1K2H A;  1Q80 A;  1OSA A;  4GGN A;  3WHU B;  3EK8 A;  1ALW A;  2LCP A;  1MQ1 A;  1TN4 A;  1MHO A;  3PM8 A;  4P5O E;  1FF1 A;  2WOR A;  3SG6 A;  2KI6 C;  4OVN F;  2NCO A;  1KQM B;  1IQ3 A;  4CPV A;  1J7P A;  4MEW A;  1FI6 A;  3HX4 A;  5KSZ A;  1FW4 A;  1XO5 A;  2O5G A;  4C0J A;  1PUL A;  2OPO A;  5CSF A;  2LMV A;  5G08 A;  1JSA A;  1CLL A;  1QLS A;  2I2R E;  2K2A A;  2ZRT A;  2AMI A;  4YI9 A;  4TNC A;  1DVI A;  2KI4 B;  3D10 A;  4UPG A;  2EC6 B;  1GGZ A;  1CMG A;  5J3X A;  4HSZ A;  1DF0 A;  3TDI A;  2E30 A;  1QX2 A;  3BUO B;  4DCK A;  2BEC A;  1YR5 A;  1TNX A;  3VRN A;  3JTD B;  1H8B A;  3AKB A;  1YUU A;  1XVJ A;  2LVK A;  4WRI A;  1JFK A;  2LHI A;  3LLE A;  5KU1 A;  1D1O A;  1J55 A;  1K9K A;  3CR5 X;  1CFC A;  4YGC B;  1AJ5 A;  1S6I A;  1UUS A;  1CM1 A;  1V1F A;  2KYF A;  2LVV A;  2LLS A;  4C0K A;  4PHJ A;  1XFU O;  3NSO A;  3TS5 B;  2LMT A;  3VGO A;  1WRK A;  1B47 A;  2JTZ A;  1F4Q A;  3EVU A;  1CDN A;  2BCX A;  3I5F B;  1DT7 B;  3I5H B;  1YVH A;  2NXQ A;  3OB1 B;  1K9U A;  2FCE A;  3I5G C;  3MSE B;  4N1F A;  2L98 A;  2KGR A;  2DOQ A;  4AOM A;  2EGD A;  2JQ6 A;  2WCF A;  3KF9 A;  3FWB A;  3C1V A;  3SG7 A;  3ICB A;  2BBM A;  5PAL A;  1CDM A;  5JJG A;  3F45 A;  1F55 A;  2I7A A;  2Y5I A;  1LA3 A;  2MA2 A;  1C7V A;  3LCP C;  1TNW A;  1TIZ A;  3TZ1 A;  2QPT A;  2JPT A;  2ZN9 A;  4OCI A;  1SK6 D;  1SW8 A;  2JOJ A;  1JUO A;  4DRW A;  2HPS A;  3A4U B;  2G9B A;  4N1G A;  1BLQ A;  1B8R A;  1DGU A;  5ER5 A;  4ORB B;  3EVR A;  2M29 A;  1N0Y A;  3KHE A;  1KK7 Z;  1RWY A;  3DVJ A;  3ZWH A;  1PVB A;  1PAL A;  1DJX A;  5AXI A;  2F3Y A;  4Q04 A;  1XFV O;  2FCD A;  2JC2 A;  2K61 A;  4GGF C;  1CFD A;  2H2K A;  5AEQ A;  2JXL A;  1TOP A;  1FPW A;  4AQJ A;  2PMY A;  1BOC A;  2BE6 A;  1C07 A;  2LP2 A;  1BOD A;  2L51 A;  1CLB A;  2MRD A;  5AER A;  1F54 A;  1IQ5 A;  1B8C A;  2KFG A;  3EVV A;  2GGM A;  2JNF A;  2JTT A;  1AHR A;  1DJI A;  4YGD B;  5AFP A;  1IKU A;  3PLF B;  2JT3 A;  2LUC A;  5B8I B;  1H4B A;  5DKQ A;  5HKW A;  5TNC A;  1PK0 D;  1OMD A;  4USL A;  5GQQ C;  2M1K B;  1E8A A;  1B7T Y;  1S1E A;  2A4J A;  2LLT A;  4QJ4 B;  1BF5 A;  1EH2 A;  1L2O C;  1A29 A;  2PAS A;  1S26 D;  1G8I A;  1QX7 A;  2Y4Q A;  4DIR A;  2M7N A;  4A4B A;  1K90 D;  2JZI A;  4MVF A;  1TCO B;  4CID A;  1U5I B;  2M1U A;  1S6J A;  1XFY O;  1EXR A;  2SAS A;  2F33 A;  2D8N A;  2BKI B;  4ETO A;  4QJ3 B;  1DMO A;  1Y1U A;  2JWW A;  1QX5 B;  2KHN A;  2ZKM X;  1NCX A;  1N65 A;  3I5G B;  1WDC C;  1XFW O;  2CNP A;  3BUW B;  2KBM A;  1JBA A;  3BUM B;  4HRG A;  3LL8 B;  3FS7 A;  2H61 C;  2F2O A;  4OR9 B;  1YX7 A;  5DKR A;  4FTG A;  2LAP A;  3NSK A;  3BUX B;  2LMU A;  2KQY A;  2PRU A;  2F8P A;  2JU0 A;  1SL7 A;  1M31 A;  1SY9 A;  5KTY A;  3KO0 A;  1N2D A;  1SPY A;  1Y0V H;  3O6B A;  1KK8 C;  3OX5 A;  4M2O A;  4ZCU A;  1KFX L;  1SYM A;  1XK4 C;  4BY5 A;  2LAN A;  1IRJ A;  1NYA A;  1BR1 B;  3SG5 A;  1QTX A;  5ER4 X;  3VRQ A;  1CLM A;  1BT6 A;  1F4O A;  1ALV A;  2KAV A;  2ZFD A;  4NDB A;  1JF0 A;  1X02 A;  4PHK A;  5HLO A;  5HKY A;  2LC5 A;  3NSI A;  1UUR A;  2L2E A;  1NP8 A;  1TTX A;  1C7W A;  2LUX A;  2LE9 B;  1SNL A;  1U5I A;  1L7Z A;  3PSR A;  1B9A A;  1NX3 A;  1NX1 A;  2KAY A;  2AUC A;  2KYC A;  2Q91 A;  4ORC B;  4D1E A;  3CTN A;  4JWQ A;  1WY9 A;  3RLZ A;  1KSO A;  1F8H A;  1YUT A;  1IJ5 A;  1UHN A;  2AAO A;  1R2U A;  3BQ3 A;  1QV0 A;  2MJW B;  4MZK A;  4PE7 A;  1J1D A;  3IQO A;  3TDZ A;  4M2P A;  1LIN A;  2CCM A;  1VRK A;  1SL8 A;  5CSI A;  2WOS A;  2BKH B;  3O78 A;  1CNP A;  1NUB A;  3AKA A;  4U8D A;  2LP3 A;  1K93 D;  1EJ3 A;  1LA0 A;  1WRL A;  1B4C A;  1L2O B;  3O2P A;  1CB1 A;  2ZRS A;  4L9M A;  1UHJ A;  2M9G A;  3DVK A;  2ZND A;  1NPQ A;  1RJV A;  1YX8 A;  2MLE C;  1Y6W A;  1KFU S;  2NLN A;  3EKJ A;  2LM5 A;  3JVT C;  4OV2 A;  1SCV A;  1LKJ A;  1SR6 C;  4I5L B;  1IWQ A;  2FOT A;  1MXE A;  2LHL A;  2PAL A;  4WQ3 A;  4XYN A;  4YGE B;  4ICB A;  2KSP A;  3TUY B;  3WNX B;  3PN7 B;  2F2P A;  1SKT A;  1G33 A;  1MXL C;  1BU3 A;  1BJF A;  1YUR A;  1NSH A;  4YGB B;  2BE4 A;  3GK4 X;  2L4I A;  1WDC B;  2M3W A;  1A2X A;  1LXF C;  1BR4 B;  2JUL A;  5D69 A;  4GNK B;  3IF7 A;  1TNP A;  1S36 A;  1QS7 A;  2LV7 A;  4GGF A;  2OTG C;  1DJG A;  1DGV A;  4YRU A;  3SJS A;  1ODB A;  1OZS A;  4M2Q A;  3SG2 A;  1JWD A;  1TRF A;  2K7C A;  2MAZ A;  2CXJ A;  1DJW A;  1KK8 B;  1TNQ A;  2NCP A;  1G4Y R;  4GPL B;  1AP4 A;  1NWD A;  2NZ0 A;  2P6B B;  1J7O A;  4WQ2 A;  3K21 A;  1REC A;  2KOT A;  1AK8 A;  3E3R A;  5BPJ A;  3LK1 A;  2VRG A;  1IG5 A;  1M63 B;  1KFU L;  4C0L A;  4PE0 A;  3SIA A;  2I94 A;  3EK7 A;  2I18 A;  3SG4 A;  4R1E A;  1K94 A;  1PSB A;  1B7T Z;  5K89 A;  2BCA A;  2KFF A;  2KBI A;  2K7O A;  3FWC A;  4DS7 A;  5CPV A;  3D0Y B;  1AUI B;  5D7F A;  2MHH A;  2WCB A;  2K8M B;  5FYX A;  1MWN A;  4PAL A;  4PE4 A;  1S5G Z;  1YRT B;  1S5G Y;  4YI8 A;  3TUY C;  2H61 A;  3KPX A;  5HLV A;  1UHI A;  2KFH A;  1K96 A;  3PN7 C;  1PVA A;  2WC8 A;  1OE9 B;  1OMV A;  3JVT B;  1CKK A;  2LNK A;  1RTP 1;  4I5K A;  3PAL A;  1S6C A;  1SR6 B;  3I5I C;  5CSJ A;  1IH0 A;  2M49 B;  3OB2 B;  1OQP A;  2KAX A;  2KNE A;  2WND A;  1YRU B;  1JFJ A;  4JQ0 D;  2K7B A;  4MZL A;  1XFX O;  1XK4 A;  1HQV A;  3WHT B;  3OX6 A;  4I5J A;  1QAS A;  2GV5 A;  2Y1N A;  1W7I B;  2CBL A;  4MZJ A;  3M0W A;  4YBH B;  1GJY A;  1QXP A;  2COL B;  2OTG B;  2LVI A;  1ZAC A;  2BCB A;  3CWG A;  1XA5 A;  4F0Z B;  3CR4 X;  4PHN A;  1GQM A;  3HCM A;  2O60 A;  2L4H A;  2WCE A;  1B1G A;  2G2B A;  3D0Y A;  1PSR A;  2ZN8 A;  3VRP A;  2KDH A;  1UP5 A;  2OS8 C;  1F71 A;  1KWO C;  1YVL A;  1CMF A;  1PRW A;  3H4S E;  2M97 A;  1UWO A;  1A75 B;  3DVM A;  4FQO A;  5I2O A;  3RM1 A;  1WLM A;  1ZFS A;  1Y1A A;  1DTL A;  2HF5 A;  5HYD A;  1JF2 A;  3EK4 A;  2ZNE A;  4E68 A;  1CFP A;  4A4C A;  1EG3 A;  2BL0 C;  1J7R A;  4HRH A;  2JT0 A;  4GBA A;  4I5N B;  3IQQ A;  4ZCV A;  4CLN A;  1M45 A;  1RFJ A;  5CSN A;  1BMO A;  3AAJ A;  3DF0 B;  2PVB A;  1NIW A;  3TDU A;  2HQW A;  5I8N A;  2KI6 D;  4NDC A;  1V1G A;  1ZUZ A;  3SG3 A;  1W7J B;  1SCM C;  3CR2 A;  1XYD A;  2KQ6 A;  2SCP A;  4N5X A;  2R2I A;  4HRE E;  5JOL A;  4JPZ B;  4BY4 A;  1XFZ O;  1BG1 A;  2K2F A;  1SMG A;  5HKZ A;  3OHM B;  1OOJ A;  1IGV A;  1Y1X A;  3ZNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...