1XVJA

Crystal structure of rat alpha-parvalbumin d94s/g98e mutant
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
109
structure length
109
Chain Sequence
b'SMTDLLSAEDIKKAIGAFTAADSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKSGFIEEDELGSILKGFSSDARDLSAKETKTLMAAGDKDGSGKIEVEEFSTLVAES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Parvalbumin alpha
publication title Crystal Structure of the D94S/G98E Variant of Rat alpha-Parvalbumin. An Explanation for the Reduced Divalent Ion Affinity.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
total genus 41
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xvjA00
1DJIA 1Y1AA 1CB1A 1JF0A 1YUUA 2PSRA 1KQMC 3EVRA 1YX7A 2KOTA 1SR6C 2M29A 4GBAA 1IG5A 3NSKA 4QJ4B 3A4UB 1CKKA 3H4SE 1CNPA 2ZFDA 1DJWA 1WLMA 2KQYA 2EC6C 3TZ1A 4YGAA 3SG2A 2K7OA 2WOSA 1F70A 2GGZA 1U5IA 3O78A 4BY4A 2BBNA 3SIBA 1NX1A 2F3ZA 1M63B 1SNLA 1TNWA 1A2XA 2BCAA 1SKTA 2JT8A 5G08A 4GGFA 1BLQA 1LINA 2WORA 1S5GY 2Q91A 1QV1A 1RK9A 1EL4A 4MZLA 4YBHB 1KK7Y 1NX3A 4I5JA 2GV5A 2JNFA 2Y1MA 3I5HB 3CR4X 4GGFC 1UHIA 1CFDA 2LNKA 2BL0C 2BE4A 1YURA 4OR9B 2L50A 3OX6A 4CIDA 1QIWA 1X02A 5K89A 1CDLA 3KO0A 2LLUA 1C7WA 1LVCD 1SW8A 1DJXA 2KI4C 2Y1NA 1SYMA 1C7VA 4PHNA 1FW4A 3QRXA 4WQ3A 3AAKA 1DJZA 2KAYA 1WRKA 3ICBA 1RECA 1IJ6A 2G2BA 4MSPA 4PE0A 2KGRA 1RWYA 3CR5X 1G4YR 2LAPA 2M1UA 3BOWB 5HKYA 1N2DA 2KGBC 3D0YB 4R1EA 1WDCC 2JXCA 1KCYA 1J7PA 3NXAA 3CTNA 1CM4A 2KDHA 1TNPA 4PCWA 3KHEA 2ISDA 5CSFA 1L2OB 2JT0A 3SG7A 1K8UA 1QX7A 3EVUA 4CPVA 1B47A 1G8IA 3KPXA 1JBAA 2BECA 1IH0A 1OSAA 2JTTA 4PHJA 1LA3A 1NCZA 1S36A 1E8AA 3O4YA 3ZWHA 3JVTC 1KK8C 4A4BA 1OZSA 1CM1A 5DKRA 1QVIZ 1ZACA 2LLTA 5KSZA 3HX4A 4ICBA 3TDZA 1S6CA 1OZOA 5ER5A 2AUCA 4GGNA 2KNEA 1J1EA 3PM8A 1OMDA 4XYNA 1PVAA 2B1UA 2KFGA 1CFCA 1AJ4A 1Q80A 1S6JA 1TN4A 5AANA 1NUBA 4PE7A 1ZOTB 1F71A 1UP5A 2MRDA 5HKZA 4MZKA 1RJVA 2R2IA 3I5GC 1BF5A 4U8DA 1BOCA 1GGWA 1H4BA 4Q04A 4E68A 1JFKA 1SBJA 3PLFB 3NSLA 1TIZA 4MZJA 1UHNA 5GQQC 1K93D 2OTGC 2JPTA 3FS7A 1A29A 1FBVA 3I5FC 1LKJA 2ZNDA 2JNXA 3TUYB 1JF2A 4DUQA 1SCMB 2Q4UA 5CPVA 5TNCA 4JQ0D 1FI5A 2Y4QA 5I2QA 2F33A 1EH2A 2AAOA 4BY5A 2ZNEA 1NX2A 4AQIA 1DJGA 1F4QA 3NSOA 1B1GA 3KEVA 2LVJA 1J7OA 4YGBB 3SG6A 2MBXA 1UWOA 3DD4A 1A75A 1J7RA 3I5IB 1NYAA 4MRYA 5JOLA 4MLWA 5BPJA 3EKHA 2JOJA 1SK6D 2MAZA 3CWGA 1MUXA 1QX5B 4D1EA 1K96A 3IQOA 2L0PA 2ZN9A 2M49B 1S1EA 1FF1A 2PRUA 4AOMA 1F55A 4XJKB 1XFUO 3DF0A 4WRIA 1F54A 2WCBA 1ALWA 2H2KA 1KQVA 1PULA 3GK4X 2LVIA 3EK4A 1ALVA 2ZRSA 1CFFA 1PVBA 5DKQA 1IQ3A 4AQJA 1KSMA 1DGUA 2CBLA 2MLEC 4GUKA 4CLNA 3F45A 1DJHA 1QXPA 1LXFC 5JJGA 4P2YB 5HLVA 2BKIB 3WXAA 1TCFA 2OS8C 3VRRA 1TRFA 1M39A 1VRKA 1NCXA 4L9MA 1NCYA 2QACA 4NDDA 2KSPA 1N65A 1DTLA 1OOJA 3CLNA 1YUTA 3IF7A 1NIWA 3OB1B 1UHKA 1ZUZA 1Y1UA 2BE6A 4DIRA 4N1GA 2L5XB 2E6WA 2K2FA 3LCPC 1KQMB 4PALA 4PHMA 4C0LA 2DOQA 1SR6B 1S5GZ 2LUCA 5KTYA 4FQOA 2KAXA 4GNKB 2EC6B 1KK7Z 3BUMB 2NXQA 4YGCB 2HPSA 2G9BA 2KQ6A 2M8UA 1XVJA 2I18A 1W7IB 1K2HA 2K0JA 3K21A 1XFVO 2E30A 1K9KA 1CDPA 2BCBA 2LMUA 2RGIA 1U5IB 1B4CA 3JTDC 1SRAA 1NP8A 2CTNA 1XA5A 5CSJA 2M3WA 3TDIA 3VRPA 4C0KA 1IQ5A 4MEWA 1EG3A 3DVMA 1M31A 4JWQA 2M0RA 4ETOA 1BR1B 2BL0B 4JPZB 1Y1XA 3CGAA 3AKAA 5D7FA 4ZCVA 1CFPA 4N5XA 3A8RA 4M2QA 2CXJA 4HRGA 1M46A 5PALA 4ORCB 2TN4A 2JT3A 1BJFA 1G33A 1BR4B 1WLZA 2NCOA 2K7BA 1MXLC 1S3PA 2NCPA 1QJTA 2KI4B 3C1VA 1MWNA 1H8BA 1RROA 4NDCA 3O6BA 3TS5C 4CFQA 4YRUA 5IBWA 1D1OA 1CLMA 4PDZA 3M0WA 1IWQA 1SMGA 1QVIY 1F8HA 2F2OA 3LK1A 1KFXL 4ZCUA 2KI6C 1DT7B 3VRNA 2LMTA 1CDNA 3VROA 1SPYA 1XK4A 2M1KB 1WDCB 2LP2A 1CMFA 1MQ1A 1OE9B 3PN7C 4GFTA 1DF0A 1GGZA 2ZN8A 1KWOC 2KBIA 3EVVA 3E3RA 1AHRA 1QASA 1FPWA 1XK4C 2HF5A 1TCOB 1ODBA 3SG4A 2L2EA 1XFZO 2KI6D 3HCMA 3GOFA 1ZMZA 2KFHA 2CT9A 2F3YA 2LV7A 1AVSA 2WCFA 1DGVA 1HT9A 5D69A 1B7TY 2MHHA 3SIAA 2I94A 3JVTB 1KK8B 5FYXA 1UHJA 1AJ5A 4I5NB 4HRHA 1XO5A 1NX0A 4NDBA 5F6TA 1QLKA 5HKWA 1YRUB 3O2PA 5DKNA 5I8NA 4MBEA 4C0JA 2CNPA 2PVBA 1CLLA 1Y6WA 1YX8A 3FWCA 1CLBA 4DRWA 3IQQA 4IL1A 1KFUL 1AK8A 1SL9A 2KHNA 3BUWB 1A03A 3PATA 3I5GB 2AMIA 3FWBA 1IJ5A 2JWWA 1OMRA 5CSIA 5AERA 2HQ8A 1OMVA 1TNQA 1GJYA 1YRTB 1J1DA 2JZIA 1ZFSA 3CZTX 4PHKA 2OTGB 3OP0A 4MRXA 1AP4A 2L98A 3BUNB 2M97A 3I5FB 4MN0A 3GK1A 1BT6A 1QV0A 1N0YA 2WNDA 3CS1A 5I2OA 1B9AA 3BXKA 5AFPA 2L51A 1GQMA 1DJYA 2K7DA 1DVIA 2PASA 1YR5A 1IKUA 2ZRTA 4DS7A 3AAJA 3I5HC 1JFJA 1PK0D 1S6IA 3PFVA 3PSRA 4OCIA 3RLZA 1AUIB 3FIAA 3ZNIA 2QPTA 1SCVA 1NPQA 1R2UA 1R6PA 1XFWO 3EKJA 4A4CA 2KAVA 1QLSA 2GGMA 3BYAA 5HLOA 1TTXA 2D8NA 4FTGA 4M2OA 2K8MB 1YUSA 3AKBA 4PE4A 1QX2A 1A75B 1XFYO 3BOWA 4OKHA 3WHTB 3RM1A 3SG3A 3D0YA 3PALA 2LANA 1TNXA 2LCPA 5B8IB 1CTRA 1WRLA 4ORAB 1RFJA 2K2AA 5AXIA 1KSOA 1W7JB 3LK0A 1QATA 1UUSA 1SY9A 4QJ5B 3DF0B 2LVVA 2MJWB 1BG1A 2ZKMX 2JXLA 1L2OC 1YVLA 2L4IA 4UPGA 1EXRA 1PALA 1F4OA 4ORBB 1NSHA 1FI6A 2BCXA 2SASA 3MSEB 2OS8B 2NZ0A 3GK2A 3BUXB 1NWDA 2LMVA 3SJSA 4WQ2A 4NQGA 2L4HA 2LHLA 1S26D 2COLB 1JUOA 2EGDA 5KU1A 1B8CA 1IGVA 3OX5A 2FCDA 2FCEA 1K95A 4HREE 3LL8B 1K94A 1QIVA 1C07A 2LP3A 2WCEA 1M45A 3LLEA 2CCMA 1PSRA 4M2PA 1MF8B 1KFXS 1JWDA 1MR8A 3OB2B 1PSBA 1JSAA 2F2PA 3D10A 2PALA 2KBMA 1EG4A 2IS9A 3NSIA 2JC2A 1HQVA 3VGOA 1BODA 4TNCA 2LHIA 1J7QA 1CDMA 4F0ZB 2MA2A 1TOPA 2PMYA 1UHHA 4DCKA 1K90D 3EK8A 2LE9B 5I2LA 1V1FA 3JTDB 2LLSA 4MVFA 2F8PA 3WHUB 3TUYC 2K61A 2HQWA 2NLNA 1SCMC 2M9GA 1SL7A 5HYDA 2KFFA 2JRFA 2MLFC 1A4PA 1IRJA 1RTP1 2HETA 2VRGA 3BUOB 4I5LB 3BQ3A 4PE1A 2K7CA 5ER4X 1XFXO 2LC5A 2JU0A 2JTZA 3I5IC 2JQ6A 2JULA 3VRQA 2LUXA 1Y0VH 2I2RE 3KF9A 4YGDB 2I7AA 2FOTA 4GAOA 1KFUS 3TS5B 2A4JA 4XJKA 1WRZA 1MHOA 2Y5IA 4YI8A 3SG5A 2H61A 4OVNF 2EHBA 4N1FA 1V1GA 3EK7A 1YVHA 3DVEA 1B7TZ 1SL8A 3OHMB 4OV2A 3PN7B 1EJ3A 2H61C 2KYFA 2M7LA 2KYCA 1KWOB 3WNXB 1BMOA 4CFRA 5CSNA 1K9UA 2V53A 4QJ3B 5AEQA 2WC8A 1UURA 2O5GA 1XYDA 1DF0B 2M7NA 1J55A 1LA0A 4YI9A 2OPOA 1PRWA 1K9PA 2LM5A 3DVKA 2O60A 2P6BB 1L7ZA 4GPLB 1WY9A 5J3XA 3CR2A 1QS7A 2FJUB 4HSZA 2BBMA 2LVKA 4YGEB 2BKHB 1QTXA 1CMGA 1B8LA 1BU3A 3TDUA 4I5KA 1JC2A 4USLA 1DMOA 1YTZC 1OQPA 2SCPA 4P5OE 1MXEA 1B8RA 3DVJA
chains in the Genus database with same CATH superfamily
3B6XA 4KYNA 2K60A 3QMEA 1DJIA 1Y1AA 3R72A 1CB1A 1JF0A 1YUUA 2PSRA 1KQMC 3EVRA 1YX7A 2KOTA 1SR6C 2M29A 3L4LA 1IG5A 1QWVA 3NSKA 3A4UB 4GBAA 3H4SE 2WCLA 2ZFDA 1DJWA 1WLMA 2KQYA 2EC6C 3BJHA 3TZ1A 4YGAA 5D3OA 3SG2A 2K7OA 3PM2A 2WOSA 1F70A 2GGZA 1U5IA 3O78A 4BY4A 2BBNA 3D78A 3SIBA 1NX1A 2F3ZA 1M63B 1SNLA 1TNWA 1A2XA 2BCAA 3BFHA 1SKTA 2JT8A 5G08A 4GGFA 1BLQA 3N7HA 1LINA 2WORA 1S5GY 2Q91A 1QV1A 3L4AA 1RK9A 1EL4A 2BNXA 4MZLA 1KK7Y 1NX3A 4I5JA 4YBHB 2GV5A 2JNFA 2Y1MA 3I5HB 3CR4X 4GGFC 1UHIA 1CFDA 2LNKA 3DY9A 2BL0C 2BE4A 3R1PA 1YURA 4OR9B 2L50A 3OX6A 4CIDA 1QIWA 1X02A 5K89A 1CDLA 3KO0A 2LLUA 1C7WA 1LVCD 1SW8A 1DJXA 2KI4C 2GTEA 2Y1NA 1SYMA 1C7VA 4PHNA 1FW4A 3QRXA 4WQ3A 3AAKA 1DJZA 2KAYA 3VB1A 1WRKA 3ICBA 1RECA 1IJ6A 2G2BA 4MSPA 4PE0A 2KGRA 1RWYA 2WCJA 1G4YR 3B7AA 3CR5X 3SS3A 3B86A 2LAPA 2M1UA 3BOWB 5HKYA 1N2DA 2KGBC 3D0YB 2ERBA 4R1EA 3S0FA 1WDCC 2JXCA 1KCYA 1J7PA 3NXAA 3SS4A 2KPHA 3CTNA 1CM4A 5FI6A 2KDHA 1TNPA 4PCWA 3KHEA 2ISDA 5CSFA 1L2OB 2JT0A 3SG7A 1C3YA 1K8UA 1QX7A 3EVUA 4CPVA 1G8IA 1B47A 3KPXA 1JBAA 2BECA 4INWA 1IH0A 1OSAA 2JTTA 4PHJA 1LA3A 1NCZA 1S36A 1E8AA 1LS8A 3O4YA 4FQTA 3ZWHA 3JVTC 1KK8C 4A4BA 1CNPA 1OZSA 1CM1A 2WCHA 5DKRA 1QVIZ 3BFBA 3V2LA 1ZACA 2LLTA 5KSZA 3HX4A 4ICBA 3TDZA 1S6CA 1OZOA 5ER5A 2AUCA 4GGNA 2KNEA 1J1EA 3PM8A 1OMDA 4XYNA 3DZTA 1PVAA 1Z2CB 2B1UA 2KFGA 1CFCA 1AJ4A 1Q80A 1S6JA 1TN4A 5AANA 1NUBA 3L47A 4PE7A 1IIOA 1ZOTB 1F71A 1UP5A 2MRDA 5HKZA 4MZKA 1RJVA 2R2IA 3I5GC 1BF5A 4U8DA 1BOCA 1GGWA 1H4BA 4Q04A 4E68A 1JFKA 1SBJA 1W9ZA 3PLFB 3NSLA 1TIZA 4MZJA 1UHNA 5GQQC 1K93D 2OTGC 2JPTA 3FS7A 1A29A 4JKTA 1FBVA 3I5FC 1LKJA 2ZNDA 2JNXA 3TUYB 2PYQA 1JF2A 4DUQA 1SCMB 2Q4UA 5CPVA 5TNCA 4JQ0D 1FI5A 2Y4QA 3FE8A 1TWOA 5I2QA 2F33A 1EH2A 2AAOA 4BY5A 2ZNEA 1NX2A 1OW4A 1DJGA 4AQIA 1F4QA 3NSOA 2P71A 1B1GA 3KEVA 2LVJA 1J7OA 4YGBB 1DQEA 3SG6A 2MBXA 1UWOA 3DD4A 1A75A 1J7RA 3I5IB 1NYAA 3NHTA 4MRYA 4MLWA 5JOLA 5BPJA 3EKHA 2JOJA 1SK6D 2MAZA 3CWGA 1MUXA 1QX5B 4D1EA 1K96A 3IQOA 2L0PA 1TUZA 2ZN9A 2M49B 1S1EA 1FF1A 2PRUA 4AOMA 1F55A 4XJKB 1XFUO 3D77A 3DF0A 4WRIA 1F54A 2WCBA 1ALWA 2H2KA 1KQVA 1PULA 3GK4X 2LVIA 3EK4A 1ALVA 2ZRSA 1CFFA 1PVBA 5DKQA 1IQ3A 4AQJA 2BAPA 1CKKA 1KSMA 1DGUA 2CBLA 3PJIA 2MLEC 4GUKA 4CLNA 3F45A 1DJHA 1QXPA 1LXFC 2QEVA 5JJGA 4P2YB 3NHIA 5HLVA 2BKIB 3WXAA 1TCFA 2OS8C 3VRRA 1TRFA 1OOFA 3OBVA 1M39A 1VRKA 1NCXA 2JPOA 4L9MA 1NCYA 2QACA 4NDDA 2KSPA 1N65A 1DTLA 2WC5A 1OOJA 3CLNA 1YUTA 3IF7A 1NIWA 3K1EA 3OB1B 1DELA 3DYEA 1UHKA 1ZUZA 1Y1UA 2BE6A 4DIRA 4N1GA 2L5XB 2E6WA 2K2FA 3LCPC 1KQMB 4PALA 4PHMA 4C0LA 2DOQA 1SR6B 1S5GZ 2LUCA 3BFAA 5KTYA 4FQOA 2KAXA 4GNKB 2EC6B 1KK7Z 3BUMB 2NXQA 3CYZA 2HPSA 4YGCB 2G9BA 2KQ6A 2M8UA 1XVJA 2I18A 1W7IB 1K2HA 2K0JA 3K21A 1XFVO 2E30A 1K9KA 1CDPA 2BCBA 2LMUA 2RGIA 1U5IB 1B4CA 3JTDC 1DC1A 1SRAA 1NP8A 5EL2A 2CTNA 1XA5A 5CSJA 2M3WA 3TDIA 3VRPA 4C0KA 1IQ5A 4MEWA 2KLDA 1EG3A 3DVMA 3S0DA 4JD9A 1M31A 4JWQA 2M0RA 4ETOA 1BR1B 2BL0B 4JPZB 1Y1XA 3CGAA 3AKAA 5D7FA 4ZCVA 1CFPA 1OOGA 4N5XA 3A8RA 4M2QA 2CXJA 4HRGA 1M46A 5PALA 4ORCB 2TN4A 2JT3A 1BJFA 1G33A 1BR4B 1WLZA 2NCOA 2K7BA 1MXLC 1S3PA 2NCPA 1QJTA 2KI4B 3C1VA 1MWNA 1H8BA 1RROA 4NDCA 3O6BA 3TS5C 4CFQA 4YRUA 5IBWA 1D1OA 1CLMA 4PDZA 3M0WA 1IWQA 1SMGA 1QVIY 1F8HA 2F2OA 3LK1A 1KFXL 4ZCUA 2KI6C 4QJ4B 3VRNA 2LMTA 1DT7B 1CDNA 3VROA 1SPYA 1XK4A 2M1KB 1WDCB 2LP2A 1CMFA 1MQ1A 1OE9B 3PN7C 4GFTA 1DF0A 1GGZA 2ZN8A 1CMGA 1KWOC 1C3ZA 2KBIA 3EVVA 3E3RA 1AHRA 1QASA 1FPWA 2FJYA 1XK4C 2HF5A 1TCOB 1ODBA 3SG4A 2L2EA 1XFZO 2KI6D 3HCMA 3GOFA 1ZMZA 2KFHA 2CT9A 3RZSA 2F3YA 2LV7A 1AVSA 2WCFA 1DGVA 1HT9A 5D69A 1B7TY 2MHHA 3SIAA 2I94A 3JVTB 1KK8B 5FYXA 1UHJA 1AJ5A 4I5NB 1GM0A 4HRHA 1XO5A 1NX0A 4NDBA 5F6TA 1QLKA 3OGNA 1YRUB 3O2PA 5DKNA 5HKWA 3S0BA 4MBEA 4C0JA 5I8NA 2CNPA 2PVBA 1CLLA 1Y6WA 1YX8A 3FWCA 1CLBA 4DRWA 3IQQA 4IL1A 1T14A 1KFUL 1AK8A 4OZDA 1SL9A 2KHNA 3BUWB 1A03A 3PATA 3I5GB 2AMIA 3FWBA 3D73A 1IJ5A 2JWWA 1OMRA 5CSIA 5AERA 2HQ8A 1OMVA 1TNQA 1GJYA 1YRTB 1J1DA 2JZIA 1ZFSA 3CZTX 4PHKA 2OTGB 3FE9A 3O4XA 3OP0A 4MRXA 1AP4A 2L98A 3BUNB 2M97A 3I5FB 4MN0A 3GK1A 1BT6A 1QV0A 1N0YA 2WNDA 3CS1A 5I2OA 1B9AA 3BXKA 5AFPA 2L51A 2H8VA 1GQMA 1DJYA 2K7DA 1DVIA 1ORGA 2PASA 3D75A 1YR5A 1IKUA 2ZRTA 4DS7A 3AAJA 3I5HC 1JFJA 2KLEA 5FI7A 1PK0D 1S6IA 3PFVA 3PSRA 3D76A 4OCIA 3RLZA 1AUIB 3FIAA 3ZNIA 2QPTA 2L2CA 1SCVA 1NPQA 1R2UA 1R6PA 1XFWO 3EKJA 4A4CA 2WCKA 2KAVA 2YGUA 1QLSA 2GGMA 3BYAA 5HLOA 1TTXA 2D8NA 4FTGA 4M2OA 2K8MB 1YUSA 3AKBA 4PE4A 3UO9A 1QX2A 1A75B 4F7FA 1XFYO 3BOWA 4OKHA 3WHTB 3RM1A 3SG3A 3D0YA 3R1VA 3B88A 3PALA 2LANA 1TNXA 2LCPA 5B8IB 3CZ1A 1CTRA 1WRLA 3CZ0A 4ORAB 1RFJA 2L5YA 2K2AA 5AXIA 1XFRA 1KSOA 1W7JB 3LK0A 1QATA 1UUSA 1SY9A 4QJ5B 3DF0B 2LVVA 5HL1A 2MJWB 1BG1A 2ZKMX 2JXLA 1L2OC 1YVLA 2L4IA 4UPGA 1EXRA 1PALA 1F4OA 4ORBB 1NSHA 1FI6A 1P28A 2BCXA 1OOIX 2SASA 3MSEB 2OS8B 2NZ0A 3GK2A 3SS5A 5I94A 3BUXB 1NWDA 2LMVA 3SJSA 4WQ2A 4NQGA 2L4HA 2LHLA 1S26D 2COLB 1JUOA 2EGDA 5KU1A 1OOHA 1B8CA 1IGVA 3OX5A 1DEKA 2FCDA 2FCEA 1K95A 4HREE 3LL8B 1K94A 1QIVA 1C07A 2LP3A 2WCEA 1M45A 3D74A 3LLEA 2CCMA 1PSRA 4M2PA 1MF8B 1KFXS 1JWDA 1MR8A 3OB2B 1PSBA 1JSAA 2F2PA 3D10A 2PALA 2KBMA 3B87A 1EG4A 2IS9A 3NSIA 2JC2A 1HQVA 3VGOA 1BODA 4TNCA 2LHIA 1J7QA 1CDMA 4F0ZB 2MA2A 1TOPA 2PMYA 1UHHA 4DCKA 1K90D 3EK8A 2LE9B 5I2LA 1V1FA 3JTDB 2LLSA 4MVFA 2F8PA 3WHUB 3TUYC 2K61A 2HQWA 4PT1A 2NLNA 1SCMC 2M9GA 1SL7A 5HYDA 2KFFA 2JRFA 2MLFC 1A4PA 1IRJA 1RTP1 2HETA 3Q8IA 2VRGA 3CABA 3BUOB 3S0EA 4I5LB 3BQ3A 4PE1A 3UNWA 2QEOA 2K7CA 5ER4X 1XFXO 2LC5A 3DXLA 3CZ2A 2JU0A 2JTZA 3I5IC 1SSEB 2JQ6A 2JULA 4IJ7A 3VRQA 2LUXA 1TUJA 1Y0VH 2I2RE 3KF9A 4YGDB 2I7AA 2FOTA 4GAOA 1KFUS 3TS5B 3S0AA 2A4JA 4XJKA 1WRZA 5DICA 1MHOA 2Y5IA 4YI8A 3SG5A 2H61A 4OVNF 2EHBA 4N1FA 2QEBA 3R1OA 1V1GA 3EK7A 1YVHA 3NGVA 3DVEA 1B7TZ 1SL8A 3OHMB 4OV2A 3CDNA 3PN7B 2QDIA 1EJ3A 2H61C 2KYFA 2M7LA 2KYCA 1KWOB 3WNXB 1BMOA 2QEHA 4INXA 4CFRA 5CSNA 1K9UA 2V53A 4QJ3B 5AEQA 2WC8A 1UURA 2O5GA 2WCMA 1XYDA 2P70A 1DF0B 2M7NA 1J55A 1LA0A 4YI9A 2OPOA 1PRWA 1K9PA 2LM5A 3DVKA 2O60A 2P6BB 1L7ZA 4GPLB 2PQLA 1WY9A 3EG5B 3S0GA 5J3XA 3CR2A 3IVTA 1QS7A 2FJUB 4HSZA 2BBMA 2LVKA 3FE6A 2BKHB 1QTXA 4YGEB 1B8LA 1BU3A 2WC6A 4I5KA 5FI2A 3TDUA 1JC2A 4USLA 1DMOA 1YTZC 1OQPA 2SCPA 4P5OE 1Z4HA 1MXEA 1B8RA 3DVJA
chains in the Genus database with same CATH topology
1DJIA 1Y1AA 1CB1A 1JF0A 1YUUA 2PSRA 1KQMC 3EVRA 1YX7A 2KOTA 1SR6C 2M29A 4GBAA 1IG5A 3NSKA 4QJ4B 3A4UB 1CKKA 3H4SE 1CNPA 2ZFDA 1DJWA 1WLMA 2KQYA 2EC6C 3TZ1A 4YGAA 3SG2A 2K7OA 2WOSA 1F70A 2GGZA 1U5IA 3O78A 4BY4A 2BBNA 3SIBA 1NX1A 2F3ZA 1M63B 1SNLA 1TNWA 1A2XA 2BCAA 1SKTA 2JT8A 5G08A 4GGFA 1BLQA 1LINA 2WORA 1S5GY 2Q91A 1QV1A 1RK9A 1EL4A 4MZLA 4YBHB 1KK7Y 1NX3A 4I5JA 2GV5A 2JNFA 2Y1MA 3I5HB 3CR4X 4GGFC 1UHIA 1CFDA 2LNKA 2BL0C 2BE4A 1YURA 4OR9B 2L50A 3OX6A 4CIDA 1QIWA 1X02A 5K89A 1CDLA 3KO0A 2LLUA 1C7WA 1LVCD 1SW8A 1DJXA 2KI4C 2Y1NA 1SYMA 1C7VA 4PHNA 1FW4A 3QRXA 4WQ3A 3AAKA 1DJZA 2KAYA 1WRKA 3ICBA 1RECA 1IJ6A 2G2BA 4MSPA 4PE0A 2KGRA 1RWYA 3CR5X 1G4YR 2LAPA 2M1UA 3BOWB 5HKYA 1N2DA 2KGBC 3D0YB 4R1EA 1WDCC 2JXCA 1KCYA 1J7PA 3NXAA 3CTNA 1CM4A 2KDHA 1TNPA 4PCWA 3KHEA 2ISDA 5CSFA 1L2OB 2JT0A 3SG7A 1K8UA 1QX7A 3EVUA 4CPVA 1B47A 1G8IA 3KPXA 1JBAA 2BECA 1IH0A 1OSAA 2JTTA 4PHJA 1LA3A 1NCZA 1S36A 1E8AA 3O4YA 3ZWHA 3JVTC 1KK8C 4A4BA 1OZSA 1CM1A 5DKRA 1QVIZ 1ZACA 2LLTA 5KSZA 3HX4A 4ICBA 3TDZA 1S6CA 1OZOA 5ER5A 2AUCA 4GGNA 2KNEA 1J1EA 3PM8A 1OMDA 4XYNA 1PVAA 2B1UA 2KFGA 1CFCA 1AJ4A 1Q80A 1S6JA 1TN4A 5AANA 1NUBA 4PE7A 1ZOTB 1F71A 1UP5A 2MRDA 5HKZA 4MZKA 1RJVA 2R2IA 3I5GC 1BF5A 4U8DA 1BOCA 1GGWA 1H4BA 4Q04A 4E68A 1JFKA 1SBJA 3PLFB 3NSLA 1TIZA 4MZJA 1UHNA 5GQQC 1K93D 2OTGC 2JPTA 3FS7A 1A29A 1FBVA 3I5FC 1LKJA 2ZNDA 2JNXA 3TUYB 1JF2A 4DUQA 1SCMB 2Q4UA 5CPVA 5TNCA 4JQ0D 1FI5A 2Y4QA 5I2QA 2F33A 1EH2A 2AAOA 4BY5A 2ZNEA 1NX2A 4AQIA 1DJGA 1F4QA 3NSOA 1B1GA 3KEVA 2LVJA 1J7OA 4YGBB 3SG6A 2MBXA 1UWOA 3DD4A 1A75A 1J7RA 3I5IB 1NYAA 4MRYA 5JOLA 4MLWA 5BPJA 3EKHA 2JOJA 1SK6D 2MAZA 3CWGA 1MUXA 1QX5B 4D1EA 1K96A 3IQOA 2L0PA 2ZN9A 2M49B 1S1EA 1FF1A 2PRUA 4AOMA 1F55A 4XJKB 1XFUO 3DF0A 4WRIA 1F54A 2WCBA 1ALWA 2H2KA 1KQVA 1PULA 3GK4X 2LVIA 3EK4A 1ALVA 2ZRSA 1CFFA 1PVBA 5DKQA 1IQ3A 4AQJA 1KSMA 1DGUA 2CBLA 2MLEC 4GUKA 4CLNA 3F45A 1DJHA 1QXPA 1LXFC 5JJGA 4P2YB 5HLVA 2BKIB 3WXAA 1TCFA 2OS8C 3VRRA 1TRFA 1M39A 1VRKA 1NCXA 4L9MA 1NCYA 2QACA 4NDDA 2KSPA 1N65A 1DTLA 1OOJA 3CLNA 1YUTA 3IF7A 1NIWA 3OB1B 1UHKA 1ZUZA 1Y1UA 2BE6A 4DIRA 4N1GA 2L5XB 2E6WA 2K2FA 3LCPC 1KQMB 4PALA 4PHMA 4C0LA 2DOQA 1SR6B 1S5GZ 2LUCA 5KTYA 4FQOA 2KAXA 4GNKB 2EC6B 1KK7Z 3BUMB 2NXQA 4YGCB 2HPSA 2G9BA 2KQ6A 2M8UA 1XVJA 2I18A 1W7IB 1K2HA 2K0JA 3K21A 1XFVO 2E30A 1K9KA 1CDPA 2BCBA 2LMUA 2RGIA 1U5IB 1B4CA 3JTDC 1SRAA 1NP8A 2CTNA 1XA5A 5CSJA 2M3WA 3TDIA 3VRPA 4C0KA 1IQ5A 4MEWA 1EG3A 3DVMA 1M31A 4JWQA 2M0RA 4ETOA 1BR1B 2BL0B 4JPZB 1Y1XA 3CGAA 3AKAA 5D7FA 4ZCVA 1CFPA 4N5XA 3A8RA 4M2QA 2CXJA 4HRGA 1M46A 5PALA 4ORCB 2TN4A 2JT3A 1BJFA 1G33A 1BR4B 1WLZA 2NCOA 2K7BA 1MXLC 1S3PA 2NCPA 1QJTA 2KI4B 3C1VA 1MWNA 1H8BA 1RROA 4NDCA 3O6BA 3TS5C 4CFQA 4YRUA 5IBWA 1D1OA 1CLMA 4PDZA 3M0WA 1IWQA 1SMGA 1QVIY 1F8HA 2F2OA 3LK1A 1KFXL 4ZCUA 2KI6C 1DT7B 3VRNA 2LMTA 1CDNA 3VROA 1SPYA 1XK4A 2M1KB 1WDCB 2LP2A 1CMFA 1MQ1A 1OE9B 3PN7C 4GFTA 1DF0A 1GGZA 2ZN8A 1KWOC 2KBIA 3EVVA 3E3RA 1AHRA 1QASA 1FPWA 1XK4C 2HF5A 1TCOB 1ODBA 3SG4A 2L2EA 1XFZO 2KI6D 3HCMA 3GOFA 1ZMZA 2KFHA 2CT9A 2F3YA 2LV7A 1AVSA 2WCFA 1DGVA 1HT9A 5D69A 1B7TY 2MHHA 3SIAA 2I94A 3JVTB 1KK8B 5FYXA 1UHJA 1AJ5A 4I5NB 4HRHA 1XO5A 1NX0A 4NDBA 5F6TA 1QLKA 5HKWA 1YRUB 3O2PA 5DKNA 5I8NA 4MBEA 4C0JA 2CNPA 2PVBA 1CLLA 1Y6WA 1YX8A 3FWCA 1CLBA 4DRWA 3IQQA 4IL1A 1KFUL 1AK8A 1SL9A 2KHNA 3BUWB 1A03A 3PATA 3I5GB 2AMIA 3FWBA 1IJ5A 2JWWA 1OMRA 5CSIA 5AERA 2HQ8A 1OMVA 1TNQA 1GJYA 1YRTB 1J1DA 2JZIA 1ZFSA 3CZTX 4PHKA 2OTGB 3OP0A 4MRXA 1AP4A 2L98A 3BUNB 2M97A 3I5FB 4MN0A 3GK1A 1BT6A 1QV0A 1N0YA 2WNDA 3CS1A 5I2OA 1B9AA 3BXKA 5AFPA 2L51A 1GQMA 1DJYA 2K7DA 1DVIA 2PASA 1YR5A 1IKUA 2ZRTA 4DS7A 3AAJA 3I5HC 1JFJA 1PK0D 1S6IA 3PFVA 3PSRA 4OCIA 3RLZA 1AUIB 3FIAA 3ZNIA 2QPTA 1SCVA 1NPQA 1R2UA 1R6PA 1XFWO 3EKJA 4A4CA 2KAVA 1QLSA 2GGMA 3BYAA 5HLOA 1TTXA 2D8NA 4FTGA 4M2OA 2K8MB 1YUSA 3AKBA 4PE4A 1QX2A 1A75B 1XFYO 3BOWA 4OKHA 3WHTB 3RM1A 3SG3A 3D0YA 3PALA 2LANA 1TNXA 2LCPA 5B8IB 1CTRA 1WRLA 4ORAB 1RFJA 2K2AA 5AXIA 1KSOA 1W7JB 3LK0A 1QATA 1UUSA 1SY9A 4QJ5B 3DF0B 2LVVA 2MJWB 1BG1A 2ZKMX 2JXLA 1L2OC 1YVLA 2L4IA 4UPGA 1EXRA 1PALA 1F4OA 4ORBB 1NSHA 1FI6A 2BCXA 2SASA 3MSEB 2OS8B 2NZ0A 3GK2A 3BUXB 1NWDA 2LMVA 3SJSA 4WQ2A 4NQGA 2L4HA 2LHLA 1S26D 2COLB 1JUOA 2EGDA 5KU1A 1B8CA 1IGVA 3OX5A 2FCDA 2FCEA 1K95A 4HREE 3LL8B 1K94A 1QIVA 1C07A 2LP3A 2WCEA 1M45A 3LLEA 2CCMA 1PSRA 4M2PA 1MF8B 1KFXS 1JWDA 1MR8A 3OB2B 1PSBA 1JSAA 2F2PA 3D10A 2PALA 2KBMA 1EG4A 2IS9A 3NSIA 2JC2A 1HQVA 3VGOA 1BODA 4TNCA 2LHIA 1J7QA 1CDMA 4F0ZB 2MA2A 1TOPA 2PMYA 1UHHA 4DCKA 1K90D 3EK8A 2LE9B 5I2LA 1V1FA 3JTDB 2LLSA 4MVFA 2F8PA 3WHUB 3TUYC 2K61A 2HQWA 2NLNA 1SCMC 2M9GA 1SL7A 5HYDA 2KFFA 2JRFA 2MLFC 1A4PA 1IRJA 1RTP1 2HETA 2VRGA 3BUOB 4I5LB 3BQ3A 4PE1A 2K7CA 5ER4X 1XFXO 2LC5A 2JU0A 2JTZA 3I5IC 2JQ6A 2JULA 3VRQA 2LUXA 1Y0VH 2I2RE 3KF9A 4YGDB 2I7AA 2FOTA 4GAOA 1KFUS 3TS5B 2A4JA 4XJKA 1WRZA 1MHOA 2Y5IA 4YI8A 3SG5A 2H61A 4OVNF 2EHBA 4N1FA 1V1GA 3EK7A 1YVHA 3DVEA 1B7TZ 1SL8A 3OHMB 4OV2A 3PN7B 1EJ3A 2H61C 2KYFA 2M7LA 2KYCA 1KWOB 3WNXB 1BMOA 4CFRA 5CSNA 1K9UA 2V53A 4QJ3B 5AEQA 2WC8A 1UURA 2O5GA 1XYDA 1DF0B 2M7NA 1J55A 1LA0A 4YI9A 2OPOA 1PRWA 1K9PA 2LM5A 3DVKA 2O60A 2P6BB 1L7ZA 4GPLB 1WY9A 5J3XA 3CR2A 1QS7A 2FJUB 4HSZA 2BBMA 2LVKA 4YGEB 2BKHB 1QTXA 1CMGA 1B8LA 1BU3A 3TDUA 4I5KA 1JC2A 4USLA 1DMOA 1YTZC 1OQPA 2SCPA 4P5OE 1MXEA 1B8RA 3DVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DJI A;  1Y1A A;  1CB1 A;  1JF0 A;  1YUU A;  2PSR A;  1KQM C;  3EVR A;  1YX7 A;  2KOT A;  1SR6 C;  2M29 A;  4GBA A;  1IG5 A;  3NSK A;  4QJ4 B;  3A4U B;  1CKK A;  3H4S E;  1CNP A;  2ZFD A;  1DJW A;  1WLM A;  2KQY A;  2EC6 C;  3TZ1 A;  4YGA A;  3SG2 A;  2K7O A;  2WOS A;  1F70 A;  2GGZ A;  1U5I A;  3O78 A;  4BY4 A;  2BBN A;  3SIB A;  1NX1 A;  2F3Z A;  1M63 B;  1SNL A;  1TNW A;  1A2X A;  2BCA A;  1SKT A;  2JT8 A;  5G08 A;  4GGF A;  1BLQ A;  1LIN A;  2WOR A;  1S5G Y;  2Q91 A;  1QV1 A;  1RK9 A;  1EL4 A;  4MZL A;  4YBH B;  1KK7 Y;  1NX3 A;  4I5J A;  2GV5 A;  2JNF A;  2Y1M A;  3I5H B;  3CR4 X;  4GGF C;  1UHI A;  1CFD A;  2LNK A;  2BL0 C;  2BE4 A;  1YUR A;  4OR9 B;  2L50 A;  3OX6 A;  4CID A;  1QIW A;  1X02 A;  5K89 A;  1CDL A;  3KO0 A;  2LLU A;  1C7W A;  1LVC D;  1SW8 A;  1DJX A;  2KI4 C;  2Y1N A;  1SYM A;  1C7V A;  4PHN A;  1FW4 A;  3QRX A;  4WQ3 A;  3AAK A;  1DJZ A;  2KAY A;  1WRK A;  3ICB A;  1REC A;  1IJ6 A;  2G2B A;  4MSP A;  4PE0 A;  2KGR A;  1RWY A;  3CR5 X;  1G4Y R;  2LAP A;  2M1U A;  3BOW B;  5HKY A;  1N2D A;  2KGB C;  3D0Y B;  4R1E A;  1WDC C;  2JXC A;  1KCY A;  1J7P A;  3NXA A;  3CTN A;  1CM4 A;  2KDH A;  1TNP A;  4PCW A;  3KHE A;  2ISD A;  5CSF A;  1L2O B;  2JT0 A;  3SG7 A;  1K8U A;  1QX7 A;  3EVU A;  4CPV A;  1B47 A;  1G8I A;  3KPX A;  1JBA A;  2BEC A;  1IH0 A;  1OSA A;  2JTT A;  4PHJ A;  1LA3 A;  1NCZ A;  1S36 A;  1E8A A;  3O4Y A;  3ZWH A;  3JVT C;  1KK8 C;  4A4B A;  1OZS A;  1CM1 A;  5DKR A;  1QVI Z;  1ZAC A;  2LLT A;  5KSZ A;  3HX4 A;  4ICB A;  3TDZ A;  1S6C A;  1OZO A;  5ER5 A;  2AUC A;  4GGN A;  2KNE A;  1J1E A;  3PM8 A;  1OMD A;  4XYN A;  1PVA A;  2B1U A;  2KFG A;  1CFC A;  1AJ4 A;  1Q80 A;  1S6J A;  1TN4 A;  5AAN A;  1NUB A;  4PE7 A;  1ZOT B;  1F71 A;  1UP5 A;  2MRD A;  5HKZ A;  4MZK A;  1RJV A;  2R2I A;  3I5G C;  1BF5 A;  4U8D A;  1BOC A;  1GGW A;  1H4B A;  4Q04 A;  4E68 A;  1JFK A;  1SBJ A;  3PLF B;  3NSL A;  1TIZ A;  4MZJ A;  1UHN A;  5GQQ C;  1K93 D;  2OTG C;  2JPT A;  3FS7 A;  1A29 A;  1FBV A;  3I5F C;  1LKJ A;  2ZND A;  2JNX A;  3TUY B;  1JF2 A;  4DUQ A;  1SCM B;  2Q4U A;  5CPV A;  5TNC A;  4JQ0 D;  1FI5 A;  2Y4Q A;  5I2Q A;  2F33 A;  1EH2 A;  2AAO A;  4BY5 A;  2ZNE A;  1NX2 A;  4AQI A;  1DJG A;  1F4Q A;  3NSO A;  1B1G A;  3KEV A;  2LVJ A;  1J7O A;  4YGB B;  3SG6 A;  2MBX A;  1UWO A;  3DD4 A;  1A75 A;  1J7R A;  3I5I B;  1NYA A;  4MRY A;  5JOL A;  4MLW A;  5BPJ A;  3EKH A;  2JOJ A;  1SK6 D;  2MAZ A;  3CWG A;  1MUX A;  1QX5 B;  4D1E A;  1K96 A;  3IQO A;  2L0P A;  2ZN9 A;  2M49 B;  1S1E A;  1FF1 A;  2PRU A;  4AOM A;  1F55 A;  4XJK B;  1XFU O;  3DF0 A;  4WRI A;  1F54 A;  2WCB A;  1ALW A;  2H2K A;  1KQV A;  1PUL A;  3GK4 X;  2LVI A;  3EK4 A;  1ALV A;  2ZRS A;  1CFF A;  1PVB A;  5DKQ A;  1IQ3 A;  4AQJ A;  1KSM A;  1DGU A;  2CBL A;  2MLE C;  4GUK A;  4CLN A;  3F45 A;  1DJH A;  1QXP A;  1LXF C;  5JJG A;  4P2Y B;  5HLV A;  2BKI B;  3WXA A;  1TCF A;  2OS8 C;  3VRR A;  1TRF A;  1M39 A;  1VRK A;  1NCX A;  4L9M A;  1NCY A;  2QAC A;  4NDD A;  2KSP A;  1N65 A;  1DTL A;  1OOJ A;  3CLN A;  1YUT A;  3IF7 A;  1NIW A;  3OB1 B;  1UHK A;  1ZUZ A;  1Y1U A;  2BE6 A;  4DIR A;  4N1G A;  2L5X B;  2E6W A;  2K2F A;  3LCP C;  1KQM B;  4PAL A;  4PHM A;  4C0L A;  2DOQ A;  1SR6 B;  1S5G Z;  2LUC A;  5KTY A;  4FQO A;  2KAX A;  4GNK B;  2EC6 B;  1KK7 Z;  3BUM B;  2NXQ A;  4YGC B;  2HPS A;  2G9B A;  2KQ6 A;  2M8U A;  1XVJ A;  2I18 A;  1W7I B;  1K2H A;  2K0J A;  3K21 A;  1XFV O;  2E30 A;  1K9K A;  1CDP A;  2BCB A;  2LMU A;  2RGI A;  1U5I B;  1B4C A;  3JTD C;  1SRA A;  1NP8 A;  2CTN A;  1XA5 A;  5CSJ A;  2M3W A;  3TDI A;  3VRP A;  4C0K A;  1IQ5 A;  4MEW A;  1EG3 A;  3DVM A;  1M31 A;  4JWQ A;  2M0R A;  4ETO A;  1BR1 B;  2BL0 B;  4JPZ B;  1Y1X A;  3CGA A;  3AKA A;  5D7F A;  4ZCV A;  1CFP A;  4N5X A;  3A8R A;  4M2Q A;  2CXJ A;  4HRG A;  1M46 A;  5PAL A;  4ORC B;  2TN4 A;  2JT3 A;  1BJF A;  1G33 A;  1BR4 B;  1WLZ A;  2NCO A;  2K7B A;  1MXL C;  1S3P A;  2NCP A;  1QJT A;  2KI4 B;  3C1V A;  1MWN A;  1H8B A;  1RRO A;  4NDC A;  3O6B A;  3TS5 C;  4CFQ A;  4YRU A;  5IBW A;  1D1O A;  1CLM A;  4PDZ A;  3M0W A;  1IWQ A;  1SMG A;  1QVI Y;  1F8H A;  2F2O A;  3LK1 A;  1KFX L;  4ZCU A;  2KI6 C;  1DT7 B;  3VRN A;  2LMT A;  1CDN A;  3VRO A;  1SPY A;  1XK4 A;  2M1K B;  1WDC B;  2LP2 A;  1CMF A;  1MQ1 A;  1OE9 B;  3PN7 C;  4GFT A;  1DF0 A;  1GGZ A;  2ZN8 A;  1KWO C;  2KBI A;  3EVV A;  3E3R A;  1AHR A;  1QAS A;  1FPW A;  1XK4 C;  2HF5 A;  1TCO B;  1ODB A;  3SG4 A;  2L2E A;  1XFZ O;  2KI6 D;  3HCM A;  3GOF A;  1ZMZ A;  2KFH A;  2CT9 A;  2F3Y A;  2LV7 A;  1AVS A;  2WCF A;  1DGV A;  1HT9 A;  5D69 A;  1B7T Y;  2MHH A;  3SIA A;  2I94 A;  3JVT B;  1KK8 B;  5FYX A;  1UHJ A;  1AJ5 A;  4I5N B;  4HRH A;  1XO5 A;  1NX0 A;  4NDB A;  5F6T A;  1QLK A;  5HKW A;  1YRU B;  3O2P A;  5DKN A;  5I8N A;  4MBE A;  4C0J A;  2CNP A;  2PVB A;  1CLL A;  1Y6W A;  1YX8 A;  3FWC A;  1CLB A;  4DRW A;  3IQQ A;  4IL1 A;  1KFU L;  1AK8 A;  1SL9 A;  2KHN A;  3BUW B;  1A03 A;  3PAT A;  3I5G B;  2AMI A;  3FWB A;  1IJ5 A;  2JWW A;  1OMR A;  5CSI A;  5AER A;  2HQ8 A;  1OMV A;  1TNQ A;  1GJY A;  1YRT B;  1J1D A;  2JZI A;  1ZFS A;  3CZT X;  4PHK A;  2OTG B;  3OP0 A;  4MRX A;  1AP4 A;  2L98 A;  3BUN B;  2M97 A;  3I5F B;  4MN0 A;  3GK1 A;  1BT6 A;  1QV0 A;  1N0Y A;  2WND A;  3CS1 A;  5I2O A;  1B9A A;  3BXK A;  5AFP A;  2L51 A;  1GQM A;  1DJY A;  2K7D A;  1DVI A;  2PAS A;  1YR5 A;  1IKU A;  2ZRT A;  4DS7 A;  3AAJ A;  3I5H C;  1JFJ A;  1PK0 D;  1S6I A;  3PFV A;  3PSR A;  4OCI A;  3RLZ A;  1AUI B;  3FIA A;  3ZNI A;  2QPT A;  1SCV A;  1NPQ A;  1R2U A;  1R6P A;  1XFW O;  3EKJ A;  4A4C A;  2KAV A;  1QLS A;  2GGM A;  3BYA A;  5HLO A;  1TTX A;  2D8N A;  4FTG A;  4M2O A;  2K8M B;  1YUS A;  3AKB A;  4PE4 A;  1QX2 A;  1A75 B;  1XFY O;  3BOW A;  4OKH A;  3WHT B;  3RM1 A;  3SG3 A;  3D0Y A;  3PAL A;  2LAN A;  1TNX A;  2LCP A;  5B8I B;  1CTR A;  1WRL A;  4ORA B;  1RFJ A;  2K2A A;  5AXI A;  1KSO A;  1W7J B;  3LK0 A;  1QAT A;  1UUS A;  1SY9 A;  4QJ5 B;  3DF0 B;  2LVV A;  2MJW B;  1BG1 A;  2ZKM X;  2JXL A;  1L2O C;  1YVL A;  2L4I A;  4UPG A;  1EXR A;  1PAL A;  1F4O A;  4ORB B;  1NSH A;  1FI6 A;  2BCX A;  2SAS A;  3MSE B;  2OS8 B;  2NZ0 A;  3GK2 A;  3BUX B;  1NWD A;  2LMV A;  3SJS A;  4WQ2 A;  4NQG A;  2L4H A;  2LHL A;  1S26 D;  2COL B;  1JUO A;  2EGD A;  5KU1 A;  1B8C A;  1IGV A;  3OX5 A;  2FCD A;  2FCE A;  1K95 A;  4HRE E;  3LL8 B;  1K94 A;  1QIV A;  1C07 A;  2LP3 A;  2WCE A;  1M45 A;  3LLE A;  2CCM A;  1PSR A;  4M2P A;  1MF8 B;  1KFX S;  1JWD A;  1MR8 A;  3OB2 B;  1PSB A;  1JSA A;  2F2P A;  3D10 A;  2PAL A;  2KBM A;  1EG4 A;  2IS9 A;  3NSI A;  2JC2 A;  1HQV A;  3VGO A;  1BOD A;  4TNC A;  2LHI A;  1J7Q A;  1CDM A;  4F0Z B;  2MA2 A;  1TOP A;  2PMY A;  1UHH A;  4DCK A;  1K90 D;  3EK8 A;  2LE9 B;  5I2L A;  1V1F A;  3JTD B;  2LLS A;  4MVF A;  2F8P A;  3WHU B;  3TUY C;  2K61 A;  2HQW A;  2NLN A;  1SCM C;  2M9G A;  1SL7 A;  5HYD A;  2KFF A;  2JRF A;  2MLF C;  1A4P A;  1IRJ A;  1RTP 1;  2HET A;  2VRG A;  3BUO B;  4I5L B;  3BQ3 A;  4PE1 A;  2K7C A;  5ER4 X;  1XFX O;  2LC5 A;  2JU0 A;  2JTZ A;  3I5I C;  2JQ6 A;  2JUL A;  3VRQ A;  2LUX A;  1Y0V H;  2I2R E;  3KF9 A;  4YGD B;  2I7A A;  2FOT A;  4GAO A;  1KFU S;  3TS5 B;  2A4J A;  4XJK A;  1WRZ A;  1MHO A;  2Y5I A;  4YI8 A;  3SG5 A;  2H61 A;  4OVN F;  2EHB A;  4N1F A;  1V1G A;  3EK7 A;  1YVH A;  3DVE A;  1B7T Z;  1SL8 A;  3OHM B;  4OV2 A;  3PN7 B;  1EJ3 A;  2H61 C;  2KYF A;  2M7L A;  2KYC A;  1KWO B;  3WNX B;  1BMO A;  4CFR A;  5CSN A;  1K9U A;  2V53 A;  4QJ3 B;  5AEQ A;  2WC8 A;  1UUR A;  2O5G A;  1XYD A;  1DF0 B;  2M7N A;  1J55 A;  1LA0 A;  4YI9 A;  2OPO A;  1PRW A;  1K9P A;  2LM5 A;  3DVK A;  2O60 A;  2P6B B;  1L7Z A;  4GPL B;  1WY9 A;  5J3X A;  3CR2 A;  1QS7 A;  2FJU B;  4HSZ A;  2BBM A;  2LVK A;  4YGE B;  2BKH B;  1QTX A;  1CMG A;  1B8L A;  1BU3 A;  3TDU A;  4I5K A;  1JC2 A;  4USL A;  1DMO A;  1YTZ C;  1OQP A;  2SCP A;  4P5O E;  1MXE A;  1B8R A;  3DVJ A; 
#chains in the Genus database with same CATH topology
 3B6X A;  4KYN A;  2K60 A;  3QME A;  1DJI A;  1Y1A A;  3R72 A;  1CB1 A;  1JF0 A;  1YUU A;  2PSR A;  1KQM C;  3EVR A;  1YX7 A;  2KOT A;  1SR6 C;  2M29 A;  3L4L A;  1IG5 A;  1QWV A;  3NSK A;  3A4U B;  4GBA A;  3H4S E;  2WCL A;  2ZFD A;  1DJW A;  1WLM A;  2KQY A;  2EC6 C;  3BJH A;  3TZ1 A;  4YGA A;  5D3O A;  3SG2 A;  2K7O A;  3PM2 A;  2WOS A;  1F70 A;  2GGZ A;  1U5I A;  3O78 A;  4BY4 A;  2BBN A;  3D78 A;  3SIB A;  1NX1 A;  2F3Z A;  1M63 B;  1SNL A;  1TNW A;  1A2X A;  2BCA A;  3BFH A;  1SKT A;  2JT8 A;  5G08 A;  4GGF A;  1BLQ A;  3N7H A;  1LIN A;  2WOR A;  1S5G Y;  2Q91 A;  1QV1 A;  3L4A A;  1RK9 A;  1EL4 A;  2BNX A;  4MZL A;  1KK7 Y;  1NX3 A;  4I5J A;  4YBH B;  2GV5 A;  2JNF A;  2Y1M A;  3I5H B;  3CR4 X;  4GGF C;  1UHI A;  1CFD A;  2LNK A;  3DY9 A;  2BL0 C;  2BE4 A;  3R1P A;  1YUR A;  4OR9 B;  2L50 A;  3OX6 A;  4CID A;  1QIW A;  1X02 A;  5K89 A;  1CDL A;  3KO0 A;  2LLU A;  1C7W A;  1LVC D;  1SW8 A;  1DJX A;  2KI4 C;  2GTE A;  2Y1N A;  1SYM A;  1C7V A;  4PHN A;  1FW4 A;  3QRX A;  4WQ3 A;  3AAK A;  1DJZ A;  2KAY A;  3VB1 A;  1WRK A;  3ICB A;  1REC A;  1IJ6 A;  2G2B A;  4MSP A;  4PE0 A;  2KGR A;  1RWY A;  2WCJ A;  1G4Y R;  3B7A A;  3CR5 X;  3SS3 A;  3B86 A;  2LAP A;  2M1U A;  3BOW B;  5HKY A;  1N2D A;  2KGB C;  3D0Y B;  2ERB A;  4R1E A;  3S0F A;  1WDC C;  2JXC A;  1KCY A;  1J7P A;  3NXA A;  3SS4 A;  2KPH A;  3CTN A;  1CM4 A;  5FI6 A;  2KDH A;  1TNP A;  4PCW A;  3KHE A;  2ISD A;  5CSF A;  1L2O B;  2JT0 A;  3SG7 A;  1C3Y A;  1K8U A;  1QX7 A;  3EVU A;  4CPV A;  1G8I A;  1B47 A;  3KPX A;  1JBA A;  2BEC A;  4INW A;  1IH0 A;  1OSA A;  2JTT A;  4PHJ A;  1LA3 A;  1NCZ A;  1S36 A;  1E8A A;  1LS8 A;  3O4Y A;  4FQT A;  3ZWH A;  3JVT C;  1KK8 C;  4A4B A;  1CNP A;  1OZS A;  1CM1 A;  2WCH A;  5DKR A;  1QVI Z;  3BFB A;  3V2L A;  1ZAC A;  2LLT A;  5KSZ A;  3HX4 A;  4ICB A;  3TDZ A;  1S6C A;  1OZO A;  5ER5 A;  2AUC A;  4GGN A;  2KNE A;  1J1E A;  3PM8 A;  1OMD A;  4XYN A;  3DZT A;  1PVA A;  1Z2C B;  2B1U A;  2KFG A;  1CFC A;  1AJ4 A;  1Q80 A;  1S6J A;  1TN4 A;  5AAN A;  1NUB A;  3L47 A;  4PE7 A;  1IIO A;  1ZOT B;  1F71 A;  1UP5 A;  2MRD A;  5HKZ A;  4MZK A;  1RJV A;  2R2I A;  3I5G C;  1BF5 A;  4U8D A;  1BOC A;  1GGW A;  1H4B A;  4Q04 A;  4E68 A;  1JFK A;  1SBJ A;  1W9Z A;  3PLF B;  3NSL A;  1TIZ A;  4MZJ A;  1UHN A;  5GQQ C;  1K93 D;  2OTG C;  2JPT A;  3FS7 A;  1A29 A;  4JKT A;  1FBV A;  3I5F C;  1LKJ A;  2ZND A;  2JNX A;  3TUY B;  2PYQ A;  1JF2 A;  4DUQ A;  1SCM B;  2Q4U A;  5CPV A;  5TNC A;  4JQ0 D;  1FI5 A;  2Y4Q A;  3FE8 A;  1TWO A;  5I2Q A;  2F33 A;  1EH2 A;  2AAO A;  4BY5 A;  2ZNE A;  1NX2 A;  1OW4 A;  1DJG A;  4AQI A;  1F4Q A;  3NSO A;  2P71 A;  1B1G A;  3KEV A;  2LVJ A;  1J7O A;  4YGB B;  1DQE A;  3SG6 A;  2MBX A;  1UWO A;  3DD4 A;  1A75 A;  1J7R A;  3I5I B;  1NYA A;  3NHT A;  4MRY A;  4MLW A;  5JOL A;  5BPJ A;  3EKH A;  2JOJ A;  1SK6 D;  2MAZ A;  3CWG A;  1MUX A;  1QX5 B;  4D1E A;  1K96 A;  3IQO A;  2L0P A;  1TUZ A;  2ZN9 A;  2M49 B;  1S1E A;  1FF1 A;  2PRU A;  4AOM A;  1F55 A;  4XJK B;  1XFU O;  3D77 A;  3DF0 A;  4WRI A;  1F54 A;  2WCB A;  1ALW A;  2H2K A;  1KQV A;  1PUL A;  3GK4 X;  2LVI A;  3EK4 A;  1ALV A;  2ZRS A;  1CFF A;  1PVB A;  5DKQ A;  1IQ3 A;  4AQJ A;  2BAP A;  1CKK A;  1KSM A;  1DGU A;  2CBL A;  3PJI A;  2MLE C;  4GUK A;  4CLN A;  3F45 A;  1DJH A;  1QXP A;  1LXF C;  2QEV A;  5JJG A;  4P2Y B;  3NHI A;  5HLV A;  2BKI B;  3WXA A;  1TCF A;  2OS8 C;  3VRR A;  1TRF A;  1OOF A;  3OBV A;  1M39 A;  1VRK A;  1NCX A;  2JPO A;  4L9M A;  1NCY A;  2QAC A;  4NDD A;  2KSP A;  1N65 A;  1DTL A;  2WC5 A;  1OOJ A;  3CLN A;  1YUT A;  3IF7 A;  1NIW A;  3K1E A;  3OB1 B;  1DEL A;  3DYE A;  1UHK A;  1ZUZ A;  1Y1U A;  2BE6 A;  4DIR A;  4N1G A;  2L5X B;  2E6W A;  2K2F A;  3LCP C;  1KQM B;  4PAL A;  4PHM A;  4C0L A;  2DOQ A;  1SR6 B;  1S5G Z;  2LUC A;  3BFA A;  5KTY A;  4FQO A;  2KAX A;  4GNK B;  2EC6 B;  1KK7 Z;  3BUM B;  2NXQ A;  3CYZ A;  2HPS A;  4YGC B;  2G9B A;  2KQ6 A;  2M8U A;  1XVJ A;  2I18 A;  1W7I B;  1K2H A;  2K0J A;  3K21 A;  1XFV O;  2E30 A;  1K9K A;  1CDP A;  2BCB A;  2LMU A;  2RGI A;  1U5I B;  1B4C A;  3JTD C;  1DC1 A;  1SRA A;  1NP8 A;  5EL2 A;  2CTN A;  1XA5 A;  5CSJ A;  2M3W A;  3TDI A;  3VRP A;  4C0K A;  1IQ5 A;  4MEW A;  2KLD A;  1EG3 A;  3DVM A;  3S0D A;  4JD9 A;  1M31 A;  4JWQ A;  2M0R A;  4ETO A;  1BR1 B;  2BL0 B;  4JPZ B;  1Y1X A;  3CGA A;  3AKA A;  5D7F A;  4ZCV A;  1CFP A;  1OOG A;  4N5X A;  3A8R A;  4M2Q A;  2CXJ A;  4HRG A;  1M46 A;  5PAL A;  4ORC B;  2TN4 A;  2JT3 A;  1BJF A;  1G33 A;  1BR4 B;  1WLZ A;  2NCO A;  2K7B A;  1MXL C;  1S3P A;  2NCP A;  1QJT A;  2KI4 B;  3C1V A;  1MWN A;  1H8B A;  1RRO A;  4NDC A;  3O6B A;  3TS5 C;  4CFQ A;  4YRU A;  5IBW A;  1D1O A;  1CLM A;  4PDZ A;  3M0W A;  1IWQ A;  1SMG A;  1QVI Y;  1F8H A;  2F2O A;  3LK1 A;  1KFX L;  4ZCU A;  2KI6 C;  4QJ4 B;  3VRN A;  2LMT A;  1DT7 B;  1CDN A;  3VRO A;  1SPY A;  1XK4 A;  2M1K B;  1WDC B;  2LP2 A;  1CMF A;  1MQ1 A;  1OE9 B;  3PN7 C;  4GFT A;  1DF0 A;  1GGZ A;  2ZN8 A;  1CMG A;  1KWO C;  1C3Z A;  2KBI A;  3EVV A;  3E3R A;  1AHR A;  1QAS A;  1FPW A;  2FJY A;  1XK4 C;  2HF5 A;  1TCO B;  1ODB A;  3SG4 A;  2L2E A;  1XFZ O;  2KI6 D;  3HCM A;  3GOF A;  1ZMZ A;  2KFH A;  2CT9 A;  3RZS A;  2F3Y A;  2LV7 A;  1AVS A;  2WCF A;  1DGV A;  1HT9 A;  5D69 A;  1B7T Y;  2MHH A;  3SIA A;  2I94 A;  3JVT B;  1KK8 B;  5FYX A;  1UHJ A;  1AJ5 A;  4I5N B;  1GM0 A;  4HRH A;  1XO5 A;  1NX0 A;  4NDB A;  5F6T A;  1QLK A;  3OGN A;  1YRU B;  3O2P A;  5DKN A;  5HKW A;  3S0B A;  4MBE A;  4C0J A;  5I8N A;  2CNP A;  2PVB A;  1CLL A;  1Y6W A;  1YX8 A;  3FWC A;  1CLB A;  4DRW A;  3IQQ A;  4IL1 A;  1T14 A;  1KFU L;  1AK8 A;  4OZD A;  1SL9 A;  2KHN A;  3BUW B;  1A03 A;  3PAT A;  3I5G B;  2AMI A;  3FWB A;  3D73 A;  1IJ5 A;  2JWW A;  1OMR A;  5CSI A;  5AER A;  2HQ8 A;  1OMV A;  1TNQ A;  1GJY A;  1YRT B;  1J1D A;  2JZI A;  1ZFS A;  3CZT X;  4PHK A;  2OTG B;  3FE9 A;  3O4X A;  3OP0 A;  4MRX A;  1AP4 A;  2L98 A;  3BUN B;  2M97 A;  3I5F B;  4MN0 A;  3GK1 A;  1BT6 A;  1QV0 A;  1N0Y A;  2WND A;  3CS1 A;  5I2O A;  1B9A A;  3BXK A;  5AFP A;  2L51 A;  2H8V A;  1GQM A;  1DJY A;  2K7D A;  1DVI A;  1ORG A;  2PAS A;  3D75 A;  1YR5 A;  1IKU A;  2ZRT A;  4DS7 A;  3AAJ A;  3I5H C;  1JFJ A;  2KLE A;  5FI7 A;  1PK0 D;  1S6I A;  3PFV A;  3PSR A;  3D76 A;  4OCI A;  3RLZ A;  1AUI B;  3FIA A;  3ZNI A;  2QPT A;  2L2C A;  1SCV A;  1NPQ A;  1R2U A;  1R6P A;  1XFW O;  3EKJ A;  4A4C A;  2WCK A;  2KAV A;  2YGU A;  1QLS A;  2GGM A;  3BYA A;  5HLO A;  1TTX A;  2D8N A;  4FTG A;  4M2O A;  2K8M B;  1YUS A;  3AKB A;  4PE4 A;  3UO9 A;  1QX2 A;  1A75 B;  4F7F A;  1XFY O;  3BOW A;  4OKH A;  3WHT B;  3RM1 A;  3SG3 A;  3D0Y A;  3R1V A;  3B88 A;  3PAL A;  2LAN A;  1TNX A;  2LCP A;  5B8I B;  3CZ1 A;  1CTR A;  1WRL A;  3CZ0 A;  4ORA B;  1RFJ A;  2L5Y A;  2K2A A;  5AXI A;  1XFR A;  1KSO A;  1W7J B;  3LK0 A;  1QAT A;  1UUS A;  1SY9 A;  4QJ5 B;  3DF0 B;  2LVV A;  5HL1 A;  2MJW B;  1BG1 A;  2ZKM X;  2JXL A;  1L2O C;  1YVL A;  2L4I A;  4UPG A;  1EXR A;  1PAL A;  1F4O A;  4ORB B;  1NSH A;  1FI6 A;  1P28 A;  2BCX A;  1OOI X;  2SAS A;  3MSE B;  2OS8 B;  2NZ0 A;  3GK2 A;  3SS5 A;  5I94 A;  3BUX B;  1NWD A;  2LMV A;  3SJS A;  4WQ2 A;  4NQG A;  2L4H A;  2LHL A;  1S26 D;  2COL B;  1JUO A;  2EGD A;  5KU1 A;  1OOH A;  1B8C A;  1IGV A;  3OX5 A;  1DEK A;  2FCD A;  2FCE A;  1K95 A;  4HRE E;  3LL8 B;  1K94 A;  1QIV A;  1C07 A;  2LP3 A;  2WCE A;  1M45 A;  3D74 A;  3LLE A;  2CCM A;  1PSR A;  4M2P A;  1MF8 B;  1KFX S;  1JWD A;  1MR8 A;  3OB2 B;  1PSB A;  1JSA A;  2F2P A;  3D10 A;  2PAL A;  2KBM A;  3B87 A;  1EG4 A;  2IS9 A;  3NSI A;  2JC2 A;  1HQV A;  3VGO A;  1BOD A;  4TNC A;  2LHI A;  1J7Q A;  1CDM A;  4F0Z B;  2MA2 A;  1TOP A;  2PMY A;  1UHH A;  4DCK A;  1K90 D;  3EK8 A;  2LE9 B;  5I2L A;  1V1F A;  3JTD B;  2LLS A;  4MVF A;  2F8P A;  3WHU B;  3TUY C;  2K61 A;  2HQW A;  4PT1 A;  2NLN A;  1SCM C;  2M9G A;  1SL7 A;  5HYD A;  2KFF A;  2JRF A;  2MLF C;  1A4P A;  1IRJ A;  1RTP 1;  2HET A;  3Q8I A;  2VRG A;  3CAB A;  3BUO B;  3S0E A;  4I5L B;  3BQ3 A;  4PE1 A;  3UNW A;  2QEO A;  2K7C A;  5ER4 X;  1XFX O;  2LC5 A;  3DXL A;  3CZ2 A;  2JU0 A;  2JTZ A;  3I5I C;  1SSE B;  2JQ6 A;  2JUL A;  4IJ7 A;  3VRQ A;  2LUX A;  1TUJ A;  1Y0V H;  2I2R E;  3KF9 A;  4YGD B;  2I7A A;  2FOT A;  4GAO A;  1KFU S;  3TS5 B;  3S0A A;  2A4J A;  4XJK A;  1WRZ A;  5DIC A;  1MHO A;  2Y5I A;  4YI8 A;  3SG5 A;  2H61 A;  4OVN F;  2EHB A;  4N1F A;  2QEB A;  3R1O A;  1V1G A;  3EK7 A;  1YVH A;  3NGV A;  3DVE A;  1B7T Z;  1SL8 A;  3OHM B;  4OV2 A;  3CDN A;  3PN7 B;  2QDI A;  1EJ3 A;  2H61 C;  2KYF A;  2M7L A;  2KYC A;  1KWO B;  3WNX B;  1BMO A;  2QEH A;  4INX A;  4CFR A;  5CSN A;  1K9U A;  2V53 A;  4QJ3 B;  5AEQ A;  2WC8 A;  1UUR A;  2O5G A;  2WCM A;  1XYD A;  2P70 A;  1DF0 B;  2M7N A;  1J55 A;  1LA0 A;  4YI9 A;  2OPO A;  1PRW A;  1K9P A;  2LM5 A;  3DVK A;  2O60 A;  2P6B B;  1L7Z A;  4GPL B;  2PQL A;  1WY9 A;  3EG5 B;  3S0G A;  5J3X A;  3CR2 A;  3IVT A;  1QS7 A;  2FJU B;  4HSZ A;  2BBM A;  2LVK A;  3FE6 A;  2BKH B;  1QTX A;  4YGE B;  1B8L A;  1BU3 A;  2WC6 A;  4I5K A;  5FI2 A;  3TDU A;  1JC2 A;  4USL A;  1DMO A;  1YTZ C;  1OQP A;  2SCP A;  4P5O E;  1Z4H A;  1MXE A;  1B8R A;  3DVJ A; 
#chains in the Genus database with same CATH homology
 1DJI A;  1Y1A A;  1CB1 A;  1JF0 A;  1YUU A;  2PSR A;  1KQM C;  3EVR A;  1YX7 A;  2KOT A;  1SR6 C;  2M29 A;  4GBA A;  1IG5 A;  3NSK A;  4QJ4 B;  3A4U B;  1CKK A;  3H4S E;  1CNP A;  2ZFD A;  1DJW A;  1WLM A;  2KQY A;  2EC6 C;  3TZ1 A;  4YGA A;  3SG2 A;  2K7O A;  2WOS A;  1F70 A;  2GGZ A;  1U5I A;  3O78 A;  4BY4 A;  2BBN A;  3SIB A;  1NX1 A;  2F3Z A;  1M63 B;  1SNL A;  1TNW A;  1A2X A;  2BCA A;  1SKT A;  2JT8 A;  5G08 A;  4GGF A;  1BLQ A;  1LIN A;  2WOR A;  1S5G Y;  2Q91 A;  1QV1 A;  1RK9 A;  1EL4 A;  4MZL A;  4YBH B;  1KK7 Y;  1NX3 A;  4I5J A;  2GV5 A;  2JNF A;  2Y1M A;  3I5H B;  3CR4 X;  4GGF C;  1UHI A;  1CFD A;  2LNK A;  2BL0 C;  2BE4 A;  1YUR A;  4OR9 B;  2L50 A;  3OX6 A;  4CID A;  1QIW A;  1X02 A;  5K89 A;  1CDL A;  3KO0 A;  2LLU A;  1C7W A;  1LVC D;  1SW8 A;  1DJX A;  2KI4 C;  2Y1N A;  1SYM A;  1C7V A;  4PHN A;  1FW4 A;  3QRX A;  4WQ3 A;  3AAK A;  1DJZ A;  2KAY A;  1WRK A;  3ICB A;  1REC A;  1IJ6 A;  2G2B A;  4MSP A;  4PE0 A;  2KGR A;  1RWY A;  3CR5 X;  1G4Y R;  2LAP A;  2M1U A;  3BOW B;  5HKY A;  1N2D A;  2KGB C;  3D0Y B;  4R1E A;  1WDC C;  2JXC A;  1KCY A;  1J7P A;  3NXA A;  3CTN A;  1CM4 A;  2KDH A;  1TNP A;  4PCW A;  3KHE A;  2ISD A;  5CSF A;  1L2O B;  2JT0 A;  3SG7 A;  1K8U A;  1QX7 A;  3EVU A;  4CPV A;  1B47 A;  1G8I A;  3KPX A;  1JBA A;  2BEC A;  1IH0 A;  1OSA A;  2JTT A;  4PHJ A;  1LA3 A;  1NCZ A;  1S36 A;  1E8A A;  3O4Y A;  3ZWH A;  3JVT C;  1KK8 C;  4A4B A;  1OZS A;  1CM1 A;  5DKR A;  1QVI Z;  1ZAC A;  2LLT A;  5KSZ A;  3HX4 A;  4ICB A;  3TDZ A;  1S6C A;  1OZO A;  5ER5 A;  2AUC A;  4GGN A;  2KNE A;  1J1E A;  3PM8 A;  1OMD A;  4XYN A;  1PVA A;  2B1U A;  2KFG A;  1CFC A;  1AJ4 A;  1Q80 A;  1S6J A;  1TN4 A;  5AAN A;  1NUB A;  4PE7 A;  1ZOT B;  1F71 A;  1UP5 A;  2MRD A;  5HKZ A;  4MZK A;  1RJV A;  2R2I A;  3I5G C;  1BF5 A;  4U8D A;  1BOC A;  1GGW A;  1H4B A;  4Q04 A;  4E68 A;  1JFK A;  1SBJ A;  3PLF B;  3NSL A;  1TIZ A;  4MZJ A;  1UHN A;  5GQQ C;  1K93 D;  2OTG C;  2JPT A;  3FS7 A;  1A29 A;  1FBV A;  3I5F C;  1LKJ A;  2ZND A;  2JNX A;  3TUY B;  1JF2 A;  4DUQ A;  1SCM B;  2Q4U A;  5CPV A;  5TNC A;  4JQ0 D;  1FI5 A;  2Y4Q A;  5I2Q A;  2F33 A;  1EH2 A;  2AAO A;  4BY5 A;  2ZNE A;  1NX2 A;  4AQI A;  1DJG A;  1F4Q A;  3NSO A;  1B1G A;  3KEV A;  2LVJ A;  1J7O A;  4YGB B;  3SG6 A;  2MBX A;  1UWO A;  3DD4 A;  1A75 A;  1J7R A;  3I5I B;  1NYA A;  4MRY A;  5JOL A;  4MLW A;  5BPJ A;  3EKH A;  2JOJ A;  1SK6 D;  2MAZ A;  3CWG A;  1MUX A;  1QX5 B;  4D1E A;  1K96 A;  3IQO A;  2L0P A;  2ZN9 A;  2M49 B;  1S1E A;  1FF1 A;  2PRU A;  4AOM A;  1F55 A;  4XJK B;  1XFU O;  3DF0 A;  4WRI A;  1F54 A;  2WCB A;  1ALW A;  2H2K A;  1KQV A;  1PUL A;  3GK4 X;  2LVI A;  3EK4 A;  1ALV A;  2ZRS A;  1CFF A;  1PVB A;  5DKQ A;  1IQ3 A;  4AQJ A;  1KSM A;  1DGU A;  2CBL A;  2MLE C;  4GUK A;  4CLN A;  3F45 A;  1DJH A;  1QXP A;  1LXF C;  5JJG A;  4P2Y B;  5HLV A;  2BKI B;  3WXA A;  1TCF A;  2OS8 C;  3VRR A;  1TRF A;  1M39 A;  1VRK A;  1NCX A;  4L9M A;  1NCY A;  2QAC A;  4NDD A;  2KSP A;  1N65 A;  1DTL A;  1OOJ A;  3CLN A;  1YUT A;  3IF7 A;  1NIW A;  3OB1 B;  1UHK A;  1ZUZ A;  1Y1U A;  2BE6 A;  4DIR A;  4N1G A;  2L5X B;  2E6W A;  2K2F A;  3LCP C;  1KQM B;  4PAL A;  4PHM A;  4C0L A;  2DOQ A;  1SR6 B;  1S5G Z;  2LUC A;  5KTY A;  4FQO A;  2KAX A;  4GNK B;  2EC6 B;  1KK7 Z;  3BUM B;  2NXQ A;  4YGC B;  2HPS A;  2G9B A;  2KQ6 A;  2M8U A;  1XVJ A;  2I18 A;  1W7I B;  1K2H A;  2K0J A;  3K21 A;  1XFV O;  2E30 A;  1K9K A;  1CDP A;  2BCB A;  2LMU A;  2RGI A;  1U5I B;  1B4C A;  3JTD C;  1SRA A;  1NP8 A;  2CTN A;  1XA5 A;  5CSJ A;  2M3W A;  3TDI A;  3VRP A;  4C0K A;  1IQ5 A;  4MEW A;  1EG3 A;  3DVM A;  1M31 A;  4JWQ A;  2M0R A;  4ETO A;  1BR1 B;  2BL0 B;  4JPZ B;  1Y1X A;  3CGA A;  3AKA A;  5D7F A;  4ZCV A;  1CFP A;  4N5X A;  3A8R A;  4M2Q A;  2CXJ A;  4HRG A;  1M46 A;  5PAL A;  4ORC B;  2TN4 A;  2JT3 A;  1BJF A;  1G33 A;  1BR4 B;  1WLZ A;  2NCO A;  2K7B A;  1MXL C;  1S3P A;  2NCP A;  1QJT A;  2KI4 B;  3C1V A;  1MWN A;  1H8B A;  1RRO A;  4NDC A;  3O6B A;  3TS5 C;  4CFQ A;  4YRU A;  5IBW A;  1D1O A;  1CLM A;  4PDZ A;  3M0W A;  1IWQ A;  1SMG A;  1QVI Y;  1F8H A;  2F2O A;  3LK1 A;  1KFX L;  4ZCU A;  2KI6 C;  1DT7 B;  3VRN A;  2LMT A;  1CDN A;  3VRO A;  1SPY A;  1XK4 A;  2M1K B;  1WDC B;  2LP2 A;  1CMF A;  1MQ1 A;  1OE9 B;  3PN7 C;  4GFT A;  1DF0 A;  1GGZ A;  2ZN8 A;  1KWO C;  2KBI A;  3EVV A;  3E3R A;  1AHR A;  1QAS A;  1FPW A;  1XK4 C;  2HF5 A;  1TCO B;  1ODB A;  3SG4 A;  2L2E A;  1XFZ O;  2KI6 D;  3HCM A;  3GOF A;  1ZMZ A;  2KFH A;  2CT9 A;  2F3Y A;  2LV7 A;  1AVS A;  2WCF A;  1DGV A;  1HT9 A;  5D69 A;  1B7T Y;  2MHH A;  3SIA A;  2I94 A;  3JVT B;  1KK8 B;  5FYX A;  1UHJ A;  1AJ5 A;  4I5N B;  4HRH A;  1XO5 A;  1NX0 A;  4NDB A;  5F6T A;  1QLK A;  5HKW A;  1YRU B;  3O2P A;  5DKN A;  5I8N A;  4MBE A;  4C0J A;  2CNP A;  2PVB A;  1CLL A;  1Y6W A;  1YX8 A;  3FWC A;  1CLB A;  4DRW A;  3IQQ A;  4IL1 A;  1KFU L;  1AK8 A;  1SL9 A;  2KHN A;  3BUW B;  1A03 A;  3PAT A;  3I5G B;  2AMI A;  3FWB A;  1IJ5 A;  2JWW A;  1OMR A;  5CSI A;  5AER A;  2HQ8 A;  1OMV A;  1TNQ A;  1GJY A;  1YRT B;  1J1D A;  2JZI A;  1ZFS A;  3CZT X;  4PHK A;  2OTG B;  3OP0 A;  4MRX A;  1AP4 A;  2L98 A;  3BUN B;  2M97 A;  3I5F B;  4MN0 A;  3GK1 A;  1BT6 A;  1QV0 A;  1N0Y A;  2WND A;  3CS1 A;  5I2O A;  1B9A A;  3BXK A;  5AFP A;  2L51 A;  1GQM A;  1DJY A;  2K7D A;  1DVI A;  2PAS A;  1YR5 A;  1IKU A;  2ZRT A;  4DS7 A;  3AAJ A;  3I5H C;  1JFJ A;  1PK0 D;  1S6I A;  3PFV A;  3PSR A;  4OCI A;  3RLZ A;  1AUI B;  3FIA A;  3ZNI A;  2QPT A;  1SCV A;  1NPQ A;  1R2U A;  1R6P A;  1XFW O;  3EKJ A;  4A4C A;  2KAV A;  1QLS A;  2GGM A;  3BYA A;  5HLO A;  1TTX A;  2D8N A;  4FTG A;  4M2O A;  2K8M B;  1YUS A;  3AKB A;  4PE4 A;  1QX2 A;  1A75 B;  1XFY O;  3BOW A;  4OKH A;  3WHT B;  3RM1 A;  3SG3 A;  3D0Y A;  3PAL A;  2LAN A;  1TNX A;  2LCP A;  5B8I B;  1CTR A;  1WRL A;  4ORA B;  1RFJ A;  2K2A A;  5AXI A;  1KSO A;  1W7J B;  3LK0 A;  1QAT A;  1UUS A;  1SY9 A;  4QJ5 B;  3DF0 B;  2LVV A;  2MJW B;  1BG1 A;  2ZKM X;  2JXL A;  1L2O C;  1YVL A;  2L4I A;  4UPG A;  1EXR A;  1PAL A;  1F4O A;  4ORB B;  1NSH A;  1FI6 A;  2BCX A;  2SAS A;  3MSE B;  2OS8 B;  2NZ0 A;  3GK2 A;  3BUX B;  1NWD A;  2LMV A;  3SJS A;  4WQ2 A;  4NQG A;  2L4H A;  2LHL A;  1S26 D;  2COL B;  1JUO A;  2EGD A;  5KU1 A;  1B8C A;  1IGV A;  3OX5 A;  2FCD A;  2FCE A;  1K95 A;  4HRE E;  3LL8 B;  1K94 A;  1QIV A;  1C07 A;  2LP3 A;  2WCE A;  1M45 A;  3LLE A;  2CCM A;  1PSR A;  4M2P A;  1MF8 B;  1KFX S;  1JWD A;  1MR8 A;  3OB2 B;  1PSB A;  1JSA A;  2F2P A;  3D10 A;  2PAL A;  2KBM A;  1EG4 A;  2IS9 A;  3NSI A;  2JC2 A;  1HQV A;  3VGO A;  1BOD A;  4TNC A;  2LHI A;  1J7Q A;  1CDM A;  4F0Z B;  2MA2 A;  1TOP A;  2PMY A;  1UHH A;  4DCK A;  1K90 D;  3EK8 A;  2LE9 B;  5I2L A;  1V1F A;  3JTD B;  2LLS A;  4MVF A;  2F8P A;  3WHU B;  3TUY C;  2K61 A;  2HQW A;  2NLN A;  1SCM C;  2M9G A;  1SL7 A;  5HYD A;  2KFF A;  2JRF A;  2MLF C;  1A4P A;  1IRJ A;  1RTP 1;  2HET A;  2VRG A;  3BUO B;  4I5L B;  3BQ3 A;  4PE1 A;  2K7C A;  5ER4 X;  1XFX O;  2LC5 A;  2JU0 A;  2JTZ A;  3I5I C;  2JQ6 A;  2JUL A;  3VRQ A;  2LUX A;  1Y0V H;  2I2R E;  3KF9 A;  4YGD B;  2I7A A;  2FOT A;  4GAO A;  1KFU S;  3TS5 B;  2A4J A;  4XJK A;  1WRZ A;  1MHO A;  2Y5I A;  4YI8 A;  3SG5 A;  2H61 A;  4OVN F;  2EHB A;  4N1F A;  1V1G A;  3EK7 A;  1YVH A;  3DVE A;  1B7T Z;  1SL8 A;  3OHM B;  4OV2 A;  3PN7 B;  1EJ3 A;  2H61 C;  2KYF A;  2M7L A;  2KYC A;  1KWO B;  3WNX B;  1BMO A;  4CFR A;  5CSN A;  1K9U A;  2V53 A;  4QJ3 B;  5AEQ A;  2WC8 A;  1UUR A;  2O5G A;  1XYD A;  1DF0 B;  2M7N A;  1J55 A;  1LA0 A;  4YI9 A;  2OPO A;  1PRW A;  1K9P A;  2LM5 A;  3DVK A;  2O60 A;  2P6B B;  1L7Z A;  4GPL B;  1WY9 A;  5J3X A;  3CR2 A;  1QS7 A;  2FJU B;  4HSZ A;  2BBM A;  2LVK A;  4YGE B;  2BKH B;  1QTX A;  1CMG A;  1B8L A;  1BU3 A;  3TDU A;  4I5K A;  1JC2 A;  4USL A;  1DMO A;  1YTZ C;  1OQP A;  2SCP A;  4P5O E;  1MXE A;  1B8R A;  3DVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...