4YGDB

Crystal structure of ergic-53/mcfd2, monoclinic calcium-bound form 2
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
79
structure length
69
Chain Sequence
MSPQELQLHYFKMHDYDGNNLLDGLELSTAITHPLMSEDELINIIDGVLRDDDKNNDGYIDYAEFAKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein ERGIC-53
publication title Interaction mode of coagulation factors V and VIII with the cargo receptor MCFD2/ERGIC-53 complex
rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 26
structure length 69
sequence length 79
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ygdB00
2FJUB 1SCMC 3LLEA 4MZLA 1JF2A 1R6PA 1S6JA 4N1GA 2CT9A 3CR2A 2L4HA 1TCOB 1YUUA 5CSJA 1F70A 1DTLA 2K2AA 1F71A 2LVIA 4MBEA 1BLQA 1CTRA 1LA0A 2K2FA 4PCWA 3KEVA 3ZWHA 3D0YB 2MAZA 2JWWA 1KFUL 1WLMA 1XFYO 4QJ3B 1RK9A 3PM8A 4XJKA 2I18A 1ALVA 1CDMA 1QLKA 1CMGA 4JPZB 2LVVA 5CSIA 1IH0A 1QATA 2EC6C 4DS7A 3TS5B 1J1EA 4P5OE 1HQVA 1PK0D 2KFHA 1XA5A 1KFXL 2E30A 5HLOA 3IF7A 3AKBA 4GGNA 1EJ3A 5G08A 4MRYA 4DRWA 1IWQA 2QPTA 2L5XB 1D1OA 1IQ5A 1N2DA 2I94A 2LCPA 2OPOA 1QASA 1H4BA 2JNFA 2WNDA 1CMFA 2CNPA 1CDNA 1K8UA 2WCFA 5D7FA 2KBMA 2PASA 1CM1A 4CLNA 1NCZA 1QJTA 1OSAA 2O60A 2BCXA 2ZRTA 1OOJA 1ZFSA 1S3PA 1V1FA 2EGDA 2EHBA 1XFXO 3O2PA 3CS1A 1PSBA 1QX7A 1SY9A 2MBXA 1TOPA 2F8PA 3OP0A 3BOWB 2FCDA 2OS8C 1VRKA 3PFVA 1L2OC 2L98A 5D69A 2LVJA 1NCXA 2CCMA 2COLB 1AHRA 2H2KA 2LVKA 3HX4A 2CXJA 2LAPA 3ZNIA 4I5JA 4N1FA 1Y1AA 3NXAA 3I5IC 2ISDA 1QIVA 2Y4QA 2NZ0A 3EK8A 1LXFC 1SL7A 3TDZA 1C7VA 3DF0B 4GNKB 1C07A 2BBNA 1XK4A 4WRIA 1NPQA 1DJWA 2GGZA 2HQWA 1RWYA 2ZKMX 1BT6A 1K9UA 1MXEA 3I5GB 1S1EA 5HKWA 1AVSA 1XO5A 3EK4A 1DJIA 3TS5C 2Q91A 1NX0A 3OHMB 4NDBA 1SBJA 2BKHB 2R2IA 4I5NB 2HPSA 4JQ0D 3I5FB 3LK1A 2M3WA 1B4CA 3CR5X 4YGAA 2JU0A 2WCEA 4R1EA 3A4UB 1IJ5A 3TUYC 4GGFA 4PE1A 2KHNA 4ZCUA 2K7CA 2BCAA 3FWCA 3IQOA 1F8HA 2Y5IA 1CLLA 1SL8A 2PMYA 1UHJA 1GJYA 2LUCA 2JC2A 3SG7A 2JQ6A 2LE9B 1CFCA 3K21A 4PDZA 1DJHA 1OZSA 1IG5A 3ICBA 1AUIB 1DT7B 3SIBA 2JTZA 4Q04A 2KFGA 1B8LA 2LMUA 3BQ3A 3JTDC 4CPVA 1WRZA 1YX8A 3PATA 4A4CA 3DVMA 1RROA 5JOLA 2AAOA 1ZMZA 2WORA 4JWQA 1M45A 2M49B 3A8RA 5DKRA 4C0JA 1G4YR 1TNXA 1XFWO 1BODA 1YX7A 4WQ3A 4ZCVA 1DF0B 2DOQA 3I5GC 1CFDA 1GGZA 1AP4A 2E6WA 3PALA 5K89A 1TTXA 2ZFDA 2KGBC 4AQIA 2NCOA 5DKQA 2KI4C 4ORBB 3KF9A 1FF1A 1KFUS 2LANA 3PLFB 4PALA 1A75A 1E8AA 2BKIB 1DJXA 4GUKA 3GK2A 2IS9A 5I2OA 4DCKA 2MA2A 3I5HC 5IBWA 1CDPA 1QX5B 2LHIA 3VRNA 3BXKA 2M1KB 3BYAA 1KK7Y 1QVIY 3SG3A 1ODBA 1K93D 1OZOA 1QIWA 1S36A 2BL0B 3BUXB 5J3XA 1IGVA 2F3YA 2KGRA 1JF0A 2QACA 3VRRA 5I8NA 1KK7Z 1TIZA 1F4QA 2HF5A 4I5LB 1KFXS 1OMDA 2G9BA 3SG2A 3NSOA 3VRPA 4HSZA 3OX5A 1SR6B 1K96A 2M7LA 2NLNA 4PE4A 3DD4A 3EVRA 2Y1MA 1PALA 4MRXA 1DMOA 1W7IB 3FWBA 1CDLA 3C1VA 1QS7A 4ICBA 2JOJA 1CFFA 3BUMB 1JFKA 1Y1UA 1KK8C 2JPTA 2PSRA 1YRUB 3VROA 1XFZO 1XYDA 2H61C 3CLNA 1KWOC 1RECA 1WRLA 4HRGA 1JC2A 5BPJA 1OQPA 1B7TY 1C7WA 1HT9A 2KAXA 1K2HA 1WRKA 3EVVA 1RJVA 2GV5A 3E3RA 4YGCB 2M0RA 1UWOA 1TNQA 2M9GA 2HQ8A 1XFUO 2WOSA 1Y6WA 4PE0A 1YURA 1UHIA 2D8NA 4HRHA 1DVIA 1Y0VH 1G8IA 1KQMB 1JBAA 2MRDA 3EKJA 2BL0C 3JVTB 2F2OA 1ZOTB 1PRWA 2ZNEA 3SG4A 1BJFA 1NWDA 2KSPA 3O6BA 2G2BA 1YVHA 4L9MA 2LLUA 4OCIA 1N0YA 2FOTA 3NSKA 4PHKA 3SG6A 2BECA 2LHLA 4CFQA 1SW8A 1B47A 4YGEB 3SG5A 1JSAA 1DJYA 1J7QA 2LLTA 1ALWA 2JNXA 1NUBA 1PVAA 2I7AA 2NCPA 1WDCB 4C0KA 2OTGB 3AAJA 2KNEA 5AERA 1PVBA 2KI6C 1EXRA 4OV2A 1WLZA 4XJKB 4PHMA 1JFJA 2K8MB 1LVCD 1LA3A 5I2LA 3LL8B 1MXLC 3WNXB 2JTTA 3WXAA 1KCYA 4USLA 3OX6A 4MEWA 3HCMA 2SCPA 3KO0A 1MF8B 1K9KA 2MLFC 3PN7B 3DVJA 1DGUA 2LMTA 1MQ1A 3D0YA 1IJ6A 1S5GY 2LMVA 3GK4X 4M2OA 2LC5A 2K7DA 2L4IA 1CFPA 1M39A 4F0ZB 5AFPA 1WY9A 1B9AA 3NSIA 2JT3A 2RGIA 4U8DA 1TCFA 2M29A 3RM1A 2MLEC 1TN4A 4GAOA 1H8BA 2KBIA 2CTNA 5AANA 1SNLA 3TDUA 5HYDA 1TNPA 1DGVA 1SYMA 4E68A 1F55A 3VRQA 5FYXA 4ORAB 2BE4A 3WHUB 1R2UA 1YVLA 2NXQA 5DKNA 2V53A 4N5XA 2O5GA 4WQ2A 2JZIA 3VGOA 1BR1B 4CFRA 3BUNB 2LUXA 1QTXA 3FIAA 1FI6A 2OTGC 2SASA 3CWGA 2M8UA 3F45A 2EC6B 1CKKA 1DJGA 3I5FC 1GQMA 3MSEB 2KI6D 1S6CA 5KSZA 2JXLA 1U5IA 3OB1B 3EK7A 1K9PA 1KSOA 4HREE 4IL1A 1PSRA 3NSLA 2M7NA 1ZACA 1AJ5A 5AEQA 1FBVA 2P6BB 2Q4UA 3TZ1A 4I5KA 5PALA 1IKUA 1J7RA 2F33A 3D10A 1QVIZ 1OE9B 1ZUZA 4YGDB 3IQQA 1F54A 4NQGA 2PRUA 5HKZA 5CPVA 1AJ4A 2CBLA 1BMOA 1F4OA 4YI9A 1KQVA 2K0JA 3LCPC 1BF5A 2BBMA 3O78A 5F6TA 3DF0A 2K61A 1NYAA 1CM4A 5AXIA 5B8IB 1LKJA 1TRFA 1XVJA 2OS8B 1IQ3A 2F2PA 2ZN9A 1L2OB 1NCYA 1SCVA 2L51A 1B1GA 1X02A 2LNKA 2HETA 3BUOB 3CR4X 1JUOA 1G33A 2JXCA 2L0PA 1UHNA 5ER5A 1NSHA 5HKYA 3M0WA 1FPWA 1IRJA 2Y1NA 4DUQA 2K7BA 3CGAA 1SRAA 2KYCA 3I5IB 1QXPA 5CSNA 2A4JA 4NDDA 1UHKA 1AK8A 3BUWB 1M31A 4D1EA 1FI5A 4BY5A 4MSPA 4YI8A 2ZNDA 2JT8A 1CLMA 4PE7A 5HLVA 1Q80A 2F3ZA 1J7OA 1XK4C 1M63B 3DVKA 1B7TZ 1S26D 3FS7A 1GGWA 2B1UA 1EG4A 2L50A 4QJ5B 3CZTX 1SPYA 4M2PA 1QV1A 1FW4A 2JT0A 1A4PA 3AAKA 2KAVA 1M46A 1UUSA 2BE6A 3EVUA 1A29A 2AUCA 3TUYB 1A75B 1SR6C 2PALA 2BCBA 1A03A 1SMGA 4XYNA 1U5IB 2ZN8A 2MJWB 3KPXA 4GBAA 4GGFC 1MR8A 1K90D 2LP2A 1QX2A 1J55A 1SK6D 1BU3A 1DF0A 4MZKA 2H61A 5GQQC 2VRGA 3SJSA 1EG3A 4C0LA 4YBHB 3JTDB 1UP5A 1CNPA 2LV7A 3GOFA 4MN0A 4M2QA 4MLWA 2LP3A 1YRTB 3OB2B 1V1GA 2L2EA 1CB1A 1BOCA 3LK0A 2JRFA 2PVBA 1S6IA 3H4SE 3TDIA 1K94A 2KYFA 1MWNA 1PULA 2KFFA 1EH2A 1NX2A 3EKHA 4PHJA 1OMVA 3CTNA 1XFVO 1NP8A 1UHHA 1MHOA 1KSMA 2KI4B 4ORCB 2KDHA 2GGMA 1CLBA 4YGBB 3WHTB 1LINA 1N65A 4FQOA 4AOMA 5KU1A 5KTYA 4GFTA 1SCMB 1L7ZA 4TNCA 5I2QA 4OR9B 1KQMC 1W7JB 1S5GZ 1OMRA 2M97A 3JVTC 3O4YA 3I5HB 3AKAA 1TNWA 4UPGA 2WC8A 1J1DA 1A2XA 3GK1A 2LM5A 2I2RE 1EL4A 3SIAA 4PHNA 1NX3A 3KHEA 2MHHA 2KQYA 1UURA 3PSRA 2AMIA 5JJGA 1YTZC 1YUTA 1QV0A 2KQ6A 1NX1A 1YR5A 2M1UA 1K95A 2ZRSA 5CSFA 4DIRA 5TNCA 2LLSA 2FCEA 4P2YB 4CIDA 1WDCC 3DVEA 5ER4X 1BR4B 1Y1XA 1MUXA 2KOTA 1RTP1 4QJ4B 2JULA 1BG1A 4MZJA 1RFJA 2KAYA 4OVNF 1JWDA 4ETOA 4FTGA 1SL9A 1KK8B 3BOWA 4YRUA 3QRXA 4MVFA 4AQJA 1YUSA 1KWOB 1NIWA 1B8RA 1B8CA 2WCBA 2TN4A 3PN7C 3RLZA 2K7OA 1J7PA 1QLSA 4NDCA 1SKTA 1DJZA 4OKHA 4BY4A 4A4BA 4GPLB
chains in the Genus database with same CATH superfamily
2FJUB 1SCMC 3LLEA 4MZLA 1JF2A 1R6PA 1S6JA 3S0BA 4N1GA 2CT9A 3CR2A 2L4HA 1TCOB 1YUUA 5CSJA 1F70A 1DTLA 2K2AA 3NGVA 1F71A 2LVIA 4MBEA 1BLQA 1CTRA 5I94A 2KPHA 1LA0A 3V2LA 2K2FA 4PCWA 3KEVA 3ZWHA 3D0YB 2MAZA 2JWWA 1KFUL 1WLMA 1XFYO 4QJ3B 1RK9A 3PM8A 4XJKA 2I18A 1ALVA 1CDMA 1QLKA 1CMGA 3D76A 4JPZB 2LVVA 2L5YA 5CSIA 1IH0A 3BJHA 3L47A 1QATA 2EC6C 4DS7A 3TS5B 1J1EA 4P5OE 1HQVA 1PK0D 2KFHA 1XA5A 1KFXL 2E30A 5HLOA 3IF7A 4INWA 3AKBA 4GGNA 1EJ3A 5G08A 4MRYA 4DRWA 1IWQA 2QPTA 2L5XB 1D1OA 1IQ5A 1N2DA 2I94A 2LCPA 2OPOA 1QASA 1H4BA 2JNFA 2WNDA 1CMFA 2CNPA 1CDNA 1K8UA 2WCFA 5D7FA 2KBMA 2PASA 1CM1A 4CLNA 1NCZA 1QJTA 1OSAA 2O60A 2BCXA 4IJ7A 2ZRTA 1OOJA 1ZFSA 1S3PA 1V1FA 2EGDA 2EHBA 1XFXO 3CZ2A 3O2PA 3CS1A 1PSBA 1QX7A 1SY9A 2MBXA 1TOPA 2F8PA 3OP0A 3CABA 3BOWB 2FCDA 3NHTA 2OS8C 1VRKA 5DICA 3DY9A 3PFVA 1L2OC 2L98A 5D69A 2LVJA 1NCXA 2CCMA 2COLB 1AHRA 2YGUA 2H2KA 2LVKA 5FI2A 3HX4A 2CXJA 2LAPA 3ZNIA 3PM2A 4I5JA 4N1FA 1Y1AA 3NXAA 3I5IC 2ISDA 1QIVA 2Y4QA 2NZ0A 3EK8A 1LXFC 1SL7A 1TWOA 3TDZA 1C7VA 3DF0B 4GNKB 1C07A 2BBNA 1XK4A 1QWVA 4WRIA 1NPQA 1DJWA 2GGZA 2HQWA 1RWYA 2ZKMX 1BT6A 1K9UA 1GM0A 1MXEA 3I5GB 1S1EA 5HKWA 1AVSA 1XO5A 1DELA 3EK4A 1DJIA 3TS5C 2Q91A 1NX0A 5EL2A 3OHMB 4NDBA 1SBJA 2BKHB 2R2IA 4I5NB 2HPSA 3L4AA 3I5FB 4JQ0D 3LK1A 2M3WA 2PQLA 3CR5X 1B4CA 4YGAA 2JU0A 2WCEA 4R1EA 3A4UB 1IJ5A 3TUYC 4GGFA 4PE1A 2KHNA 4ZCUA 2QDIA 2K7CA 2BCAA 3FWCA 2JPOA 3IQOA 1F8HA 2Y5IA 3S0AA 1CLLA 1SL8A 2PMYA 1UHJA 1GJYA 2LUCA 2JC2A 3SG7A 2JQ6A 2LE9B 1C3YA 1CFCA 3K21A 4PDZA 1DJHA 1OZSA 1IG5A 3ICBA 1AUIB 1DT7B 3SIBA 2JTZA 4Q04A 3S0FA 2GTEA 3VB1A 2KFGA 1B8LA 2LMUA 3BQ3A 3JTDC 4CPVA 1WRZA 1XFRA 1YX8A 3OGNA 3QMEA 3PATA 4A4CA 2KLDA 3PJIA 3DVMA 1RROA 5JOLA 5HL1A 2AAOA 1ZMZA 2WORA 4JWQA 1M45A 2M49B 3A8RA 5DKRA 4C0JA 3VRRA 1G4YR 1TNXA 1XFWO 2K60A 1YX7A 4WQ3A 1BODA 4ZCVA 1DF0B 2DOQA 3I5GC 1CFDA 1GGZA 3R1VA 2E6WA 3PALA 5K89A 1TTXA 1AP4A 2ZFDA 2KGBC 4AQIA 2NCOA 5DKQA 3L4LA 2KI4C 4ORBB 3KF9A 1FF1A 1KFUS 2LANA 3PLFB 4PALA 1A75A 1E8AA 2BKIB 1DJXA 4GUKA 3GK2A 2IS9A 3B86A 5I2OA 3K1EA 4DCKA 2MA2A 3I5HC 5IBWA 1CDPA 1QX5B 2LHIA 3VRNA 3BXKA 3D78A 2M1KB 2QEHA 3BYAA 1KK7Y 1QVIY 3SG3A 1ODBA 1K93D 1OZOA 1QIWA 1S36A 2BL0B 3BUXB 4INXA 5J3XA 1IGVA 2F3YA 2KGRA 1JF0A 2QACA 2QEVA 3D77A 3S0EA 1KK7Z 1TIZA 1F4QA 2HF5A 4I5LB 1KFXS 3D73A 1OMDA 3SS3A 2G9BA 3SG2A 3NSOA 3VRPA 4HSZA 3OX5A 1SR6B 1K96A 2M7LA 2NLNA 4PE4A 3DD4A 3EVRA 3EG5B 2Y1MA 2BAPA 1PALA 2WCHA 4MRXA 1DMOA 1W7IB 3FWBA 1CDLA 3C1VA 1QS7A 2P71A 4ICBA 2JOJA 1CFFA 1LS8A 3BUMB 1JFKA 1Y1UA 1KK8C 2JPTA 2PSRA 3DZTA 1YRUB 3VROA 1XFZO 1XYDA 2H61C 3CLNA 1KWOC 1TUZA 3R72A 1RECA 1WRLA 4HRGA 3CYZA 1JC2A 5BPJA 1OQPA 1B7TY 1C7WA 1HT9A 3B7AA 2KAXA 1K2HA 1WRKA 3EVVA 1RJVA 2GV5A 3E3RA 4YGCB 2M0RA 1UWOA 1TNQA 2M9GA 2HQ8A 1XFUO 2WOSA 1Y6WA 4PE0A 1YURA 1UHIA 2D8NA 1TUJA 4HRHA 1DVIA 1Y0VH 1G8IA 1KQMB 1JBAA 2MRDA 3EKJA 3NHIA 2BL0C 3JVTB 2F2OA 1ZOTB 1PRWA 2ZNEA 3SG4A 1BJFA 1NWDA 2KSPA 3O6BA 2G2BA 1YVHA 4L9MA 2LLUA 4OCIA 1N0YA 2FOTA 3NSKA 4PHKA 2WCMA 3SG6A 2BECA 2LHLA 4CFQA 1SW8A 1B47A 4YGEB 3SG5A 2WCLA 1JSAA 1DJYA 1J7QA 2LLTA 1ALWA 2JNXA 1NUBA 1PVAA 2I7AA 2NCPA 1WDCB 4C0KA 2OTGB 3AAJA 2KNEA 5AERA 1PVBA 2KI6C 2FJYA 1EXRA 2BNXA 4OV2A 1WLZA 4XJKB 4PHMA 1JFJA 2K8MB 3R1PA 1LVCD 1LA3A 5I2LA 3LL8B 1MXLC 3WNXB 2JTTA 3WXAA 1KCYA 4USLA 3OX6A 4MEWA 3HCMA 2SCPA 3FE8A 3KO0A 1MF8B 1K9KA 2MLFC 3PN7B 3DVJA 3S0GA 1DGUA 2LMTA 1MQ1A 3D0YA 1IJ6A 1S5GY 2LMVA 3GK4X 4M2OA 2LC5A 2K7DA 5D3OA 2WC6A 2L4IA 1CFPA 1M39A 2PYQA 4F0ZB 5AFPA 1WY9A 1B9AA 3NSIA 2JT3A 2RGIA 4U8DA 3CDNA 1TCFA 2M29A 3RM1A 2MLEC 1TN4A 4GAOA 5I8NA 2KBIA 1H8BA 2CTNA 5AANA 1OOIX 1SNLA 3TDUA 5HYDA 1TNPA 1DGVA 1SYMA 4E68A 1F55A 3SS4A 3VRQA 5FYXA 4ORAB 2BE4A 3WHUB 1R2UA 1YVLA 2NXQA 5DKNA 2V53A 4N5XA 2O5GA 4WQ2A 2JZIA 3VGOA 1P28A 1BR1B 4CFRA 3BUNB 2LUXA 1OOFA 1OW4A 1QTXA 3FIAA 1FI6A 2OTGC 2SASA 3CWGA 2M8UA 1ORGA 3F45A 2EC6B 1CKKA 1DJGA 3I5FC 1GQMA 3MSEB 2KI6D 1S6CA 5KSZA 1DQEA 2JXLA 1U5IA 2H8VA 3OB1B 3EK7A 1K9PA 1KSOA 4HREE 4IL1A 1PSRA 3NSLA 2M7NA 1ZACA 2L2CA 1AJ5A 5AEQA 1FBVA 2P6BB 2Q4UA 3CZ0A 3TZ1A 4I5KA 5PALA 1IKUA 1J7RA 2F33A 3D10A 1QVIZ 1OE9B 1ZUZA 4OZDA 3IQQA 4YGDB 1F54A 1W9ZA 3D74A 4NQGA 2PRUA 5HKZA 5CPVA 1AJ4A 2CBLA 1BMOA 1F4OA 2WCKA 4YI9A 1KQVA 2K0JA 4FQTA 3LCPC 1BF5A 2BBMA 3O78A 5F6TA 3DF0A 2K61A 1NYAA 1CM4A 5AXIA 5B8IB 1LKJA 1TRFA 1XVJA 2OS8B 1IQ3A 2F2PA 2ZN9A 1L2OB 1NCYA 1SCVA 2L51A 1B1GA 1X02A 2LNKA 2HETA 3BUOB 3CR4X 1JUOA 1G33A 2JXCA 2L0PA 1UHNA 1Z2CB 1NSHA 5ER5A 3M0WA 5HKYA 1FPWA 1IRJA 2Y1NA 4DUQA 2K7BA 3CGAA 1SRAA 2KYCA 3I5IB 1QXPA 5CSNA 2A4JA 4NDDA 1UHKA 1AK8A 3BUWB 1M31A 4D1EA 3R1OA 1FI5A 4BY5A 4MSPA 4YI8A 3Q8IA 2ZNDA 2JT8A 1CLMA 4PE7A 3O4XA 5HLVA 1Q80A 2F3ZA 1J7OA 2WCJA 1XK4C 1M63B 3DVKA 1B7TZ 1S26D 3FS7A 1GGWA 2B1UA 1EG4A 2L50A 4QJ5B 3CZTX 1SPYA 4PT1A 4M2PA 3UO9A 1OOHA 1QV1A 1FW4A 2JT0A 3FE9A 1A4PA 3BFAA 3AAKA 1OOGA 2KAVA 1M46A 1C3ZA 1UUSA 2BE6A 3B88A 3EVUA 1A29A 2AUCA 3TUYB 1A75B 1SR6C 2PALA 2BCBA 2QEBA 1A03A 1SMGA 4XYNA 3IVTA 1U5IB 2ZN8A 1DEKA 2MJWB 3KPXA 4GBAA 4GGFC 2QEOA 1MR8A 1K90D 2LP2A 1QX2A 1J55A 1SK6D 1BU3A 1DF0A 4MZKA 2H61A 5GQQC 2VRGA 3SJSA 1EG3A 3DYEA 3UNWA 4C0LA 3S0DA 1IIOA 4YBHB 3JTDB 1UP5A 1CNPA 2LV7A 3GOFA 4MN0A 4M2QA 4MLWA 1Z4HA 2LP3A 1YRTB 3OB2B 1V1GA 2L2EA 1CB1A 2P70A 1BOCA 2WC5A 3OBVA 3LK0A 2JRFA 2PVBA 3D75A 1S6IA 3H4SE 4JKTA 4JD9A 3TDIA 1K94A 2KYFA 3N7HA 1MWNA 1PULA 2KFFA 1EH2A 1NX2A 3EKHA 4PHJA 1OMVA 3CTNA 1XFVO 1NP8A 1UHHA 4KYNA 5FI6A 1MHOA 1KSMA 2KI4B 4ORCB 2KDHA 2GGMA 1CLBA 4YGBB 3FE6A 3WHTB 1LINA 1N65A 4FQOA 4AOMA 5KU1A 5KTYA 4GFTA 1SCMB 1L7ZA 4TNCA 3RZSA 5I2QA 4OR9B 1KQMC 1W7JB 1S5GZ 1OMRA 2M97A 3B87A 3JVTC 3O4YA 3I5HB 3AKAA 1TNWA 3BFHA 4UPGA 2WC8A 1J1DA 1A2XA 3GK1A 1DC1A 2LM5A 2I2RE 3BFBA 1EL4A 3SIAA 4PHNA 1SSEB 1NX3A 3KHEA 2MHHA 2KQYA 1UURA 3PSRA 2AMIA 5JJGA 1YTZC 1YUTA 1QV0A 2KQ6A 1NX1A 1YR5A 2M1UA 1K95A 2ZRSA 5FI7A 5CSFA 4DIRA 3SS5A 5TNCA 3DXLA 2LLSA 2FCEA 4P2YB 4CIDA 1WDCC 3DVEA 5ER4X 1BR4B 1Y1XA 1MUXA 2KOTA 2ERBA 1RTP1 1T14A 4QJ4B 2JULA 3CZ1A 1BG1A 4MZJA 4F7FA 1RFJA 2KAYA 4OVNF 1JWDA 2KLEA 4ETOA 4FTGA 1SL9A 1KK8B 3BOWA 4YRUA 3QRXA 4MVFA 4AQJA 1YUSA 1KWOB 3B6XA 1NIWA 1B8RA 1B8CA 2WCBA 2TN4A 3PN7C 3RLZA 2K7OA 1J7PA 1QLSA 4NDCA 1SKTA 1DJZA 4OKHA 4BY4A 4A4BA 4GPLB
chains in the Genus database with same CATH topology
2FJUB 1SCMC 3LLEA 4MZLA 1JF2A 1R6PA 1S6JA 4N1GA 2CT9A 3CR2A 2L4HA 1TCOB 1YUUA 5CSJA 1F70A 1DTLA 2K2AA 1F71A 2LVIA 4MBEA 1BLQA 1CTRA 1LA0A 2K2FA 4PCWA 3KEVA 3ZWHA 3D0YB 2MAZA 2JWWA 1KFUL 1WLMA 1XFYO 4QJ3B 1RK9A 3PM8A 4XJKA 2I18A 1ALVA 1CDMA 1QLKA 1CMGA 4JPZB 2LVVA 5CSIA 1IH0A 1QATA 2EC6C 4DS7A 3TS5B 1J1EA 4P5OE 1HQVA 1PK0D 2KFHA 1XA5A 1KFXL 2E30A 5HLOA 3IF7A 3AKBA 4GGNA 1EJ3A 5G08A 4MRYA 4DRWA 1IWQA 2QPTA 2L5XB 1D1OA 1IQ5A 1N2DA 2I94A 2LCPA 2OPOA 1QASA 1H4BA 2JNFA 2WNDA 1CMFA 2CNPA 1CDNA 1K8UA 2WCFA 5D7FA 2KBMA 2PASA 1CM1A 4CLNA 1NCZA 1QJTA 1OSAA 2O60A 2BCXA 2ZRTA 1OOJA 1ZFSA 1S3PA 1V1FA 2EGDA 2EHBA 1XFXO 3O2PA 3CS1A 1PSBA 1QX7A 1SY9A 2MBXA 1TOPA 2F8PA 3OP0A 3BOWB 2FCDA 2OS8C 1VRKA 3PFVA 1L2OC 2L98A 5D69A 2LVJA 1NCXA 2CCMA 2COLB 1AHRA 2H2KA 2LVKA 3HX4A 2CXJA 2LAPA 3ZNIA 4I5JA 4N1FA 1Y1AA 3NXAA 3I5IC 2ISDA 1QIVA 2Y4QA 2NZ0A 3EK8A 1LXFC 1SL7A 3TDZA 1C7VA 3DF0B 4GNKB 1C07A 2BBNA 1XK4A 4WRIA 1NPQA 1DJWA 2GGZA 2HQWA 1RWYA 2ZKMX 1BT6A 1K9UA 1MXEA 3I5GB 1S1EA 5HKWA 1AVSA 1XO5A 3EK4A 1DJIA 3TS5C 2Q91A 1NX0A 3OHMB 4NDBA 1SBJA 2BKHB 2R2IA 4I5NB 2HPSA 4JQ0D 3I5FB 3LK1A 2M3WA 1B4CA 3CR5X 4YGAA 2JU0A 2WCEA 4R1EA 3A4UB 1IJ5A 3TUYC 4GGFA 4PE1A 2KHNA 4ZCUA 2K7CA 2BCAA 3FWCA 3IQOA 1F8HA 2Y5IA 1CLLA 1SL8A 2PMYA 1UHJA 1GJYA 2LUCA 2JC2A 3SG7A 2JQ6A 2LE9B 1CFCA 3K21A 4PDZA 1DJHA 1OZSA 1IG5A 3ICBA 1AUIB 1DT7B 3SIBA 2JTZA 4Q04A 2KFGA 1B8LA 2LMUA 3BQ3A 3JTDC 4CPVA 1WRZA 1YX8A 3PATA 4A4CA 3DVMA 1RROA 5JOLA 2AAOA 1ZMZA 2WORA 4JWQA 1M45A 2M49B 3A8RA 5DKRA 4C0JA 1G4YR 1TNXA 1XFWO 1BODA 1YX7A 4WQ3A 4ZCVA 1DF0B 2DOQA 3I5GC 1CFDA 1GGZA 1AP4A 2E6WA 3PALA 5K89A 1TTXA 2ZFDA 2KGBC 4AQIA 2NCOA 5DKQA 2KI4C 4ORBB 3KF9A 1FF1A 1KFUS 2LANA 3PLFB 4PALA 1A75A 1E8AA 2BKIB 1DJXA 4GUKA 3GK2A 2IS9A 5I2OA 4DCKA 2MA2A 3I5HC 5IBWA 1CDPA 1QX5B 2LHIA 3VRNA 3BXKA 2M1KB 3BYAA 1KK7Y 1QVIY 3SG3A 1ODBA 1K93D 1OZOA 1QIWA 1S36A 2BL0B 3BUXB 5J3XA 1IGVA 2F3YA 2KGRA 1JF0A 2QACA 3VRRA 5I8NA 1KK7Z 1TIZA 1F4QA 2HF5A 4I5LB 1KFXS 1OMDA 2G9BA 3SG2A 3NSOA 3VRPA 4HSZA 3OX5A 1SR6B 1K96A 2M7LA 2NLNA 4PE4A 3DD4A 3EVRA 2Y1MA 1PALA 4MRXA 1DMOA 1W7IB 3FWBA 1CDLA 3C1VA 1QS7A 4ICBA 2JOJA 1CFFA 3BUMB 1JFKA 1Y1UA 1KK8C 2JPTA 2PSRA 1YRUB 3VROA 1XFZO 1XYDA 2H61C 3CLNA 1KWOC 1RECA 1WRLA 4HRGA 1JC2A 5BPJA 1OQPA 1B7TY 1C7WA 1HT9A 2KAXA 1K2HA 1WRKA 3EVVA 1RJVA 2GV5A 3E3RA 4YGCB 2M0RA 1UWOA 1TNQA 2M9GA 2HQ8A 1XFUO 2WOSA 1Y6WA 4PE0A 1YURA 1UHIA 2D8NA 4HRHA 1DVIA 1Y0VH 1G8IA 1KQMB 1JBAA 2MRDA 3EKJA 2BL0C 3JVTB 2F2OA 1ZOTB 1PRWA 2ZNEA 3SG4A 1BJFA 1NWDA 2KSPA 3O6BA 2G2BA 1YVHA 4L9MA 2LLUA 4OCIA 1N0YA 2FOTA 3NSKA 4PHKA 3SG6A 2BECA 2LHLA 4CFQA 1SW8A 1B47A 4YGEB 3SG5A 1JSAA 1DJYA 1J7QA 2LLTA 1ALWA 2JNXA 1NUBA 1PVAA 2I7AA 2NCPA 1WDCB 4C0KA 2OTGB 3AAJA 2KNEA 5AERA 1PVBA 2KI6C 1EXRA 4OV2A 1WLZA 4XJKB 4PHMA 1JFJA 2K8MB 1LVCD 1LA3A 5I2LA 3LL8B 1MXLC 3WNXB 2JTTA 3WXAA 1KCYA 4USLA 3OX6A 4MEWA 3HCMA 2SCPA 3KO0A 1MF8B 1K9KA 2MLFC 3PN7B 3DVJA 1DGUA 2LMTA 1MQ1A 3D0YA 1IJ6A 1S5GY 2LMVA 3GK4X 4M2OA 2LC5A 2K7DA 2L4IA 1CFPA 1M39A 4F0ZB 5AFPA 1WY9A 1B9AA 3NSIA 2JT3A 2RGIA 4U8DA 1TCFA 2M29A 3RM1A 2MLEC 1TN4A 4GAOA 1H8BA 2KBIA 2CTNA 5AANA 1SNLA 3TDUA 5HYDA 1TNPA 1DGVA 1SYMA 4E68A 1F55A 3VRQA 5FYXA 4ORAB 2BE4A 3WHUB 1R2UA 1YVLA 2NXQA 5DKNA 2V53A 4N5XA 2O5GA 4WQ2A 2JZIA 3VGOA 1BR1B 4CFRA 3BUNB 2LUXA 1QTXA 3FIAA 1FI6A 2OTGC 2SASA 3CWGA 2M8UA 3F45A 2EC6B 1CKKA 1DJGA 3I5FC 1GQMA 3MSEB 2KI6D 1S6CA 5KSZA 2JXLA 1U5IA 3OB1B 3EK7A 1K9PA 1KSOA 4HREE 4IL1A 1PSRA 3NSLA 2M7NA 1ZACA 1AJ5A 5AEQA 1FBVA 2P6BB 2Q4UA 3TZ1A 4I5KA 5PALA 1IKUA 1J7RA 2F33A 3D10A 1QVIZ 1OE9B 1ZUZA 4YGDB 3IQQA 1F54A 4NQGA 2PRUA 5HKZA 5CPVA 1AJ4A 2CBLA 1BMOA 1F4OA 4YI9A 1KQVA 2K0JA 3LCPC 1BF5A 2BBMA 3O78A 5F6TA 3DF0A 2K61A 1NYAA 1CM4A 5AXIA 5B8IB 1LKJA 1TRFA 1XVJA 2OS8B 1IQ3A 2F2PA 2ZN9A 1L2OB 1NCYA 1SCVA 2L51A 1B1GA 1X02A 2LNKA 2HETA 3BUOB 3CR4X 1JUOA 1G33A 2JXCA 2L0PA 1UHNA 5ER5A 1NSHA 5HKYA 3M0WA 1FPWA 1IRJA 2Y1NA 4DUQA 2K7BA 3CGAA 1SRAA 2KYCA 3I5IB 1QXPA 5CSNA 2A4JA 4NDDA 1UHKA 1AK8A 3BUWB 1M31A 4D1EA 1FI5A 4BY5A 4MSPA 4YI8A 2ZNDA 2JT8A 1CLMA 4PE7A 5HLVA 1Q80A 2F3ZA 1J7OA 1XK4C 1M63B 3DVKA 1B7TZ 1S26D 3FS7A 1GGWA 2B1UA 1EG4A 2L50A 4QJ5B 3CZTX 1SPYA 4M2PA 1QV1A 1FW4A 2JT0A 1A4PA 3AAKA 2KAVA 1M46A 1UUSA 2BE6A 3EVUA 1A29A 2AUCA 3TUYB 1A75B 1SR6C 2PALA 2BCBA 1A03A 1SMGA 4XYNA 1U5IB 2ZN8A 2MJWB 3KPXA 4GBAA 4GGFC 1MR8A 1K90D 2LP2A 1QX2A 1J55A 1SK6D 1BU3A 1DF0A 4MZKA 2H61A 5GQQC 2VRGA 3SJSA 1EG3A 4C0LA 4YBHB 3JTDB 1UP5A 1CNPA 2LV7A 3GOFA 4MN0A 4M2QA 4MLWA 2LP3A 1YRTB 3OB2B 1V1GA 2L2EA 1CB1A 1BOCA 3LK0A 2JRFA 2PVBA 1S6IA 3H4SE 3TDIA 1K94A 2KYFA 1MWNA 1PULA 2KFFA 1EH2A 1NX2A 3EKHA 4PHJA 1OMVA 3CTNA 1XFVO 1NP8A 1UHHA 1MHOA 1KSMA 2KI4B 4ORCB 2KDHA 2GGMA 1CLBA 4YGBB 3WHTB 1LINA 1N65A 4FQOA 4AOMA 5KU1A 5KTYA 4GFTA 1SCMB 1L7ZA 4TNCA 5I2QA 4OR9B 1KQMC 1W7JB 1S5GZ 1OMRA 2M97A 3JVTC 3O4YA 3I5HB 3AKAA 1TNWA 4UPGA 2WC8A 1J1DA 1A2XA 3GK1A 2LM5A 2I2RE 1EL4A 3SIAA 4PHNA 1NX3A 3KHEA 2MHHA 2KQYA 1UURA 3PSRA 2AMIA 5JJGA 1YTZC 1YUTA 1QV0A 2KQ6A 1NX1A 1YR5A 2M1UA 1K95A 2ZRSA 5CSFA 4DIRA 5TNCA 2LLSA 2FCEA 4P2YB 4CIDA 1WDCC 3DVEA 5ER4X 1BR4B 1Y1XA 1MUXA 2KOTA 1RTP1 4QJ4B 2JULA 1BG1A 4MZJA 1RFJA 2KAYA 4OVNF 1JWDA 4ETOA 4FTGA 1SL9A 1KK8B 3BOWA 4YRUA 3QRXA 4MVFA 4AQJA 1YUSA 1KWOB 1NIWA 1B8RA 1B8CA 2WCBA 2TN4A 3PN7C 3RLZA 2K7OA 1J7PA 1QLSA 4NDCA 1SKTA 1DJZA 4OKHA 4BY4A 4A4BA 4GPLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FJU B;  1SCM C;  3LLE A;  4MZL A;  1JF2 A;  1R6P A;  1S6J A;  4N1G A;  2CT9 A;  3CR2 A;  2L4H A;  1TCO B;  1YUU A;  5CSJ A;  1F70 A;  1DTL A;  2K2A A;  1F71 A;  2LVI A;  4MBE A;  1BLQ A;  1CTR A;  1LA0 A;  2K2F A;  4PCW A;  3KEV A;  3ZWH A;  3D0Y B;  2MAZ A;  2JWW A;  1KFU L;  1WLM A;  1XFY O;  4QJ3 B;  1RK9 A;  3PM8 A;  4XJK A;  2I18 A;  1ALV A;  1CDM A;  1QLK A;  1CMG A;  4JPZ B;  2LVV A;  5CSI A;  1IH0 A;  1QAT A;  2EC6 C;  4DS7 A;  3TS5 B;  1J1E A;  4P5O E;  1HQV A;  1PK0 D;  2KFH A;  1XA5 A;  1KFX L;  2E30 A;  5HLO A;  3IF7 A;  3AKB A;  4GGN A;  1EJ3 A;  5G08 A;  4MRY A;  4DRW A;  1IWQ A;  2QPT A;  2L5X B;  1D1O A;  1IQ5 A;  1N2D A;  2I94 A;  2LCP A;  2OPO A;  1QAS A;  1H4B A;  2JNF A;  2WND A;  1CMF A;  2CNP A;  1CDN A;  1K8U A;  2WCF A;  5D7F A;  2KBM A;  2PAS A;  1CM1 A;  4CLN A;  1NCZ A;  1QJT A;  1OSA A;  2O60 A;  2BCX A;  2ZRT A;  1OOJ A;  1ZFS A;  1S3P A;  1V1F A;  2EGD A;  2EHB A;  1XFX O;  3O2P A;  3CS1 A;  1PSB A;  1QX7 A;  1SY9 A;  2MBX A;  1TOP A;  2F8P A;  3OP0 A;  3BOW B;  2FCD A;  2OS8 C;  1VRK A;  3PFV A;  1L2O C;  2L98 A;  5D69 A;  2LVJ A;  1NCX A;  2CCM A;  2COL B;  1AHR A;  2H2K A;  2LVK A;  3HX4 A;  2CXJ A;  2LAP A;  3ZNI A;  4I5J A;  4N1F A;  1Y1A A;  3NXA A;  3I5I C;  2ISD A;  1QIV A;  2Y4Q A;  2NZ0 A;  3EK8 A;  1LXF C;  1SL7 A;  3TDZ A;  1C7V A;  3DF0 B;  4GNK B;  1C07 A;  2BBN A;  1XK4 A;  4WRI A;  1NPQ A;  1DJW A;  2GGZ A;  2HQW A;  1RWY A;  2ZKM X;  1BT6 A;  1K9U A;  1MXE A;  3I5G B;  1S1E A;  5HKW A;  1AVS A;  1XO5 A;  3EK4 A;  1DJI A;  3TS5 C;  2Q91 A;  1NX0 A;  3OHM B;  4NDB A;  1SBJ A;  2BKH B;  2R2I A;  4I5N B;  2HPS A;  4JQ0 D;  3I5F B;  3LK1 A;  2M3W A;  1B4C A;  3CR5 X;  4YGA A;  2JU0 A;  2WCE A;  4R1E A;  3A4U B;  1IJ5 A;  3TUY C;  4GGF A;  4PE1 A;  2KHN A;  4ZCU A;  2K7C A;  2BCA A;  3FWC A;  3IQO A;  1F8H A;  2Y5I A;  1CLL A;  1SL8 A;  2PMY A;  1UHJ A;  1GJY A;  2LUC A;  2JC2 A;  3SG7 A;  2JQ6 A;  2LE9 B;  1CFC A;  3K21 A;  4PDZ A;  1DJH A;  1OZS A;  1IG5 A;  3ICB A;  1AUI B;  1DT7 B;  3SIB A;  2JTZ A;  4Q04 A;  2KFG A;  1B8L A;  2LMU A;  3BQ3 A;  3JTD C;  4CPV A;  1WRZ A;  1YX8 A;  3PAT A;  4A4C A;  3DVM A;  1RRO A;  5JOL A;  2AAO A;  1ZMZ A;  2WOR A;  4JWQ A;  1M45 A;  2M49 B;  3A8R A;  5DKR A;  4C0J A;  1G4Y R;  1TNX A;  1XFW O;  1BOD A;  1YX7 A;  4WQ3 A;  4ZCV A;  1DF0 B;  2DOQ A;  3I5G C;  1CFD A;  1GGZ A;  1AP4 A;  2E6W A;  3PAL A;  5K89 A;  1TTX A;  2ZFD A;  2KGB C;  4AQI A;  2NCO A;  5DKQ A;  2KI4 C;  4ORB B;  3KF9 A;  1FF1 A;  1KFU S;  2LAN A;  3PLF B;  4PAL A;  1A75 A;  1E8A A;  2BKI B;  1DJX A;  4GUK A;  3GK2 A;  2IS9 A;  5I2O A;  4DCK A;  2MA2 A;  3I5H C;  5IBW A;  1CDP A;  1QX5 B;  2LHI A;  3VRN A;  3BXK A;  2M1K B;  3BYA A;  1KK7 Y;  1QVI Y;  3SG3 A;  1ODB A;  1K93 D;  1OZO A;  1QIW A;  1S36 A;  2BL0 B;  3BUX B;  5J3X A;  1IGV A;  2F3Y A;  2KGR A;  1JF0 A;  2QAC A;  3VRR A;  5I8N A;  1KK7 Z;  1TIZ A;  1F4Q A;  2HF5 A;  4I5L B;  1KFX S;  1OMD A;  2G9B A;  3SG2 A;  3NSO A;  3VRP A;  4HSZ A;  3OX5 A;  1SR6 B;  1K96 A;  2M7L A;  2NLN A;  4PE4 A;  3DD4 A;  3EVR A;  2Y1M A;  1PAL A;  4MRX A;  1DMO A;  1W7I B;  3FWB A;  1CDL A;  3C1V A;  1QS7 A;  4ICB A;  2JOJ A;  1CFF A;  3BUM B;  1JFK A;  1Y1U A;  1KK8 C;  2JPT A;  2PSR A;  1YRU B;  3VRO A;  1XFZ O;  1XYD A;  2H61 C;  3CLN A;  1KWO C;  1REC A;  1WRL A;  4HRG A;  1JC2 A;  5BPJ A;  1OQP A;  1B7T Y;  1C7W A;  1HT9 A;  2KAX A;  1K2H A;  1WRK A;  3EVV A;  1RJV A;  2GV5 A;  3E3R A;  4YGC B;  2M0R A;  1UWO A;  1TNQ A;  2M9G A;  2HQ8 A;  1XFU O;  2WOS A;  1Y6W A;  4PE0 A;  1YUR A;  1UHI A;  2D8N A;  4HRH A;  1DVI A;  1Y0V H;  1G8I A;  1KQM B;  1JBA A;  2MRD A;  3EKJ A;  2BL0 C;  3JVT B;  2F2O A;  1ZOT B;  1PRW A;  2ZNE A;  3SG4 A;  1BJF A;  1NWD A;  2KSP A;  3O6B A;  2G2B A;  1YVH A;  4L9M A;  2LLU A;  4OCI A;  1N0Y A;  2FOT A;  3NSK A;  4PHK A;  3SG6 A;  2BEC A;  2LHL A;  4CFQ A;  1SW8 A;  1B47 A;  4YGE B;  3SG5 A;  1JSA A;  1DJY A;  1J7Q A;  2LLT A;  1ALW A;  2JNX A;  1NUB A;  1PVA A;  2I7A A;  2NCP A;  1WDC B;  4C0K A;  2OTG B;  3AAJ A;  2KNE A;  5AER A;  1PVB A;  2KI6 C;  1EXR A;  4OV2 A;  1WLZ A;  4XJK B;  4PHM A;  1JFJ A;  2K8M B;  1LVC D;  1LA3 A;  5I2L A;  3LL8 B;  1MXL C;  3WNX B;  2JTT A;  3WXA A;  1KCY A;  4USL A;  3OX6 A;  4MEW A;  3HCM A;  2SCP A;  3KO0 A;  1MF8 B;  1K9K A;  2MLF C;  3PN7 B;  3DVJ A;  1DGU A;  2LMT A;  1MQ1 A;  3D0Y A;  1IJ6 A;  1S5G Y;  2LMV A;  3GK4 X;  4M2O A;  2LC5 A;  2K7D A;  2L4I A;  1CFP A;  1M39 A;  4F0Z B;  5AFP A;  1WY9 A;  1B9A A;  3NSI A;  2JT3 A;  2RGI A;  4U8D A;  1TCF A;  2M29 A;  3RM1 A;  2MLE C;  1TN4 A;  4GAO A;  1H8B A;  2KBI A;  2CTN A;  5AAN A;  1SNL A;  3TDU A;  5HYD A;  1TNP A;  1DGV A;  1SYM A;  4E68 A;  1F55 A;  3VRQ A;  5FYX A;  4ORA B;  2BE4 A;  3WHU B;  1R2U A;  1YVL A;  2NXQ A;  5DKN A;  2V53 A;  4N5X A;  2O5G A;  4WQ2 A;  2JZI A;  3VGO A;  1BR1 B;  4CFR A;  3BUN B;  2LUX A;  1QTX A;  3FIA A;  1FI6 A;  2OTG C;  2SAS A;  3CWG A;  2M8U A;  3F45 A;  2EC6 B;  1CKK A;  1DJG A;  3I5F C;  1GQM A;  3MSE B;  2KI6 D;  1S6C A;  5KSZ A;  2JXL A;  1U5I A;  3OB1 B;  3EK7 A;  1K9P A;  1KSO A;  4HRE E;  4IL1 A;  1PSR A;  3NSL A;  2M7N A;  1ZAC A;  1AJ5 A;  5AEQ A;  1FBV A;  2P6B B;  2Q4U A;  3TZ1 A;  4I5K A;  5PAL A;  1IKU A;  1J7R A;  2F33 A;  3D10 A;  1QVI Z;  1OE9 B;  1ZUZ A;  4YGD B;  3IQQ A;  1F54 A;  4NQG A;  2PRU A;  5HKZ A;  5CPV A;  1AJ4 A;  2CBL A;  1BMO A;  1F4O A;  4YI9 A;  1KQV A;  2K0J A;  3LCP C;  1BF5 A;  2BBM A;  3O78 A;  5F6T A;  3DF0 A;  2K61 A;  1NYA A;  1CM4 A;  5AXI A;  5B8I B;  1LKJ A;  1TRF A;  1XVJ A;  2OS8 B;  1IQ3 A;  2F2P A;  2ZN9 A;  1L2O B;  1NCY A;  1SCV A;  2L51 A;  1B1G A;  1X02 A;  2LNK A;  2HET A;  3BUO B;  3CR4 X;  1JUO A;  1G33 A;  2JXC A;  2L0P A;  1UHN A;  5ER5 A;  1NSH A;  5HKY A;  3M0W A;  1FPW A;  1IRJ A;  2Y1N A;  4DUQ A;  2K7B A;  3CGA A;  1SRA A;  2KYC A;  3I5I B;  1QXP A;  5CSN A;  2A4J A;  4NDD A;  1UHK A;  1AK8 A;  3BUW B;  1M31 A;  4D1E A;  1FI5 A;  4BY5 A;  4MSP A;  4YI8 A;  2ZND A;  2JT8 A;  1CLM A;  4PE7 A;  5HLV A;  1Q80 A;  2F3Z A;  1J7O A;  1XK4 C;  1M63 B;  3DVK A;  1B7T Z;  1S26 D;  3FS7 A;  1GGW A;  2B1U A;  1EG4 A;  2L50 A;  4QJ5 B;  3CZT X;  1SPY A;  4M2P A;  1QV1 A;  1FW4 A;  2JT0 A;  1A4P A;  3AAK A;  2KAV A;  1M46 A;  1UUS A;  2BE6 A;  3EVU A;  1A29 A;  2AUC A;  3TUY B;  1A75 B;  1SR6 C;  2PAL A;  2BCB A;  1A03 A;  1SMG A;  4XYN A;  1U5I B;  2ZN8 A;  2MJW B;  3KPX A;  4GBA A;  4GGF C;  1MR8 A;  1K90 D;  2LP2 A;  1QX2 A;  1J55 A;  1SK6 D;  1BU3 A;  1DF0 A;  4MZK A;  2H61 A;  5GQQ C;  2VRG A;  3SJS A;  1EG3 A;  4C0L A;  4YBH B;  3JTD B;  1UP5 A;  1CNP A;  2LV7 A;  3GOF A;  4MN0 A;  4M2Q A;  4MLW A;  2LP3 A;  1YRT B;  3OB2 B;  1V1G A;  2L2E A;  1CB1 A;  1BOC A;  3LK0 A;  2JRF A;  2PVB A;  1S6I A;  3H4S E;  3TDI A;  1K94 A;  2KYF A;  1MWN A;  1PUL A;  2KFF A;  1EH2 A;  1NX2 A;  3EKH A;  4PHJ A;  1OMV A;  3CTN A;  1XFV O;  1NP8 A;  1UHH A;  1MHO A;  1KSM A;  2KI4 B;  4ORC B;  2KDH A;  2GGM A;  1CLB A;  4YGB B;  3WHT B;  1LIN A;  1N65 A;  4FQO A;  4AOM A;  5KU1 A;  5KTY A;  4GFT A;  1SCM B;  1L7Z A;  4TNC A;  5I2Q A;  4OR9 B;  1KQM C;  1W7J B;  1S5G Z;  1OMR A;  2M97 A;  3JVT C;  3O4Y A;  3I5H B;  3AKA A;  1TNW A;  4UPG A;  2WC8 A;  1J1D A;  1A2X A;  3GK1 A;  2LM5 A;  2I2R E;  1EL4 A;  3SIA A;  4PHN A;  1NX3 A;  3KHE A;  2MHH A;  2KQY A;  1UUR A;  3PSR A;  2AMI A;  5JJG A;  1YTZ C;  1YUT A;  1QV0 A;  2KQ6 A;  1NX1 A;  1YR5 A;  2M1U A;  1K95 A;  2ZRS A;  5CSF A;  4DIR A;  5TNC A;  2LLS A;  2FCE A;  4P2Y B;  4CID A;  1WDC C;  3DVE A;  5ER4 X;  1BR4 B;  1Y1X A;  1MUX A;  2KOT A;  1RTP 1;  4QJ4 B;  2JUL A;  1BG1 A;  4MZJ A;  1RFJ A;  2KAY A;  4OVN F;  1JWD A;  4ETO A;  4FTG A;  1SL9 A;  1KK8 B;  3BOW A;  4YRU A;  3QRX A;  4MVF A;  4AQJ A;  1YUS A;  1KWO B;  1NIW A;  1B8R A;  1B8C A;  2WCB A;  2TN4 A;  3PN7 C;  3RLZ A;  2K7O A;  1J7P A;  1QLS A;  4NDC A;  1SKT A;  1DJZ A;  4OKH A;  4BY4 A;  4A4B A;  4GPL B; 
#chains in the Genus database with same CATH topology
 2FJU B;  1SCM C;  3LLE A;  4MZL A;  1JF2 A;  1R6P A;  1S6J A;  3S0B A;  4N1G A;  2CT9 A;  3CR2 A;  2L4H A;  1TCO B;  1YUU A;  5CSJ A;  1F70 A;  1DTL A;  2K2A A;  3NGV A;  1F71 A;  2LVI A;  4MBE A;  1BLQ A;  1CTR A;  5I94 A;  2KPH A;  1LA0 A;  3V2L A;  2K2F A;  4PCW A;  3KEV A;  3ZWH A;  3D0Y B;  2MAZ A;  2JWW A;  1KFU L;  1WLM A;  1XFY O;  4QJ3 B;  1RK9 A;  3PM8 A;  4XJK A;  2I18 A;  1ALV A;  1CDM A;  1QLK A;  1CMG A;  3D76 A;  4JPZ B;  2LVV A;  2L5Y A;  5CSI A;  1IH0 A;  3BJH A;  3L47 A;  1QAT A;  2EC6 C;  4DS7 A;  3TS5 B;  1J1E A;  4P5O E;  1HQV A;  1PK0 D;  2KFH A;  1XA5 A;  1KFX L;  2E30 A;  5HLO A;  3IF7 A;  4INW A;  3AKB A;  4GGN A;  1EJ3 A;  5G08 A;  4MRY A;  4DRW A;  1IWQ A;  2QPT A;  2L5X B;  1D1O A;  1IQ5 A;  1N2D A;  2I94 A;  2LCP A;  2OPO A;  1QAS A;  1H4B A;  2JNF A;  2WND A;  1CMF A;  2CNP A;  1CDN A;  1K8U A;  2WCF A;  5D7F A;  2KBM A;  2PAS A;  1CM1 A;  4CLN A;  1NCZ A;  1QJT A;  1OSA A;  2O60 A;  2BCX A;  4IJ7 A;  2ZRT A;  1OOJ A;  1ZFS A;  1S3P A;  1V1F A;  2EGD A;  2EHB A;  1XFX O;  3CZ2 A;  3O2P A;  3CS1 A;  1PSB A;  1QX7 A;  1SY9 A;  2MBX A;  1TOP A;  2F8P A;  3OP0 A;  3CAB A;  3BOW B;  2FCD A;  3NHT A;  2OS8 C;  1VRK A;  5DIC A;  3DY9 A;  3PFV A;  1L2O C;  2L98 A;  5D69 A;  2LVJ A;  1NCX A;  2CCM A;  2COL B;  1AHR A;  2YGU A;  2H2K A;  2LVK A;  5FI2 A;  3HX4 A;  2CXJ A;  2LAP A;  3ZNI A;  3PM2 A;  4I5J A;  4N1F A;  1Y1A A;  3NXA A;  3I5I C;  2ISD A;  1QIV A;  2Y4Q A;  2NZ0 A;  3EK8 A;  1LXF C;  1SL7 A;  1TWO A;  3TDZ A;  1C7V A;  3DF0 B;  4GNK B;  1C07 A;  2BBN A;  1XK4 A;  1QWV A;  4WRI A;  1NPQ A;  1DJW A;  2GGZ A;  2HQW A;  1RWY A;  2ZKM X;  1BT6 A;  1K9U A;  1GM0 A;  1MXE A;  3I5G B;  1S1E A;  5HKW A;  1AVS A;  1XO5 A;  1DEL A;  3EK4 A;  1DJI A;  3TS5 C;  2Q91 A;  1NX0 A;  5EL2 A;  3OHM B;  4NDB A;  1SBJ A;  2BKH B;  2R2I A;  4I5N B;  2HPS A;  3L4A A;  3I5F B;  4JQ0 D;  3LK1 A;  2M3W A;  2PQL A;  3CR5 X;  1B4C A;  4YGA A;  2JU0 A;  2WCE A;  4R1E A;  3A4U B;  1IJ5 A;  3TUY C;  4GGF A;  4PE1 A;  2KHN A;  4ZCU A;  2QDI A;  2K7C A;  2BCA A;  3FWC A;  2JPO A;  3IQO A;  1F8H A;  2Y5I A;  3S0A A;  1CLL A;  1SL8 A;  2PMY A;  1UHJ A;  1GJY A;  2LUC A;  2JC2 A;  3SG7 A;  2JQ6 A;  2LE9 B;  1C3Y A;  1CFC A;  3K21 A;  4PDZ A;  1DJH A;  1OZS A;  1IG5 A;  3ICB A;  1AUI B;  1DT7 B;  3SIB A;  2JTZ A;  4Q04 A;  3S0F A;  2GTE A;  3VB1 A;  2KFG A;  1B8L A;  2LMU A;  3BQ3 A;  3JTD C;  4CPV A;  1WRZ A;  1XFR A;  1YX8 A;  3OGN A;  3QME A;  3PAT A;  4A4C A;  2KLD A;  3PJI A;  3DVM A;  1RRO A;  5JOL A;  5HL1 A;  2AAO A;  1ZMZ A;  2WOR A;  4JWQ A;  1M45 A;  2M49 B;  3A8R A;  5DKR A;  4C0J A;  3VRR A;  1G4Y R;  1TNX A;  1XFW O;  2K60 A;  1YX7 A;  4WQ3 A;  1BOD A;  4ZCV A;  1DF0 B;  2DOQ A;  3I5G C;  1CFD A;  1GGZ A;  3R1V A;  2E6W A;  3PAL A;  5K89 A;  1TTX A;  1AP4 A;  2ZFD A;  2KGB C;  4AQI A;  2NCO A;  5DKQ A;  3L4L A;  2KI4 C;  4ORB B;  3KF9 A;  1FF1 A;  1KFU S;  2LAN A;  3PLF B;  4PAL A;  1A75 A;  1E8A A;  2BKI B;  1DJX A;  4GUK A;  3GK2 A;  2IS9 A;  3B86 A;  5I2O A;  3K1E A;  4DCK A;  2MA2 A;  3I5H C;  5IBW A;  1CDP A;  1QX5 B;  2LHI A;  3VRN A;  3BXK A;  3D78 A;  2M1K B;  2QEH A;  3BYA A;  1KK7 Y;  1QVI Y;  3SG3 A;  1ODB A;  1K93 D;  1OZO A;  1QIW A;  1S36 A;  2BL0 B;  3BUX B;  4INX A;  5J3X A;  1IGV A;  2F3Y A;  2KGR A;  1JF0 A;  2QAC A;  2QEV A;  3D77 A;  3S0E A;  1KK7 Z;  1TIZ A;  1F4Q A;  2HF5 A;  4I5L B;  1KFX S;  3D73 A;  1OMD A;  3SS3 A;  2G9B A;  3SG2 A;  3NSO A;  3VRP A;  4HSZ A;  3OX5 A;  1SR6 B;  1K96 A;  2M7L A;  2NLN A;  4PE4 A;  3DD4 A;  3EVR A;  3EG5 B;  2Y1M A;  2BAP A;  1PAL A;  2WCH A;  4MRX A;  1DMO A;  1W7I B;  3FWB A;  1CDL A;  3C1V A;  1QS7 A;  2P71 A;  4ICB A;  2JOJ A;  1CFF A;  1LS8 A;  3BUM B;  1JFK A;  1Y1U A;  1KK8 C;  2JPT A;  2PSR A;  3DZT A;  1YRU B;  3VRO A;  1XFZ O;  1XYD A;  2H61 C;  3CLN A;  1KWO C;  1TUZ A;  3R72 A;  1REC A;  1WRL A;  4HRG A;  3CYZ A;  1JC2 A;  5BPJ A;  1OQP A;  1B7T Y;  1C7W A;  1HT9 A;  3B7A A;  2KAX A;  1K2H A;  1WRK A;  3EVV A;  1RJV A;  2GV5 A;  3E3R A;  4YGC B;  2M0R A;  1UWO A;  1TNQ A;  2M9G A;  2HQ8 A;  1XFU O;  2WOS A;  1Y6W A;  4PE0 A;  1YUR A;  1UHI A;  2D8N A;  1TUJ A;  4HRH A;  1DVI A;  1Y0V H;  1G8I A;  1KQM B;  1JBA A;  2MRD A;  3EKJ A;  3NHI A;  2BL0 C;  3JVT B;  2F2O A;  1ZOT B;  1PRW A;  2ZNE A;  3SG4 A;  1BJF A;  1NWD A;  2KSP A;  3O6B A;  2G2B A;  1YVH A;  4L9M A;  2LLU A;  4OCI A;  1N0Y A;  2FOT A;  3NSK A;  4PHK A;  2WCM A;  3SG6 A;  2BEC A;  2LHL A;  4CFQ A;  1SW8 A;  1B47 A;  4YGE B;  3SG5 A;  2WCL A;  1JSA A;  1DJY A;  1J7Q A;  2LLT A;  1ALW A;  2JNX A;  1NUB A;  1PVA A;  2I7A A;  2NCP A;  1WDC B;  4C0K A;  2OTG B;  3AAJ A;  2KNE A;  5AER A;  1PVB A;  2KI6 C;  2FJY A;  1EXR A;  2BNX A;  4OV2 A;  1WLZ A;  4XJK B;  4PHM A;  1JFJ A;  2K8M B;  3R1P A;  1LVC D;  1LA3 A;  5I2L A;  3LL8 B;  1MXL C;  3WNX B;  2JTT A;  3WXA A;  1KCY A;  4USL A;  3OX6 A;  4MEW A;  3HCM A;  2SCP A;  3FE8 A;  3KO0 A;  1MF8 B;  1K9K A;  2MLF C;  3PN7 B;  3DVJ A;  3S0G A;  1DGU A;  2LMT A;  1MQ1 A;  3D0Y A;  1IJ6 A;  1S5G Y;  2LMV A;  3GK4 X;  4M2O A;  2LC5 A;  2K7D A;  5D3O A;  2WC6 A;  2L4I A;  1CFP A;  1M39 A;  2PYQ A;  4F0Z B;  5AFP A;  1WY9 A;  1B9A A;  3NSI A;  2JT3 A;  2RGI A;  4U8D A;  3CDN A;  1TCF A;  2M29 A;  3RM1 A;  2MLE C;  1TN4 A;  4GAO A;  5I8N A;  2KBI A;  1H8B A;  2CTN A;  5AAN A;  1OOI X;  1SNL A;  3TDU A;  5HYD A;  1TNP A;  1DGV A;  1SYM A;  4E68 A;  1F55 A;  3SS4 A;  3VRQ A;  5FYX A;  4ORA B;  2BE4 A;  3WHU B;  1R2U A;  1YVL A;  2NXQ A;  5DKN A;  2V53 A;  4N5X A;  2O5G A;  4WQ2 A;  2JZI A;  3VGO A;  1P28 A;  1BR1 B;  4CFR A;  3BUN B;  2LUX A;  1OOF A;  1OW4 A;  1QTX A;  3FIA A;  1FI6 A;  2OTG C;  2SAS A;  3CWG A;  2M8U A;  1ORG A;  3F45 A;  2EC6 B;  1CKK A;  1DJG A;  3I5F C;  1GQM A;  3MSE B;  2KI6 D;  1S6C A;  5KSZ A;  1DQE A;  2JXL A;  1U5I A;  2H8V A;  3OB1 B;  3EK7 A;  1K9P A;  1KSO A;  4HRE E;  4IL1 A;  1PSR A;  3NSL A;  2M7N A;  1ZAC A;  2L2C A;  1AJ5 A;  5AEQ A;  1FBV A;  2P6B B;  2Q4U A;  3CZ0 A;  3TZ1 A;  4I5K A;  5PAL A;  1IKU A;  1J7R A;  2F33 A;  3D10 A;  1QVI Z;  1OE9 B;  1ZUZ A;  4OZD A;  3IQQ A;  4YGD B;  1F54 A;  1W9Z A;  3D74 A;  4NQG A;  2PRU A;  5HKZ A;  5CPV A;  1AJ4 A;  2CBL A;  1BMO A;  1F4O A;  2WCK A;  4YI9 A;  1KQV A;  2K0J A;  4FQT A;  3LCP C;  1BF5 A;  2BBM A;  3O78 A;  5F6T A;  3DF0 A;  2K61 A;  1NYA A;  1CM4 A;  5AXI A;  5B8I B;  1LKJ A;  1TRF A;  1XVJ A;  2OS8 B;  1IQ3 A;  2F2P A;  2ZN9 A;  1L2O B;  1NCY A;  1SCV A;  2L51 A;  1B1G A;  1X02 A;  2LNK A;  2HET A;  3BUO B;  3CR4 X;  1JUO A;  1G33 A;  2JXC A;  2L0P A;  1UHN A;  1Z2C B;  1NSH A;  5ER5 A;  3M0W A;  5HKY A;  1FPW A;  1IRJ A;  2Y1N A;  4DUQ A;  2K7B A;  3CGA A;  1SRA A;  2KYC A;  3I5I B;  1QXP A;  5CSN A;  2A4J A;  4NDD A;  1UHK A;  1AK8 A;  3BUW B;  1M31 A;  4D1E A;  3R1O A;  1FI5 A;  4BY5 A;  4MSP A;  4YI8 A;  3Q8I A;  2ZND A;  2JT8 A;  1CLM A;  4PE7 A;  3O4X A;  5HLV A;  1Q80 A;  2F3Z A;  1J7O A;  2WCJ A;  1XK4 C;  1M63 B;  3DVK A;  1B7T Z;  1S26 D;  3FS7 A;  1GGW A;  2B1U A;  1EG4 A;  2L50 A;  4QJ5 B;  3CZT X;  1SPY A;  4PT1 A;  4M2P A;  3UO9 A;  1OOH A;  1QV1 A;  1FW4 A;  2JT0 A;  3FE9 A;  1A4P A;  3BFA A;  3AAK A;  1OOG A;  2KAV A;  1M46 A;  1C3Z A;  1UUS A;  2BE6 A;  3B88 A;  3EVU A;  1A29 A;  2AUC A;  3TUY B;  1A75 B;  1SR6 C;  2PAL A;  2BCB A;  2QEB A;  1A03 A;  1SMG A;  4XYN A;  3IVT A;  1U5I B;  2ZN8 A;  1DEK A;  2MJW B;  3KPX A;  4GBA A;  4GGF C;  2QEO A;  1MR8 A;  1K90 D;  2LP2 A;  1QX2 A;  1J55 A;  1SK6 D;  1BU3 A;  1DF0 A;  4MZK A;  2H61 A;  5GQQ C;  2VRG A;  3SJS A;  1EG3 A;  3DYE A;  3UNW A;  4C0L A;  3S0D A;  1IIO A;  4YBH B;  3JTD B;  1UP5 A;  1CNP A;  2LV7 A;  3GOF A;  4MN0 A;  4M2Q A;  4MLW A;  1Z4H A;  2LP3 A;  1YRT B;  3OB2 B;  1V1G A;  2L2E A;  1CB1 A;  2P70 A;  1BOC A;  2WC5 A;  3OBV A;  3LK0 A;  2JRF A;  2PVB A;  3D75 A;  1S6I A;  3H4S E;  4JKT A;  4JD9 A;  3TDI A;  1K94 A;  2KYF A;  3N7H A;  1MWN A;  1PUL A;  2KFF A;  1EH2 A;  1NX2 A;  3EKH A;  4PHJ A;  1OMV A;  3CTN A;  1XFV O;  1NP8 A;  1UHH A;  4KYN A;  5FI6 A;  1MHO A;  1KSM A;  2KI4 B;  4ORC B;  2KDH A;  2GGM A;  1CLB A;  4YGB B;  3FE6 A;  3WHT B;  1LIN A;  1N65 A;  4FQO A;  4AOM A;  5KU1 A;  5KTY A;  4GFT A;  1SCM B;  1L7Z A;  4TNC A;  3RZS A;  5I2Q A;  4OR9 B;  1KQM C;  1W7J B;  1S5G Z;  1OMR A;  2M97 A;  3B87 A;  3JVT C;  3O4Y A;  3I5H B;  3AKA A;  1TNW A;  3BFH A;  4UPG A;  2WC8 A;  1J1D A;  1A2X A;  3GK1 A;  1DC1 A;  2LM5 A;  2I2R E;  3BFB A;  1EL4 A;  3SIA A;  4PHN A;  1SSE B;  1NX3 A;  3KHE A;  2MHH A;  2KQY A;  1UUR A;  3PSR A;  2AMI A;  5JJG A;  1YTZ C;  1YUT A;  1QV0 A;  2KQ6 A;  1NX1 A;  1YR5 A;  2M1U A;  1K95 A;  2ZRS A;  5FI7 A;  5CSF A;  4DIR A;  3SS5 A;  5TNC A;  3DXL A;  2LLS A;  2FCE A;  4P2Y B;  4CID A;  1WDC C;  3DVE A;  5ER4 X;  1BR4 B;  1Y1X A;  1MUX A;  2KOT A;  2ERB A;  1RTP 1;  1T14 A;  4QJ4 B;  2JUL A;  3CZ1 A;  1BG1 A;  4MZJ A;  4F7F A;  1RFJ A;  2KAY A;  4OVN F;  1JWD A;  2KLE A;  4ETO A;  4FTG A;  1SL9 A;  1KK8 B;  3BOW A;  4YRU A;  3QRX A;  4MVF A;  4AQJ A;  1YUS A;  1KWO B;  3B6X A;  1NIW A;  1B8R A;  1B8C A;  2WCB A;  2TN4 A;  3PN7 C;  3RLZ A;  2K7O A;  1J7P A;  1QLS A;  4NDC A;  1SKT A;  1DJZ A;  4OKH A;  4BY4 A;  4A4B A;  4GPL B; 
#chains in the Genus database with same CATH homology
 2FJU B;  1SCM C;  3LLE A;  4MZL A;  1JF2 A;  1R6P A;  1S6J A;  4N1G A;  2CT9 A;  3CR2 A;  2L4H A;  1TCO B;  1YUU A;  5CSJ A;  1F70 A;  1DTL A;  2K2A A;  1F71 A;  2LVI A;  4MBE A;  1BLQ A;  1CTR A;  1LA0 A;  2K2F A;  4PCW A;  3KEV A;  3ZWH A;  3D0Y B;  2MAZ A;  2JWW A;  1KFU L;  1WLM A;  1XFY O;  4QJ3 B;  1RK9 A;  3PM8 A;  4XJK A;  2I18 A;  1ALV A;  1CDM A;  1QLK A;  1CMG A;  4JPZ B;  2LVV A;  5CSI A;  1IH0 A;  1QAT A;  2EC6 C;  4DS7 A;  3TS5 B;  1J1E A;  4P5O E;  1HQV A;  1PK0 D;  2KFH A;  1XA5 A;  1KFX L;  2E30 A;  5HLO A;  3IF7 A;  3AKB A;  4GGN A;  1EJ3 A;  5G08 A;  4MRY A;  4DRW A;  1IWQ A;  2QPT A;  2L5X B;  1D1O A;  1IQ5 A;  1N2D A;  2I94 A;  2LCP A;  2OPO A;  1QAS A;  1H4B A;  2JNF A;  2WND A;  1CMF A;  2CNP A;  1CDN A;  1K8U A;  2WCF A;  5D7F A;  2KBM A;  2PAS A;  1CM1 A;  4CLN A;  1NCZ A;  1QJT A;  1OSA A;  2O60 A;  2BCX A;  2ZRT A;  1OOJ A;  1ZFS A;  1S3P A;  1V1F A;  2EGD A;  2EHB A;  1XFX O;  3O2P A;  3CS1 A;  1PSB A;  1QX7 A;  1SY9 A;  2MBX A;  1TOP A;  2F8P A;  3OP0 A;  3BOW B;  2FCD A;  2OS8 C;  1VRK A;  3PFV A;  1L2O C;  2L98 A;  5D69 A;  2LVJ A;  1NCX A;  2CCM A;  2COL B;  1AHR A;  2H2K A;  2LVK A;  3HX4 A;  2CXJ A;  2LAP A;  3ZNI A;  4I5J A;  4N1F A;  1Y1A A;  3NXA A;  3I5I C;  2ISD A;  1QIV A;  2Y4Q A;  2NZ0 A;  3EK8 A;  1LXF C;  1SL7 A;  3TDZ A;  1C7V A;  3DF0 B;  4GNK B;  1C07 A;  2BBN A;  1XK4 A;  4WRI A;  1NPQ A;  1DJW A;  2GGZ A;  2HQW A;  1RWY A;  2ZKM X;  1BT6 A;  1K9U A;  1MXE A;  3I5G B;  1S1E A;  5HKW A;  1AVS A;  1XO5 A;  3EK4 A;  1DJI A;  3TS5 C;  2Q91 A;  1NX0 A;  3OHM B;  4NDB A;  1SBJ A;  2BKH B;  2R2I A;  4I5N B;  2HPS A;  4JQ0 D;  3I5F B;  3LK1 A;  2M3W A;  1B4C A;  3CR5 X;  4YGA A;  2JU0 A;  2WCE A;  4R1E A;  3A4U B;  1IJ5 A;  3TUY C;  4GGF A;  4PE1 A;  2KHN A;  4ZCU A;  2K7C A;  2BCA A;  3FWC A;  3IQO A;  1F8H A;  2Y5I A;  1CLL A;  1SL8 A;  2PMY A;  1UHJ A;  1GJY A;  2LUC A;  2JC2 A;  3SG7 A;  2JQ6 A;  2LE9 B;  1CFC A;  3K21 A;  4PDZ A;  1DJH A;  1OZS A;  1IG5 A;  3ICB A;  1AUI B;  1DT7 B;  3SIB A;  2JTZ A;  4Q04 A;  2KFG A;  1B8L A;  2LMU A;  3BQ3 A;  3JTD C;  4CPV A;  1WRZ A;  1YX8 A;  3PAT A;  4A4C A;  3DVM A;  1RRO A;  5JOL A;  2AAO A;  1ZMZ A;  2WOR A;  4JWQ A;  1M45 A;  2M49 B;  3A8R A;  5DKR A;  4C0J A;  1G4Y R;  1TNX A;  1XFW O;  1BOD A;  1YX7 A;  4WQ3 A;  4ZCV A;  1DF0 B;  2DOQ A;  3I5G C;  1CFD A;  1GGZ A;  1AP4 A;  2E6W A;  3PAL A;  5K89 A;  1TTX A;  2ZFD A;  2KGB C;  4AQI A;  2NCO A;  5DKQ A;  2KI4 C;  4ORB B;  3KF9 A;  1FF1 A;  1KFU S;  2LAN A;  3PLF B;  4PAL A;  1A75 A;  1E8A A;  2BKI B;  1DJX A;  4GUK A;  3GK2 A;  2IS9 A;  5I2O A;  4DCK A;  2MA2 A;  3I5H C;  5IBW A;  1CDP A;  1QX5 B;  2LHI A;  3VRN A;  3BXK A;  2M1K B;  3BYA A;  1KK7 Y;  1QVI Y;  3SG3 A;  1ODB A;  1K93 D;  1OZO A;  1QIW A;  1S36 A;  2BL0 B;  3BUX B;  5J3X A;  1IGV A;  2F3Y A;  2KGR A;  1JF0 A;  2QAC A;  3VRR A;  5I8N A;  1KK7 Z;  1TIZ A;  1F4Q A;  2HF5 A;  4I5L B;  1KFX S;  1OMD A;  2G9B A;  3SG2 A;  3NSO A;  3VRP A;  4HSZ A;  3OX5 A;  1SR6 B;  1K96 A;  2M7L A;  2NLN A;  4PE4 A;  3DD4 A;  3EVR A;  2Y1M A;  1PAL A;  4MRX A;  1DMO A;  1W7I B;  3FWB A;  1CDL A;  3C1V A;  1QS7 A;  4ICB A;  2JOJ A;  1CFF A;  3BUM B;  1JFK A;  1Y1U A;  1KK8 C;  2JPT A;  2PSR A;  1YRU B;  3VRO A;  1XFZ O;  1XYD A;  2H61 C;  3CLN A;  1KWO C;  1REC A;  1WRL A;  4HRG A;  1JC2 A;  5BPJ A;  1OQP A;  1B7T Y;  1C7W A;  1HT9 A;  2KAX A;  1K2H A;  1WRK A;  3EVV A;  1RJV A;  2GV5 A;  3E3R A;  4YGC B;  2M0R A;  1UWO A;  1TNQ A;  2M9G A;  2HQ8 A;  1XFU O;  2WOS A;  1Y6W A;  4PE0 A;  1YUR A;  1UHI A;  2D8N A;  4HRH A;  1DVI A;  1Y0V H;  1G8I A;  1KQM B;  1JBA A;  2MRD A;  3EKJ A;  2BL0 C;  3JVT B;  2F2O A;  1ZOT B;  1PRW A;  2ZNE A;  3SG4 A;  1BJF A;  1NWD A;  2KSP A;  3O6B A;  2G2B A;  1YVH A;  4L9M A;  2LLU A;  4OCI A;  1N0Y A;  2FOT A;  3NSK A;  4PHK A;  3SG6 A;  2BEC A;  2LHL A;  4CFQ A;  1SW8 A;  1B47 A;  4YGE B;  3SG5 A;  1JSA A;  1DJY A;  1J7Q A;  2LLT A;  1ALW A;  2JNX A;  1NUB A;  1PVA A;  2I7A A;  2NCP A;  1WDC B;  4C0K A;  2OTG B;  3AAJ A;  2KNE A;  5AER A;  1PVB A;  2KI6 C;  1EXR A;  4OV2 A;  1WLZ A;  4XJK B;  4PHM A;  1JFJ A;  2K8M B;  1LVC D;  1LA3 A;  5I2L A;  3LL8 B;  1MXL C;  3WNX B;  2JTT A;  3WXA A;  1KCY A;  4USL A;  3OX6 A;  4MEW A;  3HCM A;  2SCP A;  3KO0 A;  1MF8 B;  1K9K A;  2MLF C;  3PN7 B;  3DVJ A;  1DGU A;  2LMT A;  1MQ1 A;  3D0Y A;  1IJ6 A;  1S5G Y;  2LMV A;  3GK4 X;  4M2O A;  2LC5 A;  2K7D A;  2L4I A;  1CFP A;  1M39 A;  4F0Z B;  5AFP A;  1WY9 A;  1B9A A;  3NSI A;  2JT3 A;  2RGI A;  4U8D A;  1TCF A;  2M29 A;  3RM1 A;  2MLE C;  1TN4 A;  4GAO A;  1H8B A;  2KBI A;  2CTN A;  5AAN A;  1SNL A;  3TDU A;  5HYD A;  1TNP A;  1DGV A;  1SYM A;  4E68 A;  1F55 A;  3VRQ A;  5FYX A;  4ORA B;  2BE4 A;  3WHU B;  1R2U A;  1YVL A;  2NXQ A;  5DKN A;  2V53 A;  4N5X A;  2O5G A;  4WQ2 A;  2JZI A;  3VGO A;  1BR1 B;  4CFR A;  3BUN B;  2LUX A;  1QTX A;  3FIA A;  1FI6 A;  2OTG C;  2SAS A;  3CWG A;  2M8U A;  3F45 A;  2EC6 B;  1CKK A;  1DJG A;  3I5F C;  1GQM A;  3MSE B;  2KI6 D;  1S6C A;  5KSZ A;  2JXL A;  1U5I A;  3OB1 B;  3EK7 A;  1K9P A;  1KSO A;  4HRE E;  4IL1 A;  1PSR A;  3NSL A;  2M7N A;  1ZAC A;  1AJ5 A;  5AEQ A;  1FBV A;  2P6B B;  2Q4U A;  3TZ1 A;  4I5K A;  5PAL A;  1IKU A;  1J7R A;  2F33 A;  3D10 A;  1QVI Z;  1OE9 B;  1ZUZ A;  4YGD B;  3IQQ A;  1F54 A;  4NQG A;  2PRU A;  5HKZ A;  5CPV A;  1AJ4 A;  2CBL A;  1BMO A;  1F4O A;  4YI9 A;  1KQV A;  2K0J A;  3LCP C;  1BF5 A;  2BBM A;  3O78 A;  5F6T A;  3DF0 A;  2K61 A;  1NYA A;  1CM4 A;  5AXI A;  5B8I B;  1LKJ A;  1TRF A;  1XVJ A;  2OS8 B;  1IQ3 A;  2F2P A;  2ZN9 A;  1L2O B;  1NCY A;  1SCV A;  2L51 A;  1B1G A;  1X02 A;  2LNK A;  2HET A;  3BUO B;  3CR4 X;  1JUO A;  1G33 A;  2JXC A;  2L0P A;  1UHN A;  5ER5 A;  1NSH A;  5HKY A;  3M0W A;  1FPW A;  1IRJ A;  2Y1N A;  4DUQ A;  2K7B A;  3CGA A;  1SRA A;  2KYC A;  3I5I B;  1QXP A;  5CSN A;  2A4J A;  4NDD A;  1UHK A;  1AK8 A;  3BUW B;  1M31 A;  4D1E A;  1FI5 A;  4BY5 A;  4MSP A;  4YI8 A;  2ZND A;  2JT8 A;  1CLM A;  4PE7 A;  5HLV A;  1Q80 A;  2F3Z A;  1J7O A;  1XK4 C;  1M63 B;  3DVK A;  1B7T Z;  1S26 D;  3FS7 A;  1GGW A;  2B1U A;  1EG4 A;  2L50 A;  4QJ5 B;  3CZT X;  1SPY A;  4M2P A;  1QV1 A;  1FW4 A;  2JT0 A;  1A4P A;  3AAK A;  2KAV A;  1M46 A;  1UUS A;  2BE6 A;  3EVU A;  1A29 A;  2AUC A;  3TUY B;  1A75 B;  1SR6 C;  2PAL A;  2BCB A;  1A03 A;  1SMG A;  4XYN A;  1U5I B;  2ZN8 A;  2MJW B;  3KPX A;  4GBA A;  4GGF C;  1MR8 A;  1K90 D;  2LP2 A;  1QX2 A;  1J55 A;  1SK6 D;  1BU3 A;  1DF0 A;  4MZK A;  2H61 A;  5GQQ C;  2VRG A;  3SJS A;  1EG3 A;  4C0L A;  4YBH B;  3JTD B;  1UP5 A;  1CNP A;  2LV7 A;  3GOF A;  4MN0 A;  4M2Q A;  4MLW A;  2LP3 A;  1YRT B;  3OB2 B;  1V1G A;  2L2E A;  1CB1 A;  1BOC A;  3LK0 A;  2JRF A;  2PVB A;  1S6I A;  3H4S E;  3TDI A;  1K94 A;  2KYF A;  1MWN A;  1PUL A;  2KFF A;  1EH2 A;  1NX2 A;  3EKH A;  4PHJ A;  1OMV A;  3CTN A;  1XFV O;  1NP8 A;  1UHH A;  1MHO A;  1KSM A;  2KI4 B;  4ORC B;  2KDH A;  2GGM A;  1CLB A;  4YGB B;  3WHT B;  1LIN A;  1N65 A;  4FQO A;  4AOM A;  5KU1 A;  5KTY A;  4GFT A;  1SCM B;  1L7Z A;  4TNC A;  5I2Q A;  4OR9 B;  1KQM C;  1W7J B;  1S5G Z;  1OMR A;  2M97 A;  3JVT C;  3O4Y A;  3I5H B;  3AKA A;  1TNW A;  4UPG A;  2WC8 A;  1J1D A;  1A2X A;  3GK1 A;  2LM5 A;  2I2R E;  1EL4 A;  3SIA A;  4PHN A;  1NX3 A;  3KHE A;  2MHH A;  2KQY A;  1UUR A;  3PSR A;  2AMI A;  5JJG A;  1YTZ C;  1YUT A;  1QV0 A;  2KQ6 A;  1NX1 A;  1YR5 A;  2M1U A;  1K95 A;  2ZRS A;  5CSF A;  4DIR A;  5TNC A;  2LLS A;  2FCE A;  4P2Y B;  4CID A;  1WDC C;  3DVE A;  5ER4 X;  1BR4 B;  1Y1X A;  1MUX A;  2KOT A;  1RTP 1;  4QJ4 B;  2JUL A;  1BG1 A;  4MZJ A;  1RFJ A;  2KAY A;  4OVN F;  1JWD A;  4ETO A;  4FTG A;  1SL9 A;  1KK8 B;  3BOW A;  4YRU A;  3QRX A;  4MVF A;  4AQJ A;  1YUS A;  1KWO B;  1NIW A;  1B8R A;  1B8C A;  2WCB A;  2TN4 A;  3PN7 C;  3RLZ A;  2K7O A;  1J7P A;  1QLS A;  4NDC A;  1SKT A;  1DJZ A;  4OKH A;  4BY4 A;  4A4B A;  4GPL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...