4YGDB

Crystal structure of ergic-53/mcfd2, monoclinic calcium-bound form 2
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
79
structure length
69
Chain Sequence
MSPQELQLHYFKMHDYDGNNLLDGLELSTAITHPLMSEDELINIIDGVLRDDDKNNDGYIDYAEFAKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein ERGIC-53
publication title Interaction mode of coagulation factors V and VIII with the cargo receptor MCFD2/ERGIC-53 complex
rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 26
structure length 69
sequence length 79
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ygdB00
1U5IB 1XFZO 2TN4A 4DS7A 3DVMA 1WLZA 1SL7A 1CLLA 2VRGA 4CIDA 1JUOA 3SJSA 1AK8A 3BUOB 4L9MA 3VROA 1N0YA 4QJ4B 4E68A 1NYAA 4PHMA 1DGVA 3O2PA 5CSIA 5J3XA 1FPWA 1B8CA 3TZ1A 4HSZA 3CTNA 4JQ0D 4MZKA 3VRPA 1W7JB 1UHHA 2LP3A 2KDHA 2K7BA 3SG6A 1VRKA 4DCKA 1M39A 2WNDA 2Y1MA 1YX7A 1LXFC 4YGBB 1YVLA 2KBIA 1LA0A 3VRQA 1CMGA 3PALA 1DJWA 5HKWA 1BU3A 1UHNA 1DTLA 1ALWA 3TUYC 1EG4A 1MWNA 1K90D 2BCBA 2Q91A 4DIRA 1BLQA 2F3ZA 1PALA 1JWDA 2JULA 5DKNA 1XFYO 1BF5A 1AJ4A 1OOJA 4WQ3A 2L98A 3IQQA 2K0JA 1NX3A 1FW4A 1C07A 2PRUA 4A4CA 1XVJA 5CSFA 3DVJA 1JSAA 4GGNA 4MZJA 3NSOA 1XFWO 1SKTA 1CFPA 1SBJA 3LL8B 2H61C 1OSAA 4YI9A 1A75B 5BPJA 1PSRA 3SG5A 1J7OA 1IRJA 2K61A 3DVEA 3D10A 2MLEC 4YBHB 2PMYA 1MF8B 2H61A 5CSJA 1UHIA 1YURA 3BOWA 1ZACA 1S3PA 3KO0A 3O4YA 4AOMA 1NP8A 4QJ5B 3VGOA 3NSIA 2FOTA 1RWYA 2CXJA 2LHIA 1KK7Z 4P2YB 1SMGA 1XFXO 2OTGB 3AKAA 1DF0B 2KGBC 1DMOA 5JJGA 2JOJA 3AAKA 1M45A 4PALA 1Q80A 5KTYA 1F54A 1S26D 3PFVA 4C0KA 4OV2A 3EVUA 2BE6A 1CLMA 1DT7B 2JC2A 1IJ5A 3I5GC 2BCAA 4YI8A 3VRRA 3CLNA 3CZTX 2LLUA 2KAXA 1QTXA 5HYDA 2MBXA 4GNKB 2NZ0A 4PDZA 2MRDA 1YX8A 2LVJA 2KAVA 4D1EA 2ZN8A 4PE1A 1KFXL 1DVIA 2CNPA 1PK0D 2I2RE 2PASA 3KF9A 1CLBA 1FI6A 5K89A 2Q4UA 2R2IA 1QX2A 2BL0C 3CGAA 1Y1UA 1BODA 1PULA 2CBLA 3BQ3A 2L0PA 4M2PA 2LVIA 1XFVO 2EC6B 1LVCD 4MLWA 1DJYA 1KSMA 1OMVA 2E30A 3A4UB 2M7LA 2ZN9A 1JC2A 1F70A 1IQ3A 1SPYA 1NUBA 4C0LA 1OZOA 2GGMA 3MSEB 1QIVA 1NSHA 4GBAA 1QV1A 2KSPA 2H2KA 1H8BA 2AAOA 3WHTB 1KWOC 2O60A 1KQMB 1UURA 2Y5IA 4PCWA 1C7VA 4MZLA 1TOPA 2MLFC 1LA3A 3LK0A 4N5XA 1X02A 1UHJA 1A03A 2I94A 3E3RA 1L7ZA 2JTTA 4P5OE 2BBMA 1LKJA 3D0YA 4GPLB 1D1OA 1J1DA 1ZMZA 1KCYA 1NPQA 1V1FA 2F3YA 1WRLA 4IL1A 1JBAA 4OCIA 2JXCA 1CNPA 2RGIA 2WCFA 4I5JA 5D7FA 2LE9B 1ZUZA 1AJ5A 3AAJA 4M2OA 1B7TY 1CTRA 1JFKA 1SL8A 5TNCA 2I7AA 4YGDB 2CT9A 1QVIY 2MAZA 4QJ3B 4Q04A 1XYDA 3TUYB 2EGDA 1G4YR 1RK9A 5HKYA 4PHNA 2K7OA 2BBNA 2WCBA 1PVBA 5AEQA 3OHMB 1S6JA 1C7WA 1OE9B 2CTNA 2M97A 1J1EA 1NCZA 2M29A 5HKZA 1DJIA 1XA5A 1GGWA 4NQGA 1RROA 2KQ6A 2L51A 2ZKMX 1CDLA 1QXPA 4FTGA 2JNFA 2SASA 1SCMC 5GQQC 2G2BA 1Y1XA 4OVNF 2MHHA 3EK4A 2BCXA 4XJKA 1F8HA 1K8UA 1R2UA 4YGAA 1IH0A 1S5GY 1QASA 5G08A 1DJHA 3O6BA 1NX1A 3H4SE 1IG5A 3DF0B 5IBWA 3VRNA 3RM1A 1QV0A 3EVVA 3O78A 3K21A 2LC5A 4AQIA 4CLNA 1TN4A 2KBMA 1CDNA 5HLOA 2DOQA 1SCVA 2F33A 2EHBA 1DJZA 4HRGA 3PSRA 3TDIA 1NWDA 4ZCUA 2M3WA 2MJWB 1MXLC 2LUCA 4I5KA 1TCOB 4OR9B 2L4HA 1SR6C 3I5GB 1XK4A 2F8PA 1NX2A 1BG1A 1NCYA 2PALA 2JWWA 3FWBA 2PSRA 1RJVA 1YRUB 5KU1A 2M0RA 4UPGA 2I18A 3BUNB 1U5IA 4BY5A 2D8NA 1SRAA 1CFDA 3PM8A 3I5FC 2JTZA 4A4BA 4MN0A 4I5LB 1NCXA 1QX7A 2KFGA 4PE0A 1QLSA 3CR2A 1CDMA 1QS7A 4ORAB 2LLTA 2BL0B 2COLB 2OS8C 5DKQA 3TS5B 1DGUA 2CCMA 1SNLA 1M63B 2ZNEA 3I5IC 2OPOA 1MQ1A 1DJGA 3WXAA 4BY4A 1K96A 1L2OC 1UUSA 5ER4X 3SG7A 1YR5A 1A4PA 1JFJA 1KFXS 2LMUA 2V53A 4OKHA 2F2PA 4U8DA 3EKHA 2LVVA 1KWOB 2KGRA 4N1GA 2LMTA 3CWGA 3HX4A 2HQWA 1WDCC 1SK6D 2BKIB 1OQPA 1A29A 1EXRA 2KFFA 1XFUO 2KHNA 1AHRA 2K8MB 1M31A 2KFHA 4HRHA 1YTZC 5F6TA 1BOCA 1WY9A 1NIWA 1A75A 2BKHB 1SYMA 4R1EA 4GAOA 2K2FA 1GGZA 2WOSA 2KI4C 1E8AA 1XO5A 1JF2A 2KOTA 3CR4X 1FBVA 3SG4A 1B1GA 1S6CA 1EL4A 1TNPA 3KPXA 1KFUL 4GGFA 2JT8A 3GOFA 5JOLA 1H4BA 1SY9A 2ZFDA 4I5NB 3SG2A 4PHJA 4MBEA 2JPTA 1PSBA 1B8LA 1DF0A 1IKUA 5D69A 1CB1A 1Y0VH 4CFQA 2B1UA 4XJKB 1RFJA 2NLNA 1TIZA 1YUSA 2WORA 1K93D 3GK1A 4YGCB 3JTDC 1SCMB 3EKJA 4ETOA 1BMOA 3LCPC 1CMFA 1NX0A 3A8RA 4USLA 4JPZB 2KI6C 2JT0A 5AERA 3SIAA 1G33A 1CM1A 1TNQA 1PRWA 3ZNIA 2LAPA 2LMVA 2MA2A 5PALA 2ZNDA 2M9GA 2AUCA 1TRFA 1KSOA 2IS9A 3LK1A 4NDBA 2G9BA 1WLMA 1SW8A 1CFFA 1Y6WA 3OB2B 2QACA 2ZRTA 5FYXA 4PHKA 1AVSA 1TCFA 3BOWB 1K9UA 2KYCA 1S36A 2LM5A 3FS7A 3PLFB 3GK4X 1EH2A 1B7TZ 2L2EA 2L5XB 2JNXA 1QVIZ 1SR6B 3HCMA 2HPSA 2M1KB 1PVAA 1K9KA 3IQOA 2O5GA 1AP4A 3IF7A 1CKKA 4TNCA 4WQ2A 1UHKA 4GFTA 1HT9A 1KK8C 2M8UA 5CPVA 1K94A 3BUXB 2ISDA 3I5FB 3I5HC 1Y1AA 1QATA 4ORBB 2ZRSA 3JVTC 1XK4C 1IWQA 2JU0A 1YVHA 1B47A 1BT6A 3PN7C 1OMDA 1OMRA 2OS8B 5I2OA 3I5IB 2KYFA 1B4CA 3OX5A 2Y1NA 1ALVA 1KK7Y 1S5GZ 1L2OB 1J7QA 4F0ZB 1YUTA 1OZSA 2P6BB 2KAYA 3DVKA 4WRIA 4PE4A 1S6IA 4HREE 3CR5X 3SG3A 1F71A 2PVBA 2LV7A 1YRTB 1WDCB 2M49B 1M46A 2E6WA 2KNEA 5B8IB 1DJXA 2FCDA 5ER5A 4DUQA 1GJYA 1A2XA 1BR1B 2K7CA 5DKRA 4CPVA 3KEVA 5AFPA 3WHUB 3EK8A 1FF1A 1V1GA 5HLVA 1AUIB 1RECA 2JXLA 2KI6D 3OB1B 5KSZA 4XYNA 1CDPA 1QJTA 2BE4A 2FJUB 2WCEA 1JF0A 1UP5A 1LINA 1N65A 2QPTA 1J7PA 4PE7A 2KI4B 3CS1A 4N1FA 3FWCA 1J55A 3DF0A 2NCOA 4M2QA 2LVKA 1QLKA 1F4OA 4NDCA 5I2QA 3D0YB 1WRKA 1F55A 1MUXA 1FI5A 1SL9A 1R6PA 2L50A 4FQOA 1CFCA 3EK7A 1B9AA 1BJFA 2WC8A 3OP0A 2LANA 4NDDA 2A4JA 5AANA 2JRFA 2K2AA 1K2HA 4MSPA 4GGFC 3PATA 1HQVA 2GGZA 3JTDB 3ZWHA 2M1UA 3WNXB 1KFUS 1QX5B 1MXEA 4YGEB 1MHOA 1S1EA 2OTGC 3BXKA 1WRZA 4ZCVA 4MEWA 5I2LA 4YRUA 1MR8A 4AQJA 5AXIA 2Y4QA 3NSLA 3F45A 3KHEA 2KQYA 3TS5C 1KQVA 1ODBA 1G8IA 5CSNA 2JZIA 2LUXA 3BUMB 3BUWB 1N2DA 1EJ3A 3NSKA 3BYAA 1K9PA 4CFRA 5I8NA 3M0WA 1ZOTB 2M7NA 2AMIA 2FCEA 3AKBA 3NXAA 3EVRA 1EG3A 3LLEA 1RTP1 1CM4A 2SCPA 4GUKA 4ICBA 4C0JA 4DRWA 3FIAA 2L4IA 1TNWA 4ORCB 1W7IB 3TDUA 3SIBA 1GQMA 1QIWA 1B8RA 1K95A 2LHLA 2LP2A 2NCPA 2HQ8A 1J7RA 1ZFSA 1IQ5A 2EC6C 2LLSA 2BECA 2HF5A 4JWQA 4MRXA 2JT3A 1F4QA 1UWOA 1KK8B 2NXQA 4MVFA 3DD4A 3GK2A 3I5HB 1YUUA 2F2OA 1TTXA 2LCPA 3JVTB 2JQ6A 3C1VA 1BR4B 4MRYA 2GV5A 2LNKA 2K7DA 3RLZA 1KQMC 3TDZA 3PN7B 1IJ6A 3OX6A 3QRXA 2HETA 1TNXA 3ICBA 1IGVA
chains in the Genus database with same CATH superfamily
1U5IB 1XFZO 2TN4A 3D77A 3DVMA 1WLZA 1SL7A 1CLLA 1P28A 2VRGA 4CIDA 4DS7A 1JUOA 3SJSA 1AK8A 3BUOB 4L9MA 3VROA 1N0YA 4QJ4B 4E68A 2K60A 1NYAA 4PHMA 1DGVA 3O2PA 5CSIA 5J3XA 1FPWA 1B8CA 3TZ1A 4HSZA 3CTNA 4JQ0D 4MZKA 3VRPA 1W7JB 1UHHA 2LP3A 2KDHA 2K7BA 2KLDA 3SG6A 1VRKA 4DCKA 1M39A 2WNDA 2Y1MA 1YX7A 1LXFC 4YGBB 1YVLA 2KBIA 1LA0A 3VRQA 1CMGA 3PALA 1DJWA 5HKWA 1BU3A 1UHNA 1DTLA 1ALWA 3TUYC 1EG4A 3B6XA 1MWNA 1GM0A 1OOIX 1K90D 2BCBA 2Q91A 4DIRA 2WCKA 1BLQA 2F3ZA 1PALA 3UNWA 1JWDA 2JULA 3R1VA 5DKNA 1XFYO 1BF5A 1AJ4A 1OOJA 4WQ3A 2L98A 3IQQA 2K0JA 1NX3A 1FW4A 1C07A 2PRUA 4A4CA 2WC5A 1XVJA 5CSFA 3DVJA 1JSAA 4GGNA 4MZJA 3NSOA 1XFWO 1SKTA 1CFPA 1SBJA 3LL8B 2H61C 3NGVA 1OSAA 4YI9A 1A75B 5BPJA 1PSRA 3SG5A 1J7OA 4IJ7A 1IRJA 3SS4A 2K61A 2WCHA 3D10A 2MLEC 3DVEA 4YBHB 2PMYA 1MF8B 2H61A 5CSJA 1UHIA 1YURA 3BOWA 1ZACA 1S3PA 3KO0A 3O4YA 4AOMA 1NP8A 1OOFA 3VGOA 4QJ5B 3NSIA 1TUZA 1RWYA 2FOTA 2CXJA 2QEBA 2LHIA 1KK7Z 4P2YB 1SMGA 1XFXO 2OTGB 3AKAA 1DF0B 2KGBC 1DMOA 5JJGA 2JOJA 3AAKA 1M45A 4PALA 1Q80A 5KTYA 1F54A 1S26D 3PFVA 4C0KA 4OV2A 3EVUA 2BE6A 1CLMA 1DT7B 2JC2A 1IJ5A 3I5GC 2BCAA 4YI8A 3VRRA 1IIOA 2JPOA 3CLNA 3CZTX 2LLUA 2KAXA 3OGNA 1QTXA 5HYDA 2MBXA 4GNKB 2NZ0A 4PDZA 2MRDA 1YX8A 2LVJA 3B7AA 4INXA 2KAVA 4D1EA 4KYNA 2ZN8A 4PE1A 1KFXL 1DVIA 2CNPA 3R1OA 1PK0D 3D76A 2I2RE 2PASA 3KF9A 1CLBA 1FI6A 5K89A 2Q4UA 2R2IA 1QX2A 2BL0C 2ERBA 3CGAA 1Y1UA 1BODA 1PULA 2CBLA 3BQ3A 2L0PA 4M2PA 2LVIA 1XFVO 2EC6B 1LVCD 4MLWA 1DJYA 1KSMA 1OMVA 1QWVA 2E30A 3A4UB 2ZN9A 2M7LA 1JC2A 1OOGA 1IQ3A 1SPYA 1F70A 1NUBA 4C0LA 1OZOA 2GGMA 3MSEB 1QIVA 1NSHA 4GBAA 3V2LA 1QV1A 2KSPA 2H2KA 1H8BA 2AAOA 3WHTB 1KWOC 2O60A 1KQMB 1UURA 2Y5IA 4PCWA 3NHTA 1C7VA 4MZLA 1TOPA 2MLFC 1LA3A 3LK0A 4N5XA 1X02A 1UHJA 1A03A 2I94A 3D78A 3PM2A 3L47A 3E3RA 1L7ZA 2JTTA 4P5OE 2BBMA 1LKJA 3D0YA 4GPLB 1D1OA 1J1DA 1ZMZA 1KCYA 1NPQA 1V1FA 2F3YA 1WRLA 4IL1A 3FE8A 3RZSA 1JBAA 4OCIA 2JXCA 1CNPA 2RGIA 3L4AA 2WCFA 4I5JA 5D7FA 2LE9B 1OOHA 1ZUZA 1AJ5A 3AAJA 4M2OA 1B7TY 1CTRA 1JFKA 1SL8A 5TNCA 2I7AA 4YGDB 1W9ZA 2CT9A 1QVIY 2MAZA 4QJ3B 4Q04A 1XYDA 3TUYB 2EGDA 1G4YR 1RK9A 5HKYA 4PHNA 1DELA 1Z4HA 2K7OA 2BBNA 2WCBA 1PVBA 3FE6A 5AEQA 3OHMB 1S6JA 1C7WA 1OE9B 3S0FA 2CTNA 2M97A 1J1EA 1NCZA 2M29A 3D73A 1DJIA 5HKZA 5I94A 1XA5A 1GGWA 3FE9A 1RROA 2KQ6A 3B87A 4NQGA 2L51A 2ZKMX 3CDNA 1CDLA 1QXPA 4FTGA 2JNFA 5HL1A 2SASA 1SCMC 3DYEA 5GQQC 2G2BA 1Y1XA 4OVNF 2KPHA 2MHHA 3D75A 3EK4A 2BCXA 4XJKA 1F8HA 1K8UA 1R2UA 4YGAA 1IH0A 1S5GY 3R72A 1QASA 5G08A 1DJHA 3O6BA 3NHIA 1NX1A 3H4SE 1IG5A 3DF0B 5FI7A 5IBWA 3VRNA 3D74A 3RM1A 1QV0A 3EVVA 3O78A 3K21A 2LC5A 4AQIA 4CLNA 1TN4A 2KBMA 1CDNA 5HLOA 2WCLA 2DOQA 1SCVA 2F33A 2EHBA 1DJZA 4HRGA 2QDIA 2WCMA 3PSRA 3TDIA 1NWDA 4ZCUA 2M3WA 2KLEA 1MXLC 2LUCA 2MJWB 1TCOB 4I5KA 4OR9B 2L4HA 1SR6C 3I5GB 2BNXA 1XK4A 2F8PA 1NX2A 1BG1A 1NCYA 2PALA 2JWWA 3EG5B 3FWBA 3QMEA 2PSRA 1RJVA 1YRUB 5KU1A 2M0RA 4UPGA 3L4LA 2I18A 3BUNB 1U5IA 3DY9A 5FI6A 4BY5A 2D8NA 1SRAA 1CFDA 3PM8A 3I5FC 2JTZA 4A4BA 4MN0A 4I5LB 3SS5A 1NCXA 3DXLA 1QX7A 1T14A 2KFGA 4PE0A 1QLSA 3CR2A 1CDMA 1QS7A 3N7HA 4ORAB 2LLTA 2BL0B 2COLB 2OS8C 5DKQA 3TS5B 1DGUA 2CCMA 1SNLA 1M63B 2ZNEA 3I5IC 5D3OA 2OPOA 1MQ1A 1DJGA 3WXAA 4INWA 4BY4A 1K96A 1L2OC 1UUSA 5ER4X 3SG7A 1C3ZA 1YR5A 1A4PA 1JFJA 1KFXS 2LMUA 2V53A 3R1PA 1Z2CB 4OKHA 2F2PA 4U8DA 1TWOA 3EKHA 2LVVA 1KWOB 2KGRA 3CZ2A 4N1GA 2LMTA 3CWGA 3HX4A 3BJHA 2HQWA 1WDCC 1SK6D 2BKIB 1OQPA 3SS3A 1A29A 3OBVA 1EXRA 2KFFA 1XFUO 2KHNA 1AHRA 5DICA 1SSEB 2K8MB 1M31A 2KFHA 4HRHA 1YTZC 5F6TA 1BOCA 3S0EA 1WY9A 1NIWA 1A75A 2BKHB 1SYMA 4R1EA 4GAOA 2K2FA 1GGZA 2WOSA 2KI4C 4PT1A 1E8AA 1XO5A 1JF2A 2KOTA 3CR4X 1FBVA 3SG4A 2GTEA 1B1GA 1S6CA 1EL4A 1TNPA 3KPXA 1KFUL 4GGFA 2JT8A 3GOFA 5JOLA 1H4BA 1SY9A 2ZFDA 4I5NB 3SG2A 4PHJA 4MBEA 3BFHA 2JPTA 3DZTA 1PSBA 1B8LA 1DF0A 1DC1A 1IKUA 3CZ1A 3O4XA 5D69A 1CB1A 1Y0VH 4CFQA 2B1UA 4XJKB 1RFJA 2NLNA 1TIZA 1YUSA 2WORA 1K93D 3GK1A 4YGCB 3JTDC 1SCMB 3EKJA 4ETOA 1BMOA 3LCPC 1CMFA 1NX0A 2WCJA 3A8RA 2P71A 4USLA 4JPZB 2KI6C 2JT0A 5AERA 3SIAA 1G33A 1CM1A 1TNQA 1PRWA 3ZNIA 2LAPA 3Q8IA 2LMVA 2MA2A 5PALA 2ZNDA 2M9GA 2AUCA 1TRFA 1KSOA 2IS9A 3LK1A 4NDBA 2G9BA 1WLMA 2FJYA 1SW8A 1C3YA 1CFFA 1Y6WA 3OB2B 2QACA 2ZRTA 5FYXA 4PHKA 3CYZA 1AVSA 1TCFA 3BOWB 1K9UA 2KYCA 1S36A 2LM5A 3FS7A 3PLFB 3GK4X 1EH2A 1B7TZ 4OZDA 2L2EA 2L5XB 2JNXA 1QVIZ 1SR6B 3HCMA 2HPSA 2M1KB 1PVAA 1K9KA 3IQOA 2O5GA 1AP4A 2QEOA 3IF7A 2L2CA 3VB1A 1CKKA 4TNCA 4WQ2A 1UHKA 4GFTA 4JD9A 1HT9A 1KK8C 2M8UA 5CPVA 1K94A 3BUXB 2ISDA 3I5FB 3I5HC 1Y1AA 1QATA 4ORBB 2ZRSA 3JVTC 3S0AA 1XK4C 1IWQA 2JU0A 1YVHA 1B47A 1BT6A 3PN7C 1OMDA 1OMRA 2OS8B 5I2OA 3CABA 3BFBA 3I5IB 2KYFA 1B4CA 3OX5A 2Y1NA 1ALVA 1KK7Y 1S5GZ 1L2OB 1J7QA 4F0ZB 1YUTA 1OZSA 2QEVA 2P6BB 2KAYA 3DVKA 4WRIA 4PE4A 3UO9A 1S6IA 4HREE 3CR5X 3SG3A 1F71A 2PVBA 2LV7A 2H8VA 1YRTB 2QEHA 1WDCB 2M49B 1M46A 2E6WA 2KNEA 3K1EA 1DJXA 2FCDA 5ER5A 4DUQA 1GJYA 5B8IB 1A2XA 1BR1B 2K7CA 5DKRA 4CPVA 3KEVA 5AFPA 3WHUB 3EK8A 1TUJA 1FF1A 1V1GA 5HLVA 1AUIB 1RECA 2JXLA 2KI6D 3OB1B 5KSZA 4XYNA 1CDPA 1QJTA 2BE4A 2FJUB 2WCEA 1JF0A 1UP5A 1LINA 1N65A 2QPTA 1J7PA 4PE7A 2KI4B 3CS1A 4N1FA 3FWCA 1J55A 3DF0A 2NCOA 5FI2A 4M2QA 2LVKA 1QLKA 1F4OA 4NDCA 5I2QA 3D0YB 1WRKA 1DQEA 1MUXA 1F55A 1FI5A 1SL9A 1R6PA 2L50A 4FQOA 1CFCA 3EK7A 1LS8A 2PQLA 1B9AA 1BJFA 2WC8A 3OP0A 3S0BA 2LANA 4NDDA 2A4JA 2PYQA 5AANA 2JRFA 2K2AA 1XFRA 2BAPA 2YGUA 1K2HA 4MSPA 4GGFC 3PATA 5EL2A 1HQVA 1ORGA 2GGZA 3JTDB 3ZWHA 2M1UA 3WNXB 1KFUS 1QX5B 1MXEA 4JKTA 4YGEB 1MHOA 1S1EA 2OTGC 3BXKA 1WRZA 4ZCVA 4MEWA 5I2LA 2WC6A 4YRUA 1MR8A 4AQJA 5AXIA 2Y4QA 3NSLA 3F45A 3KHEA 2KQYA 3S0DA 3TS5C 1KQVA 1ODBA 1G8IA 5CSNA 2JZIA 1DEKA 4FQTA 2LUXA 3BUMB 3BUWB 1N2DA 3PJIA 1EJ3A 3NSKA 3BYAA 1K9PA 4CFRA 5I8NA 3M0WA 1ZOTB 4F7FA 2M7NA 2AMIA 2FCEA 3AKBA 3NXAA 3EVRA 3S0GA 1EG3A 3LLEA 1RTP1 1CM4A 2SCPA 4GUKA 4ICBA 4C0JA 4DRWA 3FIAA 2L4IA 1TNWA 4ORCB 1W7IB 3TDUA 3SIBA 1GQMA 1OW4A 1QIWA 1B8RA 1K95A 2LHLA 2LP2A 2NCPA 3BFAA 2HQ8A 1J7RA 1ZFSA 3IVTA 1IQ5A 3B86A 2EC6C 2LLSA 2BECA 2HF5A 4JWQA 4MRXA 2JT3A 1F4QA 2L5YA 1UWOA 1KK8B 2NXQA 4MVFA 3DD4A 3GK2A 3I5HB 1YUUA 2F2OA 1TTXA 2LCPA 3JVTB 2JQ6A 3C1VA 1BR4B 4MRYA 2GV5A 2LNKA 3B88A 2K7DA 3RLZA 1KQMC 3CZ0A 3PN7B 3TDZA 1IJ6A 2P70A 3OX6A 3QRXA 2HETA 1TNXA 3ICBA 1IGVA
chains in the Genus database with same CATH topology
1U5IB 1XFZO 2TN4A 4DS7A 3DVMA 1WLZA 1SL7A 1CLLA 2VRGA 4CIDA 1JUOA 3SJSA 1AK8A 3BUOB 4L9MA 3VROA 1N0YA 4QJ4B 4E68A 1NYAA 4PHMA 1DGVA 3O2PA 5CSIA 5J3XA 1FPWA 1B8CA 3TZ1A 4HSZA 3CTNA 4JQ0D 4MZKA 3VRPA 1W7JB 1UHHA 2LP3A 2KDHA 2K7BA 3SG6A 1VRKA 4DCKA 1M39A 2WNDA 2Y1MA 1YX7A 1LXFC 4YGBB 1YVLA 2KBIA 1LA0A 3VRQA 1CMGA 3PALA 1DJWA 5HKWA 1BU3A 1UHNA 1DTLA 1ALWA 3TUYC 1EG4A 1MWNA 1K90D 2BCBA 2Q91A 4DIRA 1BLQA 2F3ZA 1PALA 1JWDA 2JULA 5DKNA 1XFYO 1BF5A 1AJ4A 1OOJA 4WQ3A 2L98A 3IQQA 2K0JA 1NX3A 1FW4A 1C07A 2PRUA 4A4CA 1XVJA 5CSFA 3DVJA 1JSAA 4GGNA 4MZJA 3NSOA 1XFWO 1SKTA 1CFPA 1SBJA 3LL8B 2H61C 1OSAA 4YI9A 1A75B 5BPJA 1PSRA 3SG5A 1J7OA 1IRJA 2K61A 3DVEA 3D10A 2MLEC 4YBHB 2PMYA 1MF8B 2H61A 5CSJA 1UHIA 1YURA 3BOWA 1ZACA 1S3PA 3KO0A 3O4YA 4AOMA 1NP8A 4QJ5B 3VGOA 3NSIA 2FOTA 1RWYA 2CXJA 2LHIA 1KK7Z 4P2YB 1SMGA 1XFXO 2OTGB 3AKAA 1DF0B 2KGBC 1DMOA 5JJGA 2JOJA 3AAKA 1M45A 4PALA 1Q80A 5KTYA 1F54A 1S26D 3PFVA 4C0KA 4OV2A 3EVUA 2BE6A 1CLMA 1DT7B 2JC2A 1IJ5A 3I5GC 2BCAA 4YI8A 3VRRA 3CLNA 3CZTX 2LLUA 2KAXA 1QTXA 5HYDA 2MBXA 4GNKB 2NZ0A 4PDZA 2MRDA 1YX8A 2LVJA 2KAVA 4D1EA 2ZN8A 4PE1A 1KFXL 1DVIA 2CNPA 1PK0D 2I2RE 2PASA 3KF9A 1CLBA 1FI6A 5K89A 2Q4UA 2R2IA 1QX2A 2BL0C 3CGAA 1Y1UA 1BODA 1PULA 2CBLA 3BQ3A 2L0PA 4M2PA 2LVIA 1XFVO 2EC6B 1LVCD 4MLWA 1DJYA 1KSMA 1OMVA 2E30A 3A4UB 2M7LA 2ZN9A 1JC2A 1F70A 1IQ3A 1SPYA 1NUBA 4C0LA 1OZOA 2GGMA 3MSEB 1QIVA 1NSHA 4GBAA 1QV1A 2KSPA 2H2KA 1H8BA 2AAOA 3WHTB 1KWOC 2O60A 1KQMB 1UURA 2Y5IA 4PCWA 1C7VA 4MZLA 1TOPA 2MLFC 1LA3A 3LK0A 4N5XA 1X02A 1UHJA 1A03A 2I94A 3E3RA 1L7ZA 2JTTA 4P5OE 2BBMA 1LKJA 3D0YA 4GPLB 1D1OA 1J1DA 1ZMZA 1KCYA 1NPQA 1V1FA 2F3YA 1WRLA 4IL1A 1JBAA 4OCIA 2JXCA 1CNPA 2RGIA 2WCFA 4I5JA 5D7FA 2LE9B 1ZUZA 1AJ5A 3AAJA 4M2OA 1B7TY 1CTRA 1JFKA 1SL8A 5TNCA 2I7AA 4YGDB 2CT9A 1QVIY 2MAZA 4QJ3B 4Q04A 1XYDA 3TUYB 2EGDA 1G4YR 1RK9A 5HKYA 4PHNA 2K7OA 2BBNA 2WCBA 1PVBA 5AEQA 3OHMB 1S6JA 1C7WA 1OE9B 2CTNA 2M97A 1J1EA 1NCZA 2M29A 5HKZA 1DJIA 1XA5A 1GGWA 4NQGA 1RROA 2KQ6A 2L51A 2ZKMX 1CDLA 1QXPA 4FTGA 2JNFA 2SASA 1SCMC 5GQQC 2G2BA 1Y1XA 4OVNF 2MHHA 3EK4A 2BCXA 4XJKA 1F8HA 1K8UA 1R2UA 4YGAA 1IH0A 1S5GY 1QASA 5G08A 1DJHA 3O6BA 1NX1A 3H4SE 1IG5A 3DF0B 5IBWA 3VRNA 3RM1A 1QV0A 3EVVA 3O78A 3K21A 2LC5A 4AQIA 4CLNA 1TN4A 2KBMA 1CDNA 5HLOA 2DOQA 1SCVA 2F33A 2EHBA 1DJZA 4HRGA 3PSRA 3TDIA 1NWDA 4ZCUA 2M3WA 2MJWB 1MXLC 2LUCA 4I5KA 1TCOB 4OR9B 2L4HA 1SR6C 3I5GB 1XK4A 2F8PA 1NX2A 1BG1A 1NCYA 2PALA 2JWWA 3FWBA 2PSRA 1RJVA 1YRUB 5KU1A 2M0RA 4UPGA 2I18A 3BUNB 1U5IA 4BY5A 2D8NA 1SRAA 1CFDA 3PM8A 3I5FC 2JTZA 4A4BA 4MN0A 4I5LB 1NCXA 1QX7A 2KFGA 4PE0A 1QLSA 3CR2A 1CDMA 1QS7A 4ORAB 2LLTA 2BL0B 2COLB 2OS8C 5DKQA 3TS5B 1DGUA 2CCMA 1SNLA 1M63B 2ZNEA 3I5IC 2OPOA 1MQ1A 1DJGA 3WXAA 4BY4A 1K96A 1L2OC 1UUSA 5ER4X 3SG7A 1YR5A 1A4PA 1JFJA 1KFXS 2LMUA 2V53A 4OKHA 2F2PA 4U8DA 3EKHA 2LVVA 1KWOB 2KGRA 4N1GA 2LMTA 3CWGA 3HX4A 2HQWA 1WDCC 1SK6D 2BKIB 1OQPA 1A29A 1EXRA 2KFFA 1XFUO 2KHNA 1AHRA 2K8MB 1M31A 2KFHA 4HRHA 1YTZC 5F6TA 1BOCA 1WY9A 1NIWA 1A75A 2BKHB 1SYMA 4R1EA 4GAOA 2K2FA 1GGZA 2WOSA 2KI4C 1E8AA 1XO5A 1JF2A 2KOTA 3CR4X 1FBVA 3SG4A 1B1GA 1S6CA 1EL4A 1TNPA 3KPXA 1KFUL 4GGFA 2JT8A 3GOFA 5JOLA 1H4BA 1SY9A 2ZFDA 4I5NB 3SG2A 4PHJA 4MBEA 2JPTA 1PSBA 1B8LA 1DF0A 1IKUA 5D69A 1CB1A 1Y0VH 4CFQA 2B1UA 4XJKB 1RFJA 2NLNA 1TIZA 1YUSA 2WORA 1K93D 3GK1A 4YGCB 3JTDC 1SCMB 3EKJA 4ETOA 1BMOA 3LCPC 1CMFA 1NX0A 3A8RA 4USLA 4JPZB 2KI6C 2JT0A 5AERA 3SIAA 1G33A 1CM1A 1TNQA 1PRWA 3ZNIA 2LAPA 2LMVA 2MA2A 5PALA 2ZNDA 2M9GA 2AUCA 1TRFA 1KSOA 2IS9A 3LK1A 4NDBA 2G9BA 1WLMA 1SW8A 1CFFA 1Y6WA 3OB2B 2QACA 2ZRTA 5FYXA 4PHKA 1AVSA 1TCFA 3BOWB 1K9UA 2KYCA 1S36A 2LM5A 3FS7A 3PLFB 3GK4X 1EH2A 1B7TZ 2L2EA 2L5XB 2JNXA 1QVIZ 1SR6B 3HCMA 2HPSA 2M1KB 1PVAA 1K9KA 3IQOA 2O5GA 1AP4A 3IF7A 1CKKA 4TNCA 4WQ2A 1UHKA 4GFTA 1HT9A 1KK8C 2M8UA 5CPVA 1K94A 3BUXB 2ISDA 3I5FB 3I5HC 1Y1AA 1QATA 4ORBB 2ZRSA 3JVTC 1XK4C 1IWQA 2JU0A 1YVHA 1B47A 1BT6A 3PN7C 1OMDA 1OMRA 2OS8B 5I2OA 3I5IB 2KYFA 1B4CA 3OX5A 2Y1NA 1ALVA 1KK7Y 1S5GZ 1L2OB 1J7QA 4F0ZB 1YUTA 1OZSA 2P6BB 2KAYA 3DVKA 4WRIA 4PE4A 1S6IA 4HREE 3CR5X 3SG3A 1F71A 2PVBA 2LV7A 1YRTB 1WDCB 2M49B 1M46A 2E6WA 2KNEA 5B8IB 1DJXA 2FCDA 5ER5A 4DUQA 1GJYA 1A2XA 1BR1B 2K7CA 5DKRA 4CPVA 3KEVA 5AFPA 3WHUB 3EK8A 1FF1A 1V1GA 5HLVA 1AUIB 1RECA 2JXLA 2KI6D 3OB1B 5KSZA 4XYNA 1CDPA 1QJTA 2BE4A 2FJUB 2WCEA 1JF0A 1UP5A 1LINA 1N65A 2QPTA 1J7PA 4PE7A 2KI4B 3CS1A 4N1FA 3FWCA 1J55A 3DF0A 2NCOA 4M2QA 2LVKA 1QLKA 1F4OA 4NDCA 5I2QA 3D0YB 1WRKA 1F55A 1MUXA 1FI5A 1SL9A 1R6PA 2L50A 4FQOA 1CFCA 3EK7A 1B9AA 1BJFA 2WC8A 3OP0A 2LANA 4NDDA 2A4JA 5AANA 2JRFA 2K2AA 1K2HA 4MSPA 4GGFC 3PATA 1HQVA 2GGZA 3JTDB 3ZWHA 2M1UA 3WNXB 1KFUS 1QX5B 1MXEA 4YGEB 1MHOA 1S1EA 2OTGC 3BXKA 1WRZA 4ZCVA 4MEWA 5I2LA 4YRUA 1MR8A 4AQJA 5AXIA 2Y4QA 3NSLA 3F45A 3KHEA 2KQYA 3TS5C 1KQVA 1ODBA 1G8IA 5CSNA 2JZIA 2LUXA 3BUMB 3BUWB 1N2DA 1EJ3A 3NSKA 3BYAA 1K9PA 4CFRA 5I8NA 3M0WA 1ZOTB 2M7NA 2AMIA 2FCEA 3AKBA 3NXAA 3EVRA 1EG3A 3LLEA 1RTP1 1CM4A 2SCPA 4GUKA 4ICBA 4C0JA 4DRWA 3FIAA 2L4IA 1TNWA 4ORCB 1W7IB 3TDUA 3SIBA 1GQMA 1QIWA 1B8RA 1K95A 2LHLA 2LP2A 2NCPA 2HQ8A 1J7RA 1ZFSA 1IQ5A 2EC6C 2LLSA 2BECA 2HF5A 4JWQA 4MRXA 2JT3A 1F4QA 1UWOA 1KK8B 2NXQA 4MVFA 3DD4A 3GK2A 3I5HB 1YUUA 2F2OA 1TTXA 2LCPA 3JVTB 2JQ6A 3C1VA 1BR4B 4MRYA 2GV5A 2LNKA 2K7DA 3RLZA 1KQMC 3TDZA 3PN7B 1IJ6A 3OX6A 3QRXA 2HETA 1TNXA 3ICBA 1IGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U5I B;  1XFZ O;  2TN4 A;  4DS7 A;  3DVM A;  1WLZ A;  1SL7 A;  1CLL A;  2VRG A;  4CID A;  1JUO A;  3SJS A;  1AK8 A;  3BUO B;  4L9M A;  3VRO A;  1N0Y A;  4QJ4 B;  4E68 A;  1NYA A;  4PHM A;  1DGV A;  3O2P A;  5CSI A;  5J3X A;  1FPW A;  1B8C A;  3TZ1 A;  4HSZ A;  3CTN A;  4JQ0 D;  4MZK A;  3VRP A;  1W7J B;  1UHH A;  2LP3 A;  2KDH A;  2K7B A;  3SG6 A;  1VRK A;  4DCK A;  1M39 A;  2WND A;  2Y1M A;  1YX7 A;  1LXF C;  4YGB B;  1YVL A;  2KBI A;  1LA0 A;  3VRQ A;  1CMG A;  3PAL A;  1DJW A;  5HKW A;  1BU3 A;  1UHN A;  1DTL A;  1ALW A;  3TUY C;  1EG4 A;  1MWN A;  1K90 D;  2BCB A;  2Q91 A;  4DIR A;  1BLQ A;  2F3Z A;  1PAL A;  1JWD A;  2JUL A;  5DKN A;  1XFY O;  1BF5 A;  1AJ4 A;  1OOJ A;  4WQ3 A;  2L98 A;  3IQQ A;  2K0J A;  1NX3 A;  1FW4 A;  1C07 A;  2PRU A;  4A4C A;  1XVJ A;  5CSF A;  3DVJ A;  1JSA A;  4GGN A;  4MZJ A;  3NSO A;  1XFW O;  1SKT A;  1CFP A;  1SBJ A;  3LL8 B;  2H61 C;  1OSA A;  4YI9 A;  1A75 B;  5BPJ A;  1PSR A;  3SG5 A;  1J7O A;  1IRJ A;  2K61 A;  3DVE A;  3D10 A;  2MLE C;  4YBH B;  2PMY A;  1MF8 B;  2H61 A;  5CSJ A;  1UHI A;  1YUR A;  3BOW A;  1ZAC A;  1S3P A;  3KO0 A;  3O4Y A;  4AOM A;  1NP8 A;  4QJ5 B;  3VGO A;  3NSI A;  2FOT A;  1RWY A;  2CXJ A;  2LHI A;  1KK7 Z;  4P2Y B;  1SMG A;  1XFX O;  2OTG B;  3AKA A;  1DF0 B;  2KGB C;  1DMO A;  5JJG A;  2JOJ A;  3AAK A;  1M45 A;  4PAL A;  1Q80 A;  5KTY A;  1F54 A;  1S26 D;  3PFV A;  4C0K A;  4OV2 A;  3EVU A;  2BE6 A;  1CLM A;  1DT7 B;  2JC2 A;  1IJ5 A;  3I5G C;  2BCA A;  4YI8 A;  3VRR A;  3CLN A;  3CZT X;  2LLU A;  2KAX A;  1QTX A;  5HYD A;  2MBX A;  4GNK B;  2NZ0 A;  4PDZ A;  2MRD A;  1YX8 A;  2LVJ A;  2KAV A;  4D1E A;  2ZN8 A;  4PE1 A;  1KFX L;  1DVI A;  2CNP A;  1PK0 D;  2I2R E;  2PAS A;  3KF9 A;  1CLB A;  1FI6 A;  5K89 A;  2Q4U A;  2R2I A;  1QX2 A;  2BL0 C;  3CGA A;  1Y1U A;  1BOD A;  1PUL A;  2CBL A;  3BQ3 A;  2L0P A;  4M2P A;  2LVI A;  1XFV O;  2EC6 B;  1LVC D;  4MLW A;  1DJY A;  1KSM A;  1OMV A;  2E30 A;  3A4U B;  2M7L A;  2ZN9 A;  1JC2 A;  1F70 A;  1IQ3 A;  1SPY A;  1NUB A;  4C0L A;  1OZO A;  2GGM A;  3MSE B;  1QIV A;  1NSH A;  4GBA A;  1QV1 A;  2KSP A;  2H2K A;  1H8B A;  2AAO A;  3WHT B;  1KWO C;  2O60 A;  1KQM B;  1UUR A;  2Y5I A;  4PCW A;  1C7V A;  4MZL A;  1TOP A;  2MLF C;  1LA3 A;  3LK0 A;  4N5X A;  1X02 A;  1UHJ A;  1A03 A;  2I94 A;  3E3R A;  1L7Z A;  2JTT A;  4P5O E;  2BBM A;  1LKJ A;  3D0Y A;  4GPL B;  1D1O A;  1J1D A;  1ZMZ A;  1KCY A;  1NPQ A;  1V1F A;  2F3Y A;  1WRL A;  4IL1 A;  1JBA A;  4OCI A;  2JXC A;  1CNP A;  2RGI A;  2WCF A;  4I5J A;  5D7F A;  2LE9 B;  1ZUZ A;  1AJ5 A;  3AAJ A;  4M2O A;  1B7T Y;  1CTR A;  1JFK A;  1SL8 A;  5TNC A;  2I7A A;  4YGD B;  2CT9 A;  1QVI Y;  2MAZ A;  4QJ3 B;  4Q04 A;  1XYD A;  3TUY B;  2EGD A;  1G4Y R;  1RK9 A;  5HKY A;  4PHN A;  2K7O A;  2BBN A;  2WCB A;  1PVB A;  5AEQ A;  3OHM B;  1S6J A;  1C7W A;  1OE9 B;  2CTN A;  2M97 A;  1J1E A;  1NCZ A;  2M29 A;  5HKZ A;  1DJI A;  1XA5 A;  1GGW A;  4NQG A;  1RRO A;  2KQ6 A;  2L51 A;  2ZKM X;  1CDL A;  1QXP A;  4FTG A;  2JNF A;  2SAS A;  1SCM C;  5GQQ C;  2G2B A;  1Y1X A;  4OVN F;  2MHH A;  3EK4 A;  2BCX A;  4XJK A;  1F8H A;  1K8U A;  1R2U A;  4YGA A;  1IH0 A;  1S5G Y;  1QAS A;  5G08 A;  1DJH A;  3O6B A;  1NX1 A;  3H4S E;  1IG5 A;  3DF0 B;  5IBW A;  3VRN A;  3RM1 A;  1QV0 A;  3EVV A;  3O78 A;  3K21 A;  2LC5 A;  4AQI A;  4CLN A;  1TN4 A;  2KBM A;  1CDN A;  5HLO A;  2DOQ A;  1SCV A;  2F33 A;  2EHB A;  1DJZ A;  4HRG A;  3PSR A;  3TDI A;  1NWD A;  4ZCU A;  2M3W A;  2MJW B;  1MXL C;  2LUC A;  4I5K A;  1TCO B;  4OR9 B;  2L4H A;  1SR6 C;  3I5G B;  1XK4 A;  2F8P A;  1NX2 A;  1BG1 A;  1NCY A;  2PAL A;  2JWW A;  3FWB A;  2PSR A;  1RJV A;  1YRU B;  5KU1 A;  2M0R A;  4UPG A;  2I18 A;  3BUN B;  1U5I A;  4BY5 A;  2D8N A;  1SRA A;  1CFD A;  3PM8 A;  3I5F C;  2JTZ A;  4A4B A;  4MN0 A;  4I5L B;  1NCX A;  1QX7 A;  2KFG A;  4PE0 A;  1QLS A;  3CR2 A;  1CDM A;  1QS7 A;  4ORA B;  2LLT A;  2BL0 B;  2COL B;  2OS8 C;  5DKQ A;  3TS5 B;  1DGU A;  2CCM A;  1SNL A;  1M63 B;  2ZNE A;  3I5I C;  2OPO A;  1MQ1 A;  1DJG A;  3WXA A;  4BY4 A;  1K96 A;  1L2O C;  1UUS A;  5ER4 X;  3SG7 A;  1YR5 A;  1A4P A;  1JFJ A;  1KFX S;  2LMU A;  2V53 A;  4OKH A;  2F2P A;  4U8D A;  3EKH A;  2LVV A;  1KWO B;  2KGR A;  4N1G A;  2LMT A;  3CWG A;  3HX4 A;  2HQW A;  1WDC C;  1SK6 D;  2BKI B;  1OQP A;  1A29 A;  1EXR A;  2KFF A;  1XFU O;  2KHN A;  1AHR A;  2K8M B;  1M31 A;  2KFH A;  4HRH A;  1YTZ C;  5F6T A;  1BOC A;  1WY9 A;  1NIW A;  1A75 A;  2BKH B;  1SYM A;  4R1E A;  4GAO A;  2K2F A;  1GGZ A;  2WOS A;  2KI4 C;  1E8A A;  1XO5 A;  1JF2 A;  2KOT A;  3CR4 X;  1FBV A;  3SG4 A;  1B1G A;  1S6C A;  1EL4 A;  1TNP A;  3KPX A;  1KFU L;  4GGF A;  2JT8 A;  3GOF A;  5JOL A;  1H4B A;  1SY9 A;  2ZFD A;  4I5N B;  3SG2 A;  4PHJ A;  4MBE A;  2JPT A;  1PSB A;  1B8L A;  1DF0 A;  1IKU A;  5D69 A;  1CB1 A;  1Y0V H;  4CFQ A;  2B1U A;  4XJK B;  1RFJ A;  2NLN A;  1TIZ A;  1YUS A;  2WOR A;  1K93 D;  3GK1 A;  4YGC B;  3JTD C;  1SCM B;  3EKJ A;  4ETO A;  1BMO A;  3LCP C;  1CMF A;  1NX0 A;  3A8R A;  4USL A;  4JPZ B;  2KI6 C;  2JT0 A;  5AER A;  3SIA A;  1G33 A;  1CM1 A;  1TNQ A;  1PRW A;  3ZNI A;  2LAP A;  2LMV A;  2MA2 A;  5PAL A;  2ZND A;  2M9G A;  2AUC A;  1TRF A;  1KSO A;  2IS9 A;  3LK1 A;  4NDB A;  2G9B A;  1WLM A;  1SW8 A;  1CFF A;  1Y6W A;  3OB2 B;  2QAC A;  2ZRT A;  5FYX A;  4PHK A;  1AVS A;  1TCF A;  3BOW B;  1K9U A;  2KYC A;  1S36 A;  2LM5 A;  3FS7 A;  3PLF B;  3GK4 X;  1EH2 A;  1B7T Z;  2L2E A;  2L5X B;  2JNX A;  1QVI Z;  1SR6 B;  3HCM A;  2HPS A;  2M1K B;  1PVA A;  1K9K A;  3IQO A;  2O5G A;  1AP4 A;  3IF7 A;  1CKK A;  4TNC A;  4WQ2 A;  1UHK A;  4GFT A;  1HT9 A;  1KK8 C;  2M8U A;  5CPV A;  1K94 A;  3BUX B;  2ISD A;  3I5F B;  3I5H C;  1Y1A A;  1QAT A;  4ORB B;  2ZRS A;  3JVT C;  1XK4 C;  1IWQ A;  2JU0 A;  1YVH A;  1B47 A;  1BT6 A;  3PN7 C;  1OMD A;  1OMR A;  2OS8 B;  5I2O A;  3I5I B;  2KYF A;  1B4C A;  3OX5 A;  2Y1N A;  1ALV A;  1KK7 Y;  1S5G Z;  1L2O B;  1J7Q A;  4F0Z B;  1YUT A;  1OZS A;  2P6B B;  2KAY A;  3DVK A;  4WRI A;  4PE4 A;  1S6I A;  4HRE E;  3CR5 X;  3SG3 A;  1F71 A;  2PVB A;  2LV7 A;  1YRT B;  1WDC B;  2M49 B;  1M46 A;  2E6W A;  2KNE A;  5B8I B;  1DJX A;  2FCD A;  5ER5 A;  4DUQ A;  1GJY A;  1A2X A;  1BR1 B;  2K7C A;  5DKR A;  4CPV A;  3KEV A;  5AFP A;  3WHU B;  3EK8 A;  1FF1 A;  1V1G A;  5HLV A;  1AUI B;  1REC A;  2JXL A;  2KI6 D;  3OB1 B;  5KSZ A;  4XYN A;  1CDP A;  1QJT A;  2BE4 A;  2FJU B;  2WCE A;  1JF0 A;  1UP5 A;  1LIN A;  1N65 A;  2QPT A;  1J7P A;  4PE7 A;  2KI4 B;  3CS1 A;  4N1F A;  3FWC A;  1J55 A;  3DF0 A;  2NCO A;  4M2Q A;  2LVK A;  1QLK A;  1F4O A;  4NDC A;  5I2Q A;  3D0Y B;  1WRK A;  1F55 A;  1MUX A;  1FI5 A;  1SL9 A;  1R6P A;  2L50 A;  4FQO A;  1CFC A;  3EK7 A;  1B9A A;  1BJF A;  2WC8 A;  3OP0 A;  2LAN A;  4NDD A;  2A4J A;  5AAN A;  2JRF A;  2K2A A;  1K2H A;  4MSP A;  4GGF C;  3PAT A;  1HQV A;  2GGZ A;  3JTD B;  3ZWH A;  2M1U A;  3WNX B;  1KFU S;  1QX5 B;  1MXE A;  4YGE B;  1MHO A;  1S1E A;  2OTG C;  3BXK A;  1WRZ A;  4ZCV A;  4MEW A;  5I2L A;  4YRU A;  1MR8 A;  4AQJ A;  5AXI A;  2Y4Q A;  3NSL A;  3F45 A;  3KHE A;  2KQY A;  3TS5 C;  1KQV A;  1ODB A;  1G8I A;  5CSN A;  2JZI A;  2LUX A;  3BUM B;  3BUW B;  1N2D A;  1EJ3 A;  3NSK A;  3BYA A;  1K9P A;  4CFR A;  5I8N A;  3M0W A;  1ZOT B;  2M7N A;  2AMI A;  2FCE A;  3AKB A;  3NXA A;  3EVR A;  1EG3 A;  3LLE A;  1RTP 1;  1CM4 A;  2SCP A;  4GUK A;  4ICB A;  4C0J A;  4DRW A;  3FIA A;  2L4I A;  1TNW A;  4ORC B;  1W7I B;  3TDU A;  3SIB A;  1GQM A;  1QIW A;  1B8R A;  1K95 A;  2LHL A;  2LP2 A;  2NCP A;  2HQ8 A;  1J7R A;  1ZFS A;  1IQ5 A;  2EC6 C;  2LLS A;  2BEC A;  2HF5 A;  4JWQ A;  4MRX A;  2JT3 A;  1F4Q A;  1UWO A;  1KK8 B;  2NXQ A;  4MVF A;  3DD4 A;  3GK2 A;  3I5H B;  1YUU A;  2F2O A;  1TTX A;  2LCP A;  3JVT B;  2JQ6 A;  3C1V A;  1BR4 B;  4MRY A;  2GV5 A;  2LNK A;  2K7D A;  3RLZ A;  1KQM C;  3TDZ A;  3PN7 B;  1IJ6 A;  3OX6 A;  3QRX A;  2HET A;  1TNX A;  3ICB A;  1IGV A; 
#chains in the Genus database with same CATH topology
 1U5I B;  1XFZ O;  2TN4 A;  3D77 A;  3DVM A;  1WLZ A;  1SL7 A;  1CLL A;  1P28 A;  2VRG A;  4CID A;  4DS7 A;  1JUO A;  3SJS A;  1AK8 A;  3BUO B;  4L9M A;  3VRO A;  1N0Y A;  4QJ4 B;  4E68 A;  2K60 A;  1NYA A;  4PHM A;  1DGV A;  3O2P A;  5CSI A;  5J3X A;  1FPW A;  1B8C A;  3TZ1 A;  4HSZ A;  3CTN A;  4JQ0 D;  4MZK A;  3VRP A;  1W7J B;  1UHH A;  2LP3 A;  2KDH A;  2K7B A;  2KLD A;  3SG6 A;  1VRK A;  4DCK A;  1M39 A;  2WND A;  2Y1M A;  1YX7 A;  1LXF C;  4YGB B;  1YVL A;  2KBI A;  1LA0 A;  3VRQ A;  1CMG A;  3PAL A;  1DJW A;  5HKW A;  1BU3 A;  1UHN A;  1DTL A;  1ALW A;  3TUY C;  1EG4 A;  3B6X A;  1MWN A;  1GM0 A;  1OOI X;  1K90 D;  2BCB A;  2Q91 A;  4DIR A;  2WCK A;  1BLQ A;  2F3Z A;  1PAL A;  3UNW A;  1JWD A;  2JUL A;  3R1V A;  5DKN A;  1XFY O;  1BF5 A;  1AJ4 A;  1OOJ A;  4WQ3 A;  2L98 A;  3IQQ A;  2K0J A;  1NX3 A;  1FW4 A;  1C07 A;  2PRU A;  4A4C A;  2WC5 A;  1XVJ A;  5CSF A;  3DVJ A;  1JSA A;  4GGN A;  4MZJ A;  3NSO A;  1XFW O;  1SKT A;  1CFP A;  1SBJ A;  3LL8 B;  2H61 C;  3NGV A;  1OSA A;  4YI9 A;  1A75 B;  5BPJ A;  1PSR A;  3SG5 A;  1J7O A;  4IJ7 A;  1IRJ A;  3SS4 A;  2K61 A;  2WCH A;  3D10 A;  2MLE C;  3DVE A;  4YBH B;  2PMY A;  1MF8 B;  2H61 A;  5CSJ A;  1UHI A;  1YUR A;  3BOW A;  1ZAC A;  1S3P A;  3KO0 A;  3O4Y A;  4AOM A;  1NP8 A;  1OOF A;  3VGO A;  4QJ5 B;  3NSI A;  1TUZ A;  1RWY A;  2FOT A;  2CXJ A;  2QEB A;  2LHI A;  1KK7 Z;  4P2Y B;  1SMG A;  1XFX O;  2OTG B;  3AKA A;  1DF0 B;  2KGB C;  1DMO A;  5JJG A;  2JOJ A;  3AAK A;  1M45 A;  4PAL A;  1Q80 A;  5KTY A;  1F54 A;  1S26 D;  3PFV A;  4C0K A;  4OV2 A;  3EVU A;  2BE6 A;  1CLM A;  1DT7 B;  2JC2 A;  1IJ5 A;  3I5G C;  2BCA A;  4YI8 A;  3VRR A;  1IIO A;  2JPO A;  3CLN A;  3CZT X;  2LLU A;  2KAX A;  3OGN A;  1QTX A;  5HYD A;  2MBX A;  4GNK B;  2NZ0 A;  4PDZ A;  2MRD A;  1YX8 A;  2LVJ A;  3B7A A;  4INX A;  2KAV A;  4D1E A;  4KYN A;  2ZN8 A;  4PE1 A;  1KFX L;  1DVI A;  2CNP A;  3R1O A;  1PK0 D;  3D76 A;  2I2R E;  2PAS A;  3KF9 A;  1CLB A;  1FI6 A;  5K89 A;  2Q4U A;  2R2I A;  1QX2 A;  2BL0 C;  2ERB A;  3CGA A;  1Y1U A;  1BOD A;  1PUL A;  2CBL A;  3BQ3 A;  2L0P A;  4M2P A;  2LVI A;  1XFV O;  2EC6 B;  1LVC D;  4MLW A;  1DJY A;  1KSM A;  1OMV A;  1QWV A;  2E30 A;  3A4U B;  2ZN9 A;  2M7L A;  1JC2 A;  1OOG A;  1IQ3 A;  1SPY A;  1F70 A;  1NUB A;  4C0L A;  1OZO A;  2GGM A;  3MSE B;  1QIV A;  1NSH A;  4GBA A;  3V2L A;  1QV1 A;  2KSP A;  2H2K A;  1H8B A;  2AAO A;  3WHT B;  1KWO C;  2O60 A;  1KQM B;  1UUR A;  2Y5I A;  4PCW A;  3NHT A;  1C7V A;  4MZL A;  1TOP A;  2MLF C;  1LA3 A;  3LK0 A;  4N5X A;  1X02 A;  1UHJ A;  1A03 A;  2I94 A;  3D78 A;  3PM2 A;  3L47 A;  3E3R A;  1L7Z A;  2JTT A;  4P5O E;  2BBM A;  1LKJ A;  3D0Y A;  4GPL B;  1D1O A;  1J1D A;  1ZMZ A;  1KCY A;  1NPQ A;  1V1F A;  2F3Y A;  1WRL A;  4IL1 A;  3FE8 A;  3RZS A;  1JBA A;  4OCI A;  2JXC A;  1CNP A;  2RGI A;  3L4A A;  2WCF A;  4I5J A;  5D7F A;  2LE9 B;  1OOH A;  1ZUZ A;  1AJ5 A;  3AAJ A;  4M2O A;  1B7T Y;  1CTR A;  1JFK A;  1SL8 A;  5TNC A;  2I7A A;  4YGD B;  1W9Z A;  2CT9 A;  1QVI Y;  2MAZ A;  4QJ3 B;  4Q04 A;  1XYD A;  3TUY B;  2EGD A;  1G4Y R;  1RK9 A;  5HKY A;  4PHN A;  1DEL A;  1Z4H A;  2K7O A;  2BBN A;  2WCB A;  1PVB A;  3FE6 A;  5AEQ A;  3OHM B;  1S6J A;  1C7W A;  1OE9 B;  3S0F A;  2CTN A;  2M97 A;  1J1E A;  1NCZ A;  2M29 A;  3D73 A;  1DJI A;  5HKZ A;  5I94 A;  1XA5 A;  1GGW A;  3FE9 A;  1RRO A;  2KQ6 A;  3B87 A;  4NQG A;  2L51 A;  2ZKM X;  3CDN A;  1CDL A;  1QXP A;  4FTG A;  2JNF A;  5HL1 A;  2SAS A;  1SCM C;  3DYE A;  5GQQ C;  2G2B A;  1Y1X A;  4OVN F;  2KPH A;  2MHH A;  3D75 A;  3EK4 A;  2BCX A;  4XJK A;  1F8H A;  1K8U A;  1R2U A;  4YGA A;  1IH0 A;  1S5G Y;  3R72 A;  1QAS A;  5G08 A;  1DJH A;  3O6B A;  3NHI A;  1NX1 A;  3H4S E;  1IG5 A;  3DF0 B;  5FI7 A;  5IBW A;  3VRN A;  3D74 A;  3RM1 A;  1QV0 A;  3EVV A;  3O78 A;  3K21 A;  2LC5 A;  4AQI A;  4CLN A;  1TN4 A;  2KBM A;  1CDN A;  5HLO A;  2WCL A;  2DOQ A;  1SCV A;  2F33 A;  2EHB A;  1DJZ A;  4HRG A;  2QDI A;  2WCM A;  3PSR A;  3TDI A;  1NWD A;  4ZCU A;  2M3W A;  2KLE A;  1MXL C;  2LUC A;  2MJW B;  1TCO B;  4I5K A;  4OR9 B;  2L4H A;  1SR6 C;  3I5G B;  2BNX A;  1XK4 A;  2F8P A;  1NX2 A;  1BG1 A;  1NCY A;  2PAL A;  2JWW A;  3EG5 B;  3FWB A;  3QME A;  2PSR A;  1RJV A;  1YRU B;  5KU1 A;  2M0R A;  4UPG A;  3L4L A;  2I18 A;  3BUN B;  1U5I A;  3DY9 A;  5FI6 A;  4BY5 A;  2D8N A;  1SRA A;  1CFD A;  3PM8 A;  3I5F C;  2JTZ A;  4A4B A;  4MN0 A;  4I5L B;  3SS5 A;  1NCX A;  3DXL A;  1QX7 A;  1T14 A;  2KFG A;  4PE0 A;  1QLS A;  3CR2 A;  1CDM A;  1QS7 A;  3N7H A;  4ORA B;  2LLT A;  2BL0 B;  2COL B;  2OS8 C;  5DKQ A;  3TS5 B;  1DGU A;  2CCM A;  1SNL A;  1M63 B;  2ZNE A;  3I5I C;  5D3O A;  2OPO A;  1MQ1 A;  1DJG A;  3WXA A;  4INW A;  4BY4 A;  1K96 A;  1L2O C;  1UUS A;  5ER4 X;  3SG7 A;  1C3Z A;  1YR5 A;  1A4P A;  1JFJ A;  1KFX S;  2LMU A;  2V53 A;  3R1P A;  1Z2C B;  4OKH A;  2F2P A;  4U8D A;  1TWO A;  3EKH A;  2LVV A;  1KWO B;  2KGR A;  3CZ2 A;  4N1G A;  2LMT A;  3CWG A;  3HX4 A;  3BJH A;  2HQW A;  1WDC C;  1SK6 D;  2BKI B;  1OQP A;  3SS3 A;  1A29 A;  3OBV A;  1EXR A;  2KFF A;  1XFU O;  2KHN A;  1AHR A;  5DIC A;  1SSE B;  2K8M B;  1M31 A;  2KFH A;  4HRH A;  1YTZ C;  5F6T A;  1BOC A;  3S0E A;  1WY9 A;  1NIW A;  1A75 A;  2BKH B;  1SYM A;  4R1E A;  4GAO A;  2K2F A;  1GGZ A;  2WOS A;  2KI4 C;  4PT1 A;  1E8A A;  1XO5 A;  1JF2 A;  2KOT A;  3CR4 X;  1FBV A;  3SG4 A;  2GTE A;  1B1G A;  1S6C A;  1EL4 A;  1TNP A;  3KPX A;  1KFU L;  4GGF A;  2JT8 A;  3GOF A;  5JOL A;  1H4B A;  1SY9 A;  2ZFD A;  4I5N B;  3SG2 A;  4PHJ A;  4MBE A;  3BFH A;  2JPT A;  3DZT A;  1PSB A;  1B8L A;  1DF0 A;  1DC1 A;  1IKU A;  3CZ1 A;  3O4X A;  5D69 A;  1CB1 A;  1Y0V H;  4CFQ A;  2B1U A;  4XJK B;  1RFJ A;  2NLN A;  1TIZ A;  1YUS A;  2WOR A;  1K93 D;  3GK1 A;  4YGC B;  3JTD C;  1SCM B;  3EKJ A;  4ETO A;  1BMO A;  3LCP C;  1CMF A;  1NX0 A;  2WCJ A;  3A8R A;  2P71 A;  4USL A;  4JPZ B;  2KI6 C;  2JT0 A;  5AER A;  3SIA A;  1G33 A;  1CM1 A;  1TNQ A;  1PRW A;  3ZNI A;  2LAP A;  3Q8I A;  2LMV A;  2MA2 A;  5PAL A;  2ZND A;  2M9G A;  2AUC A;  1TRF A;  1KSO A;  2IS9 A;  3LK1 A;  4NDB A;  2G9B A;  1WLM A;  2FJY A;  1SW8 A;  1C3Y A;  1CFF A;  1Y6W A;  3OB2 B;  2QAC A;  2ZRT A;  5FYX A;  4PHK A;  3CYZ A;  1AVS A;  1TCF A;  3BOW B;  1K9U A;  2KYC A;  1S36 A;  2LM5 A;  3FS7 A;  3PLF B;  3GK4 X;  1EH2 A;  1B7T Z;  4OZD A;  2L2E A;  2L5X B;  2JNX A;  1QVI Z;  1SR6 B;  3HCM A;  2HPS A;  2M1K B;  1PVA A;  1K9K A;  3IQO A;  2O5G A;  1AP4 A;  2QEO A;  3IF7 A;  2L2C A;  3VB1 A;  1CKK A;  4TNC A;  4WQ2 A;  1UHK A;  4GFT A;  4JD9 A;  1HT9 A;  1KK8 C;  2M8U A;  5CPV A;  1K94 A;  3BUX B;  2ISD A;  3I5F B;  3I5H C;  1Y1A A;  1QAT A;  4ORB B;  2ZRS A;  3JVT C;  3S0A A;  1XK4 C;  1IWQ A;  2JU0 A;  1YVH A;  1B47 A;  1BT6 A;  3PN7 C;  1OMD A;  1OMR A;  2OS8 B;  5I2O A;  3CAB A;  3BFB A;  3I5I B;  2KYF A;  1B4C A;  3OX5 A;  2Y1N A;  1ALV A;  1KK7 Y;  1S5G Z;  1L2O B;  1J7Q A;  4F0Z B;  1YUT A;  1OZS A;  2QEV A;  2P6B B;  2KAY A;  3DVK A;  4WRI A;  4PE4 A;  3UO9 A;  1S6I A;  4HRE E;  3CR5 X;  3SG3 A;  1F71 A;  2PVB A;  2LV7 A;  2H8V A;  1YRT B;  2QEH A;  1WDC B;  2M49 B;  1M46 A;  2E6W A;  2KNE A;  3K1E A;  1DJX A;  2FCD A;  5ER5 A;  4DUQ A;  1GJY A;  5B8I B;  1A2X A;  1BR1 B;  2K7C A;  5DKR A;  4CPV A;  3KEV A;  5AFP A;  3WHU B;  3EK8 A;  1TUJ A;  1FF1 A;  1V1G A;  5HLV A;  1AUI B;  1REC A;  2JXL A;  2KI6 D;  3OB1 B;  5KSZ A;  4XYN A;  1CDP A;  1QJT A;  2BE4 A;  2FJU B;  2WCE A;  1JF0 A;  1UP5 A;  1LIN A;  1N65 A;  2QPT A;  1J7P A;  4PE7 A;  2KI4 B;  3CS1 A;  4N1F A;  3FWC A;  1J55 A;  3DF0 A;  2NCO A;  5FI2 A;  4M2Q A;  2LVK A;  1QLK A;  1F4O A;  4NDC A;  5I2Q A;  3D0Y B;  1WRK A;  1DQE A;  1MUX A;  1F55 A;  1FI5 A;  1SL9 A;  1R6P A;  2L50 A;  4FQO A;  1CFC A;  3EK7 A;  1LS8 A;  2PQL A;  1B9A A;  1BJF A;  2WC8 A;  3OP0 A;  3S0B A;  2LAN A;  4NDD A;  2A4J A;  2PYQ A;  5AAN A;  2JRF A;  2K2A A;  1XFR A;  2BAP A;  2YGU A;  1K2H A;  4MSP A;  4GGF C;  3PAT A;  5EL2 A;  1HQV A;  1ORG A;  2GGZ A;  3JTD B;  3ZWH A;  2M1U A;  3WNX B;  1KFU S;  1QX5 B;  1MXE A;  4JKT A;  4YGE B;  1MHO A;  1S1E A;  2OTG C;  3BXK A;  1WRZ A;  4ZCV A;  4MEW A;  5I2L A;  2WC6 A;  4YRU A;  1MR8 A;  4AQJ A;  5AXI A;  2Y4Q A;  3NSL A;  3F45 A;  3KHE A;  2KQY A;  3S0D A;  3TS5 C;  1KQV A;  1ODB A;  1G8I A;  5CSN A;  2JZI A;  1DEK A;  4FQT A;  2LUX A;  3BUM B;  3BUW B;  1N2D A;  3PJI A;  1EJ3 A;  3NSK A;  3BYA A;  1K9P A;  4CFR A;  5I8N A;  3M0W A;  1ZOT B;  4F7F A;  2M7N A;  2AMI A;  2FCE A;  3AKB A;  3NXA A;  3EVR A;  3S0G A;  1EG3 A;  3LLE A;  1RTP 1;  1CM4 A;  2SCP A;  4GUK A;  4ICB A;  4C0J A;  4DRW A;  3FIA A;  2L4I A;  1TNW A;  4ORC B;  1W7I B;  3TDU A;  3SIB A;  1GQM A;  1OW4 A;  1QIW A;  1B8R A;  1K95 A;  2LHL A;  2LP2 A;  2NCP A;  3BFA A;  2HQ8 A;  1J7R A;  1ZFS A;  3IVT A;  1IQ5 A;  3B86 A;  2EC6 C;  2LLS A;  2BEC A;  2HF5 A;  4JWQ A;  4MRX A;  2JT3 A;  1F4Q A;  2L5Y A;  1UWO A;  1KK8 B;  2NXQ A;  4MVF A;  3DD4 A;  3GK2 A;  3I5H B;  1YUU A;  2F2O A;  1TTX A;  2LCP A;  3JVT B;  2JQ6 A;  3C1V A;  1BR4 B;  4MRY A;  2GV5 A;  2LNK A;  3B88 A;  2K7D A;  3RLZ A;  1KQM C;  3CZ0 A;  3PN7 B;  3TDZ A;  1IJ6 A;  2P70 A;  3OX6 A;  3QRX A;  2HET A;  1TNX A;  3ICB A;  1IGV A; 
#chains in the Genus database with same CATH homology
 1U5I B;  1XFZ O;  2TN4 A;  4DS7 A;  3DVM A;  1WLZ A;  1SL7 A;  1CLL A;  2VRG A;  4CID A;  1JUO A;  3SJS A;  1AK8 A;  3BUO B;  4L9M A;  3VRO A;  1N0Y A;  4QJ4 B;  4E68 A;  1NYA A;  4PHM A;  1DGV A;  3O2P A;  5CSI A;  5J3X A;  1FPW A;  1B8C A;  3TZ1 A;  4HSZ A;  3CTN A;  4JQ0 D;  4MZK A;  3VRP A;  1W7J B;  1UHH A;  2LP3 A;  2KDH A;  2K7B A;  3SG6 A;  1VRK A;  4DCK A;  1M39 A;  2WND A;  2Y1M A;  1YX7 A;  1LXF C;  4YGB B;  1YVL A;  2KBI A;  1LA0 A;  3VRQ A;  1CMG A;  3PAL A;  1DJW A;  5HKW A;  1BU3 A;  1UHN A;  1DTL A;  1ALW A;  3TUY C;  1EG4 A;  1MWN A;  1K90 D;  2BCB A;  2Q91 A;  4DIR A;  1BLQ A;  2F3Z A;  1PAL A;  1JWD A;  2JUL A;  5DKN A;  1XFY O;  1BF5 A;  1AJ4 A;  1OOJ A;  4WQ3 A;  2L98 A;  3IQQ A;  2K0J A;  1NX3 A;  1FW4 A;  1C07 A;  2PRU A;  4A4C A;  1XVJ A;  5CSF A;  3DVJ A;  1JSA A;  4GGN A;  4MZJ A;  3NSO A;  1XFW O;  1SKT A;  1CFP A;  1SBJ A;  3LL8 B;  2H61 C;  1OSA A;  4YI9 A;  1A75 B;  5BPJ A;  1PSR A;  3SG5 A;  1J7O A;  1IRJ A;  2K61 A;  3DVE A;  3D10 A;  2MLE C;  4YBH B;  2PMY A;  1MF8 B;  2H61 A;  5CSJ A;  1UHI A;  1YUR A;  3BOW A;  1ZAC A;  1S3P A;  3KO0 A;  3O4Y A;  4AOM A;  1NP8 A;  4QJ5 B;  3VGO A;  3NSI A;  2FOT A;  1RWY A;  2CXJ A;  2LHI A;  1KK7 Z;  4P2Y B;  1SMG A;  1XFX O;  2OTG B;  3AKA A;  1DF0 B;  2KGB C;  1DMO A;  5JJG A;  2JOJ A;  3AAK A;  1M45 A;  4PAL A;  1Q80 A;  5KTY A;  1F54 A;  1S26 D;  3PFV A;  4C0K A;  4OV2 A;  3EVU A;  2BE6 A;  1CLM A;  1DT7 B;  2JC2 A;  1IJ5 A;  3I5G C;  2BCA A;  4YI8 A;  3VRR A;  3CLN A;  3CZT X;  2LLU A;  2KAX A;  1QTX A;  5HYD A;  2MBX A;  4GNK B;  2NZ0 A;  4PDZ A;  2MRD A;  1YX8 A;  2LVJ A;  2KAV A;  4D1E A;  2ZN8 A;  4PE1 A;  1KFX L;  1DVI A;  2CNP A;  1PK0 D;  2I2R E;  2PAS A;  3KF9 A;  1CLB A;  1FI6 A;  5K89 A;  2Q4U A;  2R2I A;  1QX2 A;  2BL0 C;  3CGA A;  1Y1U A;  1BOD A;  1PUL A;  2CBL A;  3BQ3 A;  2L0P A;  4M2P A;  2LVI A;  1XFV O;  2EC6 B;  1LVC D;  4MLW A;  1DJY A;  1KSM A;  1OMV A;  2E30 A;  3A4U B;  2M7L A;  2ZN9 A;  1JC2 A;  1F70 A;  1IQ3 A;  1SPY A;  1NUB A;  4C0L A;  1OZO A;  2GGM A;  3MSE B;  1QIV A;  1NSH A;  4GBA A;  1QV1 A;  2KSP A;  2H2K A;  1H8B A;  2AAO A;  3WHT B;  1KWO C;  2O60 A;  1KQM B;  1UUR A;  2Y5I A;  4PCW A;  1C7V A;  4MZL A;  1TOP A;  2MLF C;  1LA3 A;  3LK0 A;  4N5X A;  1X02 A;  1UHJ A;  1A03 A;  2I94 A;  3E3R A;  1L7Z A;  2JTT A;  4P5O E;  2BBM A;  1LKJ A;  3D0Y A;  4GPL B;  1D1O A;  1J1D A;  1ZMZ A;  1KCY A;  1NPQ A;  1V1F A;  2F3Y A;  1WRL A;  4IL1 A;  1JBA A;  4OCI A;  2JXC A;  1CNP A;  2RGI A;  2WCF A;  4I5J A;  5D7F A;  2LE9 B;  1ZUZ A;  1AJ5 A;  3AAJ A;  4M2O A;  1B7T Y;  1CTR A;  1JFK A;  1SL8 A;  5TNC A;  2I7A A;  4YGD B;  2CT9 A;  1QVI Y;  2MAZ A;  4QJ3 B;  4Q04 A;  1XYD A;  3TUY B;  2EGD A;  1G4Y R;  1RK9 A;  5HKY A;  4PHN A;  2K7O A;  2BBN A;  2WCB A;  1PVB A;  5AEQ A;  3OHM B;  1S6J A;  1C7W A;  1OE9 B;  2CTN A;  2M97 A;  1J1E A;  1NCZ A;  2M29 A;  5HKZ A;  1DJI A;  1XA5 A;  1GGW A;  4NQG A;  1RRO A;  2KQ6 A;  2L51 A;  2ZKM X;  1CDL A;  1QXP A;  4FTG A;  2JNF A;  2SAS A;  1SCM C;  5GQQ C;  2G2B A;  1Y1X A;  4OVN F;  2MHH A;  3EK4 A;  2BCX A;  4XJK A;  1F8H A;  1K8U A;  1R2U A;  4YGA A;  1IH0 A;  1S5G Y;  1QAS A;  5G08 A;  1DJH A;  3O6B A;  1NX1 A;  3H4S E;  1IG5 A;  3DF0 B;  5IBW A;  3VRN A;  3RM1 A;  1QV0 A;  3EVV A;  3O78 A;  3K21 A;  2LC5 A;  4AQI A;  4CLN A;  1TN4 A;  2KBM A;  1CDN A;  5HLO A;  2DOQ A;  1SCV A;  2F33 A;  2EHB A;  1DJZ A;  4HRG A;  3PSR A;  3TDI A;  1NWD A;  4ZCU A;  2M3W A;  2MJW B;  1MXL C;  2LUC A;  4I5K A;  1TCO B;  4OR9 B;  2L4H A;  1SR6 C;  3I5G B;  1XK4 A;  2F8P A;  1NX2 A;  1BG1 A;  1NCY A;  2PAL A;  2JWW A;  3FWB A;  2PSR A;  1RJV A;  1YRU B;  5KU1 A;  2M0R A;  4UPG A;  2I18 A;  3BUN B;  1U5I A;  4BY5 A;  2D8N A;  1SRA A;  1CFD A;  3PM8 A;  3I5F C;  2JTZ A;  4A4B A;  4MN0 A;  4I5L B;  1NCX A;  1QX7 A;  2KFG A;  4PE0 A;  1QLS A;  3CR2 A;  1CDM A;  1QS7 A;  4ORA B;  2LLT A;  2BL0 B;  2COL B;  2OS8 C;  5DKQ A;  3TS5 B;  1DGU A;  2CCM A;  1SNL A;  1M63 B;  2ZNE A;  3I5I C;  2OPO A;  1MQ1 A;  1DJG A;  3WXA A;  4BY4 A;  1K96 A;  1L2O C;  1UUS A;  5ER4 X;  3SG7 A;  1YR5 A;  1A4P A;  1JFJ A;  1KFX S;  2LMU A;  2V53 A;  4OKH A;  2F2P A;  4U8D A;  3EKH A;  2LVV A;  1KWO B;  2KGR A;  4N1G A;  2LMT A;  3CWG A;  3HX4 A;  2HQW A;  1WDC C;  1SK6 D;  2BKI B;  1OQP A;  1A29 A;  1EXR A;  2KFF A;  1XFU O;  2KHN A;  1AHR A;  2K8M B;  1M31 A;  2KFH A;  4HRH A;  1YTZ C;  5F6T A;  1BOC A;  1WY9 A;  1NIW A;  1A75 A;  2BKH B;  1SYM A;  4R1E A;  4GAO A;  2K2F A;  1GGZ A;  2WOS A;  2KI4 C;  1E8A A;  1XO5 A;  1JF2 A;  2KOT A;  3CR4 X;  1FBV A;  3SG4 A;  1B1G A;  1S6C A;  1EL4 A;  1TNP A;  3KPX A;  1KFU L;  4GGF A;  2JT8 A;  3GOF A;  5JOL A;  1H4B A;  1SY9 A;  2ZFD A;  4I5N B;  3SG2 A;  4PHJ A;  4MBE A;  2JPT A;  1PSB A;  1B8L A;  1DF0 A;  1IKU A;  5D69 A;  1CB1 A;  1Y0V H;  4CFQ A;  2B1U A;  4XJK B;  1RFJ A;  2NLN A;  1TIZ A;  1YUS A;  2WOR A;  1K93 D;  3GK1 A;  4YGC B;  3JTD C;  1SCM B;  3EKJ A;  4ETO A;  1BMO A;  3LCP C;  1CMF A;  1NX0 A;  3A8R A;  4USL A;  4JPZ B;  2KI6 C;  2JT0 A;  5AER A;  3SIA A;  1G33 A;  1CM1 A;  1TNQ A;  1PRW A;  3ZNI A;  2LAP A;  2LMV A;  2MA2 A;  5PAL A;  2ZND A;  2M9G A;  2AUC A;  1TRF A;  1KSO A;  2IS9 A;  3LK1 A;  4NDB A;  2G9B A;  1WLM A;  1SW8 A;  1CFF A;  1Y6W A;  3OB2 B;  2QAC A;  2ZRT A;  5FYX A;  4PHK A;  1AVS A;  1TCF A;  3BOW B;  1K9U A;  2KYC A;  1S36 A;  2LM5 A;  3FS7 A;  3PLF B;  3GK4 X;  1EH2 A;  1B7T Z;  2L2E A;  2L5X B;  2JNX A;  1QVI Z;  1SR6 B;  3HCM A;  2HPS A;  2M1K B;  1PVA A;  1K9K A;  3IQO A;  2O5G A;  1AP4 A;  3IF7 A;  1CKK A;  4TNC A;  4WQ2 A;  1UHK A;  4GFT A;  1HT9 A;  1KK8 C;  2M8U A;  5CPV A;  1K94 A;  3BUX B;  2ISD A;  3I5F B;  3I5H C;  1Y1A A;  1QAT A;  4ORB B;  2ZRS A;  3JVT C;  1XK4 C;  1IWQ A;  2JU0 A;  1YVH A;  1B47 A;  1BT6 A;  3PN7 C;  1OMD A;  1OMR A;  2OS8 B;  5I2O A;  3I5I B;  2KYF A;  1B4C A;  3OX5 A;  2Y1N A;  1ALV A;  1KK7 Y;  1S5G Z;  1L2O B;  1J7Q A;  4F0Z B;  1YUT A;  1OZS A;  2P6B B;  2KAY A;  3DVK A;  4WRI A;  4PE4 A;  1S6I A;  4HRE E;  3CR5 X;  3SG3 A;  1F71 A;  2PVB A;  2LV7 A;  1YRT B;  1WDC B;  2M49 B;  1M46 A;  2E6W A;  2KNE A;  5B8I B;  1DJX A;  2FCD A;  5ER5 A;  4DUQ A;  1GJY A;  1A2X A;  1BR1 B;  2K7C A;  5DKR A;  4CPV A;  3KEV A;  5AFP A;  3WHU B;  3EK8 A;  1FF1 A;  1V1G A;  5HLV A;  1AUI B;  1REC A;  2JXL A;  2KI6 D;  3OB1 B;  5KSZ A;  4XYN A;  1CDP A;  1QJT A;  2BE4 A;  2FJU B;  2WCE A;  1JF0 A;  1UP5 A;  1LIN A;  1N65 A;  2QPT A;  1J7P A;  4PE7 A;  2KI4 B;  3CS1 A;  4N1F A;  3FWC A;  1J55 A;  3DF0 A;  2NCO A;  4M2Q A;  2LVK A;  1QLK A;  1F4O A;  4NDC A;  5I2Q A;  3D0Y B;  1WRK A;  1F55 A;  1MUX A;  1FI5 A;  1SL9 A;  1R6P A;  2L50 A;  4FQO A;  1CFC A;  3EK7 A;  1B9A A;  1BJF A;  2WC8 A;  3OP0 A;  2LAN A;  4NDD A;  2A4J A;  5AAN A;  2JRF A;  2K2A A;  1K2H A;  4MSP A;  4GGF C;  3PAT A;  1HQV A;  2GGZ A;  3JTD B;  3ZWH A;  2M1U A;  3WNX B;  1KFU S;  1QX5 B;  1MXE A;  4YGE B;  1MHO A;  1S1E A;  2OTG C;  3BXK A;  1WRZ A;  4ZCV A;  4MEW A;  5I2L A;  4YRU A;  1MR8 A;  4AQJ A;  5AXI A;  2Y4Q A;  3NSL A;  3F45 A;  3KHE A;  2KQY A;  3TS5 C;  1KQV A;  1ODB A;  1G8I A;  5CSN A;  2JZI A;  2LUX A;  3BUM B;  3BUW B;  1N2D A;  1EJ3 A;  3NSK A;  3BYA A;  1K9P A;  4CFR A;  5I8N A;  3M0W A;  1ZOT B;  2M7N A;  2AMI A;  2FCE A;  3AKB A;  3NXA A;  3EVR A;  1EG3 A;  3LLE A;  1RTP 1;  1CM4 A;  2SCP A;  4GUK A;  4ICB A;  4C0J A;  4DRW A;  3FIA A;  2L4I A;  1TNW A;  4ORC B;  1W7I B;  3TDU A;  3SIB A;  1GQM A;  1QIW A;  1B8R A;  1K95 A;  2LHL A;  2LP2 A;  2NCP A;  2HQ8 A;  1J7R A;  1ZFS A;  1IQ5 A;  2EC6 C;  2LLS A;  2BEC A;  2HF5 A;  4JWQ A;  4MRX A;  2JT3 A;  1F4Q A;  1UWO A;  1KK8 B;  2NXQ A;  4MVF A;  3DD4 A;  3GK2 A;  3I5H B;  1YUU A;  2F2O A;  1TTX A;  2LCP A;  3JVT B;  2JQ6 A;  3C1V A;  1BR4 B;  4MRY A;  2GV5 A;  2LNK A;  2K7D A;  3RLZ A;  1KQM C;  3TDZ A;  3PN7 B;  1IJ6 A;  3OX6 A;  3QRX A;  2HET A;  1TNX A;  3ICB A;  1IGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...