1GGWA

Cdc4p from schizosaccharomyces pombe
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
140
structure length
140
Chain Sequence
STDDSPYKQAFSLFDRHGTGRIPKTSIGDLLRACGQNPTLAEITEIESTLPAEVDMEQFLQVLNRPNGFDMPGDPEEFVKGFQVFDKDATGMIGVGELRYVLTSLGEKLSNEEMDELLKGVPVKDGMVNYHDFVQMILAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CDC4P)
publication title Structure of Cdc4p, a contractile ring protein essential for cytokinesis in Schizosaccharomyces pombe.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Cytokine
total genus 30
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2000-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ggwA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ggwA01
3EVUA 5AEQA 4ORBB 2BCBA 1MXLC 1KK7Y 4YRUA 2PSRA 2MHHA 1DJZA 1A4PA 4PALA 1A03A 2E30A 2LUCA 2M9GA 1SYMA 2K2AA 1BG1A 2M3WA 3DD4A 3BOWB 1KK8C 3FIAA 1ALWA 1B8RA 4M2PA 2KFHA 3BXKA 4MEWA 2ZRTA 3I5GB 1SW8A 4YGEB 4PE7A 1IRJA 2ZNEA 1OOJA 3LL8B 1PSRA 2ZN8A 1BLQA 4MSPA 3TZ1A 1BT6A 2BCAA 2FCEA 3PALA 1SPYA 1L2OC 1NCZA 2PVBA 3PN7C 4XJKB 1H4BA 1B8LA 1F4OA 1N65A 3CS1A 2LLTA 4Q04A 2OS8B 2QACA 2M1KB 5J3XA 1XFXO 4MZKA 2GV5A 2FCDA 2WORA 2BBMA 1DVIA 3DVKA 1OMDA 4BY4A 1BR1B 5JJGA 2JWWA 2LMUA 1UWOA 4CIDA 3TDIA 1J7QA 2K8MB 4QJ5B 2JNXA 2NCPA 5I2OA 2D8NA 2COLB 2M49B 2M7LA 1SNLA 2MJWB 2WCBA 1A29A 5I2QA 1PVAA 1NX0A 1TNWA 1N0YA 1EH2A 2K7DA 1F4QA 4I5KA 1K94A 1XK4C 1K9PA 4WQ2A 2KI6C 1K93D 1V1FA 2NLNA 1WLZA 3PFVA 3OP0A 5PALA 5CPVA 2JT8A 2SASA 4GGFC 1OZSA 3TDUA 1SL8A 5B8IB 2M97A 4ICBA 2M1UA 2PALA 4TNCA 4DRWA 1EXRA 5IBWA 1Y6WA 2BECA 1GJYA 1OSAA 4OVNF 3BUNB 3WNXB 2L4HA 1DT7B 1F70A 3RM1A 4ORCB 3DF0A 1M46A 3EKHA 5DKNA 3SG2A 1E8AA 5TNCA 1RTP1 4PE0A 1TN4A 1JBAA 1BR4B 1AP4A 3NXAA 3TUYC 2Y1MA 3D10A 3K21A 3SG5A 2G2BA 3AAJA 1F8HA 1CDLA 4JQ0D 4PHJA 3D0YA 4GGFA 2FOTA 1SRAA 4MRYA 5I8NA 4YI8A 5AXIA 3BOWA 1ZACA 2JXLA 4DCKA 4AQIA 1TTXA 1XFUO 3SIBA 1CNPA 1KK8B 1QATA 2SCPA 1UURA 4PHMA 2PASA 1QVIZ 1NP8A 1JSAA 2JT0A 1G8IA 1BF5A 1IQ3A 1DF0B 1DJYA 2JOJA 4MBEA 3JTDB 2HPSA 4M2QA 2BKHB 1K9UA 2LP3A 2KI4C 1EL4A 4C0LA 1L2OB 2F33A 3FS7A 3MSEB 2KGBC 2I18A 1CLMA 3PN7B 4MRXA 1FPWA 1JWDA 3C1VA 2KOTA 1QXPA 2LVJA 4OR9B 2TN4A 1AHRA 1YRUB 2V53A 2K7OA 5HKWA 2F8PA 4YBHB 1K95A 1FI5A 1K96A 2GGZA 1QLKA 1UUSA 3KEVA 2NXQA 2L0PA 2CNPA 1B4CA 3PLFB 1SCMC 1IJ5A 4FQOA 1SR6B 2H2KA 5KTYA 1QIWA 5ER4X 2WCEA 2FJUB 4MLWA 4PDZA 4MN0A 4OCIA 2LVIA 3EKJA 2JU0A 1Y1XA 3SG7A 1S26D 1S36A 2JT3A 2P6BB 2NCOA 3H4SE 1UHKA 3BUWB 4GUKA 1CFDA 1BU3A 1UHJA 3LLEA 2ZNDA 2Y4QA 4YGAA 4OKHA 1WRLA 1ALVA 1SL7A 2GGMA 1QTXA 3CR5X 4GGNA 1FF1A 3D0YB 4PE4A 1M63B 1OZOA 1CB1A 1GQMA 1CFCA 1NIWA 2BE6A 5ER5A 4HRGA 1YTZC 3GK1A 1CLBA 2L2EA 4PE1A 1DGUA 2Y5IA 4ORAB 1CKKA 4QJ3B 2BKIB 3F45A 1Y1UA 3FWBA 2H61A 1KQMC 3SIAA 1QX7A 1EG4A 4IL1A 1J7OA 1YUSA 3AKBA 1QS7A 1XA5A 2B1UA 4XYNA 1CDPA 1HQVA 1SBJA 4R1EA 2F2OA 3TUYB 2G9BA 1A75A 4GNKB 2BL0C 1JC2A 2E6WA 3VGOA 3A4UB 4CFRA 1YUUA 1RFJA 2KSPA 2HQWA 2OPOA 1IWQA 1FBVA 3E3RA 3GOFA 1TNXA 1JFKA 1R2UA 4USLA 1DF0A 1ZUZA 3TS5B 1W7JB 3LK1A 4AOMA 1CFFA 1R6PA 5JOLA 1YURA 5BPJA 1SL9A 1HT9A 4PCWA 4WRIA 1YX8A 3BUXB 4ZCVA 2KYCA 3VRNA 4N1FA 4MZLA 4HREE 2PRUA 4E68A 1QVIY 1QV0A 4I5JA 3CR2A 1B8CA 3EK7A 3EVVA 2KHNA 2K0JA 1TNQA 3CZTX 4JWQA 1SY9A 2AUCA 1SCMB 5AFPA 1JFJA 1LA3A 1DMOA 1UHIA 4DUQA 5D7FA 1PVBA 3KF9A 3EK4A 1JF2A 3DVMA 3O6BA 2LVVA 3O2PA 4U8DA 2I7AA 3CLNA 5AERA 3TDZA 4GPLB 1NX1A 1DJWA 2KQYA 1CDMA 4CPVA 4YGCB 1XK4A 2JTTA 2L50A 4YI9A 2R2IA 1BOCA 1MXEA 1TRFA 3CWGA 2OTGC 1QX2A 3SG6A 1VRKA 3OX5A 1B1GA 4NQGA 4YGDB 1A75B 3LCPC 3OB2B 5CSNA 4NDCA 3NSIA 3IQQA 1NUBA 1PK0D 2JXCA 1F71A 1U5IB 1IJ6A 2LVKA 4QJ4B 1V1GA 2BE4A 1Q80A 3DVJA 2KI6D 1AVSA 1W7IB 1OMVA 2ZN9A 1IGVA 2K7CA 2NZ0A 1PRWA 1X02A 1J7RA 1TCOB 2ISDA 2AAOA 5I2LA 3I5HC 2HETA 3SG4A 4C0JA 2CCMA 1J55A 1LKJA 2CT9A 2BL0B 1M45A 1S5GZ 1L7ZA 1F55A 4N5XA 1D1OA 3KHEA 2O60A 1YRTB 4M2OA 5CSIA 3VROA 1K2HA 1MWNA 1TNPA 1XFWO 2MRDA 2WOSA 3VRRA 1NWDA 2BCXA 1KFUS 3LK0A 1C7VA 5D69A 1GGZA 1B7TZ 5GQQC 2VRGA 3A8RA 1WRZA 1FW4A 1AJ5A 1G33A 2LV7A 2M8UA 2HF5A 2HQ8A 5AANA 1NYAA 1NCXA 2LNKA 2ZFDA 1WDCC 1MHOA 3ZWHA 1J1DA 1ZMZA 1RWYA 3WXAA 2M0RA 1CFPA 2RGIA 2WCFA 2JC2A 2L98A 3BUOB 2EGDA 1ZOTB 4JPZB 4UPGA 1QJTA 5KU1A 4MZJA 2KFGA 1TCFA 2MAZA 1BMOA 2LANA 2LMTA 3JVTC 3I5FC 1XFVO 1WLMA 1J7PA 1YVHA 1YVLA 2LC5A 2F2PA 2O5GA 3VRPA 1KQVA 1A2XA 1XYDA 5DKRA 1KSMA 1KWOC 3VRQA 2K2FA 2L5XB 1K90D 3AAKA 1FI6A 2WC8A 2KQ6A 1CTRA 2M29A 1XO5A 3KO0A 1AJ4A 1XVJA 1OMRA 2K61A 1CDNA 2OTGB 1CLLA 1MR8A 3WHUB 4CFQA 4FTGA 2JPTA 1JF0A 4N1GA 2LCPA 1U5IA 3CGAA 1UHHA 3CTNA 2Q91A 1YR5A 2Y1NA 4C0KA 1KFXS 3DVEA 1SK6D 4MVFA 3JTDC 4BY5A 1PSBA 3IQOA 2KYFA 2KBMA 5HLOA 2A4JA 1M39A 1PALA 1RK9A 1S1EA 3SG3A 1NX2A 1UHNA 3IF7A 2LP2A 1CM1A 3FWCA 4AQJA 2KI4B 2MA2A 1CM4A 3I5IC 2KNEA 4NDDA 3I5HB 3RLZA 1QV1A 4WQ3A 1DGVA 1NSHA 2ZKMX 2KAVA 1YX7A 5K89A 1KK7Z 1SR6C 3HCMA 4D1EA 3HX4A 1AUIB 3ZNIA 1CMFA 1XFYO 2M7NA 2EC6C 4YGBB 3O4YA 4HSZA 2JRFA 4I5NB 2CTNA 1LVCD 4L9MA 4DIRA 4F0ZB 2K7BA 2LM5A 2LE9B 4GBAA 1S3PA 3KPXA 2LHLA 4OV2A 1G4YR 3EK8A 1IG5A 4DS7A 3CR4X 4A4BA 2WNDA 1S5GY 1S6IA 2Q4UA 1YUTA 5HLVA 1M31A 1MQ1A 1QX5B 1WRKA 2I2RE 4I5LB 1RROA 1WDCB 1BJFA 1SCVA 2IS9A 1LINA 1QASA 3O78A 3OX6A 1F54A 1GGWA 2LHIA 1DJIA 3I5GC 3SJSA 1B7TY 5HKZA 3QRXA 2F3YA 5HKYA 2CBLA 1EG3A 1DJXA 1S6JA 3M0WA 1K9KA 1LA0A 2LUXA 3JVTB 3I5FB 1BODA 1DJGA 3PM8A 2JULA 5CSFA 1KQMB 2MBXA 5FYXA 1Y0VH 1B47A 2OS8C 2AMIA 1H8BA 1C07A 1IQ5A 1SKTA 2QPTA 4PHKA 1KWOB 1QLSA 1UP5A 5CSJA 1AK8A 1KFUL 1IKUA 1DTLA 2PMYA 2KBIA 1K8UA 2KGRA 3EVRA 3NSOA 1MUXA 3NSKA 1LXFC 4NDBA 5F6TA 4CLNA 3BUMB 1Y1AA 2MLEC 2JQ6A 1QIVA 1IH0A 2MLFC 3TS5C 4ETOA 1SMGA 3GK2A 1DJHA 1EJ3A 1ODBA 2KFFA 3PSRA 1OE9B 2ZRSA 4XJKA 3AKAA 2LLSA 1KFXL 4PHNA 1CMGA 1NPQA 2I94A 4HRHA 1PULA 3GK4X 2JNFA 1WY9A 3ICBA 4A4CA 1B9AA 1MF8B 5KSZA 2L4IA 1N2DA 4P2YB 3BYAA 4ZCUA 2JZIA 3I5IB 2EHBA 2LAPA 1JUOA 1NX3A 1RECA 1NCYA 4GAOA 2LMVA 1RJVA 1TIZA 2JTZA 5HYDA 2KAXA 3OHMB 2LLUA 3WHTB 2L51A 2EC6B 3BQ3A 2DOQA 3OB1B 1J1EA 1TOPA 3NSLA 4GFTA 3DF0B 2H61C 1XFZO 2BBNA 2CXJA 2KDHA 2F3ZA 5G08A 2KAYA 1OQPA 1S6CA 1C7WA 3PATA 1ZFSA 5DKQA 1KSOA 1KCYA 4P5OE
chains in the Genus database with same CATH superfamily
3EVUA 5AEQA 4ORBB 2BCBA 1MXLC 1KK7Y 3BFAA 4YRUA 2PSRA 1DQEA 2MHHA 1DJZA 1A4PA 4PALA 1A03A 2E30A 2LUCA 2M9GA 3SS3A 1SYMA 2K2AA 1BG1A 2M3WA 3DD4A 3BOWB 1KK8C 3FIAA 1ALWA 1B8RA 4M2PA 3BFBA 2KFHA 3BXKA 4MEWA 2ZRTA 3I5GB 1SW8A 4YGEB 4PE7A 1IRJA 2ZNEA 1OOJA 3LL8B 1PSRA 2ZN8A 1BLQA 4MSPA 3TZ1A 1BT6A 2BCAA 2FCEA 3PALA 1SPYA 1L2OC 1NCZA 2PVBA 3PN7C 4XJKB 1H4BA 1B8LA 1F4OA 1N65A 3CS1A 1Z4HA 2LLTA 4Q04A 2OS8B 2QACA 2M1KB 5J3XA 1XFXO 4MZKA 2GV5A 2FCDA 2WORA 2BBMA 1DVIA 3DVKA 1OMDA 4BY4A 1BR1B 5JJGA 2JWWA 1QWVA 2LMUA 1UWOA 4CIDA 3TDIA 1J7QA 2K8MB 3FE9A 1TWOA 4QJ5B 2JNXA 2NCPA 5I2OA 2D8NA 2COLB 2M49B 3D77A 2M7LA 1SNLA 2MJWB 2WCBA 1A29A 4OZDA 1PVAA 5I2QA 1NX0A 1TNWA 1N0YA 2K60A 1EH2A 2K7DA 1F4QA 4I5KA 1K94A 3NHIA 5EL2A 1XK4C 1K9PA 2FJYA 4WQ2A 1T14A 2KI6C 1K93D 1V1FA 2ERBA 2NLNA 3EG5B 1WLZA 3PFVA 3OP0A 5PALA 5CPVA 2JT8A 2SASA 4GGFC 1OZSA 3TDUA 3VB1A 1SL8A 5B8IB 2M97A 4ICBA 2M1UA 2PALA 4TNCA 4DRWA 1EXRA 5IBWA 1Y6WA 2BECA 1GJYA 1OSAA 4OVNF 3BUNB 3WNXB 2L4HA 3FE6A 1DT7B 3RM1A 1F70A 4ORCB 3DF0A 1M46A 3EKHA 5DKNA 3SG2A 1E8AA 5TNCA 1RTP1 4PE0A 1TN4A 1JBAA 1BR4B 1AP4A 3FE8A 3NXAA 3R1PA 2Y1MA 3D10A 3K21A 2GTEA 3SG5A 3TUYC 2G2BA 3AAJA 1F8HA 2QEBA 1CDLA 4JQ0D 2YGUA 4PHJA 1OOGA 3D0YA 4GGFA 2FOTA 2BNXA 1SRAA 4MRYA 5I8NA 4YI8A 5AXIA 3BOWA 1ZACA 2JXLA 3O4XA 4DCKA 4AQIA 1TTXA 1XFUO 3SIBA 1CNPA 1KK8B 1QATA 2SCPA 1UURA 4PHMA 3DZTA 3SS5A 2PASA 1QVIZ 1NP8A 3V2LA 1JSAA 2JT0A 1G8IA 1BF5A 1IQ3A 1DF0B 1DJYA 2JOJA 4MBEA 3JTDB 2HPSA 4M2QA 4INXA 2BKHB 1K9UA 2LP3A 2KI4C 1EL4A 2P71A 4C0LA 1L2OB 2F33A 3FS7A 3MSEB 2KGBC 2I18A 1CLMA 3PN7B 4MRXA 1FPWA 1JWDA 3C1VA 2KOTA 1QXPA 2LVJA 4OR9B 2TN4A 1AHRA 1YRUB 2V53A 2K7OA 3D76A 5HKWA 2F8PA 4YBHB 1K95A 1FI5A 1K96A 2GGZA 1QLKA 1UUSA 3KEVA 2NXQA 2L0PA 2CNPA 1B4CA 3PLFB 1SCMC 1IJ5A 4FQOA 1SR6B 2H2KA 5KTYA 1QIWA 5ER4X 1OOHA 2FJUB 2WCEA 4MLWA 4PDZA 4MN0A 4OCIA 2LVIA 4F7FA 3EKJA 2JU0A 2JPOA 4PT1A 3OBVA 1Y1XA 3SG7A 1S26D 2WCMA 1S36A 2JT3A 2P6BB 2NCOA 3R1OA 3H4SE 1UHKA 3BUWB 4GUKA 1CFDA 1BU3A 1UHJA 3LLEA 3R1VA 2ZNDA 2Y4QA 4YGAA 3DY9A 4OKHA 1WRLA 1ALVA 1SL7A 2GGMA 1QTXA 3CR5X 4GGNA 1OOFA 1FF1A 3D0YB 4PE4A 1M63B 1OZOA 4KYNA 1CB1A 1GQMA 1CFCA 1NIWA 2BE6A 1DELA 3K1EA 5ER5A 4HRGA 1YTZC 3GK1A 1CLBA 2L2EA 4PE1A 1DGUA 2Y5IA 4ORAB 1CKKA 1SSEB 1TUZA 2BKIB 3F45A 1Y1UA 3FWBA 4QJ3B 2H61A 1KQMC 5FI7A 3SIAA 1QX7A 1EG4A 4IL1A 1J7OA 1YUSA 1LS8A 3AKBA 1QS7A 1XA5A 3D74A 2B1UA 4XYNA 1CDPA 1HQVA 2QEVA 1SBJA 4R1EA 2F2OA 3SS4A 3TUYB 2G9BA 1A75A 4GNKB 2BL0C 1JC2A 2E6WA 3VGOA 3A4UB 4CFRA 1YUUA 1RFJA 3CDNA 2KSPA 2HQWA 2OPOA 3L4LA 1IWQA 1FBVA 3E3RA 3GOFA 1TNXA 1JFKA 2WCJA 1R2UA 4USLA 1DF0A 1ZUZA 3TS5B 3UO9A 1W7JB 3LK1A 4AOMA 1CFFA 3B88A 4FQTA 1R6PA 5JOLA 1YURA 5BPJA 1SL9A 1HT9A 3BFHA 4PCWA 4WRIA 1YX8A 3BUXB 4ZCVA 2KYCA 1IKUA 3VRNA 4N1FA 4MZLA 4HREE 1Z2CB 2PRUA 4E68A 1QVIY 1QV0A 4I5JA 3CR2A 1B8CA 3EK7A 3EVVA 5HL1A 2KHNA 2K0JA 1TNQA 3CZTX 3D73A 4JWQA 1SY9A 2AUCA 1SCMB 3S0GA 5AFPA 1JFJA 1LA3A 1DMOA 2PYQA 1UHIA 4DUQA 5D7FA 1PVBA 3KF9A 3EK4A 1JF2A 3DVMA 3O6BA 3PM2A 2LVVA 3O2PA 4U8DA 2I7AA 3CLNA 5AERA 3TDZA 4GPLB 1NX1A 1DJWA 2KQYA 1CDMA 4CPVA 4YGCB 1XK4A 2JTTA 2L50A 4YI9A 2R2IA 1BOCA 1MXEA 1TRFA 3CWGA 2OTGC 2P70A 1QX2A 3Q8IA 1VRKA 3OX5A 3SG6A 1B1GA 4NQGA 4YGDB 1A75B 3LCPC 3OB2B 5CSNA 4NDCA 3NSIA 3IQQA 1NUBA 1PK0D 2PQLA 3S0FA 2JXCA 1F71A 1OW4A 1U5IB 1W9ZA 1IJ6A 2LVKA 4QJ4B 1V1GA 2BE4A 1Q80A 3CYZA 3DVJA 2KI6D 1AVSA 1W7IB 1OMVA 2ZN9A 1IGVA 1C3YA 2K7CA 2NZ0A 1PRWA 1X02A 1J7RA 1TCOB 2ISDA 2AAOA 5I2LA 3I5HC 2HETA 3SG4A 4C0JA 2CCMA 1J55A 1LKJA 2CT9A 4JKTA 2BL0B 3D75A 1M45A 1S5GZ 1L7ZA 1F55A 4N5XA 1D1OA 3KHEA 2O60A 1YRTB 4M2OA 5CSIA 2KPHA 3VROA 1K2HA 1MWNA 1TNPA 1XFWO 2MRDA 2WOSA 3VRRA 3S0EA 1NWDA 2BCXA 1KFUS 1P28A 2QEHA 3BJHA 3LK0A 1C7VA 5D69A 1GGZA 1B7TZ 3RZSA 5GQQC 2VRGA 3A8RA 1WRZA 1FW4A 1AJ5A 1G33A 2LV7A 2M8UA 2HF5A 2HQ8A 5AANA 1NYAA 1NCXA 2LNKA 2ZFDA 1WDCC 1MHOA 3ZWHA 1J1DA 1ZMZA 1RWYA 3WXAA 2M0RA 1CFPA 2RGIA 2WCFA 2JC2A 2L98A 3BUOB 2EGDA 1ZOTB 4JPZB 4UPGA 1QJTA 5KU1A 4MZJA 2KFGA 3B6XA 1TCFA 5DICA 2MAZA 1BMOA 2LANA 2LMTA 3OGNA 3JVTC 3I5FC 1XFVO 1WLMA 1J7PA 1YVHA 1YVLA 2LC5A 2F2PA 2O5GA 3VRPA 1KQVA 1A2XA 1XYDA 3PJIA 2H8VA 5DKRA 1KSMA 1KWOC 2BAPA 2K2FA 2L5XB 1K90D 3AAKA 3VRQA 1FI6A 2WC8A 2L5YA 2KQ6A 1CTRA 2M29A 1XO5A 1GM0A 3KO0A 1AJ4A 3S0BA 1XVJA 1OMRA 2K61A 1CDNA 2OTGB 1CLLA 1MR8A 3WHUB 4CFQA 4FTGA 2JPTA 1JF0A 4N1GA 2LCPA 1U5IA 3CGAA 1UHHA 3CTNA 2Q91A 1YR5A 2Y1NA 4C0KA 2WC6A 1KFXS 3DVEA 1SK6D 3NGVA 4MVFA 3D78A 3JTDC 4BY5A 1PSBA 1OOIX 5D3OA 3IQOA 2KYFA 2KBMA 5HLOA 2A4JA 1M39A 1PALA 1RK9A 1S1EA 3DXLA 3SG3A 1NX2A 1UHNA 3IF7A 2LP2A 1CM1A 3B7AA 3FWCA 4AQJA 2KI4B 2MA2A 1CM4A 3I5IC 2KNEA 4NDDA 2WCLA 3IVTA 3I5HB 3RLZA 1QV1A 4WQ3A 1DGVA 1NSHA 2ZKMX 2KAVA 3CABA 1YX7A 5K89A 1KK7Z 1SR6C 3CZ1A 3HCMA 4D1EA 3HX4A 1TUJA 1AUIB 3ZNIA 1CMFA 1XFYO 1DC1A 2M7NA 2EC6C 4YGBB 3O4YA 4HSZA 2JRFA 4I5NB 2CTNA 2WCHA 1LVCD 1XFRA 2KLDA 4L9MA 2K7BA 4DIRA 4F0ZB 2LM5A 2LE9B 1DEKA 1S3PA 4GBAA 3KPXA 2LHLA 1ORGA 4OV2A 1G4YR 3EK8A 1IG5A 5FI6A 4DS7A 3CR4X 4A4BA 2WNDA 1S5GY 1S6IA 2Q4UA 1YUTA 5HLVA 1M31A 1MQ1A 1QX5B 1WRKA 2I2RE 4I5LB 2QEOA 1RROA 3B87A 1WDCB 1BJFA 1SCVA 2IS9A 1LINA 1QASA 3O78A 3OX6A 2L2CA 1F54A 2LHIA 1GGWA 1DJIA 3I5GC 2KLEA 3SJSA 1B7TY 5HKZA 2QDIA 3QRXA 2F3YA 5HKYA 2CBLA 1EG3A 1DJXA 3N7HA 1S6JA 3L4AA 1K9KA 3M0WA 1LA0A 2LUXA 3JVTB 3I5FB 1BODA 1DJGA 3PM8A 2JULA 3CZ0A 5CSFA 1KQMB 2MBXA 5FYXA 1Y0VH 1B47A 2OS8C 2AMIA 1H8BA 1C07A 1IQ5A 1SKTA 2QPTA 4PHKA 1KWOB 1QLSA 1UP5A 5CSJA 1AK8A 1KFUL 3R72A 1DTLA 2PMYA 2KBIA 1K8UA 2KGRA 2WC5A 3DYEA 1MUXA 3EVRA 3NSOA 3NSKA 3S0DA 4IJ7A 1LXFC 4NDBA 5F6TA 4CLNA 3BUMB 1Y1AA 1C3ZA 2MLEC 2JQ6A 1QIVA 1IH0A 2MLFC 3TS5C 4INWA 4ETOA 1SMGA 3B86A 3GK2A 1DJHA 1EJ3A 1ODBA 2KFFA 3PSRA 1OE9B 5FI2A 2ZRSA 4XJKA 3AKAA 2LLSA 1KFXL 4PHNA 1CMGA 1NPQA 2I94A 4HRHA 5I94A 1PULA 3GK4X 2JNFA 1WY9A 1IIOA 2WCKA 4JD9A 3ICBA 4A4CA 1B9AA 1MF8B 5KSZA 3UNWA 2L4IA 1N2DA 4P2YB 3BYAA 3L47A 3CZ2A 4ZCUA 2JZIA 3I5IB 2EHBA 2LAPA 1JUOA 3QMEA 1NX3A 1RECA 1NCYA 3NHTA 4GAOA 2LMVA 1RJVA 1TIZA 2JTZA 5HYDA 2KAXA 3OHMB 2LLUA 3WHTB 2L51A 2EC6B 3BQ3A 2DOQA 3OB1B 1J1EA 1TOPA 3NSLA 4GFTA 3DF0B 2H61C 1XFZO 2BBNA 2CXJA 2KDHA 2F3ZA 5G08A 2KAYA 1OQPA 1S6CA 1C7WA 3PATA 1ZFSA 5DKQA 1KSOA 3S0AA 1KCYA 4P5OE
chains in the Genus database with same CATH topology
3EVUA 5AEQA 4ORBB 2BCBA 1MXLC 1KK7Y 4YRUA 2PSRA 2MHHA 1DJZA 1A4PA 4PALA 1A03A 2E30A 2LUCA 2M9GA 1SYMA 2K2AA 1BG1A 2M3WA 3DD4A 3BOWB 1KK8C 3FIAA 1ALWA 1B8RA 4M2PA 2KFHA 3BXKA 4MEWA 2ZRTA 3I5GB 1SW8A 4YGEB 4PE7A 1IRJA 2ZNEA 1OOJA 3LL8B 1PSRA 2ZN8A 1BLQA 4MSPA 3TZ1A 1BT6A 2BCAA 2FCEA 3PALA 1SPYA 1L2OC 1NCZA 2PVBA 3PN7C 4XJKB 1H4BA 1B8LA 1F4OA 1N65A 3CS1A 2LLTA 4Q04A 2OS8B 2QACA 2M1KB 5J3XA 1XFXO 4MZKA 2GV5A 2FCDA 2WORA 2BBMA 1DVIA 3DVKA 1OMDA 4BY4A 1BR1B 5JJGA 2JWWA 2LMUA 1UWOA 4CIDA 3TDIA 1J7QA 2K8MB 4QJ5B 2JNXA 2NCPA 5I2OA 2D8NA 2COLB 2M49B 2M7LA 1SNLA 2MJWB 2WCBA 1A29A 5I2QA 1PVAA 1NX0A 1TNWA 1N0YA 1EH2A 2K7DA 1F4QA 4I5KA 1K94A 1XK4C 1K9PA 4WQ2A 2KI6C 1K93D 1V1FA 2NLNA 1WLZA 3PFVA 3OP0A 5PALA 5CPVA 2JT8A 2SASA 4GGFC 1OZSA 3TDUA 1SL8A 5B8IB 2M97A 4ICBA 2M1UA 2PALA 4TNCA 4DRWA 1EXRA 5IBWA 1Y6WA 2BECA 1GJYA 1OSAA 4OVNF 3BUNB 3WNXB 2L4HA 1DT7B 1F70A 3RM1A 4ORCB 3DF0A 1M46A 3EKHA 5DKNA 3SG2A 1E8AA 5TNCA 1RTP1 4PE0A 1TN4A 1JBAA 1BR4B 1AP4A 3NXAA 3TUYC 2Y1MA 3D10A 3K21A 3SG5A 2G2BA 3AAJA 1F8HA 1CDLA 4JQ0D 4PHJA 3D0YA 4GGFA 2FOTA 1SRAA 4MRYA 5I8NA 4YI8A 5AXIA 3BOWA 1ZACA 2JXLA 4DCKA 4AQIA 1TTXA 1XFUO 3SIBA 1CNPA 1KK8B 1QATA 2SCPA 1UURA 4PHMA 2PASA 1QVIZ 1NP8A 1JSAA 2JT0A 1G8IA 1BF5A 1IQ3A 1DF0B 1DJYA 2JOJA 4MBEA 3JTDB 2HPSA 4M2QA 2BKHB 1K9UA 2LP3A 2KI4C 1EL4A 4C0LA 1L2OB 2F33A 3FS7A 3MSEB 2KGBC 2I18A 1CLMA 3PN7B 4MRXA 1FPWA 1JWDA 3C1VA 2KOTA 1QXPA 2LVJA 4OR9B 2TN4A 1AHRA 1YRUB 2V53A 2K7OA 5HKWA 2F8PA 4YBHB 1K95A 1FI5A 1K96A 2GGZA 1QLKA 1UUSA 3KEVA 2NXQA 2L0PA 2CNPA 1B4CA 3PLFB 1SCMC 1IJ5A 4FQOA 1SR6B 2H2KA 5KTYA 1QIWA 5ER4X 2WCEA 2FJUB 4MLWA 4PDZA 4MN0A 4OCIA 2LVIA 3EKJA 2JU0A 1Y1XA 3SG7A 1S26D 1S36A 2JT3A 2P6BB 2NCOA 3H4SE 1UHKA 3BUWB 4GUKA 1CFDA 1BU3A 1UHJA 3LLEA 2ZNDA 2Y4QA 4YGAA 4OKHA 1WRLA 1ALVA 1SL7A 2GGMA 1QTXA 3CR5X 4GGNA 1FF1A 3D0YB 4PE4A 1M63B 1OZOA 1CB1A 1GQMA 1CFCA 1NIWA 2BE6A 5ER5A 4HRGA 1YTZC 3GK1A 1CLBA 2L2EA 4PE1A 1DGUA 2Y5IA 4ORAB 1CKKA 4QJ3B 2BKIB 3F45A 1Y1UA 3FWBA 2H61A 1KQMC 3SIAA 1QX7A 1EG4A 4IL1A 1J7OA 1YUSA 3AKBA 1QS7A 1XA5A 2B1UA 4XYNA 1CDPA 1HQVA 1SBJA 4R1EA 2F2OA 3TUYB 2G9BA 1A75A 4GNKB 2BL0C 1JC2A 2E6WA 3VGOA 3A4UB 4CFRA 1YUUA 1RFJA 2KSPA 2HQWA 2OPOA 1IWQA 1FBVA 3E3RA 3GOFA 1TNXA 1JFKA 1R2UA 4USLA 1DF0A 1ZUZA 3TS5B 1W7JB 3LK1A 4AOMA 1CFFA 1R6PA 5JOLA 1YURA 5BPJA 1SL9A 1HT9A 4PCWA 4WRIA 1YX8A 3BUXB 4ZCVA 2KYCA 3VRNA 4N1FA 4MZLA 4HREE 2PRUA 4E68A 1QVIY 1QV0A 4I5JA 3CR2A 1B8CA 3EK7A 3EVVA 2KHNA 2K0JA 1TNQA 3CZTX 4JWQA 1SY9A 2AUCA 1SCMB 5AFPA 1JFJA 1LA3A 1DMOA 1UHIA 4DUQA 5D7FA 1PVBA 3KF9A 3EK4A 1JF2A 3DVMA 3O6BA 2LVVA 3O2PA 4U8DA 2I7AA 3CLNA 5AERA 3TDZA 4GPLB 1NX1A 1DJWA 2KQYA 1CDMA 4CPVA 4YGCB 1XK4A 2JTTA 2L50A 4YI9A 2R2IA 1BOCA 1MXEA 1TRFA 3CWGA 2OTGC 1QX2A 3SG6A 1VRKA 3OX5A 1B1GA 4NQGA 4YGDB 1A75B 3LCPC 3OB2B 5CSNA 4NDCA 3NSIA 3IQQA 1NUBA 1PK0D 2JXCA 1F71A 1U5IB 1IJ6A 2LVKA 4QJ4B 1V1GA 2BE4A 1Q80A 3DVJA 2KI6D 1AVSA 1W7IB 1OMVA 2ZN9A 1IGVA 2K7CA 2NZ0A 1PRWA 1X02A 1J7RA 1TCOB 2ISDA 2AAOA 5I2LA 3I5HC 2HETA 3SG4A 4C0JA 2CCMA 1J55A 1LKJA 2CT9A 2BL0B 1M45A 1S5GZ 1L7ZA 1F55A 4N5XA 1D1OA 3KHEA 2O60A 1YRTB 4M2OA 5CSIA 3VROA 1K2HA 1MWNA 1TNPA 1XFWO 2MRDA 2WOSA 3VRRA 1NWDA 2BCXA 1KFUS 3LK0A 1C7VA 5D69A 1GGZA 1B7TZ 5GQQC 2VRGA 3A8RA 1WRZA 1FW4A 1AJ5A 1G33A 2LV7A 2M8UA 2HF5A 2HQ8A 5AANA 1NYAA 1NCXA 2LNKA 2ZFDA 1WDCC 1MHOA 3ZWHA 1J1DA 1ZMZA 1RWYA 3WXAA 2M0RA 1CFPA 2RGIA 2WCFA 2JC2A 2L98A 3BUOB 2EGDA 1ZOTB 4JPZB 4UPGA 1QJTA 5KU1A 4MZJA 2KFGA 1TCFA 2MAZA 1BMOA 2LANA 2LMTA 3JVTC 3I5FC 1XFVO 1WLMA 1J7PA 1YVHA 1YVLA 2LC5A 2F2PA 2O5GA 3VRPA 1KQVA 1A2XA 1XYDA 5DKRA 1KSMA 1KWOC 3VRQA 2K2FA 2L5XB 1K90D 3AAKA 1FI6A 2WC8A 2KQ6A 1CTRA 2M29A 1XO5A 3KO0A 1AJ4A 1XVJA 1OMRA 2K61A 1CDNA 2OTGB 1CLLA 1MR8A 3WHUB 4CFQA 4FTGA 2JPTA 1JF0A 4N1GA 2LCPA 1U5IA 3CGAA 1UHHA 3CTNA 2Q91A 1YR5A 2Y1NA 4C0KA 1KFXS 3DVEA 1SK6D 4MVFA 3JTDC 4BY5A 1PSBA 3IQOA 2KYFA 2KBMA 5HLOA 2A4JA 1M39A 1PALA 1RK9A 1S1EA 3SG3A 1NX2A 1UHNA 3IF7A 2LP2A 1CM1A 3FWCA 4AQJA 2KI4B 2MA2A 1CM4A 3I5IC 2KNEA 4NDDA 3I5HB 3RLZA 1QV1A 4WQ3A 1DGVA 1NSHA 2ZKMX 2KAVA 1YX7A 5K89A 1KK7Z 1SR6C 3HCMA 4D1EA 3HX4A 1AUIB 3ZNIA 1CMFA 1XFYO 2M7NA 2EC6C 4YGBB 3O4YA 4HSZA 2JRFA 4I5NB 2CTNA 1LVCD 4L9MA 4DIRA 4F0ZB 2K7BA 2LM5A 2LE9B 4GBAA 1S3PA 3KPXA 2LHLA 4OV2A 1G4YR 3EK8A 1IG5A 4DS7A 3CR4X 4A4BA 2WNDA 1S5GY 1S6IA 2Q4UA 1YUTA 5HLVA 1M31A 1MQ1A 1QX5B 1WRKA 2I2RE 4I5LB 1RROA 1WDCB 1BJFA 1SCVA 2IS9A 1LINA 1QASA 3O78A 3OX6A 1F54A 1GGWA 2LHIA 1DJIA 3I5GC 3SJSA 1B7TY 5HKZA 3QRXA 2F3YA 5HKYA 2CBLA 1EG3A 1DJXA 1S6JA 3M0WA 1K9KA 1LA0A 2LUXA 3JVTB 3I5FB 1BODA 1DJGA 3PM8A 2JULA 5CSFA 1KQMB 2MBXA 5FYXA 1Y0VH 1B47A 2OS8C 2AMIA 1H8BA 1C07A 1IQ5A 1SKTA 2QPTA 4PHKA 1KWOB 1QLSA 1UP5A 5CSJA 1AK8A 1KFUL 1IKUA 1DTLA 2PMYA 2KBIA 1K8UA 2KGRA 3EVRA 3NSOA 1MUXA 3NSKA 1LXFC 4NDBA 5F6TA 4CLNA 3BUMB 1Y1AA 2MLEC 2JQ6A 1QIVA 1IH0A 2MLFC 3TS5C 4ETOA 1SMGA 3GK2A 1DJHA 1EJ3A 1ODBA 2KFFA 3PSRA 1OE9B 2ZRSA 4XJKA 3AKAA 2LLSA 1KFXL 4PHNA 1CMGA 1NPQA 2I94A 4HRHA 1PULA 3GK4X 2JNFA 1WY9A 3ICBA 4A4CA 1B9AA 1MF8B 5KSZA 2L4IA 1N2DA 4P2YB 3BYAA 4ZCUA 2JZIA 3I5IB 2EHBA 2LAPA 1JUOA 1NX3A 1RECA 1NCYA 4GAOA 2LMVA 1RJVA 1TIZA 2JTZA 5HYDA 2KAXA 3OHMB 2LLUA 3WHTB 2L51A 2EC6B 3BQ3A 2DOQA 3OB1B 1J1EA 1TOPA 3NSLA 4GFTA 3DF0B 2H61C 1XFZO 2BBNA 2CXJA 2KDHA 2F3ZA 5G08A 2KAYA 1OQPA 1S6CA 1C7WA 3PATA 1ZFSA 5DKQA 1KSOA 1KCYA 4P5OE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EVU A;  5AEQ A;  4ORB B;  2BCB A;  1MXL C;  1KK7 Y;  4YRU A;  2PSR A;  2MHH A;  1DJZ A;  1A4P A;  4PAL A;  1A03 A;  2E30 A;  2LUC A;  2M9G A;  1SYM A;  2K2A A;  1BG1 A;  2M3W A;  3DD4 A;  3BOW B;  1KK8 C;  3FIA A;  1ALW A;  1B8R A;  4M2P A;  2KFH A;  3BXK A;  4MEW A;  2ZRT A;  3I5G B;  1SW8 A;  4YGE B;  4PE7 A;  1IRJ A;  2ZNE A;  1OOJ A;  3LL8 B;  1PSR A;  2ZN8 A;  1BLQ A;  4MSP A;  3TZ1 A;  1BT6 A;  2BCA A;  2FCE A;  3PAL A;  1SPY A;  1L2O C;  1NCZ A;  2PVB A;  3PN7 C;  4XJK B;  1H4B A;  1B8L A;  1F4O A;  1N65 A;  3CS1 A;  2LLT A;  4Q04 A;  2OS8 B;  2QAC A;  2M1K B;  5J3X A;  1XFX O;  4MZK A;  2GV5 A;  2FCD A;  2WOR A;  2BBM A;  1DVI A;  3DVK A;  1OMD A;  4BY4 A;  1BR1 B;  5JJG A;  2JWW A;  2LMU A;  1UWO A;  4CID A;  3TDI A;  1J7Q A;  2K8M B;  4QJ5 B;  2JNX A;  2NCP A;  5I2O A;  2D8N A;  2COL B;  2M49 B;  2M7L A;  1SNL A;  2MJW B;  2WCB A;  1A29 A;  5I2Q A;  1PVA A;  1NX0 A;  1TNW A;  1N0Y A;  1EH2 A;  2K7D A;  1F4Q A;  4I5K A;  1K94 A;  1XK4 C;  1K9P A;  4WQ2 A;  2KI6 C;  1K93 D;  1V1F A;  2NLN A;  1WLZ A;  3PFV A;  3OP0 A;  5PAL A;  5CPV A;  2JT8 A;  2SAS A;  4GGF C;  1OZS A;  3TDU A;  1SL8 A;  5B8I B;  2M97 A;  4ICB A;  2M1U A;  2PAL A;  4TNC A;  4DRW A;  1EXR A;  5IBW A;  1Y6W A;  2BEC A;  1GJY A;  1OSA A;  4OVN F;  3BUN B;  3WNX B;  2L4H A;  1DT7 B;  1F70 A;  3RM1 A;  4ORC B;  3DF0 A;  1M46 A;  3EKH A;  5DKN A;  3SG2 A;  1E8A A;  5TNC A;  1RTP 1;  4PE0 A;  1TN4 A;  1JBA A;  1BR4 B;  1AP4 A;  3NXA A;  3TUY C;  2Y1M A;  3D10 A;  3K21 A;  3SG5 A;  2G2B A;  3AAJ A;  1F8H A;  1CDL A;  4JQ0 D;  4PHJ A;  3D0Y A;  4GGF A;  2FOT A;  1SRA A;  4MRY A;  5I8N A;  4YI8 A;  5AXI A;  3BOW A;  1ZAC A;  2JXL A;  4DCK A;  4AQI A;  1TTX A;  1XFU O;  3SIB A;  1CNP A;  1KK8 B;  1QAT A;  2SCP A;  1UUR A;  4PHM A;  2PAS A;  1QVI Z;  1NP8 A;  1JSA A;  2JT0 A;  1G8I A;  1BF5 A;  1IQ3 A;  1DF0 B;  1DJY A;  2JOJ A;  4MBE A;  3JTD B;  2HPS A;  4M2Q A;  2BKH B;  1K9U A;  2LP3 A;  2KI4 C;  1EL4 A;  4C0L A;  1L2O B;  2F33 A;  3FS7 A;  3MSE B;  2KGB C;  2I18 A;  1CLM A;  3PN7 B;  4MRX A;  1FPW A;  1JWD A;  3C1V A;  2KOT A;  1QXP A;  2LVJ A;  4OR9 B;  2TN4 A;  1AHR A;  1YRU B;  2V53 A;  2K7O A;  5HKW A;  2F8P A;  4YBH B;  1K95 A;  1FI5 A;  1K96 A;  2GGZ A;  1QLK A;  1UUS A;  3KEV A;  2NXQ A;  2L0P A;  2CNP A;  1B4C A;  3PLF B;  1SCM C;  1IJ5 A;  4FQO A;  1SR6 B;  2H2K A;  5KTY A;  1QIW A;  5ER4 X;  2WCE A;  2FJU B;  4MLW A;  4PDZ A;  4MN0 A;  4OCI A;  2LVI A;  3EKJ A;  2JU0 A;  1Y1X A;  3SG7 A;  1S26 D;  1S36 A;  2JT3 A;  2P6B B;  2NCO A;  3H4S E;  1UHK A;  3BUW B;  4GUK A;  1CFD A;  1BU3 A;  1UHJ A;  3LLE A;  2ZND A;  2Y4Q A;  4YGA A;  4OKH A;  1WRL A;  1ALV A;  1SL7 A;  2GGM A;  1QTX A;  3CR5 X;  4GGN A;  1FF1 A;  3D0Y B;  4PE4 A;  1M63 B;  1OZO A;  1CB1 A;  1GQM A;  1CFC A;  1NIW A;  2BE6 A;  5ER5 A;  4HRG A;  1YTZ C;  3GK1 A;  1CLB A;  2L2E A;  4PE1 A;  1DGU A;  2Y5I A;  4ORA B;  1CKK A;  4QJ3 B;  2BKI B;  3F45 A;  1Y1U A;  3FWB A;  2H61 A;  1KQM C;  3SIA A;  1QX7 A;  1EG4 A;  4IL1 A;  1J7O A;  1YUS A;  3AKB A;  1QS7 A;  1XA5 A;  2B1U A;  4XYN A;  1CDP A;  1HQV A;  1SBJ A;  4R1E A;  2F2O A;  3TUY B;  2G9B A;  1A75 A;  4GNK B;  2BL0 C;  1JC2 A;  2E6W A;  3VGO A;  3A4U B;  4CFR A;  1YUU A;  1RFJ A;  2KSP A;  2HQW A;  2OPO A;  1IWQ A;  1FBV A;  3E3R A;  3GOF A;  1TNX A;  1JFK A;  1R2U A;  4USL A;  1DF0 A;  1ZUZ A;  3TS5 B;  1W7J B;  3LK1 A;  4AOM A;  1CFF A;  1R6P A;  5JOL A;  1YUR A;  5BPJ A;  1SL9 A;  1HT9 A;  4PCW A;  4WRI A;  1YX8 A;  3BUX B;  4ZCV A;  2KYC A;  3VRN A;  4N1F A;  4MZL A;  4HRE E;  2PRU A;  4E68 A;  1QVI Y;  1QV0 A;  4I5J A;  3CR2 A;  1B8C A;  3EK7 A;  3EVV A;  2KHN A;  2K0J A;  1TNQ A;  3CZT X;  4JWQ A;  1SY9 A;  2AUC A;  1SCM B;  5AFP A;  1JFJ A;  1LA3 A;  1DMO A;  1UHI A;  4DUQ A;  5D7F A;  1PVB A;  3KF9 A;  3EK4 A;  1JF2 A;  3DVM A;  3O6B A;  2LVV A;  3O2P A;  4U8D A;  2I7A A;  3CLN A;  5AER A;  3TDZ A;  4GPL B;  1NX1 A;  1DJW A;  2KQY A;  1CDM A;  4CPV A;  4YGC B;  1XK4 A;  2JTT A;  2L50 A;  4YI9 A;  2R2I A;  1BOC A;  1MXE A;  1TRF A;  3CWG A;  2OTG C;  1QX2 A;  3SG6 A;  1VRK A;  3OX5 A;  1B1G A;  4NQG A;  4YGD B;  1A75 B;  3LCP C;  3OB2 B;  5CSN A;  4NDC A;  3NSI A;  3IQQ A;  1NUB A;  1PK0 D;  2JXC A;  1F71 A;  1U5I B;  1IJ6 A;  2LVK A;  4QJ4 B;  1V1G A;  2BE4 A;  1Q80 A;  3DVJ A;  2KI6 D;  1AVS A;  1W7I B;  1OMV A;  2ZN9 A;  1IGV A;  2K7C A;  2NZ0 A;  1PRW A;  1X02 A;  1J7R A;  1TCO B;  2ISD A;  2AAO A;  5I2L A;  3I5H C;  2HET A;  3SG4 A;  4C0J A;  2CCM A;  1J55 A;  1LKJ A;  2CT9 A;  2BL0 B;  1M45 A;  1S5G Z;  1L7Z A;  1F55 A;  4N5X A;  1D1O A;  3KHE A;  2O60 A;  1YRT B;  4M2O A;  5CSI A;  3VRO A;  1K2H A;  1MWN A;  1TNP A;  1XFW O;  2MRD A;  2WOS A;  3VRR A;  1NWD A;  2BCX A;  1KFU S;  3LK0 A;  1C7V A;  5D69 A;  1GGZ A;  1B7T Z;  5GQQ C;  2VRG A;  3A8R A;  1WRZ A;  1FW4 A;  1AJ5 A;  1G33 A;  2LV7 A;  2M8U A;  2HF5 A;  2HQ8 A;  5AAN A;  1NYA A;  1NCX A;  2LNK A;  2ZFD A;  1WDC C;  1MHO A;  3ZWH A;  1J1D A;  1ZMZ A;  1RWY A;  3WXA A;  2M0R A;  1CFP A;  2RGI A;  2WCF A;  2JC2 A;  2L98 A;  3BUO B;  2EGD A;  1ZOT B;  4JPZ B;  4UPG A;  1QJT A;  5KU1 A;  4MZJ A;  2KFG A;  1TCF A;  2MAZ A;  1BMO A;  2LAN A;  2LMT A;  3JVT C;  3I5F C;  1XFV O;  1WLM A;  1J7P A;  1YVH A;  1YVL A;  2LC5 A;  2F2P A;  2O5G A;  3VRP A;  1KQV A;  1A2X A;  1XYD A;  5DKR A;  1KSM A;  1KWO C;  3VRQ A;  2K2F A;  2L5X B;  1K90 D;  3AAK A;  1FI6 A;  2WC8 A;  2KQ6 A;  1CTR A;  2M29 A;  1XO5 A;  3KO0 A;  1AJ4 A;  1XVJ A;  1OMR A;  2K61 A;  1CDN A;  2OTG B;  1CLL A;  1MR8 A;  3WHU B;  4CFQ A;  4FTG A;  2JPT A;  1JF0 A;  4N1G A;  2LCP A;  1U5I A;  3CGA A;  1UHH A;  3CTN A;  2Q91 A;  1YR5 A;  2Y1N A;  4C0K A;  1KFX S;  3DVE A;  1SK6 D;  4MVF A;  3JTD C;  4BY5 A;  1PSB A;  3IQO A;  2KYF A;  2KBM A;  5HLO A;  2A4J A;  1M39 A;  1PAL A;  1RK9 A;  1S1E A;  3SG3 A;  1NX2 A;  1UHN A;  3IF7 A;  2LP2 A;  1CM1 A;  3FWC A;  4AQJ A;  2KI4 B;  2MA2 A;  1CM4 A;  3I5I C;  2KNE A;  4NDD A;  3I5H B;  3RLZ A;  1QV1 A;  4WQ3 A;  1DGV A;  1NSH A;  2ZKM X;  2KAV A;  1YX7 A;  5K89 A;  1KK7 Z;  1SR6 C;  3HCM A;  4D1E A;  3HX4 A;  1AUI B;  3ZNI A;  1CMF A;  1XFY O;  2M7N A;  2EC6 C;  4YGB B;  3O4Y A;  4HSZ A;  2JRF A;  4I5N B;  2CTN A;  1LVC D;  4L9M A;  4DIR A;  4F0Z B;  2K7B A;  2LM5 A;  2LE9 B;  4GBA A;  1S3P A;  3KPX A;  2LHL A;  4OV2 A;  1G4Y R;  3EK8 A;  1IG5 A;  4DS7 A;  3CR4 X;  4A4B A;  2WND A;  1S5G Y;  1S6I A;  2Q4U A;  1YUT A;  5HLV A;  1M31 A;  1MQ1 A;  1QX5 B;  1WRK A;  2I2R E;  4I5L B;  1RRO A;  1WDC B;  1BJF A;  1SCV A;  2IS9 A;  1LIN A;  1QAS A;  3O78 A;  3OX6 A;  1F54 A;  1GGW A;  2LHI A;  1DJI A;  3I5G C;  3SJS A;  1B7T Y;  5HKZ A;  3QRX A;  2F3Y A;  5HKY A;  2CBL A;  1EG3 A;  1DJX A;  1S6J A;  3M0W A;  1K9K A;  1LA0 A;  2LUX A;  3JVT B;  3I5F B;  1BOD A;  1DJG A;  3PM8 A;  2JUL A;  5CSF A;  1KQM B;  2MBX A;  5FYX A;  1Y0V H;  1B47 A;  2OS8 C;  2AMI A;  1H8B A;  1C07 A;  1IQ5 A;  1SKT A;  2QPT A;  4PHK A;  1KWO B;  1QLS A;  1UP5 A;  5CSJ A;  1AK8 A;  1KFU L;  1IKU A;  1DTL A;  2PMY A;  2KBI A;  1K8U A;  2KGR A;  3EVR A;  3NSO A;  1MUX A;  3NSK A;  1LXF C;  4NDB A;  5F6T A;  4CLN A;  3BUM B;  1Y1A A;  2MLE C;  2JQ6 A;  1QIV A;  1IH0 A;  2MLF C;  3TS5 C;  4ETO A;  1SMG A;  3GK2 A;  1DJH A;  1EJ3 A;  1ODB A;  2KFF A;  3PSR A;  1OE9 B;  2ZRS A;  4XJK A;  3AKA A;  2LLS A;  1KFX L;  4PHN A;  1CMG A;  1NPQ A;  2I94 A;  4HRH A;  1PUL A;  3GK4 X;  2JNF A;  1WY9 A;  3ICB A;  4A4C A;  1B9A A;  1MF8 B;  5KSZ A;  2L4I A;  1N2D A;  4P2Y B;  3BYA A;  4ZCU A;  2JZI A;  3I5I B;  2EHB A;  2LAP A;  1JUO A;  1NX3 A;  1REC A;  1NCY A;  4GAO A;  2LMV A;  1RJV A;  1TIZ A;  2JTZ A;  5HYD A;  2KAX A;  3OHM B;  2LLU A;  3WHT B;  2L51 A;  2EC6 B;  3BQ3 A;  2DOQ A;  3OB1 B;  1J1E A;  1TOP A;  3NSL A;  4GFT A;  3DF0 B;  2H61 C;  1XFZ O;  2BBN A;  2CXJ A;  2KDH A;  2F3Z A;  5G08 A;  2KAY A;  1OQP A;  1S6C A;  1C7W A;  3PAT A;  1ZFS A;  5DKQ A;  1KSO A;  1KCY A;  4P5O E; 
#chains in the Genus database with same CATH topology
 3EVU A;  5AEQ A;  4ORB B;  2BCB A;  1MXL C;  1KK7 Y;  3BFA A;  4YRU A;  2PSR A;  1DQE A;  2MHH A;  1DJZ A;  1A4P A;  4PAL A;  1A03 A;  2E30 A;  2LUC A;  2M9G A;  3SS3 A;  1SYM A;  2K2A A;  1BG1 A;  2M3W A;  3DD4 A;  3BOW B;  1KK8 C;  3FIA A;  1ALW A;  1B8R A;  4M2P A;  3BFB A;  2KFH A;  3BXK A;  4MEW A;  2ZRT A;  3I5G B;  1SW8 A;  4YGE B;  4PE7 A;  1IRJ A;  2ZNE A;  1OOJ A;  3LL8 B;  1PSR A;  2ZN8 A;  1BLQ A;  4MSP A;  3TZ1 A;  1BT6 A;  2BCA A;  2FCE A;  3PAL A;  1SPY A;  1L2O C;  1NCZ A;  2PVB A;  3PN7 C;  4XJK B;  1H4B A;  1B8L A;  1F4O A;  1N65 A;  3CS1 A;  1Z4H A;  2LLT A;  4Q04 A;  2OS8 B;  2QAC A;  2M1K B;  5J3X A;  1XFX O;  4MZK A;  2GV5 A;  2FCD A;  2WOR A;  2BBM A;  1DVI A;  3DVK A;  1OMD A;  4BY4 A;  1BR1 B;  5JJG A;  2JWW A;  1QWV A;  2LMU A;  1UWO A;  4CID A;  3TDI A;  1J7Q A;  2K8M B;  3FE9 A;  1TWO A;  4QJ5 B;  2JNX A;  2NCP A;  5I2O A;  2D8N A;  2COL B;  2M49 B;  3D77 A;  2M7L A;  1SNL A;  2MJW B;  2WCB A;  1A29 A;  4OZD A;  1PVA A;  5I2Q A;  1NX0 A;  1TNW A;  1N0Y A;  2K60 A;  1EH2 A;  2K7D A;  1F4Q A;  4I5K A;  1K94 A;  3NHI A;  5EL2 A;  1XK4 C;  1K9P A;  2FJY A;  4WQ2 A;  1T14 A;  2KI6 C;  1K93 D;  1V1F A;  2ERB A;  2NLN A;  3EG5 B;  1WLZ A;  3PFV A;  3OP0 A;  5PAL A;  5CPV A;  2JT8 A;  2SAS A;  4GGF C;  1OZS A;  3TDU A;  3VB1 A;  1SL8 A;  5B8I B;  2M97 A;  4ICB A;  2M1U A;  2PAL A;  4TNC A;  4DRW A;  1EXR A;  5IBW A;  1Y6W A;  2BEC A;  1GJY A;  1OSA A;  4OVN F;  3BUN B;  3WNX B;  2L4H A;  3FE6 A;  1DT7 B;  3RM1 A;  1F70 A;  4ORC B;  3DF0 A;  1M46 A;  3EKH A;  5DKN A;  3SG2 A;  1E8A A;  5TNC A;  1RTP 1;  4PE0 A;  1TN4 A;  1JBA A;  1BR4 B;  1AP4 A;  3FE8 A;  3NXA A;  3R1P A;  2Y1M A;  3D10 A;  3K21 A;  2GTE A;  3SG5 A;  3TUY C;  2G2B A;  3AAJ A;  1F8H A;  2QEB A;  1CDL A;  4JQ0 D;  2YGU A;  4PHJ A;  1OOG A;  3D0Y A;  4GGF A;  2FOT A;  2BNX A;  1SRA A;  4MRY A;  5I8N A;  4YI8 A;  5AXI A;  3BOW A;  1ZAC A;  2JXL A;  3O4X A;  4DCK A;  4AQI A;  1TTX A;  1XFU O;  3SIB A;  1CNP A;  1KK8 B;  1QAT A;  2SCP A;  1UUR A;  4PHM A;  3DZT A;  3SS5 A;  2PAS A;  1QVI Z;  1NP8 A;  3V2L A;  1JSA A;  2JT0 A;  1G8I A;  1BF5 A;  1IQ3 A;  1DF0 B;  1DJY A;  2JOJ A;  4MBE A;  3JTD B;  2HPS A;  4M2Q A;  4INX A;  2BKH B;  1K9U A;  2LP3 A;  2KI4 C;  1EL4 A;  2P71 A;  4C0L A;  1L2O B;  2F33 A;  3FS7 A;  3MSE B;  2KGB C;  2I18 A;  1CLM A;  3PN7 B;  4MRX A;  1FPW A;  1JWD A;  3C1V A;  2KOT A;  1QXP A;  2LVJ A;  4OR9 B;  2TN4 A;  1AHR A;  1YRU B;  2V53 A;  2K7O A;  3D76 A;  5HKW A;  2F8P A;  4YBH B;  1K95 A;  1FI5 A;  1K96 A;  2GGZ A;  1QLK A;  1UUS A;  3KEV A;  2NXQ A;  2L0P A;  2CNP A;  1B4C A;  3PLF B;  1SCM C;  1IJ5 A;  4FQO A;  1SR6 B;  2H2K A;  5KTY A;  1QIW A;  5ER4 X;  1OOH A;  2FJU B;  2WCE A;  4MLW A;  4PDZ A;  4MN0 A;  4OCI A;  2LVI A;  4F7F A;  3EKJ A;  2JU0 A;  2JPO A;  4PT1 A;  3OBV A;  1Y1X A;  3SG7 A;  1S26 D;  2WCM A;  1S36 A;  2JT3 A;  2P6B B;  2NCO A;  3R1O A;  3H4S E;  1UHK A;  3BUW B;  4GUK A;  1CFD A;  1BU3 A;  1UHJ A;  3LLE A;  3R1V A;  2ZND A;  2Y4Q A;  4YGA A;  3DY9 A;  4OKH A;  1WRL A;  1ALV A;  1SL7 A;  2GGM A;  1QTX A;  3CR5 X;  4GGN A;  1OOF A;  1FF1 A;  3D0Y B;  4PE4 A;  1M63 B;  1OZO A;  4KYN A;  1CB1 A;  1GQM A;  1CFC A;  1NIW A;  2BE6 A;  1DEL A;  3K1E A;  5ER5 A;  4HRG A;  1YTZ C;  3GK1 A;  1CLB A;  2L2E A;  4PE1 A;  1DGU A;  2Y5I A;  4ORA B;  1CKK A;  1SSE B;  1TUZ A;  2BKI B;  3F45 A;  1Y1U A;  3FWB A;  4QJ3 B;  2H61 A;  1KQM C;  5FI7 A;  3SIA A;  1QX7 A;  1EG4 A;  4IL1 A;  1J7O A;  1YUS A;  1LS8 A;  3AKB A;  1QS7 A;  1XA5 A;  3D74 A;  2B1U A;  4XYN A;  1CDP A;  1HQV A;  2QEV A;  1SBJ A;  4R1E A;  2F2O A;  3SS4 A;  3TUY B;  2G9B A;  1A75 A;  4GNK B;  2BL0 C;  1JC2 A;  2E6W A;  3VGO A;  3A4U B;  4CFR A;  1YUU A;  1RFJ A;  3CDN A;  2KSP A;  2HQW A;  2OPO A;  3L4L A;  1IWQ A;  1FBV A;  3E3R A;  3GOF A;  1TNX A;  1JFK A;  2WCJ A;  1R2U A;  4USL A;  1DF0 A;  1ZUZ A;  3TS5 B;  3UO9 A;  1W7J B;  3LK1 A;  4AOM A;  1CFF A;  3B88 A;  4FQT A;  1R6P A;  5JOL A;  1YUR A;  5BPJ A;  1SL9 A;  1HT9 A;  3BFH A;  4PCW A;  4WRI A;  1YX8 A;  3BUX B;  4ZCV A;  2KYC A;  1IKU A;  3VRN A;  4N1F A;  4MZL A;  4HRE E;  1Z2C B;  2PRU A;  4E68 A;  1QVI Y;  1QV0 A;  4I5J A;  3CR2 A;  1B8C A;  3EK7 A;  3EVV A;  5HL1 A;  2KHN A;  2K0J A;  1TNQ A;  3CZT X;  3D73 A;  4JWQ A;  1SY9 A;  2AUC A;  1SCM B;  3S0G A;  5AFP A;  1JFJ A;  1LA3 A;  1DMO A;  2PYQ A;  1UHI A;  4DUQ A;  5D7F A;  1PVB A;  3KF9 A;  3EK4 A;  1JF2 A;  3DVM A;  3O6B A;  3PM2 A;  2LVV A;  3O2P A;  4U8D A;  2I7A A;  3CLN A;  5AER A;  3TDZ A;  4GPL B;  1NX1 A;  1DJW A;  2KQY A;  1CDM A;  4CPV A;  4YGC B;  1XK4 A;  2JTT A;  2L50 A;  4YI9 A;  2R2I A;  1BOC A;  1MXE A;  1TRF A;  3CWG A;  2OTG C;  2P70 A;  1QX2 A;  3Q8I A;  1VRK A;  3OX5 A;  3SG6 A;  1B1G A;  4NQG A;  4YGD B;  1A75 B;  3LCP C;  3OB2 B;  5CSN A;  4NDC A;  3NSI A;  3IQQ A;  1NUB A;  1PK0 D;  2PQL A;  3S0F A;  2JXC A;  1F71 A;  1OW4 A;  1U5I B;  1W9Z A;  1IJ6 A;  2LVK A;  4QJ4 B;  1V1G A;  2BE4 A;  1Q80 A;  3CYZ A;  3DVJ A;  2KI6 D;  1AVS A;  1W7I B;  1OMV A;  2ZN9 A;  1IGV A;  1C3Y A;  2K7C A;  2NZ0 A;  1PRW A;  1X02 A;  1J7R A;  1TCO B;  2ISD A;  2AAO A;  5I2L A;  3I5H C;  2HET A;  3SG4 A;  4C0J A;  2CCM A;  1J55 A;  1LKJ A;  2CT9 A;  4JKT A;  2BL0 B;  3D75 A;  1M45 A;  1S5G Z;  1L7Z A;  1F55 A;  4N5X A;  1D1O A;  3KHE A;  2O60 A;  1YRT B;  4M2O A;  5CSI A;  2KPH A;  3VRO A;  1K2H A;  1MWN A;  1TNP A;  1XFW O;  2MRD A;  2WOS A;  3VRR A;  3S0E A;  1NWD A;  2BCX A;  1KFU S;  1P28 A;  2QEH A;  3BJH A;  3LK0 A;  1C7V A;  5D69 A;  1GGZ A;  1B7T Z;  3RZS A;  5GQQ C;  2VRG A;  3A8R A;  1WRZ A;  1FW4 A;  1AJ5 A;  1G33 A;  2LV7 A;  2M8U A;  2HF5 A;  2HQ8 A;  5AAN A;  1NYA A;  1NCX A;  2LNK A;  2ZFD A;  1WDC C;  1MHO A;  3ZWH A;  1J1D A;  1ZMZ A;  1RWY A;  3WXA A;  2M0R A;  1CFP A;  2RGI A;  2WCF A;  2JC2 A;  2L98 A;  3BUO B;  2EGD A;  1ZOT B;  4JPZ B;  4UPG A;  1QJT A;  5KU1 A;  4MZJ A;  2KFG A;  3B6X A;  1TCF A;  5DIC A;  2MAZ A;  1BMO A;  2LAN A;  2LMT A;  3OGN A;  3JVT C;  3I5F C;  1XFV O;  1WLM A;  1J7P A;  1YVH A;  1YVL A;  2LC5 A;  2F2P A;  2O5G A;  3VRP A;  1KQV A;  1A2X A;  1XYD A;  3PJI A;  2H8V A;  5DKR A;  1KSM A;  1KWO C;  2BAP A;  2K2F A;  2L5X B;  1K90 D;  3AAK A;  3VRQ A;  1FI6 A;  2WC8 A;  2L5Y A;  2KQ6 A;  1CTR A;  2M29 A;  1XO5 A;  1GM0 A;  3KO0 A;  1AJ4 A;  3S0B A;  1XVJ A;  1OMR A;  2K61 A;  1CDN A;  2OTG B;  1CLL A;  1MR8 A;  3WHU B;  4CFQ A;  4FTG A;  2JPT A;  1JF0 A;  4N1G A;  2LCP A;  1U5I A;  3CGA A;  1UHH A;  3CTN A;  2Q91 A;  1YR5 A;  2Y1N A;  4C0K A;  2WC6 A;  1KFX S;  3DVE A;  1SK6 D;  3NGV A;  4MVF A;  3D78 A;  3JTD C;  4BY5 A;  1PSB A;  1OOI X;  5D3O A;  3IQO A;  2KYF A;  2KBM A;  5HLO A;  2A4J A;  1M39 A;  1PAL A;  1RK9 A;  1S1E A;  3DXL A;  3SG3 A;  1NX2 A;  1UHN A;  3IF7 A;  2LP2 A;  1CM1 A;  3B7A A;  3FWC A;  4AQJ A;  2KI4 B;  2MA2 A;  1CM4 A;  3I5I C;  2KNE A;  4NDD A;  2WCL A;  3IVT A;  3I5H B;  3RLZ A;  1QV1 A;  4WQ3 A;  1DGV A;  1NSH A;  2ZKM X;  2KAV A;  3CAB A;  1YX7 A;  5K89 A;  1KK7 Z;  1SR6 C;  3CZ1 A;  3HCM A;  4D1E A;  3HX4 A;  1TUJ A;  1AUI B;  3ZNI A;  1CMF A;  1XFY O;  1DC1 A;  2M7N A;  2EC6 C;  4YGB B;  3O4Y A;  4HSZ A;  2JRF A;  4I5N B;  2CTN A;  2WCH A;  1LVC D;  1XFR A;  2KLD A;  4L9M A;  2K7B A;  4DIR A;  4F0Z B;  2LM5 A;  2LE9 B;  1DEK A;  1S3P A;  4GBA A;  3KPX A;  2LHL A;  1ORG A;  4OV2 A;  1G4Y R;  3EK8 A;  1IG5 A;  5FI6 A;  4DS7 A;  3CR4 X;  4A4B A;  2WND A;  1S5G Y;  1S6I A;  2Q4U A;  1YUT A;  5HLV A;  1M31 A;  1MQ1 A;  1QX5 B;  1WRK A;  2I2R E;  4I5L B;  2QEO A;  1RRO A;  3B87 A;  1WDC B;  1BJF A;  1SCV A;  2IS9 A;  1LIN A;  1QAS A;  3O78 A;  3OX6 A;  2L2C A;  1F54 A;  2LHI A;  1GGW A;  1DJI A;  3I5G C;  2KLE A;  3SJS A;  1B7T Y;  5HKZ A;  2QDI A;  3QRX A;  2F3Y A;  5HKY A;  2CBL A;  1EG3 A;  1DJX A;  3N7H A;  1S6J A;  3L4A A;  1K9K A;  3M0W A;  1LA0 A;  2LUX A;  3JVT B;  3I5F B;  1BOD A;  1DJG A;  3PM8 A;  2JUL A;  3CZ0 A;  5CSF A;  1KQM B;  2MBX A;  5FYX A;  1Y0V H;  1B47 A;  2OS8 C;  2AMI A;  1H8B A;  1C07 A;  1IQ5 A;  1SKT A;  2QPT A;  4PHK A;  1KWO B;  1QLS A;  1UP5 A;  5CSJ A;  1AK8 A;  1KFU L;  3R72 A;  1DTL A;  2PMY A;  2KBI A;  1K8U A;  2KGR A;  2WC5 A;  3DYE A;  1MUX A;  3EVR A;  3NSO A;  3NSK A;  3S0D A;  4IJ7 A;  1LXF C;  4NDB A;  5F6T A;  4CLN A;  3BUM B;  1Y1A A;  1C3Z A;  2MLE C;  2JQ6 A;  1QIV A;  1IH0 A;  2MLF C;  3TS5 C;  4INW A;  4ETO A;  1SMG A;  3B86 A;  3GK2 A;  1DJH A;  1EJ3 A;  1ODB A;  2KFF A;  3PSR A;  1OE9 B;  5FI2 A;  2ZRS A;  4XJK A;  3AKA A;  2LLS A;  1KFX L;  4PHN A;  1CMG A;  1NPQ A;  2I94 A;  4HRH A;  5I94 A;  1PUL A;  3GK4 X;  2JNF A;  1WY9 A;  1IIO A;  2WCK A;  4JD9 A;  3ICB A;  4A4C A;  1B9A A;  1MF8 B;  5KSZ A;  3UNW A;  2L4I A;  1N2D A;  4P2Y B;  3BYA A;  3L47 A;  3CZ2 A;  4ZCU A;  2JZI A;  3I5I B;  2EHB A;  2LAP A;  1JUO A;  3QME A;  1NX3 A;  1REC A;  1NCY A;  3NHT A;  4GAO A;  2LMV A;  1RJV A;  1TIZ A;  2JTZ A;  5HYD A;  2KAX A;  3OHM B;  2LLU A;  3WHT B;  2L51 A;  2EC6 B;  3BQ3 A;  2DOQ A;  3OB1 B;  1J1E A;  1TOP A;  3NSL A;  4GFT A;  3DF0 B;  2H61 C;  1XFZ O;  2BBN A;  2CXJ A;  2KDH A;  2F3Z A;  5G08 A;  2KAY A;  1OQP A;  1S6C A;  1C7W A;  3PAT A;  1ZFS A;  5DKQ A;  1KSO A;  3S0A A;  1KCY A;  4P5O E; 
#chains in the Genus database with same CATH homology
 3EVU A;  5AEQ A;  4ORB B;  2BCB A;  1MXL C;  1KK7 Y;  4YRU A;  2PSR A;  2MHH A;  1DJZ A;  1A4P A;  4PAL A;  1A03 A;  2E30 A;  2LUC A;  2M9G A;  1SYM A;  2K2A A;  1BG1 A;  2M3W A;  3DD4 A;  3BOW B;  1KK8 C;  3FIA A;  1ALW A;  1B8R A;  4M2P A;  2KFH A;  3BXK A;  4MEW A;  2ZRT A;  3I5G B;  1SW8 A;  4YGE B;  4PE7 A;  1IRJ A;  2ZNE A;  1OOJ A;  3LL8 B;  1PSR A;  2ZN8 A;  1BLQ A;  4MSP A;  3TZ1 A;  1BT6 A;  2BCA A;  2FCE A;  3PAL A;  1SPY A;  1L2O C;  1NCZ A;  2PVB A;  3PN7 C;  4XJK B;  1H4B A;  1B8L A;  1F4O A;  1N65 A;  3CS1 A;  2LLT A;  4Q04 A;  2OS8 B;  2QAC A;  2M1K B;  5J3X A;  1XFX O;  4MZK A;  2GV5 A;  2FCD A;  2WOR A;  2BBM A;  1DVI A;  3DVK A;  1OMD A;  4BY4 A;  1BR1 B;  5JJG A;  2JWW A;  2LMU A;  1UWO A;  4CID A;  3TDI A;  1J7Q A;  2K8M B;  4QJ5 B;  2JNX A;  2NCP A;  5I2O A;  2D8N A;  2COL B;  2M49 B;  2M7L A;  1SNL A;  2MJW B;  2WCB A;  1A29 A;  5I2Q A;  1PVA A;  1NX0 A;  1TNW A;  1N0Y A;  1EH2 A;  2K7D A;  1F4Q A;  4I5K A;  1K94 A;  1XK4 C;  1K9P A;  4WQ2 A;  2KI6 C;  1K93 D;  1V1F A;  2NLN A;  1WLZ A;  3PFV A;  3OP0 A;  5PAL A;  5CPV A;  2JT8 A;  2SAS A;  4GGF C;  1OZS A;  3TDU A;  1SL8 A;  5B8I B;  2M97 A;  4ICB A;  2M1U A;  2PAL A;  4TNC A;  4DRW A;  1EXR A;  5IBW A;  1Y6W A;  2BEC A;  1GJY A;  1OSA A;  4OVN F;  3BUN B;  3WNX B;  2L4H A;  1DT7 B;  1F70 A;  3RM1 A;  4ORC B;  3DF0 A;  1M46 A;  3EKH A;  5DKN A;  3SG2 A;  1E8A A;  5TNC A;  1RTP 1;  4PE0 A;  1TN4 A;  1JBA A;  1BR4 B;  1AP4 A;  3NXA A;  3TUY C;  2Y1M A;  3D10 A;  3K21 A;  3SG5 A;  2G2B A;  3AAJ A;  1F8H A;  1CDL A;  4JQ0 D;  4PHJ A;  3D0Y A;  4GGF A;  2FOT A;  1SRA A;  4MRY A;  5I8N A;  4YI8 A;  5AXI A;  3BOW A;  1ZAC A;  2JXL A;  4DCK A;  4AQI A;  1TTX A;  1XFU O;  3SIB A;  1CNP A;  1KK8 B;  1QAT A;  2SCP A;  1UUR A;  4PHM A;  2PAS A;  1QVI Z;  1NP8 A;  1JSA A;  2JT0 A;  1G8I A;  1BF5 A;  1IQ3 A;  1DF0 B;  1DJY A;  2JOJ A;  4MBE A;  3JTD B;  2HPS A;  4M2Q A;  2BKH B;  1K9U A;  2LP3 A;  2KI4 C;  1EL4 A;  4C0L A;  1L2O B;  2F33 A;  3FS7 A;  3MSE B;  2KGB C;  2I18 A;  1CLM A;  3PN7 B;  4MRX A;  1FPW A;  1JWD A;  3C1V A;  2KOT A;  1QXP A;  2LVJ A;  4OR9 B;  2TN4 A;  1AHR A;  1YRU B;  2V53 A;  2K7O A;  5HKW A;  2F8P A;  4YBH B;  1K95 A;  1FI5 A;  1K96 A;  2GGZ A;  1QLK A;  1UUS A;  3KEV A;  2NXQ A;  2L0P A;  2CNP A;  1B4C A;  3PLF B;  1SCM C;  1IJ5 A;  4FQO A;  1SR6 B;  2H2K A;  5KTY A;  1QIW A;  5ER4 X;  2WCE A;  2FJU B;  4MLW A;  4PDZ A;  4MN0 A;  4OCI A;  2LVI A;  3EKJ A;  2JU0 A;  1Y1X A;  3SG7 A;  1S26 D;  1S36 A;  2JT3 A;  2P6B B;  2NCO A;  3H4S E;  1UHK A;  3BUW B;  4GUK A;  1CFD A;  1BU3 A;  1UHJ A;  3LLE A;  2ZND A;  2Y4Q A;  4YGA A;  4OKH A;  1WRL A;  1ALV A;  1SL7 A;  2GGM A;  1QTX A;  3CR5 X;  4GGN A;  1FF1 A;  3D0Y B;  4PE4 A;  1M63 B;  1OZO A;  1CB1 A;  1GQM A;  1CFC A;  1NIW A;  2BE6 A;  5ER5 A;  4HRG A;  1YTZ C;  3GK1 A;  1CLB A;  2L2E A;  4PE1 A;  1DGU A;  2Y5I A;  4ORA B;  1CKK A;  4QJ3 B;  2BKI B;  3F45 A;  1Y1U A;  3FWB A;  2H61 A;  1KQM C;  3SIA A;  1QX7 A;  1EG4 A;  4IL1 A;  1J7O A;  1YUS A;  3AKB A;  1QS7 A;  1XA5 A;  2B1U A;  4XYN A;  1CDP A;  1HQV A;  1SBJ A;  4R1E A;  2F2O A;  3TUY B;  2G9B A;  1A75 A;  4GNK B;  2BL0 C;  1JC2 A;  2E6W A;  3VGO A;  3A4U B;  4CFR A;  1YUU A;  1RFJ A;  2KSP A;  2HQW A;  2OPO A;  1IWQ A;  1FBV A;  3E3R A;  3GOF A;  1TNX A;  1JFK A;  1R2U A;  4USL A;  1DF0 A;  1ZUZ A;  3TS5 B;  1W7J B;  3LK1 A;  4AOM A;  1CFF A;  1R6P A;  5JOL A;  1YUR A;  5BPJ A;  1SL9 A;  1HT9 A;  4PCW A;  4WRI A;  1YX8 A;  3BUX B;  4ZCV A;  2KYC A;  3VRN A;  4N1F A;  4MZL A;  4HRE E;  2PRU A;  4E68 A;  1QVI Y;  1QV0 A;  4I5J A;  3CR2 A;  1B8C A;  3EK7 A;  3EVV A;  2KHN A;  2K0J A;  1TNQ A;  3CZT X;  4JWQ A;  1SY9 A;  2AUC A;  1SCM B;  5AFP A;  1JFJ A;  1LA3 A;  1DMO A;  1UHI A;  4DUQ A;  5D7F A;  1PVB A;  3KF9 A;  3EK4 A;  1JF2 A;  3DVM A;  3O6B A;  2LVV A;  3O2P A;  4U8D A;  2I7A A;  3CLN A;  5AER A;  3TDZ A;  4GPL B;  1NX1 A;  1DJW A;  2KQY A;  1CDM A;  4CPV A;  4YGC B;  1XK4 A;  2JTT A;  2L50 A;  4YI9 A;  2R2I A;  1BOC A;  1MXE A;  1TRF A;  3CWG A;  2OTG C;  1QX2 A;  3SG6 A;  1VRK A;  3OX5 A;  1B1G A;  4NQG A;  4YGD B;  1A75 B;  3LCP C;  3OB2 B;  5CSN A;  4NDC A;  3NSI A;  3IQQ A;  1NUB A;  1PK0 D;  2JXC A;  1F71 A;  1U5I B;  1IJ6 A;  2LVK A;  4QJ4 B;  1V1G A;  2BE4 A;  1Q80 A;  3DVJ A;  2KI6 D;  1AVS A;  1W7I B;  1OMV A;  2ZN9 A;  1IGV A;  2K7C A;  2NZ0 A;  1PRW A;  1X02 A;  1J7R A;  1TCO B;  2ISD A;  2AAO A;  5I2L A;  3I5H C;  2HET A;  3SG4 A;  4C0J A;  2CCM A;  1J55 A;  1LKJ A;  2CT9 A;  2BL0 B;  1M45 A;  1S5G Z;  1L7Z A;  1F55 A;  4N5X A;  1D1O A;  3KHE A;  2O60 A;  1YRT B;  4M2O A;  5CSI A;  3VRO A;  1K2H A;  1MWN A;  1TNP A;  1XFW O;  2MRD A;  2WOS A;  3VRR A;  1NWD A;  2BCX A;  1KFU S;  3LK0 A;  1C7V A;  5D69 A;  1GGZ A;  1B7T Z;  5GQQ C;  2VRG A;  3A8R A;  1WRZ A;  1FW4 A;  1AJ5 A;  1G33 A;  2LV7 A;  2M8U A;  2HF5 A;  2HQ8 A;  5AAN A;  1NYA A;  1NCX A;  2LNK A;  2ZFD A;  1WDC C;  1MHO A;  3ZWH A;  1J1D A;  1ZMZ A;  1RWY A;  3WXA A;  2M0R A;  1CFP A;  2RGI A;  2WCF A;  2JC2 A;  2L98 A;  3BUO B;  2EGD A;  1ZOT B;  4JPZ B;  4UPG A;  1QJT A;  5KU1 A;  4MZJ A;  2KFG A;  1TCF A;  2MAZ A;  1BMO A;  2LAN A;  2LMT A;  3JVT C;  3I5F C;  1XFV O;  1WLM A;  1J7P A;  1YVH A;  1YVL A;  2LC5 A;  2F2P A;  2O5G A;  3VRP A;  1KQV A;  1A2X A;  1XYD A;  5DKR A;  1KSM A;  1KWO C;  3VRQ A;  2K2F A;  2L5X B;  1K90 D;  3AAK A;  1FI6 A;  2WC8 A;  2KQ6 A;  1CTR A;  2M29 A;  1XO5 A;  3KO0 A;  1AJ4 A;  1XVJ A;  1OMR A;  2K61 A;  1CDN A;  2OTG B;  1CLL A;  1MR8 A;  3WHU B;  4CFQ A;  4FTG A;  2JPT A;  1JF0 A;  4N1G A;  2LCP A;  1U5I A;  3CGA A;  1UHH A;  3CTN A;  2Q91 A;  1YR5 A;  2Y1N A;  4C0K A;  1KFX S;  3DVE A;  1SK6 D;  4MVF A;  3JTD C;  4BY5 A;  1PSB A;  3IQO A;  2KYF A;  2KBM A;  5HLO A;  2A4J A;  1M39 A;  1PAL A;  1RK9 A;  1S1E A;  3SG3 A;  1NX2 A;  1UHN A;  3IF7 A;  2LP2 A;  1CM1 A;  3FWC A;  4AQJ A;  2KI4 B;  2MA2 A;  1CM4 A;  3I5I C;  2KNE A;  4NDD A;  3I5H B;  3RLZ A;  1QV1 A;  4WQ3 A;  1DGV A;  1NSH A;  2ZKM X;  2KAV A;  1YX7 A;  5K89 A;  1KK7 Z;  1SR6 C;  3HCM A;  4D1E A;  3HX4 A;  1AUI B;  3ZNI A;  1CMF A;  1XFY O;  2M7N A;  2EC6 C;  4YGB B;  3O4Y A;  4HSZ A;  2JRF A;  4I5N B;  2CTN A;  1LVC D;  4L9M A;  4DIR A;  4F0Z B;  2K7B A;  2LM5 A;  2LE9 B;  4GBA A;  1S3P A;  3KPX A;  2LHL A;  4OV2 A;  1G4Y R;  3EK8 A;  1IG5 A;  4DS7 A;  3CR4 X;  4A4B A;  2WND A;  1S5G Y;  1S6I A;  2Q4U A;  1YUT A;  5HLV A;  1M31 A;  1MQ1 A;  1QX5 B;  1WRK A;  2I2R E;  4I5L B;  1RRO A;  1WDC B;  1BJF A;  1SCV A;  2IS9 A;  1LIN A;  1QAS A;  3O78 A;  3OX6 A;  1F54 A;  1GGW A;  2LHI A;  1DJI A;  3I5G C;  3SJS A;  1B7T Y;  5HKZ A;  3QRX A;  2F3Y A;  5HKY A;  2CBL A;  1EG3 A;  1DJX A;  1S6J A;  3M0W A;  1K9K A;  1LA0 A;  2LUX A;  3JVT B;  3I5F B;  1BOD A;  1DJG A;  3PM8 A;  2JUL A;  5CSF A;  1KQM B;  2MBX A;  5FYX A;  1Y0V H;  1B47 A;  2OS8 C;  2AMI A;  1H8B A;  1C07 A;  1IQ5 A;  1SKT A;  2QPT A;  4PHK A;  1KWO B;  1QLS A;  1UP5 A;  5CSJ A;  1AK8 A;  1KFU L;  1IKU A;  1DTL A;  2PMY A;  2KBI A;  1K8U A;  2KGR A;  3EVR A;  3NSO A;  1MUX A;  3NSK A;  1LXF C;  4NDB A;  5F6T A;  4CLN A;  3BUM B;  1Y1A A;  2MLE C;  2JQ6 A;  1QIV A;  1IH0 A;  2MLF C;  3TS5 C;  4ETO A;  1SMG A;  3GK2 A;  1DJH A;  1EJ3 A;  1ODB A;  2KFF A;  3PSR A;  1OE9 B;  2ZRS A;  4XJK A;  3AKA A;  2LLS A;  1KFX L;  4PHN A;  1CMG A;  1NPQ A;  2I94 A;  4HRH A;  1PUL A;  3GK4 X;  2JNF A;  1WY9 A;  3ICB A;  4A4C A;  1B9A A;  1MF8 B;  5KSZ A;  2L4I A;  1N2D A;  4P2Y B;  3BYA A;  4ZCU A;  2JZI A;  3I5I B;  2EHB A;  2LAP A;  1JUO A;  1NX3 A;  1REC A;  1NCY A;  4GAO A;  2LMV A;  1RJV A;  1TIZ A;  2JTZ A;  5HYD A;  2KAX A;  3OHM B;  2LLU A;  3WHT B;  2L51 A;  2EC6 B;  3BQ3 A;  2DOQ A;  3OB1 B;  1J1E A;  1TOP A;  3NSL A;  4GFT A;  3DF0 B;  2H61 C;  1XFZ O;  2BBN A;  2CXJ A;  2KDH A;  2F3Z A;  5G08 A;  2KAY A;  1OQP A;  1S6C A;  1C7W A;  3PAT A;  1ZFS A;  5DKQ A;  1KSO A;  1KCY A;  4P5O E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...