1XVJA

Crystal structure of rat alpha-parvalbumin d94s/g98e mutant
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
109
structure length
109
Chain Sequence
SMTDLLSAEDIKKAIGAFTAADSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKSGFIEEDELGSILKGFSSDARDLSAKETKTLMAAGDKDGSGKIEVEEFSTLVAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Parvalbumin alpha
publication title Crystal Structure of the D94S/G98E Variant of Rat alpha-Parvalbumin. An Explanation for the Reduced Divalent Ion Affinity.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 41
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xvjA00
1AHRA 1TNQA 2HQWA 1QX2A 3LK0A 4YI9A 5HKYA 1PSBA 1PVBA 5DKRA 2M7NA 1FI5A 1XO5A 1YX7A 2OS8C 2E30A 4ZCVA 1HT9A 1RK9A 4OV2A 1A03A 1FPWA 2WNDA 2K7OA 3JVTC 5KSZA 1SCVA 3OB2B 1KK7Y 1OMVA 2JNFA 5J3XA 1DJIA 4GGFC 5G08A 4L9MA 1TNWA 3D0YB 1FBVA 2NZ0A 1V1FA 2K7DA 2PMYA 1NX2A 4FTGA 1MF8B 2MAZA 5HLVA 2I7AA 4GNKB 2ISDA 4A4BA 4OR9B 1F70A 1KWOC 3DVMA 1FW4A 4YGEB 1TTXA 2F3YA 2L0PA 2JXLA 2LANA 3PSRA 4CIDA 5I2OA 1C07A 1LINA 1CMFA 1B4CA 3LLEA 1S26D 2KQYA 4ICBA 3EVUA 1UP5A 2JNXA 2HETA 1S6CA 1LXFC 1WRZA 2BKHB 1DF0A 3PM8A 1JUOA 4N1GA 1H4BA 2Y4QA 3M0WA 3TDUA 2TN4A 3PATA 2BBMA 3JVTB 5PALA 1OQPA 2PVBA 3EK8A 1U5IB 3TUYC 4ETOA 1AUIB 3IQOA 3TZ1A 4PE7A 1S1EA 1KFXS 1IG5A 1QXPA 2G2BA 2CCMA 1K94A 3MSEB 1K95A 2HQ8A 1LA3A 2LHIA 1TOPA 3RLZA 1F8HA 1L2OC 2F3ZA 1QV0A 2JQ6A 1G4YR 1NP8A 1M63B 3SJSA 1PULA 1LVCD 1SL7A 1SW8A 4PHNA 1S3PA 2E6WA 4OKHA 4M2PA 4CPVA 1Y6WA 5D7FA 1B8LA 3AKAA 3SG2A 4JPZB 2QPTA 1SR6C 1NCYA 1CDLA 1BLQA 2MRDA 1CM1A 1K9UA 1VRKA 2KBMA 2LUCA 1J7RA 1IH0A 1IJ6A 1DJHA 5DKNA 5B8IB 1OSAA 1S5GZ 1A4PA 2M1UA 2PSRA 1B1GA 2JTTA 5CPVA 2JTZA 2I94A 4UPGA 2PASA 1EL4A 3OHMB 1RTP1 5BPJA 4DIRA 3FIAA 1YR5A 4NDBA 1BR4B 1L2OB 2KDHA 2WCBA 1V1GA 2RGIA 3JTDC 1NYAA 2BE4A 4QJ5B 1DVIA 1BODA 3ZNIA 1RROA 3PLFB 3FWBA 4E68A 2EC6C 2JU0A 3BUNB 4MZLA 2KI6D 1TIZA 4YGAA 4MRXA 3I5GC 1C7VA 2LAPA 2KOTA 1SR6B 3VROA 1Y1XA 3AKBA 1PRWA 1N65A 2LVJA 2CNPA 3VRNA 1M39A 1JBAA 1UUSA 1CTRA 2DOQA 2LHLA 3VRQA 2FJUB 5HLOA 5KTYA 2LLSA 1JF2A 1XFUO 1S5GY 1DJWA 1JFKA 4DCKA 5CSJA 1NIWA 3IF7A 2L51A 2NXQA 2JT3A 4A4CA 2JULA 3JTDB 2M9GA 4R1EA 3VGOA 1A75B 3CWGA 2SASA 4YI8A 1NSHA 1FI6A 1EXRA 1UHJA 2M49B 2M97A 2MBXA 2IS9A 1BT6A 2KNEA 1WDCC 4DUQA 3O78A 1S6JA 1IQ3A 4AOMA 1F54A 2B1UA 2FCDA 1BU3A 4CFRA 2K2AA 3E3RA 1LA0A 5F6TA 2M7LA 3I5IC 3OX6A 3F45A 1XFZO 3SG3A 3HCMA 1KFUS 4YGDB 1MQ1A 2OTGC 1NX0A 1SK6D 1KK8C 3D0YA 3I5FB 5I8NA 1JF0A 3EK4A 1MUXA 2F2PA 1CKKA 4IL1A 4NDDA 5JJGA 2I18A 3BQ3A 1MHOA 4WRIA 2OPOA 1QIWA 4PE4A 4WQ2A 5FYXA 2KI6C 4MVFA 4MZKA 1IRJA 1RFJA 1ODBA 3LL8B 1CFPA 3DF0B 1F71A 2NCPA 3H4SE 4PDZA 4F0ZB 2JXCA 1SL9A 5DKQA 1R6PA 2A4JA 3DVEA 1XFYO 4I5JA 2LVIA 3I5IB 1ZMZA 1YX8A 3OP0A 3BOWA 1PSRA 1U5IA 1SY9A 1M31A 4GGFA 5TNCA 4MZJA 2OTGB 2Y5IA 1KK8B 2OS8B 3SG4A 1UHIA 1CFDA 1Q80A 2JC2A 1EG4A 1NWDA 1QLKA 1DGVA 2EGDA 3BOWB 3GK4X 2ZFDA 3TS5C 3DD4A 1CNPA 1BR1B 4CLNA 3KEVA 1OMDA 2GGZA 2I2RE 2ZNEA 2WC8A 3CR2A 3PN7C 4PE1A 1XVJA 1WLZA 2BCAA 1S36A 3EVVA 1UWOA 2LLUA 1J7PA 2JZIA 1CLLA 1DJZA 2D8NA 3QRXA 4HRGA 1IJ5A 1KWOB 1QTXA 3CR4X 4MN0A 3WHUB 1TNXA 4ORAB 3GK2A 4YRUA 1ALWA 1B47A 2K61A 4XYNA 1B8CA 1SPYA 1CDMA 1XK4C 1EH2A 1YVHA 3CTNA 1E8AA 4DS7A 1QS7A 3NSLA 1UHHA 3BXKA 4ORCB 4JQ0D 2CTNA 4MLWA 2K0JA 2LUXA 2Y1MA 1OE9B 3BYAA 3TS5B 4PALA 1QIVA 3A4UB 3TUYB 1CLBA 2KHNA 1B9AA 3EKJA 3PN7B 1AJ4A 1MXLC 1KFUL 2NCOA 4YGCB 2M8UA 2KYCA 1AVSA 1MR8A 1QVIY 1XFVO 1K90D 2LVVA 3VRRA 2H61C 1RWYA 1XFXO 2LLTA 5AANA 5AFPA 1DT7B 2AUCA 2M29A 1XFWO 4GBAA 2LNKA 2ZN9A 2LMTA 2BBNA 2PRUA 4AQJA 1CDPA 1FF1A 2LP2A 3EVRA 3VRPA 4HSZA 2ZNDA 1DJXA 3I5HC 4QJ3B 4C0JA 2BECA 1M45A 3WHTB 1C7WA 4HRHA 4M2QA 4GGNA 4U8DA 5GQQC 1A75A 3BUXB 1WLMA 5JOLA 1N0YA 1KQMC 2KAXA 3EK7A 1TRFA 1GJYA 2FCEA 2KAVA 3ICBA 1YUSA 2GV5A 3WXAA 1B7TZ 2LC5A 2L50A 1NCZA 2BL0C 2M1KB 1LKJA 1NX3A 2BE6A 5ER5A 2L5XB 4MBEA 1UHKA 3AAKA 2CBLA 5I2QA 1QLSA 4WQ3A 2LCPA 2EC6B 1JWDA 2LM5A 1SYMA 4FQOA 3I5GB 1OZOA 3KHEA 1TCOB 2ZRTA 3NSKA 2AMIA 3FWCA 4M2OA 4PHMA 3GOFA 2LVKA 1D1OA 2KFFA 5AERA 4PCWA 2F33A 3D10A 1DGUA 3PFVA 1SL8A 1SKTA 2HF5A 1R2UA 3DVJA 1CFFA 5D69A 4OVNF 1KQMB 2BKIB 2CT9A 3OX5A 4BY4A 4PHKA 2LMVA 4N5XA 2LMUA 1WRLA 1F55A 1ZUZA 4AQIA 2AAOA 2BCBA 1OOJA 4MRYA 2HPSA 1QX7A 2BL0B 3DF0A 3HX4A 4OCIA 1NCXA 4P2YB 1XA5A 4GUKA 1PK0D 4C0KA 2JRFA 2JT8A 1K96A 1B7TY 1Y0VH 4N1FA 2K7CA 3AAJA 3GK1A 5CSIA 3TDZA 2MLEC 3LK1A 2L4HA 3SIBA 2LP3A 3SG6A 2KSPA 2PALA 1QATA 4C0LA 4GAOA 1WDCB 1DMOA 1TCFA 1YURA 3EKHA 5HKZA 1G8IA 1ZACA 4QJ4B 1MXEA 1YUUA 2M3WA 2WCEA 1W7JB 4YGBB 1TNPA 4BY5A 1YTZC 1W7IB 2BCXA 1J1EA 1M46A 5AXIA 3O6BA 3CZTX 3KF9A 2L2EA 2Q91A 1AK8A 2V53A 1B8RA 1YRUB 3K21A 3SG5A 2LE9B 4NDCA 2JT0A 1QVIZ 3CR5X 3ZWHA 1DJYA 2K7BA 1J1DA 2Q4UA 3O2PA 3C1VA 3NSIA 3NSOA 4D1EA 1UHNA 1K9PA 4YBHB 1F4OA 2WORA 1HQVA 2FOTA 1DTLA 3FS7A 2K2FA 2SCPA 1SRAA 2KI4C 2KBIA 1YUTA 1YVLA 4I5KA 1XYDA 4MSPA 1SMGA 2EHBA 2MJWB 5IBWA 5KU1A 1JC2A 1CMGA 1X02A 1RECA 2WOSA 1Y1UA 1DF0B 2KGRA 1KSOA 2F2OA 1L7ZA 1OZSA 4XJKA 1CFCA 1CLMA 1GGZA 1J55A 5HKWA 3TDIA 1N2DA 5HYDA 4PE0A 4XJKB 1K2HA 4GPLB 1IGVA 3CLNA 4Q04A 1GGWA 1XK4A 2JOJA 1EJ3A 1KSMA 1SCMC 1WY9A 2G9BA 1A2XA 2KI4B 5CSNA 2LV7A 1MWNA 3BUOB 1IKUA 1KQVA 1ZFSA 2P6BB 2ZKMX 2R2IA 3KPXA 1KCYA 2VRGA 4I5LB 1NUBA 2COLB 3NXAA 5K89A 1S6IA 2F8PA 3KO0A 1BF5A 1TN4A 1G33A 3CS1A 1IQ5A 2KGBC 1A29A 3SIAA 2H61A 1BOCA 1SNLA 4CFQA 1F4QA 1H8BA 1JSAA 4USLA 1J7QA 3DVKA 5CSFA 1IWQA 1AJ5A 3CGAA 1Y1AA 3WNXB 1GQMA 2L4IA 1PVAA 1RJVA 4I5NB 1DJGA 2WCFA 2QACA 2O5GA 1QV1A 2K8MB 4PHJA 2KYFA 2JPTA 1OMRA 1K8UA 3BUMB 2JWWA 4JWQA 4ORBB 4MEWA 1BG1A 1SCMB 4TNCA 3SG7A 1AP4A 1JFJA 1PALA 3RM1A 3IQQA 2L98A 2MLFC 3O4YA 1CB1A 1NPQA 1CDNA 4DRWA 2ZRSA 4GFTA 3I5HB 1EG3A 2MA2A 1QJTA 1QASA 2KFHA 4HREE 3PALA 1SBJA 1ZOTB 1K93D 2MHHA 3I5FC 1WRKA 2Y1NA 5I2LA 1KK7Z 1NX1A 1ALVA 2KQ6A 2KAYA 2KFGA 4NQGA 2H2KA 1BJFA 2CXJA 2GGMA 1YRTB 2M0RA 5AEQA 3A8RA 1J7OA 1BMOA 1CM4A 1KFXL 3OB1B 2O60A 1K9KA 3LCPC 1UURA 1QX5B 3BUWB 4ZCUA 2ZN8A 2NLNA 4P5OE 5ER4X
chains in the Genus database with same CATH superfamily
1AHRA 1TNQA 2HQWA 1QX2A 3LK0A 4YI9A 5HKYA 1PSBA 1PVBA 5DKRA 2M7NA 3D78A 1FI5A 1XO5A 1YX7A 2OS8C 2E30A 4ZCVA 1HT9A 1RK9A 4OV2A 1A03A 1FPWA 2WNDA 2K7OA 3JVTC 3CZ0A 5KSZA 3B86A 1SCVA 3QMEA 3OB2B 1KK7Y 1OMVA 2JNFA 2QEVA 1DJIA 4GGFC 4JKTA 4OZDA 5G08A 5J3XA 4L9MA 1TNWA 3D0YB 1FBVA 2NZ0A 1V1FA 2K7DA 2PMYA 1NX2A 4FTGA 1MF8B 2MAZA 5HLVA 2I7AA 3FE8A 2JPOA 4GNKB 2ISDA 4OR9B 4A4BA 1KWOC 3DVMA 1FW4A 4YGEB 1TTXA 2F3YA 2L0PA 2JXLA 2LANA 3PSRA 4CIDA 5HL1A 5I2OA 1C07A 1LINA 1CMFA 1B4CA 3LLEA 1S26D 2KQYA 3BFHA 4ICBA 3EVUA 1UP5A 2JNXA 2HETA 1S6CA 2WCMA 1LXFC 1WRZA 2BKHB 1DF0A 2WCJA 1JUOA 3PM8A 3S0BA 4N1GA 1H4BA 2Y4QA 3M0WA 3TDUA 2TN4A 3PATA 2BBMA 3JVTB 5PALA 1OQPA 2PVBA 3EK8A 1U5IB 3TUYC 4ETOA 1AUIB 3IQOA 3TZ1A 4PE7A 1S1EA 1KFXS 1IG5A 1QXPA 2G2BA 2CCMA 2PQLA 1K94A 3MSEB 3D77A 1K95A 2HQ8A 1SSEB 1LA3A 2LHIA 1TOPA 3RLZA 1F8HA 1L2OC 2F3ZA 3IVTA 3PJIA 1QV0A 2JQ6A 1G4YR 1NP8A 1M63B 3EG5B 3SJSA 1PULA 1LVCD 1SL7A 1SW8A 4PHNA 3S0EA 1S3PA 2E6WA 4OKHA 2QEOA 4M2PA 4CPVA 1Y6WA 5D7FA 1B8LA 3SS5A 3AKAA 3SG2A 4JPZB 2QPTA 1SR6C 1NCYA 1CDLA 1BLQA 2MRDA 1CM1A 1K9UA 1VRKA 2BNXA 2KBMA 2LUCA 1J7RA 1IH0A 1IJ6A 1DJHA 5DKNA 5B8IB 1OSAA 1S5GZ 1A4PA 2M1UA 2PSRA 1B1GA 2JTTA 5CPVA 2JTZA 2I94A 4UPGA 3B7AA 1W9ZA 3D73A 2PYQA 2PASA 1EL4A 3OHMB 1RTP1 5BPJA 4DIRA 3FIAA 1YR5A 3D75A 4NDBA 1BR4B 1L2OB 2KDHA 2WCBA 1V1GA 2RGIA 3JTDC 1NYAA 3D76A 2BE4A 4QJ5B 1DVIA 1BODA 2YGUA 5FI2A 3ZNIA 1RROA 3PLFB 3FWBA 4E68A 2EC6C 2JU0A 2L5YA 3BUNB 2KI6D 4MZLA 1TIZA 4YGAA 1T14A 3NGVA 3I5GC 4MRXA 2LAPA 1C7VA 2KOTA 1SR6B 3VROA 1Y1XA 3AKBA 1PRWA 4INXA 1N65A 3UO9A 2LVJA 2CNPA 3VRNA 1M39A 1JBAA 1UUSA 1C3ZA 1CTRA 2DOQA 2LHLA 3VRQA 2FJUB 5HLOA 5KTYA 2LLSA 1JF2A 1XFUO 1S5GY 1DJWA 1JFKA 4DCKA 5CSJA 1NIWA 3IF7A 2L51A 2NXQA 2JT3A 4A4CA 2JULA 3JTDB 2M9GA 4R1EA 3VGOA 1A75B 3CWGA 1OOFA 2SASA 1DQEA 4YI8A 1NSHA 1FI6A 1EXRA 1UHJA 2M49B 2WCHA 2M97A 3RZSA 3V2LA 2MBXA 2IS9A 1BT6A 2KNEA 1WDCC 2FJYA 1QWVA 3O78A 4DUQA 1S6JA 1IQ3A 4AOMA 2GTEA 1F54A 2B1UA 2FCDA 1BU3A 4CFRA 3DY9A 2K2AA 3E3RA 1LA0A 5F6TA 2M7LA 3I5IC 3CZ2A 3OX6A 4P2YB 3F45A 1XFZO 3SG3A 3HCMA 1KFUS 4YGDB 1MQ1A 4IJ7A 2OTGC 3R72A 1NX0A 1SK6D 1KK8C 3D0YA 3I5FB 5I8NA 3S0DA 1JF0A 3EK4A 1MUXA 2F2PA 1CKKA 4IL1A 4NDDA 5JJGA 2I18A 3BQ3A 1MHOA 4WRIA 2OPOA 1QIWA 4PE4A 4WQ2A 5DICA 2KI6C 3DYEA 4MVFA 4MZKA 5FYXA 1IRJA 1RFJA 1ODBA 3LL8B 1DC1A 1CFPA 2H8VA 3DF0B 1F71A 2NCPA 3H4SE 5FI6A 4PDZA 4F0ZB 2JXCA 1LS8A 1SL9A 3B6XA 1R6PA 2A4JA 5DKQA 3DVEA 1XFYO 3R1VA 4I5JA 2LVIA 3I5IB 1ZMZA 1YX8A 3OP0A 3BOWA 5EL2A 1PSRA 1U5IA 1SY9A 1M31A 3BFAA 4GGFA 5TNCA 4MZJA 2OTGB 2Y5IA 1KK8B 3S0GA 2OS8B 3SG4A 1UHIA 1CFDA 1Q80A 2JC2A 1EG4A 2WCLA 1NWDA 1QLKA 1DGVA 2EGDA 3BOWB 3GK4X 2ZFDA 3TS5C 3DD4A 1CNPA 1BR1B 4CLNA 3KEVA 1OMDA 2GGZA 2I2RE 2ZNEA 2WC8A 3CR2A 3PN7C 4PE1A 1XVJA 1TUZA 1WLZA 2BCAA 1S36A 3EVVA 1UWOA 2LLUA 3L47A 2JZIA 1TWOA 1J7PA 1CLLA 1DJZA 2D8NA 3QRXA 4HRGA 1IJ5A 1KWOB 1QTXA 3CR4X 4MN0A 3WHUB 1TNXA 4ORAB 3GK2A 4YRUA 1ALWA 3DZTA 1B47A 3OGNA 2K61A 2QEHA 4XYNA 1B8CA 1SPYA 1CDMA 1XK4C 1EH2A 1YVHA 3CTNA 1E8AA 4DS7A 1QS7A 3NSLA 1UHHA 3BXKA 4ORCB 1TUJA 2CTNA 4JQ0D 2K0JA 4MLWA 2LUXA 2Y1MA 1OE9B 1OOGA 3BYAA 3TS5B 4PALA 1QIVA 3A4UB 3TUYB 1CLBA 2KHNA 1B9AA 3EKJA 3PN7B 1AJ4A 1MXLC 1KFUL 2NCOA 4YGCB 2M8UA 2KYCA 3S0AA 1AVSA 1MR8A 1QVIY 1XFVO 1K90D 2LVVA 2QEBA 3VRRA 2H61C 1RWYA 1XFXO 2LLTA 5AANA 5AFPA 1DT7B 2AUCA 4P5OE 2M29A 1XFRA 1XFWO 4GBAA 2LNKA 2ZN9A 4FQTA 2LMTA 2BBNA 2PRUA 3VB1A 4AQJA 1CDPA 1FF1A 2LP2A 3EVRA 3B88A 3VRPA 3NHIA 4HSZA 2ZNDA 1DJXA 3I5HC 3CZ1A 4QJ3B 4C0JA 2BECA 1M45A 3WHTB 3SS3A 1C7WA 3D74A 4HRHA 4M2QA 4GGNA 4KYNA 4U8DA 5GQQC 1A75A 3BUXB 1WLMA 1GM0A 2WC6A 1N0YA 1KQMC 2KAXA 5JOLA 3EK7A 1TRFA 1GJYA 2FCEA 2KAVA 3ICBA 1YUSA 2GV5A 4INWA 3WXAA 1B7TZ 2LC5A 2L50A 1NCZA 2BL0C 2M1KB 1LKJA 2L2CA 1NX3A 2BE6A 5ER5A 2L5XB 4MBEA 1UHKA 3AAKA 2CBLA 3L4LA 5I2QA 1QLSA 4WQ3A 2LCPA 2EC6B 1JWDA 2LM5A 1SYMA 4FQOA 3I5GB 1OZOA 3KHEA 1TCOB 2ZRTA 3R1OA 3NSKA 2AMIA 3FWCA 2K60A 4M2OA 4PHMA 3GOFA 2LVKA 1D1OA 2KFFA 1P28A 5AERA 4PCWA 1DELA 2F33A 1DGUA 3D10A 3PFVA 1SL8A 1SKTA 2HF5A 1R2UA 3DVJA 1CFFA 5D69A 4OVNF 1KQMB 3FE9A 2BKIB 2CT9A 3OX5A 4BY4A 4PHKA 2LMVA 4N5XA 2LMUA 1WRLA 1F55A 1ZUZA 4AQIA 2AAOA 2BCBA 1OOJA 4MRYA 2HPSA 1QX7A 2BL0B 3DF0A 3HX4A 3O4XA 1NCXA 4OCIA 1XA5A 2QDIA 1PK0D 1OW4A 2JRFA 2JT8A 1K96A 1B7TY 1Y0VH 4GUKA 4N1FA 2K7CA 3AAJA 3GK1A 5CSIA 3CYZA 3TDZA 3B87A 2MLEC 3LK1A 2L4HA 3SIBA 2LP3A 3SG6A 2KSPA 2PALA 1QATA 4C0LA 4GAOA 1WDCB 1DMOA 1TCFA 3N7HA 1YURA 3EKHA 5HKZA 1G8IA 1ZACA 1DEKA 4QJ4B 1MXEA 1YUUA 2M3WA 2WCEA 1W7JB 2P70A 4YGBB 1TNPA 4BY5A 1ORGA 1YTZC 1W7IB 2BCXA 1J1EA 1M46A 3CABA 4C0KA 5I94A 5AXIA 3O6BA 2P71A 3CZTX 3KF9A 2L2EA 2Q91A 1AK8A 2V53A 1B8RA 1YRUB 3K21A 3SG5A 2LE9B 4NDCA 2JT0A 1QVIZ 3CR5X 3ZWHA 1DJYA 2K7BA 1J1DA 2Q4UA 3O2PA 3C1VA 4F7FA 3NSIA 3NSOA 4D1EA 1UHNA 1K9PA 4YBHB 1F4OA 3L4AA 3SS4A 2WORA 1HQVA 2FOTA 1DTLA 3FS7A 2K2FA 2SCPA 1SRAA 2KI4C 2KBIA 1YUTA 1YVLA 4I5KA 1XYDA 4MSPA 1SMGA 1Z2CB 2EHBA 2MJWB 5IBWA 5KU1A 1JC2A 1OOIX 1CMGA 1X02A 1RECA 2WOSA 1Y1UA 1DF0B 3BJHA 5FI7A 2KGRA 1KSOA 2F2OA 1L7ZA 1OZSA 4XJKA 1CFCA 1CLMA 1GGZA 3K1EA 1J55A 5HKWA 1OOHA 3UNWA 3TDIA 3S0FA 1N2DA 5HYDA 4PE0A 4XJKB 1K2HA 3DXLA 4GPLB 1IGVA 1IIOA 3CLNA 4Q04A 2ERBA 1GGWA 1XK4A 2JOJA 1EJ3A 1KSMA 1SCMC 1F70A 1WY9A 2G9BA 1A2XA 2KI4B 5CSNA 5D3OA 2LV7A 1MWNA 3BUOB 1IKUA 1KQVA 1ZFSA 2P6BB 2ZKMX 2R2IA 3KPXA 1KCYA 2VRGA 4I5LB 1NUBA 2COLB 3NXAA 5K89A 1S6IA 2F8PA 3KO0A 1BF5A 1TN4A 1G33A 3CS1A 1IQ5A 2KGBC 1A29A 3SIAA 2H61A 1BOCA 1SNLA 4CFQA 1F4QA 3FE6A 1H8BA 4USLA 1JSAA 1J7QA 3DVKA 5CSFA 1IWQA 1AJ5A 3CGAA 1Y1AA 3WNXB 4JD9A 1GQMA 2L4IA 1PVAA 1RJVA 4I5NB 1DJGA 2WCFA 2QACA 2WCKA 2O5GA 1QV1A 2K8MB 4PHJA 3Q8IA 2KYFA 2JPTA 1OMRA 1K8UA 3BUMB 2JWWA 4JWQA 4ORBB 4MEWA 1BG1A 3OBVA 1SCMB 4TNCA 3SG7A 1AP4A 1JFJA 1PALA 3RM1A 3IQQA 2L98A 2MLFC 3R1PA 3O4YA 1CB1A 1NPQA 1CDNA 3CDNA 4DRWA 2ZRSA 4GFTA 3I5HB 1EG3A 2MA2A 1QJTA 1QASA 2KFHA 4PT1A 4HREE 3PALA 1SBJA 1ZOTB 1Z4HA 3PM2A 1K93D 2MHHA 3I5FC 1WRKA 2Y1NA 5I2LA 1KK7Z 1NX1A 1ALVA 1C3YA 2KQ6A 3NHTA 2KAYA 2KFGA 4NQGA 2H2KA 1BJFA 2CXJA 2GGMA 1YRTB 2M0RA 2KLDA 3BFBA 5AEQA 3A8RA 1J7OA 2KPHA 1BMOA 1CM4A 1KFXL 3OB1B 2O60A 1K9KA 3LCPC 1UURA 1QX5B 2WC5A 2KLEA 3BUWB 4ZCUA 2ZN8A 2NLNA 2BAPA 5ER4X
chains in the Genus database with same CATH topology
1AHRA 1TNQA 2HQWA 1QX2A 3LK0A 4YI9A 5HKYA 1PSBA 1PVBA 5DKRA 2M7NA 1FI5A 1XO5A 1YX7A 2OS8C 2E30A 4ZCVA 1HT9A 1RK9A 4OV2A 1A03A 1FPWA 2WNDA 2K7OA 3JVTC 5KSZA 1SCVA 3OB2B 1KK7Y 1OMVA 2JNFA 5J3XA 1DJIA 4GGFC 5G08A 4L9MA 1TNWA 3D0YB 1FBVA 2NZ0A 1V1FA 2K7DA 2PMYA 1NX2A 4FTGA 1MF8B 2MAZA 5HLVA 2I7AA 4GNKB 2ISDA 4A4BA 4OR9B 1F70A 1KWOC 3DVMA 1FW4A 4YGEB 1TTXA 2F3YA 2L0PA 2JXLA 2LANA 3PSRA 4CIDA 5I2OA 1C07A 1LINA 1CMFA 1B4CA 3LLEA 1S26D 2KQYA 4ICBA 3EVUA 1UP5A 2JNXA 2HETA 1S6CA 1LXFC 1WRZA 2BKHB 1DF0A 3PM8A 1JUOA 4N1GA 1H4BA 2Y4QA 3M0WA 3TDUA 2TN4A 3PATA 2BBMA 3JVTB 5PALA 1OQPA 2PVBA 3EK8A 1U5IB 3TUYC 4ETOA 1AUIB 3IQOA 3TZ1A 4PE7A 1S1EA 1KFXS 1IG5A 1QXPA 2G2BA 2CCMA 1K94A 3MSEB 1K95A 2HQ8A 1LA3A 2LHIA 1TOPA 3RLZA 1F8HA 1L2OC 2F3ZA 1QV0A 2JQ6A 1G4YR 1NP8A 1M63B 3SJSA 1PULA 1LVCD 1SL7A 1SW8A 4PHNA 1S3PA 2E6WA 4OKHA 4M2PA 4CPVA 1Y6WA 5D7FA 1B8LA 3AKAA 3SG2A 4JPZB 2QPTA 1SR6C 1NCYA 1CDLA 1BLQA 2MRDA 1CM1A 1K9UA 1VRKA 2KBMA 2LUCA 1J7RA 1IH0A 1IJ6A 1DJHA 5DKNA 5B8IB 1OSAA 1S5GZ 1A4PA 2M1UA 2PSRA 1B1GA 2JTTA 5CPVA 2JTZA 2I94A 4UPGA 2PASA 1EL4A 3OHMB 1RTP1 5BPJA 4DIRA 3FIAA 1YR5A 4NDBA 1BR4B 1L2OB 2KDHA 2WCBA 1V1GA 2RGIA 3JTDC 1NYAA 2BE4A 4QJ5B 1DVIA 1BODA 3ZNIA 1RROA 3PLFB 3FWBA 4E68A 2EC6C 2JU0A 3BUNB 4MZLA 2KI6D 1TIZA 4YGAA 4MRXA 3I5GC 1C7VA 2LAPA 2KOTA 1SR6B 3VROA 1Y1XA 3AKBA 1PRWA 1N65A 2LVJA 2CNPA 3VRNA 1M39A 1JBAA 1UUSA 1CTRA 2DOQA 2LHLA 3VRQA 2FJUB 5HLOA 5KTYA 2LLSA 1JF2A 1XFUO 1S5GY 1DJWA 1JFKA 4DCKA 5CSJA 1NIWA 3IF7A 2L51A 2NXQA 2JT3A 4A4CA 2JULA 3JTDB 2M9GA 4R1EA 3VGOA 1A75B 3CWGA 2SASA 4YI8A 1NSHA 1FI6A 1EXRA 1UHJA 2M49B 2M97A 2MBXA 2IS9A 1BT6A 2KNEA 1WDCC 4DUQA 3O78A 1S6JA 1IQ3A 4AOMA 1F54A 2B1UA 2FCDA 1BU3A 4CFRA 2K2AA 3E3RA 1LA0A 5F6TA 2M7LA 3I5IC 3OX6A 3F45A 1XFZO 3SG3A 3HCMA 1KFUS 4YGDB 1MQ1A 2OTGC 1NX0A 1SK6D 1KK8C 3D0YA 3I5FB 5I8NA 1JF0A 3EK4A 1MUXA 2F2PA 1CKKA 4IL1A 4NDDA 5JJGA 2I18A 3BQ3A 1MHOA 4WRIA 2OPOA 1QIWA 4PE4A 4WQ2A 5FYXA 2KI6C 4MVFA 4MZKA 1IRJA 1RFJA 1ODBA 3LL8B 1CFPA 3DF0B 1F71A 2NCPA 3H4SE 4PDZA 4F0ZB 2JXCA 1SL9A 5DKQA 1R6PA 2A4JA 3DVEA 1XFYO 4I5JA 2LVIA 3I5IB 1ZMZA 1YX8A 3OP0A 3BOWA 1PSRA 1U5IA 1SY9A 1M31A 4GGFA 5TNCA 4MZJA 2OTGB 2Y5IA 1KK8B 2OS8B 3SG4A 1UHIA 1CFDA 1Q80A 2JC2A 1EG4A 1NWDA 1QLKA 1DGVA 2EGDA 3BOWB 3GK4X 2ZFDA 3TS5C 3DD4A 1CNPA 1BR1B 4CLNA 3KEVA 1OMDA 2GGZA 2I2RE 2ZNEA 2WC8A 3CR2A 3PN7C 4PE1A 1XVJA 1WLZA 2BCAA 1S36A 3EVVA 1UWOA 2LLUA 1J7PA 2JZIA 1CLLA 1DJZA 2D8NA 3QRXA 4HRGA 1IJ5A 1KWOB 1QTXA 3CR4X 4MN0A 3WHUB 1TNXA 4ORAB 3GK2A 4YRUA 1ALWA 1B47A 2K61A 4XYNA 1B8CA 1SPYA 1CDMA 1XK4C 1EH2A 1YVHA 3CTNA 1E8AA 4DS7A 1QS7A 3NSLA 1UHHA 3BXKA 4ORCB 4JQ0D 2CTNA 4MLWA 2K0JA 2LUXA 2Y1MA 1OE9B 3BYAA 3TS5B 4PALA 1QIVA 3A4UB 3TUYB 1CLBA 2KHNA 1B9AA 3EKJA 3PN7B 1AJ4A 1MXLC 1KFUL 2NCOA 4YGCB 2M8UA 2KYCA 1AVSA 1MR8A 1QVIY 1XFVO 1K90D 2LVVA 3VRRA 2H61C 1RWYA 1XFXO 2LLTA 5AANA 5AFPA 1DT7B 2AUCA 2M29A 1XFWO 4GBAA 2LNKA 2ZN9A 2LMTA 2BBNA 2PRUA 4AQJA 1CDPA 1FF1A 2LP2A 3EVRA 3VRPA 4HSZA 2ZNDA 1DJXA 3I5HC 4QJ3B 4C0JA 2BECA 1M45A 3WHTB 1C7WA 4HRHA 4M2QA 4GGNA 4U8DA 5GQQC 1A75A 3BUXB 1WLMA 5JOLA 1N0YA 1KQMC 2KAXA 3EK7A 1TRFA 1GJYA 2FCEA 2KAVA 3ICBA 1YUSA 2GV5A 3WXAA 1B7TZ 2LC5A 2L50A 1NCZA 2BL0C 2M1KB 1LKJA 1NX3A 2BE6A 5ER5A 2L5XB 4MBEA 1UHKA 3AAKA 2CBLA 5I2QA 1QLSA 4WQ3A 2LCPA 2EC6B 1JWDA 2LM5A 1SYMA 4FQOA 3I5GB 1OZOA 3KHEA 1TCOB 2ZRTA 3NSKA 2AMIA 3FWCA 4M2OA 4PHMA 3GOFA 2LVKA 1D1OA 2KFFA 5AERA 4PCWA 2F33A 3D10A 1DGUA 3PFVA 1SL8A 1SKTA 2HF5A 1R2UA 3DVJA 1CFFA 5D69A 4OVNF 1KQMB 2BKIB 2CT9A 3OX5A 4BY4A 4PHKA 2LMVA 4N5XA 2LMUA 1WRLA 1F55A 1ZUZA 4AQIA 2AAOA 2BCBA 1OOJA 4MRYA 2HPSA 1QX7A 2BL0B 3DF0A 3HX4A 4OCIA 1NCXA 4P2YB 1XA5A 4GUKA 1PK0D 4C0KA 2JRFA 2JT8A 1K96A 1B7TY 1Y0VH 4N1FA 2K7CA 3AAJA 3GK1A 5CSIA 3TDZA 2MLEC 3LK1A 2L4HA 3SIBA 2LP3A 3SG6A 2KSPA 2PALA 1QATA 4C0LA 4GAOA 1WDCB 1DMOA 1TCFA 1YURA 3EKHA 5HKZA 1G8IA 1ZACA 4QJ4B 1MXEA 1YUUA 2M3WA 2WCEA 1W7JB 4YGBB 1TNPA 4BY5A 1YTZC 1W7IB 2BCXA 1J1EA 1M46A 5AXIA 3O6BA 3CZTX 3KF9A 2L2EA 2Q91A 1AK8A 2V53A 1B8RA 1YRUB 3K21A 3SG5A 2LE9B 4NDCA 2JT0A 1QVIZ 3CR5X 3ZWHA 1DJYA 2K7BA 1J1DA 2Q4UA 3O2PA 3C1VA 3NSIA 3NSOA 4D1EA 1UHNA 1K9PA 4YBHB 1F4OA 2WORA 1HQVA 2FOTA 1DTLA 3FS7A 2K2FA 2SCPA 1SRAA 2KI4C 2KBIA 1YUTA 1YVLA 4I5KA 1XYDA 4MSPA 1SMGA 2EHBA 2MJWB 5IBWA 5KU1A 1JC2A 1CMGA 1X02A 1RECA 2WOSA 1Y1UA 1DF0B 2KGRA 1KSOA 2F2OA 1L7ZA 1OZSA 4XJKA 1CFCA 1CLMA 1GGZA 1J55A 5HKWA 3TDIA 1N2DA 5HYDA 4PE0A 4XJKB 1K2HA 4GPLB 1IGVA 3CLNA 4Q04A 1GGWA 1XK4A 2JOJA 1EJ3A 1KSMA 1SCMC 1WY9A 2G9BA 1A2XA 2KI4B 5CSNA 2LV7A 1MWNA 3BUOB 1IKUA 1KQVA 1ZFSA 2P6BB 2ZKMX 2R2IA 3KPXA 1KCYA 2VRGA 4I5LB 1NUBA 2COLB 3NXAA 5K89A 1S6IA 2F8PA 3KO0A 1BF5A 1TN4A 1G33A 3CS1A 1IQ5A 2KGBC 1A29A 3SIAA 2H61A 1BOCA 1SNLA 4CFQA 1F4QA 1H8BA 1JSAA 4USLA 1J7QA 3DVKA 5CSFA 1IWQA 1AJ5A 3CGAA 1Y1AA 3WNXB 1GQMA 2L4IA 1PVAA 1RJVA 4I5NB 1DJGA 2WCFA 2QACA 2O5GA 1QV1A 2K8MB 4PHJA 2KYFA 2JPTA 1OMRA 1K8UA 3BUMB 2JWWA 4JWQA 4ORBB 4MEWA 1BG1A 1SCMB 4TNCA 3SG7A 1AP4A 1JFJA 1PALA 3RM1A 3IQQA 2L98A 2MLFC 3O4YA 1CB1A 1NPQA 1CDNA 4DRWA 2ZRSA 4GFTA 3I5HB 1EG3A 2MA2A 1QJTA 1QASA 2KFHA 4HREE 3PALA 1SBJA 1ZOTB 1K93D 2MHHA 3I5FC 1WRKA 2Y1NA 5I2LA 1KK7Z 1NX1A 1ALVA 2KQ6A 2KAYA 2KFGA 4NQGA 2H2KA 1BJFA 2CXJA 2GGMA 1YRTB 2M0RA 5AEQA 3A8RA 1J7OA 1BMOA 1CM4A 1KFXL 3OB1B 2O60A 1K9KA 3LCPC 1UURA 1QX5B 3BUWB 4ZCUA 2ZN8A 2NLNA 4P5OE 5ER4X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AHR A;  1TNQ A;  2HQW A;  1QX2 A;  3LK0 A;  4YI9 A;  5HKY A;  1PSB A;  1PVB A;  5DKR A;  2M7N A;  1FI5 A;  1XO5 A;  1YX7 A;  2OS8 C;  2E30 A;  4ZCV A;  1HT9 A;  1RK9 A;  4OV2 A;  1A03 A;  1FPW A;  2WND A;  2K7O A;  3JVT C;  5KSZ A;  1SCV A;  3OB2 B;  1KK7 Y;  1OMV A;  2JNF A;  5J3X A;  1DJI A;  4GGF C;  5G08 A;  4L9M A;  1TNW A;  3D0Y B;  1FBV A;  2NZ0 A;  1V1F A;  2K7D A;  2PMY A;  1NX2 A;  4FTG A;  1MF8 B;  2MAZ A;  5HLV A;  2I7A A;  4GNK B;  2ISD A;  4A4B A;  4OR9 B;  1F70 A;  1KWO C;  3DVM A;  1FW4 A;  4YGE B;  1TTX A;  2F3Y A;  2L0P A;  2JXL A;  2LAN A;  3PSR A;  4CID A;  5I2O A;  1C07 A;  1LIN A;  1CMF A;  1B4C A;  3LLE A;  1S26 D;  2KQY A;  4ICB A;  3EVU A;  1UP5 A;  2JNX A;  2HET A;  1S6C A;  1LXF C;  1WRZ A;  2BKH B;  1DF0 A;  3PM8 A;  1JUO A;  4N1G A;  1H4B A;  2Y4Q A;  3M0W A;  3TDU A;  2TN4 A;  3PAT A;  2BBM A;  3JVT B;  5PAL A;  1OQP A;  2PVB A;  3EK8 A;  1U5I B;  3TUY C;  4ETO A;  1AUI B;  3IQO A;  3TZ1 A;  4PE7 A;  1S1E A;  1KFX S;  1IG5 A;  1QXP A;  2G2B A;  2CCM A;  1K94 A;  3MSE B;  1K95 A;  2HQ8 A;  1LA3 A;  2LHI A;  1TOP A;  3RLZ A;  1F8H A;  1L2O C;  2F3Z A;  1QV0 A;  2JQ6 A;  1G4Y R;  1NP8 A;  1M63 B;  3SJS A;  1PUL A;  1LVC D;  1SL7 A;  1SW8 A;  4PHN A;  1S3P A;  2E6W A;  4OKH A;  4M2P A;  4CPV A;  1Y6W A;  5D7F A;  1B8L A;  3AKA A;  3SG2 A;  4JPZ B;  2QPT A;  1SR6 C;  1NCY A;  1CDL A;  1BLQ A;  2MRD A;  1CM1 A;  1K9U A;  1VRK A;  2KBM A;  2LUC A;  1J7R A;  1IH0 A;  1IJ6 A;  1DJH A;  5DKN A;  5B8I B;  1OSA A;  1S5G Z;  1A4P A;  2M1U A;  2PSR A;  1B1G A;  2JTT A;  5CPV A;  2JTZ A;  2I94 A;  4UPG A;  2PAS A;  1EL4 A;  3OHM B;  1RTP 1;  5BPJ A;  4DIR A;  3FIA A;  1YR5 A;  4NDB A;  1BR4 B;  1L2O B;  2KDH A;  2WCB A;  1V1G A;  2RGI A;  3JTD C;  1NYA A;  2BE4 A;  4QJ5 B;  1DVI A;  1BOD A;  3ZNI A;  1RRO A;  3PLF B;  3FWB A;  4E68 A;  2EC6 C;  2JU0 A;  3BUN B;  4MZL A;  2KI6 D;  1TIZ A;  4YGA A;  4MRX A;  3I5G C;  1C7V A;  2LAP A;  2KOT A;  1SR6 B;  3VRO A;  1Y1X A;  3AKB A;  1PRW A;  1N65 A;  2LVJ A;  2CNP A;  3VRN A;  1M39 A;  1JBA A;  1UUS A;  1CTR A;  2DOQ A;  2LHL A;  3VRQ A;  2FJU B;  5HLO A;  5KTY A;  2LLS A;  1JF2 A;  1XFU O;  1S5G Y;  1DJW A;  1JFK A;  4DCK A;  5CSJ A;  1NIW A;  3IF7 A;  2L51 A;  2NXQ A;  2JT3 A;  4A4C A;  2JUL A;  3JTD B;  2M9G A;  4R1E A;  3VGO A;  1A75 B;  3CWG A;  2SAS A;  4YI8 A;  1NSH A;  1FI6 A;  1EXR A;  1UHJ A;  2M49 B;  2M97 A;  2MBX A;  2IS9 A;  1BT6 A;  2KNE A;  1WDC C;  4DUQ A;  3O78 A;  1S6J A;  1IQ3 A;  4AOM A;  1F54 A;  2B1U A;  2FCD A;  1BU3 A;  4CFR A;  2K2A A;  3E3R A;  1LA0 A;  5F6T A;  2M7L A;  3I5I C;  3OX6 A;  3F45 A;  1XFZ O;  3SG3 A;  3HCM A;  1KFU S;  4YGD B;  1MQ1 A;  2OTG C;  1NX0 A;  1SK6 D;  1KK8 C;  3D0Y A;  3I5F B;  5I8N A;  1JF0 A;  3EK4 A;  1MUX A;  2F2P A;  1CKK A;  4IL1 A;  4NDD A;  5JJG A;  2I18 A;  3BQ3 A;  1MHO A;  4WRI A;  2OPO A;  1QIW A;  4PE4 A;  4WQ2 A;  5FYX A;  2KI6 C;  4MVF A;  4MZK A;  1IRJ A;  1RFJ A;  1ODB A;  3LL8 B;  1CFP A;  3DF0 B;  1F71 A;  2NCP A;  3H4S E;  4PDZ A;  4F0Z B;  2JXC A;  1SL9 A;  5DKQ A;  1R6P A;  2A4J A;  3DVE A;  1XFY O;  4I5J A;  2LVI A;  3I5I B;  1ZMZ A;  1YX8 A;  3OP0 A;  3BOW A;  1PSR A;  1U5I A;  1SY9 A;  1M31 A;  4GGF A;  5TNC A;  4MZJ A;  2OTG B;  2Y5I A;  1KK8 B;  2OS8 B;  3SG4 A;  1UHI A;  1CFD A;  1Q80 A;  2JC2 A;  1EG4 A;  1NWD A;  1QLK A;  1DGV A;  2EGD A;  3BOW B;  3GK4 X;  2ZFD A;  3TS5 C;  3DD4 A;  1CNP A;  1BR1 B;  4CLN A;  3KEV A;  1OMD A;  2GGZ A;  2I2R E;  2ZNE A;  2WC8 A;  3CR2 A;  3PN7 C;  4PE1 A;  1XVJ A;  1WLZ A;  2BCA A;  1S36 A;  3EVV A;  1UWO A;  2LLU A;  1J7P A;  2JZI A;  1CLL A;  1DJZ A;  2D8N A;  3QRX A;  4HRG A;  1IJ5 A;  1KWO B;  1QTX A;  3CR4 X;  4MN0 A;  3WHU B;  1TNX A;  4ORA B;  3GK2 A;  4YRU A;  1ALW A;  1B47 A;  2K61 A;  4XYN A;  1B8C A;  1SPY A;  1CDM A;  1XK4 C;  1EH2 A;  1YVH A;  3CTN A;  1E8A A;  4DS7 A;  1QS7 A;  3NSL A;  1UHH A;  3BXK A;  4ORC B;  4JQ0 D;  2CTN A;  4MLW A;  2K0J A;  2LUX A;  2Y1M A;  1OE9 B;  3BYA A;  3TS5 B;  4PAL A;  1QIV A;  3A4U B;  3TUY B;  1CLB A;  2KHN A;  1B9A A;  3EKJ A;  3PN7 B;  1AJ4 A;  1MXL C;  1KFU L;  2NCO A;  4YGC B;  2M8U A;  2KYC A;  1AVS A;  1MR8 A;  1QVI Y;  1XFV O;  1K90 D;  2LVV A;  3VRR A;  2H61 C;  1RWY A;  1XFX O;  2LLT A;  5AAN A;  5AFP A;  1DT7 B;  2AUC A;  2M29 A;  1XFW O;  4GBA A;  2LNK A;  2ZN9 A;  2LMT A;  2BBN A;  2PRU A;  4AQJ A;  1CDP A;  1FF1 A;  2LP2 A;  3EVR A;  3VRP A;  4HSZ A;  2ZND A;  1DJX A;  3I5H C;  4QJ3 B;  4C0J A;  2BEC A;  1M45 A;  3WHT B;  1C7W A;  4HRH A;  4M2Q A;  4GGN A;  4U8D A;  5GQQ C;  1A75 A;  3BUX B;  1WLM A;  5JOL A;  1N0Y A;  1KQM C;  2KAX A;  3EK7 A;  1TRF A;  1GJY A;  2FCE A;  2KAV A;  3ICB A;  1YUS A;  2GV5 A;  3WXA A;  1B7T Z;  2LC5 A;  2L50 A;  1NCZ A;  2BL0 C;  2M1K B;  1LKJ A;  1NX3 A;  2BE6 A;  5ER5 A;  2L5X B;  4MBE A;  1UHK A;  3AAK A;  2CBL A;  5I2Q A;  1QLS A;  4WQ3 A;  2LCP A;  2EC6 B;  1JWD A;  2LM5 A;  1SYM A;  4FQO A;  3I5G B;  1OZO A;  3KHE A;  1TCO B;  2ZRT A;  3NSK A;  2AMI A;  3FWC A;  4M2O A;  4PHM A;  3GOF A;  2LVK A;  1D1O A;  2KFF A;  5AER A;  4PCW A;  2F33 A;  3D10 A;  1DGU A;  3PFV A;  1SL8 A;  1SKT A;  2HF5 A;  1R2U A;  3DVJ A;  1CFF A;  5D69 A;  4OVN F;  1KQM B;  2BKI B;  2CT9 A;  3OX5 A;  4BY4 A;  4PHK A;  2LMV A;  4N5X A;  2LMU A;  1WRL A;  1F55 A;  1ZUZ A;  4AQI A;  2AAO A;  2BCB A;  1OOJ A;  4MRY A;  2HPS A;  1QX7 A;  2BL0 B;  3DF0 A;  3HX4 A;  4OCI A;  1NCX A;  4P2Y B;  1XA5 A;  4GUK A;  1PK0 D;  4C0K A;  2JRF A;  2JT8 A;  1K96 A;  1B7T Y;  1Y0V H;  4N1F A;  2K7C A;  3AAJ A;  3GK1 A;  5CSI A;  3TDZ A;  2MLE C;  3LK1 A;  2L4H A;  3SIB A;  2LP3 A;  3SG6 A;  2KSP A;  2PAL A;  1QAT A;  4C0L A;  4GAO A;  1WDC B;  1DMO A;  1TCF A;  1YUR A;  3EKH A;  5HKZ A;  1G8I A;  1ZAC A;  4QJ4 B;  1MXE A;  1YUU A;  2M3W A;  2WCE A;  1W7J B;  4YGB B;  1TNP A;  4BY5 A;  1YTZ C;  1W7I B;  2BCX A;  1J1E A;  1M46 A;  5AXI A;  3O6B A;  3CZT X;  3KF9 A;  2L2E A;  2Q91 A;  1AK8 A;  2V53 A;  1B8R A;  1YRU B;  3K21 A;  3SG5 A;  2LE9 B;  4NDC A;  2JT0 A;  1QVI Z;  3CR5 X;  3ZWH A;  1DJY A;  2K7B A;  1J1D A;  2Q4U A;  3O2P A;  3C1V A;  3NSI A;  3NSO A;  4D1E A;  1UHN A;  1K9P A;  4YBH B;  1F4O A;  2WOR A;  1HQV A;  2FOT A;  1DTL A;  3FS7 A;  2K2F A;  2SCP A;  1SRA A;  2KI4 C;  2KBI A;  1YUT A;  1YVL A;  4I5K A;  1XYD A;  4MSP A;  1SMG A;  2EHB A;  2MJW B;  5IBW A;  5KU1 A;  1JC2 A;  1CMG A;  1X02 A;  1REC A;  2WOS A;  1Y1U A;  1DF0 B;  2KGR A;  1KSO A;  2F2O A;  1L7Z A;  1OZS A;  4XJK A;  1CFC A;  1CLM A;  1GGZ A;  1J55 A;  5HKW A;  3TDI A;  1N2D A;  5HYD A;  4PE0 A;  4XJK B;  1K2H A;  4GPL B;  1IGV A;  3CLN A;  4Q04 A;  1GGW A;  1XK4 A;  2JOJ A;  1EJ3 A;  1KSM A;  1SCM C;  1WY9 A;  2G9B A;  1A2X A;  2KI4 B;  5CSN A;  2LV7 A;  1MWN A;  3BUO B;  1IKU A;  1KQV A;  1ZFS A;  2P6B B;  2ZKM X;  2R2I A;  3KPX A;  1KCY A;  2VRG A;  4I5L B;  1NUB A;  2COL B;  3NXA A;  5K89 A;  1S6I A;  2F8P A;  3KO0 A;  1BF5 A;  1TN4 A;  1G33 A;  3CS1 A;  1IQ5 A;  2KGB C;  1A29 A;  3SIA A;  2H61 A;  1BOC A;  1SNL A;  4CFQ A;  1F4Q A;  1H8B A;  1JSA A;  4USL A;  1J7Q A;  3DVK A;  5CSF A;  1IWQ A;  1AJ5 A;  3CGA A;  1Y1A A;  3WNX B;  1GQM A;  2L4I A;  1PVA A;  1RJV A;  4I5N B;  1DJG A;  2WCF A;  2QAC A;  2O5G A;  1QV1 A;  2K8M B;  4PHJ A;  2KYF A;  2JPT A;  1OMR A;  1K8U A;  3BUM B;  2JWW A;  4JWQ A;  4ORB B;  4MEW A;  1BG1 A;  1SCM B;  4TNC A;  3SG7 A;  1AP4 A;  1JFJ A;  1PAL A;  3RM1 A;  3IQQ A;  2L98 A;  2MLF C;  3O4Y A;  1CB1 A;  1NPQ A;  1CDN A;  4DRW A;  2ZRS A;  4GFT A;  3I5H B;  1EG3 A;  2MA2 A;  1QJT A;  1QAS A;  2KFH A;  4HRE E;  3PAL A;  1SBJ A;  1ZOT B;  1K93 D;  2MHH A;  3I5F C;  1WRK A;  2Y1N A;  5I2L A;  1KK7 Z;  1NX1 A;  1ALV A;  2KQ6 A;  2KAY A;  2KFG A;  4NQG A;  2H2K A;  1BJF A;  2CXJ A;  2GGM A;  1YRT B;  2M0R A;  5AEQ A;  3A8R A;  1J7O A;  1BMO A;  1CM4 A;  1KFX L;  3OB1 B;  2O60 A;  1K9K A;  3LCP C;  1UUR A;  1QX5 B;  3BUW B;  4ZCU A;  2ZN8 A;  2NLN A;  4P5O E;  5ER4 X; 
#chains in the Genus database with same CATH topology
 1AHR A;  1TNQ A;  2HQW A;  1QX2 A;  3LK0 A;  4YI9 A;  5HKY A;  1PSB A;  1PVB A;  5DKR A;  2M7N A;  3D78 A;  1FI5 A;  1XO5 A;  1YX7 A;  2OS8 C;  2E30 A;  4ZCV A;  1HT9 A;  1RK9 A;  4OV2 A;  1A03 A;  1FPW A;  2WND A;  2K7O A;  3JVT C;  3CZ0 A;  5KSZ A;  3B86 A;  1SCV A;  3QME A;  3OB2 B;  1KK7 Y;  1OMV A;  2JNF A;  2QEV A;  1DJI A;  4GGF C;  4JKT A;  4OZD A;  5G08 A;  5J3X A;  4L9M A;  1TNW A;  3D0Y B;  1FBV A;  2NZ0 A;  1V1F A;  2K7D A;  2PMY A;  1NX2 A;  4FTG A;  1MF8 B;  2MAZ A;  5HLV A;  2I7A A;  3FE8 A;  2JPO A;  4GNK B;  2ISD A;  4OR9 B;  4A4B A;  1KWO C;  3DVM A;  1FW4 A;  4YGE B;  1TTX A;  2F3Y A;  2L0P A;  2JXL A;  2LAN A;  3PSR A;  4CID A;  5HL1 A;  5I2O A;  1C07 A;  1LIN A;  1CMF A;  1B4C A;  3LLE A;  1S26 D;  2KQY A;  3BFH A;  4ICB A;  3EVU A;  1UP5 A;  2JNX A;  2HET A;  1S6C A;  2WCM A;  1LXF C;  1WRZ A;  2BKH B;  1DF0 A;  2WCJ A;  1JUO A;  3PM8 A;  3S0B A;  4N1G A;  1H4B A;  2Y4Q A;  3M0W A;  3TDU A;  2TN4 A;  3PAT A;  2BBM A;  3JVT B;  5PAL A;  1OQP A;  2PVB A;  3EK8 A;  1U5I B;  3TUY C;  4ETO A;  1AUI B;  3IQO A;  3TZ1 A;  4PE7 A;  1S1E A;  1KFX S;  1IG5 A;  1QXP A;  2G2B A;  2CCM A;  2PQL A;  1K94 A;  3MSE B;  3D77 A;  1K95 A;  2HQ8 A;  1SSE B;  1LA3 A;  2LHI A;  1TOP A;  3RLZ A;  1F8H A;  1L2O C;  2F3Z A;  3IVT A;  3PJI A;  1QV0 A;  2JQ6 A;  1G4Y R;  1NP8 A;  1M63 B;  3EG5 B;  3SJS A;  1PUL A;  1LVC D;  1SL7 A;  1SW8 A;  4PHN A;  3S0E A;  1S3P A;  2E6W A;  4OKH A;  2QEO A;  4M2P A;  4CPV A;  1Y6W A;  5D7F A;  1B8L A;  3SS5 A;  3AKA A;  3SG2 A;  4JPZ B;  2QPT A;  1SR6 C;  1NCY A;  1CDL A;  1BLQ A;  2MRD A;  1CM1 A;  1K9U A;  1VRK A;  2BNX A;  2KBM A;  2LUC A;  1J7R A;  1IH0 A;  1IJ6 A;  1DJH A;  5DKN A;  5B8I B;  1OSA A;  1S5G Z;  1A4P A;  2M1U A;  2PSR A;  1B1G A;  2JTT A;  5CPV A;  2JTZ A;  2I94 A;  4UPG A;  3B7A A;  1W9Z A;  3D73 A;  2PYQ A;  2PAS A;  1EL4 A;  3OHM B;  1RTP 1;  5BPJ A;  4DIR A;  3FIA A;  1YR5 A;  3D75 A;  4NDB A;  1BR4 B;  1L2O B;  2KDH A;  2WCB A;  1V1G A;  2RGI A;  3JTD C;  1NYA A;  3D76 A;  2BE4 A;  4QJ5 B;  1DVI A;  1BOD A;  2YGU A;  5FI2 A;  3ZNI A;  1RRO A;  3PLF B;  3FWB A;  4E68 A;  2EC6 C;  2JU0 A;  2L5Y A;  3BUN B;  2KI6 D;  4MZL A;  1TIZ A;  4YGA A;  1T14 A;  3NGV A;  3I5G C;  4MRX A;  2LAP A;  1C7V A;  2KOT A;  1SR6 B;  3VRO A;  1Y1X A;  3AKB A;  1PRW A;  4INX A;  1N65 A;  3UO9 A;  2LVJ A;  2CNP A;  3VRN A;  1M39 A;  1JBA A;  1UUS A;  1C3Z A;  1CTR A;  2DOQ A;  2LHL A;  3VRQ A;  2FJU B;  5HLO A;  5KTY A;  2LLS A;  1JF2 A;  1XFU O;  1S5G Y;  1DJW A;  1JFK A;  4DCK A;  5CSJ A;  1NIW A;  3IF7 A;  2L51 A;  2NXQ A;  2JT3 A;  4A4C A;  2JUL A;  3JTD B;  2M9G A;  4R1E A;  3VGO A;  1A75 B;  3CWG A;  1OOF A;  2SAS A;  1DQE A;  4YI8 A;  1NSH A;  1FI6 A;  1EXR A;  1UHJ A;  2M49 B;  2WCH A;  2M97 A;  3RZS A;  3V2L A;  2MBX A;  2IS9 A;  1BT6 A;  2KNE A;  1WDC C;  2FJY A;  1QWV A;  3O78 A;  4DUQ A;  1S6J A;  1IQ3 A;  4AOM A;  2GTE A;  1F54 A;  2B1U A;  2FCD A;  1BU3 A;  4CFR A;  3DY9 A;  2K2A A;  3E3R A;  1LA0 A;  5F6T A;  2M7L A;  3I5I C;  3CZ2 A;  3OX6 A;  4P2Y B;  3F45 A;  1XFZ O;  3SG3 A;  3HCM A;  1KFU S;  4YGD B;  1MQ1 A;  4IJ7 A;  2OTG C;  3R72 A;  1NX0 A;  1SK6 D;  1KK8 C;  3D0Y A;  3I5F B;  5I8N A;  3S0D A;  1JF0 A;  3EK4 A;  1MUX A;  2F2P A;  1CKK A;  4IL1 A;  4NDD A;  5JJG A;  2I18 A;  3BQ3 A;  1MHO A;  4WRI A;  2OPO A;  1QIW A;  4PE4 A;  4WQ2 A;  5DIC A;  2KI6 C;  3DYE A;  4MVF A;  4MZK A;  5FYX A;  1IRJ A;  1RFJ A;  1ODB A;  3LL8 B;  1DC1 A;  1CFP A;  2H8V A;  3DF0 B;  1F71 A;  2NCP A;  3H4S E;  5FI6 A;  4PDZ A;  4F0Z B;  2JXC A;  1LS8 A;  1SL9 A;  3B6X A;  1R6P A;  2A4J A;  5DKQ A;  3DVE A;  1XFY O;  3R1V A;  4I5J A;  2LVI A;  3I5I B;  1ZMZ A;  1YX8 A;  3OP0 A;  3BOW A;  5EL2 A;  1PSR A;  1U5I A;  1SY9 A;  1M31 A;  3BFA A;  4GGF A;  5TNC A;  4MZJ A;  2OTG B;  2Y5I A;  1KK8 B;  3S0G A;  2OS8 B;  3SG4 A;  1UHI A;  1CFD A;  1Q80 A;  2JC2 A;  1EG4 A;  2WCL A;  1NWD A;  1QLK A;  1DGV A;  2EGD A;  3BOW B;  3GK4 X;  2ZFD A;  3TS5 C;  3DD4 A;  1CNP A;  1BR1 B;  4CLN A;  3KEV A;  1OMD A;  2GGZ A;  2I2R E;  2ZNE A;  2WC8 A;  3CR2 A;  3PN7 C;  4PE1 A;  1XVJ A;  1TUZ A;  1WLZ A;  2BCA A;  1S36 A;  3EVV A;  1UWO A;  2LLU A;  3L47 A;  2JZI A;  1TWO A;  1J7P A;  1CLL A;  1DJZ A;  2D8N A;  3QRX A;  4HRG A;  1IJ5 A;  1KWO B;  1QTX A;  3CR4 X;  4MN0 A;  3WHU B;  1TNX A;  4ORA B;  3GK2 A;  4YRU A;  1ALW A;  3DZT A;  1B47 A;  3OGN A;  2K61 A;  2QEH A;  4XYN A;  1B8C A;  1SPY A;  1CDM A;  1XK4 C;  1EH2 A;  1YVH A;  3CTN A;  1E8A A;  4DS7 A;  1QS7 A;  3NSL A;  1UHH A;  3BXK A;  4ORC B;  1TUJ A;  2CTN A;  4JQ0 D;  2K0J A;  4MLW A;  2LUX A;  2Y1M A;  1OE9 B;  1OOG A;  3BYA A;  3TS5 B;  4PAL A;  1QIV A;  3A4U B;  3TUY B;  1CLB A;  2KHN A;  1B9A A;  3EKJ A;  3PN7 B;  1AJ4 A;  1MXL C;  1KFU L;  2NCO A;  4YGC B;  2M8U A;  2KYC A;  3S0A A;  1AVS A;  1MR8 A;  1QVI Y;  1XFV O;  1K90 D;  2LVV A;  2QEB A;  3VRR A;  2H61 C;  1RWY A;  1XFX O;  2LLT A;  5AAN A;  5AFP A;  1DT7 B;  2AUC A;  4P5O E;  2M29 A;  1XFR A;  1XFW O;  4GBA A;  2LNK A;  2ZN9 A;  4FQT A;  2LMT A;  2BBN A;  2PRU A;  3VB1 A;  4AQJ A;  1CDP A;  1FF1 A;  2LP2 A;  3EVR A;  3B88 A;  3VRP A;  3NHI A;  4HSZ A;  2ZND A;  1DJX A;  3I5H C;  3CZ1 A;  4QJ3 B;  4C0J A;  2BEC A;  1M45 A;  3WHT B;  3SS3 A;  1C7W A;  3D74 A;  4HRH A;  4M2Q A;  4GGN A;  4KYN A;  4U8D A;  5GQQ C;  1A75 A;  3BUX B;  1WLM A;  1GM0 A;  2WC6 A;  1N0Y A;  1KQM C;  2KAX A;  5JOL A;  3EK7 A;  1TRF A;  1GJY A;  2FCE A;  2KAV A;  3ICB A;  1YUS A;  2GV5 A;  4INW A;  3WXA A;  1B7T Z;  2LC5 A;  2L50 A;  1NCZ A;  2BL0 C;  2M1K B;  1LKJ A;  2L2C A;  1NX3 A;  2BE6 A;  5ER5 A;  2L5X B;  4MBE A;  1UHK A;  3AAK A;  2CBL A;  3L4L A;  5I2Q A;  1QLS A;  4WQ3 A;  2LCP A;  2EC6 B;  1JWD A;  2LM5 A;  1SYM A;  4FQO A;  3I5G B;  1OZO A;  3KHE A;  1TCO B;  2ZRT A;  3R1O A;  3NSK A;  2AMI A;  3FWC A;  2K60 A;  4M2O A;  4PHM A;  3GOF A;  2LVK A;  1D1O A;  2KFF A;  1P28 A;  5AER A;  4PCW A;  1DEL A;  2F33 A;  1DGU A;  3D10 A;  3PFV A;  1SL8 A;  1SKT A;  2HF5 A;  1R2U A;  3DVJ A;  1CFF A;  5D69 A;  4OVN F;  1KQM B;  3FE9 A;  2BKI B;  2CT9 A;  3OX5 A;  4BY4 A;  4PHK A;  2LMV A;  4N5X A;  2LMU A;  1WRL A;  1F55 A;  1ZUZ A;  4AQI A;  2AAO A;  2BCB A;  1OOJ A;  4MRY A;  2HPS A;  1QX7 A;  2BL0 B;  3DF0 A;  3HX4 A;  3O4X A;  1NCX A;  4OCI A;  1XA5 A;  2QDI A;  1PK0 D;  1OW4 A;  2JRF A;  2JT8 A;  1K96 A;  1B7T Y;  1Y0V H;  4GUK A;  4N1F A;  2K7C A;  3AAJ A;  3GK1 A;  5CSI A;  3CYZ A;  3TDZ A;  3B87 A;  2MLE C;  3LK1 A;  2L4H A;  3SIB A;  2LP3 A;  3SG6 A;  2KSP A;  2PAL A;  1QAT A;  4C0L A;  4GAO A;  1WDC B;  1DMO A;  1TCF A;  3N7H A;  1YUR A;  3EKH A;  5HKZ A;  1G8I A;  1ZAC A;  1DEK A;  4QJ4 B;  1MXE A;  1YUU A;  2M3W A;  2WCE A;  1W7J B;  2P70 A;  4YGB B;  1TNP A;  4BY5 A;  1ORG A;  1YTZ C;  1W7I B;  2BCX A;  1J1E A;  1M46 A;  3CAB A;  4C0K A;  5I94 A;  5AXI A;  3O6B A;  2P71 A;  3CZT X;  3KF9 A;  2L2E A;  2Q91 A;  1AK8 A;  2V53 A;  1B8R A;  1YRU B;  3K21 A;  3SG5 A;  2LE9 B;  4NDC A;  2JT0 A;  1QVI Z;  3CR5 X;  3ZWH A;  1DJY A;  2K7B A;  1J1D A;  2Q4U A;  3O2P A;  3C1V A;  4F7F A;  3NSI A;  3NSO A;  4D1E A;  1UHN A;  1K9P A;  4YBH B;  1F4O A;  3L4A A;  3SS4 A;  2WOR A;  1HQV A;  2FOT A;  1DTL A;  3FS7 A;  2K2F A;  2SCP A;  1SRA A;  2KI4 C;  2KBI A;  1YUT A;  1YVL A;  4I5K A;  1XYD A;  4MSP A;  1SMG A;  1Z2C B;  2EHB A;  2MJW B;  5IBW A;  5KU1 A;  1JC2 A;  1OOI X;  1CMG A;  1X02 A;  1REC A;  2WOS A;  1Y1U A;  1DF0 B;  3BJH A;  5FI7 A;  2KGR A;  1KSO A;  2F2O A;  1L7Z A;  1OZS A;  4XJK A;  1CFC A;  1CLM A;  1GGZ A;  3K1E A;  1J55 A;  5HKW A;  1OOH A;  3UNW A;  3TDI A;  3S0F A;  1N2D A;  5HYD A;  4PE0 A;  4XJK B;  1K2H A;  3DXL A;  4GPL B;  1IGV A;  1IIO A;  3CLN A;  4Q04 A;  2ERB A;  1GGW A;  1XK4 A;  2JOJ A;  1EJ3 A;  1KSM A;  1SCM C;  1F70 A;  1WY9 A;  2G9B A;  1A2X A;  2KI4 B;  5CSN A;  5D3O A;  2LV7 A;  1MWN A;  3BUO B;  1IKU A;  1KQV A;  1ZFS A;  2P6B B;  2ZKM X;  2R2I A;  3KPX A;  1KCY A;  2VRG A;  4I5L B;  1NUB A;  2COL B;  3NXA A;  5K89 A;  1S6I A;  2F8P A;  3KO0 A;  1BF5 A;  1TN4 A;  1G33 A;  3CS1 A;  1IQ5 A;  2KGB C;  1A29 A;  3SIA A;  2H61 A;  1BOC A;  1SNL A;  4CFQ A;  1F4Q A;  3FE6 A;  1H8B A;  4USL A;  1JSA A;  1J7Q A;  3DVK A;  5CSF A;  1IWQ A;  1AJ5 A;  3CGA A;  1Y1A A;  3WNX B;  4JD9 A;  1GQM A;  2L4I A;  1PVA A;  1RJV A;  4I5N B;  1DJG A;  2WCF A;  2QAC A;  2WCK A;  2O5G A;  1QV1 A;  2K8M B;  4PHJ A;  3Q8I A;  2KYF A;  2JPT A;  1OMR A;  1K8U A;  3BUM B;  2JWW A;  4JWQ A;  4ORB B;  4MEW A;  1BG1 A;  3OBV A;  1SCM B;  4TNC A;  3SG7 A;  1AP4 A;  1JFJ A;  1PAL A;  3RM1 A;  3IQQ A;  2L98 A;  2MLF C;  3R1P A;  3O4Y A;  1CB1 A;  1NPQ A;  1CDN A;  3CDN A;  4DRW A;  2ZRS A;  4GFT A;  3I5H B;  1EG3 A;  2MA2 A;  1QJT A;  1QAS A;  2KFH A;  4PT1 A;  4HRE E;  3PAL A;  1SBJ A;  1ZOT B;  1Z4H A;  3PM2 A;  1K93 D;  2MHH A;  3I5F C;  1WRK A;  2Y1N A;  5I2L A;  1KK7 Z;  1NX1 A;  1ALV A;  1C3Y A;  2KQ6 A;  3NHT A;  2KAY A;  2KFG A;  4NQG A;  2H2K A;  1BJF A;  2CXJ A;  2GGM A;  1YRT B;  2M0R A;  2KLD A;  3BFB A;  5AEQ A;  3A8R A;  1J7O A;  2KPH A;  1BMO A;  1CM4 A;  1KFX L;  3OB1 B;  2O60 A;  1K9K A;  3LCP C;  1UUR A;  1QX5 B;  2WC5 A;  2KLE A;  3BUW B;  4ZCU A;  2ZN8 A;  2NLN A;  2BAP A;  5ER4 X; 
#chains in the Genus database with same CATH homology
 1AHR A;  1TNQ A;  2HQW A;  1QX2 A;  3LK0 A;  4YI9 A;  5HKY A;  1PSB A;  1PVB A;  5DKR A;  2M7N A;  1FI5 A;  1XO5 A;  1YX7 A;  2OS8 C;  2E30 A;  4ZCV A;  1HT9 A;  1RK9 A;  4OV2 A;  1A03 A;  1FPW A;  2WND A;  2K7O A;  3JVT C;  5KSZ A;  1SCV A;  3OB2 B;  1KK7 Y;  1OMV A;  2JNF A;  5J3X A;  1DJI A;  4GGF C;  5G08 A;  4L9M A;  1TNW A;  3D0Y B;  1FBV A;  2NZ0 A;  1V1F A;  2K7D A;  2PMY A;  1NX2 A;  4FTG A;  1MF8 B;  2MAZ A;  5HLV A;  2I7A A;  4GNK B;  2ISD A;  4A4B A;  4OR9 B;  1F70 A;  1KWO C;  3DVM A;  1FW4 A;  4YGE B;  1TTX A;  2F3Y A;  2L0P A;  2JXL A;  2LAN A;  3PSR A;  4CID A;  5I2O A;  1C07 A;  1LIN A;  1CMF A;  1B4C A;  3LLE A;  1S26 D;  2KQY A;  4ICB A;  3EVU A;  1UP5 A;  2JNX A;  2HET A;  1S6C A;  1LXF C;  1WRZ A;  2BKH B;  1DF0 A;  3PM8 A;  1JUO A;  4N1G A;  1H4B A;  2Y4Q A;  3M0W A;  3TDU A;  2TN4 A;  3PAT A;  2BBM A;  3JVT B;  5PAL A;  1OQP A;  2PVB A;  3EK8 A;  1U5I B;  3TUY C;  4ETO A;  1AUI B;  3IQO A;  3TZ1 A;  4PE7 A;  1S1E A;  1KFX S;  1IG5 A;  1QXP A;  2G2B A;  2CCM A;  1K94 A;  3MSE B;  1K95 A;  2HQ8 A;  1LA3 A;  2LHI A;  1TOP A;  3RLZ A;  1F8H A;  1L2O C;  2F3Z A;  1QV0 A;  2JQ6 A;  1G4Y R;  1NP8 A;  1M63 B;  3SJS A;  1PUL A;  1LVC D;  1SL7 A;  1SW8 A;  4PHN A;  1S3P A;  2E6W A;  4OKH A;  4M2P A;  4CPV A;  1Y6W A;  5D7F A;  1B8L A;  3AKA A;  3SG2 A;  4JPZ B;  2QPT A;  1SR6 C;  1NCY A;  1CDL A;  1BLQ A;  2MRD A;  1CM1 A;  1K9U A;  1VRK A;  2KBM A;  2LUC A;  1J7R A;  1IH0 A;  1IJ6 A;  1DJH A;  5DKN A;  5B8I B;  1OSA A;  1S5G Z;  1A4P A;  2M1U A;  2PSR A;  1B1G A;  2JTT A;  5CPV A;  2JTZ A;  2I94 A;  4UPG A;  2PAS A;  1EL4 A;  3OHM B;  1RTP 1;  5BPJ A;  4DIR A;  3FIA A;  1YR5 A;  4NDB A;  1BR4 B;  1L2O B;  2KDH A;  2WCB A;  1V1G A;  2RGI A;  3JTD C;  1NYA A;  2BE4 A;  4QJ5 B;  1DVI A;  1BOD A;  3ZNI A;  1RRO A;  3PLF B;  3FWB A;  4E68 A;  2EC6 C;  2JU0 A;  3BUN B;  4MZL A;  2KI6 D;  1TIZ A;  4YGA A;  4MRX A;  3I5G C;  1C7V A;  2LAP A;  2KOT A;  1SR6 B;  3VRO A;  1Y1X A;  3AKB A;  1PRW A;  1N65 A;  2LVJ A;  2CNP A;  3VRN A;  1M39 A;  1JBA A;  1UUS A;  1CTR A;  2DOQ A;  2LHL A;  3VRQ A;  2FJU B;  5HLO A;  5KTY A;  2LLS A;  1JF2 A;  1XFU O;  1S5G Y;  1DJW A;  1JFK A;  4DCK A;  5CSJ A;  1NIW A;  3IF7 A;  2L51 A;  2NXQ A;  2JT3 A;  4A4C A;  2JUL A;  3JTD B;  2M9G A;  4R1E A;  3VGO A;  1A75 B;  3CWG A;  2SAS A;  4YI8 A;  1NSH A;  1FI6 A;  1EXR A;  1UHJ A;  2M49 B;  2M97 A;  2MBX A;  2IS9 A;  1BT6 A;  2KNE A;  1WDC C;  4DUQ A;  3O78 A;  1S6J A;  1IQ3 A;  4AOM A;  1F54 A;  2B1U A;  2FCD A;  1BU3 A;  4CFR A;  2K2A A;  3E3R A;  1LA0 A;  5F6T A;  2M7L A;  3I5I C;  3OX6 A;  3F45 A;  1XFZ O;  3SG3 A;  3HCM A;  1KFU S;  4YGD B;  1MQ1 A;  2OTG C;  1NX0 A;  1SK6 D;  1KK8 C;  3D0Y A;  3I5F B;  5I8N A;  1JF0 A;  3EK4 A;  1MUX A;  2F2P A;  1CKK A;  4IL1 A;  4NDD A;  5JJG A;  2I18 A;  3BQ3 A;  1MHO A;  4WRI A;  2OPO A;  1QIW A;  4PE4 A;  4WQ2 A;  5FYX A;  2KI6 C;  4MVF A;  4MZK A;  1IRJ A;  1RFJ A;  1ODB A;  3LL8 B;  1CFP A;  3DF0 B;  1F71 A;  2NCP A;  3H4S E;  4PDZ A;  4F0Z B;  2JXC A;  1SL9 A;  5DKQ A;  1R6P A;  2A4J A;  3DVE A;  1XFY O;  4I5J A;  2LVI A;  3I5I B;  1ZMZ A;  1YX8 A;  3OP0 A;  3BOW A;  1PSR A;  1U5I A;  1SY9 A;  1M31 A;  4GGF A;  5TNC A;  4MZJ A;  2OTG B;  2Y5I A;  1KK8 B;  2OS8 B;  3SG4 A;  1UHI A;  1CFD A;  1Q80 A;  2JC2 A;  1EG4 A;  1NWD A;  1QLK A;  1DGV A;  2EGD A;  3BOW B;  3GK4 X;  2ZFD A;  3TS5 C;  3DD4 A;  1CNP A;  1BR1 B;  4CLN A;  3KEV A;  1OMD A;  2GGZ A;  2I2R E;  2ZNE A;  2WC8 A;  3CR2 A;  3PN7 C;  4PE1 A;  1XVJ A;  1WLZ A;  2BCA A;  1S36 A;  3EVV A;  1UWO A;  2LLU A;  1J7P A;  2JZI A;  1CLL A;  1DJZ A;  2D8N A;  3QRX A;  4HRG A;  1IJ5 A;  1KWO B;  1QTX A;  3CR4 X;  4MN0 A;  3WHU B;  1TNX A;  4ORA B;  3GK2 A;  4YRU A;  1ALW A;  1B47 A;  2K61 A;  4XYN A;  1B8C A;  1SPY A;  1CDM A;  1XK4 C;  1EH2 A;  1YVH A;  3CTN A;  1E8A A;  4DS7 A;  1QS7 A;  3NSL A;  1UHH A;  3BXK A;  4ORC B;  4JQ0 D;  2CTN A;  4MLW A;  2K0J A;  2LUX A;  2Y1M A;  1OE9 B;  3BYA A;  3TS5 B;  4PAL A;  1QIV A;  3A4U B;  3TUY B;  1CLB A;  2KHN A;  1B9A A;  3EKJ A;  3PN7 B;  1AJ4 A;  1MXL C;  1KFU L;  2NCO A;  4YGC B;  2M8U A;  2KYC A;  1AVS A;  1MR8 A;  1QVI Y;  1XFV O;  1K90 D;  2LVV A;  3VRR A;  2H61 C;  1RWY A;  1XFX O;  2LLT A;  5AAN A;  5AFP A;  1DT7 B;  2AUC A;  2M29 A;  1XFW O;  4GBA A;  2LNK A;  2ZN9 A;  2LMT A;  2BBN A;  2PRU A;  4AQJ A;  1CDP A;  1FF1 A;  2LP2 A;  3EVR A;  3VRP A;  4HSZ A;  2ZND A;  1DJX A;  3I5H C;  4QJ3 B;  4C0J A;  2BEC A;  1M45 A;  3WHT B;  1C7W A;  4HRH A;  4M2Q A;  4GGN A;  4U8D A;  5GQQ C;  1A75 A;  3BUX B;  1WLM A;  5JOL A;  1N0Y A;  1KQM C;  2KAX A;  3EK7 A;  1TRF A;  1GJY A;  2FCE A;  2KAV A;  3ICB A;  1YUS A;  2GV5 A;  3WXA A;  1B7T Z;  2LC5 A;  2L50 A;  1NCZ A;  2BL0 C;  2M1K B;  1LKJ A;  1NX3 A;  2BE6 A;  5ER5 A;  2L5X B;  4MBE A;  1UHK A;  3AAK A;  2CBL A;  5I2Q A;  1QLS A;  4WQ3 A;  2LCP A;  2EC6 B;  1JWD A;  2LM5 A;  1SYM A;  4FQO A;  3I5G B;  1OZO A;  3KHE A;  1TCO B;  2ZRT A;  3NSK A;  2AMI A;  3FWC A;  4M2O A;  4PHM A;  3GOF A;  2LVK A;  1D1O A;  2KFF A;  5AER A;  4PCW A;  2F33 A;  3D10 A;  1DGU A;  3PFV A;  1SL8 A;  1SKT A;  2HF5 A;  1R2U A;  3DVJ A;  1CFF A;  5D69 A;  4OVN F;  1KQM B;  2BKI B;  2CT9 A;  3OX5 A;  4BY4 A;  4PHK A;  2LMV A;  4N5X A;  2LMU A;  1WRL A;  1F55 A;  1ZUZ A;  4AQI A;  2AAO A;  2BCB A;  1OOJ A;  4MRY A;  2HPS A;  1QX7 A;  2BL0 B;  3DF0 A;  3HX4 A;  4OCI A;  1NCX A;  4P2Y B;  1XA5 A;  4GUK A;  1PK0 D;  4C0K A;  2JRF A;  2JT8 A;  1K96 A;  1B7T Y;  1Y0V H;  4N1F A;  2K7C A;  3AAJ A;  3GK1 A;  5CSI A;  3TDZ A;  2MLE C;  3LK1 A;  2L4H A;  3SIB A;  2LP3 A;  3SG6 A;  2KSP A;  2PAL A;  1QAT A;  4C0L A;  4GAO A;  1WDC B;  1DMO A;  1TCF A;  1YUR A;  3EKH A;  5HKZ A;  1G8I A;  1ZAC A;  4QJ4 B;  1MXE A;  1YUU A;  2M3W A;  2WCE A;  1W7J B;  4YGB B;  1TNP A;  4BY5 A;  1YTZ C;  1W7I B;  2BCX A;  1J1E A;  1M46 A;  5AXI A;  3O6B A;  3CZT X;  3KF9 A;  2L2E A;  2Q91 A;  1AK8 A;  2V53 A;  1B8R A;  1YRU B;  3K21 A;  3SG5 A;  2LE9 B;  4NDC A;  2JT0 A;  1QVI Z;  3CR5 X;  3ZWH A;  1DJY A;  2K7B A;  1J1D A;  2Q4U A;  3O2P A;  3C1V A;  3NSI A;  3NSO A;  4D1E A;  1UHN A;  1K9P A;  4YBH B;  1F4O A;  2WOR A;  1HQV A;  2FOT A;  1DTL A;  3FS7 A;  2K2F A;  2SCP A;  1SRA A;  2KI4 C;  2KBI A;  1YUT A;  1YVL A;  4I5K A;  1XYD A;  4MSP A;  1SMG A;  2EHB A;  2MJW B;  5IBW A;  5KU1 A;  1JC2 A;  1CMG A;  1X02 A;  1REC A;  2WOS A;  1Y1U A;  1DF0 B;  2KGR A;  1KSO A;  2F2O A;  1L7Z A;  1OZS A;  4XJK A;  1CFC A;  1CLM A;  1GGZ A;  1J55 A;  5HKW A;  3TDI A;  1N2D A;  5HYD A;  4PE0 A;  4XJK B;  1K2H A;  4GPL B;  1IGV A;  3CLN A;  4Q04 A;  1GGW A;  1XK4 A;  2JOJ A;  1EJ3 A;  1KSM A;  1SCM C;  1WY9 A;  2G9B A;  1A2X A;  2KI4 B;  5CSN A;  2LV7 A;  1MWN A;  3BUO B;  1IKU A;  1KQV A;  1ZFS A;  2P6B B;  2ZKM X;  2R2I A;  3KPX A;  1KCY A;  2VRG A;  4I5L B;  1NUB A;  2COL B;  3NXA A;  5K89 A;  1S6I A;  2F8P A;  3KO0 A;  1BF5 A;  1TN4 A;  1G33 A;  3CS1 A;  1IQ5 A;  2KGB C;  1A29 A;  3SIA A;  2H61 A;  1BOC A;  1SNL A;  4CFQ A;  1F4Q A;  1H8B A;  1JSA A;  4USL A;  1J7Q A;  3DVK A;  5CSF A;  1IWQ A;  1AJ5 A;  3CGA A;  1Y1A A;  3WNX B;  1GQM A;  2L4I A;  1PVA A;  1RJV A;  4I5N B;  1DJG A;  2WCF A;  2QAC A;  2O5G A;  1QV1 A;  2K8M B;  4PHJ A;  2KYF A;  2JPT A;  1OMR A;  1K8U A;  3BUM B;  2JWW A;  4JWQ A;  4ORB B;  4MEW A;  1BG1 A;  1SCM B;  4TNC A;  3SG7 A;  1AP4 A;  1JFJ A;  1PAL A;  3RM1 A;  3IQQ A;  2L98 A;  2MLF C;  3O4Y A;  1CB1 A;  1NPQ A;  1CDN A;  4DRW A;  2ZRS A;  4GFT A;  3I5H B;  1EG3 A;  2MA2 A;  1QJT A;  1QAS A;  2KFH A;  4HRE E;  3PAL A;  1SBJ A;  1ZOT B;  1K93 D;  2MHH A;  3I5F C;  1WRK A;  2Y1N A;  5I2L A;  1KK7 Z;  1NX1 A;  1ALV A;  2KQ6 A;  2KAY A;  2KFG A;  4NQG A;  2H2K A;  1BJF A;  2CXJ A;  2GGM A;  1YRT B;  2M0R A;  5AEQ A;  3A8R A;  1J7O A;  1BMO A;  1CM4 A;  1KFX L;  3OB1 B;  2O60 A;  1K9K A;  3LCP C;  1UUR A;  1QX5 B;  3BUW B;  4ZCU A;  2ZN8 A;  2NLN A;  4P5O E;  5ER4 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...