4YGDB

Crystal structure of ergic-53/mcfd2, monoclinic calcium-bound form 2
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
79
structure length
69
Chain Sequence
MSPQELQLHYFKMHDYDGNNLLDGLELSTAITHPLMSEDELINIIDGVLRDDDKNNDGYIDYAEFAKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Protein ERGIC-53
publication title Interaction mode of coagulation factors V and VIII with the cargo receptor MCFD2/ERGIC-53 complex
rcsb
source organism Homo sapiens
total genus 26
structure length 69
sequence length 79
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ygdB00
1SNLA 3HCMA 4WQ2A 2K2FA 1MUXA 3LK0A 4OVNF 3PN7B 1XK4C 2M8UA 1WRZA 3AKBA 2LHLA 1M31A 1VRKA 2KAYA 1JF0A 1SK6D 3I5GB 4AQJA 1SR6C 2HQ8A 2FJUB 1BJFA 1BU3A 2LNKA 2JNXA 5FYXA 2LVIA 2LMTA 3BOWB 4ORBB 1KFXL 1OZSA 1TNQA 5GQQC 4YRUA 5I8NA 1M39A 1Y1XA 4IL1A 1C7WA 2KI6D 1KK8C 1ZOTB 1CFCA 5ER5A 5DKNA 1UUSA 2IS9A 1NPQA 4CLNA 2FOTA 3CZTX 3LCPC 2A4JA 2MJWB 5KSZA 2DOQA 1F71A 1YRUB 1BODA 3AAJA 2MBXA 4DUQA 2K7CA 4A4BA 1X02A 1Q80A 1IJ5A 1SRAA 2LC5A 3DVEA 1A03A 1WRLA 3WNXB 1XFVO 2KFFA 1KQMB 3I5IB 1PSBA 3BUWB 2F3YA 4TNCA 1OQPA 1KWOB 2CXJA 4YI8A 4YGDB 3RM1A 1BR4B 2F2PA 1TCFA 2LE9B 1J7RA 1CM4A 2BECA 1F55A 4P2YB 4YGCB 1HQVA 4YGAA 1A75A 1LKJA 3HX4A 1OMRA 2FCEA 2LCPA 3SG6A 2KAXA 1SCVA 2EGDA 3WHUB 1XVJA 2KHNA 1CMGA 1CLLA 2ZNDA 1AHRA 4DCKA 2KI6C 2ZN9A 5G08A 4NDDA 1WLMA 4CIDA 1QLSA 4PDZA 3TS5B 3SG7A 1KQVA 4PCWA 2OTGB 2H61C 1RK9A 1NYAA 3LLEA 2LVKA 1XFUO 1K95A 2HPSA 4P5OE 2OPOA 1TCOB 4PE4A 1MF8B 2EC6B 1J1DA 3JVTC 2O60A 1K9KA 1NX1A 1YR5A 2K2AA 1IH0A 1NX2A 3KEVA 1DJZA 2KFHA 4Q04A 5PALA 1FPWA 2NLNA 1OE9B 3E3RA 4PE1A 2M97A 1MQ1A 1RJVA 3DF0A 3PM8A 2Y4QA 1TNWA 3KPXA 4ZCUA 2TN4A 2HF5A 1NP8A 1S6JA 3LL8B 1PULA 1RECA 1NCZA 1KSOA 1MHOA 1MXLC 3IQQA 4GUKA 1S1EA 1NWDA 1DF0B 1QX5B 2KQYA 5KU1A 2MHHA 3PALA 3CR4X 1DVIA 1A2XA 2WORA 5KTYA 4HRHA 2LM5A 1QLKA 4XJKB 1B8RA 1LINA 4CFRA 3I5FB 3K21A 2LVVA 3AAKA 4F0ZB 4YGBB 3WHTB 3A8RA 1CKKA 4OKHA 1B4CA 2K8MB 3EVVA 1AUIB 1QATA 2QPTA 4DS7A 2CNPA 2ZKMX 3ZWHA 2L2EA 2WCBA 1KSMA 4JQ0D 1R6PA 4N5XA 3NXAA 2CT9A 1WRKA 5AFPA 2LP2A 1LA3A 4PE0A 2KI4C 1ALVA 1TIZA 4JWQA 2JT0A 2Q4UA 1S6CA 2KDHA 2LV7A 1CNPA 3TDIA 2JT8A 2KSPA 1QTXA 5CSNA 2AAOA 2LMVA 2KYFA 2MAZA 1KFXS 3BQ3A 1AJ5A 2WCEA 2JZIA 5B8IB 2LLUA 1QIVA 3OX6A 2K7DA 1Y6WA 2KBIA 4NDCA 3PATA 5HKZA 1XFZO 1YVHA 1EXRA 3LK1A 3TDZA 1YUUA 4ORAB 2L4HA 1C7VA 2M7NA 1PK0D 4A4CA 4WQ3A 1GGWA 3SG2A 1WDCC 1TN4A 1CDLA 4GGNA 3ICBA 2KAVA 2OS8B 1N65A 1EL4A 1QJTA 3VRNA 2KYCA 2KNEA 4GNKB 1SPYA 1ZACA 1BR1B 2L50A 3O2PA 2O5GA 4MRXA 1DGVA 1ZFSA 4DIRA 4FQOA 1UHKA 1J55A 1Y1AA 3M0WA 4U8DA 2JU0A 1K9UA 1ODBA 3D0YB 2LLSA 2ZNEA 3FS7A 4OV2A 4PHNA 1K90D 1J7OA 1OOJA 1EG4A 3BYAA 3TUYC 1LVCD 3FWBA 1YRTB 5I2QA 1L7ZA 1SW8A 1E8AA 1XA5A 2KBMA 1CM1A 1OSAA 2JTZA 5F6TA 2CTNA 1K8UA 1SYMA 2GGMA 2AUCA 2LAPA 3GOFA 2NCOA 3BUXB 1IQ5A 2L98A 3VGOA 3MSEB 1F70A 1LA0A 3EVUA 3JTDB 4QJ4B 2BL0C 2JNFA 2R2IA 2K7OA 3CR2A 3SJSA 2GGZA 1BLQA 3CR5X 1UWOA 2D8NA 1NCXA 1B8LA 2H2KA 3KO0A 2HQWA 1CDPA 2P6BB 3PN7C 3I5HB 1MR8A 2JOJA 2JXLA 1EG3A 2BBNA 1DF0A 1IQ3A 1B7TZ 1QS7A 1J7QA 2MA2A 1FI5A 2LLTA 3I5GC 5AERA 4DRWA 3FWCA 1QV1A 3BUNB 3TZ1A 4OR9B 1DJYA 3PLFB 4HREE 1W7JB 1NX3A 1QV0A 3D10A 1F54A 1IRJA 2G2BA 3BUOB 1N0YA 3EK8A 2JPTA 4MZLA 1DJIA 1SCMB 4PHKA 1HT9A 1M45A 2ZN8A 3VRRA 3CS1A 1JFJA 2JXCA 1L2OC 4I5NB 1GQMA 4ETOA 1CDMA 2KI4B 3GK1A 1XO5A 1XFXO 4MEWA 2Y1MA 2BKHB 3OB1B 3QRXA 1BG1A 4M2OA 3PSRA 3I5IC 2M3WA 1NCYA 2KQ6A 4GFTA 4NDBA 1F4OA 4MLWA 1JF2A 3GK4X 1DT7B 5DKQA 1B47A 1SL7A 1KWOC 1NIWA 1QVIZ 2I2RE 1KK7Z 1CB1A 3SG5A 1DGUA 1DJHA 3NSKA 5D69A 1JBAA 1S26D 1SR6B 1BOCA 1RTP1 1B8CA 4AQIA 1A75B 5I2OA 2ZRSA 2F2OA 3SIAA 5HYDA 2JULA 1CMFA 1CFFA 1IKUA 4HRGA 1A29A 3BOWA 3OP0A 5HKYA 4YBHB 3SG4A 4PE7A 4D1EA 1KK8B 4I5KA 3IF7A 2Y1NA 5HLOA 1PRWA 2AMIA 3TS5C 5K89A 3CWGA 1IG5A 2OTGC 4MZJA 1TNXA 1NX0A 2I94A 2ZRTA 4MVFA 1B7TY 2LANA 2CBLA 3D0YA 3DVMA 2EC6C 1N2DA 5AANA 2GV5A 1S6IA 3VRPA 1SL9A 5DKRA 1FI6A 5I2LA 1CTRA 1SBJA 2NCPA 5AEQA 2PASA 1OZOA 4C0LA 1QX2A 3GK2A 3DF0B 2BCBA 1YUSA 1NSHA 1OMDA 1DJGA 1G33A 3BUMB 2M9GA 2PALA 1CDNA 4JPZB 4GGFA 3VROA 2M0RA 2E6WA 1MWNA 1TRFA 3KF9A 4OCIA 5J3XA 1Y1UA 1G4YR 1WY9A 2MLFC 2WC8A 2WOSA 2RGIA 3CLNA 1YURA 4YI9A 1QX7A 1G8IA 3I5FC 1TTXA 2E30A 2EHBA 2FCDA 4AOMA 1NUBA 1QVIY 2QACA 1KK7Y 1PVBA 4C0JA 5CSJA 2LMUA 1U5IB 1AVSA 4PALA 4MN0A 3PFVA 1AP4A 2PRUA 3CTNA 3EKHA 5CSFA 2G9BA 1QXPA 1GJYA 1M46A 3JVTB 1IWQA 4L9MA 3DVJA 2BCAA 4N1FA 3C1VA 5ER4X 1R2UA 5JOLA 1PALA 1RROA 2K7BA 2BCXA 1UP5A 1EJ3A 2M49B 3OB2B 1UHJA 4C0KA 4I5JA 1IGVA 1L2OB 2VRGA 1V1FA 4PHMA 1K94A 1PVAA 3DVKA 2BBMA 2BE4A 4USLA 4XYNA 1F8HA 3OHMB 1J7PA 1YUTA 5BPJA 1CLBA 1S5GZ 2LHIA 1AK8A 4BY4A 2PSRA 2L4IA 4MRYA 3EVRA 2LVJA 4YGEB 1K93D 2I7AA 2Y5IA 5IBWA 2WCFA 1ALWA 4ICBA 2JTTA 3SIBA 1DJXA 1YVLA 4ORCB 2LUCA 3F45A 1XK4A 3IQOA 3O4YA 1QIWA 1KFUS 4XJKA 2B1UA 3TDUA 3ZNIA 1YTZC 1H8BA 4N1GA 5TNCA 1EH2A 1BT6A 2L5XB 1A4PA 2PVBA 1H4BA 1D1OA 2CCMA 2OS8C 3RLZA 1K96A 1SY9A 1FF1A 3O6BA 1AJ4A 2PMYA 4MBEA 4MZKA 4E68A 1QASA 1FBVA 1F4QA 1KFUL 1DJWA 1IJ6A 2MLEC 3SG3A 1JUOA 1LXFC 2JC2A 1K9PA 1S3PA 2M29A 3BXKA 1JSAA 5CSIA 3WXAA 1V1GA 2HETA 5HKWA 1CFPA 4BY5A 2KGRA 3OX5A 2NXQA 1KQMC 2V53A 2M1KB 4CPVA 1J1EA 1YX7A 1SKTA 2I18A 1CLMA 1CFDA 3H4SE 2F3ZA 4FTGA 4NQGA 1KCYA 1ZUZA 2JT3A 5CPVA 3JTDC 2JQ6A 1WLZA 4I5LB 1JFKA 2BE6A 2JWWA 4GAOA 4GGFC 1M63B 1UURA 4M2PA 2LUXA 1JC2A 5D7FA 2M7LA 2F33A 2F8PA 3O78A 1GGZA 3VRQA 1K2HA 1SL8A 1W7IB 1WDCB 1Y0VH 2KOTA 4GBAA 4QJ3B 2L51A 1DMOA 1UHHA 2JRFA 3I5HC 3EKJA 1PSRA 1S5GY 1UHNA 3A4UB 3DD4A 1MXEA 2WNDA 3FIAA 4WRIA 2M1UA 5JJGA 1YX8A 4PHJA 2COLB 2LP3A 4CFQA 1B1GA 1B9AA 3AKAA 2KGBC 2H61A 1ZMZA 1XFWO 4HSZA 1JWDA 1RWYA 2NZ0A 2SASA 4M2QA 3TUYB 1TOPA 1SMGA 3EK4A 1BMOA 2ISDA 1DTLA 1U5IA 1OMVA 2Q91A 1SCMC 3EK7A 1S36A 1BF5A 1C07A 3NSLA 1XFYO 5AXIA 3CGAA 1FW4A 2BKIB 2L0PA 4R1EA 4GPLB 3NSIA 4QJ5B 4MSPA 2K61A 2K0JA 2KFGA 5HLVA 1RFJA 2BL0B 1UHIA 2SCPA 2ZFDA 3KHEA 2MRDA 3NSOA 4ZCVA 4UPGA 1XYDA 1TNPA
chains in the Genus database with same CATH superfamily
1SNLA 3HCMA 3Q8IA 4WQ2A 3R1VA 2K2FA 1MUXA 3LK0A 4OVNF 3EG5B 1XK4C 2M8UA 1WRZA 3AKBA 3PN7B 2LHLA 1M31A 5D3OA 1VRKA 2KAYA 3SS3A 1JF0A 1SK6D 3I5GB 1GM0A 4AQJA 1SR6C 5FI6A 2HQ8A 2FJUB 3BFBA 1BJFA 2QEHA 1BU3A 1T14A 2PQLA 2LNKA 2WCHA 2JNXA 5FYXA 2LVIA 2LMTA 3DZTA 1DEKA 3BOWB 4ORBB 1KFXL 1OZSA 1TNQA 5GQQC 4YRUA 5I8NA 1M39A 1TUZA 1Y1XA 4IL1A 1C7WA 2KI6D 1KK8C 1ZOTB 1CFCA 5ER5A 5DKNA 1UUSA 2IS9A 1NPQA 4CLNA 2FOTA 3CZTX 3LCPC 2A4JA 2MJWB 5KSZA 2DOQA 3D76A 1F71A 1YRUB 1BODA 3AAJA 2MBXA 4DUQA 2K7CA 4A4BA 1X02A 1Q80A 1IJ5A 1SRAA 2LC5A 3DVEA 1OOHA 1WRLA 3WNXB 1A03A 1XFVO 2KFFA 1KQMB 3I5IB 1PSBA 3BUWB 2F3YA 4TNCA 3VB1A 1OQPA 1KWOB 2CXJA 4YI8A 4YGDB 3RM1A 1BR4B 2F2PA 1TCFA 2LE9B 1J7RA 1CM4A 2BECA 1F55A 4P2YB 2K60A 4YGCB 1HQVA 4YGAA 1A75A 1LKJA 3HX4A 1OMRA 2FCEA 2LCPA 2WCMA 3SG6A 2KAXA 1SCVA 2EGDA 2H8VA 3WHUB 1XVJA 2KHNA 1CMGA 1CLLA 3B7AA 2ZNDA 1AHRA 3OGNA 4DCKA 2KI6C 2ZN9A 5G08A 1Z4HA 4NDDA 1WLMA 4CIDA 1QLSA 4PDZA 3TS5B 2ERBA 3SG7A 1KQVA 4PCWA 2OTGB 2H61C 1RK9A 1NYAA 3LLEA 2LVKA 3PM2A 1XFUO 1K95A 2HPSA 4P5OE 2OPOA 1TCOB 4PE4A 1MF8B 2EC6B 5EL2A 1J1DA 3JVTC 2O60A 1K9KA 1NX1A 1YR5A 2K2AA 1IH0A 1NX2A 4FQTA 3KEVA 1DJZA 2BAPA 2KFHA 4Q04A 5PALA 1FPWA 2NLNA 4PT1A 3FE8A 3L4AA 1OE9B 3E3RA 4PE1A 2M97A 1MQ1A 3S0DA 1RJVA 3DF0A 3PM8A 2Y4QA 1TNWA 3KPXA 4ZCUA 2TN4A 2HF5A 1NP8A 1S6JA 3LL8B 1PULA 1RECA 1NCZA 1KSOA 1MHOA 1MXLC 3IQQA 4GUKA 1S1EA 1NWDA 3K1EA 2WC6A 3UO9A 1DF0B 1QX5B 2KQYA 5KU1A 2MHHA 3PALA 3CR4X 1DVIA 1A2XA 4F7FA 2WORA 5KTYA 4HRHA 2LM5A 1QLKA 4XJKB 1B8RA 3BJHA 3CZ2A 1LINA 4CFRA 3I5FB 3K21A 3V2LA 2LVVA 3AAKA 1IIOA 4F0ZB 4YGBB 3WHTB 3A8RA 1CKKA 4JD9A 3OBVA 4OKHA 1B4CA 3CZ1A 2K8MB 3EVVA 1AUIB 1QATA 2QPTA 4DS7A 4INXA 2CNPA 2ZKMX 3ZWHA 2L2EA 2WCBA 1ORGA 1KSMA 4JQ0D 1R6PA 4N5XA 3NXAA 2CT9A 1WRKA 5AFPA 2LP2A 3O4XA 1LA3A 4PE0A 2KI4C 1ALVA 1TIZA 4JWQA 2JT0A 2Q4UA 1S6CA 3CYZA 2KDHA 2LV7A 3R1PA 3TDIA 1CNPA 2JT8A 5I94A 2KSPA 1QTXA 5CSNA 1C3YA 2AAOA 2LMVA 2KYFA 2MAZA 1KFXS 3CABA 3BQ3A 1AJ5A 2WCEA 2JZIA 5B8IB 2LLUA 1QIVA 3OX6A 2K7DA 1Y6WA 2KBIA 4NDCA 3PATA 5HKZA 1XFZO 1YVHA 3RZSA 1EXRA 3LK1A 3TDZA 1YUUA 4ORAB 1QWVA 2JPOA 2L4HA 2M7NA 1C7VA 3R1OA 1PK0D 3B88A 4A4CA 4WQ3A 3FE6A 1GGWA 3SG2A 1WDCC 5HL1A 1TN4A 1CDLA 4GGNA 3ICBA 2KAVA 2OS8B 1N65A 1EL4A 1QJTA 4OZDA 3VRNA 2KYCA 2KNEA 4GNKB 1SPYA 1ZACA 1BR1B 2L50A 3O2PA 2O5GA 4MRXA 1DGVA 2WCLA 1ZFSA 4DIRA 4FQOA 1UHKA 1J55A 1Y1AA 3M0WA 4U8DA 2JU0A 1K9UA 1ODBA 3D0YB 2LLSA 2ZNEA 3FS7A 4KYNA 4OV2A 1K90D 4PHNA 1J7OA 1OOJA 1EG4A 3BYAA 3TUYC 1LVCD 3FWBA 1YRTB 3D74A 5I2QA 1L7ZA 1SW8A 1E8AA 1XA5A 2KBMA 1CM1A 1OSAA 2BNXA 2JTZA 5F6TA 2CTNA 1K8UA 1SYMA 2GGMA 3S0EA 2AUCA 1Z2CB 2LAPA 3GOFA 2NCOA 3BUXB 1IQ5A 2L98A 3VGOA 3MSEB 1F70A 1SSEB 1LA0A 3CDNA 2YGUA 3EVUA 3JTDB 4QJ4B 2BL0C 2JNFA 2R2IA 3N7HA 2K7OA 3CR2A 3SJSA 2GGZA 1BLQA 3CR5X 3NHIA 1UWOA 2D8NA 1NCXA 1B8LA 2H2KA 3KO0A 1OOIX 1CDPA 2HQWA 2P6BB 3PN7C 3CZ0A 3I5HB 1MR8A 2JOJA 2JXLA 3QMEA 1EG3A 2BBNA 1DF0A 1IQ3A 1B7TZ 1QS7A 1J7QA 2MA2A 1FI5A 2LLTA 3I5GC 5AERA 4DRWA 3FWCA 2PYQA 2P70A 1QV1A 3B86A 3BUNB 3TZ1A 4OR9B 1DJYA 3PLFB 4HREE 3SS4A 1W7JB 1NX3A 1QV0A 3D10A 1F54A 2QEVA 1IRJA 2G2BA 3BUOB 1N0YA 3EK8A 2JPTA 4MZLA 2FJYA 1DJIA 1SCMB 3PJIA 4PHKA 1HT9A 1C3ZA 1M45A 2ZN8A 3VRRA 3CS1A 1JFJA 2JXCA 1L2OC 4I5NB 1GQMA 3UNWA 4ETOA 1CDMA 3BFAA 2KI4B 3GK1A 1XO5A 1XFXO 3D73A 5FI7A 4MEWA 2Y1MA 2BKHB 3OB1B 3QRXA 4IJ7A 1BG1A 4M2OA 3PSRA 3I5IC 2M3WA 1NCYA 2KQ6A 4GFTA 4NDBA 1F4OA 4MLWA 1JF2A 3GK4X 1DT7B 5DKQA 1B47A 1SL7A 1KWOC 1NIWA 1QVIZ 2I2RE 1KK7Z 1CB1A 3SG5A 1DGUA 1DJHA 3NSKA 5D69A 1JBAA 1S26D 1SR6B 1BOCA 1RTP1 1B8CA 4AQIA 3B6XA 1A75B 5I2OA 2ZRSA 2F2OA 3SIAA 5HYDA 2JULA 1OOFA 1CMFA 1CFFA 1IKUA 4HRGA 1P28A 1A29A 3BOWA 3OP0A 5HKYA 4YBHB 3SG4A 4PE7A 4D1EA 1KK8B 4I5KA 3IF7A 2Y1NA 5HLOA 1PRWA 2AMIA 1W9ZA 3TS5C 3CWGA 5K89A 1IG5A 2OTGC 4MZJA 1TNXA 1NX0A 2I94A 2ZRTA 3B87A 3DY9A 1B7TY 4MVFA 2LANA 2CBLA 3D0YA 3DVMA 2EC6C 1N2DA 5AANA 2GV5A 1S6IA 3VRPA 1SL9A 5DKRA 1FI6A 2L5YA 3DXLA 5I2LA 1CTRA 1SBJA 2NCPA 5AEQA 2PASA 1OZOA 4C0LA 1QX2A 3GK2A 3DF0B 2BCBA 1YUSA 1NSHA 1OMDA 1DJGA 1G33A 3BUMB 2M9GA 2L2CA 2PALA 4INWA 1CDNA 3L47A 4JPZB 4GGFA 3D75A 3VROA 2M0RA 2QDIA 3S0GA 2E6WA 1MWNA 1TRFA 3KF9A 4OCIA 5J3XA 1Y1UA 1G4YR 1WY9A 2MLFC 2WC8A 2WOSA 2RGIA 3CLNA 2P71A 2KPHA 1YURA 4YI9A 1QX7A 1G8IA 3I5FC 1TTXA 2E30A 2EHBA 2FCDA 4AOMA 1NUBA 1QVIY 2QACA 1KK7Y 1PVBA 4C0JA 5CSJA 2LMUA 2WCKA 1U5IB 1AVSA 4PALA 4MN0A 3PFVA 1AP4A 2PRUA 3CTNA 3EKHA 5CSFA 2G9BA 1QXPA 1GJYA 1M46A 3JVTB 1IWQA 5DICA 4L9MA 3DVJA 2BCAA 4N1FA 3C1VA 5ER4X 1R2UA 3BFHA 1PALA 5JOLA 1RROA 2K7BA 2BCXA 1UP5A 1EJ3A 2M49B 3OB2B 1UHJA 4C0KA 4I5JA 1IGVA 1L2OB 2VRGA 1V1FA 3S0BA 4PHMA 1K94A 1PVAA 3DVKA 2BBMA 2BE4A 4USLA 4XYNA 1F8HA 3OHMB 1J7PA 1YUTA 5BPJA 1CLBA 1S5GZ 2LHIA 1AK8A 4BY4A 3IVTA 2PSRA 2L4IA 3NHTA 4MRYA 3DYEA 1DQEA 3EVRA 2LVJA 4YGEB 1K93D 2I7AA 2Y5IA 5IBWA 2WCFA 1ALWA 4ICBA 1XFRA 2JTTA 2QEOA 3SIBA 2WC5A 1DJXA 1YVLA 4ORCB 2LUCA 3F45A 1XK4A 3IQOA 3O4YA 1OOGA 1QIWA 1KFUS 4XJKA 2B1UA 3TDUA 3ZNIA 1YTZC 1H8BA 4N1GA 5TNCA 1EH2A 2GTEA 1BT6A 2L5XB 5FI2A 1A4PA 3D77A 2PVBA 1H4BA 1D1OA 3R72A 2CCMA 2OS8C 3RLZA 1K96A 1SY9A 1FF1A 3O6BA 1OW4A 1AJ4A 2PMYA 4MBEA 4MZKA 4E68A 1QASA 1FBVA 1F4QA 1KFUL 1DJWA 1IJ6A 2MLEC 3SG3A 1JUOA 1LXFC 2JC2A 2WCJA 1LS8A 1K9PA 1S3PA 2M29A 3BXKA 3SS5A 1JSAA 5CSIA 3NGVA 3WXAA 1V1GA 2HETA 5HKWA 1CFPA 1DELA 2KLEA 4BY5A 2KGRA 3OX5A 1DC1A 2NXQA 1KQMC 2V53A 2M1KB 4CPVA 1J1EA 1YX7A 2QEBA 1SKTA 2I18A 1CLMA 1CFDA 3H4SE 2F3ZA 4FTGA 4NQGA 1KCYA 1ZUZA 2JT3A 5CPVA 3JTDC 2JQ6A 1WLZA 4I5LB 1JFKA 2BE6A 2JWWA 4GAOA 4GGFC 1M63B 1UURA 4M2PA 2LUXA 3S0AA 1JC2A 5D7FA 3D78A 2M7LA 2F33A 2F8PA 3O78A 1GGZA 1TUJA 3VRQA 1K2HA 1SL8A 1W7IB 1WDCB 1Y0VH 2KOTA 4GBAA 4QJ3B 2L51A 1DMOA 1UHHA 2JRFA 3I5HC 3EKJA 3S0FA 1PSRA 1S5GY 1UHNA 3A4UB 3DD4A 1MXEA 2WNDA 3FIAA 4WRIA 2M1UA 5JJGA 1YX8A 4PHJA 4JKTA 2COLB 2LP3A 4CFQA 1B1GA 1B9AA 3AKAA 2KGBC 2H61A 1ZMZA 1XFWO 2KLDA 4HSZA 1JWDA 1RWYA 2NZ0A 2SASA 4M2QA 3TUYB 1TOPA 1SMGA 3EK4A 1BMOA 3FE9A 1DTLA 1U5IA 2ISDA 1OMVA 2Q91A 1SCMC 3EK7A 1S36A 1BF5A 1C07A 3NSLA 1XFYO 1TWOA 5AXIA 3CGAA 1FW4A 2BKIB 2L0PA 4R1EA 4GPLB 3NSIA 4QJ5B 4MSPA 2K61A 2K0JA 2KFGA 5HLVA 1RFJA 2BL0B 1UHIA 2SCPA 2ZFDA 3KHEA 2MRDA 3L4LA 3NSOA 4ZCVA 4UPGA 1XYDA 1TNPA
chains in the Genus database with same CATH topology
1SNLA 3HCMA 4WQ2A 2K2FA 1MUXA 3LK0A 4OVNF 3PN7B 1XK4C 2M8UA 1WRZA 3AKBA 2LHLA 1M31A 1VRKA 2KAYA 1JF0A 1SK6D 3I5GB 4AQJA 1SR6C 2HQ8A 2FJUB 1BJFA 1BU3A 2LNKA 2JNXA 5FYXA 2LVIA 2LMTA 3BOWB 4ORBB 1KFXL 1OZSA 1TNQA 5GQQC 4YRUA 5I8NA 1M39A 1Y1XA 4IL1A 1C7WA 2KI6D 1KK8C 1ZOTB 1CFCA 5ER5A 5DKNA 1UUSA 2IS9A 1NPQA 4CLNA 2FOTA 3CZTX 3LCPC 2A4JA 2MJWB 5KSZA 2DOQA 1F71A 1YRUB 1BODA 3AAJA 2MBXA 4DUQA 2K7CA 4A4BA 1X02A 1Q80A 1IJ5A 1SRAA 2LC5A 3DVEA 1A03A 1WRLA 3WNXB 1XFVO 2KFFA 1KQMB 3I5IB 1PSBA 3BUWB 2F3YA 4TNCA 1OQPA 1KWOB 2CXJA 4YI8A 4YGDB 3RM1A 1BR4B 2F2PA 1TCFA 2LE9B 1J7RA 1CM4A 2BECA 1F55A 4P2YB 4YGCB 1HQVA 4YGAA 1A75A 1LKJA 3HX4A 1OMRA 2FCEA 2LCPA 3SG6A 2KAXA 1SCVA 2EGDA 3WHUB 1XVJA 2KHNA 1CMGA 1CLLA 2ZNDA 1AHRA 4DCKA 2KI6C 2ZN9A 5G08A 4NDDA 1WLMA 4CIDA 1QLSA 4PDZA 3TS5B 3SG7A 1KQVA 4PCWA 2OTGB 2H61C 1RK9A 1NYAA 3LLEA 2LVKA 1XFUO 1K95A 2HPSA 4P5OE 2OPOA 1TCOB 4PE4A 1MF8B 2EC6B 1J1DA 3JVTC 2O60A 1K9KA 1NX1A 1YR5A 2K2AA 1IH0A 1NX2A 3KEVA 1DJZA 2KFHA 4Q04A 5PALA 1FPWA 2NLNA 1OE9B 3E3RA 4PE1A 2M97A 1MQ1A 1RJVA 3DF0A 3PM8A 2Y4QA 1TNWA 3KPXA 4ZCUA 2TN4A 2HF5A 1NP8A 1S6JA 3LL8B 1PULA 1RECA 1NCZA 1KSOA 1MHOA 1MXLC 3IQQA 4GUKA 1S1EA 1NWDA 1DF0B 1QX5B 2KQYA 5KU1A 2MHHA 3PALA 3CR4X 1DVIA 1A2XA 2WORA 5KTYA 4HRHA 2LM5A 1QLKA 4XJKB 1B8RA 1LINA 4CFRA 3I5FB 3K21A 2LVVA 3AAKA 4F0ZB 4YGBB 3WHTB 3A8RA 1CKKA 4OKHA 1B4CA 2K8MB 3EVVA 1AUIB 1QATA 2QPTA 4DS7A 2CNPA 2ZKMX 3ZWHA 2L2EA 2WCBA 1KSMA 4JQ0D 1R6PA 4N5XA 3NXAA 2CT9A 1WRKA 5AFPA 2LP2A 1LA3A 4PE0A 2KI4C 1ALVA 1TIZA 4JWQA 2JT0A 2Q4UA 1S6CA 2KDHA 2LV7A 1CNPA 3TDIA 2JT8A 2KSPA 1QTXA 5CSNA 2AAOA 2LMVA 2KYFA 2MAZA 1KFXS 3BQ3A 1AJ5A 2WCEA 2JZIA 5B8IB 2LLUA 1QIVA 3OX6A 2K7DA 1Y6WA 2KBIA 4NDCA 3PATA 5HKZA 1XFZO 1YVHA 1EXRA 3LK1A 3TDZA 1YUUA 4ORAB 2L4HA 1C7VA 2M7NA 1PK0D 4A4CA 4WQ3A 1GGWA 3SG2A 1WDCC 1TN4A 1CDLA 4GGNA 3ICBA 2KAVA 2OS8B 1N65A 1EL4A 1QJTA 3VRNA 2KYCA 2KNEA 4GNKB 1SPYA 1ZACA 1BR1B 2L50A 3O2PA 2O5GA 4MRXA 1DGVA 1ZFSA 4DIRA 4FQOA 1UHKA 1J55A 1Y1AA 3M0WA 4U8DA 2JU0A 1K9UA 1ODBA 3D0YB 2LLSA 2ZNEA 3FS7A 4OV2A 4PHNA 1K90D 1J7OA 1OOJA 1EG4A 3BYAA 3TUYC 1LVCD 3FWBA 1YRTB 5I2QA 1L7ZA 1SW8A 1E8AA 1XA5A 2KBMA 1CM1A 1OSAA 2JTZA 5F6TA 2CTNA 1K8UA 1SYMA 2GGMA 2AUCA 2LAPA 3GOFA 2NCOA 3BUXB 1IQ5A 2L98A 3VGOA 3MSEB 1F70A 1LA0A 3EVUA 3JTDB 4QJ4B 2BL0C 2JNFA 2R2IA 2K7OA 3CR2A 3SJSA 2GGZA 1BLQA 3CR5X 1UWOA 2D8NA 1NCXA 1B8LA 2H2KA 3KO0A 2HQWA 1CDPA 2P6BB 3PN7C 3I5HB 1MR8A 2JOJA 2JXLA 1EG3A 2BBNA 1DF0A 1IQ3A 1B7TZ 1QS7A 1J7QA 2MA2A 1FI5A 2LLTA 3I5GC 5AERA 4DRWA 3FWCA 1QV1A 3BUNB 3TZ1A 4OR9B 1DJYA 3PLFB 4HREE 1W7JB 1NX3A 1QV0A 3D10A 1F54A 1IRJA 2G2BA 3BUOB 1N0YA 3EK8A 2JPTA 4MZLA 1DJIA 1SCMB 4PHKA 1HT9A 1M45A 2ZN8A 3VRRA 3CS1A 1JFJA 2JXCA 1L2OC 4I5NB 1GQMA 4ETOA 1CDMA 2KI4B 3GK1A 1XO5A 1XFXO 4MEWA 2Y1MA 2BKHB 3OB1B 3QRXA 1BG1A 4M2OA 3PSRA 3I5IC 2M3WA 1NCYA 2KQ6A 4GFTA 4NDBA 1F4OA 4MLWA 1JF2A 3GK4X 1DT7B 5DKQA 1B47A 1SL7A 1KWOC 1NIWA 1QVIZ 2I2RE 1KK7Z 1CB1A 3SG5A 1DGUA 1DJHA 3NSKA 5D69A 1JBAA 1S26D 1SR6B 1BOCA 1RTP1 1B8CA 4AQIA 1A75B 5I2OA 2ZRSA 2F2OA 3SIAA 5HYDA 2JULA 1CMFA 1CFFA 1IKUA 4HRGA 1A29A 3BOWA 3OP0A 5HKYA 4YBHB 3SG4A 4PE7A 4D1EA 1KK8B 4I5KA 3IF7A 2Y1NA 5HLOA 1PRWA 2AMIA 3TS5C 5K89A 3CWGA 1IG5A 2OTGC 4MZJA 1TNXA 1NX0A 2I94A 2ZRTA 4MVFA 1B7TY 2LANA 2CBLA 3D0YA 3DVMA 2EC6C 1N2DA 5AANA 2GV5A 1S6IA 3VRPA 1SL9A 5DKRA 1FI6A 5I2LA 1CTRA 1SBJA 2NCPA 5AEQA 2PASA 1OZOA 4C0LA 1QX2A 3GK2A 3DF0B 2BCBA 1YUSA 1NSHA 1OMDA 1DJGA 1G33A 3BUMB 2M9GA 2PALA 1CDNA 4JPZB 4GGFA 3VROA 2M0RA 2E6WA 1MWNA 1TRFA 3KF9A 4OCIA 5J3XA 1Y1UA 1G4YR 1WY9A 2MLFC 2WC8A 2WOSA 2RGIA 3CLNA 1YURA 4YI9A 1QX7A 1G8IA 3I5FC 1TTXA 2E30A 2EHBA 2FCDA 4AOMA 1NUBA 1QVIY 2QACA 1KK7Y 1PVBA 4C0JA 5CSJA 2LMUA 1U5IB 1AVSA 4PALA 4MN0A 3PFVA 1AP4A 2PRUA 3CTNA 3EKHA 5CSFA 2G9BA 1QXPA 1GJYA 1M46A 3JVTB 1IWQA 4L9MA 3DVJA 2BCAA 4N1FA 3C1VA 5ER4X 1R2UA 5JOLA 1PALA 1RROA 2K7BA 2BCXA 1UP5A 1EJ3A 2M49B 3OB2B 1UHJA 4C0KA 4I5JA 1IGVA 1L2OB 2VRGA 1V1FA 4PHMA 1K94A 1PVAA 3DVKA 2BBMA 2BE4A 4USLA 4XYNA 1F8HA 3OHMB 1J7PA 1YUTA 5BPJA 1CLBA 1S5GZ 2LHIA 1AK8A 4BY4A 2PSRA 2L4IA 4MRYA 3EVRA 2LVJA 4YGEB 1K93D 2I7AA 2Y5IA 5IBWA 2WCFA 1ALWA 4ICBA 2JTTA 3SIBA 1DJXA 1YVLA 4ORCB 2LUCA 3F45A 1XK4A 3IQOA 3O4YA 1QIWA 1KFUS 4XJKA 2B1UA 3TDUA 3ZNIA 1YTZC 1H8BA 4N1GA 5TNCA 1EH2A 1BT6A 2L5XB 1A4PA 2PVBA 1H4BA 1D1OA 2CCMA 2OS8C 3RLZA 1K96A 1SY9A 1FF1A 3O6BA 1AJ4A 2PMYA 4MBEA 4MZKA 4E68A 1QASA 1FBVA 1F4QA 1KFUL 1DJWA 1IJ6A 2MLEC 3SG3A 1JUOA 1LXFC 2JC2A 1K9PA 1S3PA 2M29A 3BXKA 1JSAA 5CSIA 3WXAA 1V1GA 2HETA 5HKWA 1CFPA 4BY5A 2KGRA 3OX5A 2NXQA 1KQMC 2V53A 2M1KB 4CPVA 1J1EA 1YX7A 1SKTA 2I18A 1CLMA 1CFDA 3H4SE 2F3ZA 4FTGA 4NQGA 1KCYA 1ZUZA 2JT3A 5CPVA 3JTDC 2JQ6A 1WLZA 4I5LB 1JFKA 2BE6A 2JWWA 4GAOA 4GGFC 1M63B 1UURA 4M2PA 2LUXA 1JC2A 5D7FA 2M7LA 2F33A 2F8PA 3O78A 1GGZA 3VRQA 1K2HA 1SL8A 1W7IB 1WDCB 1Y0VH 2KOTA 4GBAA 4QJ3B 2L51A 1DMOA 1UHHA 2JRFA 3I5HC 3EKJA 1PSRA 1S5GY 1UHNA 3A4UB 3DD4A 1MXEA 2WNDA 3FIAA 4WRIA 2M1UA 5JJGA 1YX8A 4PHJA 2COLB 2LP3A 4CFQA 1B1GA 1B9AA 3AKAA 2KGBC 2H61A 1ZMZA 1XFWO 4HSZA 1JWDA 1RWYA 2NZ0A 2SASA 4M2QA 3TUYB 1TOPA 1SMGA 3EK4A 1BMOA 2ISDA 1DTLA 1U5IA 1OMVA 2Q91A 1SCMC 3EK7A 1S36A 1BF5A 1C07A 3NSLA 1XFYO 5AXIA 3CGAA 1FW4A 2BKIB 2L0PA 4R1EA 4GPLB 3NSIA 4QJ5B 4MSPA 2K61A 2K0JA 2KFGA 5HLVA 1RFJA 2BL0B 1UHIA 2SCPA 2ZFDA 3KHEA 2MRDA 3NSOA 4ZCVA 4UPGA 1XYDA 1TNPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SNL A;  3HCM A;  4WQ2 A;  2K2F A;  1MUX A;  3LK0 A;  4OVN F;  3PN7 B;  1XK4 C;  2M8U A;  1WRZ A;  3AKB A;  2LHL A;  1M31 A;  1VRK A;  2KAY A;  1JF0 A;  1SK6 D;  3I5G B;  4AQJ A;  1SR6 C;  2HQ8 A;  2FJU B;  1BJF A;  1BU3 A;  2LNK A;  2JNX A;  5FYX A;  2LVI A;  2LMT A;  3BOW B;  4ORB B;  1KFX L;  1OZS A;  1TNQ A;  5GQQ C;  4YRU A;  5I8N A;  1M39 A;  1Y1X A;  4IL1 A;  1C7W A;  2KI6 D;  1KK8 C;  1ZOT B;  1CFC A;  5ER5 A;  5DKN A;  1UUS A;  2IS9 A;  1NPQ A;  4CLN A;  2FOT A;  3CZT X;  3LCP C;  2A4J A;  2MJW B;  5KSZ A;  2DOQ A;  1F71 A;  1YRU B;  1BOD A;  3AAJ A;  2MBX A;  4DUQ A;  2K7C A;  4A4B A;  1X02 A;  1Q80 A;  1IJ5 A;  1SRA A;  2LC5 A;  3DVE A;  1A03 A;  1WRL A;  3WNX B;  1XFV O;  2KFF A;  1KQM B;  3I5I B;  1PSB A;  3BUW B;  2F3Y A;  4TNC A;  1OQP A;  1KWO B;  2CXJ A;  4YI8 A;  4YGD B;  3RM1 A;  1BR4 B;  2F2P A;  1TCF A;  2LE9 B;  1J7R A;  1CM4 A;  2BEC A;  1F55 A;  4P2Y B;  4YGC B;  1HQV A;  4YGA A;  1A75 A;  1LKJ A;  3HX4 A;  1OMR A;  2FCE A;  2LCP A;  3SG6 A;  2KAX A;  1SCV A;  2EGD A;  3WHU B;  1XVJ A;  2KHN A;  1CMG A;  1CLL A;  2ZND A;  1AHR A;  4DCK A;  2KI6 C;  2ZN9 A;  5G08 A;  4NDD A;  1WLM A;  4CID A;  1QLS A;  4PDZ A;  3TS5 B;  3SG7 A;  1KQV A;  4PCW A;  2OTG B;  2H61 C;  1RK9 A;  1NYA A;  3LLE A;  2LVK A;  1XFU O;  1K95 A;  2HPS A;  4P5O E;  2OPO A;  1TCO B;  4PE4 A;  1MF8 B;  2EC6 B;  1J1D A;  3JVT C;  2O60 A;  1K9K A;  1NX1 A;  1YR5 A;  2K2A A;  1IH0 A;  1NX2 A;  3KEV A;  1DJZ A;  2KFH A;  4Q04 A;  5PAL A;  1FPW A;  2NLN A;  1OE9 B;  3E3R A;  4PE1 A;  2M97 A;  1MQ1 A;  1RJV A;  3DF0 A;  3PM8 A;  2Y4Q A;  1TNW A;  3KPX A;  4ZCU A;  2TN4 A;  2HF5 A;  1NP8 A;  1S6J A;  3LL8 B;  1PUL A;  1REC A;  1NCZ A;  1KSO A;  1MHO A;  1MXL C;  3IQQ A;  4GUK A;  1S1E A;  1NWD A;  1DF0 B;  1QX5 B;  2KQY A;  5KU1 A;  2MHH A;  3PAL A;  3CR4 X;  1DVI A;  1A2X A;  2WOR A;  5KTY A;  4HRH A;  2LM5 A;  1QLK A;  4XJK B;  1B8R A;  1LIN A;  4CFR A;  3I5F B;  3K21 A;  2LVV A;  3AAK A;  4F0Z B;  4YGB B;  3WHT B;  3A8R A;  1CKK A;  4OKH A;  1B4C A;  2K8M B;  3EVV A;  1AUI B;  1QAT A;  2QPT A;  4DS7 A;  2CNP A;  2ZKM X;  3ZWH A;  2L2E A;  2WCB A;  1KSM A;  4JQ0 D;  1R6P A;  4N5X A;  3NXA A;  2CT9 A;  1WRK A;  5AFP A;  2LP2 A;  1LA3 A;  4PE0 A;  2KI4 C;  1ALV A;  1TIZ A;  4JWQ A;  2JT0 A;  2Q4U A;  1S6C A;  2KDH A;  2LV7 A;  1CNP A;  3TDI A;  2JT8 A;  2KSP A;  1QTX A;  5CSN A;  2AAO A;  2LMV A;  2KYF A;  2MAZ A;  1KFX S;  3BQ3 A;  1AJ5 A;  2WCE A;  2JZI A;  5B8I B;  2LLU A;  1QIV A;  3OX6 A;  2K7D A;  1Y6W A;  2KBI A;  4NDC A;  3PAT A;  5HKZ A;  1XFZ O;  1YVH A;  1EXR A;  3LK1 A;  3TDZ A;  1YUU A;  4ORA B;  2L4H A;  1C7V A;  2M7N A;  1PK0 D;  4A4C A;  4WQ3 A;  1GGW A;  3SG2 A;  1WDC C;  1TN4 A;  1CDL A;  4GGN A;  3ICB A;  2KAV A;  2OS8 B;  1N65 A;  1EL4 A;  1QJT A;  3VRN A;  2KYC A;  2KNE A;  4GNK B;  1SPY A;  1ZAC A;  1BR1 B;  2L50 A;  3O2P A;  2O5G A;  4MRX A;  1DGV A;  1ZFS A;  4DIR A;  4FQO A;  1UHK A;  1J55 A;  1Y1A A;  3M0W A;  4U8D A;  2JU0 A;  1K9U A;  1ODB A;  3D0Y B;  2LLS A;  2ZNE A;  3FS7 A;  4OV2 A;  4PHN A;  1K90 D;  1J7O A;  1OOJ A;  1EG4 A;  3BYA A;  3TUY C;  1LVC D;  3FWB A;  1YRT B;  5I2Q A;  1L7Z A;  1SW8 A;  1E8A A;  1XA5 A;  2KBM A;  1CM1 A;  1OSA A;  2JTZ A;  5F6T A;  2CTN A;  1K8U A;  1SYM A;  2GGM A;  2AUC A;  2LAP A;  3GOF A;  2NCO A;  3BUX B;  1IQ5 A;  2L98 A;  3VGO A;  3MSE B;  1F70 A;  1LA0 A;  3EVU A;  3JTD B;  4QJ4 B;  2BL0 C;  2JNF A;  2R2I A;  2K7O A;  3CR2 A;  3SJS A;  2GGZ A;  1BLQ A;  3CR5 X;  1UWO A;  2D8N A;  1NCX A;  1B8L A;  2H2K A;  3KO0 A;  2HQW A;  1CDP A;  2P6B B;  3PN7 C;  3I5H B;  1MR8 A;  2JOJ A;  2JXL A;  1EG3 A;  2BBN A;  1DF0 A;  1IQ3 A;  1B7T Z;  1QS7 A;  1J7Q A;  2MA2 A;  1FI5 A;  2LLT A;  3I5G C;  5AER A;  4DRW A;  3FWC A;  1QV1 A;  3BUN B;  3TZ1 A;  4OR9 B;  1DJY A;  3PLF B;  4HRE E;  1W7J B;  1NX3 A;  1QV0 A;  3D10 A;  1F54 A;  1IRJ A;  2G2B A;  3BUO B;  1N0Y A;  3EK8 A;  2JPT A;  4MZL A;  1DJI A;  1SCM B;  4PHK A;  1HT9 A;  1M45 A;  2ZN8 A;  3VRR A;  3CS1 A;  1JFJ A;  2JXC A;  1L2O C;  4I5N B;  1GQM A;  4ETO A;  1CDM A;  2KI4 B;  3GK1 A;  1XO5 A;  1XFX O;  4MEW A;  2Y1M A;  2BKH B;  3OB1 B;  3QRX A;  1BG1 A;  4M2O A;  3PSR A;  3I5I C;  2M3W A;  1NCY A;  2KQ6 A;  4GFT A;  4NDB A;  1F4O A;  4MLW A;  1JF2 A;  3GK4 X;  1DT7 B;  5DKQ A;  1B47 A;  1SL7 A;  1KWO C;  1NIW A;  1QVI Z;  2I2R E;  1KK7 Z;  1CB1 A;  3SG5 A;  1DGU A;  1DJH A;  3NSK A;  5D69 A;  1JBA A;  1S26 D;  1SR6 B;  1BOC A;  1RTP 1;  1B8C A;  4AQI A;  1A75 B;  5I2O A;  2ZRS A;  2F2O A;  3SIA A;  5HYD A;  2JUL A;  1CMF A;  1CFF A;  1IKU A;  4HRG A;  1A29 A;  3BOW A;  3OP0 A;  5HKY A;  4YBH B;  3SG4 A;  4PE7 A;  4D1E A;  1KK8 B;  4I5K A;  3IF7 A;  2Y1N A;  5HLO A;  1PRW A;  2AMI A;  3TS5 C;  5K89 A;  3CWG A;  1IG5 A;  2OTG C;  4MZJ A;  1TNX A;  1NX0 A;  2I94 A;  2ZRT A;  4MVF A;  1B7T Y;  2LAN A;  2CBL A;  3D0Y A;  3DVM A;  2EC6 C;  1N2D A;  5AAN A;  2GV5 A;  1S6I A;  3VRP A;  1SL9 A;  5DKR A;  1FI6 A;  5I2L A;  1CTR A;  1SBJ A;  2NCP A;  5AEQ A;  2PAS A;  1OZO A;  4C0L A;  1QX2 A;  3GK2 A;  3DF0 B;  2BCB A;  1YUS A;  1NSH A;  1OMD A;  1DJG A;  1G33 A;  3BUM B;  2M9G A;  2PAL A;  1CDN A;  4JPZ B;  4GGF A;  3VRO A;  2M0R A;  2E6W A;  1MWN A;  1TRF A;  3KF9 A;  4OCI A;  5J3X A;  1Y1U A;  1G4Y R;  1WY9 A;  2MLF C;  2WC8 A;  2WOS A;  2RGI A;  3CLN A;  1YUR A;  4YI9 A;  1QX7 A;  1G8I A;  3I5F C;  1TTX A;  2E30 A;  2EHB A;  2FCD A;  4AOM A;  1NUB A;  1QVI Y;  2QAC A;  1KK7 Y;  1PVB A;  4C0J A;  5CSJ A;  2LMU A;  1U5I B;  1AVS A;  4PAL A;  4MN0 A;  3PFV A;  1AP4 A;  2PRU A;  3CTN A;  3EKH A;  5CSF A;  2G9B A;  1QXP A;  1GJY A;  1M46 A;  3JVT B;  1IWQ A;  4L9M A;  3DVJ A;  2BCA A;  4N1F A;  3C1V A;  5ER4 X;  1R2U A;  5JOL A;  1PAL A;  1RRO A;  2K7B A;  2BCX A;  1UP5 A;  1EJ3 A;  2M49 B;  3OB2 B;  1UHJ A;  4C0K A;  4I5J A;  1IGV A;  1L2O B;  2VRG A;  1V1F A;  4PHM A;  1K94 A;  1PVA A;  3DVK A;  2BBM A;  2BE4 A;  4USL A;  4XYN A;  1F8H A;  3OHM B;  1J7P A;  1YUT A;  5BPJ A;  1CLB A;  1S5G Z;  2LHI A;  1AK8 A;  4BY4 A;  2PSR A;  2L4I A;  4MRY A;  3EVR A;  2LVJ A;  4YGE B;  1K93 D;  2I7A A;  2Y5I A;  5IBW A;  2WCF A;  1ALW A;  4ICB A;  2JTT A;  3SIB A;  1DJX A;  1YVL A;  4ORC B;  2LUC A;  3F45 A;  1XK4 A;  3IQO A;  3O4Y A;  1QIW A;  1KFU S;  4XJK A;  2B1U A;  3TDU A;  3ZNI A;  1YTZ C;  1H8B A;  4N1G A;  5TNC A;  1EH2 A;  1BT6 A;  2L5X B;  1A4P A;  2PVB A;  1H4B A;  1D1O A;  2CCM A;  2OS8 C;  3RLZ A;  1K96 A;  1SY9 A;  1FF1 A;  3O6B A;  1AJ4 A;  2PMY A;  4MBE A;  4MZK A;  4E68 A;  1QAS A;  1FBV A;  1F4Q A;  1KFU L;  1DJW A;  1IJ6 A;  2MLE C;  3SG3 A;  1JUO A;  1LXF C;  2JC2 A;  1K9P A;  1S3P A;  2M29 A;  3BXK A;  1JSA A;  5CSI A;  3WXA A;  1V1G A;  2HET A;  5HKW A;  1CFP A;  4BY5 A;  2KGR A;  3OX5 A;  2NXQ A;  1KQM C;  2V53 A;  2M1K B;  4CPV A;  1J1E A;  1YX7 A;  1SKT A;  2I18 A;  1CLM A;  1CFD A;  3H4S E;  2F3Z A;  4FTG A;  4NQG A;  1KCY A;  1ZUZ A;  2JT3 A;  5CPV A;  3JTD C;  2JQ6 A;  1WLZ A;  4I5L B;  1JFK A;  2BE6 A;  2JWW A;  4GAO A;  4GGF C;  1M63 B;  1UUR A;  4M2P A;  2LUX A;  1JC2 A;  5D7F A;  2M7L A;  2F33 A;  2F8P A;  3O78 A;  1GGZ A;  3VRQ A;  1K2H A;  1SL8 A;  1W7I B;  1WDC B;  1Y0V H;  2KOT A;  4GBA A;  4QJ3 B;  2L51 A;  1DMO A;  1UHH A;  2JRF A;  3I5H C;  3EKJ A;  1PSR A;  1S5G Y;  1UHN A;  3A4U B;  3DD4 A;  1MXE A;  2WND A;  3FIA A;  4WRI A;  2M1U A;  5JJG A;  1YX8 A;  4PHJ A;  2COL B;  2LP3 A;  4CFQ A;  1B1G A;  1B9A A;  3AKA A;  2KGB C;  2H61 A;  1ZMZ A;  1XFW O;  4HSZ A;  1JWD A;  1RWY A;  2NZ0 A;  2SAS A;  4M2Q A;  3TUY B;  1TOP A;  1SMG A;  3EK4 A;  1BMO A;  2ISD A;  1DTL A;  1U5I A;  1OMV A;  2Q91 A;  1SCM C;  3EK7 A;  1S36 A;  1BF5 A;  1C07 A;  3NSL A;  1XFY O;  5AXI A;  3CGA A;  1FW4 A;  2BKI B;  2L0P A;  4R1E A;  4GPL B;  3NSI A;  4QJ5 B;  4MSP A;  2K61 A;  2K0J A;  2KFG A;  5HLV A;  1RFJ A;  2BL0 B;  1UHI A;  2SCP A;  2ZFD A;  3KHE A;  2MRD A;  3NSO A;  4ZCV A;  4UPG A;  1XYD A;  1TNP A; 
#chains in the Genus database with same CATH topology
 1SNL A;  3HCM A;  3Q8I A;  4WQ2 A;  3R1V A;  2K2F A;  1MUX A;  3LK0 A;  4OVN F;  3EG5 B;  1XK4 C;  2M8U A;  1WRZ A;  3AKB A;  3PN7 B;  2LHL A;  1M31 A;  5D3O A;  1VRK A;  2KAY A;  3SS3 A;  1JF0 A;  1SK6 D;  3I5G B;  1GM0 A;  4AQJ A;  1SR6 C;  5FI6 A;  2HQ8 A;  2FJU B;  3BFB A;  1BJF A;  2QEH A;  1BU3 A;  1T14 A;  2PQL A;  2LNK A;  2WCH A;  2JNX A;  5FYX A;  2LVI A;  2LMT A;  3DZT A;  1DEK A;  3BOW B;  4ORB B;  1KFX L;  1OZS A;  1TNQ A;  5GQQ C;  4YRU A;  5I8N A;  1M39 A;  1TUZ A;  1Y1X A;  4IL1 A;  1C7W A;  2KI6 D;  1KK8 C;  1ZOT B;  1CFC A;  5ER5 A;  5DKN A;  1UUS A;  2IS9 A;  1NPQ A;  4CLN A;  2FOT A;  3CZT X;  3LCP C;  2A4J A;  2MJW B;  5KSZ A;  2DOQ A;  3D76 A;  1F71 A;  1YRU B;  1BOD A;  3AAJ A;  2MBX A;  4DUQ A;  2K7C A;  4A4B A;  1X02 A;  1Q80 A;  1IJ5 A;  1SRA A;  2LC5 A;  3DVE A;  1OOH A;  1WRL A;  3WNX B;  1A03 A;  1XFV O;  2KFF A;  1KQM B;  3I5I B;  1PSB A;  3BUW B;  2F3Y A;  4TNC A;  3VB1 A;  1OQP A;  1KWO B;  2CXJ A;  4YI8 A;  4YGD B;  3RM1 A;  1BR4 B;  2F2P A;  1TCF A;  2LE9 B;  1J7R A;  1CM4 A;  2BEC A;  1F55 A;  4P2Y B;  2K60 A;  4YGC B;  1HQV A;  4YGA A;  1A75 A;  1LKJ A;  3HX4 A;  1OMR A;  2FCE A;  2LCP A;  2WCM A;  3SG6 A;  2KAX A;  1SCV A;  2EGD A;  2H8V A;  3WHU B;  1XVJ A;  2KHN A;  1CMG A;  1CLL A;  3B7A A;  2ZND A;  1AHR A;  3OGN A;  4DCK A;  2KI6 C;  2ZN9 A;  5G08 A;  1Z4H A;  4NDD A;  1WLM A;  4CID A;  1QLS A;  4PDZ A;  3TS5 B;  2ERB A;  3SG7 A;  1KQV A;  4PCW A;  2OTG B;  2H61 C;  1RK9 A;  1NYA A;  3LLE A;  2LVK A;  3PM2 A;  1XFU O;  1K95 A;  2HPS A;  4P5O E;  2OPO A;  1TCO B;  4PE4 A;  1MF8 B;  2EC6 B;  5EL2 A;  1J1D A;  3JVT C;  2O60 A;  1K9K A;  1NX1 A;  1YR5 A;  2K2A A;  1IH0 A;  1NX2 A;  4FQT A;  3KEV A;  1DJZ A;  2BAP A;  2KFH A;  4Q04 A;  5PAL A;  1FPW A;  2NLN A;  4PT1 A;  3FE8 A;  3L4A A;  1OE9 B;  3E3R A;  4PE1 A;  2M97 A;  1MQ1 A;  3S0D A;  1RJV A;  3DF0 A;  3PM8 A;  2Y4Q A;  1TNW A;  3KPX A;  4ZCU A;  2TN4 A;  2HF5 A;  1NP8 A;  1S6J A;  3LL8 B;  1PUL A;  1REC A;  1NCZ A;  1KSO A;  1MHO A;  1MXL C;  3IQQ A;  4GUK A;  1S1E A;  1NWD A;  3K1E A;  2WC6 A;  3UO9 A;  1DF0 B;  1QX5 B;  2KQY A;  5KU1 A;  2MHH A;  3PAL A;  3CR4 X;  1DVI A;  1A2X A;  4F7F A;  2WOR A;  5KTY A;  4HRH A;  2LM5 A;  1QLK A;  4XJK B;  1B8R A;  3BJH A;  3CZ2 A;  1LIN A;  4CFR A;  3I5F B;  3K21 A;  3V2L A;  2LVV A;  3AAK A;  1IIO A;  4F0Z B;  4YGB B;  3WHT B;  3A8R A;  1CKK A;  4JD9 A;  3OBV A;  4OKH A;  1B4C A;  3CZ1 A;  2K8M B;  3EVV A;  1AUI B;  1QAT A;  2QPT A;  4DS7 A;  4INX A;  2CNP A;  2ZKM X;  3ZWH A;  2L2E A;  2WCB A;  1ORG A;  1KSM A;  4JQ0 D;  1R6P A;  4N5X A;  3NXA A;  2CT9 A;  1WRK A;  5AFP A;  2LP2 A;  3O4X A;  1LA3 A;  4PE0 A;  2KI4 C;  1ALV A;  1TIZ A;  4JWQ A;  2JT0 A;  2Q4U A;  1S6C A;  3CYZ A;  2KDH A;  2LV7 A;  3R1P A;  3TDI A;  1CNP A;  2JT8 A;  5I94 A;  2KSP A;  1QTX A;  5CSN A;  1C3Y A;  2AAO A;  2LMV A;  2KYF A;  2MAZ A;  1KFX S;  3CAB A;  3BQ3 A;  1AJ5 A;  2WCE A;  2JZI A;  5B8I B;  2LLU A;  1QIV A;  3OX6 A;  2K7D A;  1Y6W A;  2KBI A;  4NDC A;  3PAT A;  5HKZ A;  1XFZ O;  1YVH A;  3RZS A;  1EXR A;  3LK1 A;  3TDZ A;  1YUU A;  4ORA B;  1QWV A;  2JPO A;  2L4H A;  2M7N A;  1C7V A;  3R1O A;  1PK0 D;  3B88 A;  4A4C A;  4WQ3 A;  3FE6 A;  1GGW A;  3SG2 A;  1WDC C;  5HL1 A;  1TN4 A;  1CDL A;  4GGN A;  3ICB A;  2KAV A;  2OS8 B;  1N65 A;  1EL4 A;  1QJT A;  4OZD A;  3VRN A;  2KYC A;  2KNE A;  4GNK B;  1SPY A;  1ZAC A;  1BR1 B;  2L50 A;  3O2P A;  2O5G A;  4MRX A;  1DGV A;  2WCL A;  1ZFS A;  4DIR A;  4FQO A;  1UHK A;  1J55 A;  1Y1A A;  3M0W A;  4U8D A;  2JU0 A;  1K9U A;  1ODB A;  3D0Y B;  2LLS A;  2ZNE A;  3FS7 A;  4KYN A;  4OV2 A;  1K90 D;  4PHN A;  1J7O A;  1OOJ A;  1EG4 A;  3BYA A;  3TUY C;  1LVC D;  3FWB A;  1YRT B;  3D74 A;  5I2Q A;  1L7Z A;  1SW8 A;  1E8A A;  1XA5 A;  2KBM A;  1CM1 A;  1OSA A;  2BNX A;  2JTZ A;  5F6T A;  2CTN A;  1K8U A;  1SYM A;  2GGM A;  3S0E A;  2AUC A;  1Z2C B;  2LAP A;  3GOF A;  2NCO A;  3BUX B;  1IQ5 A;  2L98 A;  3VGO A;  3MSE B;  1F70 A;  1SSE B;  1LA0 A;  3CDN A;  2YGU A;  3EVU A;  3JTD B;  4QJ4 B;  2BL0 C;  2JNF A;  2R2I A;  3N7H A;  2K7O A;  3CR2 A;  3SJS A;  2GGZ A;  1BLQ A;  3CR5 X;  3NHI A;  1UWO A;  2D8N A;  1NCX A;  1B8L A;  2H2K A;  3KO0 A;  1OOI X;  1CDP A;  2HQW A;  2P6B B;  3PN7 C;  3CZ0 A;  3I5H B;  1MR8 A;  2JOJ A;  2JXL A;  3QME A;  1EG3 A;  2BBN A;  1DF0 A;  1IQ3 A;  1B7T Z;  1QS7 A;  1J7Q A;  2MA2 A;  1FI5 A;  2LLT A;  3I5G C;  5AER A;  4DRW A;  3FWC A;  2PYQ A;  2P70 A;  1QV1 A;  3B86 A;  3BUN B;  3TZ1 A;  4OR9 B;  1DJY A;  3PLF B;  4HRE E;  3SS4 A;  1W7J B;  1NX3 A;  1QV0 A;  3D10 A;  1F54 A;  2QEV A;  1IRJ A;  2G2B A;  3BUO B;  1N0Y A;  3EK8 A;  2JPT A;  4MZL A;  2FJY A;  1DJI A;  1SCM B;  3PJI A;  4PHK A;  1HT9 A;  1C3Z A;  1M45 A;  2ZN8 A;  3VRR A;  3CS1 A;  1JFJ A;  2JXC A;  1L2O C;  4I5N B;  1GQM A;  3UNW A;  4ETO A;  1CDM A;  3BFA A;  2KI4 B;  3GK1 A;  1XO5 A;  1XFX O;  3D73 A;  5FI7 A;  4MEW A;  2Y1M A;  2BKH B;  3OB1 B;  3QRX A;  4IJ7 A;  1BG1 A;  4M2O A;  3PSR A;  3I5I C;  2M3W A;  1NCY A;  2KQ6 A;  4GFT A;  4NDB A;  1F4O A;  4MLW A;  1JF2 A;  3GK4 X;  1DT7 B;  5DKQ A;  1B47 A;  1SL7 A;  1KWO C;  1NIW A;  1QVI Z;  2I2R E;  1KK7 Z;  1CB1 A;  3SG5 A;  1DGU A;  1DJH A;  3NSK A;  5D69 A;  1JBA A;  1S26 D;  1SR6 B;  1BOC A;  1RTP 1;  1B8C A;  4AQI A;  3B6X A;  1A75 B;  5I2O A;  2ZRS A;  2F2O A;  3SIA A;  5HYD A;  2JUL A;  1OOF A;  1CMF A;  1CFF A;  1IKU A;  4HRG A;  1P28 A;  1A29 A;  3BOW A;  3OP0 A;  5HKY A;  4YBH B;  3SG4 A;  4PE7 A;  4D1E A;  1KK8 B;  4I5K A;  3IF7 A;  2Y1N A;  5HLO A;  1PRW A;  2AMI A;  1W9Z A;  3TS5 C;  3CWG A;  5K89 A;  1IG5 A;  2OTG C;  4MZJ A;  1TNX A;  1NX0 A;  2I94 A;  2ZRT A;  3B87 A;  3DY9 A;  1B7T Y;  4MVF A;  2LAN A;  2CBL A;  3D0Y A;  3DVM A;  2EC6 C;  1N2D A;  5AAN A;  2GV5 A;  1S6I A;  3VRP A;  1SL9 A;  5DKR A;  1FI6 A;  2L5Y A;  3DXL A;  5I2L A;  1CTR A;  1SBJ A;  2NCP A;  5AEQ A;  2PAS A;  1OZO A;  4C0L A;  1QX2 A;  3GK2 A;  3DF0 B;  2BCB A;  1YUS A;  1NSH A;  1OMD A;  1DJG A;  1G33 A;  3BUM B;  2M9G A;  2L2C A;  2PAL A;  4INW A;  1CDN A;  3L47 A;  4JPZ B;  4GGF A;  3D75 A;  3VRO A;  2M0R A;  2QDI A;  3S0G A;  2E6W A;  1MWN A;  1TRF A;  3KF9 A;  4OCI A;  5J3X A;  1Y1U A;  1G4Y R;  1WY9 A;  2MLF C;  2WC8 A;  2WOS A;  2RGI A;  3CLN A;  2P71 A;  2KPH A;  1YUR A;  4YI9 A;  1QX7 A;  1G8I A;  3I5F C;  1TTX A;  2E30 A;  2EHB A;  2FCD A;  4AOM A;  1NUB A;  1QVI Y;  2QAC A;  1KK7 Y;  1PVB A;  4C0J A;  5CSJ A;  2LMU A;  2WCK A;  1U5I B;  1AVS A;  4PAL A;  4MN0 A;  3PFV A;  1AP4 A;  2PRU A;  3CTN A;  3EKH A;  5CSF A;  2G9B A;  1QXP A;  1GJY A;  1M46 A;  3JVT B;  1IWQ A;  5DIC A;  4L9M A;  3DVJ A;  2BCA A;  4N1F A;  3C1V A;  5ER4 X;  1R2U A;  3BFH A;  1PAL A;  5JOL A;  1RRO A;  2K7B A;  2BCX A;  1UP5 A;  1EJ3 A;  2M49 B;  3OB2 B;  1UHJ A;  4C0K A;  4I5J A;  1IGV A;  1L2O B;  2VRG A;  1V1F A;  3S0B A;  4PHM A;  1K94 A;  1PVA A;  3DVK A;  2BBM A;  2BE4 A;  4USL A;  4XYN A;  1F8H A;  3OHM B;  1J7P A;  1YUT A;  5BPJ A;  1CLB A;  1S5G Z;  2LHI A;  1AK8 A;  4BY4 A;  3IVT A;  2PSR A;  2L4I A;  3NHT A;  4MRY A;  3DYE A;  1DQE A;  3EVR A;  2LVJ A;  4YGE B;  1K93 D;  2I7A A;  2Y5I A;  5IBW A;  2WCF A;  1ALW A;  4ICB A;  1XFR A;  2JTT A;  2QEO A;  3SIB A;  2WC5 A;  1DJX A;  1YVL A;  4ORC B;  2LUC A;  3F45 A;  1XK4 A;  3IQO A;  3O4Y A;  1OOG A;  1QIW A;  1KFU S;  4XJK A;  2B1U A;  3TDU A;  3ZNI A;  1YTZ C;  1H8B A;  4N1G A;  5TNC A;  1EH2 A;  2GTE A;  1BT6 A;  2L5X B;  5FI2 A;  1A4P A;  3D77 A;  2PVB A;  1H4B A;  1D1O A;  3R72 A;  2CCM A;  2OS8 C;  3RLZ A;  1K96 A;  1SY9 A;  1FF1 A;  3O6B A;  1OW4 A;  1AJ4 A;  2PMY A;  4MBE A;  4MZK A;  4E68 A;  1QAS A;  1FBV A;  1F4Q A;  1KFU L;  1DJW A;  1IJ6 A;  2MLE C;  3SG3 A;  1JUO A;  1LXF C;  2JC2 A;  2WCJ A;  1LS8 A;  1K9P A;  1S3P A;  2M29 A;  3BXK A;  3SS5 A;  1JSA A;  5CSI A;  3NGV A;  3WXA A;  1V1G A;  2HET A;  5HKW A;  1CFP A;  1DEL A;  2KLE A;  4BY5 A;  2KGR A;  3OX5 A;  1DC1 A;  2NXQ A;  1KQM C;  2V53 A;  2M1K B;  4CPV A;  1J1E A;  1YX7 A;  2QEB A;  1SKT A;  2I18 A;  1CLM A;  1CFD A;  3H4S E;  2F3Z A;  4FTG A;  4NQG A;  1KCY A;  1ZUZ A;  2JT3 A;  5CPV A;  3JTD C;  2JQ6 A;  1WLZ A;  4I5L B;  1JFK A;  2BE6 A;  2JWW A;  4GAO A;  4GGF C;  1M63 B;  1UUR A;  4M2P A;  2LUX A;  3S0A A;  1JC2 A;  5D7F A;  3D78 A;  2M7L A;  2F33 A;  2F8P A;  3O78 A;  1GGZ A;  1TUJ A;  3VRQ A;  1K2H A;  1SL8 A;  1W7I B;  1WDC B;  1Y0V H;  2KOT A;  4GBA A;  4QJ3 B;  2L51 A;  1DMO A;  1UHH A;  2JRF A;  3I5H C;  3EKJ A;  3S0F A;  1PSR A;  1S5G Y;  1UHN A;  3A4U B;  3DD4 A;  1MXE A;  2WND A;  3FIA A;  4WRI A;  2M1U A;  5JJG A;  1YX8 A;  4PHJ A;  4JKT A;  2COL B;  2LP3 A;  4CFQ A;  1B1G A;  1B9A A;  3AKA A;  2KGB C;  2H61 A;  1ZMZ A;  1XFW O;  2KLD A;  4HSZ A;  1JWD A;  1RWY A;  2NZ0 A;  2SAS A;  4M2Q A;  3TUY B;  1TOP A;  1SMG A;  3EK4 A;  1BMO A;  3FE9 A;  1DTL A;  1U5I A;  2ISD A;  1OMV A;  2Q91 A;  1SCM C;  3EK7 A;  1S36 A;  1BF5 A;  1C07 A;  3NSL A;  1XFY O;  1TWO A;  5AXI A;  3CGA A;  1FW4 A;  2BKI B;  2L0P A;  4R1E A;  4GPL B;  3NSI A;  4QJ5 B;  4MSP A;  2K61 A;  2K0J A;  2KFG A;  5HLV A;  1RFJ A;  2BL0 B;  1UHI A;  2SCP A;  2ZFD A;  3KHE A;  2MRD A;  3L4L A;  3NSO A;  4ZCV A;  4UPG A;  1XYD A;  1TNP A; 
#chains in the Genus database with same CATH homology
 1SNL A;  3HCM A;  4WQ2 A;  2K2F A;  1MUX A;  3LK0 A;  4OVN F;  3PN7 B;  1XK4 C;  2M8U A;  1WRZ A;  3AKB A;  2LHL A;  1M31 A;  1VRK A;  2KAY A;  1JF0 A;  1SK6 D;  3I5G B;  4AQJ A;  1SR6 C;  2HQ8 A;  2FJU B;  1BJF A;  1BU3 A;  2LNK A;  2JNX A;  5FYX A;  2LVI A;  2LMT A;  3BOW B;  4ORB B;  1KFX L;  1OZS A;  1TNQ A;  5GQQ C;  4YRU A;  5I8N A;  1M39 A;  1Y1X A;  4IL1 A;  1C7W A;  2KI6 D;  1KK8 C;  1ZOT B;  1CFC A;  5ER5 A;  5DKN A;  1UUS A;  2IS9 A;  1NPQ A;  4CLN A;  2FOT A;  3CZT X;  3LCP C;  2A4J A;  2MJW B;  5KSZ A;  2DOQ A;  1F71 A;  1YRU B;  1BOD A;  3AAJ A;  2MBX A;  4DUQ A;  2K7C A;  4A4B A;  1X02 A;  1Q80 A;  1IJ5 A;  1SRA A;  2LC5 A;  3DVE A;  1A03 A;  1WRL A;  3WNX B;  1XFV O;  2KFF A;  1KQM B;  3I5I B;  1PSB A;  3BUW B;  2F3Y A;  4TNC A;  1OQP A;  1KWO B;  2CXJ A;  4YI8 A;  4YGD B;  3RM1 A;  1BR4 B;  2F2P A;  1TCF A;  2LE9 B;  1J7R A;  1CM4 A;  2BEC A;  1F55 A;  4P2Y B;  4YGC B;  1HQV A;  4YGA A;  1A75 A;  1LKJ A;  3HX4 A;  1OMR A;  2FCE A;  2LCP A;  3SG6 A;  2KAX A;  1SCV A;  2EGD A;  3WHU B;  1XVJ A;  2KHN A;  1CMG A;  1CLL A;  2ZND A;  1AHR A;  4DCK A;  2KI6 C;  2ZN9 A;  5G08 A;  4NDD A;  1WLM A;  4CID A;  1QLS A;  4PDZ A;  3TS5 B;  3SG7 A;  1KQV A;  4PCW A;  2OTG B;  2H61 C;  1RK9 A;  1NYA A;  3LLE A;  2LVK A;  1XFU O;  1K95 A;  2HPS A;  4P5O E;  2OPO A;  1TCO B;  4PE4 A;  1MF8 B;  2EC6 B;  1J1D A;  3JVT C;  2O60 A;  1K9K A;  1NX1 A;  1YR5 A;  2K2A A;  1IH0 A;  1NX2 A;  3KEV A;  1DJZ A;  2KFH A;  4Q04 A;  5PAL A;  1FPW A;  2NLN A;  1OE9 B;  3E3R A;  4PE1 A;  2M97 A;  1MQ1 A;  1RJV A;  3DF0 A;  3PM8 A;  2Y4Q A;  1TNW A;  3KPX A;  4ZCU A;  2TN4 A;  2HF5 A;  1NP8 A;  1S6J A;  3LL8 B;  1PUL A;  1REC A;  1NCZ A;  1KSO A;  1MHO A;  1MXL C;  3IQQ A;  4GUK A;  1S1E A;  1NWD A;  1DF0 B;  1QX5 B;  2KQY A;  5KU1 A;  2MHH A;  3PAL A;  3CR4 X;  1DVI A;  1A2X A;  2WOR A;  5KTY A;  4HRH A;  2LM5 A;  1QLK A;  4XJK B;  1B8R A;  1LIN A;  4CFR A;  3I5F B;  3K21 A;  2LVV A;  3AAK A;  4F0Z B;  4YGB B;  3WHT B;  3A8R A;  1CKK A;  4OKH A;  1B4C A;  2K8M B;  3EVV A;  1AUI B;  1QAT A;  2QPT A;  4DS7 A;  2CNP A;  2ZKM X;  3ZWH A;  2L2E A;  2WCB A;  1KSM A;  4JQ0 D;  1R6P A;  4N5X A;  3NXA A;  2CT9 A;  1WRK A;  5AFP A;  2LP2 A;  1LA3 A;  4PE0 A;  2KI4 C;  1ALV A;  1TIZ A;  4JWQ A;  2JT0 A;  2Q4U A;  1S6C A;  2KDH A;  2LV7 A;  1CNP A;  3TDI A;  2JT8 A;  2KSP A;  1QTX A;  5CSN A;  2AAO A;  2LMV A;  2KYF A;  2MAZ A;  1KFX S;  3BQ3 A;  1AJ5 A;  2WCE A;  2JZI A;  5B8I B;  2LLU A;  1QIV A;  3OX6 A;  2K7D A;  1Y6W A;  2KBI A;  4NDC A;  3PAT A;  5HKZ A;  1XFZ O;  1YVH A;  1EXR A;  3LK1 A;  3TDZ A;  1YUU A;  4ORA B;  2L4H A;  1C7V A;  2M7N A;  1PK0 D;  4A4C A;  4WQ3 A;  1GGW A;  3SG2 A;  1WDC C;  1TN4 A;  1CDL A;  4GGN A;  3ICB A;  2KAV A;  2OS8 B;  1N65 A;  1EL4 A;  1QJT A;  3VRN A;  2KYC A;  2KNE A;  4GNK B;  1SPY A;  1ZAC A;  1BR1 B;  2L50 A;  3O2P A;  2O5G A;  4MRX A;  1DGV A;  1ZFS A;  4DIR A;  4FQO A;  1UHK A;  1J55 A;  1Y1A A;  3M0W A;  4U8D A;  2JU0 A;  1K9U A;  1ODB A;  3D0Y B;  2LLS A;  2ZNE A;  3FS7 A;  4OV2 A;  4PHN A;  1K90 D;  1J7O A;  1OOJ A;  1EG4 A;  3BYA A;  3TUY C;  1LVC D;  3FWB A;  1YRT B;  5I2Q A;  1L7Z A;  1SW8 A;  1E8A A;  1XA5 A;  2KBM A;  1CM1 A;  1OSA A;  2JTZ A;  5F6T A;  2CTN A;  1K8U A;  1SYM A;  2GGM A;  2AUC A;  2LAP A;  3GOF A;  2NCO A;  3BUX B;  1IQ5 A;  2L98 A;  3VGO A;  3MSE B;  1F70 A;  1LA0 A;  3EVU A;  3JTD B;  4QJ4 B;  2BL0 C;  2JNF A;  2R2I A;  2K7O A;  3CR2 A;  3SJS A;  2GGZ A;  1BLQ A;  3CR5 X;  1UWO A;  2D8N A;  1NCX A;  1B8L A;  2H2K A;  3KO0 A;  2HQW A;  1CDP A;  2P6B B;  3PN7 C;  3I5H B;  1MR8 A;  2JOJ A;  2JXL A;  1EG3 A;  2BBN A;  1DF0 A;  1IQ3 A;  1B7T Z;  1QS7 A;  1J7Q A;  2MA2 A;  1FI5 A;  2LLT A;  3I5G C;  5AER A;  4DRW A;  3FWC A;  1QV1 A;  3BUN B;  3TZ1 A;  4OR9 B;  1DJY A;  3PLF B;  4HRE E;  1W7J B;  1NX3 A;  1QV0 A;  3D10 A;  1F54 A;  1IRJ A;  2G2B A;  3BUO B;  1N0Y A;  3EK8 A;  2JPT A;  4MZL A;  1DJI A;  1SCM B;  4PHK A;  1HT9 A;  1M45 A;  2ZN8 A;  3VRR A;  3CS1 A;  1JFJ A;  2JXC A;  1L2O C;  4I5N B;  1GQM A;  4ETO A;  1CDM A;  2KI4 B;  3GK1 A;  1XO5 A;  1XFX O;  4MEW A;  2Y1M A;  2BKH B;  3OB1 B;  3QRX A;  1BG1 A;  4M2O A;  3PSR A;  3I5I C;  2M3W A;  1NCY A;  2KQ6 A;  4GFT A;  4NDB A;  1F4O A;  4MLW A;  1JF2 A;  3GK4 X;  1DT7 B;  5DKQ A;  1B47 A;  1SL7 A;  1KWO C;  1NIW A;  1QVI Z;  2I2R E;  1KK7 Z;  1CB1 A;  3SG5 A;  1DGU A;  1DJH A;  3NSK A;  5D69 A;  1JBA A;  1S26 D;  1SR6 B;  1BOC A;  1RTP 1;  1B8C A;  4AQI A;  1A75 B;  5I2O A;  2ZRS A;  2F2O A;  3SIA A;  5HYD A;  2JUL A;  1CMF A;  1CFF A;  1IKU A;  4HRG A;  1A29 A;  3BOW A;  3OP0 A;  5HKY A;  4YBH B;  3SG4 A;  4PE7 A;  4D1E A;  1KK8 B;  4I5K A;  3IF7 A;  2Y1N A;  5HLO A;  1PRW A;  2AMI A;  3TS5 C;  5K89 A;  3CWG A;  1IG5 A;  2OTG C;  4MZJ A;  1TNX A;  1NX0 A;  2I94 A;  2ZRT A;  4MVF A;  1B7T Y;  2LAN A;  2CBL A;  3D0Y A;  3DVM A;  2EC6 C;  1N2D A;  5AAN A;  2GV5 A;  1S6I A;  3VRP A;  1SL9 A;  5DKR A;  1FI6 A;  5I2L A;  1CTR A;  1SBJ A;  2NCP A;  5AEQ A;  2PAS A;  1OZO A;  4C0L A;  1QX2 A;  3GK2 A;  3DF0 B;  2BCB A;  1YUS A;  1NSH A;  1OMD A;  1DJG A;  1G33 A;  3BUM B;  2M9G A;  2PAL A;  1CDN A;  4JPZ B;  4GGF A;  3VRO A;  2M0R A;  2E6W A;  1MWN A;  1TRF A;  3KF9 A;  4OCI A;  5J3X A;  1Y1U A;  1G4Y R;  1WY9 A;  2MLF C;  2WC8 A;  2WOS A;  2RGI A;  3CLN A;  1YUR A;  4YI9 A;  1QX7 A;  1G8I A;  3I5F C;  1TTX A;  2E30 A;  2EHB A;  2FCD A;  4AOM A;  1NUB A;  1QVI Y;  2QAC A;  1KK7 Y;  1PVB A;  4C0J A;  5CSJ A;  2LMU A;  1U5I B;  1AVS A;  4PAL A;  4MN0 A;  3PFV A;  1AP4 A;  2PRU A;  3CTN A;  3EKH A;  5CSF A;  2G9B A;  1QXP A;  1GJY A;  1M46 A;  3JVT B;  1IWQ A;  4L9M A;  3DVJ A;  2BCA A;  4N1F A;  3C1V A;  5ER4 X;  1R2U A;  5JOL A;  1PAL A;  1RRO A;  2K7B A;  2BCX A;  1UP5 A;  1EJ3 A;  2M49 B;  3OB2 B;  1UHJ A;  4C0K A;  4I5J A;  1IGV A;  1L2O B;  2VRG A;  1V1F A;  4PHM A;  1K94 A;  1PVA A;  3DVK A;  2BBM A;  2BE4 A;  4USL A;  4XYN A;  1F8H A;  3OHM B;  1J7P A;  1YUT A;  5BPJ A;  1CLB A;  1S5G Z;  2LHI A;  1AK8 A;  4BY4 A;  2PSR A;  2L4I A;  4MRY A;  3EVR A;  2LVJ A;  4YGE B;  1K93 D;  2I7A A;  2Y5I A;  5IBW A;  2WCF A;  1ALW A;  4ICB A;  2JTT A;  3SIB A;  1DJX A;  1YVL A;  4ORC B;  2LUC A;  3F45 A;  1XK4 A;  3IQO A;  3O4Y A;  1QIW A;  1KFU S;  4XJK A;  2B1U A;  3TDU A;  3ZNI A;  1YTZ C;  1H8B A;  4N1G A;  5TNC A;  1EH2 A;  1BT6 A;  2L5X B;  1A4P A;  2PVB A;  1H4B A;  1D1O A;  2CCM A;  2OS8 C;  3RLZ A;  1K96 A;  1SY9 A;  1FF1 A;  3O6B A;  1AJ4 A;  2PMY A;  4MBE A;  4MZK A;  4E68 A;  1QAS A;  1FBV A;  1F4Q A;  1KFU L;  1DJW A;  1IJ6 A;  2MLE C;  3SG3 A;  1JUO A;  1LXF C;  2JC2 A;  1K9P A;  1S3P A;  2M29 A;  3BXK A;  1JSA A;  5CSI A;  3WXA A;  1V1G A;  2HET A;  5HKW A;  1CFP A;  4BY5 A;  2KGR A;  3OX5 A;  2NXQ A;  1KQM C;  2V53 A;  2M1K B;  4CPV A;  1J1E A;  1YX7 A;  1SKT A;  2I18 A;  1CLM A;  1CFD A;  3H4S E;  2F3Z A;  4FTG A;  4NQG A;  1KCY A;  1ZUZ A;  2JT3 A;  5CPV A;  3JTD C;  2JQ6 A;  1WLZ A;  4I5L B;  1JFK A;  2BE6 A;  2JWW A;  4GAO A;  4GGF C;  1M63 B;  1UUR A;  4M2P A;  2LUX A;  1JC2 A;  5D7F A;  2M7L A;  2F33 A;  2F8P A;  3O78 A;  1GGZ A;  3VRQ A;  1K2H A;  1SL8 A;  1W7I B;  1WDC B;  1Y0V H;  2KOT A;  4GBA A;  4QJ3 B;  2L51 A;  1DMO A;  1UHH A;  2JRF A;  3I5H C;  3EKJ A;  1PSR A;  1S5G Y;  1UHN A;  3A4U B;  3DD4 A;  1MXE A;  2WND A;  3FIA A;  4WRI A;  2M1U A;  5JJG A;  1YX8 A;  4PHJ A;  2COL B;  2LP3 A;  4CFQ A;  1B1G A;  1B9A A;  3AKA A;  2KGB C;  2H61 A;  1ZMZ A;  1XFW O;  4HSZ A;  1JWD A;  1RWY A;  2NZ0 A;  2SAS A;  4M2Q A;  3TUY B;  1TOP A;  1SMG A;  3EK4 A;  1BMO A;  2ISD A;  1DTL A;  1U5I A;  1OMV A;  2Q91 A;  1SCM C;  3EK7 A;  1S36 A;  1BF5 A;  1C07 A;  3NSL A;  1XFY O;  5AXI A;  3CGA A;  1FW4 A;  2BKI B;  2L0P A;  4R1E A;  4GPL B;  3NSI A;  4QJ5 B;  4MSP A;  2K61 A;  2K0J A;  2KFG A;  5HLV A;  1RFJ A;  2BL0 B;  1UHI A;  2SCP A;  2ZFD A;  3KHE A;  2MRD A;  3NSO A;  4ZCV A;  4UPG A;  1XYD A;  1TNP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...