1XVJA

Crystal structure of rat alpha-parvalbumin d94s/g98e mutant
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
109
structure length
109
Chain Sequence
SMTDLLSAEDIKKAIGAFTAADSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKSGFIEEDELGSILKGFSSDARDLSAKETKTLMAAGDKDGSGKIEVEEFSTLVAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Parvalbumin alpha
publication title Crystal Structure of the D94S/G98E Variant of Rat alpha-Parvalbumin. An Explanation for the Reduced Divalent Ion Affinity.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
total genus 41
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xvjA00
3WXAA 1LA3A 2M3WA 4JPZB 1OZSA 1NCXA 2F3YA 2LANA 2NCPA 1G4YR 4NDCA 1E8AA 1L2OB 1ZUZA 4N5XA 2DOQA 3ZNIA 1IQ5A 4CLNA 3JVTB 3SG6A 1F54A 2GGZA 2M1KB 2MJWB 1A75B 4JQ0D 2ISDA 5KU1A 4BY4A 1QLSA 2MA2A 2LUXA 4OR9B 2JULA 4I5KA 1CLMA 4GNKB 4PHJA 1DJXA 4AQIA 1CB1A 1RTP1 1B7TZ 2NZ0A 1J7RA 3H4SE 2SASA 1JWDA 1M45A 4HREE 1NIWA 4GGNA 2LAPA 3KO0A 1M46A 1BF5A 4YI8A 2AAOA 3NSKA 4YGBB 4XYNA 4C0JA 2EHBA 2R2IA 1TN4A 5HKZA 4PCWA 1J55A 4MLWA 2GGMA 2I94A 2LNKA 5HKYA 3CS1A 4HRGA 2WNDA 3EK7A 1JF2A 3DD4A 2K2FA 3VROA 2CTNA 1XK4C 1YUTA 2NLNA 3I5GB 2BE6A 1B8CA 5I2LA 5K89A 1NUBA 4JWQA 3PM8A 4FTGA 4MRXA 4ORBB 1BR1B 1SY9A 2LMTA 1NSHA 3MSEB 4DCKA 2WCFA 2JXLA 3CR5X 1MR8A 3EKJA 4OKHA 2KI4C 1NX3A 3OB2B 2LP3A 2F8PA 2MAZA 2BL0C 1XO5A 3IF7A 1IRJA 4CIDA 1KQMC 3BQ3A 1QVIY 2PVBA 1GGWA 2MBXA 4MZJA 1OQPA 2JTZA 1B8LA 1ZACA 4NQGA 3OB1B 1AJ4A 1B9AA 2F3ZA 2I7AA 2K61A 3OX6A 4IL1A 1TNQA 3AAKA 4DRWA 4GGFA 3RM1A 4YGEB 1KK7Z 1OSAA 5CPVA 4MN0A 2EGDA 3TUYC 2L98A 2CNPA 1WLMA 1CDLA 1XYDA 2K0JA 1TIZA 1KK8C 1K93D 2M7NA 4I5LB 1K94A 1NX2A 4GFTA 2M49B 4WQ3A 5DKQA 1QX5B 1U5IA 4MRYA 5AXIA 3VRPA 2KYCA 1F70A 1K90D 1F55A 1H8BA 1EG3A 2MHHA 1IJ6A 2JWWA 1CKKA 3EK8A 1JFKA 1J7QA 4PHNA 3GK4X 1CFPA 3I5FC 5G08A 4HSZA 1GGZA 2M8UA 1TCOB 4OCIA 4PDZA 1S6IA 2JOJA 1NWDA 3D0YA 3TDUA 4FQOA 1EH2A 1SL7A 2M0RA 2ZNEA 1QX7A 1S5GY 2EC6C 2GV5A 2KI4B 4CFRA 1JF0A 3WHTB 1GJYA 2LV7A 2MLFC 1CDPA 1NX0A 2BL0B 3CGAA 3CR2A 1DJHA 2BBNA 2MLEC 1YTZC 1KQMB 1FI5A 3NSLA 1TNWA 1NYAA 4DIRA 3KPXA 2KFHA 2LLTA 3NSOA 1J1DA 1R2UA 1ZMZA 2CXJA 4I5JA 2LHLA 1QXPA 3SG4A 1XFWO 2KAYA 2M1UA 2JXCA 4QJ3B 4ORCB 3E3RA 1Y1AA 3O78A 2K7CA 3BUNB 2M7LA 4F0ZB 3SIAA 2NCOA 3LL8B 1YRTB 1MWNA 3PALA 5D69A 1MF8B 3TUYB 4ZCUA 4QJ4B 2LVJA 5JOLA 1DJGA 3LLEA 2VRGA 1KK8B 2L5XB 1XVJA 2ZFDA 1S26D 4HRHA 2ZN8A 2OS8C 1J7OA 2QPTA 1DF0A 4D1EA 1LVCD 2KGBC 3SG3A 2K7OA 2KAXA 1CDMA 3EVRA 1PALA 4YBHB 3VRNA 3BUOB 2BCXA 1QATA 2G9BA 3I5FB 1BU3A 2TN4A 1SRAA 1MQ1A 1A75A 1AHRA 2ZNDA 5JJGA 1M63B 1SW8A 1IG5A 1UHNA 1NPQA 2KSPA 2ZRSA 3GOFA 3TDIA 1LA0A 2EC6B 3BYAA 3LCPC 4GGFC 1KFUL 2OTGC 3CZTX 1FF1A 4MVFA 2M29A 4MSPA 2BKHB 3OX5A 2D8NA 2O5GA 3DF0B 5D7FA 4USLA 2L4IA 2L2EA 2F2PA 2I18A 1JUOA 2QACA 2KI6D 2JRFA 2ZKMX 3EKHA 5KTYA 1TTXA 3O6BA 2H2KA 4CPVA 1XFYO 1S5GZ 4WQ2A 4XJKA 1PRWA 1MXEA 1UHJA 2FOTA 3DVKA 2A4JA 3CTNA 1TCFA 1VRKA 3AKAA 2LVKA 4NDBA 4OVNF 1DJWA 2JT8A 2K2AA 1CNPA 1QLKA 1YX7A 2JPTA 2WOSA 1SPYA 3PN7C 2HQ8A 3JTDC 3LK0A 1DTLA 2PALA 1S6CA 2HPSA 4PE1A 3KF9A 3GK2A 1UHKA 2OS8B 4GUKA 2M9GA 4C0KA 2KOTA 1QIWA 4WRIA 1B8RA 1L7ZA 2KFGA 1K95A 1MXLC 5HKWA 4NDDA 1HQVA 1EL4A 2CT9A 3VGOA 1NP8A 2JT0A 1TRFA 2LP2A 1A4PA 1SL9A 1ALWA 1Y1UA 1CMFA 1N0YA 1KSMA 2FCDA 1F71A 1KFUS 2Q91A 3DVEA 5HYDA 4N1FA 2JNFA 2K7BA 1QV0A 2BBMA 5CSIA 4DUQA 1EJ3A 3NXAA 4M2QA 1S36A 1B4CA 2OTGB 1S6JA 3DVMA 3WNXB 2Y5IA 1LINA 1CM1A 1IJ5A 2BKIB 1SCVA 1DJIA 2KYFA 1CFDA 1RWYA 2HF5A 3DVJA 2JU0A 2PMYA 3FIAA 1N65A 1C7VA 2KQ6A 1PSRA 3OHMB 2WCEA 1TOPA 2Y4QA 1WRLA 3NSIA 5ER5A 4MBEA 1RJVA 4ZCVA 1V1GA 1B7TY 2Y1MA 2KGRA 1QIVA 1ALVA 3FWBA 1K8UA 4PHMA 1KSOA 4YGAA 2HQWA 3SG5A 2H61A 1WLZA 1A29A 3CLNA 3K21A 2Q4UA 2G2BA 3JTDB 3PN7B 5CSNA 1W7IB 1QX2A 1SNLA 3BUWB 3BOWA 1IH0A 1OMRA 3D0YB 3IQQA 1FPWA 1FI6A 2KBMA 4C0LA 1FBVA 3SG2A 1XFXO 1TNXA 1ZOTB 1OE9B 2CCMA 1BLQA 2LC5A 1MUXA 2LLUA 5IBWA 2KI6C 1NCZA 3PFVA 1YRUB 1JC2A 1XFVO 2WCBA 3CR4X 2LHIA 1BR4B 4P5OE 3VRRA 1BOCA 2L4HA 1OMDA 4PHKA 1RFJA 1UUSA 1CLLA 2M97A 2KBIA 3HCMA 3D10A 1Y1XA 1QVIZ 2BECA 3ZWHA 4I5NB 2JT3A 2KFFA 2B1UA 4ETOA 4OV2A 2JNXA 3VRQA 2COLB 3O4YA 3TS5C 1K9PA 4AOMA 3O2PA 4AQJA 2I2RE 5B8IB 1CM4A 1YX8A 3I5IC 5I2QA 1V1FA 1SBJA 3SIBA 3EVUA 1UWOA 2LLSA 1PSBA 3A8RA 5DKNA 1DF0B 1WY9A 4YI9A 5DKRA 1ODBA 1LKJA 1EXRA 1DGVA 1NCYA 2JZIA 1OMVA 1WDCC 1YR5A 1JFJA 2SCPA 1SYMA 3BUXB 1KK7Y 4MEWA 3KHEA 3EK4A 4ICBA 1D1OA 1CLBA 1IGVA 1KFXL 1M31A 2LM5A 5TNCA 3SJSA 4YRUA 2BCBA 4GBAA 3CWGA 1F8HA 4E68A 2NXQA 2PRUA 4PE4A 1X02A 4YGDB 1QTXA 3KEVA 2KAVA 1DT7B 5AFPA 1K9KA 4MZLA 1CFCA 2L51A 2CBLA 3F45A 2E30A 1KCYA 2WORA 3LK1A 4L9MA 5J3XA 1SL8A 2PASA 2JTTA 3I5HC 1UP5A 1QASA 1WRKA 2JC2A 1UURA 3DF0A 2AUCA 1B1GA 1F4OA 1F4QA 5CSFA 2L50A 1RECA 1R6PA 1XFUO 2RGIA 3PSRA 5I2OA 3TDZA 4TNCA 1AK8A 1QV1A 1FW4A 4XJKB 5F6TA 1K96A 3WHUB 1JSAA 1S1EA 1BG1A 5CSJA 1KWOC 3BUMB 4BY5A 2HETA 1DJYA 3C1VA 3AAJA 2BCAA 1YUSA 1CMGA 3TS5B 1S3PA 3A4UB 2KQYA 2H61C 3FWCA 1SCMC 4CFQA 1SR6C 2KDHA 1PVAA 2E6WA 1N2DA 2ZRTA 3I5IB 4QJ5B 2KNEA 2L0PA 3ICBA 1SMGA 2JQ6A 3M0WA 1CFFA 1DJZA 1K2HA 3IQOA 1BMOA 2OPOA 1KFXS 1WDCB 1JBAA 1J7PA 5PALA 5I8NA 1AVSA 3FS7A 2PSRA 5HLVA 5FYXA 1LXFC 5HLOA 1OOJA 1MHOA 2ZN9A 1UHIA 4UPGA 1PULA 3AKBA 1XA5A 1ZFSA 5GQQC 1W7JB 2O60A 1G8IA 4A4CA 2Y1NA 1NX1A 1CTRA 2BE4A 1DGUA 4PE7A 1BODA 4GAOA 1IQ3A 1QS7A 1SKTA 3BXKA 1U5IB 3I5HB 3OP0A 4Q04A 2MRDA 1BJFA 2LMVA 3TZ1A 1Y6WA 1AUIB 1L2OC 1WRZA 1KQVA 2LCPA 3QRXA 3JVTC 4GPLB 2LUCA 1C07A 3RLZA 4MZKA 1J1EA 1XK4A 3EVVA 1XFZO 1K9UA 1C7WA 1KWOB 1Y0VH 3PATA 1OZOA 1Q80A 1IWQA 2AMIA 5AERA 3GK1A 1YURA 1QJTA 1TNPA 2WC8A 4M2PA 1HT9A 1SCMB 2FCEA 1EG4A 1SK6D 1SR6B 3HX4A 2IS9A 5ER4X 4A4BA 1PK0D 3BOWB 4R1EA 5KSZA 3SG7A 1CDNA 3PLFB 5BPJA 2FJUB 2LVIA 1DVIA 4ORAB 4DS7A 1H4BA 2F2OA 4N1GA 1A03A 2V53A 2K7DA 5AANA 2F33A 2K8MB 1G33A 1DMOA 1GQMA 1YUUA 1UHHA 1AP4A 1B47A 4YGCB 5AEQA 1RK9A 4PE0A 2KHNA 2LMUA 1M39A 4U8DA 1IKUA 4PALA 2P6BB 1A2XA 1BT6A 1YVHA 1YVLA 1PVBA 3I5GC 4P2YB 2LE9B 1AJ5A 2LVVA 1RROA 4M2OA
chains in the Genus database with same CATH superfamily
3WXAA 1SSEB 1LA3A 2M3WA 4JPZB 1OZSA 1NCXA 2F3YA 3VB1A 2LANA 2NCPA 1G4YR 4NDCA 1E8AA 1L2OB 1ZUZA 4N5XA 2DOQA 5FI2A 1IQ5A 3ZNIA 4CLNA 3JVTB 3Q8IA 3SG6A 4OZDA 1F54A 2GGZA 2M1KB 2MJWB 1A75B 4JQ0D 2ISDA 5KU1A 3SS5A 4BY4A 3FE8A 1QLSA 2MA2A 5D3OA 2LUXA 4OR9B 3N7HA 2JULA 4I5KA 1CLMA 4IJ7A 4GNKB 4PHJA 1DJXA 3L4AA 4AQIA 1CB1A 1RTP1 1B7TZ 2NZ0A 1J7RA 3H4SE 2SASA 1JWDA 1OOFA 1DELA 1M45A 4HREE 1NIWA 3D77A 4GGNA 2LAPA 3KO0A 1M46A 1BF5A 4YI8A 2AAOA 3NSKA 4YGBB 2H8VA 4XYNA 1W9ZA 4C0JA 2EHBA 2R2IA 1TN4A 5HKZA 4PCWA 1J55A 4MLWA 2GGMA 2I94A 2LNKA 5HKYA 3CS1A 4HRGA 2WNDA 3EK7A 1JF2A 3DD4A 2K2FA 3VROA 2CTNA 1XK4C 1YUTA 2NLNA 3I5GB 2BE6A 1B8CA 5I2LA 5K89A 1NUBA 4JWQA 1P28A 1QWVA 3PM8A 4FTGA 2K60A 4MRXA 4ORBB 3K1EA 1BR1B 1SY9A 2LMTA 1NSHA 3MSEB 4DCKA 2WCFA 2JXLA 3CR5X 1MR8A 2P71A 3EKJA 4OKHA 2KI4C 1NX3A 3OB2B 2LP3A 2F8PA 2MAZA 2BL0C 1XO5A 3IF7A 1IRJA 4CIDA 1KQMC 3BQ3A 1QVIY 2PVBA 1GGWA 2MBXA 4MZJA 1OQPA 2JTZA 1B8LA 1ZACA 4NQGA 3OB1B 1AJ4A 1B9AA 2F3ZA 2I7AA 2K61A 3D78A 3OX6A 4IL1A 1TNQA 3AAKA 4JKTA 4DRWA 4GGFA 3RM1A 4YGEB 1KK7Z 1OSAA 5CPVA 4MN0A 2EGDA 3SS3A 5FI6A 3TUYC 2L98A 2CNPA 1WLMA 1T14A 1CDLA 1XYDA 2K0JA 1TIZA 2WCJA 1KK8C 1K93D 2M7NA 4I5LB 1K94A 1NX2A 3UO9A 1OW4A 2M49B 4GFTA 4WQ3A 5DKQA 1QX5B 1U5IA 4MRYA 3D74A 5AXIA 3DY9A 3VRPA 3B6XA 2KYCA 1F70A 1K90D 1F55A 1H8BA 1EG3A 2MHHA 1IJ6A 2JWWA 1CKKA 3EK8A 1JFKA 1J7QA 4PHNA 5HL1A 1ORGA 3GK4X 3I5FC 5G08A 1CFPA 4HSZA 1OOHA 1GGZA 2M8UA 1TCOB 1OOIX 4OCIA 3PJIA 4PDZA 1S6IA 2JOJA 1NWDA 3D0YA 3TDUA 4FQOA 1EH2A 1SL7A 2M0RA 2ZNEA 1QX7A 1S5GY 2EC6C 2GV5A 2KI4B 4CFRA 1JF0A 3WHTB 1GJYA 2LV7A 2MLFC 1CDPA 3NGVA 1NX0A 2BL0B 3CGAA 3CR2A 1DJHA 2BBNA 2MLEC 1YTZC 3NHIA 1KQMB 1FI5A 3EG5B 3NSLA 1TNWA 1NYAA 4DIRA 1LS8A 3KPXA 3NHTA 2KFHA 2LLTA 3NSOA 1J1DA 1R2UA 1ZMZA 2L2CA 2CXJA 4I5JA 5FI7A 2LHLA 1QXPA 3SG4A 1XFWO 2KAYA 2M1UA 3DXLA 2JXCA 4QJ3B 4ORCB 3E3RA 1Y1AA 3O78A 2K7CA 3BUNB 3CABA 2M7LA 4F0ZB 3SIAA 2NCOA 3LL8B 1YRTB 1MWNA 3PALA 5D69A 1MF8B 3TUYB 4ZCUA 4QJ4B 2WCKA 2LVJA 5JOLA 1DJGA 3LLEA 2VRGA 1KK8B 2L5XB 1XVJA 3B87A 2ZFDA 1S26D 4HRHA 2ZN8A 2QEVA 2OS8C 1J7OA 3BFHA 1OOGA 2JPOA 1DF0A 2QPTA 3CDNA 4D1EA 1LVCD 2KGBC 3SG3A 2K7OA 2KAXA 1CDMA 2QEOA 3EVRA 1PALA 4YBHB 3VRNA 3BUOB 2BCXA 1QATA 2G9BA 3I5FB 1BU3A 2TN4A 2PYQA 3RZSA 1SRAA 1MQ1A 1A75A 1AHRA 2ZNDA 5JJGA 2QEBA 1M63B 1SW8A 1IG5A 1UHNA 1NPQA 2KSPA 2ZRSA 3GOFA 3TDIA 1LA0A 2EC6B 3DYEA 3BYAA 2ERBA 3LCPC 4GGFC 1KFUL 2OTGC 3CZTX 1FF1A 4MVFA 2M29A 4MSPA 2PQLA 2BKHB 3OX5A 2D8NA 2O5GA 5DICA 3DF0B 5D7FA 4USLA 2L4IA 2L2EA 3D76A 2F2PA 3D73A 2I18A 1JUOA 2QACA 2KI6D 2JRFA 2ZKMX 3EKHA 5KTYA 1TTXA 3O6BA 2H2KA 4CPVA 1XFYO 1S5GZ 4WQ2A 4XJKA 1PRWA 1MXEA 1UHJA 2FOTA 4KYNA 3DVKA 2A4JA 3CTNA 1TCFA 1VRKA 3AKAA 2LVKA 4NDBA 4OVNF 1DJWA 2JT8A 2K2AA 3BJHA 3S0DA 1CNPA 1QLKA 1YX7A 2JPTA 2WOSA 1SPYA 3PN7C 2HQ8A 3JTDC 2KPHA 1DTLA 3LK0A 2PALA 1S6CA 2HPSA 1DQEA 3KF9A 4PE1A 3GK2A 1UHKA 2OS8B 4GUKA 2M9GA 4C0KA 2KOTA 1QIWA 4WRIA 1B8RA 1L7ZA 2KFGA 2WCHA 1K95A 1MXLC 5HKWA 4NDDA 1HQVA 1EL4A 2CT9A 3VGOA 1NP8A 2JT0A 1TRFA 2LP2A 1A4PA 1SL9A 1ALWA 1Y1UA 2QEHA 1CMFA 1N0YA 1KSMA 2FCDA 4PT1A 1F71A 2BNXA 3B86A 1KFUS 2Q91A 3DVEA 5HYDA 2YGUA 4N1FA 2JNFA 2K7BA 1QV0A 2BBMA 5CSIA 4DUQA 1EJ3A 1TWOA 3NXAA 4M2QA 1S36A 2P70A 2OTGB 1B4CA 1S6JA 3DVMA 3WNXB 2Y5IA 1LINA 2KLEA 1CM1A 1IJ5A 3R72A 2BKIB 1SCVA 1DJIA 1TUJA 2KYFA 1CFDA 1RWYA 2QDIA 5I94A 2HF5A 3DVJA 2JU0A 2PMYA 3FIAA 1N65A 1C7VA 2KQ6A 1PSRA 3OHMB 2WCEA 1TOPA 2Y4QA 1WRLA 3NSIA 5ER5A 4MBEA 1RJVA 4ZCVA 1AK8A 1V1GA 1B7TY 2Y1MA 2KGRA 3L47A 1QIVA 1ALVA 3FWBA 1K8UA 4PHMA 1KSOA 4YGAA 3BFBA 2HQWA 3SG5A 2H61A 1WLZA 3SS4A 1A29A 3CLNA 3K21A 2Q4UA 2G2BA 3JTDB 3PN7B 5CSNA 1W7IB 1QX2A 1SNLA 3BUWB 3BOWA 1IH0A 1OMRA 3D0YB 3IQQA 1FPWA 1FI6A 2KBMA 4C0LA 1FBVA 3SG2A 1XFXO 1TNXA 1ZOTB 1OE9B 2CCMA 2FJYA 1BLQA 2LC5A 1MUXA 1XFRA 2LLUA 5IBWA 2KI6C 1NCZA 3PFVA 1YRUB 1JC2A 1XFVO 2WCBA 3CR4X 2LHIA 1BR4B 4P5OE 3VRRA 1BOCA 2L4HA 1OMDA 4PHKA 1RFJA 1UUSA 1CLLA 2M97A 2KBIA 3HCMA 3D10A 1Y1XA 1QVIZ 2BECA 3ZWHA 4I5NB 2JT3A 2KFFA 2B1UA 4ETOA 4OV2A 2JNXA 3VRQA 2COLB 3O4YA 3TS5C 1K9PA 4AOMA 3O2PA 4AQJA 2I2RE 5B8IB 4JD9A 1CM4A 1YX8A 3I5IC 5I2QA 1V1FA 1SBJA 3SIBA 3EVUA 1UWOA 2LLSA 1PSBA 3A8RA 5DKNA 1DF0B 1WY9A 4YI9A 5DKRA 1ODBA 1LKJA 1EXRA 1DGVA 1NCYA 2JZIA 1OMVA 1WDCC 1YR5A 1JFJA 2SCPA 1SYMA 3BUXB 1KK7Y 4MEWA 3KHEA 3EK4A 4ICBA 1D1OA 1CLBA 1IGVA 1KFXL 4FQTA 1M31A 2KLDA 2LM5A 5TNCA 3SJSA 4YRUA 1GM0A 2BCBA 4GBAA 3CWGA 1F8HA 4E68A 2NXQA 2PRUA 4PE4A 1X02A 4INXA 4YGDB 1QTXA 3CYZA 3KEVA 2KAVA 1DT7B 5AFPA 1K9KA 4MZLA 1CFCA 2L51A 2CBLA 1DEKA 2E30A 3F45A 2WORA 1KCYA 3LK1A 4L9MA 3FE6A 5J3XA 1SL8A 2PASA 2JTTA 3I5HC 1UP5A 1QASA 1WRKA 2JC2A 1UURA 3DF0A 2AUCA 3S0GA 1B1GA 1F4OA 1F4QA 5CSFA 2L50A 1RECA 1R6PA 1XFUO 2RGIA 3PSRA 5I2OA 3TDZA 4TNCA 2WCMA 1QV1A 1FW4A 4XJKB 5F6TA 1K96A 3PM2A 3WHUB 1JSAA 1S1EA 2L5YA 3V2LA 5CSJA 1BG1A 1KWOC 3BUMB 2BAPA 2WC6A 4BY5A 2HETA 1DJYA 3C1VA 3AAJA 2BCAA 1YUSA 1CMGA 3TS5B 1S3PA 3A4UB 2KQYA 2H61C 3FWCA 1SCMC 4CFQA 1SR6C 2KDHA 1PVAA 2E6WA 1N2DA 2ZRTA 3BFAA 3I5IB 1Z2CB 2KNEA 2L0PA 3ICBA 4QJ5B 3S0EA 1SMGA 3R1VA 2JQ6A 3M0WA 1CFFA 1DJZA 1K2HA 3IQOA 1BMOA 3OBVA 3OGNA 2OPOA 1KFXS 1WDCB 1DC1A 1J7PA 5PALA 5I8NA 1AVSA 3FS7A 1JBAA 2PSRA 5HLVA 1Z4HA 5FYXA 1LXFC 5HLOA 1OOJA 1MHOA 3O4XA 2ZN9A 1UHIA 4UPGA 1PULA 2GTEA 3AKBA 1XA5A 1ZFSA 5GQQC 1W7JB 2O60A 1G8IA 4A4CA 2Y1NA 3CZ0A 1NX1A 1CTRA 2BE4A 1DGUA 4PE7A 5EL2A 1BODA 3QMEA 4GAOA 1IQ3A 1C3ZA 1QS7A 1SKTA 3BXKA 1U5IB 3I5HB 3OP0A 4Q04A 3DZTA 1C3YA 2MRDA 1BJFA 2LMVA 3TZ1A 1Y6WA 1AUIB 1L2OC 3B7AA 1WRZA 1KQVA 2LCPA 3QRXA 3JVTC 4INWA 4GPLB 2LUCA 2WC5A 3R1PA 1C07A 3RLZA 4F7FA 4MZKA 1J1EA 1XK4A 3EVVA 1XFZO 1K9UA 1C7WA 1KWOB 1Y0VH 3PATA 1OZOA 1Q80A 3FE9A 1IWQA 2AMIA 5AERA 1TUZA 3GK1A 1YURA 1QJTA 1TNPA 2WC8A 4M2PA 1HT9A 1SCMB 2FCEA 1EG4A 1SK6D 1SR6B 3HX4A 2IS9A 5ER4X 3S0BA 4A4BA 1PK0D 3BOWB 3D75A 4R1EA 5KSZA 3SG7A 1CDNA 3PLFB 5BPJA 2FJUB 3S0FA 2LVIA 1DVIA 4ORAB 4DS7A 1H4BA 2F2OA 4N1GA 2WCLA 1A03A 2V53A 2K7DA 5AANA 2F33A 2K8MB 1G33A 1DMOA 1GQMA 3B88A 1YUUA 1IIOA 1UHHA 3CZ2A 1AP4A 1B47A 3R1OA 4YGCB 5AEQA 3IVTA 1RK9A 4PE0A 2KHNA 2LMUA 1M39A 4U8DA 3CZ1A 1IKUA 4PALA 3L4LA 2P6BB 1A2XA 1BT6A 1YVHA 3S0AA 1YVLA 1PVBA 3I5GC 4P2YB 3UNWA 2LE9B 1AJ5A 2LVVA 1RROA 4M2OA
chains in the Genus database with same CATH topology
3WXAA 1LA3A 2M3WA 4JPZB 1OZSA 1NCXA 2F3YA 2LANA 2NCPA 1G4YR 4NDCA 1E8AA 1L2OB 1ZUZA 4N5XA 2DOQA 3ZNIA 1IQ5A 4CLNA 3JVTB 3SG6A 1F54A 2GGZA 2M1KB 2MJWB 1A75B 4JQ0D 2ISDA 5KU1A 4BY4A 1QLSA 2MA2A 2LUXA 4OR9B 2JULA 4I5KA 1CLMA 4GNKB 4PHJA 1DJXA 4AQIA 1CB1A 1RTP1 1B7TZ 2NZ0A 1J7RA 3H4SE 2SASA 1JWDA 1M45A 4HREE 1NIWA 4GGNA 2LAPA 3KO0A 1M46A 1BF5A 4YI8A 2AAOA 3NSKA 4YGBB 4XYNA 4C0JA 2EHBA 2R2IA 1TN4A 5HKZA 4PCWA 1J55A 4MLWA 2GGMA 2I94A 2LNKA 5HKYA 3CS1A 4HRGA 2WNDA 3EK7A 1JF2A 3DD4A 2K2FA 3VROA 2CTNA 1XK4C 1YUTA 2NLNA 3I5GB 2BE6A 1B8CA 5I2LA 5K89A 1NUBA 4JWQA 3PM8A 4FTGA 4MRXA 4ORBB 1BR1B 1SY9A 2LMTA 1NSHA 3MSEB 4DCKA 2WCFA 2JXLA 3CR5X 1MR8A 3EKJA 4OKHA 2KI4C 1NX3A 3OB2B 2LP3A 2F8PA 2MAZA 2BL0C 1XO5A 3IF7A 1IRJA 4CIDA 1KQMC 3BQ3A 1QVIY 2PVBA 1GGWA 2MBXA 4MZJA 1OQPA 2JTZA 1B8LA 1ZACA 4NQGA 3OB1B 1AJ4A 1B9AA 2F3ZA 2I7AA 2K61A 3OX6A 4IL1A 1TNQA 3AAKA 4DRWA 4GGFA 3RM1A 4YGEB 1KK7Z 1OSAA 5CPVA 4MN0A 2EGDA 3TUYC 2L98A 2CNPA 1WLMA 1CDLA 1XYDA 2K0JA 1TIZA 1KK8C 1K93D 2M7NA 4I5LB 1K94A 1NX2A 4GFTA 2M49B 4WQ3A 5DKQA 1QX5B 1U5IA 4MRYA 5AXIA 3VRPA 2KYCA 1F70A 1K90D 1F55A 1H8BA 1EG3A 2MHHA 1IJ6A 2JWWA 1CKKA 3EK8A 1JFKA 1J7QA 4PHNA 3GK4X 1CFPA 3I5FC 5G08A 4HSZA 1GGZA 2M8UA 1TCOB 4OCIA 4PDZA 1S6IA 2JOJA 1NWDA 3D0YA 3TDUA 4FQOA 1EH2A 1SL7A 2M0RA 2ZNEA 1QX7A 1S5GY 2EC6C 2GV5A 2KI4B 4CFRA 1JF0A 3WHTB 1GJYA 2LV7A 2MLFC 1CDPA 1NX0A 2BL0B 3CGAA 3CR2A 1DJHA 2BBNA 2MLEC 1YTZC 1KQMB 1FI5A 3NSLA 1TNWA 1NYAA 4DIRA 3KPXA 2KFHA 2LLTA 3NSOA 1J1DA 1R2UA 1ZMZA 2CXJA 4I5JA 2LHLA 1QXPA 3SG4A 1XFWO 2KAYA 2M1UA 2JXCA 4QJ3B 4ORCB 3E3RA 1Y1AA 3O78A 2K7CA 3BUNB 2M7LA 4F0ZB 3SIAA 2NCOA 3LL8B 1YRTB 1MWNA 3PALA 5D69A 1MF8B 3TUYB 4ZCUA 4QJ4B 2LVJA 5JOLA 1DJGA 3LLEA 2VRGA 1KK8B 2L5XB 1XVJA 2ZFDA 1S26D 4HRHA 2ZN8A 2OS8C 1J7OA 2QPTA 1DF0A 4D1EA 1LVCD 2KGBC 3SG3A 2K7OA 2KAXA 1CDMA 3EVRA 1PALA 4YBHB 3VRNA 3BUOB 2BCXA 1QATA 2G9BA 3I5FB 1BU3A 2TN4A 1SRAA 1MQ1A 1A75A 1AHRA 2ZNDA 5JJGA 1M63B 1SW8A 1IG5A 1UHNA 1NPQA 2KSPA 2ZRSA 3GOFA 3TDIA 1LA0A 2EC6B 3BYAA 3LCPC 4GGFC 1KFUL 2OTGC 3CZTX 1FF1A 4MVFA 2M29A 4MSPA 2BKHB 3OX5A 2D8NA 2O5GA 3DF0B 5D7FA 4USLA 2L4IA 2L2EA 2F2PA 2I18A 1JUOA 2QACA 2KI6D 2JRFA 2ZKMX 3EKHA 5KTYA 1TTXA 3O6BA 2H2KA 4CPVA 1XFYO 1S5GZ 4WQ2A 4XJKA 1PRWA 1MXEA 1UHJA 2FOTA 3DVKA 2A4JA 3CTNA 1TCFA 1VRKA 3AKAA 2LVKA 4NDBA 4OVNF 1DJWA 2JT8A 2K2AA 1CNPA 1QLKA 1YX7A 2JPTA 2WOSA 1SPYA 3PN7C 2HQ8A 3JTDC 3LK0A 1DTLA 2PALA 1S6CA 2HPSA 4PE1A 3KF9A 3GK2A 1UHKA 2OS8B 4GUKA 2M9GA 4C0KA 2KOTA 1QIWA 4WRIA 1B8RA 1L7ZA 2KFGA 1K95A 1MXLC 5HKWA 4NDDA 1HQVA 1EL4A 2CT9A 3VGOA 1NP8A 2JT0A 1TRFA 2LP2A 1A4PA 1SL9A 1ALWA 1Y1UA 1CMFA 1N0YA 1KSMA 2FCDA 1F71A 1KFUS 2Q91A 3DVEA 5HYDA 4N1FA 2JNFA 2K7BA 1QV0A 2BBMA 5CSIA 4DUQA 1EJ3A 3NXAA 4M2QA 1S36A 1B4CA 2OTGB 1S6JA 3DVMA 3WNXB 2Y5IA 1LINA 1CM1A 1IJ5A 2BKIB 1SCVA 1DJIA 2KYFA 1CFDA 1RWYA 2HF5A 3DVJA 2JU0A 2PMYA 3FIAA 1N65A 1C7VA 2KQ6A 1PSRA 3OHMB 2WCEA 1TOPA 2Y4QA 1WRLA 3NSIA 5ER5A 4MBEA 1RJVA 4ZCVA 1V1GA 1B7TY 2Y1MA 2KGRA 1QIVA 1ALVA 3FWBA 1K8UA 4PHMA 1KSOA 4YGAA 2HQWA 3SG5A 2H61A 1WLZA 1A29A 3CLNA 3K21A 2Q4UA 2G2BA 3JTDB 3PN7B 5CSNA 1W7IB 1QX2A 1SNLA 3BUWB 3BOWA 1IH0A 1OMRA 3D0YB 3IQQA 1FPWA 1FI6A 2KBMA 4C0LA 1FBVA 3SG2A 1XFXO 1TNXA 1ZOTB 1OE9B 2CCMA 1BLQA 2LC5A 1MUXA 2LLUA 5IBWA 2KI6C 1NCZA 3PFVA 1YRUB 1JC2A 1XFVO 2WCBA 3CR4X 2LHIA 1BR4B 4P5OE 3VRRA 1BOCA 2L4HA 1OMDA 4PHKA 1RFJA 1UUSA 1CLLA 2M97A 2KBIA 3HCMA 3D10A 1Y1XA 1QVIZ 2BECA 3ZWHA 4I5NB 2JT3A 2KFFA 2B1UA 4ETOA 4OV2A 2JNXA 3VRQA 2COLB 3O4YA 3TS5C 1K9PA 4AOMA 3O2PA 4AQJA 2I2RE 5B8IB 1CM4A 1YX8A 3I5IC 5I2QA 1V1FA 1SBJA 3SIBA 3EVUA 1UWOA 2LLSA 1PSBA 3A8RA 5DKNA 1DF0B 1WY9A 4YI9A 5DKRA 1ODBA 1LKJA 1EXRA 1DGVA 1NCYA 2JZIA 1OMVA 1WDCC 1YR5A 1JFJA 2SCPA 1SYMA 3BUXB 1KK7Y 4MEWA 3KHEA 3EK4A 4ICBA 1D1OA 1CLBA 1IGVA 1KFXL 1M31A 2LM5A 5TNCA 3SJSA 4YRUA 2BCBA 4GBAA 3CWGA 1F8HA 4E68A 2NXQA 2PRUA 4PE4A 1X02A 4YGDB 1QTXA 3KEVA 2KAVA 1DT7B 5AFPA 1K9KA 4MZLA 1CFCA 2L51A 2CBLA 3F45A 2E30A 1KCYA 2WORA 3LK1A 4L9MA 5J3XA 1SL8A 2PASA 2JTTA 3I5HC 1UP5A 1QASA 1WRKA 2JC2A 1UURA 3DF0A 2AUCA 1B1GA 1F4OA 1F4QA 5CSFA 2L50A 1RECA 1R6PA 1XFUO 2RGIA 3PSRA 5I2OA 3TDZA 4TNCA 1AK8A 1QV1A 1FW4A 4XJKB 5F6TA 1K96A 3WHUB 1JSAA 1S1EA 1BG1A 5CSJA 1KWOC 3BUMB 4BY5A 2HETA 1DJYA 3C1VA 3AAJA 2BCAA 1YUSA 1CMGA 3TS5B 1S3PA 3A4UB 2KQYA 2H61C 3FWCA 1SCMC 4CFQA 1SR6C 2KDHA 1PVAA 2E6WA 1N2DA 2ZRTA 3I5IB 4QJ5B 2KNEA 2L0PA 3ICBA 1SMGA 2JQ6A 3M0WA 1CFFA 1DJZA 1K2HA 3IQOA 1BMOA 2OPOA 1KFXS 1WDCB 1JBAA 1J7PA 5PALA 5I8NA 1AVSA 3FS7A 2PSRA 5HLVA 5FYXA 1LXFC 5HLOA 1OOJA 1MHOA 2ZN9A 1UHIA 4UPGA 1PULA 3AKBA 1XA5A 1ZFSA 5GQQC 1W7JB 2O60A 1G8IA 4A4CA 2Y1NA 1NX1A 1CTRA 2BE4A 1DGUA 4PE7A 1BODA 4GAOA 1IQ3A 1QS7A 1SKTA 3BXKA 1U5IB 3I5HB 3OP0A 4Q04A 2MRDA 1BJFA 2LMVA 3TZ1A 1Y6WA 1AUIB 1L2OC 1WRZA 1KQVA 2LCPA 3QRXA 3JVTC 4GPLB 2LUCA 1C07A 3RLZA 4MZKA 1J1EA 1XK4A 3EVVA 1XFZO 1K9UA 1C7WA 1KWOB 1Y0VH 3PATA 1OZOA 1Q80A 1IWQA 2AMIA 5AERA 3GK1A 1YURA 1QJTA 1TNPA 2WC8A 4M2PA 1HT9A 1SCMB 2FCEA 1EG4A 1SK6D 1SR6B 3HX4A 2IS9A 5ER4X 4A4BA 1PK0D 3BOWB 4R1EA 5KSZA 3SG7A 1CDNA 3PLFB 5BPJA 2FJUB 2LVIA 1DVIA 4ORAB 4DS7A 1H4BA 2F2OA 4N1GA 1A03A 2V53A 2K7DA 5AANA 2F33A 2K8MB 1G33A 1DMOA 1GQMA 1YUUA 1UHHA 1AP4A 1B47A 4YGCB 5AEQA 1RK9A 4PE0A 2KHNA 2LMUA 1M39A 4U8DA 1IKUA 4PALA 2P6BB 1A2XA 1BT6A 1YVHA 1YVLA 1PVBA 3I5GC 4P2YB 2LE9B 1AJ5A 2LVVA 1RROA 4M2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WXA A;  1LA3 A;  2M3W A;  4JPZ B;  1OZS A;  1NCX A;  2F3Y A;  2LAN A;  2NCP A;  1G4Y R;  4NDC A;  1E8A A;  1L2O B;  1ZUZ A;  4N5X A;  2DOQ A;  3ZNI A;  1IQ5 A;  4CLN A;  3JVT B;  3SG6 A;  1F54 A;  2GGZ A;  2M1K B;  2MJW B;  1A75 B;  4JQ0 D;  2ISD A;  5KU1 A;  4BY4 A;  1QLS A;  2MA2 A;  2LUX A;  4OR9 B;  2JUL A;  4I5K A;  1CLM A;  4GNK B;  4PHJ A;  1DJX A;  4AQI A;  1CB1 A;  1RTP 1;  1B7T Z;  2NZ0 A;  1J7R A;  3H4S E;  2SAS A;  1JWD A;  1M45 A;  4HRE E;  1NIW A;  4GGN A;  2LAP A;  3KO0 A;  1M46 A;  1BF5 A;  4YI8 A;  2AAO A;  3NSK A;  4YGB B;  4XYN A;  4C0J A;  2EHB A;  2R2I A;  1TN4 A;  5HKZ A;  4PCW A;  1J55 A;  4MLW A;  2GGM A;  2I94 A;  2LNK A;  5HKY A;  3CS1 A;  4HRG A;  2WND A;  3EK7 A;  1JF2 A;  3DD4 A;  2K2F A;  3VRO A;  2CTN A;  1XK4 C;  1YUT A;  2NLN A;  3I5G B;  2BE6 A;  1B8C A;  5I2L A;  5K89 A;  1NUB A;  4JWQ A;  3PM8 A;  4FTG A;  4MRX A;  4ORB B;  1BR1 B;  1SY9 A;  2LMT A;  1NSH A;  3MSE B;  4DCK A;  2WCF A;  2JXL A;  3CR5 X;  1MR8 A;  3EKJ A;  4OKH A;  2KI4 C;  1NX3 A;  3OB2 B;  2LP3 A;  2F8P A;  2MAZ A;  2BL0 C;  1XO5 A;  3IF7 A;  1IRJ A;  4CID A;  1KQM C;  3BQ3 A;  1QVI Y;  2PVB A;  1GGW A;  2MBX A;  4MZJ A;  1OQP A;  2JTZ A;  1B8L A;  1ZAC A;  4NQG A;  3OB1 B;  1AJ4 A;  1B9A A;  2F3Z A;  2I7A A;  2K61 A;  3OX6 A;  4IL1 A;  1TNQ A;  3AAK A;  4DRW A;  4GGF A;  3RM1 A;  4YGE B;  1KK7 Z;  1OSA A;  5CPV A;  4MN0 A;  2EGD A;  3TUY C;  2L98 A;  2CNP A;  1WLM A;  1CDL A;  1XYD A;  2K0J A;  1TIZ A;  1KK8 C;  1K93 D;  2M7N A;  4I5L B;  1K94 A;  1NX2 A;  4GFT A;  2M49 B;  4WQ3 A;  5DKQ A;  1QX5 B;  1U5I A;  4MRY A;  5AXI A;  3VRP A;  2KYC A;  1F70 A;  1K90 D;  1F55 A;  1H8B A;  1EG3 A;  2MHH A;  1IJ6 A;  2JWW A;  1CKK A;  3EK8 A;  1JFK A;  1J7Q A;  4PHN A;  3GK4 X;  1CFP A;  3I5F C;  5G08 A;  4HSZ A;  1GGZ A;  2M8U A;  1TCO B;  4OCI A;  4PDZ A;  1S6I A;  2JOJ A;  1NWD A;  3D0Y A;  3TDU A;  4FQO A;  1EH2 A;  1SL7 A;  2M0R A;  2ZNE A;  1QX7 A;  1S5G Y;  2EC6 C;  2GV5 A;  2KI4 B;  4CFR A;  1JF0 A;  3WHT B;  1GJY A;  2LV7 A;  2MLF C;  1CDP A;  1NX0 A;  2BL0 B;  3CGA A;  3CR2 A;  1DJH A;  2BBN A;  2MLE C;  1YTZ C;  1KQM B;  1FI5 A;  3NSL A;  1TNW A;  1NYA A;  4DIR A;  3KPX A;  2KFH A;  2LLT A;  3NSO A;  1J1D A;  1R2U A;  1ZMZ A;  2CXJ A;  4I5J A;  2LHL A;  1QXP A;  3SG4 A;  1XFW O;  2KAY A;  2M1U A;  2JXC A;  4QJ3 B;  4ORC B;  3E3R A;  1Y1A A;  3O78 A;  2K7C A;  3BUN B;  2M7L A;  4F0Z B;  3SIA A;  2NCO A;  3LL8 B;  1YRT B;  1MWN A;  3PAL A;  5D69 A;  1MF8 B;  3TUY B;  4ZCU A;  4QJ4 B;  2LVJ A;  5JOL A;  1DJG A;  3LLE A;  2VRG A;  1KK8 B;  2L5X B;  1XVJ A;  2ZFD A;  1S26 D;  4HRH A;  2ZN8 A;  2OS8 C;  1J7O A;  2QPT A;  1DF0 A;  4D1E A;  1LVC D;  2KGB C;  3SG3 A;  2K7O A;  2KAX A;  1CDM A;  3EVR A;  1PAL A;  4YBH B;  3VRN A;  3BUO B;  2BCX A;  1QAT A;  2G9B A;  3I5F B;  1BU3 A;  2TN4 A;  1SRA A;  1MQ1 A;  1A75 A;  1AHR A;  2ZND A;  5JJG A;  1M63 B;  1SW8 A;  1IG5 A;  1UHN A;  1NPQ A;  2KSP A;  2ZRS A;  3GOF A;  3TDI A;  1LA0 A;  2EC6 B;  3BYA A;  3LCP C;  4GGF C;  1KFU L;  2OTG C;  3CZT X;  1FF1 A;  4MVF A;  2M29 A;  4MSP A;  2BKH B;  3OX5 A;  2D8N A;  2O5G A;  3DF0 B;  5D7F A;  4USL A;  2L4I A;  2L2E A;  2F2P A;  2I18 A;  1JUO A;  2QAC A;  2KI6 D;  2JRF A;  2ZKM X;  3EKH A;  5KTY A;  1TTX A;  3O6B A;  2H2K A;  4CPV A;  1XFY O;  1S5G Z;  4WQ2 A;  4XJK A;  1PRW A;  1MXE A;  1UHJ A;  2FOT A;  3DVK A;  2A4J A;  3CTN A;  1TCF A;  1VRK A;  3AKA A;  2LVK A;  4NDB A;  4OVN F;  1DJW A;  2JT8 A;  2K2A A;  1CNP A;  1QLK A;  1YX7 A;  2JPT A;  2WOS A;  1SPY A;  3PN7 C;  2HQ8 A;  3JTD C;  3LK0 A;  1DTL A;  2PAL A;  1S6C A;  2HPS A;  4PE1 A;  3KF9 A;  3GK2 A;  1UHK A;  2OS8 B;  4GUK A;  2M9G A;  4C0K A;  2KOT A;  1QIW A;  4WRI A;  1B8R A;  1L7Z A;  2KFG A;  1K95 A;  1MXL C;  5HKW A;  4NDD A;  1HQV A;  1EL4 A;  2CT9 A;  3VGO A;  1NP8 A;  2JT0 A;  1TRF A;  2LP2 A;  1A4P A;  1SL9 A;  1ALW A;  1Y1U A;  1CMF A;  1N0Y A;  1KSM A;  2FCD A;  1F71 A;  1KFU S;  2Q91 A;  3DVE A;  5HYD A;  4N1F A;  2JNF A;  2K7B A;  1QV0 A;  2BBM A;  5CSI A;  4DUQ A;  1EJ3 A;  3NXA A;  4M2Q A;  1S36 A;  1B4C A;  2OTG B;  1S6J A;  3DVM A;  3WNX B;  2Y5I A;  1LIN A;  1CM1 A;  1IJ5 A;  2BKI B;  1SCV A;  1DJI A;  2KYF A;  1CFD A;  1RWY A;  2HF5 A;  3DVJ A;  2JU0 A;  2PMY A;  3FIA A;  1N65 A;  1C7V A;  2KQ6 A;  1PSR A;  3OHM B;  2WCE A;  1TOP A;  2Y4Q A;  1WRL A;  3NSI A;  5ER5 A;  4MBE A;  1RJV A;  4ZCV A;  1V1G A;  1B7T Y;  2Y1M A;  2KGR A;  1QIV A;  1ALV A;  3FWB A;  1K8U A;  4PHM A;  1KSO A;  4YGA A;  2HQW A;  3SG5 A;  2H61 A;  1WLZ A;  1A29 A;  3CLN A;  3K21 A;  2Q4U A;  2G2B A;  3JTD B;  3PN7 B;  5CSN A;  1W7I B;  1QX2 A;  1SNL A;  3BUW B;  3BOW A;  1IH0 A;  1OMR A;  3D0Y B;  3IQQ A;  1FPW A;  1FI6 A;  2KBM A;  4C0L A;  1FBV A;  3SG2 A;  1XFX O;  1TNX A;  1ZOT B;  1OE9 B;  2CCM A;  1BLQ A;  2LC5 A;  1MUX A;  2LLU A;  5IBW A;  2KI6 C;  1NCZ A;  3PFV A;  1YRU B;  1JC2 A;  1XFV O;  2WCB A;  3CR4 X;  2LHI A;  1BR4 B;  4P5O E;  3VRR A;  1BOC A;  2L4H A;  1OMD A;  4PHK A;  1RFJ A;  1UUS A;  1CLL A;  2M97 A;  2KBI A;  3HCM A;  3D10 A;  1Y1X A;  1QVI Z;  2BEC A;  3ZWH A;  4I5N B;  2JT3 A;  2KFF A;  2B1U A;  4ETO A;  4OV2 A;  2JNX A;  3VRQ A;  2COL B;  3O4Y A;  3TS5 C;  1K9P A;  4AOM A;  3O2P A;  4AQJ A;  2I2R E;  5B8I B;  1CM4 A;  1YX8 A;  3I5I C;  5I2Q A;  1V1F A;  1SBJ A;  3SIB A;  3EVU A;  1UWO A;  2LLS A;  1PSB A;  3A8R A;  5DKN A;  1DF0 B;  1WY9 A;  4YI9 A;  5DKR A;  1ODB A;  1LKJ A;  1EXR A;  1DGV A;  1NCY A;  2JZI A;  1OMV A;  1WDC C;  1YR5 A;  1JFJ A;  2SCP A;  1SYM A;  3BUX B;  1KK7 Y;  4MEW A;  3KHE A;  3EK4 A;  4ICB A;  1D1O A;  1CLB A;  1IGV A;  1KFX L;  1M31 A;  2LM5 A;  5TNC A;  3SJS A;  4YRU A;  2BCB A;  4GBA A;  3CWG A;  1F8H A;  4E68 A;  2NXQ A;  2PRU A;  4PE4 A;  1X02 A;  4YGD B;  1QTX A;  3KEV A;  2KAV A;  1DT7 B;  5AFP A;  1K9K A;  4MZL A;  1CFC A;  2L51 A;  2CBL A;  3F45 A;  2E30 A;  1KCY A;  2WOR A;  3LK1 A;  4L9M A;  5J3X A;  1SL8 A;  2PAS A;  2JTT A;  3I5H C;  1UP5 A;  1QAS A;  1WRK A;  2JC2 A;  1UUR A;  3DF0 A;  2AUC A;  1B1G A;  1F4O A;  1F4Q A;  5CSF A;  2L50 A;  1REC A;  1R6P A;  1XFU O;  2RGI A;  3PSR A;  5I2O A;  3TDZ A;  4TNC A;  1AK8 A;  1QV1 A;  1FW4 A;  4XJK B;  5F6T A;  1K96 A;  3WHU B;  1JSA A;  1S1E A;  1BG1 A;  5CSJ A;  1KWO C;  3BUM B;  4BY5 A;  2HET A;  1DJY A;  3C1V A;  3AAJ A;  2BCA A;  1YUS A;  1CMG A;  3TS5 B;  1S3P A;  3A4U B;  2KQY A;  2H61 C;  3FWC A;  1SCM C;  4CFQ A;  1SR6 C;  2KDH A;  1PVA A;  2E6W A;  1N2D A;  2ZRT A;  3I5I B;  4QJ5 B;  2KNE A;  2L0P A;  3ICB A;  1SMG A;  2JQ6 A;  3M0W A;  1CFF A;  1DJZ A;  1K2H A;  3IQO A;  1BMO A;  2OPO A;  1KFX S;  1WDC B;  1JBA A;  1J7P A;  5PAL A;  5I8N A;  1AVS A;  3FS7 A;  2PSR A;  5HLV A;  5FYX A;  1LXF C;  5HLO A;  1OOJ A;  1MHO A;  2ZN9 A;  1UHI A;  4UPG A;  1PUL A;  3AKB A;  1XA5 A;  1ZFS A;  5GQQ C;  1W7J B;  2O60 A;  1G8I A;  4A4C A;  2Y1N A;  1NX1 A;  1CTR A;  2BE4 A;  1DGU A;  4PE7 A;  1BOD A;  4GAO A;  1IQ3 A;  1QS7 A;  1SKT A;  3BXK A;  1U5I B;  3I5H B;  3OP0 A;  4Q04 A;  2MRD A;  1BJF A;  2LMV A;  3TZ1 A;  1Y6W A;  1AUI B;  1L2O C;  1WRZ A;  1KQV A;  2LCP A;  3QRX A;  3JVT C;  4GPL B;  2LUC A;  1C07 A;  3RLZ A;  4MZK A;  1J1E A;  1XK4 A;  3EVV A;  1XFZ O;  1K9U A;  1C7W A;  1KWO B;  1Y0V H;  3PAT A;  1OZO A;  1Q80 A;  1IWQ A;  2AMI A;  5AER A;  3GK1 A;  1YUR A;  1QJT A;  1TNP A;  2WC8 A;  4M2P A;  1HT9 A;  1SCM B;  2FCE A;  1EG4 A;  1SK6 D;  1SR6 B;  3HX4 A;  2IS9 A;  5ER4 X;  4A4B A;  1PK0 D;  3BOW B;  4R1E A;  5KSZ A;  3SG7 A;  1CDN A;  3PLF B;  5BPJ A;  2FJU B;  2LVI A;  1DVI A;  4ORA B;  4DS7 A;  1H4B A;  2F2O A;  4N1G A;  1A03 A;  2V53 A;  2K7D A;  5AAN A;  2F33 A;  2K8M B;  1G33 A;  1DMO A;  1GQM A;  1YUU A;  1UHH A;  1AP4 A;  1B47 A;  4YGC B;  5AEQ A;  1RK9 A;  4PE0 A;  2KHN A;  2LMU A;  1M39 A;  4U8D A;  1IKU A;  4PAL A;  2P6B B;  1A2X A;  1BT6 A;  1YVH A;  1YVL A;  1PVB A;  3I5G C;  4P2Y B;  2LE9 B;  1AJ5 A;  2LVV A;  1RRO A;  4M2O A; 
#chains in the Genus database with same CATH topology
 3WXA A;  1SSE B;  1LA3 A;  2M3W A;  4JPZ B;  1OZS A;  1NCX A;  2F3Y A;  3VB1 A;  2LAN A;  2NCP A;  1G4Y R;  4NDC A;  1E8A A;  1L2O B;  1ZUZ A;  4N5X A;  2DOQ A;  5FI2 A;  1IQ5 A;  3ZNI A;  4CLN A;  3JVT B;  3Q8I A;  3SG6 A;  4OZD A;  1F54 A;  2GGZ A;  2M1K B;  2MJW B;  1A75 B;  4JQ0 D;  2ISD A;  5KU1 A;  3SS5 A;  4BY4 A;  3FE8 A;  1QLS A;  2MA2 A;  5D3O A;  2LUX A;  4OR9 B;  3N7H A;  2JUL A;  4I5K A;  1CLM A;  4IJ7 A;  4GNK B;  4PHJ A;  1DJX A;  3L4A A;  4AQI A;  1CB1 A;  1RTP 1;  1B7T Z;  2NZ0 A;  1J7R A;  3H4S E;  2SAS A;  1JWD A;  1OOF A;  1DEL A;  1M45 A;  4HRE E;  1NIW A;  3D77 A;  4GGN A;  2LAP A;  3KO0 A;  1M46 A;  1BF5 A;  4YI8 A;  2AAO A;  3NSK A;  4YGB B;  2H8V A;  4XYN A;  1W9Z A;  4C0J A;  2EHB A;  2R2I A;  1TN4 A;  5HKZ A;  4PCW A;  1J55 A;  4MLW A;  2GGM A;  2I94 A;  2LNK A;  5HKY A;  3CS1 A;  4HRG A;  2WND A;  3EK7 A;  1JF2 A;  3DD4 A;  2K2F A;  3VRO A;  2CTN A;  1XK4 C;  1YUT A;  2NLN A;  3I5G B;  2BE6 A;  1B8C A;  5I2L A;  5K89 A;  1NUB A;  4JWQ A;  1P28 A;  1QWV A;  3PM8 A;  4FTG A;  2K60 A;  4MRX A;  4ORB B;  3K1E A;  1BR1 B;  1SY9 A;  2LMT A;  1NSH A;  3MSE B;  4DCK A;  2WCF A;  2JXL A;  3CR5 X;  1MR8 A;  2P71 A;  3EKJ A;  4OKH A;  2KI4 C;  1NX3 A;  3OB2 B;  2LP3 A;  2F8P A;  2MAZ A;  2BL0 C;  1XO5 A;  3IF7 A;  1IRJ A;  4CID A;  1KQM C;  3BQ3 A;  1QVI Y;  2PVB A;  1GGW A;  2MBX A;  4MZJ A;  1OQP A;  2JTZ A;  1B8L A;  1ZAC A;  4NQG A;  3OB1 B;  1AJ4 A;  1B9A A;  2F3Z A;  2I7A A;  2K61 A;  3D78 A;  3OX6 A;  4IL1 A;  1TNQ A;  3AAK A;  4JKT A;  4DRW A;  4GGF A;  3RM1 A;  4YGE B;  1KK7 Z;  1OSA A;  5CPV A;  4MN0 A;  2EGD A;  3SS3 A;  5FI6 A;  3TUY C;  2L98 A;  2CNP A;  1WLM A;  1T14 A;  1CDL A;  1XYD A;  2K0J A;  1TIZ A;  2WCJ A;  1KK8 C;  1K93 D;  2M7N A;  4I5L B;  1K94 A;  1NX2 A;  3UO9 A;  1OW4 A;  2M49 B;  4GFT A;  4WQ3 A;  5DKQ A;  1QX5 B;  1U5I A;  4MRY A;  3D74 A;  5AXI A;  3DY9 A;  3VRP A;  3B6X A;  2KYC A;  1F70 A;  1K90 D;  1F55 A;  1H8B A;  1EG3 A;  2MHH A;  1IJ6 A;  2JWW A;  1CKK A;  3EK8 A;  1JFK A;  1J7Q A;  4PHN A;  5HL1 A;  1ORG A;  3GK4 X;  3I5F C;  5G08 A;  1CFP A;  4HSZ A;  1OOH A;  1GGZ A;  2M8U A;  1TCO B;  1OOI X;  4OCI A;  3PJI A;  4PDZ A;  1S6I A;  2JOJ A;  1NWD A;  3D0Y A;  3TDU A;  4FQO A;  1EH2 A;  1SL7 A;  2M0R A;  2ZNE A;  1QX7 A;  1S5G Y;  2EC6 C;  2GV5 A;  2KI4 B;  4CFR A;  1JF0 A;  3WHT B;  1GJY A;  2LV7 A;  2MLF C;  1CDP A;  3NGV A;  1NX0 A;  2BL0 B;  3CGA A;  3CR2 A;  1DJH A;  2BBN A;  2MLE C;  1YTZ C;  3NHI A;  1KQM B;  1FI5 A;  3EG5 B;  3NSL A;  1TNW A;  1NYA A;  4DIR A;  1LS8 A;  3KPX A;  3NHT A;  2KFH A;  2LLT A;  3NSO A;  1J1D A;  1R2U A;  1ZMZ A;  2L2C A;  2CXJ A;  4I5J A;  5FI7 A;  2LHL A;  1QXP A;  3SG4 A;  1XFW O;  2KAY A;  2M1U A;  3DXL A;  2JXC A;  4QJ3 B;  4ORC B;  3E3R A;  1Y1A A;  3O78 A;  2K7C A;  3BUN B;  3CAB A;  2M7L A;  4F0Z B;  3SIA A;  2NCO A;  3LL8 B;  1YRT B;  1MWN A;  3PAL A;  5D69 A;  1MF8 B;  3TUY B;  4ZCU A;  4QJ4 B;  2WCK A;  2LVJ A;  5JOL A;  1DJG A;  3LLE A;  2VRG A;  1KK8 B;  2L5X B;  1XVJ A;  3B87 A;  2ZFD A;  1S26 D;  4HRH A;  2ZN8 A;  2QEV A;  2OS8 C;  1J7O A;  3BFH A;  1OOG A;  2JPO A;  1DF0 A;  2QPT A;  3CDN A;  4D1E A;  1LVC D;  2KGB C;  3SG3 A;  2K7O A;  2KAX A;  1CDM A;  2QEO A;  3EVR A;  1PAL A;  4YBH B;  3VRN A;  3BUO B;  2BCX A;  1QAT A;  2G9B A;  3I5F B;  1BU3 A;  2TN4 A;  2PYQ A;  3RZS A;  1SRA A;  1MQ1 A;  1A75 A;  1AHR A;  2ZND A;  5JJG A;  2QEB A;  1M63 B;  1SW8 A;  1IG5 A;  1UHN A;  1NPQ A;  2KSP A;  2ZRS A;  3GOF A;  3TDI A;  1LA0 A;  2EC6 B;  3DYE A;  3BYA A;  2ERB A;  3LCP C;  4GGF C;  1KFU L;  2OTG C;  3CZT X;  1FF1 A;  4MVF A;  2M29 A;  4MSP A;  2PQL A;  2BKH B;  3OX5 A;  2D8N A;  2O5G A;  5DIC A;  3DF0 B;  5D7F A;  4USL A;  2L4I A;  2L2E A;  3D76 A;  2F2P A;  3D73 A;  2I18 A;  1JUO A;  2QAC A;  2KI6 D;  2JRF A;  2ZKM X;  3EKH A;  5KTY A;  1TTX A;  3O6B A;  2H2K A;  4CPV A;  1XFY O;  1S5G Z;  4WQ2 A;  4XJK A;  1PRW A;  1MXE A;  1UHJ A;  2FOT A;  4KYN A;  3DVK A;  2A4J A;  3CTN A;  1TCF A;  1VRK A;  3AKA A;  2LVK A;  4NDB A;  4OVN F;  1DJW A;  2JT8 A;  2K2A A;  3BJH A;  3S0D A;  1CNP A;  1QLK A;  1YX7 A;  2JPT A;  2WOS A;  1SPY A;  3PN7 C;  2HQ8 A;  3JTD C;  2KPH A;  1DTL A;  3LK0 A;  2PAL A;  1S6C A;  2HPS A;  1DQE A;  3KF9 A;  4PE1 A;  3GK2 A;  1UHK A;  2OS8 B;  4GUK A;  2M9G A;  4C0K A;  2KOT A;  1QIW A;  4WRI A;  1B8R A;  1L7Z A;  2KFG A;  2WCH A;  1K95 A;  1MXL C;  5HKW A;  4NDD A;  1HQV A;  1EL4 A;  2CT9 A;  3VGO A;  1NP8 A;  2JT0 A;  1TRF A;  2LP2 A;  1A4P A;  1SL9 A;  1ALW A;  1Y1U A;  2QEH A;  1CMF A;  1N0Y A;  1KSM A;  2FCD A;  4PT1 A;  1F71 A;  2BNX A;  3B86 A;  1KFU S;  2Q91 A;  3DVE A;  5HYD A;  2YGU A;  4N1F A;  2JNF A;  2K7B A;  1QV0 A;  2BBM A;  5CSI A;  4DUQ A;  1EJ3 A;  1TWO A;  3NXA A;  4M2Q A;  1S36 A;  2P70 A;  2OTG B;  1B4C A;  1S6J A;  3DVM A;  3WNX B;  2Y5I A;  1LIN A;  2KLE A;  1CM1 A;  1IJ5 A;  3R72 A;  2BKI B;  1SCV A;  1DJI A;  1TUJ A;  2KYF A;  1CFD A;  1RWY A;  2QDI A;  5I94 A;  2HF5 A;  3DVJ A;  2JU0 A;  2PMY A;  3FIA A;  1N65 A;  1C7V A;  2KQ6 A;  1PSR A;  3OHM B;  2WCE A;  1TOP A;  2Y4Q A;  1WRL A;  3NSI A;  5ER5 A;  4MBE A;  1RJV A;  4ZCV A;  1AK8 A;  1V1G A;  1B7T Y;  2Y1M A;  2KGR A;  3L47 A;  1QIV A;  1ALV A;  3FWB A;  1K8U A;  4PHM A;  1KSO A;  4YGA A;  3BFB A;  2HQW A;  3SG5 A;  2H61 A;  1WLZ A;  3SS4 A;  1A29 A;  3CLN A;  3K21 A;  2Q4U A;  2G2B A;  3JTD B;  3PN7 B;  5CSN A;  1W7I B;  1QX2 A;  1SNL A;  3BUW B;  3BOW A;  1IH0 A;  1OMR A;  3D0Y B;  3IQQ A;  1FPW A;  1FI6 A;  2KBM A;  4C0L A;  1FBV A;  3SG2 A;  1XFX O;  1TNX A;  1ZOT B;  1OE9 B;  2CCM A;  2FJY A;  1BLQ A;  2LC5 A;  1MUX A;  1XFR A;  2LLU A;  5IBW A;  2KI6 C;  1NCZ A;  3PFV A;  1YRU B;  1JC2 A;  1XFV O;  2WCB A;  3CR4 X;  2LHI A;  1BR4 B;  4P5O E;  3VRR A;  1BOC A;  2L4H A;  1OMD A;  4PHK A;  1RFJ A;  1UUS A;  1CLL A;  2M97 A;  2KBI A;  3HCM A;  3D10 A;  1Y1X A;  1QVI Z;  2BEC A;  3ZWH A;  4I5N B;  2JT3 A;  2KFF A;  2B1U A;  4ETO A;  4OV2 A;  2JNX A;  3VRQ A;  2COL B;  3O4Y A;  3TS5 C;  1K9P A;  4AOM A;  3O2P A;  4AQJ A;  2I2R E;  5B8I B;  4JD9 A;  1CM4 A;  1YX8 A;  3I5I C;  5I2Q A;  1V1F A;  1SBJ A;  3SIB A;  3EVU A;  1UWO A;  2LLS A;  1PSB A;  3A8R A;  5DKN A;  1DF0 B;  1WY9 A;  4YI9 A;  5DKR A;  1ODB A;  1LKJ A;  1EXR A;  1DGV A;  1NCY A;  2JZI A;  1OMV A;  1WDC C;  1YR5 A;  1JFJ A;  2SCP A;  1SYM A;  3BUX B;  1KK7 Y;  4MEW A;  3KHE A;  3EK4 A;  4ICB A;  1D1O A;  1CLB A;  1IGV A;  1KFX L;  4FQT A;  1M31 A;  2KLD A;  2LM5 A;  5TNC A;  3SJS A;  4YRU A;  1GM0 A;  2BCB A;  4GBA A;  3CWG A;  1F8H A;  4E68 A;  2NXQ A;  2PRU A;  4PE4 A;  1X02 A;  4INX A;  4YGD B;  1QTX A;  3CYZ A;  3KEV A;  2KAV A;  1DT7 B;  5AFP A;  1K9K A;  4MZL A;  1CFC A;  2L51 A;  2CBL A;  1DEK A;  2E30 A;  3F45 A;  2WOR A;  1KCY A;  3LK1 A;  4L9M A;  3FE6 A;  5J3X A;  1SL8 A;  2PAS A;  2JTT A;  3I5H C;  1UP5 A;  1QAS A;  1WRK A;  2JC2 A;  1UUR A;  3DF0 A;  2AUC A;  3S0G A;  1B1G A;  1F4O A;  1F4Q A;  5CSF A;  2L50 A;  1REC A;  1R6P A;  1XFU O;  2RGI A;  3PSR A;  5I2O A;  3TDZ A;  4TNC A;  2WCM A;  1QV1 A;  1FW4 A;  4XJK B;  5F6T A;  1K96 A;  3PM2 A;  3WHU B;  1JSA A;  1S1E A;  2L5Y A;  3V2L A;  5CSJ A;  1BG1 A;  1KWO C;  3BUM B;  2BAP A;  2WC6 A;  4BY5 A;  2HET A;  1DJY A;  3C1V A;  3AAJ A;  2BCA A;  1YUS A;  1CMG A;  3TS5 B;  1S3P A;  3A4U B;  2KQY A;  2H61 C;  3FWC A;  1SCM C;  4CFQ A;  1SR6 C;  2KDH A;  1PVA A;  2E6W A;  1N2D A;  2ZRT A;  3BFA A;  3I5I B;  1Z2C B;  2KNE A;  2L0P A;  3ICB A;  4QJ5 B;  3S0E A;  1SMG A;  3R1V A;  2JQ6 A;  3M0W A;  1CFF A;  1DJZ A;  1K2H A;  3IQO A;  1BMO A;  3OBV A;  3OGN A;  2OPO A;  1KFX S;  1WDC B;  1DC1 A;  1J7P A;  5PAL A;  5I8N A;  1AVS A;  3FS7 A;  1JBA A;  2PSR A;  5HLV A;  1Z4H A;  5FYX A;  1LXF C;  5HLO A;  1OOJ A;  1MHO A;  3O4X A;  2ZN9 A;  1UHI A;  4UPG A;  1PUL A;  2GTE A;  3AKB A;  1XA5 A;  1ZFS A;  5GQQ C;  1W7J B;  2O60 A;  1G8I A;  4A4C A;  2Y1N A;  3CZ0 A;  1NX1 A;  1CTR A;  2BE4 A;  1DGU A;  4PE7 A;  5EL2 A;  1BOD A;  3QME A;  4GAO A;  1IQ3 A;  1C3Z A;  1QS7 A;  1SKT A;  3BXK A;  1U5I B;  3I5H B;  3OP0 A;  4Q04 A;  3DZT A;  1C3Y A;  2MRD A;  1BJF A;  2LMV A;  3TZ1 A;  1Y6W A;  1AUI B;  1L2O C;  3B7A A;  1WRZ A;  1KQV A;  2LCP A;  3QRX A;  3JVT C;  4INW A;  4GPL B;  2LUC A;  2WC5 A;  3R1P A;  1C07 A;  3RLZ A;  4F7F A;  4MZK A;  1J1E A;  1XK4 A;  3EVV A;  1XFZ O;  1K9U A;  1C7W A;  1KWO B;  1Y0V H;  3PAT A;  1OZO A;  1Q80 A;  3FE9 A;  1IWQ A;  2AMI A;  5AER A;  1TUZ A;  3GK1 A;  1YUR A;  1QJT A;  1TNP A;  2WC8 A;  4M2P A;  1HT9 A;  1SCM B;  2FCE A;  1EG4 A;  1SK6 D;  1SR6 B;  3HX4 A;  2IS9 A;  5ER4 X;  3S0B A;  4A4B A;  1PK0 D;  3BOW B;  3D75 A;  4R1E A;  5KSZ A;  3SG7 A;  1CDN A;  3PLF B;  5BPJ A;  2FJU B;  3S0F A;  2LVI A;  1DVI A;  4ORA B;  4DS7 A;  1H4B A;  2F2O A;  4N1G A;  2WCL A;  1A03 A;  2V53 A;  2K7D A;  5AAN A;  2F33 A;  2K8M B;  1G33 A;  1DMO A;  1GQM A;  3B88 A;  1YUU A;  1IIO A;  1UHH A;  3CZ2 A;  1AP4 A;  1B47 A;  3R1O A;  4YGC B;  5AEQ A;  3IVT A;  1RK9 A;  4PE0 A;  2KHN A;  2LMU A;  1M39 A;  4U8D A;  3CZ1 A;  1IKU A;  4PAL A;  3L4L A;  2P6B B;  1A2X A;  1BT6 A;  1YVH A;  3S0A A;  1YVL A;  1PVB A;  3I5G C;  4P2Y B;  3UNW A;  2LE9 B;  1AJ5 A;  2LVV A;  1RRO A;  4M2O A; 
#chains in the Genus database with same CATH homology
 3WXA A;  1LA3 A;  2M3W A;  4JPZ B;  1OZS A;  1NCX A;  2F3Y A;  2LAN A;  2NCP A;  1G4Y R;  4NDC A;  1E8A A;  1L2O B;  1ZUZ A;  4N5X A;  2DOQ A;  3ZNI A;  1IQ5 A;  4CLN A;  3JVT B;  3SG6 A;  1F54 A;  2GGZ A;  2M1K B;  2MJW B;  1A75 B;  4JQ0 D;  2ISD A;  5KU1 A;  4BY4 A;  1QLS A;  2MA2 A;  2LUX A;  4OR9 B;  2JUL A;  4I5K A;  1CLM A;  4GNK B;  4PHJ A;  1DJX A;  4AQI A;  1CB1 A;  1RTP 1;  1B7T Z;  2NZ0 A;  1J7R A;  3H4S E;  2SAS A;  1JWD A;  1M45 A;  4HRE E;  1NIW A;  4GGN A;  2LAP A;  3KO0 A;  1M46 A;  1BF5 A;  4YI8 A;  2AAO A;  3NSK A;  4YGB B;  4XYN A;  4C0J A;  2EHB A;  2R2I A;  1TN4 A;  5HKZ A;  4PCW A;  1J55 A;  4MLW A;  2GGM A;  2I94 A;  2LNK A;  5HKY A;  3CS1 A;  4HRG A;  2WND A;  3EK7 A;  1JF2 A;  3DD4 A;  2K2F A;  3VRO A;  2CTN A;  1XK4 C;  1YUT A;  2NLN A;  3I5G B;  2BE6 A;  1B8C A;  5I2L A;  5K89 A;  1NUB A;  4JWQ A;  3PM8 A;  4FTG A;  4MRX A;  4ORB B;  1BR1 B;  1SY9 A;  2LMT A;  1NSH A;  3MSE B;  4DCK A;  2WCF A;  2JXL A;  3CR5 X;  1MR8 A;  3EKJ A;  4OKH A;  2KI4 C;  1NX3 A;  3OB2 B;  2LP3 A;  2F8P A;  2MAZ A;  2BL0 C;  1XO5 A;  3IF7 A;  1IRJ A;  4CID A;  1KQM C;  3BQ3 A;  1QVI Y;  2PVB A;  1GGW A;  2MBX A;  4MZJ A;  1OQP A;  2JTZ A;  1B8L A;  1ZAC A;  4NQG A;  3OB1 B;  1AJ4 A;  1B9A A;  2F3Z A;  2I7A A;  2K61 A;  3OX6 A;  4IL1 A;  1TNQ A;  3AAK A;  4DRW A;  4GGF A;  3RM1 A;  4YGE B;  1KK7 Z;  1OSA A;  5CPV A;  4MN0 A;  2EGD A;  3TUY C;  2L98 A;  2CNP A;  1WLM A;  1CDL A;  1XYD A;  2K0J A;  1TIZ A;  1KK8 C;  1K93 D;  2M7N A;  4I5L B;  1K94 A;  1NX2 A;  4GFT A;  2M49 B;  4WQ3 A;  5DKQ A;  1QX5 B;  1U5I A;  4MRY A;  5AXI A;  3VRP A;  2KYC A;  1F70 A;  1K90 D;  1F55 A;  1H8B A;  1EG3 A;  2MHH A;  1IJ6 A;  2JWW A;  1CKK A;  3EK8 A;  1JFK A;  1J7Q A;  4PHN A;  3GK4 X;  1CFP A;  3I5F C;  5G08 A;  4HSZ A;  1GGZ A;  2M8U A;  1TCO B;  4OCI A;  4PDZ A;  1S6I A;  2JOJ A;  1NWD A;  3D0Y A;  3TDU A;  4FQO A;  1EH2 A;  1SL7 A;  2M0R A;  2ZNE A;  1QX7 A;  1S5G Y;  2EC6 C;  2GV5 A;  2KI4 B;  4CFR A;  1JF0 A;  3WHT B;  1GJY A;  2LV7 A;  2MLF C;  1CDP A;  1NX0 A;  2BL0 B;  3CGA A;  3CR2 A;  1DJH A;  2BBN A;  2MLE C;  1YTZ C;  1KQM B;  1FI5 A;  3NSL A;  1TNW A;  1NYA A;  4DIR A;  3KPX A;  2KFH A;  2LLT A;  3NSO A;  1J1D A;  1R2U A;  1ZMZ A;  2CXJ A;  4I5J A;  2LHL A;  1QXP A;  3SG4 A;  1XFW O;  2KAY A;  2M1U A;  2JXC A;  4QJ3 B;  4ORC B;  3E3R A;  1Y1A A;  3O78 A;  2K7C A;  3BUN B;  2M7L A;  4F0Z B;  3SIA A;  2NCO A;  3LL8 B;  1YRT B;  1MWN A;  3PAL A;  5D69 A;  1MF8 B;  3TUY B;  4ZCU A;  4QJ4 B;  2LVJ A;  5JOL A;  1DJG A;  3LLE A;  2VRG A;  1KK8 B;  2L5X B;  1XVJ A;  2ZFD A;  1S26 D;  4HRH A;  2ZN8 A;  2OS8 C;  1J7O A;  2QPT A;  1DF0 A;  4D1E A;  1LVC D;  2KGB C;  3SG3 A;  2K7O A;  2KAX A;  1CDM A;  3EVR A;  1PAL A;  4YBH B;  3VRN A;  3BUO B;  2BCX A;  1QAT A;  2G9B A;  3I5F B;  1BU3 A;  2TN4 A;  1SRA A;  1MQ1 A;  1A75 A;  1AHR A;  2ZND A;  5JJG A;  1M63 B;  1SW8 A;  1IG5 A;  1UHN A;  1NPQ A;  2KSP A;  2ZRS A;  3GOF A;  3TDI A;  1LA0 A;  2EC6 B;  3BYA A;  3LCP C;  4GGF C;  1KFU L;  2OTG C;  3CZT X;  1FF1 A;  4MVF A;  2M29 A;  4MSP A;  2BKH B;  3OX5 A;  2D8N A;  2O5G A;  3DF0 B;  5D7F A;  4USL A;  2L4I A;  2L2E A;  2F2P A;  2I18 A;  1JUO A;  2QAC A;  2KI6 D;  2JRF A;  2ZKM X;  3EKH A;  5KTY A;  1TTX A;  3O6B A;  2H2K A;  4CPV A;  1XFY O;  1S5G Z;  4WQ2 A;  4XJK A;  1PRW A;  1MXE A;  1UHJ A;  2FOT A;  3DVK A;  2A4J A;  3CTN A;  1TCF A;  1VRK A;  3AKA A;  2LVK A;  4NDB A;  4OVN F;  1DJW A;  2JT8 A;  2K2A A;  1CNP A;  1QLK A;  1YX7 A;  2JPT A;  2WOS A;  1SPY A;  3PN7 C;  2HQ8 A;  3JTD C;  3LK0 A;  1DTL A;  2PAL A;  1S6C A;  2HPS A;  4PE1 A;  3KF9 A;  3GK2 A;  1UHK A;  2OS8 B;  4GUK A;  2M9G A;  4C0K A;  2KOT A;  1QIW A;  4WRI A;  1B8R A;  1L7Z A;  2KFG A;  1K95 A;  1MXL C;  5HKW A;  4NDD A;  1HQV A;  1EL4 A;  2CT9 A;  3VGO A;  1NP8 A;  2JT0 A;  1TRF A;  2LP2 A;  1A4P A;  1SL9 A;  1ALW A;  1Y1U A;  1CMF A;  1N0Y A;  1KSM A;  2FCD A;  1F71 A;  1KFU S;  2Q91 A;  3DVE A;  5HYD A;  4N1F A;  2JNF A;  2K7B A;  1QV0 A;  2BBM A;  5CSI A;  4DUQ A;  1EJ3 A;  3NXA A;  4M2Q A;  1S36 A;  1B4C A;  2OTG B;  1S6J A;  3DVM A;  3WNX B;  2Y5I A;  1LIN A;  1CM1 A;  1IJ5 A;  2BKI B;  1SCV A;  1DJI A;  2KYF A;  1CFD A;  1RWY A;  2HF5 A;  3DVJ A;  2JU0 A;  2PMY A;  3FIA A;  1N65 A;  1C7V A;  2KQ6 A;  1PSR A;  3OHM B;  2WCE A;  1TOP A;  2Y4Q A;  1WRL A;  3NSI A;  5ER5 A;  4MBE A;  1RJV A;  4ZCV A;  1V1G A;  1B7T Y;  2Y1M A;  2KGR A;  1QIV A;  1ALV A;  3FWB A;  1K8U A;  4PHM A;  1KSO A;  4YGA A;  2HQW A;  3SG5 A;  2H61 A;  1WLZ A;  1A29 A;  3CLN A;  3K21 A;  2Q4U A;  2G2B A;  3JTD B;  3PN7 B;  5CSN A;  1W7I B;  1QX2 A;  1SNL A;  3BUW B;  3BOW A;  1IH0 A;  1OMR A;  3D0Y B;  3IQQ A;  1FPW A;  1FI6 A;  2KBM A;  4C0L A;  1FBV A;  3SG2 A;  1XFX O;  1TNX A;  1ZOT B;  1OE9 B;  2CCM A;  1BLQ A;  2LC5 A;  1MUX A;  2LLU A;  5IBW A;  2KI6 C;  1NCZ A;  3PFV A;  1YRU B;  1JC2 A;  1XFV O;  2WCB A;  3CR4 X;  2LHI A;  1BR4 B;  4P5O E;  3VRR A;  1BOC A;  2L4H A;  1OMD A;  4PHK A;  1RFJ A;  1UUS A;  1CLL A;  2M97 A;  2KBI A;  3HCM A;  3D10 A;  1Y1X A;  1QVI Z;  2BEC A;  3ZWH A;  4I5N B;  2JT3 A;  2KFF A;  2B1U A;  4ETO A;  4OV2 A;  2JNX A;  3VRQ A;  2COL B;  3O4Y A;  3TS5 C;  1K9P A;  4AOM A;  3O2P A;  4AQJ A;  2I2R E;  5B8I B;  1CM4 A;  1YX8 A;  3I5I C;  5I2Q A;  1V1F A;  1SBJ A;  3SIB A;  3EVU A;  1UWO A;  2LLS A;  1PSB A;  3A8R A;  5DKN A;  1DF0 B;  1WY9 A;  4YI9 A;  5DKR A;  1ODB A;  1LKJ A;  1EXR A;  1DGV A;  1NCY A;  2JZI A;  1OMV A;  1WDC C;  1YR5 A;  1JFJ A;  2SCP A;  1SYM A;  3BUX B;  1KK7 Y;  4MEW A;  3KHE A;  3EK4 A;  4ICB A;  1D1O A;  1CLB A;  1IGV A;  1KFX L;  1M31 A;  2LM5 A;  5TNC A;  3SJS A;  4YRU A;  2BCB A;  4GBA A;  3CWG A;  1F8H A;  4E68 A;  2NXQ A;  2PRU A;  4PE4 A;  1X02 A;  4YGD B;  1QTX A;  3KEV A;  2KAV A;  1DT7 B;  5AFP A;  1K9K A;  4MZL A;  1CFC A;  2L51 A;  2CBL A;  3F45 A;  2E30 A;  1KCY A;  2WOR A;  3LK1 A;  4L9M A;  5J3X A;  1SL8 A;  2PAS A;  2JTT A;  3I5H C;  1UP5 A;  1QAS A;  1WRK A;  2JC2 A;  1UUR A;  3DF0 A;  2AUC A;  1B1G A;  1F4O A;  1F4Q A;  5CSF A;  2L50 A;  1REC A;  1R6P A;  1XFU O;  2RGI A;  3PSR A;  5I2O A;  3TDZ A;  4TNC A;  1AK8 A;  1QV1 A;  1FW4 A;  4XJK B;  5F6T A;  1K96 A;  3WHU B;  1JSA A;  1S1E A;  1BG1 A;  5CSJ A;  1KWO C;  3BUM B;  4BY5 A;  2HET A;  1DJY A;  3C1V A;  3AAJ A;  2BCA A;  1YUS A;  1CMG A;  3TS5 B;  1S3P A;  3A4U B;  2KQY A;  2H61 C;  3FWC A;  1SCM C;  4CFQ A;  1SR6 C;  2KDH A;  1PVA A;  2E6W A;  1N2D A;  2ZRT A;  3I5I B;  4QJ5 B;  2KNE A;  2L0P A;  3ICB A;  1SMG A;  2JQ6 A;  3M0W A;  1CFF A;  1DJZ A;  1K2H A;  3IQO A;  1BMO A;  2OPO A;  1KFX S;  1WDC B;  1JBA A;  1J7P A;  5PAL A;  5I8N A;  1AVS A;  3FS7 A;  2PSR A;  5HLV A;  5FYX A;  1LXF C;  5HLO A;  1OOJ A;  1MHO A;  2ZN9 A;  1UHI A;  4UPG A;  1PUL A;  3AKB A;  1XA5 A;  1ZFS A;  5GQQ C;  1W7J B;  2O60 A;  1G8I A;  4A4C A;  2Y1N A;  1NX1 A;  1CTR A;  2BE4 A;  1DGU A;  4PE7 A;  1BOD A;  4GAO A;  1IQ3 A;  1QS7 A;  1SKT A;  3BXK A;  1U5I B;  3I5H B;  3OP0 A;  4Q04 A;  2MRD A;  1BJF A;  2LMV A;  3TZ1 A;  1Y6W A;  1AUI B;  1L2O C;  1WRZ A;  1KQV A;  2LCP A;  3QRX A;  3JVT C;  4GPL B;  2LUC A;  1C07 A;  3RLZ A;  4MZK A;  1J1E A;  1XK4 A;  3EVV A;  1XFZ O;  1K9U A;  1C7W A;  1KWO B;  1Y0V H;  3PAT A;  1OZO A;  1Q80 A;  1IWQ A;  2AMI A;  5AER A;  3GK1 A;  1YUR A;  1QJT A;  1TNP A;  2WC8 A;  4M2P A;  1HT9 A;  1SCM B;  2FCE A;  1EG4 A;  1SK6 D;  1SR6 B;  3HX4 A;  2IS9 A;  5ER4 X;  4A4B A;  1PK0 D;  3BOW B;  4R1E A;  5KSZ A;  3SG7 A;  1CDN A;  3PLF B;  5BPJ A;  2FJU B;  2LVI A;  1DVI A;  4ORA B;  4DS7 A;  1H4B A;  2F2O A;  4N1G A;  1A03 A;  2V53 A;  2K7D A;  5AAN A;  2F33 A;  2K8M B;  1G33 A;  1DMO A;  1GQM A;  1YUU A;  1UHH A;  1AP4 A;  1B47 A;  4YGC B;  5AEQ A;  1RK9 A;  4PE0 A;  2KHN A;  2LMU A;  1M39 A;  4U8D A;  1IKU A;  4PAL A;  2P6B B;  1A2X A;  1BT6 A;  1YVH A;  1YVL A;  1PVB A;  3I5G C;  4P2Y B;  2LE9 B;  1AJ5 A;  2LVV A;  1RRO A;  4M2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...