1GGWA

Cdc4p from schizosaccharomyces pombe
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
140
structure length
140
Chain Sequence
STDDSPYKQAFSLFDRHGTGRIPKTSIGDLLRACGQNPTLAEITEIESTLPAEVDMEQFLQVLNRPNGFDMPGDPEEFVKGFQVFDKDATGMIGVGELRYVLTSLGEKLSNEEMDELLKGVPVKDGMVNYHDFVQMILAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords PROTEIN (CDC4P)
publication title Structure of Cdc4p, a contractile ring protein essential for cytokinesis in Schizosaccharomyces pombe.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 30
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2000-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ggwA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ggwA01
2LUCA 5CSJA 1KWOB 2BCBA 1NIWA 3SIBA 2JQ6A 2V53A 2LP3A 1L7ZA 3DD4A 2JC2A 1J7OA 2F3YA 4USLA 4CLNA 3FWCA 2WCFA 1AHRA 1KK7Z 1UUSA 4PCWA 1SL8A 3IF7A 2M9GA 1DVIA 1OSAA 1RWYA 2KFGA 2Y1MA 4PE7A 3VRNA 4UPGA 3OP0A 3O6BA 4L9MA 1WDCC 2P6BB 1K9UA 1OQPA 2K7BA 1Q80A 1AUIB 3TZ1A 1QS7A 1N65A 1K8UA 1N0YA 1SL9A 1EJ3A 2Y4QA 1ALVA 1JF2A 1QX5B 1JUOA 3BQ3A 5CSIA 1BODA 1KFXL 2KAVA 3I5GB 3CR2A 1OZOA 2COLB 3VRPA 1MWNA 2B1UA 3BOWA 4NDBA 1H4BA 2L98A 1DGVA 3O2PA 2FOTA 4OCIA 1QASA 1VRKA 1BT6A 1NSHA 5DKQA 1C7WA 1NX1A 1SW8A 3EVVA 1Y1AA 1OE9B 4YGAA 2AUCA 4GGNA 1BR1B 1KSOA 2I94A 3EKJA 1R2UA 2ZN9A 2BKHB 2LMTA 3OX6A 3SG5A 1CM1A 3FS7A 1YX8A 5B8IB 1Y1XA 4NDCA 5HKZA 4ZCVA 2Y5IA 1B9AA 2EHBA 1EL4A 1TNXA 1WY9A 5GQQC 1TIZA 3KHEA 4PE1A 2LCPA 1DJXA 1B8RA 1NCYA 3TDIA 1QLKA 2BKIB 1D1OA 5JOLA 1SCMC 2JT0A 1B47A 5HKWA 1XFXO 3IQOA 2O5GA 3NSOA 2KNEA 2KGBC 2L0PA 1NP8A 3PLFB 4M2QA 1B7TZ 2H2KA 5DKRA 1XFWO 5JJGA 3SJSA 1QJTA 3AAJA 1A2XA 4IL1A 4HRGA 3SG6A 3CGAA 2OTGB 1B8CA 3BXKA 4YGCB 4CFRA 3TUYB 1CFFA 2WORA 2K7CA 1X02A 1XVJA 4CPVA 1MHOA 3CLNA 1CDNA 3ICBA 1IGVA 2H61A 4I5KA 4MRYA 1KQMC 3I5FB 1F54A 1IWQA 4DIRA 1JF0A 1SYMA 4BY5A 5ER5A 1WRZA 3RLZA 1YUUA 1YVLA 2K61A 1KSMA 2M29A 1C07A 4D1EA 1NCXA 4XJKA 3DF0A 1DF0B 1DJZA 2F3ZA 1FF1A 2CBLA 1ZUZA 3KEVA 2LVVA 2AAOA 2MLFC 1E8AA 1J7PA 1RJVA 2L4HA 4JPZB 2NCOA 3FWBA 1S5GZ 2KI4B 4DUQA 1PK0D 2LANA 1RROA 1UHKA 1M31A 3DVJA 1XK4C 3NSKA 2LLTA 2M49B 1MR8A 1IJ5A 1F8HA 3WHTB 1NWDA 2FCEA 2K0JA 3TS5C 2WCEA 2CT9A 1PRWA 2E6WA 5I2QA 5KU1A 1PSRA 2MJWB 3PSRA 1UP5A 1QVIZ 1JSAA 2AMIA 2M7NA 1S6CA 3BUMB 4ZCUA 3I5IC 4MBEA 2L4IA 3DVKA 3VRRA 1OMVA 1KFUS 2HPSA 2BE6A 1K2HA 2L51A 1AJ4A 1SKTA 3I5IB 1A75A 3O4YA 2CNPA 1G8IA 2JXLA 4GNKB 1QVIY 1V1FA 2KDHA 2PALA 1XK4A 2PMYA 4FQOA 1U5IA 1CMGA 5FYXA 4CIDA 1K90D 2FCDA 5I8NA 1PVAA 3DVMA 1TRFA 1YR5A 5HLVA 2IS9A 2JOJA 2OS8B 3SIAA 2LNKA 1CKKA 3JTDB 1QXPA 3I5GC 5D7FA 1XFUO 1UHJA 2BCXA 2KBMA 1YX7A 2KYCA 2ZNEA 1KK7Y 4NDDA 4MZLA 1QATA 4PE4A 1RTP1 4GPLB 4PDZA 5I2OA 2GGMA 1LVCD 2F8PA 1EG3A 1BF5A 4ORAB 5CSNA 1Y6WA 1JFJA 2JT3A 3DVEA 3TDUA 4I5NB 1IJ6A 2L50A 2MAZA 2RGIA 3CS1A 4YGDB 4WRIA 3BUOB 2OPOA 2LHIA 2ZN8A 1FBVA 1TNPA 1XA5A 3EVUA 3SG3A 1JC2A 1IQ3A 4ICBA 1OOJA 1CLBA 4GBAA 2KFFA 1SRAA 2KI6D 1IG5A 2KGRA 3RM1A 1CFPA 3GK1A 4N1FA 3KO0A 2K2AA 5AANA 4NQGA 2JNXA 3BYAA 3LL8B 1Y0VH 2KSPA 4I5LB 4ETOA 1DT7B 2LAPA 2K8MB 5J3XA 4HSZA 4N1GA 4PHKA 1BR4B 3D0YB 4YBHB 2KAYA 1UHHA 1AJ5A 2CTNA 5KSZA 3BUWB 1C7VA 4XYNA 2I18A 1AVSA 3PFVA 3EK7A 2MA2A 2MHHA 4BY4A 2OTGC 5G08A 4PHMA 1F70A 1YUSA 1PULA 2JNFA 1DJIA 1TNQA 3LLEA 4TNCA 3TUYC 1LA3A 3OB1B 2D8NA 1OMRA 1TNWA 1UHIA 2BL0B 3NXAA 1DJWA 3GK2A 3ZNIA 1HT9A 1B1GA 1M63B 1G4YR 1SNLA 4MLWA 4ORCB 3NSLA 1A29A 2K2FA 1B7TY 2NLNA 1BOCA 3I5FC 2JZIA 4OR9B 1M45A 2JWWA 3PM8A 1LXFC 5D69A 2BBNA 1JFKA 2A4JA 3BUXB 1F55A 3PATA 3M0WA 1B8LA 1MQ1A 2KOTA 2WNDA 1YRUB 4HRHA 2MRDA 3K21A 1KFUL 1QIWA 2BE4A 2F33A 3I5HB 2LE9B 4R1EA 4JWQA 1DJGA 2HF5A 2QPTA 4DCKA 1YVHA 1J1EA 1B4CA 2NCPA 1S3PA 2I7AA 2KI4C 1KCYA 3DF0B 1J1DA 4C0LA 4FTGA 2KFHA 2SASA 1YURA 1GGWA 2R2IA 4ORBB 2FJUB 1QLSA 3WXAA 1UHNA 3IQQA 1ZACA 2LVKA 4Q04A 1CM4A 1L2OB 3AKAA 3VRQA 4HREE 2JTTA 4AQIA 1NX2A 4MVFA 3JVTB 5CPVA 3AKBA 1KQVA 1WRLA 2PRUA 4DRWA 1SPYA 3HX4A 1IKUA 2Y1NA 1S5GY 4GFTA 4QJ4B 1RECA 2E30A 4PHNA 1DF0A 1NX3A 1F4QA 1WLZA 4JQ0D 4QJ3B 2PSRA 1S36A 2M8UA 2KYFA 3WHUB 1ZFSA 4PE0A 5AFPA 1K95A 4OVNF 1A4PA 3SG4A 3QRXA 2HQWA 1NX0A 1MXLC 3LK1A 1LA0A 2K7OA 4A4CA 1XFVO 1SBJA 1SCVA 4MSPA 1EXRA 1MUXA 1YUTA 2KBIA 4OV2A 3GK4X 1EG4A 2WC8A 2OS8C 1AP4A 3H4SE 1KK8B 1CLLA 4QJ5B 1CTRA 2KAXA 3JTDC 3WNXB 2LV7A 2M1KB 5AEQA 2LM5A 2EC6B 1LINA 1FPWA 1K94A 1CDMA 3PN7B 4GAOA 1WLMA 3FIAA 4CFQA 1TN4A 3CWGA 5AERA 1CDPA 1SR6B 1XFYO 3CZTX 1XFZO 1H8BA 1SK6D 1BG1A 2JT8A 2LHLA 2LP2A 1QTXA 1SL7A 2M7LA 4P5OE 2SCPA 3BOWB 4GUKA 1J7QA 2ZRSA 1V1GA 1K9PA 4P2YB 5HLOA 5ER4X 4WQ2A 4F0ZB 1CFCA 4AOMA 3OX5A 2O60A 3CTNA 1A03A 1S1EA 3GOFA 2MBXA 2DOQA 1SMGA 1BU3A 1UURA 2G9BA 1WDCB 1NUBA 4YGEB 1M39A 1MF8B 2LLSA 4YRUA 1CMFA 4A4BA 3MSEB 3KPXA 5PALA 2F2PA 2MLEC 5CSFA 1DJYA 1TCFA 3KF9A 3PALA 4OKHA 1ZMZA 2LVJA 1DMOA 4MRXA 1GGZA 1S6JA 2JPTA 4MEWA 1WRKA 2LMUA 1QIVA 2VRGA 1HQVA 1RFJA 1TCOB 2LVIA 3E3RA 2Q4UA 1ALWA 5AXIA 2BL0C 1LKJA 2CXJA 1QV0A 1QV1A 1DTLA 2ZRTA 3EVRA 4AQJA 5F6TA 1K93D 2M1UA 1JWDA 1F4OA 1YTZC 4C0KA 2PVBA 2L5XB 1SY9A 3CR5X 2KQ6A 3C1VA 2H61C 3HCMA 3D0YA 2NXQA 1TTXA 1ZOTB 5HKYA 2BBMA 1PSBA 2ZKMX 3I5HC 1JBAA 4GGFC 1TOPA 1F71A 4MZKA 1KFXS 2F2OA 2GGZA 1NPQA 2LLUA 2KHNA 3CR4X 1QX2A 1OZSA 1SCMB 1IRJA 1BLQA 2G2BA 2JTZA 1GJYA 2LMVA 1J55A 2M3WA 2BECA 5HYDA 1Y1UA 1K9KA 4XJKB 1BMOA 1DJHA 3EKHA 5BPJA 3VROA 2KI6C 2L2EA 1CFDA 1L2OC 4N5XA 4YI9A 1EH2A 1CLMA 1BJFA 1J7RA 1M46A 3ZWHA 3F45A 5IBWA 3JVTC 4YI8A 4WQ3A 1ODBA 2JU0A 3LCPC 2HETA 1W7IB 4PALA 1G33A 4GGFA 1IH0A 2ISDA 3EK4A 2M0RA 2I2RE 2M97A 1KQMB 2LUXA 3TDZA 1R6PA 1OMDA 3NSIA 4M2OA 1CB1A 4C0JA 2TN4A 4M2PA 1W7JB 1GQMA 2NZ0A 2JXCA 1S26D 2LC5A 1S6IA 1K96A 2QACA 1CNPA 1FW4A 1N2DA 1PALA 3D10A 4PHJA 2GV5A 3OHMB 4I5JA 2Q91A 1KK8C 5TNCA 2K7DA 4E68A 3OB2B 1CDLA 2WOSA 2ZFDA 1A75B 2EGDA 3AAKA 3VGOA 2EC6C 1U5IB 1XYDA 4U8DA 3PN7C 1NCZA 1IQ5A 4YGBB 5I2LA 1XO5A 1AK8A 3EK8A 2JULA 2ZNDA 2JRFA 1UWOA 3A8RA 5DKNA 3SG7A 3TS5B 4DS7A 1SR6C 1YRTB 1DGUA 1RK9A 3O78A 5K89A 2PASA 3BUNB 2CCMA 2HQ8A 3A4UB 1KWOC 5KTYA 2KQYA 2WCBA 2BCAA 4MZJA 1FI6A 1FI5A 1QX7A 4MN0A 1PVBA 1NYAA 3LK0A 1MXEA 3SG2A
chains in the Genus database with same CATH superfamily
2LUCA 5CSJA 1KWOB 2BCBA 2WCHA 1NIWA 3R1PA 2JQ6A 2V53A 2LP3A 1L7ZA 3SIBA 3DD4A 2JC2A 3D74A 2F3YA 4USLA 1J7OA 4CLNA 3FWCA 2WCFA 1AHRA 1KK7Z 1UUSA 4PCWA 1SL8A 1C3ZA 3IF7A 3OBVA 2M9GA 1DVIA 1OSAA 1RWYA 2KFGA 2Y1MA 4PE7A 3VRNA 2H8VA 3OP0A 4UPGA 3O6BA 3B88A 4L9MA 1WDCC 2P6BB 1K9UA 1OQPA 2K7BA 1Q80A 1AUIB 3TZ1A 1QS7A 1N65A 1K8UA 1N0YA 1SL9A 1EJ3A 2Y4QA 1ALVA 1JF2A 1QX5B 1JUOA 3BQ3A 4PT1A 5CSIA 1BODA 1KFXL 2KAVA 4INWA 3I5GB 3CR2A 1OZOA 2COLB 3VRPA 1MWNA 2B1UA 3BOWA 4NDBA 1H4BA 2L98A 1DGVA 3O2PA 2FOTA 4OCIA 1QASA 1VRKA 1BT6A 1NSHA 5DKQA 1C7WA 1NX1A 1SW8A 3EVVA 1Y1AA 1OE9B 4YGAA 2AUCA 4GGNA 1BR1B 1KSOA 2I94A 3EKJA 3D77A 1R2UA 2ZN9A 2BKHB 2LMTA 3OX6A 3SG5A 2ERBA 1CM1A 3FS7A 1YX8A 5B8IB 1Y1XA 4NDCA 5HKZA 3FE6A 4ZCVA 2Y5IA 1B9AA 2EHBA 1EL4A 3BFHA 3VB1A 1TNXA 2KLDA 1WY9A 5GQQC 1TIZA 3KHEA 4PE1A 2LCPA 1DJXA 1B8RA 1NCYA 3TDIA 2L5YA 1QLKA 2BKIB 1D1OA 5JOLA 1SCMC 2JT0A 1B47A 3B86A 1XFXO 5HKWA 3IQOA 3S0EA 2O5GA 3NSOA 2KNEA 2KGBC 2L0PA 1NP8A 3PLFB 4M2QA 5FI2A 1B7TZ 2H2KA 5DKRA 1XFWO 5JJGA 3SJSA 1TUZA 1QJTA 3AAJA 1A2XA 2P70A 4IL1A 2BNXA 4HRGA 3CGAA 2OTGB 1B8CA 2KLEA 3BXKA 3SG6A 4YGCB 4CFRA 3TUYB 1CFFA 2WORA 2K7CA 1X02A 1XVJA 4CPVA 1MHOA 3CLNA 3Q8IA 1CDNA 3ICBA 1IGVA 2H61A 4I5KA 4MRYA 5FI7A 1KQMC 3I5FB 1ORGA 1F54A 1IWQA 4DIRA 1JF0A 1SYMA 4BY5A 5ER5A 1WRZA 3FE9A 3RLZA 1YUUA 3RZSA 1YVLA 3B7AA 2K61A 1KSMA 2QEVA 2M29A 1C07A 4D1EA 1NCXA 4XJKA 3DF0A 1DF0B 1DJZA 2F3ZA 1FF1A 2CBLA 1ZUZA 5DICA 3KEVA 2LVVA 2AAOA 2MLFC 1E8AA 2GTEA 1RJVA 2L4HA 1J7PA 4JPZB 2NCOA 3FWBA 1S5GZ 2KI4B 4DUQA 1PK0D 2LANA 1RROA 1UHKA 1M31A 2WCLA 3DVJA 3D78A 1XK4C 3NSKA 2LLTA 2M49B 1MR8A 1IJ5A 1F8HA 3WHTB 1C3YA 1NWDA 2FCEA 2K0JA 3TS5C 2WCEA 2CT9A 1PRWA 2E6WA 5I2QA 5KU1A 1PSRA 2MJWB 3PSRA 1UP5A 1QVIZ 5EL2A 2AMIA 1JSAA 1OOIX 2M7NA 3K1EA 1S6CA 3BUMB 4ZCUA 3I5IC 3FE8A 4MBEA 2L4IA 3DVKA 3VRRA 1OMVA 1KFUS 2HPSA 2BE6A 1K2HA 2L51A 1AJ4A 1SKTA 3I5IB 1A75A 3O4YA 2CNPA 1G8IA 2JXLA 4GNKB 1QVIY 1V1FA 2KDHA 2PALA 1XK4A 2PMYA 4FQOA 1U5IA 1CMGA 5FYXA 4CIDA 1K90D 2FCDA 5I8NA 1PVAA 3DVMA 1TRFA 1YR5A 3BFAA 4KYNA 5HLVA 2IS9A 2JOJA 2OS8B 3SIAA 3SS4A 2LNKA 1CKKA 5I94A 3JTDB 1QXPA 3QMEA 3I5GC 5D7FA 1XFUO 1UHJA 2BCXA 2KBMA 1YX7A 2KYCA 2ZNEA 1KK7Y 3BJHA 4NDDA 2FJYA 1QATA 4MZLA 4PE4A 1RTP1 3IVTA 4GPLB 4PDZA 1W9ZA 5I2OA 2GGMA 1LVCD 2F8PA 2WC5A 1IIOA 1EG3A 1QWVA 1BF5A 4ORAB 5CSNA 1Y6WA 1JFJA 1OOGA 2JT3A 3NHIA 3DVEA 3TDUA 1XFRA 4I5NB 1IJ6A 2L50A 2MAZA 2RGIA 3CS1A 4YGDB 4WRIA 3BUOB 2OPOA 2LHIA 2ZN8A 1FBVA 1TNPA 1XA5A 3EVUA 3S0GA 3SG3A 1IQ3A 1JC2A 4ICBA 1OOJA 1Z2CB 1CLBA 4GBAA 2KFFA 1SRAA 2KI6D 1IG5A 2KGRA 3RM1A 1CFPA 3GK1A 4N1FA 3KO0A 3SS5A 2K2AA 5AANA 4HRHA 4NQGA 1DC1A 3L4LA 2JNXA 3BYAA 3LL8B 1Y0VH 2KSPA 4I5LB 4ETOA 1DT7B 2LAPA 2K8MB 5J3XA 4HSZA 4N1GA 4PHKA 1BR4B 3D0YB 4YBHB 1DEKA 1Z4HA 1UHHA 2KAYA 1AJ5A 3UNWA 2CTNA 5KSZA 1TWOA 3BUWB 4XYNA 1C7VA 2I18A 1AVSA 3PFVA 3EK7A 3SS3A 1DQEA 2MA2A 2MHHA 4BY4A 2OTGC 5G08A 4PHMA 1F70A 1YUSA 1PULA 2JNFA 1DJIA 1TNQA 3LLEA 4TNCA 3TUYC 1LA3A 3OB1B 2D8NA 1OMRA 1TNWA 1UHIA 2BL0B 3NXAA 1DJWA 3S0BA 3GK2A 3ZNIA 1HT9A 1B1GA 1M63B 1G4YR 1SNLA 4MLWA 4ORCB 3O4XA 3NSLA 1OW4A 1A29A 2K2FA 1B7TY 2KPHA 2NLNA 3S0AA 3I5FC 1BOCA 2JPOA 4OZDA 2JZIA 4OR9B 1M45A 2JWWA 2QEOA 3PM8A 1LXFC 2K60A 5D69A 2BBNA 1JFKA 2A4JA 3BUXB 1F55A 3PATA 3M0WA 1B8LA 1MQ1A 1OOFA 2KOTA 1YRUB 2WNDA 2MRDA 3K21A 1KFUL 1QIWA 2BE4A 2F33A 3I5HB 2LE9B 3N7HA 4R1EA 4JWQA 1DJGA 2HF5A 3PJIA 2QPTA 4DCKA 1YVHA 1J1EA 1B4CA 2NCPA 1S3PA 2I7AA 2KI4C 1KCYA 4F7FA 3DF0B 2PYQA 1J1DA 4C0LA 4FTGA 2KFHA 2SASA 1YURA 1GGWA 2R2IA 4ORBB 2FJUB 1QLSA 3WXAA 1UHNA 3IQQA 1ZACA 2LVKA 4Q04A 1CM4A 1L2OB 3AKAA 3VRQA 4HREE 1T14A 2JTTA 4AQIA 1NX2A 4MVFA 3JVTB 5CPVA 3AKBA 1KQVA 1WRLA 2PRUA 1LS8A 3DY9A 4DRWA 1SPYA 3HX4A 1IKUA 2Y1NA 1S5GY 4GFTA 4QJ4B 2WCKA 1RECA 2E30A 4PHNA 1DF0A 1NX3A 1F4QA 1WLZA 4JQ0D 4QJ3B 2PSRA 1S36A 2M8UA 2KYFA 3WHUB 1ZFSA 4PE0A 5AFPA 1K95A 4OVNF 1A4PA 3OGNA 3SG4A 2BAPA 3QRXA 2HQWA 1NX0A 1MXLC 3LK1A 3R1VA 1LA0A 2K7OA 4A4CA 1XFVO 3R1OA 1SBJA 1SCVA 4MSPA 1EXRA 1MUXA 1YUTA 2KBIA 4OV2A 3GK4X 1EG4A 2WC8A 2OS8C 1AP4A 3H4SE 1KK8B 1CLLA 4IJ7A 4QJ5B 1OOHA 1CTRA 2KAXA 3JTDC 3WNXB 2LV7A 2M1KB 3CZ0A 5AEQA 2LM5A 2EC6B 1LINA 1FPWA 1K94A 1CDMA 3PN7B 4GAOA 1WLMA 3FIAA 2WCJA 4CFQA 1TN4A 3CWGA 5AERA 1CDPA 1SR6B 1XFYO 3CZTX 3V2LA 1XFZO 1H8BA 1SK6D 1BG1A 1SSEB 2JT8A 2LHLA 2LP2A 3CABA 1QTXA 1SL7A 3BFBA 2M7LA 4P5OE 2SCPA 3BOWB 4GUKA 1J7QA 2ZRSA 1V1GA 1K9PA 4P2YB 5HLOA 5ER4X 4WQ2A 3CYZA 4F0ZB 1CFCA 4AOMA 3OX5A 4INXA 2O60A 4FQTA 3CTNA 1A03A 1S1EA 3GOFA 2MBXA 2DOQA 1SMGA 1UURA 1BU3A 2G9BA 3UO9A 1WDCB 1NUBA 2P71A 2QDIA 4YGEB 5D3OA 2WCMA 1M39A 1MF8B 2LLSA 3S0DA 4YRUA 1CMFA 4A4BA 3MSEB 3KPXA 5PALA 2F2PA 2MLEC 3CDNA 5CSFA 1DJYA 1TCFA 3KF9A 3PALA 3PM2A 4OKHA 1ZMZA 2LVJA 2YGUA 1DMOA 4MRXA 1GGZA 1S6JA 2JPTA 4MEWA 1WRKA 2LMUA 1QIVA 2VRGA 1HQVA 1RFJA 1TCOB 3S0FA 2LVIA 3E3RA 2Q4UA 1ALWA 3B87A 5AXIA 2BL0C 1LKJA 2CXJA 1QV0A 1QV1A 1DTLA 2ZRTA 3EVRA 4AQJA 5F6TA 1K93D 2M1UA 1JWDA 1F4OA 1YTZC 4C0KA 2PVBA 2L5XB 5FI6A 1SY9A 3CR5X 2KQ6A 3C1VA 2H61C 4JD9A 3HCMA 3D0YA 2L2CA 2NXQA 1TTXA 1ZOTB 5HKYA 2BBMA 1PSBA 2ZKMX 3I5HC 1JBAA 4GGFC 1TOPA 1F71A 4MZKA 1KFXS 1GM0A 2F2OA 2GGZA 1NPQA 2LLUA 2KHNA 3NHTA 3CR4X 1QX2A 1OZSA 1SCMB 3CZ2A 1IRJA 1BLQA 3DYEA 2G2BA 2JTZA 1GJYA 2LMVA 1J55A 2M3WA 2BECA 2QEBA 5HYDA 1Y1UA 1K9KA 4XJKB 1BMOA 1DJHA 3EKHA 5BPJA 3VROA 2KI6C 2L2EA 1CFDA 1L2OC 4N5XA 4YI9A 1EH2A 1CLMA 1BJFA 1J7RA 1M46A 3ZWHA 3F45A 5IBWA 3JVTC 4YI8A 4WQ3A 3L4AA 1DELA 1ODBA 2JU0A 3LCPC 2HETA 1W7IB 4PALA 1G33A 4GGFA 1IH0A 2ISDA 3EK4A 2M0RA 2I2RE 2M97A 1KQMB 3L47A 2LUXA 3TDZA 1R6PA 1OMDA 2WC6A 3NSIA 4M2OA 1CB1A 3DZTA 2TN4A 4M2PA 4C0JA 1W7JB 1GQMA 2NZ0A 2JXCA 1S26D 1TUJA 1S6IA 2LC5A 2QEHA 1K96A 2QACA 5HL1A 3D73A 1CNPA 1FW4A 1N2DA 1PALA 3D10A 4PHJA 2GV5A 3B6XA 3DXLA 3OHMB 4I5JA 2Q91A 1KK8C 5TNCA 2K7DA 4E68A 3OB2B 1CDLA 3CZ1A 2WOSA 2ZFDA 1A75B 2EGDA 3AAKA 3VGOA 2EC6C 3D75A 1U5IB 1XYDA 4U8DA 3PN7C 1NCZA 1IQ5A 4YGBB 3D76A 5I2LA 1XO5A 1AK8A 3EK8A 2JULA 2ZNDA 2JRFA 1UWOA 3A8RA 5DKNA 3SG7A 4JKTA 3TS5B 1SR6C 3NGVA 4DS7A 1YRTB 1DGUA 1RK9A 3O78A 5K89A 2PASA 3BUNB 2CCMA 2PQLA 3R72A 2HQ8A 1P28A 1KWOC 3A4UB 3EG5B 2KQYA 5KTYA 2WCBA 2BCAA 4MZJA 1FI6A 1FI5A 1QX7A 4MN0A 1PVBA 1NYAA 3LK0A 1MXEA 3SG2A
chains in the Genus database with same CATH topology
2LUCA 5CSJA 1KWOB 2BCBA 1NIWA 3SIBA 2JQ6A 2V53A 2LP3A 1L7ZA 3DD4A 2JC2A 1J7OA 2F3YA 4USLA 4CLNA 3FWCA 2WCFA 1AHRA 1KK7Z 1UUSA 4PCWA 1SL8A 3IF7A 2M9GA 1DVIA 1OSAA 1RWYA 2KFGA 2Y1MA 4PE7A 3VRNA 4UPGA 3OP0A 3O6BA 4L9MA 1WDCC 2P6BB 1K9UA 1OQPA 2K7BA 1Q80A 1AUIB 3TZ1A 1QS7A 1N65A 1K8UA 1N0YA 1SL9A 1EJ3A 2Y4QA 1ALVA 1JF2A 1QX5B 1JUOA 3BQ3A 5CSIA 1BODA 1KFXL 2KAVA 3I5GB 3CR2A 1OZOA 2COLB 3VRPA 1MWNA 2B1UA 3BOWA 4NDBA 1H4BA 2L98A 1DGVA 3O2PA 2FOTA 4OCIA 1QASA 1VRKA 1BT6A 1NSHA 5DKQA 1C7WA 1NX1A 1SW8A 3EVVA 1Y1AA 1OE9B 4YGAA 2AUCA 4GGNA 1BR1B 1KSOA 2I94A 3EKJA 1R2UA 2ZN9A 2BKHB 2LMTA 3OX6A 3SG5A 1CM1A 3FS7A 1YX8A 5B8IB 1Y1XA 4NDCA 5HKZA 4ZCVA 2Y5IA 1B9AA 2EHBA 1EL4A 1TNXA 1WY9A 5GQQC 1TIZA 3KHEA 4PE1A 2LCPA 1DJXA 1B8RA 1NCYA 3TDIA 1QLKA 2BKIB 1D1OA 5JOLA 1SCMC 2JT0A 1B47A 5HKWA 1XFXO 3IQOA 2O5GA 3NSOA 2KNEA 2KGBC 2L0PA 1NP8A 3PLFB 4M2QA 1B7TZ 2H2KA 5DKRA 1XFWO 5JJGA 3SJSA 1QJTA 3AAJA 1A2XA 4IL1A 4HRGA 3SG6A 3CGAA 2OTGB 1B8CA 3BXKA 4YGCB 4CFRA 3TUYB 1CFFA 2WORA 2K7CA 1X02A 1XVJA 4CPVA 1MHOA 3CLNA 1CDNA 3ICBA 1IGVA 2H61A 4I5KA 4MRYA 1KQMC 3I5FB 1F54A 1IWQA 4DIRA 1JF0A 1SYMA 4BY5A 5ER5A 1WRZA 3RLZA 1YUUA 1YVLA 2K61A 1KSMA 2M29A 1C07A 4D1EA 1NCXA 4XJKA 3DF0A 1DF0B 1DJZA 2F3ZA 1FF1A 2CBLA 1ZUZA 3KEVA 2LVVA 2AAOA 2MLFC 1E8AA 1J7PA 1RJVA 2L4HA 4JPZB 2NCOA 3FWBA 1S5GZ 2KI4B 4DUQA 1PK0D 2LANA 1RROA 1UHKA 1M31A 3DVJA 1XK4C 3NSKA 2LLTA 2M49B 1MR8A 1IJ5A 1F8HA 3WHTB 1NWDA 2FCEA 2K0JA 3TS5C 2WCEA 2CT9A 1PRWA 2E6WA 5I2QA 5KU1A 1PSRA 2MJWB 3PSRA 1UP5A 1QVIZ 1JSAA 2AMIA 2M7NA 1S6CA 3BUMB 4ZCUA 3I5IC 4MBEA 2L4IA 3DVKA 3VRRA 1OMVA 1KFUS 2HPSA 2BE6A 1K2HA 2L51A 1AJ4A 1SKTA 3I5IB 1A75A 3O4YA 2CNPA 1G8IA 2JXLA 4GNKB 1QVIY 1V1FA 2KDHA 2PALA 1XK4A 2PMYA 4FQOA 1U5IA 1CMGA 5FYXA 4CIDA 1K90D 2FCDA 5I8NA 1PVAA 3DVMA 1TRFA 1YR5A 5HLVA 2IS9A 2JOJA 2OS8B 3SIAA 2LNKA 1CKKA 3JTDB 1QXPA 3I5GC 5D7FA 1XFUO 1UHJA 2BCXA 2KBMA 1YX7A 2KYCA 2ZNEA 1KK7Y 4NDDA 4MZLA 1QATA 4PE4A 1RTP1 4GPLB 4PDZA 5I2OA 2GGMA 1LVCD 2F8PA 1EG3A 1BF5A 4ORAB 5CSNA 1Y6WA 1JFJA 2JT3A 3DVEA 3TDUA 4I5NB 1IJ6A 2L50A 2MAZA 2RGIA 3CS1A 4YGDB 4WRIA 3BUOB 2OPOA 2LHIA 2ZN8A 1FBVA 1TNPA 1XA5A 3EVUA 3SG3A 1JC2A 1IQ3A 4ICBA 1OOJA 1CLBA 4GBAA 2KFFA 1SRAA 2KI6D 1IG5A 2KGRA 3RM1A 1CFPA 3GK1A 4N1FA 3KO0A 2K2AA 5AANA 4NQGA 2JNXA 3BYAA 3LL8B 1Y0VH 2KSPA 4I5LB 4ETOA 1DT7B 2LAPA 2K8MB 5J3XA 4HSZA 4N1GA 4PHKA 1BR4B 3D0YB 4YBHB 2KAYA 1UHHA 1AJ5A 2CTNA 5KSZA 3BUWB 1C7VA 4XYNA 2I18A 1AVSA 3PFVA 3EK7A 2MA2A 2MHHA 4BY4A 2OTGC 5G08A 4PHMA 1F70A 1YUSA 1PULA 2JNFA 1DJIA 1TNQA 3LLEA 4TNCA 3TUYC 1LA3A 3OB1B 2D8NA 1OMRA 1TNWA 1UHIA 2BL0B 3NXAA 1DJWA 3GK2A 3ZNIA 1HT9A 1B1GA 1M63B 1G4YR 1SNLA 4MLWA 4ORCB 3NSLA 1A29A 2K2FA 1B7TY 2NLNA 1BOCA 3I5FC 2JZIA 4OR9B 1M45A 2JWWA 3PM8A 1LXFC 5D69A 2BBNA 1JFKA 2A4JA 3BUXB 1F55A 3PATA 3M0WA 1B8LA 1MQ1A 2KOTA 2WNDA 1YRUB 4HRHA 2MRDA 3K21A 1KFUL 1QIWA 2BE4A 2F33A 3I5HB 2LE9B 4R1EA 4JWQA 1DJGA 2HF5A 2QPTA 4DCKA 1YVHA 1J1EA 1B4CA 2NCPA 1S3PA 2I7AA 2KI4C 1KCYA 3DF0B 1J1DA 4C0LA 4FTGA 2KFHA 2SASA 1YURA 1GGWA 2R2IA 4ORBB 2FJUB 1QLSA 3WXAA 1UHNA 3IQQA 1ZACA 2LVKA 4Q04A 1CM4A 1L2OB 3AKAA 3VRQA 4HREE 2JTTA 4AQIA 1NX2A 4MVFA 3JVTB 5CPVA 3AKBA 1KQVA 1WRLA 2PRUA 4DRWA 1SPYA 3HX4A 1IKUA 2Y1NA 1S5GY 4GFTA 4QJ4B 1RECA 2E30A 4PHNA 1DF0A 1NX3A 1F4QA 1WLZA 4JQ0D 4QJ3B 2PSRA 1S36A 2M8UA 2KYFA 3WHUB 1ZFSA 4PE0A 5AFPA 1K95A 4OVNF 1A4PA 3SG4A 3QRXA 2HQWA 1NX0A 1MXLC 3LK1A 1LA0A 2K7OA 4A4CA 1XFVO 1SBJA 1SCVA 4MSPA 1EXRA 1MUXA 1YUTA 2KBIA 4OV2A 3GK4X 1EG4A 2WC8A 2OS8C 1AP4A 3H4SE 1KK8B 1CLLA 4QJ5B 1CTRA 2KAXA 3JTDC 3WNXB 2LV7A 2M1KB 5AEQA 2LM5A 2EC6B 1LINA 1FPWA 1K94A 1CDMA 3PN7B 4GAOA 1WLMA 3FIAA 4CFQA 1TN4A 3CWGA 5AERA 1CDPA 1SR6B 1XFYO 3CZTX 1XFZO 1H8BA 1SK6D 1BG1A 2JT8A 2LHLA 2LP2A 1QTXA 1SL7A 2M7LA 4P5OE 2SCPA 3BOWB 4GUKA 1J7QA 2ZRSA 1V1GA 1K9PA 4P2YB 5HLOA 5ER4X 4WQ2A 4F0ZB 1CFCA 4AOMA 3OX5A 2O60A 3CTNA 1A03A 1S1EA 3GOFA 2MBXA 2DOQA 1SMGA 1BU3A 1UURA 2G9BA 1WDCB 1NUBA 4YGEB 1M39A 1MF8B 2LLSA 4YRUA 1CMFA 4A4BA 3MSEB 3KPXA 5PALA 2F2PA 2MLEC 5CSFA 1DJYA 1TCFA 3KF9A 3PALA 4OKHA 1ZMZA 2LVJA 1DMOA 4MRXA 1GGZA 1S6JA 2JPTA 4MEWA 1WRKA 2LMUA 1QIVA 2VRGA 1HQVA 1RFJA 1TCOB 2LVIA 3E3RA 2Q4UA 1ALWA 5AXIA 2BL0C 1LKJA 2CXJA 1QV0A 1QV1A 1DTLA 2ZRTA 3EVRA 4AQJA 5F6TA 1K93D 2M1UA 1JWDA 1F4OA 1YTZC 4C0KA 2PVBA 2L5XB 1SY9A 3CR5X 2KQ6A 3C1VA 2H61C 3HCMA 3D0YA 2NXQA 1TTXA 1ZOTB 5HKYA 2BBMA 1PSBA 2ZKMX 3I5HC 1JBAA 4GGFC 1TOPA 1F71A 4MZKA 1KFXS 2F2OA 2GGZA 1NPQA 2LLUA 2KHNA 3CR4X 1QX2A 1OZSA 1SCMB 1IRJA 1BLQA 2G2BA 2JTZA 1GJYA 2LMVA 1J55A 2M3WA 2BECA 5HYDA 1Y1UA 1K9KA 4XJKB 1BMOA 1DJHA 3EKHA 5BPJA 3VROA 2KI6C 2L2EA 1CFDA 1L2OC 4N5XA 4YI9A 1EH2A 1CLMA 1BJFA 1J7RA 1M46A 3ZWHA 3F45A 5IBWA 3JVTC 4YI8A 4WQ3A 1ODBA 2JU0A 3LCPC 2HETA 1W7IB 4PALA 1G33A 4GGFA 1IH0A 2ISDA 3EK4A 2M0RA 2I2RE 2M97A 1KQMB 2LUXA 3TDZA 1R6PA 1OMDA 3NSIA 4M2OA 1CB1A 4C0JA 2TN4A 4M2PA 1W7JB 1GQMA 2NZ0A 2JXCA 1S26D 2LC5A 1S6IA 1K96A 2QACA 1CNPA 1FW4A 1N2DA 1PALA 3D10A 4PHJA 2GV5A 3OHMB 4I5JA 2Q91A 1KK8C 5TNCA 2K7DA 4E68A 3OB2B 1CDLA 2WOSA 2ZFDA 1A75B 2EGDA 3AAKA 3VGOA 2EC6C 1U5IB 1XYDA 4U8DA 3PN7C 1NCZA 1IQ5A 4YGBB 5I2LA 1XO5A 1AK8A 3EK8A 2JULA 2ZNDA 2JRFA 1UWOA 3A8RA 5DKNA 3SG7A 3TS5B 4DS7A 1SR6C 1YRTB 1DGUA 1RK9A 3O78A 5K89A 2PASA 3BUNB 2CCMA 2HQ8A 3A4UB 1KWOC 5KTYA 2KQYA 2WCBA 2BCAA 4MZJA 1FI6A 1FI5A 1QX7A 4MN0A 1PVBA 1NYAA 3LK0A 1MXEA 3SG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LUC A;  5CSJ A;  1KWO B;  2BCB A;  1NIW A;  3SIB A;  2JQ6 A;  2V53 A;  2LP3 A;  1L7Z A;  3DD4 A;  2JC2 A;  1J7O A;  2F3Y A;  4USL A;  4CLN A;  3FWC A;  2WCF A;  1AHR A;  1KK7 Z;  1UUS A;  4PCW A;  1SL8 A;  3IF7 A;  2M9G A;  1DVI A;  1OSA A;  1RWY A;  2KFG A;  2Y1M A;  4PE7 A;  3VRN A;  4UPG A;  3OP0 A;  3O6B A;  4L9M A;  1WDC C;  2P6B B;  1K9U A;  1OQP A;  2K7B A;  1Q80 A;  1AUI B;  3TZ1 A;  1QS7 A;  1N65 A;  1K8U A;  1N0Y A;  1SL9 A;  1EJ3 A;  2Y4Q A;  1ALV A;  1JF2 A;  1QX5 B;  1JUO A;  3BQ3 A;  5CSI A;  1BOD A;  1KFX L;  2KAV A;  3I5G B;  3CR2 A;  1OZO A;  2COL B;  3VRP A;  1MWN A;  2B1U A;  3BOW A;  4NDB A;  1H4B A;  2L98 A;  1DGV A;  3O2P A;  2FOT A;  4OCI A;  1QAS A;  1VRK A;  1BT6 A;  1NSH A;  5DKQ A;  1C7W A;  1NX1 A;  1SW8 A;  3EVV A;  1Y1A A;  1OE9 B;  4YGA A;  2AUC A;  4GGN A;  1BR1 B;  1KSO A;  2I94 A;  3EKJ A;  1R2U A;  2ZN9 A;  2BKH B;  2LMT A;  3OX6 A;  3SG5 A;  1CM1 A;  3FS7 A;  1YX8 A;  5B8I B;  1Y1X A;  4NDC A;  5HKZ A;  4ZCV A;  2Y5I A;  1B9A A;  2EHB A;  1EL4 A;  1TNX A;  1WY9 A;  5GQQ C;  1TIZ A;  3KHE A;  4PE1 A;  2LCP A;  1DJX A;  1B8R A;  1NCY A;  3TDI A;  1QLK A;  2BKI B;  1D1O A;  5JOL A;  1SCM C;  2JT0 A;  1B47 A;  5HKW A;  1XFX O;  3IQO A;  2O5G A;  3NSO A;  2KNE A;  2KGB C;  2L0P A;  1NP8 A;  3PLF B;  4M2Q A;  1B7T Z;  2H2K A;  5DKR A;  1XFW O;  5JJG A;  3SJS A;  1QJT A;  3AAJ A;  1A2X A;  4IL1 A;  4HRG A;  3SG6 A;  3CGA A;  2OTG B;  1B8C A;  3BXK A;  4YGC B;  4CFR A;  3TUY B;  1CFF A;  2WOR A;  2K7C A;  1X02 A;  1XVJ A;  4CPV A;  1MHO A;  3CLN A;  1CDN A;  3ICB A;  1IGV A;  2H61 A;  4I5K A;  4MRY A;  1KQM C;  3I5F B;  1F54 A;  1IWQ A;  4DIR A;  1JF0 A;  1SYM A;  4BY5 A;  5ER5 A;  1WRZ A;  3RLZ A;  1YUU A;  1YVL A;  2K61 A;  1KSM A;  2M29 A;  1C07 A;  4D1E A;  1NCX A;  4XJK A;  3DF0 A;  1DF0 B;  1DJZ A;  2F3Z A;  1FF1 A;  2CBL A;  1ZUZ A;  3KEV A;  2LVV A;  2AAO A;  2MLF C;  1E8A A;  1J7P A;  1RJV A;  2L4H A;  4JPZ B;  2NCO A;  3FWB A;  1S5G Z;  2KI4 B;  4DUQ A;  1PK0 D;  2LAN A;  1RRO A;  1UHK A;  1M31 A;  3DVJ A;  1XK4 C;  3NSK A;  2LLT A;  2M49 B;  1MR8 A;  1IJ5 A;  1F8H A;  3WHT B;  1NWD A;  2FCE A;  2K0J A;  3TS5 C;  2WCE A;  2CT9 A;  1PRW A;  2E6W A;  5I2Q A;  5KU1 A;  1PSR A;  2MJW B;  3PSR A;  1UP5 A;  1QVI Z;  1JSA A;  2AMI A;  2M7N A;  1S6C A;  3BUM B;  4ZCU A;  3I5I C;  4MBE A;  2L4I A;  3DVK A;  3VRR A;  1OMV A;  1KFU S;  2HPS A;  2BE6 A;  1K2H A;  2L51 A;  1AJ4 A;  1SKT A;  3I5I B;  1A75 A;  3O4Y A;  2CNP A;  1G8I A;  2JXL A;  4GNK B;  1QVI Y;  1V1F A;  2KDH A;  2PAL A;  1XK4 A;  2PMY A;  4FQO A;  1U5I A;  1CMG A;  5FYX A;  4CID A;  1K90 D;  2FCD A;  5I8N A;  1PVA A;  3DVM A;  1TRF A;  1YR5 A;  5HLV A;  2IS9 A;  2JOJ A;  2OS8 B;  3SIA A;  2LNK A;  1CKK A;  3JTD B;  1QXP A;  3I5G C;  5D7F A;  1XFU O;  1UHJ A;  2BCX A;  2KBM A;  1YX7 A;  2KYC A;  2ZNE A;  1KK7 Y;  4NDD A;  4MZL A;  1QAT A;  4PE4 A;  1RTP 1;  4GPL B;  4PDZ A;  5I2O A;  2GGM A;  1LVC D;  2F8P A;  1EG3 A;  1BF5 A;  4ORA B;  5CSN A;  1Y6W A;  1JFJ A;  2JT3 A;  3DVE A;  3TDU A;  4I5N B;  1IJ6 A;  2L50 A;  2MAZ A;  2RGI A;  3CS1 A;  4YGD B;  4WRI A;  3BUO B;  2OPO A;  2LHI A;  2ZN8 A;  1FBV A;  1TNP A;  1XA5 A;  3EVU A;  3SG3 A;  1JC2 A;  1IQ3 A;  4ICB A;  1OOJ A;  1CLB A;  4GBA A;  2KFF A;  1SRA A;  2KI6 D;  1IG5 A;  2KGR A;  3RM1 A;  1CFP A;  3GK1 A;  4N1F A;  3KO0 A;  2K2A A;  5AAN A;  4NQG A;  2JNX A;  3BYA A;  3LL8 B;  1Y0V H;  2KSP A;  4I5L B;  4ETO A;  1DT7 B;  2LAP A;  2K8M B;  5J3X A;  4HSZ A;  4N1G A;  4PHK A;  1BR4 B;  3D0Y B;  4YBH B;  2KAY A;  1UHH A;  1AJ5 A;  2CTN A;  5KSZ A;  3BUW B;  1C7V A;  4XYN A;  2I18 A;  1AVS A;  3PFV A;  3EK7 A;  2MA2 A;  2MHH A;  4BY4 A;  2OTG C;  5G08 A;  4PHM A;  1F70 A;  1YUS A;  1PUL A;  2JNF A;  1DJI A;  1TNQ A;  3LLE A;  4TNC A;  3TUY C;  1LA3 A;  3OB1 B;  2D8N A;  1OMR A;  1TNW A;  1UHI A;  2BL0 B;  3NXA A;  1DJW A;  3GK2 A;  3ZNI A;  1HT9 A;  1B1G A;  1M63 B;  1G4Y R;  1SNL A;  4MLW A;  4ORC B;  3NSL A;  1A29 A;  2K2F A;  1B7T Y;  2NLN A;  1BOC A;  3I5F C;  2JZI A;  4OR9 B;  1M45 A;  2JWW A;  3PM8 A;  1LXF C;  5D69 A;  2BBN A;  1JFK A;  2A4J A;  3BUX B;  1F55 A;  3PAT A;  3M0W A;  1B8L A;  1MQ1 A;  2KOT A;  2WND A;  1YRU B;  4HRH A;  2MRD A;  3K21 A;  1KFU L;  1QIW A;  2BE4 A;  2F33 A;  3I5H B;  2LE9 B;  4R1E A;  4JWQ A;  1DJG A;  2HF5 A;  2QPT A;  4DCK A;  1YVH A;  1J1E A;  1B4C A;  2NCP A;  1S3P A;  2I7A A;  2KI4 C;  1KCY A;  3DF0 B;  1J1D A;  4C0L A;  4FTG A;  2KFH A;  2SAS A;  1YUR A;  1GGW A;  2R2I A;  4ORB B;  2FJU B;  1QLS A;  3WXA A;  1UHN A;  3IQQ A;  1ZAC A;  2LVK A;  4Q04 A;  1CM4 A;  1L2O B;  3AKA A;  3VRQ A;  4HRE E;  2JTT A;  4AQI A;  1NX2 A;  4MVF A;  3JVT B;  5CPV A;  3AKB A;  1KQV A;  1WRL A;  2PRU A;  4DRW A;  1SPY A;  3HX4 A;  1IKU A;  2Y1N A;  1S5G Y;  4GFT A;  4QJ4 B;  1REC A;  2E30 A;  4PHN A;  1DF0 A;  1NX3 A;  1F4Q A;  1WLZ A;  4JQ0 D;  4QJ3 B;  2PSR A;  1S36 A;  2M8U A;  2KYF A;  3WHU B;  1ZFS A;  4PE0 A;  5AFP A;  1K95 A;  4OVN F;  1A4P A;  3SG4 A;  3QRX A;  2HQW A;  1NX0 A;  1MXL C;  3LK1 A;  1LA0 A;  2K7O A;  4A4C A;  1XFV O;  1SBJ A;  1SCV A;  4MSP A;  1EXR A;  1MUX A;  1YUT A;  2KBI A;  4OV2 A;  3GK4 X;  1EG4 A;  2WC8 A;  2OS8 C;  1AP4 A;  3H4S E;  1KK8 B;  1CLL A;  4QJ5 B;  1CTR A;  2KAX A;  3JTD C;  3WNX B;  2LV7 A;  2M1K B;  5AEQ A;  2LM5 A;  2EC6 B;  1LIN A;  1FPW A;  1K94 A;  1CDM A;  3PN7 B;  4GAO A;  1WLM A;  3FIA A;  4CFQ A;  1TN4 A;  3CWG A;  5AER A;  1CDP A;  1SR6 B;  1XFY O;  3CZT X;  1XFZ O;  1H8B A;  1SK6 D;  1BG1 A;  2JT8 A;  2LHL A;  2LP2 A;  1QTX A;  1SL7 A;  2M7L A;  4P5O E;  2SCP A;  3BOW B;  4GUK A;  1J7Q A;  2ZRS A;  1V1G A;  1K9P A;  4P2Y B;  5HLO A;  5ER4 X;  4WQ2 A;  4F0Z B;  1CFC A;  4AOM A;  3OX5 A;  2O60 A;  3CTN A;  1A03 A;  1S1E A;  3GOF A;  2MBX A;  2DOQ A;  1SMG A;  1BU3 A;  1UUR A;  2G9B A;  1WDC B;  1NUB A;  4YGE B;  1M39 A;  1MF8 B;  2LLS A;  4YRU A;  1CMF A;  4A4B A;  3MSE B;  3KPX A;  5PAL A;  2F2P A;  2MLE C;  5CSF A;  1DJY A;  1TCF A;  3KF9 A;  3PAL A;  4OKH A;  1ZMZ A;  2LVJ A;  1DMO A;  4MRX A;  1GGZ A;  1S6J A;  2JPT A;  4MEW A;  1WRK A;  2LMU A;  1QIV A;  2VRG A;  1HQV A;  1RFJ A;  1TCO B;  2LVI A;  3E3R A;  2Q4U A;  1ALW A;  5AXI A;  2BL0 C;  1LKJ A;  2CXJ A;  1QV0 A;  1QV1 A;  1DTL A;  2ZRT A;  3EVR A;  4AQJ A;  5F6T A;  1K93 D;  2M1U A;  1JWD A;  1F4O A;  1YTZ C;  4C0K A;  2PVB A;  2L5X B;  1SY9 A;  3CR5 X;  2KQ6 A;  3C1V A;  2H61 C;  3HCM A;  3D0Y A;  2NXQ A;  1TTX A;  1ZOT B;  5HKY A;  2BBM A;  1PSB A;  2ZKM X;  3I5H C;  1JBA A;  4GGF C;  1TOP A;  1F71 A;  4MZK A;  1KFX S;  2F2O A;  2GGZ A;  1NPQ A;  2LLU A;  2KHN A;  3CR4 X;  1QX2 A;  1OZS A;  1SCM B;  1IRJ A;  1BLQ A;  2G2B A;  2JTZ A;  1GJY A;  2LMV A;  1J55 A;  2M3W A;  2BEC A;  5HYD A;  1Y1U A;  1K9K A;  4XJK B;  1BMO A;  1DJH A;  3EKH A;  5BPJ A;  3VRO A;  2KI6 C;  2L2E A;  1CFD A;  1L2O C;  4N5X A;  4YI9 A;  1EH2 A;  1CLM A;  1BJF A;  1J7R A;  1M46 A;  3ZWH A;  3F45 A;  5IBW A;  3JVT C;  4YI8 A;  4WQ3 A;  1ODB A;  2JU0 A;  3LCP C;  2HET A;  1W7I B;  4PAL A;  1G33 A;  4GGF A;  1IH0 A;  2ISD A;  3EK4 A;  2M0R A;  2I2R E;  2M97 A;  1KQM B;  2LUX A;  3TDZ A;  1R6P A;  1OMD A;  3NSI A;  4M2O A;  1CB1 A;  4C0J A;  2TN4 A;  4M2P A;  1W7J B;  1GQM A;  2NZ0 A;  2JXC A;  1S26 D;  2LC5 A;  1S6I A;  1K96 A;  2QAC A;  1CNP A;  1FW4 A;  1N2D A;  1PAL A;  3D10 A;  4PHJ A;  2GV5 A;  3OHM B;  4I5J A;  2Q91 A;  1KK8 C;  5TNC A;  2K7D A;  4E68 A;  3OB2 B;  1CDL A;  2WOS A;  2ZFD A;  1A75 B;  2EGD A;  3AAK A;  3VGO A;  2EC6 C;  1U5I B;  1XYD A;  4U8D A;  3PN7 C;  1NCZ A;  1IQ5 A;  4YGB B;  5I2L A;  1XO5 A;  1AK8 A;  3EK8 A;  2JUL A;  2ZND A;  2JRF A;  1UWO A;  3A8R A;  5DKN A;  3SG7 A;  3TS5 B;  4DS7 A;  1SR6 C;  1YRT B;  1DGU A;  1RK9 A;  3O78 A;  5K89 A;  2PAS A;  3BUN B;  2CCM A;  2HQ8 A;  3A4U B;  1KWO C;  5KTY A;  2KQY A;  2WCB A;  2BCA A;  4MZJ A;  1FI6 A;  1FI5 A;  1QX7 A;  4MN0 A;  1PVB A;  1NYA A;  3LK0 A;  1MXE A;  3SG2 A; 
#chains in the Genus database with same CATH topology
 2LUC A;  5CSJ A;  1KWO B;  2BCB A;  2WCH A;  1NIW A;  3R1P A;  2JQ6 A;  2V53 A;  2LP3 A;  1L7Z A;  3SIB A;  3DD4 A;  2JC2 A;  3D74 A;  2F3Y A;  4USL A;  1J7O A;  4CLN A;  3FWC A;  2WCF A;  1AHR A;  1KK7 Z;  1UUS A;  4PCW A;  1SL8 A;  1C3Z A;  3IF7 A;  3OBV A;  2M9G A;  1DVI A;  1OSA A;  1RWY A;  2KFG A;  2Y1M A;  4PE7 A;  3VRN A;  2H8V A;  3OP0 A;  4UPG A;  3O6B A;  3B88 A;  4L9M A;  1WDC C;  2P6B B;  1K9U A;  1OQP A;  2K7B A;  1Q80 A;  1AUI B;  3TZ1 A;  1QS7 A;  1N65 A;  1K8U A;  1N0Y A;  1SL9 A;  1EJ3 A;  2Y4Q A;  1ALV A;  1JF2 A;  1QX5 B;  1JUO A;  3BQ3 A;  4PT1 A;  5CSI A;  1BOD A;  1KFX L;  2KAV A;  4INW A;  3I5G B;  3CR2 A;  1OZO A;  2COL B;  3VRP A;  1MWN A;  2B1U A;  3BOW A;  4NDB A;  1H4B A;  2L98 A;  1DGV A;  3O2P A;  2FOT A;  4OCI A;  1QAS A;  1VRK A;  1BT6 A;  1NSH A;  5DKQ A;  1C7W A;  1NX1 A;  1SW8 A;  3EVV A;  1Y1A A;  1OE9 B;  4YGA A;  2AUC A;  4GGN A;  1BR1 B;  1KSO A;  2I94 A;  3EKJ A;  3D77 A;  1R2U A;  2ZN9 A;  2BKH B;  2LMT A;  3OX6 A;  3SG5 A;  2ERB A;  1CM1 A;  3FS7 A;  1YX8 A;  5B8I B;  1Y1X A;  4NDC A;  5HKZ A;  3FE6 A;  4ZCV A;  2Y5I A;  1B9A A;  2EHB A;  1EL4 A;  3BFH A;  3VB1 A;  1TNX A;  2KLD A;  1WY9 A;  5GQQ C;  1TIZ A;  3KHE A;  4PE1 A;  2LCP A;  1DJX A;  1B8R A;  1NCY A;  3TDI A;  2L5Y A;  1QLK A;  2BKI B;  1D1O A;  5JOL A;  1SCM C;  2JT0 A;  1B47 A;  3B86 A;  1XFX O;  5HKW A;  3IQO A;  3S0E A;  2O5G A;  3NSO A;  2KNE A;  2KGB C;  2L0P A;  1NP8 A;  3PLF B;  4M2Q A;  5FI2 A;  1B7T Z;  2H2K A;  5DKR A;  1XFW O;  5JJG A;  3SJS A;  1TUZ A;  1QJT A;  3AAJ A;  1A2X A;  2P70 A;  4IL1 A;  2BNX A;  4HRG A;  3CGA A;  2OTG B;  1B8C A;  2KLE A;  3BXK A;  3SG6 A;  4YGC B;  4CFR A;  3TUY B;  1CFF A;  2WOR A;  2K7C A;  1X02 A;  1XVJ A;  4CPV A;  1MHO A;  3CLN A;  3Q8I A;  1CDN A;  3ICB A;  1IGV A;  2H61 A;  4I5K A;  4MRY A;  5FI7 A;  1KQM C;  3I5F B;  1ORG A;  1F54 A;  1IWQ A;  4DIR A;  1JF0 A;  1SYM A;  4BY5 A;  5ER5 A;  1WRZ A;  3FE9 A;  3RLZ A;  1YUU A;  3RZS A;  1YVL A;  3B7A A;  2K61 A;  1KSM A;  2QEV A;  2M29 A;  1C07 A;  4D1E A;  1NCX A;  4XJK A;  3DF0 A;  1DF0 B;  1DJZ A;  2F3Z A;  1FF1 A;  2CBL A;  1ZUZ A;  5DIC A;  3KEV A;  2LVV A;  2AAO A;  2MLF C;  1E8A A;  2GTE A;  1RJV A;  2L4H A;  1J7P A;  4JPZ B;  2NCO A;  3FWB A;  1S5G Z;  2KI4 B;  4DUQ A;  1PK0 D;  2LAN A;  1RRO A;  1UHK A;  1M31 A;  2WCL A;  3DVJ A;  3D78 A;  1XK4 C;  3NSK A;  2LLT A;  2M49 B;  1MR8 A;  1IJ5 A;  1F8H A;  3WHT B;  1C3Y A;  1NWD A;  2FCE A;  2K0J A;  3TS5 C;  2WCE A;  2CT9 A;  1PRW A;  2E6W A;  5I2Q A;  5KU1 A;  1PSR A;  2MJW B;  3PSR A;  1UP5 A;  1QVI Z;  5EL2 A;  2AMI A;  1JSA A;  1OOI X;  2M7N A;  3K1E A;  1S6C A;  3BUM B;  4ZCU A;  3I5I C;  3FE8 A;  4MBE A;  2L4I A;  3DVK A;  3VRR A;  1OMV A;  1KFU S;  2HPS A;  2BE6 A;  1K2H A;  2L51 A;  1AJ4 A;  1SKT A;  3I5I B;  1A75 A;  3O4Y A;  2CNP A;  1G8I A;  2JXL A;  4GNK B;  1QVI Y;  1V1F A;  2KDH A;  2PAL A;  1XK4 A;  2PMY A;  4FQO A;  1U5I A;  1CMG A;  5FYX A;  4CID A;  1K90 D;  2FCD A;  5I8N A;  1PVA A;  3DVM A;  1TRF A;  1YR5 A;  3BFA A;  4KYN A;  5HLV A;  2IS9 A;  2JOJ A;  2OS8 B;  3SIA A;  3SS4 A;  2LNK A;  1CKK A;  5I94 A;  3JTD B;  1QXP A;  3QME A;  3I5G C;  5D7F A;  1XFU O;  1UHJ A;  2BCX A;  2KBM A;  1YX7 A;  2KYC A;  2ZNE A;  1KK7 Y;  3BJH A;  4NDD A;  2FJY A;  1QAT A;  4MZL A;  4PE4 A;  1RTP 1;  3IVT A;  4GPL B;  4PDZ A;  1W9Z A;  5I2O A;  2GGM A;  1LVC D;  2F8P A;  2WC5 A;  1IIO A;  1EG3 A;  1QWV A;  1BF5 A;  4ORA B;  5CSN A;  1Y6W A;  1JFJ A;  1OOG A;  2JT3 A;  3NHI A;  3DVE A;  3TDU A;  1XFR A;  4I5N B;  1IJ6 A;  2L50 A;  2MAZ A;  2RGI A;  3CS1 A;  4YGD B;  4WRI A;  3BUO B;  2OPO A;  2LHI A;  2ZN8 A;  1FBV A;  1TNP A;  1XA5 A;  3EVU A;  3S0G A;  3SG3 A;  1IQ3 A;  1JC2 A;  4ICB A;  1OOJ A;  1Z2C B;  1CLB A;  4GBA A;  2KFF A;  1SRA A;  2KI6 D;  1IG5 A;  2KGR A;  3RM1 A;  1CFP A;  3GK1 A;  4N1F A;  3KO0 A;  3SS5 A;  2K2A A;  5AAN A;  4HRH A;  4NQG A;  1DC1 A;  3L4L A;  2JNX A;  3BYA A;  3LL8 B;  1Y0V H;  2KSP A;  4I5L B;  4ETO A;  1DT7 B;  2LAP A;  2K8M B;  5J3X A;  4HSZ A;  4N1G A;  4PHK A;  1BR4 B;  3D0Y B;  4YBH B;  1DEK A;  1Z4H A;  1UHH A;  2KAY A;  1AJ5 A;  3UNW A;  2CTN A;  5KSZ A;  1TWO A;  3BUW B;  4XYN A;  1C7V A;  2I18 A;  1AVS A;  3PFV A;  3EK7 A;  3SS3 A;  1DQE A;  2MA2 A;  2MHH A;  4BY4 A;  2OTG C;  5G08 A;  4PHM A;  1F70 A;  1YUS A;  1PUL A;  2JNF A;  1DJI A;  1TNQ A;  3LLE A;  4TNC A;  3TUY C;  1LA3 A;  3OB1 B;  2D8N A;  1OMR A;  1TNW A;  1UHI A;  2BL0 B;  3NXA A;  1DJW A;  3S0B A;  3GK2 A;  3ZNI A;  1HT9 A;  1B1G A;  1M63 B;  1G4Y R;  1SNL A;  4MLW A;  4ORC B;  3O4X A;  3NSL A;  1OW4 A;  1A29 A;  2K2F A;  1B7T Y;  2KPH A;  2NLN A;  3S0A A;  3I5F C;  1BOC A;  2JPO A;  4OZD A;  2JZI A;  4OR9 B;  1M45 A;  2JWW A;  2QEO A;  3PM8 A;  1LXF C;  2K60 A;  5D69 A;  2BBN A;  1JFK A;  2A4J A;  3BUX B;  1F55 A;  3PAT A;  3M0W A;  1B8L A;  1MQ1 A;  1OOF A;  2KOT A;  1YRU B;  2WND A;  2MRD A;  3K21 A;  1KFU L;  1QIW A;  2BE4 A;  2F33 A;  3I5H B;  2LE9 B;  3N7H A;  4R1E A;  4JWQ A;  1DJG A;  2HF5 A;  3PJI A;  2QPT A;  4DCK A;  1YVH A;  1J1E A;  1B4C A;  2NCP A;  1S3P A;  2I7A A;  2KI4 C;  1KCY A;  4F7F A;  3DF0 B;  2PYQ A;  1J1D A;  4C0L A;  4FTG A;  2KFH A;  2SAS A;  1YUR A;  1GGW A;  2R2I A;  4ORB B;  2FJU B;  1QLS A;  3WXA A;  1UHN A;  3IQQ A;  1ZAC A;  2LVK A;  4Q04 A;  1CM4 A;  1L2O B;  3AKA A;  3VRQ A;  4HRE E;  1T14 A;  2JTT A;  4AQI A;  1NX2 A;  4MVF A;  3JVT B;  5CPV A;  3AKB A;  1KQV A;  1WRL A;  2PRU A;  1LS8 A;  3DY9 A;  4DRW A;  1SPY A;  3HX4 A;  1IKU A;  2Y1N A;  1S5G Y;  4GFT A;  4QJ4 B;  2WCK A;  1REC A;  2E30 A;  4PHN A;  1DF0 A;  1NX3 A;  1F4Q A;  1WLZ A;  4JQ0 D;  4QJ3 B;  2PSR A;  1S36 A;  2M8U A;  2KYF A;  3WHU B;  1ZFS A;  4PE0 A;  5AFP A;  1K95 A;  4OVN F;  1A4P A;  3OGN A;  3SG4 A;  2BAP A;  3QRX A;  2HQW A;  1NX0 A;  1MXL C;  3LK1 A;  3R1V A;  1LA0 A;  2K7O A;  4A4C A;  1XFV O;  3R1O A;  1SBJ A;  1SCV A;  4MSP A;  1EXR A;  1MUX A;  1YUT A;  2KBI A;  4OV2 A;  3GK4 X;  1EG4 A;  2WC8 A;  2OS8 C;  1AP4 A;  3H4S E;  1KK8 B;  1CLL A;  4IJ7 A;  4QJ5 B;  1OOH A;  1CTR A;  2KAX A;  3JTD C;  3WNX B;  2LV7 A;  2M1K B;  3CZ0 A;  5AEQ A;  2LM5 A;  2EC6 B;  1LIN A;  1FPW A;  1K94 A;  1CDM A;  3PN7 B;  4GAO A;  1WLM A;  3FIA A;  2WCJ A;  4CFQ A;  1TN4 A;  3CWG A;  5AER A;  1CDP A;  1SR6 B;  1XFY O;  3CZT X;  3V2L A;  1XFZ O;  1H8B A;  1SK6 D;  1BG1 A;  1SSE B;  2JT8 A;  2LHL A;  2LP2 A;  3CAB A;  1QTX A;  1SL7 A;  3BFB A;  2M7L A;  4P5O E;  2SCP A;  3BOW B;  4GUK A;  1J7Q A;  2ZRS A;  1V1G A;  1K9P A;  4P2Y B;  5HLO A;  5ER4 X;  4WQ2 A;  3CYZ A;  4F0Z B;  1CFC A;  4AOM A;  3OX5 A;  4INX A;  2O60 A;  4FQT A;  3CTN A;  1A03 A;  1S1E A;  3GOF A;  2MBX A;  2DOQ A;  1SMG A;  1UUR A;  1BU3 A;  2G9B A;  3UO9 A;  1WDC B;  1NUB A;  2P71 A;  2QDI A;  4YGE B;  5D3O A;  2WCM A;  1M39 A;  1MF8 B;  2LLS A;  3S0D A;  4YRU A;  1CMF A;  4A4B A;  3MSE B;  3KPX A;  5PAL A;  2F2P A;  2MLE C;  3CDN A;  5CSF A;  1DJY A;  1TCF A;  3KF9 A;  3PAL A;  3PM2 A;  4OKH A;  1ZMZ A;  2LVJ A;  2YGU A;  1DMO A;  4MRX A;  1GGZ A;  1S6J A;  2JPT A;  4MEW A;  1WRK A;  2LMU A;  1QIV A;  2VRG A;  1HQV A;  1RFJ A;  1TCO B;  3S0F A;  2LVI A;  3E3R A;  2Q4U A;  1ALW A;  3B87 A;  5AXI A;  2BL0 C;  1LKJ A;  2CXJ A;  1QV0 A;  1QV1 A;  1DTL A;  2ZRT A;  3EVR A;  4AQJ A;  5F6T A;  1K93 D;  2M1U A;  1JWD A;  1F4O A;  1YTZ C;  4C0K A;  2PVB A;  2L5X B;  5FI6 A;  1SY9 A;  3CR5 X;  2KQ6 A;  3C1V A;  2H61 C;  4JD9 A;  3HCM A;  3D0Y A;  2L2C A;  2NXQ A;  1TTX A;  1ZOT B;  5HKY A;  2BBM A;  1PSB A;  2ZKM X;  3I5H C;  1JBA A;  4GGF C;  1TOP A;  1F71 A;  4MZK A;  1KFX S;  1GM0 A;  2F2O A;  2GGZ A;  1NPQ A;  2LLU A;  2KHN A;  3NHT A;  3CR4 X;  1QX2 A;  1OZS A;  1SCM B;  3CZ2 A;  1IRJ A;  1BLQ A;  3DYE A;  2G2B A;  2JTZ A;  1GJY A;  2LMV A;  1J55 A;  2M3W A;  2BEC A;  2QEB A;  5HYD A;  1Y1U A;  1K9K A;  4XJK B;  1BMO A;  1DJH A;  3EKH A;  5BPJ A;  3VRO A;  2KI6 C;  2L2E A;  1CFD A;  1L2O C;  4N5X A;  4YI9 A;  1EH2 A;  1CLM A;  1BJF A;  1J7R A;  1M46 A;  3ZWH A;  3F45 A;  5IBW A;  3JVT C;  4YI8 A;  4WQ3 A;  3L4A A;  1DEL A;  1ODB A;  2JU0 A;  3LCP C;  2HET A;  1W7I B;  4PAL A;  1G33 A;  4GGF A;  1IH0 A;  2ISD A;  3EK4 A;  2M0R A;  2I2R E;  2M97 A;  1KQM B;  3L47 A;  2LUX A;  3TDZ A;  1R6P A;  1OMD A;  2WC6 A;  3NSI A;  4M2O A;  1CB1 A;  3DZT A;  2TN4 A;  4M2P A;  4C0J A;  1W7J B;  1GQM A;  2NZ0 A;  2JXC A;  1S26 D;  1TUJ A;  1S6I A;  2LC5 A;  2QEH A;  1K96 A;  2QAC A;  5HL1 A;  3D73 A;  1CNP A;  1FW4 A;  1N2D A;  1PAL A;  3D10 A;  4PHJ A;  2GV5 A;  3B6X A;  3DXL A;  3OHM B;  4I5J A;  2Q91 A;  1KK8 C;  5TNC A;  2K7D A;  4E68 A;  3OB2 B;  1CDL A;  3CZ1 A;  2WOS A;  2ZFD A;  1A75 B;  2EGD A;  3AAK A;  3VGO A;  2EC6 C;  3D75 A;  1U5I B;  1XYD A;  4U8D A;  3PN7 C;  1NCZ A;  1IQ5 A;  4YGB B;  3D76 A;  5I2L A;  1XO5 A;  1AK8 A;  3EK8 A;  2JUL A;  2ZND A;  2JRF A;  1UWO A;  3A8R A;  5DKN A;  3SG7 A;  4JKT A;  3TS5 B;  1SR6 C;  3NGV A;  4DS7 A;  1YRT B;  1DGU A;  1RK9 A;  3O78 A;  5K89 A;  2PAS A;  3BUN B;  2CCM A;  2PQL A;  3R72 A;  2HQ8 A;  1P28 A;  1KWO C;  3A4U B;  3EG5 B;  2KQY A;  5KTY A;  2WCB A;  2BCA A;  4MZJ A;  1FI6 A;  1FI5 A;  1QX7 A;  4MN0 A;  1PVB A;  1NYA A;  3LK0 A;  1MXE A;  3SG2 A; 
#chains in the Genus database with same CATH homology
 2LUC A;  5CSJ A;  1KWO B;  2BCB A;  1NIW A;  3SIB A;  2JQ6 A;  2V53 A;  2LP3 A;  1L7Z A;  3DD4 A;  2JC2 A;  1J7O A;  2F3Y A;  4USL A;  4CLN A;  3FWC A;  2WCF A;  1AHR A;  1KK7 Z;  1UUS A;  4PCW A;  1SL8 A;  3IF7 A;  2M9G A;  1DVI A;  1OSA A;  1RWY A;  2KFG A;  2Y1M A;  4PE7 A;  3VRN A;  4UPG A;  3OP0 A;  3O6B A;  4L9M A;  1WDC C;  2P6B B;  1K9U A;  1OQP A;  2K7B A;  1Q80 A;  1AUI B;  3TZ1 A;  1QS7 A;  1N65 A;  1K8U A;  1N0Y A;  1SL9 A;  1EJ3 A;  2Y4Q A;  1ALV A;  1JF2 A;  1QX5 B;  1JUO A;  3BQ3 A;  5CSI A;  1BOD A;  1KFX L;  2KAV A;  3I5G B;  3CR2 A;  1OZO A;  2COL B;  3VRP A;  1MWN A;  2B1U A;  3BOW A;  4NDB A;  1H4B A;  2L98 A;  1DGV A;  3O2P A;  2FOT A;  4OCI A;  1QAS A;  1VRK A;  1BT6 A;  1NSH A;  5DKQ A;  1C7W A;  1NX1 A;  1SW8 A;  3EVV A;  1Y1A A;  1OE9 B;  4YGA A;  2AUC A;  4GGN A;  1BR1 B;  1KSO A;  2I94 A;  3EKJ A;  1R2U A;  2ZN9 A;  2BKH B;  2LMT A;  3OX6 A;  3SG5 A;  1CM1 A;  3FS7 A;  1YX8 A;  5B8I B;  1Y1X A;  4NDC A;  5HKZ A;  4ZCV A;  2Y5I A;  1B9A A;  2EHB A;  1EL4 A;  1TNX A;  1WY9 A;  5GQQ C;  1TIZ A;  3KHE A;  4PE1 A;  2LCP A;  1DJX A;  1B8R A;  1NCY A;  3TDI A;  1QLK A;  2BKI B;  1D1O A;  5JOL A;  1SCM C;  2JT0 A;  1B47 A;  5HKW A;  1XFX O;  3IQO A;  2O5G A;  3NSO A;  2KNE A;  2KGB C;  2L0P A;  1NP8 A;  3PLF B;  4M2Q A;  1B7T Z;  2H2K A;  5DKR A;  1XFW O;  5JJG A;  3SJS A;  1QJT A;  3AAJ A;  1A2X A;  4IL1 A;  4HRG A;  3SG6 A;  3CGA A;  2OTG B;  1B8C A;  3BXK A;  4YGC B;  4CFR A;  3TUY B;  1CFF A;  2WOR A;  2K7C A;  1X02 A;  1XVJ A;  4CPV A;  1MHO A;  3CLN A;  1CDN A;  3ICB A;  1IGV A;  2H61 A;  4I5K A;  4MRY A;  1KQM C;  3I5F B;  1F54 A;  1IWQ A;  4DIR A;  1JF0 A;  1SYM A;  4BY5 A;  5ER5 A;  1WRZ A;  3RLZ A;  1YUU A;  1YVL A;  2K61 A;  1KSM A;  2M29 A;  1C07 A;  4D1E A;  1NCX A;  4XJK A;  3DF0 A;  1DF0 B;  1DJZ A;  2F3Z A;  1FF1 A;  2CBL A;  1ZUZ A;  3KEV A;  2LVV A;  2AAO A;  2MLF C;  1E8A A;  1J7P A;  1RJV A;  2L4H A;  4JPZ B;  2NCO A;  3FWB A;  1S5G Z;  2KI4 B;  4DUQ A;  1PK0 D;  2LAN A;  1RRO A;  1UHK A;  1M31 A;  3DVJ A;  1XK4 C;  3NSK A;  2LLT A;  2M49 B;  1MR8 A;  1IJ5 A;  1F8H A;  3WHT B;  1NWD A;  2FCE A;  2K0J A;  3TS5 C;  2WCE A;  2CT9 A;  1PRW A;  2E6W A;  5I2Q A;  5KU1 A;  1PSR A;  2MJW B;  3PSR A;  1UP5 A;  1QVI Z;  1JSA A;  2AMI A;  2M7N A;  1S6C A;  3BUM B;  4ZCU A;  3I5I C;  4MBE A;  2L4I A;  3DVK A;  3VRR A;  1OMV A;  1KFU S;  2HPS A;  2BE6 A;  1K2H A;  2L51 A;  1AJ4 A;  1SKT A;  3I5I B;  1A75 A;  3O4Y A;  2CNP A;  1G8I A;  2JXL A;  4GNK B;  1QVI Y;  1V1F A;  2KDH A;  2PAL A;  1XK4 A;  2PMY A;  4FQO A;  1U5I A;  1CMG A;  5FYX A;  4CID A;  1K90 D;  2FCD A;  5I8N A;  1PVA A;  3DVM A;  1TRF A;  1YR5 A;  5HLV A;  2IS9 A;  2JOJ A;  2OS8 B;  3SIA A;  2LNK A;  1CKK A;  3JTD B;  1QXP A;  3I5G C;  5D7F A;  1XFU O;  1UHJ A;  2BCX A;  2KBM A;  1YX7 A;  2KYC A;  2ZNE A;  1KK7 Y;  4NDD A;  4MZL A;  1QAT A;  4PE4 A;  1RTP 1;  4GPL B;  4PDZ A;  5I2O A;  2GGM A;  1LVC D;  2F8P A;  1EG3 A;  1BF5 A;  4ORA B;  5CSN A;  1Y6W A;  1JFJ A;  2JT3 A;  3DVE A;  3TDU A;  4I5N B;  1IJ6 A;  2L50 A;  2MAZ A;  2RGI A;  3CS1 A;  4YGD B;  4WRI A;  3BUO B;  2OPO A;  2LHI A;  2ZN8 A;  1FBV A;  1TNP A;  1XA5 A;  3EVU A;  3SG3 A;  1JC2 A;  1IQ3 A;  4ICB A;  1OOJ A;  1CLB A;  4GBA A;  2KFF A;  1SRA A;  2KI6 D;  1IG5 A;  2KGR A;  3RM1 A;  1CFP A;  3GK1 A;  4N1F A;  3KO0 A;  2K2A A;  5AAN A;  4NQG A;  2JNX A;  3BYA A;  3LL8 B;  1Y0V H;  2KSP A;  4I5L B;  4ETO A;  1DT7 B;  2LAP A;  2K8M B;  5J3X A;  4HSZ A;  4N1G A;  4PHK A;  1BR4 B;  3D0Y B;  4YBH B;  2KAY A;  1UHH A;  1AJ5 A;  2CTN A;  5KSZ A;  3BUW B;  1C7V A;  4XYN A;  2I18 A;  1AVS A;  3PFV A;  3EK7 A;  2MA2 A;  2MHH A;  4BY4 A;  2OTG C;  5G08 A;  4PHM A;  1F70 A;  1YUS A;  1PUL A;  2JNF A;  1DJI A;  1TNQ A;  3LLE A;  4TNC A;  3TUY C;  1LA3 A;  3OB1 B;  2D8N A;  1OMR A;  1TNW A;  1UHI A;  2BL0 B;  3NXA A;  1DJW A;  3GK2 A;  3ZNI A;  1HT9 A;  1B1G A;  1M63 B;  1G4Y R;  1SNL A;  4MLW A;  4ORC B;  3NSL A;  1A29 A;  2K2F A;  1B7T Y;  2NLN A;  1BOC A;  3I5F C;  2JZI A;  4OR9 B;  1M45 A;  2JWW A;  3PM8 A;  1LXF C;  5D69 A;  2BBN A;  1JFK A;  2A4J A;  3BUX B;  1F55 A;  3PAT A;  3M0W A;  1B8L A;  1MQ1 A;  2KOT A;  2WND A;  1YRU B;  4HRH A;  2MRD A;  3K21 A;  1KFU L;  1QIW A;  2BE4 A;  2F33 A;  3I5H B;  2LE9 B;  4R1E A;  4JWQ A;  1DJG A;  2HF5 A;  2QPT A;  4DCK A;  1YVH A;  1J1E A;  1B4C A;  2NCP A;  1S3P A;  2I7A A;  2KI4 C;  1KCY A;  3DF0 B;  1J1D A;  4C0L A;  4FTG A;  2KFH A;  2SAS A;  1YUR A;  1GGW A;  2R2I A;  4ORB B;  2FJU B;  1QLS A;  3WXA A;  1UHN A;  3IQQ A;  1ZAC A;  2LVK A;  4Q04 A;  1CM4 A;  1L2O B;  3AKA A;  3VRQ A;  4HRE E;  2JTT A;  4AQI A;  1NX2 A;  4MVF A;  3JVT B;  5CPV A;  3AKB A;  1KQV A;  1WRL A;  2PRU A;  4DRW A;  1SPY A;  3HX4 A;  1IKU A;  2Y1N A;  1S5G Y;  4GFT A;  4QJ4 B;  1REC A;  2E30 A;  4PHN A;  1DF0 A;  1NX3 A;  1F4Q A;  1WLZ A;  4JQ0 D;  4QJ3 B;  2PSR A;  1S36 A;  2M8U A;  2KYF A;  3WHU B;  1ZFS A;  4PE0 A;  5AFP A;  1K95 A;  4OVN F;  1A4P A;  3SG4 A;  3QRX A;  2HQW A;  1NX0 A;  1MXL C;  3LK1 A;  1LA0 A;  2K7O A;  4A4C A;  1XFV O;  1SBJ A;  1SCV A;  4MSP A;  1EXR A;  1MUX A;  1YUT A;  2KBI A;  4OV2 A;  3GK4 X;  1EG4 A;  2WC8 A;  2OS8 C;  1AP4 A;  3H4S E;  1KK8 B;  1CLL A;  4QJ5 B;  1CTR A;  2KAX A;  3JTD C;  3WNX B;  2LV7 A;  2M1K B;  5AEQ A;  2LM5 A;  2EC6 B;  1LIN A;  1FPW A;  1K94 A;  1CDM A;  3PN7 B;  4GAO A;  1WLM A;  3FIA A;  4CFQ A;  1TN4 A;  3CWG A;  5AER A;  1CDP A;  1SR6 B;  1XFY O;  3CZT X;  1XFZ O;  1H8B A;  1SK6 D;  1BG1 A;  2JT8 A;  2LHL A;  2LP2 A;  1QTX A;  1SL7 A;  2M7L A;  4P5O E;  2SCP A;  3BOW B;  4GUK A;  1J7Q A;  2ZRS A;  1V1G A;  1K9P A;  4P2Y B;  5HLO A;  5ER4 X;  4WQ2 A;  4F0Z B;  1CFC A;  4AOM A;  3OX5 A;  2O60 A;  3CTN A;  1A03 A;  1S1E A;  3GOF A;  2MBX A;  2DOQ A;  1SMG A;  1BU3 A;  1UUR A;  2G9B A;  1WDC B;  1NUB A;  4YGE B;  1M39 A;  1MF8 B;  2LLS A;  4YRU A;  1CMF A;  4A4B A;  3MSE B;  3KPX A;  5PAL A;  2F2P A;  2MLE C;  5CSF A;  1DJY A;  1TCF A;  3KF9 A;  3PAL A;  4OKH A;  1ZMZ A;  2LVJ A;  1DMO A;  4MRX A;  1GGZ A;  1S6J A;  2JPT A;  4MEW A;  1WRK A;  2LMU A;  1QIV A;  2VRG A;  1HQV A;  1RFJ A;  1TCO B;  2LVI A;  3E3R A;  2Q4U A;  1ALW A;  5AXI A;  2BL0 C;  1LKJ A;  2CXJ A;  1QV0 A;  1QV1 A;  1DTL A;  2ZRT A;  3EVR A;  4AQJ A;  5F6T A;  1K93 D;  2M1U A;  1JWD A;  1F4O A;  1YTZ C;  4C0K A;  2PVB A;  2L5X B;  1SY9 A;  3CR5 X;  2KQ6 A;  3C1V A;  2H61 C;  3HCM A;  3D0Y A;  2NXQ A;  1TTX A;  1ZOT B;  5HKY A;  2BBM A;  1PSB A;  2ZKM X;  3I5H C;  1JBA A;  4GGF C;  1TOP A;  1F71 A;  4MZK A;  1KFX S;  2F2O A;  2GGZ A;  1NPQ A;  2LLU A;  2KHN A;  3CR4 X;  1QX2 A;  1OZS A;  1SCM B;  1IRJ A;  1BLQ A;  2G2B A;  2JTZ A;  1GJY A;  2LMV A;  1J55 A;  2M3W A;  2BEC A;  5HYD A;  1Y1U A;  1K9K A;  4XJK B;  1BMO A;  1DJH A;  3EKH A;  5BPJ A;  3VRO A;  2KI6 C;  2L2E A;  1CFD A;  1L2O C;  4N5X A;  4YI9 A;  1EH2 A;  1CLM A;  1BJF A;  1J7R A;  1M46 A;  3ZWH A;  3F45 A;  5IBW A;  3JVT C;  4YI8 A;  4WQ3 A;  1ODB A;  2JU0 A;  3LCP C;  2HET A;  1W7I B;  4PAL A;  1G33 A;  4GGF A;  1IH0 A;  2ISD A;  3EK4 A;  2M0R A;  2I2R E;  2M97 A;  1KQM B;  2LUX A;  3TDZ A;  1R6P A;  1OMD A;  3NSI A;  4M2O A;  1CB1 A;  4C0J A;  2TN4 A;  4M2P A;  1W7J B;  1GQM A;  2NZ0 A;  2JXC A;  1S26 D;  2LC5 A;  1S6I A;  1K96 A;  2QAC A;  1CNP A;  1FW4 A;  1N2D A;  1PAL A;  3D10 A;  4PHJ A;  2GV5 A;  3OHM B;  4I5J A;  2Q91 A;  1KK8 C;  5TNC A;  2K7D A;  4E68 A;  3OB2 B;  1CDL A;  2WOS A;  2ZFD A;  1A75 B;  2EGD A;  3AAK A;  3VGO A;  2EC6 C;  1U5I B;  1XYD A;  4U8D A;  3PN7 C;  1NCZ A;  1IQ5 A;  4YGB B;  5I2L A;  1XO5 A;  1AK8 A;  3EK8 A;  2JUL A;  2ZND A;  2JRF A;  1UWO A;  3A8R A;  5DKN A;  3SG7 A;  3TS5 B;  4DS7 A;  1SR6 C;  1YRT B;  1DGU A;  1RK9 A;  3O78 A;  5K89 A;  2PAS A;  3BUN B;  2CCM A;  2HQ8 A;  3A4U B;  1KWO C;  5KTY A;  2KQY A;  2WCB A;  2BCA A;  4MZJ A;  1FI6 A;  1FI5 A;  1QX7 A;  4MN0 A;  1PVB A;  1NYA A;  3LK0 A;  1MXE A;  3SG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...