1UHIA

Crystal structure of i-aequorin
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
191
structure length
191
Chain Sequence
ANSKLTSDFDNPRWIGRHKHMFNFLDVNHNGKISLDEMVYKASDIVINNLGATPEQAKRHKDAVEAFFGGAGMKYGVETDWPAYIEGWKKLATDELEKYAKNEPTLIRIWGDALFDIVDKDQNGAITLDEWKAYTKAAGIIQSSEDCEETFRVCDIDESGQLDVDEMTRQHLGFWYTMDPACEKLYGGAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aequorin 2
publication title The crystal structures of semi-synthetic aequorins
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Luminescent protein
total genus 70
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1uhiA00
3OB1B 4GGNA 1MWNA 2JT8A 3PSRA 1A29A 1NX3A 1WRKA 3VRRA 3OP0A 3JTDC 3GK1A 1F54A 3I5GB 3O6BA 3TS5C 1NP8A 4DS7A 1EJ3A 1XFXO 4N1GA 3AKBA 3ZNIA 4QJ5B 3I5FC 2KFFA 1U5IA 2M49B 4MSPA 3CWGA 1IQ5A 2GGZA 1PVBA 1LKJA 2MHHA 5ER5A 5DKQA 1AP4A 1VRKA 3EVRA 1AJ5A 2L4HA 5CSFA 4HRGA 1H8BA 2BCAA 1PULA 3BOWB 3DF0B 3JVTC 1B8RA 1F4QA 4R1EA 4PE1A 3CZTX 1Y0VH 4N5XA 3D10A 2NXQA 2QACA 2DOQA 1KK7Y 1CKKA 2KAVA 2JRFA 1QS7A 2BKHB 1K9UA 1YVLA 4QJ4B 5ER4X 2M0RA 1IKUA 1F8HA 3IF7A 1OZOA 1S6CA 3OHMB 1KK8C 1J7OA 1S3PA 3DVKA 1SYMA 1K90D 1J7RA 4NDBA 2AUCA 3BUOB 4CIDA 2ZNEA 1TRFA 1LVCD 1DJIA 2P6BB 2CT9A 1FW4A 2R2IA 1JUOA 1KFXS 3I5GC 2LLUA 4ORBB 4F0ZB 1SRAA 4PALA 1WLZA 2H2KA 4MEWA 1Y1XA 1IJ6A 1KSMA 5CPVA 3BOWA 1YX7A 1PSRA 3DF0A 3EK8A 4PHNA 1K8UA 4JQ0D 4MVFA 1BODA 1B47A 1V1FA 3SG4A 4AQJA 1A2XA 4DCKA 1SBJA 1DF0B 4YGAA 4PE7A 1K9KA 2JPTA 1DT7B 1RK9A 1S6IA 5D69A 4MRYA 2KGRA 2KOTA 2PVBA 1ALVA 2F3YA 3SG2A 1PRWA 2LUCA 1LXFC 1Y6WA 2ZFDA 1QX5B 1TTXA 1ZOTB 5HKZA 5HLVA 2M7LA 3TS5B 1OMVA 4PHKA 1XVJA 1LA0A 4C0KA 3CGAA 1XK4A 1KSOA 1A4PA 1M46A 3SG3A 1QIWA 1XK4C 1PVAA 1RWYA 2EC6C 1MQ1A 1QX2A 4JPZB 1CDLA 2JULA 1QLKA 1YUTA 1B7TY 2GGMA 5FYXA 1YUSA 2LC5A 1GGWA 3E3RA 4P2YB 5G08A 4YGCB 2JOJA 2Y5IA 2M1UA 1CLBA 1QVIY 3SG5A 2I7AA 2LMVA 2KI4B 1ZUZA 4CFQA 3PM8A 2LHIA 2I2RE 1NYAA 2BL0B 4YBHB 1DF0A 2BBMA 1WY9A 3DVEA 3FWBA 1SKTA 4P5OE 5PALA 1MXLC 3QRXA 1F4OA 1CB1A 3PALA 4BY5A 1V1GA 1E8AA 1SL7A 1SL8A 2K61A 2K8MB 3EK4A 1JSAA 1OE9B 1M31A 2LM5A 3IQQA 1BR1B 1CLLA 3OX6A 1SW8A 2BE6A 3A4UB 1IG5A 1B8CA 3VROA 2LVJA 1IGVA 1N2DA 2L5XB 4UPGA 1CDMA 1QV0A 1IQ3A 1G8IA 3HCMA 2KQ6A 2PALA 4I5LB 4WQ3A 3WNXB 1BLQA 1H4BA 4FTGA 5AFPA 1SMGA 2L51A 2AAOA 2HQ8A 5B8IB 3TZ1A 3NSKA 1CLMA 4CPVA 3PATA 3EK7A 4GAOA 2GV5A 2WORA 2M8UA 1G4YR 1K95A 1WLMA 1L7ZA 3M0WA 2JXCA 2K7CA 2LV7A 2M9GA 1CM1A 1KWOB 2CBLA 1UHKA 2CTNA 1XFWO 1KK7Z 3LL8B 1MF8B 4WQ2A 1RFJA 2BE4A 2JNFA 5I2LA 2JWWA 4YI8A 1AK8A 3VRPA 3WHTB 1XFYO 4ETOA 2FJUB 2TN4A 1S6JA 1CDNA 2IS9A 1AHRA 2ZRSA 3TDIA 2KI4C 1TNWA 4MZKA 1TNQA 2BL0C 2ZKMX 3TUYB 2E30A 1JFKA 2A4JA 4U8DA 1ZMZA 1SPYA 2KAXA 4ORCB 3BYAA 1UUSA 1DMOA 1UHIA 2LLSA 1SL9A 5CSIA 1OQPA 2KFHA 1K93D 3ICBA 2EC6B 3SJSA 4N1FA 1MUXA 1WDCB 2SASA 1BU3A 1N65A 2M29A 5AXIA 3O78A 2JTZA 3PFVA 1CFCA 4GNKB 1QIVA 1SCVA 2LCPA 2O5GA 1NWDA 4Q04A 1EH2A 3NSOA 1DJWA 4OR9B 4DIRA 2L0PA 1BJFA 2KYFA 1OMRA 2Y1MA 2OS8C 1FPWA 1YURA 2L98A 1YRTB 2I94A 1BMOA 4OKHA 1KWOC 2V53A 4YRUA 5HKWA 3BUMB 5GQQC 2ZNDA 2MBXA 1DJZA 2F2PA 2WCFA 2ZRTA 2F2OA 4XJKB 4A4CA 1Q80A 2KNEA 1CMFA 1DGUA 1AUIB 1K9PA 1L2OB 3I5HC 1YVHA 4MBEA 3CR5X 1N0YA 1FI6A 1C7WA 4YGDB 1W7JB 1W7IB 2E6WA 1SCMB 4OVNF 3VRQA 2WC8A 5HLOA 1G33A 4XYNA 4DRWA 3TUYC 2KYCA 1CFDA 2BCXA 1UHJA 1XFUO 1B9AA 1NX0A 1B1GA 2VRGA 2L2EA 2LHLA 5KTYA 1TNPA 1RECA 1DJXA 2F8PA 1B7TZ 2O60A 3TDUA 2JT0A 2K2FA 1WRLA 1YUUA 4C0LA 2KI6D 2ZN9A 5JJGA 1WDCC 4GPLB 2K7BA 1EL4A 2K2AA 4MRXA 5AANA 5KSZA 1EXRA 1SK6D 1QLSA 4PE4A 2M7NA 3GK4X 3NSLA 1QVIZ 1IH0A 2ZN8A 2QPTA 3NXAA 1J1DA 3OX5A 4HRHA 4CLNA 2M1KB 1SR6C 1UURA 2HPSA 2KAYA 2M3WA 4GBAA 5HYDA 1JBAA 4NDDA 1J7PA 5J3XA 1CNPA 4PDZA 4XJKA 1DJYA 3A8RA 1TCOB 1XO5A 2MAZA 1CDPA 4DUQA 2F3ZA 3DVMA 2PSRA 4OV2A 1QV1A 4D1EA 3CS1A 4ICBA 2BCBA 2LP3A 1OMDA 3EVVA 4NQGA 1PALA 3FIAA 2D8NA 1L2OC 1KQVA 2WCEA 3I5IB 2OPOA 3RM1A 2HETA 2Q4UA 1SCMC 4MZJA 5JOLA 4C0JA 5I2OA 1B4CA 1FF1A 4A4BA 2L4IA 3KF9A 1QJTA 2KGBC 3CR2A 1TOPA 2KDHA 1HQVA 5BPJA 2LNKA 1UWOA 5TNCA 2LUXA 1ZFSA 2WCBA 3KEVA 1RROA 1SY9A 1UP5A 1J7QA 1IWQA 1NUBA 1TNXA 2LLTA 1DGVA 2Q91A 1QXPA 2JT3A 2MRDA 2OS8B 3C1VA 2LMTA 4HSZA 4PE0A 5CSNA 2KFGA 1KFUL 1A75B 1DJGA 3WHUB 3NSIA 1YRUB 1R6PA 4YI9A 2Y4QA 2KQYA 3VGOA 5IBWA 2HQWA 1Y1UA 3EKHA 5D7FA 1JF2A 4L9MA 1S5GY 1TN4A 1EG4A 2KHNA 4ORAB 2PRUA 3I5HB 1DVIA 3LK1A 4OCIA 1QATA 3AAJA 1M45A 1F55A 2LE9B 2MLEC 2K7OA 2FOTA 1KFXL 2LVIA 2MJWB 2FCEA 1CFPA 1KQMB 4GGFA 3LK0A 4PHMA 1JF0A 2NZ0A 2H61A 1S1EA 3ZWHA 1ALWA 1OZSA 4MLWA 3PN7C 2JZIA 1JWDA 2MLFC 4GGFC 4YGBB 2BKIB 1LA3A 1BF5A 3CLNA 2H61C 4USLA 3D0YB 1K96A 3I5IC 2CNPA 4GFTA 1BOCA 3K21A 1Y1AA 3VRNA 1NIWA 2JNXA 4HREE 5DKNA 2LAPA 1CFFA 3SG6A 4I5KA 1PK0D 5AEQA 1MXEA 2Y1NA 4M2PA 2K0JA 3MSEB 3OB2B 1PSBA 2JQ6A 1KFUS 1SR6B 4E68A 1A75A 1NSHA 3BUWB 3F45A 1ZACA 3LLEA 5F6TA 1SNLA 4BY4A 2BECA 1OSAA 1UHNA 2B1UA 1NCZA 2CXJA 2LVVA 2NCOA 4QJ3B 1DTLA 2KI6C 4ZCUA 1D1OA 5CSJA 4M2QA 4WRIA 2LANA 1XFZO 3AAKA 4GUKA 1NX1A 2OTGB 1AVSA 1QTXA 2WNDA 2JC2A 1FBVA 2JXLA 1C7VA 4MZLA 1QASA 1S36A 3EVUA 2CCMA 1YR5A 4CFRA 3PLFB 2MA2A 5K89A 1KCYA 1NCYA 1YX8A 2JU0A 3GOFA 1NPQA 2JTTA 4IL1A 1TIZA 1KQMC 4FQOA 1AJ4A 3H4SE 1F70A 4JWQA 4PCWA 2KBIA 1RTP1 3GK2A 4NDCA 1GGZA 3D0YA 3TDZA 1F71A 3HX4A 1IRJA 1MR8A 1TCFA 2G9BA 1X02A 3AKAA 1JFJA 2FCDA 1FI5A 1XA5A 4M2OA 2EHBA 1M63B 4AOMA 4ZCVA 1QX7A 2L50A 4MN0A 1NX2A 1BR4B 1A03A 1LINA 3BQ3A 2SCPA 4TNCA 1JC2A 1S26D 1YTZC 5I2QA 5HKYA 1ODBA 3JTDB 1WRZA 2LP2A 5AERA 2LMUA 3O2PA 1BT6A 3FWCA 2M97A 3CR4X 1GQMA 3I5FB 2K7DA 5DKRA 1IJ5A 2I18A 2ISDA 1B8LA 4PHJA 5KU1A 1XYDA 1K2HA 1OOJA 3IQOA 1U5IB 2G2BA 2NLNA 3KHEA 1GJYA 1EG3A 1NCXA 3KO0A 1M39A 2OTGC 2PMYA 3PN7B 1J1EA 1XFVO 2WOSA 3JVTB 2PASA 1HT9A 3BXKA 1CM4A 3O4YA 3SG7A 1RJVA 1R2UA 3LCPC 3DD4A 2AMIA 3KPXA 2RGIA 4I5NB 3EKJA 1K94A 2LVKA 3SIBA 1DJHA 2F33A 4YGEB 3CTNA 1CMGA 4I5JA 1KK8B 2COLB 1BG1A 1MHOA 2NCPA 1J55A 1UHHA 3SIAA 2KBMA 3RLZA 3DVJA 3BUNB 2HF5A 3FS7A 3WXAA 2KSPA 4AQIA 2EGDA 5I8NA 1S5GZ 1C07A 3BUXB 2BBNA 1CTRA
chains in the Genus database with same CATH superfamily
1SSEB 3OB1B 4GGNA 1MWNA 2JT8A 3PSRA 1A29A 1NX3A 1WRKA 3VRRA 3OP0A 3JTDC 3GK1A 1F54A 3I5GB 3O6BA 3TS5C 1NP8A 4DS7A 1DQEA 1EJ3A 1XFXO 4N1GA 3AKBA 3ZNIA 4QJ5B 3I5FC 2KFFA 1U5IA 2M49B 4MSPA 3CWGA 1IQ5A 2GGZA 1PVBA 1LKJA 2MHHA 1Z2CB 5ER5A 5DKQA 1AP4A 1VRKA 3EVRA 1AJ5A 3CZ1A 2L4HA 5CSFA 4HRGA 2QDIA 2BCAA 1PULA 3BOWB 3DF0B 1H8BA 3JVTC 3R1VA 1B8RA 1F4QA 4R1EA 4PE1A 3CZTX 1Y0VH 4N5XA 3D10A 1LS8A 2NXQA 2QACA 2DOQA 1KK7Y 1CKKA 1OOFA 2JRFA 2KAVA 1QS7A 2BKHB 1K9UA 3UO9A 1YVLA 4QJ4B 5ER4X 2M0RA 1IKUA 1F8HA 3IF7A 1OZOA 1S6CA 3OHMB 1KK8C 1J7OA 1S3PA 3DVKA 1SYMA 1K90D 1J7RA 4NDBA 2AUCA 3BUOB 4CIDA 5FI7A 1IIOA 2ZNEA 1TRFA 1LVCD 1DJIA 2P6BB 2CT9A 1FW4A 2R2IA 2PQLA 1JUOA 1KFXS 3B88A 2LLUA 3I5GC 4ORBB 4F0ZB 1SRAA 4PALA 1WLZA 2H2KA 4MEWA 3B86A 1Y1XA 1IJ6A 1KSMA 2P70A 3NGVA 5CPVA 3BOWA 1YX7A 1PSRA 3DF0A 3EK8A 4PHNA 1K8UA 2QEBA 4JQ0D 4MVFA 2BAPA 1BODA 1B47A 1V1FA 3SG4A 4AQJA 1A2XA 2K60A 4DCKA 1SBJA 1DF0B 4YGAA 4PE7A 1K9KA 2JPTA 3OBVA 1DT7B 1RK9A 1S6IA 5D69A 3S0FA 3VB1A 3N7HA 4MRYA 2KGRA 2KOTA 2PVBA 1ALVA 2F3YA 3SG2A 1PRWA 2LUCA 1LXFC 1Y6WA 2ZFDA 1QX5B 1TTXA 1ZOTB 5HKZA 5HLVA 2FJYA 2M7LA 3TS5B 1OMVA 4PHKA 1XVJA 4INXA 1LA0A 1C3ZA 4C0KA 2KPHA 3CGAA 1XK4A 1KSOA 1A4PA 1M46A 3SG3A 3RZSA 3IVTA 1QIWA 1XK4C 1PVAA 1RWYA 2EC6C 1MQ1A 1QX2A 4JPZB 1CDLA 2JULA 1QLKA 1YUTA 1B7TY 2GGMA 5FYXA 3DXLA 1YUSA 2LC5A 1GGWA 3E3RA 4P2YB 3NHIA 5G08A 4YGCB 2JOJA 2Y5IA 2M1UA 2WCHA 1ORGA 1CLBA 1QVIY 3SG5A 2I7AA 2LMVA 2KI4B 1ZUZA 1P28A 4IJ7A 4CFQA 3PM8A 2LHIA 2I2RE 4FQTA 1NYAA 2BL0B 4YBHB 1GM0A 1DF0A 2BBMA 1WY9A 3DVEA 3FWBA 1DELA 1SKTA 4P5OE 5PALA 1MXLC 3QRXA 1F4OA 1CB1A 3PALA 4BY5A 1V1GA 1E8AA 1SL7A 1SL8A 2K61A 2K8MB 3EK4A 1JSAA 1OE9B 1M31A 3SS4A 2LM5A 3IQQA 1BR1B 1CLLA 3OX6A 1SW8A 2BE6A 3A4UB 1IG5A 1B8CA 3VROA 2LVJA 1IGVA 1N2DA 2L5XB 4UPGA 1CDMA 1QV0A 1IQ3A 1G8IA 3HCMA 3R72A 2KQ6A 2PALA 4I5LB 4WQ3A 3WNXB 1BLQA 1H4BA 4FTGA 5AFPA 2L51A 2AAOA 2HQ8A 5B8IB 2WCJA 3TZ1A 3NSKA 1CLMA 4CPVA 3D76A 3EK7A 3PATA 4JKTA 4GAOA 2GV5A 2WORA 2M8UA 1G4YR 1K95A 1WLMA 1L7ZA 3M0WA 2GTEA 2L2CA 2JXCA 2K7CA 2LV7A 2M9GA 1CM1A 1KWOB 2CBLA 1UHKA 1T14A 3S0GA 2CTNA 1XFWO 1DC1A 1KK7Z 3LL8B 1MF8B 4WQ2A 1RFJA 2BE4A 2JNFA 5I2LA 2JWWA 3BFHA 4YI8A 1AK8A 3VRPA 3WHTB 1XFYO 4ETOA 2FJUB 2TN4A 1S6JA 1CDNA 2IS9A 1AHRA 2ZRSA 2WCMA 3TDIA 2KI4C 1TNWA 4MZKA 1TNQA 2BL0C 2ZKMX 4INWA 3TUYB 2E30A 3L4AA 1JFKA 2A4JA 3BFAA 4U8DA 1ZMZA 1SPYA 2KAXA 2KLEA 4ORCB 3BYAA 1UUSA 1TWOA 1DMOA 2P71A 1UHIA 2LLSA 1SL9A 5CSIA 1OOHA 3O4XA 1OQPA 2KFHA 3PM2A 1K93D 3ICBA 2EC6B 3SJSA 4N1FA 1MUXA 1WDCB 2SASA 4JD9A 1BU3A 1N65A 2M29A 3QMEA 5AXIA 3O78A 2JTZA 2YGUA 3S0DA 3PFVA 1CFCA 4GNKB 1QIVA 1SCVA 2LCPA 2O5GA 1NWDA 4Q04A 1EH2A 3NSOA 3B7AA 1DJWA 4OR9B 4DIRA 2L0PA 3OGNA 1BJFA 2KYFA 1OMRA 2Y1MA 2OS8C 3DY9A 1FPWA 1YURA 2L98A 1YRTB 2I94A 1BMOA 4OKHA 2L5YA 1KWOC 2V53A 4YRUA 5HKWA 3BUMB 1DEKA 2ZNDA 5GQQC 2MBXA 1DJZA 2F2PA 2WCFA 1Z4HA 2ZRTA 2F2OA 2WC5A 3PJIA 4XJKB 1Q80A 2KNEA 4A4CA 1CMFA 1DGUA 1AUIB 1K9PA 1L2OB 3I5HC 1YVHA 4MBEA 3SS5A 1QWVA 3CR5X 1N0YA 4KYNA 1FI6A 1C7WA 2QEHA 1XFRA 1OW4A 4YGDB 1W7JB 1W7IB 2E6WA 1SCMB 4OVNF 3VRQA 2WC8A 5FI6A 1G33A 5HLOA 4XYNA 4DRWA 3TUYC 2KYCA 1CFDA 2BCXA 1UHJA 1XFUO 1B9AA 1NX0A 1B1GA 2VRGA 2L2EA 2LHLA 5KTYA 1TNPA 1RECA 1TUJA 1DJXA 2F8PA 1B7TZ 2O60A 3TDUA 2JT0A 2K2FA 1WRLA 1YUUA 2ERBA 3EG5B 2KI6D 2ZN9A 5JJGA 1WDCC 4GPLB 2K7BA 1EL4A 2K2AA 4MRXA 5AANA 5KSZA 3UNWA 1EXRA 1SK6D 1QLSA 4PE4A 2M7NA 3GK4X 3NSLA 1QVIZ 1IH0A 2ZN8A 2QPTA 3S0EA 3NXAA 1J1DA 3OX5A 4HRHA 4CLNA 2M1KB 1SR6C 1UURA 2HPSA 2KAYA 2M3WA 4GBAA 5HYDA 1JBAA 4NDDA 1J7PA 3FE8A 5J3XA 1CNPA 4PDZA 1TUZA 4XJKA 1DJYA 3A8RA 3B6XA 1TCOB 1XO5A 2MAZA 1CDPA 2WCLA 4DUQA 2F3ZA 3DVMA 2PSRA 4OV2A 1QV1A 4D1EA 2PYQA 3CS1A 4ICBA 2BCBA 2LP3A 1OMDA 3B87A 3EVVA 4NQGA 1PALA 3FIAA 2D8NA 1L2OC 1KQVA 2WCEA 3I5IB 2OPOA 3RM1A 2HETA 2Q4UA 1SCMC 4MZJA 5JOLA 4C0JA 5I2OA 1B4CA 1FF1A 4A4BA 2L4IA 3KF9A 1QJTA 2KGBC 3CR2A 1TOPA 2KDHA 1HQVA 5BPJA 2LNKA 1UWOA 3CYZA 5TNCA 2LUXA 1ZFSA 2WCBA 3KEVA 3CZ0A 1RROA 1SY9A 1UP5A 1J7QA 1IWQA 1NUBA 1TNXA 1D1OA 2LLTA 1DGVA 2Q91A 1QXPA 2JT3A 2MRDA 2OS8B 3C1VA 2LMTA 4HSZA 3DYEA 4PE0A 5CSNA 2KFGA 1KFUL 1A75B 1DJGA 3WHUB 3NSIA 2QEVA 1YRUB 1C3YA 1R6PA 4YI9A 2Y4QA 2KQYA 3VGOA 5IBWA 2HQWA 1Y1UA 3CZ2A 3EKHA 1JF2A 5D7FA 4L9MA 2H8VA 1S5GY 1TN4A 1EG4A 2KHNA 4ORAB 2PRUA 3I5HB 1DVIA 3LK1A 4OCIA 1QATA 3AAJA 1M45A 1F55A 2LE9B 2MLEC 4OZDA 2K7OA 2FOTA 1KFXL 2LVIA 2MJWB 2FCEA 1CFPA 1KQMB 4GGFA 3LK0A 3CDNA 1OOGA 4PHMA 3SS3A 1JF0A 2NZ0A 2H61A 1S1EA 2KLDA 3ZWHA 1ALWA 1OZSA 4MLWA 3PN7C 2JZIA 1JWDA 2MLFC 1OOIX 4GGFC 4YGBB 2BKIB 3L4LA 1LA3A 1BF5A 3CLNA 2H61C 4USLA 3D0YB 1K96A 3I5IC 2CNPA 4GFTA 1BOCA 3K21A 1Y1AA 3VRNA 1NIWA 2JNXA 4HREE 5DKNA 2LAPA 1CFFA 3SG6A 4I5KA 1PK0D 5AEQA 1MXEA 2Y1NA 4M2PA 3D77A 2K0JA 3MSEB 3OB2B 1PSBA 2JQ6A 3D73A 3K1EA 1KFUS 1SR6B 4E68A 1A75A 1NSHA 3BUWB 3F45A 1ZACA 3LLEA 5F6TA 1SNLA 4BY4A 2BECA 1OSAA 1UHNA 2B1UA 1NCZA 2CXJA 2LVVA 2NCOA 4QJ3B 1DTLA 2KI6C 4ZCUA 3R1PA 5CSJA 4M2QA 5FI2A 3NHTA 2QEOA 3Q8IA 4WRIA 3CABA 5D3OA 2LANA 1XFZO 3AAKA 3BFBA 4GUKA 3S0AA 1NX1A 2OTGB 1AVSA 1QTXA 4F7FA 2WNDA 2JC2A 1FBVA 2JXLA 1C7VA 4MZLA 1QASA 1S36A 2BNXA 3D74A 3EVUA 2CCMA 1YR5A 4CFRA 3PLFB 2MA2A 5K89A 1KCYA 1NCYA 1YX8A 2JU0A 3GOFA 1NPQA 2JTTA 4IL1A 5EL2A 1TIZA 1KQMC 4FQOA 1AJ4A 3H4SE 1F70A 4JWQA 4PCWA 5I94A 2KBIA 1RTP1 3GK2A 4NDCA 1W9ZA 1GGZA 3D0YA 3TDZA 1F71A 3HX4A 1IRJA 1MR8A 1TCFA 3FE9A 2G9BA 1X02A 3AKAA 1JFJA 2FCDA 3S0BA 3V2LA 1FI5A 1XA5A 4M2OA 2EHBA 1M63B 4AOMA 5HL1A 4ZCVA 1QX7A 2L50A 4MN0A 1NX2A 1BR4B 1A03A 1LINA 3BQ3A 2SCPA 4TNCA 1JC2A 1S26D 1YTZC 5I2QA 5HKYA 1ODBA 3JTDB 1WRZA 2LP2A 2BBNA 5AERA 2LMUA 3O2PA 1BT6A 3FWCA 2M97A 3CR4X 1GQMA 3I5FB 2K7DA 5DKRA 1IJ5A 2I18A 2ISDA 1B8LA 4PHJA 5KU1A 1XYDA 1K2HA 1OOJA 3IQOA 1U5IB 2G2BA 3DZTA 2NLNA 3KHEA 1GJYA 1EG3A 1NCXA 3D75A 3KO0A 1M39A 2OTGC 2PMYA 3PN7B 5DICA 1J1EA 1XFVO 2WOSA 3JVTB 3L47A 2PASA 1HT9A 2WC6A 1CM4A 3BXKA 3O4YA 3SG7A 4C0LA 1RJVA 1R2UA 3LCPC 3DD4A 2AMIA 3KPXA 2RGIA 4I5NB 3EKJA 1K94A 2LVKA 3SIBA 1DJHA 2F33A 3D78A 3CTNA 4YGEB 1CMGA 4I5JA 2JPOA 1KK8B 2COLB 1BG1A 1MHOA 3BJHA 2NCPA 1J55A 1UHHA 3SIAA 4PT1A 2KBMA 3FE6A 3R1OA 3RLZA 3DVJA 2WCKA 3BUNB 2HF5A 3FS7A 3WXAA 2KSPA 4AQIA 2EGDA 5I8NA 1S5GZ 1C07A 3BUXB 1SMGA 1CTRA
chains in the Genus database with same CATH topology
3OB1B 4GGNA 1MWNA 2JT8A 3PSRA 1A29A 1NX3A 1WRKA 3VRRA 3OP0A 3JTDC 3GK1A 1F54A 3I5GB 3O6BA 3TS5C 1NP8A 4DS7A 1EJ3A 1XFXO 4N1GA 3AKBA 3ZNIA 4QJ5B 3I5FC 2KFFA 1U5IA 2M49B 4MSPA 3CWGA 1IQ5A 2GGZA 1PVBA 1LKJA 2MHHA 5ER5A 5DKQA 1AP4A 1VRKA 3EVRA 1AJ5A 2L4HA 5CSFA 4HRGA 1H8BA 2BCAA 1PULA 3BOWB 3DF0B 3JVTC 1B8RA 1F4QA 4R1EA 4PE1A 3CZTX 1Y0VH 4N5XA 3D10A 2NXQA 2QACA 2DOQA 1KK7Y 1CKKA 2KAVA 2JRFA 1QS7A 2BKHB 1K9UA 1YVLA 4QJ4B 5ER4X 2M0RA 1IKUA 1F8HA 3IF7A 1OZOA 1S6CA 3OHMB 1KK8C 1J7OA 1S3PA 3DVKA 1SYMA 1K90D 1J7RA 4NDBA 2AUCA 3BUOB 4CIDA 2ZNEA 1TRFA 1LVCD 1DJIA 2P6BB 2CT9A 1FW4A 2R2IA 1JUOA 1KFXS 3I5GC 2LLUA 4ORBB 4F0ZB 1SRAA 4PALA 1WLZA 2H2KA 4MEWA 1Y1XA 1IJ6A 1KSMA 5CPVA 3BOWA 1YX7A 1PSRA 3DF0A 3EK8A 4PHNA 1K8UA 4JQ0D 4MVFA 1BODA 1B47A 1V1FA 3SG4A 4AQJA 1A2XA 4DCKA 1SBJA 1DF0B 4YGAA 4PE7A 1K9KA 2JPTA 1DT7B 1RK9A 1S6IA 5D69A 4MRYA 2KGRA 2KOTA 2PVBA 1ALVA 2F3YA 3SG2A 1PRWA 2LUCA 1LXFC 1Y6WA 2ZFDA 1QX5B 1TTXA 1ZOTB 5HKZA 5HLVA 2M7LA 3TS5B 1OMVA 4PHKA 1XVJA 1LA0A 4C0KA 3CGAA 1XK4A 1KSOA 1A4PA 1M46A 3SG3A 1QIWA 1XK4C 1PVAA 1RWYA 2EC6C 1MQ1A 1QX2A 4JPZB 1CDLA 2JULA 1QLKA 1YUTA 1B7TY 2GGMA 5FYXA 1YUSA 2LC5A 1GGWA 3E3RA 4P2YB 5G08A 4YGCB 2JOJA 2Y5IA 2M1UA 1CLBA 1QVIY 3SG5A 2I7AA 2LMVA 2KI4B 1ZUZA 4CFQA 3PM8A 2LHIA 2I2RE 1NYAA 2BL0B 4YBHB 1DF0A 2BBMA 1WY9A 3DVEA 3FWBA 1SKTA 4P5OE 5PALA 1MXLC 3QRXA 1F4OA 1CB1A 3PALA 4BY5A 1V1GA 1E8AA 1SL7A 1SL8A 2K61A 2K8MB 3EK4A 1JSAA 1OE9B 1M31A 2LM5A 3IQQA 1BR1B 1CLLA 3OX6A 1SW8A 2BE6A 3A4UB 1IG5A 1B8CA 3VROA 2LVJA 1IGVA 1N2DA 2L5XB 4UPGA 1CDMA 1QV0A 1IQ3A 1G8IA 3HCMA 2KQ6A 2PALA 4I5LB 4WQ3A 3WNXB 1BLQA 1H4BA 4FTGA 5AFPA 1SMGA 2L51A 2AAOA 2HQ8A 5B8IB 3TZ1A 3NSKA 1CLMA 4CPVA 3PATA 3EK7A 4GAOA 2GV5A 2WORA 2M8UA 1G4YR 1K95A 1WLMA 1L7ZA 3M0WA 2JXCA 2K7CA 2LV7A 2M9GA 1CM1A 1KWOB 2CBLA 1UHKA 2CTNA 1XFWO 1KK7Z 3LL8B 1MF8B 4WQ2A 1RFJA 2BE4A 2JNFA 5I2LA 2JWWA 4YI8A 1AK8A 3VRPA 3WHTB 1XFYO 4ETOA 2FJUB 2TN4A 1S6JA 1CDNA 2IS9A 1AHRA 2ZRSA 3TDIA 2KI4C 1TNWA 4MZKA 1TNQA 2BL0C 2ZKMX 3TUYB 2E30A 1JFKA 2A4JA 4U8DA 1ZMZA 1SPYA 2KAXA 4ORCB 3BYAA 1UUSA 1DMOA 1UHIA 2LLSA 1SL9A 5CSIA 1OQPA 2KFHA 1K93D 3ICBA 2EC6B 3SJSA 4N1FA 1MUXA 1WDCB 2SASA 1BU3A 1N65A 2M29A 5AXIA 3O78A 2JTZA 3PFVA 1CFCA 4GNKB 1QIVA 1SCVA 2LCPA 2O5GA 1NWDA 4Q04A 1EH2A 3NSOA 1DJWA 4OR9B 4DIRA 2L0PA 1BJFA 2KYFA 1OMRA 2Y1MA 2OS8C 1FPWA 1YURA 2L98A 1YRTB 2I94A 1BMOA 4OKHA 1KWOC 2V53A 4YRUA 5HKWA 3BUMB 5GQQC 2ZNDA 2MBXA 1DJZA 2F2PA 2WCFA 2ZRTA 2F2OA 4XJKB 4A4CA 1Q80A 2KNEA 1CMFA 1DGUA 1AUIB 1K9PA 1L2OB 3I5HC 1YVHA 4MBEA 3CR5X 1N0YA 1FI6A 1C7WA 4YGDB 1W7JB 1W7IB 2E6WA 1SCMB 4OVNF 3VRQA 2WC8A 5HLOA 1G33A 4XYNA 4DRWA 3TUYC 2KYCA 1CFDA 2BCXA 1UHJA 1XFUO 1B9AA 1NX0A 1B1GA 2VRGA 2L2EA 2LHLA 5KTYA 1TNPA 1RECA 1DJXA 2F8PA 1B7TZ 2O60A 3TDUA 2JT0A 2K2FA 1WRLA 1YUUA 4C0LA 2KI6D 2ZN9A 5JJGA 1WDCC 4GPLB 2K7BA 1EL4A 2K2AA 4MRXA 5AANA 5KSZA 1EXRA 1SK6D 1QLSA 4PE4A 2M7NA 3GK4X 3NSLA 1QVIZ 1IH0A 2ZN8A 2QPTA 3NXAA 1J1DA 3OX5A 4HRHA 4CLNA 2M1KB 1SR6C 1UURA 2HPSA 2KAYA 2M3WA 4GBAA 5HYDA 1JBAA 4NDDA 1J7PA 5J3XA 1CNPA 4PDZA 4XJKA 1DJYA 3A8RA 1TCOB 1XO5A 2MAZA 1CDPA 4DUQA 2F3ZA 3DVMA 2PSRA 4OV2A 1QV1A 4D1EA 3CS1A 4ICBA 2BCBA 2LP3A 1OMDA 3EVVA 4NQGA 1PALA 3FIAA 2D8NA 1L2OC 1KQVA 2WCEA 3I5IB 2OPOA 3RM1A 2HETA 2Q4UA 1SCMC 4MZJA 5JOLA 4C0JA 5I2OA 1B4CA 1FF1A 4A4BA 2L4IA 3KF9A 1QJTA 2KGBC 3CR2A 1TOPA 2KDHA 1HQVA 5BPJA 2LNKA 1UWOA 5TNCA 2LUXA 1ZFSA 2WCBA 3KEVA 1RROA 1SY9A 1UP5A 1J7QA 1IWQA 1NUBA 1TNXA 2LLTA 1DGVA 2Q91A 1QXPA 2JT3A 2MRDA 2OS8B 3C1VA 2LMTA 4HSZA 4PE0A 5CSNA 2KFGA 1KFUL 1A75B 1DJGA 3WHUB 3NSIA 1YRUB 1R6PA 4YI9A 2Y4QA 2KQYA 3VGOA 5IBWA 2HQWA 1Y1UA 3EKHA 5D7FA 1JF2A 4L9MA 1S5GY 1TN4A 1EG4A 2KHNA 4ORAB 2PRUA 3I5HB 1DVIA 3LK1A 4OCIA 1QATA 3AAJA 1M45A 1F55A 2LE9B 2MLEC 2K7OA 2FOTA 1KFXL 2LVIA 2MJWB 2FCEA 1CFPA 1KQMB 4GGFA 3LK0A 4PHMA 1JF0A 2NZ0A 2H61A 1S1EA 3ZWHA 1ALWA 1OZSA 4MLWA 3PN7C 2JZIA 1JWDA 2MLFC 4GGFC 4YGBB 2BKIB 1LA3A 1BF5A 3CLNA 2H61C 4USLA 3D0YB 1K96A 3I5IC 2CNPA 4GFTA 1BOCA 3K21A 1Y1AA 3VRNA 1NIWA 2JNXA 4HREE 5DKNA 2LAPA 1CFFA 3SG6A 4I5KA 1PK0D 5AEQA 1MXEA 2Y1NA 4M2PA 2K0JA 3MSEB 3OB2B 1PSBA 2JQ6A 1KFUS 1SR6B 4E68A 1A75A 1NSHA 3BUWB 3F45A 1ZACA 3LLEA 5F6TA 1SNLA 4BY4A 2BECA 1OSAA 1UHNA 2B1UA 1NCZA 2CXJA 2LVVA 2NCOA 4QJ3B 1DTLA 2KI6C 4ZCUA 1D1OA 5CSJA 4M2QA 4WRIA 2LANA 1XFZO 3AAKA 4GUKA 1NX1A 2OTGB 1AVSA 1QTXA 2WNDA 2JC2A 1FBVA 2JXLA 1C7VA 4MZLA 1QASA 1S36A 3EVUA 2CCMA 1YR5A 4CFRA 3PLFB 2MA2A 5K89A 1KCYA 1NCYA 1YX8A 2JU0A 3GOFA 1NPQA 2JTTA 4IL1A 1TIZA 1KQMC 4FQOA 1AJ4A 3H4SE 1F70A 4JWQA 4PCWA 2KBIA 1RTP1 3GK2A 4NDCA 1GGZA 3D0YA 3TDZA 1F71A 3HX4A 1IRJA 1MR8A 1TCFA 2G9BA 1X02A 3AKAA 1JFJA 2FCDA 1FI5A 1XA5A 4M2OA 2EHBA 1M63B 4AOMA 4ZCVA 1QX7A 2L50A 4MN0A 1NX2A 1BR4B 1A03A 1LINA 3BQ3A 2SCPA 4TNCA 1JC2A 1S26D 1YTZC 5I2QA 5HKYA 1ODBA 3JTDB 1WRZA 2LP2A 5AERA 2LMUA 3O2PA 1BT6A 3FWCA 2M97A 3CR4X 1GQMA 3I5FB 2K7DA 5DKRA 1IJ5A 2I18A 2ISDA 1B8LA 4PHJA 5KU1A 1XYDA 1K2HA 1OOJA 3IQOA 1U5IB 2G2BA 2NLNA 3KHEA 1GJYA 1EG3A 1NCXA 3KO0A 1M39A 2OTGC 2PMYA 3PN7B 1J1EA 1XFVO 2WOSA 3JVTB 2PASA 1HT9A 3BXKA 1CM4A 3O4YA 3SG7A 1RJVA 1R2UA 3LCPC 3DD4A 2AMIA 3KPXA 2RGIA 4I5NB 3EKJA 1K94A 2LVKA 3SIBA 1DJHA 2F33A 4YGEB 3CTNA 1CMGA 4I5JA 1KK8B 2COLB 1BG1A 1MHOA 2NCPA 1J55A 1UHHA 3SIAA 2KBMA 3RLZA 3DVJA 3BUNB 2HF5A 3FS7A 3WXAA 2KSPA 4AQIA 2EGDA 5I8NA 1S5GZ 1C07A 3BUXB 2BBNA 1CTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OB1 B;  4GGN A;  1MWN A;  2JT8 A;  3PSR A;  1A29 A;  1NX3 A;  1WRK A;  3VRR A;  3OP0 A;  3JTD C;  3GK1 A;  1F54 A;  3I5G B;  3O6B A;  3TS5 C;  1NP8 A;  4DS7 A;  1EJ3 A;  1XFX O;  4N1G A;  3AKB A;  3ZNI A;  4QJ5 B;  3I5F C;  2KFF A;  1U5I A;  2M49 B;  4MSP A;  3CWG A;  1IQ5 A;  2GGZ A;  1PVB A;  1LKJ A;  2MHH A;  5ER5 A;  5DKQ A;  1AP4 A;  1VRK A;  3EVR A;  1AJ5 A;  2L4H A;  5CSF A;  4HRG A;  1H8B A;  2BCA A;  1PUL A;  3BOW B;  3DF0 B;  3JVT C;  1B8R A;  1F4Q A;  4R1E A;  4PE1 A;  3CZT X;  1Y0V H;  4N5X A;  3D10 A;  2NXQ A;  2QAC A;  2DOQ A;  1KK7 Y;  1CKK A;  2KAV A;  2JRF A;  1QS7 A;  2BKH B;  1K9U A;  1YVL A;  4QJ4 B;  5ER4 X;  2M0R A;  1IKU A;  1F8H A;  3IF7 A;  1OZO A;  1S6C A;  3OHM B;  1KK8 C;  1J7O A;  1S3P A;  3DVK A;  1SYM A;  1K90 D;  1J7R A;  4NDB A;  2AUC A;  3BUO B;  4CID A;  2ZNE A;  1TRF A;  1LVC D;  1DJI A;  2P6B B;  2CT9 A;  1FW4 A;  2R2I A;  1JUO A;  1KFX S;  3I5G C;  2LLU A;  4ORB B;  4F0Z B;  1SRA A;  4PAL A;  1WLZ A;  2H2K A;  4MEW A;  1Y1X A;  1IJ6 A;  1KSM A;  5CPV A;  3BOW A;  1YX7 A;  1PSR A;  3DF0 A;  3EK8 A;  4PHN A;  1K8U A;  4JQ0 D;  4MVF A;  1BOD A;  1B47 A;  1V1F A;  3SG4 A;  4AQJ A;  1A2X A;  4DCK A;  1SBJ A;  1DF0 B;  4YGA A;  4PE7 A;  1K9K A;  2JPT A;  1DT7 B;  1RK9 A;  1S6I A;  5D69 A;  4MRY A;  2KGR A;  2KOT A;  2PVB A;  1ALV A;  2F3Y A;  3SG2 A;  1PRW A;  2LUC A;  1LXF C;  1Y6W A;  2ZFD A;  1QX5 B;  1TTX A;  1ZOT B;  5HKZ A;  5HLV A;  2M7L A;  3TS5 B;  1OMV A;  4PHK A;  1XVJ A;  1LA0 A;  4C0K A;  3CGA A;  1XK4 A;  1KSO A;  1A4P A;  1M46 A;  3SG3 A;  1QIW A;  1XK4 C;  1PVA A;  1RWY A;  2EC6 C;  1MQ1 A;  1QX2 A;  4JPZ B;  1CDL A;  2JUL A;  1QLK A;  1YUT A;  1B7T Y;  2GGM A;  5FYX A;  1YUS A;  2LC5 A;  1GGW A;  3E3R A;  4P2Y B;  5G08 A;  4YGC B;  2JOJ A;  2Y5I A;  2M1U A;  1CLB A;  1QVI Y;  3SG5 A;  2I7A A;  2LMV A;  2KI4 B;  1ZUZ A;  4CFQ A;  3PM8 A;  2LHI A;  2I2R E;  1NYA A;  2BL0 B;  4YBH B;  1DF0 A;  2BBM A;  1WY9 A;  3DVE A;  3FWB A;  1SKT A;  4P5O E;  5PAL A;  1MXL C;  3QRX A;  1F4O A;  1CB1 A;  3PAL A;  4BY5 A;  1V1G A;  1E8A A;  1SL7 A;  1SL8 A;  2K61 A;  2K8M B;  3EK4 A;  1JSA A;  1OE9 B;  1M31 A;  2LM5 A;  3IQQ A;  1BR1 B;  1CLL A;  3OX6 A;  1SW8 A;  2BE6 A;  3A4U B;  1IG5 A;  1B8C A;  3VRO A;  2LVJ A;  1IGV A;  1N2D A;  2L5X B;  4UPG A;  1CDM A;  1QV0 A;  1IQ3 A;  1G8I A;  3HCM A;  2KQ6 A;  2PAL A;  4I5L B;  4WQ3 A;  3WNX B;  1BLQ A;  1H4B A;  4FTG A;  5AFP A;  1SMG A;  2L51 A;  2AAO A;  2HQ8 A;  5B8I B;  3TZ1 A;  3NSK A;  1CLM A;  4CPV A;  3PAT A;  3EK7 A;  4GAO A;  2GV5 A;  2WOR A;  2M8U A;  1G4Y R;  1K95 A;  1WLM A;  1L7Z A;  3M0W A;  2JXC A;  2K7C A;  2LV7 A;  2M9G A;  1CM1 A;  1KWO B;  2CBL A;  1UHK A;  2CTN A;  1XFW O;  1KK7 Z;  3LL8 B;  1MF8 B;  4WQ2 A;  1RFJ A;  2BE4 A;  2JNF A;  5I2L A;  2JWW A;  4YI8 A;  1AK8 A;  3VRP A;  3WHT B;  1XFY O;  4ETO A;  2FJU B;  2TN4 A;  1S6J A;  1CDN A;  2IS9 A;  1AHR A;  2ZRS A;  3TDI A;  2KI4 C;  1TNW A;  4MZK A;  1TNQ A;  2BL0 C;  2ZKM X;  3TUY B;  2E30 A;  1JFK A;  2A4J A;  4U8D A;  1ZMZ A;  1SPY A;  2KAX A;  4ORC B;  3BYA A;  1UUS A;  1DMO A;  1UHI A;  2LLS A;  1SL9 A;  5CSI A;  1OQP A;  2KFH A;  1K93 D;  3ICB A;  2EC6 B;  3SJS A;  4N1F A;  1MUX A;  1WDC B;  2SAS A;  1BU3 A;  1N65 A;  2M29 A;  5AXI A;  3O78 A;  2JTZ A;  3PFV A;  1CFC A;  4GNK B;  1QIV A;  1SCV A;  2LCP A;  2O5G A;  1NWD A;  4Q04 A;  1EH2 A;  3NSO A;  1DJW A;  4OR9 B;  4DIR A;  2L0P A;  1BJF A;  2KYF A;  1OMR A;  2Y1M A;  2OS8 C;  1FPW A;  1YUR A;  2L98 A;  1YRT B;  2I94 A;  1BMO A;  4OKH A;  1KWO C;  2V53 A;  4YRU A;  5HKW A;  3BUM B;  5GQQ C;  2ZND A;  2MBX A;  1DJZ A;  2F2P A;  2WCF A;  2ZRT A;  2F2O A;  4XJK B;  4A4C A;  1Q80 A;  2KNE A;  1CMF A;  1DGU A;  1AUI B;  1K9P A;  1L2O B;  3I5H C;  1YVH A;  4MBE A;  3CR5 X;  1N0Y A;  1FI6 A;  1C7W A;  4YGD B;  1W7J B;  1W7I B;  2E6W A;  1SCM B;  4OVN F;  3VRQ A;  2WC8 A;  5HLO A;  1G33 A;  4XYN A;  4DRW A;  3TUY C;  2KYC A;  1CFD A;  2BCX A;  1UHJ A;  1XFU O;  1B9A A;  1NX0 A;  1B1G A;  2VRG A;  2L2E A;  2LHL A;  5KTY A;  1TNP A;  1REC A;  1DJX A;  2F8P A;  1B7T Z;  2O60 A;  3TDU A;  2JT0 A;  2K2F A;  1WRL A;  1YUU A;  4C0L A;  2KI6 D;  2ZN9 A;  5JJG A;  1WDC C;  4GPL B;  2K7B A;  1EL4 A;  2K2A A;  4MRX A;  5AAN A;  5KSZ A;  1EXR A;  1SK6 D;  1QLS A;  4PE4 A;  2M7N A;  3GK4 X;  3NSL A;  1QVI Z;  1IH0 A;  2ZN8 A;  2QPT A;  3NXA A;  1J1D A;  3OX5 A;  4HRH A;  4CLN A;  2M1K B;  1SR6 C;  1UUR A;  2HPS A;  2KAY A;  2M3W A;  4GBA A;  5HYD A;  1JBA A;  4NDD A;  1J7P A;  5J3X A;  1CNP A;  4PDZ A;  4XJK A;  1DJY A;  3A8R A;  1TCO B;  1XO5 A;  2MAZ A;  1CDP A;  4DUQ A;  2F3Z A;  3DVM A;  2PSR A;  4OV2 A;  1QV1 A;  4D1E A;  3CS1 A;  4ICB A;  2BCB A;  2LP3 A;  1OMD A;  3EVV A;  4NQG A;  1PAL A;  3FIA A;  2D8N A;  1L2O C;  1KQV A;  2WCE A;  3I5I B;  2OPO A;  3RM1 A;  2HET A;  2Q4U A;  1SCM C;  4MZJ A;  5JOL A;  4C0J A;  5I2O A;  1B4C A;  1FF1 A;  4A4B A;  2L4I A;  3KF9 A;  1QJT A;  2KGB C;  3CR2 A;  1TOP A;  2KDH A;  1HQV A;  5BPJ A;  2LNK A;  1UWO A;  5TNC A;  2LUX A;  1ZFS A;  2WCB A;  3KEV A;  1RRO A;  1SY9 A;  1UP5 A;  1J7Q A;  1IWQ A;  1NUB A;  1TNX A;  2LLT A;  1DGV A;  2Q91 A;  1QXP A;  2JT3 A;  2MRD A;  2OS8 B;  3C1V A;  2LMT A;  4HSZ A;  4PE0 A;  5CSN A;  2KFG A;  1KFU L;  1A75 B;  1DJG A;  3WHU B;  3NSI A;  1YRU B;  1R6P A;  4YI9 A;  2Y4Q A;  2KQY A;  3VGO A;  5IBW A;  2HQW A;  1Y1U A;  3EKH A;  5D7F A;  1JF2 A;  4L9M A;  1S5G Y;  1TN4 A;  1EG4 A;  2KHN A;  4ORA B;  2PRU A;  3I5H B;  1DVI A;  3LK1 A;  4OCI A;  1QAT A;  3AAJ A;  1M45 A;  1F55 A;  2LE9 B;  2MLE C;  2K7O A;  2FOT A;  1KFX L;  2LVI A;  2MJW B;  2FCE A;  1CFP A;  1KQM B;  4GGF A;  3LK0 A;  4PHM A;  1JF0 A;  2NZ0 A;  2H61 A;  1S1E A;  3ZWH A;  1ALW A;  1OZS A;  4MLW A;  3PN7 C;  2JZI A;  1JWD A;  2MLF C;  4GGF C;  4YGB B;  2BKI B;  1LA3 A;  1BF5 A;  3CLN A;  2H61 C;  4USL A;  3D0Y B;  1K96 A;  3I5I C;  2CNP A;  4GFT A;  1BOC A;  3K21 A;  1Y1A A;  3VRN A;  1NIW A;  2JNX A;  4HRE E;  5DKN A;  2LAP A;  1CFF A;  3SG6 A;  4I5K A;  1PK0 D;  5AEQ A;  1MXE A;  2Y1N A;  4M2P A;  2K0J A;  3MSE B;  3OB2 B;  1PSB A;  2JQ6 A;  1KFU S;  1SR6 B;  4E68 A;  1A75 A;  1NSH A;  3BUW B;  3F45 A;  1ZAC A;  3LLE A;  5F6T A;  1SNL A;  4BY4 A;  2BEC A;  1OSA A;  1UHN A;  2B1U A;  1NCZ A;  2CXJ A;  2LVV A;  2NCO A;  4QJ3 B;  1DTL A;  2KI6 C;  4ZCU A;  1D1O A;  5CSJ A;  4M2Q A;  4WRI A;  2LAN A;  1XFZ O;  3AAK A;  4GUK A;  1NX1 A;  2OTG B;  1AVS A;  1QTX A;  2WND A;  2JC2 A;  1FBV A;  2JXL A;  1C7V A;  4MZL A;  1QAS A;  1S36 A;  3EVU A;  2CCM A;  1YR5 A;  4CFR A;  3PLF B;  2MA2 A;  5K89 A;  1KCY A;  1NCY A;  1YX8 A;  2JU0 A;  3GOF A;  1NPQ A;  2JTT A;  4IL1 A;  1TIZ A;  1KQM C;  4FQO A;  1AJ4 A;  3H4S E;  1F70 A;  4JWQ A;  4PCW A;  2KBI A;  1RTP 1;  3GK2 A;  4NDC A;  1GGZ A;  3D0Y A;  3TDZ A;  1F71 A;  3HX4 A;  1IRJ A;  1MR8 A;  1TCF A;  2G9B A;  1X02 A;  3AKA A;  1JFJ A;  2FCD A;  1FI5 A;  1XA5 A;  4M2O A;  2EHB A;  1M63 B;  4AOM A;  4ZCV A;  1QX7 A;  2L50 A;  4MN0 A;  1NX2 A;  1BR4 B;  1A03 A;  1LIN A;  3BQ3 A;  2SCP A;  4TNC A;  1JC2 A;  1S26 D;  1YTZ C;  5I2Q A;  5HKY A;  1ODB A;  3JTD B;  1WRZ A;  2LP2 A;  5AER A;  2LMU A;  3O2P A;  1BT6 A;  3FWC A;  2M97 A;  3CR4 X;  1GQM A;  3I5F B;  2K7D A;  5DKR A;  1IJ5 A;  2I18 A;  2ISD A;  1B8L A;  4PHJ A;  5KU1 A;  1XYD A;  1K2H A;  1OOJ A;  3IQO A;  1U5I B;  2G2B A;  2NLN A;  3KHE A;  1GJY A;  1EG3 A;  1NCX A;  3KO0 A;  1M39 A;  2OTG C;  2PMY A;  3PN7 B;  1J1E A;  1XFV O;  2WOS A;  3JVT B;  2PAS A;  1HT9 A;  3BXK A;  1CM4 A;  3O4Y A;  3SG7 A;  1RJV A;  1R2U A;  3LCP C;  3DD4 A;  2AMI A;  3KPX A;  2RGI A;  4I5N B;  3EKJ A;  1K94 A;  2LVK A;  3SIB A;  1DJH A;  2F33 A;  4YGE B;  3CTN A;  1CMG A;  4I5J A;  1KK8 B;  2COL B;  1BG1 A;  1MHO A;  2NCP A;  1J55 A;  1UHH A;  3SIA A;  2KBM A;  3RLZ A;  3DVJ A;  3BUN B;  2HF5 A;  3FS7 A;  3WXA A;  2KSP A;  4AQI A;  2EGD A;  5I8N A;  1S5G Z;  1C07 A;  3BUX B;  2BBN A;  1CTR A; 
#chains in the Genus database with same CATH topology
 1SSE B;  3OB1 B;  4GGN A;  1MWN A;  2JT8 A;  3PSR A;  1A29 A;  1NX3 A;  1WRK A;  3VRR A;  3OP0 A;  3JTD C;  3GK1 A;  1F54 A;  3I5G B;  3O6B A;  3TS5 C;  1NP8 A;  4DS7 A;  1DQE A;  1EJ3 A;  1XFX O;  4N1G A;  3AKB A;  3ZNI A;  4QJ5 B;  3I5F C;  2KFF A;  1U5I A;  2M49 B;  4MSP A;  3CWG A;  1IQ5 A;  2GGZ A;  1PVB A;  1LKJ A;  2MHH A;  1Z2C B;  5ER5 A;  5DKQ A;  1AP4 A;  1VRK A;  3EVR A;  1AJ5 A;  3CZ1 A;  2L4H A;  5CSF A;  4HRG A;  2QDI A;  2BCA A;  1PUL A;  3BOW B;  3DF0 B;  1H8B A;  3JVT C;  3R1V A;  1B8R A;  1F4Q A;  4R1E A;  4PE1 A;  3CZT X;  1Y0V H;  4N5X A;  3D10 A;  1LS8 A;  2NXQ A;  2QAC A;  2DOQ A;  1KK7 Y;  1CKK A;  1OOF A;  2JRF A;  2KAV A;  1QS7 A;  2BKH B;  1K9U A;  3UO9 A;  1YVL A;  4QJ4 B;  5ER4 X;  2M0R A;  1IKU A;  1F8H A;  3IF7 A;  1OZO A;  1S6C A;  3OHM B;  1KK8 C;  1J7O A;  1S3P A;  3DVK A;  1SYM A;  1K90 D;  1J7R A;  4NDB A;  2AUC A;  3BUO B;  4CID A;  5FI7 A;  1IIO A;  2ZNE A;  1TRF A;  1LVC D;  1DJI A;  2P6B B;  2CT9 A;  1FW4 A;  2R2I A;  2PQL A;  1JUO A;  1KFX S;  3B88 A;  2LLU A;  3I5G C;  4ORB B;  4F0Z B;  1SRA A;  4PAL A;  1WLZ A;  2H2K A;  4MEW A;  3B86 A;  1Y1X A;  1IJ6 A;  1KSM A;  2P70 A;  3NGV A;  5CPV A;  3BOW A;  1YX7 A;  1PSR A;  3DF0 A;  3EK8 A;  4PHN A;  1K8U A;  2QEB A;  4JQ0 D;  4MVF A;  2BAP A;  1BOD A;  1B47 A;  1V1F A;  3SG4 A;  4AQJ A;  1A2X A;  2K60 A;  4DCK A;  1SBJ A;  1DF0 B;  4YGA A;  4PE7 A;  1K9K A;  2JPT A;  3OBV A;  1DT7 B;  1RK9 A;  1S6I A;  5D69 A;  3S0F A;  3VB1 A;  3N7H A;  4MRY A;  2KGR A;  2KOT A;  2PVB A;  1ALV A;  2F3Y A;  3SG2 A;  1PRW A;  2LUC A;  1LXF C;  1Y6W A;  2ZFD A;  1QX5 B;  1TTX A;  1ZOT B;  5HKZ A;  5HLV A;  2FJY A;  2M7L A;  3TS5 B;  1OMV A;  4PHK A;  1XVJ A;  4INX A;  1LA0 A;  1C3Z A;  4C0K A;  2KPH A;  3CGA A;  1XK4 A;  1KSO A;  1A4P A;  1M46 A;  3SG3 A;  3RZS A;  3IVT A;  1QIW A;  1XK4 C;  1PVA A;  1RWY A;  2EC6 C;  1MQ1 A;  1QX2 A;  4JPZ B;  1CDL A;  2JUL A;  1QLK A;  1YUT A;  1B7T Y;  2GGM A;  5FYX A;  3DXL A;  1YUS A;  2LC5 A;  1GGW A;  3E3R A;  4P2Y B;  3NHI A;  5G08 A;  4YGC B;  2JOJ A;  2Y5I A;  2M1U A;  2WCH A;  1ORG A;  1CLB A;  1QVI Y;  3SG5 A;  2I7A A;  2LMV A;  2KI4 B;  1ZUZ A;  1P28 A;  4IJ7 A;  4CFQ A;  3PM8 A;  2LHI A;  2I2R E;  4FQT A;  1NYA A;  2BL0 B;  4YBH B;  1GM0 A;  1DF0 A;  2BBM A;  1WY9 A;  3DVE A;  3FWB A;  1DEL A;  1SKT A;  4P5O E;  5PAL A;  1MXL C;  3QRX A;  1F4O A;  1CB1 A;  3PAL A;  4BY5 A;  1V1G A;  1E8A A;  1SL7 A;  1SL8 A;  2K61 A;  2K8M B;  3EK4 A;  1JSA A;  1OE9 B;  1M31 A;  3SS4 A;  2LM5 A;  3IQQ A;  1BR1 B;  1CLL A;  3OX6 A;  1SW8 A;  2BE6 A;  3A4U B;  1IG5 A;  1B8C A;  3VRO A;  2LVJ A;  1IGV A;  1N2D A;  2L5X B;  4UPG A;  1CDM A;  1QV0 A;  1IQ3 A;  1G8I A;  3HCM A;  3R72 A;  2KQ6 A;  2PAL A;  4I5L B;  4WQ3 A;  3WNX B;  1BLQ A;  1H4B A;  4FTG A;  5AFP A;  2L51 A;  2AAO A;  2HQ8 A;  5B8I B;  2WCJ A;  3TZ1 A;  3NSK A;  1CLM A;  4CPV A;  3D76 A;  3EK7 A;  3PAT A;  4JKT A;  4GAO A;  2GV5 A;  2WOR A;  2M8U A;  1G4Y R;  1K95 A;  1WLM A;  1L7Z A;  3M0W A;  2GTE A;  2L2C A;  2JXC A;  2K7C A;  2LV7 A;  2M9G A;  1CM1 A;  1KWO B;  2CBL A;  1UHK A;  1T14 A;  3S0G A;  2CTN A;  1XFW O;  1DC1 A;  1KK7 Z;  3LL8 B;  1MF8 B;  4WQ2 A;  1RFJ A;  2BE4 A;  2JNF A;  5I2L A;  2JWW A;  3BFH A;  4YI8 A;  1AK8 A;  3VRP A;  3WHT B;  1XFY O;  4ETO A;  2FJU B;  2TN4 A;  1S6J A;  1CDN A;  2IS9 A;  1AHR A;  2ZRS A;  2WCM A;  3TDI A;  2KI4 C;  1TNW A;  4MZK A;  1TNQ A;  2BL0 C;  2ZKM X;  4INW A;  3TUY B;  2E30 A;  3L4A A;  1JFK A;  2A4J A;  3BFA A;  4U8D A;  1ZMZ A;  1SPY A;  2KAX A;  2KLE A;  4ORC B;  3BYA A;  1UUS A;  1TWO A;  1DMO A;  2P71 A;  1UHI A;  2LLS A;  1SL9 A;  5CSI A;  1OOH A;  3O4X A;  1OQP A;  2KFH A;  3PM2 A;  1K93 D;  3ICB A;  2EC6 B;  3SJS A;  4N1F A;  1MUX A;  1WDC B;  2SAS A;  4JD9 A;  1BU3 A;  1N65 A;  2M29 A;  3QME A;  5AXI A;  3O78 A;  2JTZ A;  2YGU A;  3S0D A;  3PFV A;  1CFC A;  4GNK B;  1QIV A;  1SCV A;  2LCP A;  2O5G A;  1NWD A;  4Q04 A;  1EH2 A;  3NSO A;  3B7A A;  1DJW A;  4OR9 B;  4DIR A;  2L0P A;  3OGN A;  1BJF A;  2KYF A;  1OMR A;  2Y1M A;  2OS8 C;  3DY9 A;  1FPW A;  1YUR A;  2L98 A;  1YRT B;  2I94 A;  1BMO A;  4OKH A;  2L5Y A;  1KWO C;  2V53 A;  4YRU A;  5HKW A;  3BUM B;  1DEK A;  2ZND A;  5GQQ C;  2MBX A;  1DJZ A;  2F2P A;  2WCF A;  1Z4H A;  2ZRT A;  2F2O A;  2WC5 A;  3PJI A;  4XJK B;  1Q80 A;  2KNE A;  4A4C A;  1CMF A;  1DGU A;  1AUI B;  1K9P A;  1L2O B;  3I5H C;  1YVH A;  4MBE A;  3SS5 A;  1QWV A;  3CR5 X;  1N0Y A;  4KYN A;  1FI6 A;  1C7W A;  2QEH A;  1XFR A;  1OW4 A;  4YGD B;  1W7J B;  1W7I B;  2E6W A;  1SCM B;  4OVN F;  3VRQ A;  2WC8 A;  5FI6 A;  1G33 A;  5HLO A;  4XYN A;  4DRW A;  3TUY C;  2KYC A;  1CFD A;  2BCX A;  1UHJ A;  1XFU O;  1B9A A;  1NX0 A;  1B1G A;  2VRG A;  2L2E A;  2LHL A;  5KTY A;  1TNP A;  1REC A;  1TUJ A;  1DJX A;  2F8P A;  1B7T Z;  2O60 A;  3TDU A;  2JT0 A;  2K2F A;  1WRL A;  1YUU A;  2ERB A;  3EG5 B;  2KI6 D;  2ZN9 A;  5JJG A;  1WDC C;  4GPL B;  2K7B A;  1EL4 A;  2K2A A;  4MRX A;  5AAN A;  5KSZ A;  3UNW A;  1EXR A;  1SK6 D;  1QLS A;  4PE4 A;  2M7N A;  3GK4 X;  3NSL A;  1QVI Z;  1IH0 A;  2ZN8 A;  2QPT A;  3S0E A;  3NXA A;  1J1D A;  3OX5 A;  4HRH A;  4CLN A;  2M1K B;  1SR6 C;  1UUR A;  2HPS A;  2KAY A;  2M3W A;  4GBA A;  5HYD A;  1JBA A;  4NDD A;  1J7P A;  3FE8 A;  5J3X A;  1CNP A;  4PDZ A;  1TUZ A;  4XJK A;  1DJY A;  3A8R A;  3B6X A;  1TCO B;  1XO5 A;  2MAZ A;  1CDP A;  2WCL A;  4DUQ A;  2F3Z A;  3DVM A;  2PSR A;  4OV2 A;  1QV1 A;  4D1E A;  2PYQ A;  3CS1 A;  4ICB A;  2BCB A;  2LP3 A;  1OMD A;  3B87 A;  3EVV A;  4NQG A;  1PAL A;  3FIA A;  2D8N A;  1L2O C;  1KQV A;  2WCE A;  3I5I B;  2OPO A;  3RM1 A;  2HET A;  2Q4U A;  1SCM C;  4MZJ A;  5JOL A;  4C0J A;  5I2O A;  1B4C A;  1FF1 A;  4A4B A;  2L4I A;  3KF9 A;  1QJT A;  2KGB C;  3CR2 A;  1TOP A;  2KDH A;  1HQV A;  5BPJ A;  2LNK A;  1UWO A;  3CYZ A;  5TNC A;  2LUX A;  1ZFS A;  2WCB A;  3KEV A;  3CZ0 A;  1RRO A;  1SY9 A;  1UP5 A;  1J7Q A;  1IWQ A;  1NUB A;  1TNX A;  1D1O A;  2LLT A;  1DGV A;  2Q91 A;  1QXP A;  2JT3 A;  2MRD A;  2OS8 B;  3C1V A;  2LMT A;  4HSZ A;  3DYE A;  4PE0 A;  5CSN A;  2KFG A;  1KFU L;  1A75 B;  1DJG A;  3WHU B;  3NSI A;  2QEV A;  1YRU B;  1C3Y A;  1R6P A;  4YI9 A;  2Y4Q A;  2KQY A;  3VGO A;  5IBW A;  2HQW A;  1Y1U A;  3CZ2 A;  3EKH A;  1JF2 A;  5D7F A;  4L9M A;  2H8V A;  1S5G Y;  1TN4 A;  1EG4 A;  2KHN A;  4ORA B;  2PRU A;  3I5H B;  1DVI A;  3LK1 A;  4OCI A;  1QAT A;  3AAJ A;  1M45 A;  1F55 A;  2LE9 B;  2MLE C;  4OZD A;  2K7O A;  2FOT A;  1KFX L;  2LVI A;  2MJW B;  2FCE A;  1CFP A;  1KQM B;  4GGF A;  3LK0 A;  3CDN A;  1OOG A;  4PHM A;  3SS3 A;  1JF0 A;  2NZ0 A;  2H61 A;  1S1E A;  2KLD A;  3ZWH A;  1ALW A;  1OZS A;  4MLW A;  3PN7 C;  2JZI A;  1JWD A;  2MLF C;  1OOI X;  4GGF C;  4YGB B;  2BKI B;  3L4L A;  1LA3 A;  1BF5 A;  3CLN A;  2H61 C;  4USL A;  3D0Y B;  1K96 A;  3I5I C;  2CNP A;  4GFT A;  1BOC A;  3K21 A;  1Y1A A;  3VRN A;  1NIW A;  2JNX A;  4HRE E;  5DKN A;  2LAP A;  1CFF A;  3SG6 A;  4I5K A;  1PK0 D;  5AEQ A;  1MXE A;  2Y1N A;  4M2P A;  3D77 A;  2K0J A;  3MSE B;  3OB2 B;  1PSB A;  2JQ6 A;  3D73 A;  3K1E A;  1KFU S;  1SR6 B;  4E68 A;  1A75 A;  1NSH A;  3BUW B;  3F45 A;  1ZAC A;  3LLE A;  5F6T A;  1SNL A;  4BY4 A;  2BEC A;  1OSA A;  1UHN A;  2B1U A;  1NCZ A;  2CXJ A;  2LVV A;  2NCO A;  4QJ3 B;  1DTL A;  2KI6 C;  4ZCU A;  3R1P A;  5CSJ A;  4M2Q A;  5FI2 A;  3NHT A;  2QEO A;  3Q8I A;  4WRI A;  3CAB A;  5D3O A;  2LAN A;  1XFZ O;  3AAK A;  3BFB A;  4GUK A;  3S0A A;  1NX1 A;  2OTG B;  1AVS A;  1QTX A;  4F7F A;  2WND A;  2JC2 A;  1FBV A;  2JXL A;  1C7V A;  4MZL A;  1QAS A;  1S36 A;  2BNX A;  3D74 A;  3EVU A;  2CCM A;  1YR5 A;  4CFR A;  3PLF B;  2MA2 A;  5K89 A;  1KCY A;  1NCY A;  1YX8 A;  2JU0 A;  3GOF A;  1NPQ A;  2JTT A;  4IL1 A;  5EL2 A;  1TIZ A;  1KQM C;  4FQO A;  1AJ4 A;  3H4S E;  1F70 A;  4JWQ A;  4PCW A;  5I94 A;  2KBI A;  1RTP 1;  3GK2 A;  4NDC A;  1W9Z A;  1GGZ A;  3D0Y A;  3TDZ A;  1F71 A;  3HX4 A;  1IRJ A;  1MR8 A;  1TCF A;  3FE9 A;  2G9B A;  1X02 A;  3AKA A;  1JFJ A;  2FCD A;  3S0B A;  3V2L A;  1FI5 A;  1XA5 A;  4M2O A;  2EHB A;  1M63 B;  4AOM A;  5HL1 A;  4ZCV A;  1QX7 A;  2L50 A;  4MN0 A;  1NX2 A;  1BR4 B;  1A03 A;  1LIN A;  3BQ3 A;  2SCP A;  4TNC A;  1JC2 A;  1S26 D;  1YTZ C;  5I2Q A;  5HKY A;  1ODB A;  3JTD B;  1WRZ A;  2LP2 A;  2BBN A;  5AER A;  2LMU A;  3O2P A;  1BT6 A;  3FWC A;  2M97 A;  3CR4 X;  1GQM A;  3I5F B;  2K7D A;  5DKR A;  1IJ5 A;  2I18 A;  2ISD A;  1B8L A;  4PHJ A;  5KU1 A;  1XYD A;  1K2H A;  1OOJ A;  3IQO A;  1U5I B;  2G2B A;  3DZT A;  2NLN A;  3KHE A;  1GJY A;  1EG3 A;  1NCX A;  3D75 A;  3KO0 A;  1M39 A;  2OTG C;  2PMY A;  3PN7 B;  5DIC A;  1J1E A;  1XFV O;  2WOS A;  3JVT B;  3L47 A;  2PAS A;  1HT9 A;  2WC6 A;  1CM4 A;  3BXK A;  3O4Y A;  3SG7 A;  4C0L A;  1RJV A;  1R2U A;  3LCP C;  3DD4 A;  2AMI A;  3KPX A;  2RGI A;  4I5N B;  3EKJ A;  1K94 A;  2LVK A;  3SIB A;  1DJH A;  2F33 A;  3D78 A;  3CTN A;  4YGE B;  1CMG A;  4I5J A;  2JPO A;  1KK8 B;  2COL B;  1BG1 A;  1MHO A;  3BJH A;  2NCP A;  1J55 A;  1UHH A;  3SIA A;  4PT1 A;  2KBM A;  3FE6 A;  3R1O A;  3RLZ A;  3DVJ A;  2WCK A;  3BUN B;  2HF5 A;  3FS7 A;  3WXA A;  2KSP A;  4AQI A;  2EGD A;  5I8N A;  1S5G Z;  1C07 A;  3BUX B;  1SMG A;  1CTR A; 
#chains in the Genus database with same CATH homology
 3OB1 B;  4GGN A;  1MWN A;  2JT8 A;  3PSR A;  1A29 A;  1NX3 A;  1WRK A;  3VRR A;  3OP0 A;  3JTD C;  3GK1 A;  1F54 A;  3I5G B;  3O6B A;  3TS5 C;  1NP8 A;  4DS7 A;  1EJ3 A;  1XFX O;  4N1G A;  3AKB A;  3ZNI A;  4QJ5 B;  3I5F C;  2KFF A;  1U5I A;  2M49 B;  4MSP A;  3CWG A;  1IQ5 A;  2GGZ A;  1PVB A;  1LKJ A;  2MHH A;  5ER5 A;  5DKQ A;  1AP4 A;  1VRK A;  3EVR A;  1AJ5 A;  2L4H A;  5CSF A;  4HRG A;  1H8B A;  2BCA A;  1PUL A;  3BOW B;  3DF0 B;  3JVT C;  1B8R A;  1F4Q A;  4R1E A;  4PE1 A;  3CZT X;  1Y0V H;  4N5X A;  3D10 A;  2NXQ A;  2QAC A;  2DOQ A;  1KK7 Y;  1CKK A;  2KAV A;  2JRF A;  1QS7 A;  2BKH B;  1K9U A;  1YVL A;  4QJ4 B;  5ER4 X;  2M0R A;  1IKU A;  1F8H A;  3IF7 A;  1OZO A;  1S6C A;  3OHM B;  1KK8 C;  1J7O A;  1S3P A;  3DVK A;  1SYM A;  1K90 D;  1J7R A;  4NDB A;  2AUC A;  3BUO B;  4CID A;  2ZNE A;  1TRF A;  1LVC D;  1DJI A;  2P6B B;  2CT9 A;  1FW4 A;  2R2I A;  1JUO A;  1KFX S;  3I5G C;  2LLU A;  4ORB B;  4F0Z B;  1SRA A;  4PAL A;  1WLZ A;  2H2K A;  4MEW A;  1Y1X A;  1IJ6 A;  1KSM A;  5CPV A;  3BOW A;  1YX7 A;  1PSR A;  3DF0 A;  3EK8 A;  4PHN A;  1K8U A;  4JQ0 D;  4MVF A;  1BOD A;  1B47 A;  1V1F A;  3SG4 A;  4AQJ A;  1A2X A;  4DCK A;  1SBJ A;  1DF0 B;  4YGA A;  4PE7 A;  1K9K A;  2JPT A;  1DT7 B;  1RK9 A;  1S6I A;  5D69 A;  4MRY A;  2KGR A;  2KOT A;  2PVB A;  1ALV A;  2F3Y A;  3SG2 A;  1PRW A;  2LUC A;  1LXF C;  1Y6W A;  2ZFD A;  1QX5 B;  1TTX A;  1ZOT B;  5HKZ A;  5HLV A;  2M7L A;  3TS5 B;  1OMV A;  4PHK A;  1XVJ A;  1LA0 A;  4C0K A;  3CGA A;  1XK4 A;  1KSO A;  1A4P A;  1M46 A;  3SG3 A;  1QIW A;  1XK4 C;  1PVA A;  1RWY A;  2EC6 C;  1MQ1 A;  1QX2 A;  4JPZ B;  1CDL A;  2JUL A;  1QLK A;  1YUT A;  1B7T Y;  2GGM A;  5FYX A;  1YUS A;  2LC5 A;  1GGW A;  3E3R A;  4P2Y B;  5G08 A;  4YGC B;  2JOJ A;  2Y5I A;  2M1U A;  1CLB A;  1QVI Y;  3SG5 A;  2I7A A;  2LMV A;  2KI4 B;  1ZUZ A;  4CFQ A;  3PM8 A;  2LHI A;  2I2R E;  1NYA A;  2BL0 B;  4YBH B;  1DF0 A;  2BBM A;  1WY9 A;  3DVE A;  3FWB A;  1SKT A;  4P5O E;  5PAL A;  1MXL C;  3QRX A;  1F4O A;  1CB1 A;  3PAL A;  4BY5 A;  1V1G A;  1E8A A;  1SL7 A;  1SL8 A;  2K61 A;  2K8M B;  3EK4 A;  1JSA A;  1OE9 B;  1M31 A;  2LM5 A;  3IQQ A;  1BR1 B;  1CLL A;  3OX6 A;  1SW8 A;  2BE6 A;  3A4U B;  1IG5 A;  1B8C A;  3VRO A;  2LVJ A;  1IGV A;  1N2D A;  2L5X B;  4UPG A;  1CDM A;  1QV0 A;  1IQ3 A;  1G8I A;  3HCM A;  2KQ6 A;  2PAL A;  4I5L B;  4WQ3 A;  3WNX B;  1BLQ A;  1H4B A;  4FTG A;  5AFP A;  1SMG A;  2L51 A;  2AAO A;  2HQ8 A;  5B8I B;  3TZ1 A;  3NSK A;  1CLM A;  4CPV A;  3PAT A;  3EK7 A;  4GAO A;  2GV5 A;  2WOR A;  2M8U A;  1G4Y R;  1K95 A;  1WLM A;  1L7Z A;  3M0W A;  2JXC A;  2K7C A;  2LV7 A;  2M9G A;  1CM1 A;  1KWO B;  2CBL A;  1UHK A;  2CTN A;  1XFW O;  1KK7 Z;  3LL8 B;  1MF8 B;  4WQ2 A;  1RFJ A;  2BE4 A;  2JNF A;  5I2L A;  2JWW A;  4YI8 A;  1AK8 A;  3VRP A;  3WHT B;  1XFY O;  4ETO A;  2FJU B;  2TN4 A;  1S6J A;  1CDN A;  2IS9 A;  1AHR A;  2ZRS A;  3TDI A;  2KI4 C;  1TNW A;  4MZK A;  1TNQ A;  2BL0 C;  2ZKM X;  3TUY B;  2E30 A;  1JFK A;  2A4J A;  4U8D A;  1ZMZ A;  1SPY A;  2KAX A;  4ORC B;  3BYA A;  1UUS A;  1DMO A;  1UHI A;  2LLS A;  1SL9 A;  5CSI A;  1OQP A;  2KFH A;  1K93 D;  3ICB A;  2EC6 B;  3SJS A;  4N1F A;  1MUX A;  1WDC B;  2SAS A;  1BU3 A;  1N65 A;  2M29 A;  5AXI A;  3O78 A;  2JTZ A;  3PFV A;  1CFC A;  4GNK B;  1QIV A;  1SCV A;  2LCP A;  2O5G A;  1NWD A;  4Q04 A;  1EH2 A;  3NSO A;  1DJW A;  4OR9 B;  4DIR A;  2L0P A;  1BJF A;  2KYF A;  1OMR A;  2Y1M A;  2OS8 C;  1FPW A;  1YUR A;  2L98 A;  1YRT B;  2I94 A;  1BMO A;  4OKH A;  1KWO C;  2V53 A;  4YRU A;  5HKW A;  3BUM B;  5GQQ C;  2ZND A;  2MBX A;  1DJZ A;  2F2P A;  2WCF A;  2ZRT A;  2F2O A;  4XJK B;  4A4C A;  1Q80 A;  2KNE A;  1CMF A;  1DGU A;  1AUI B;  1K9P A;  1L2O B;  3I5H C;  1YVH A;  4MBE A;  3CR5 X;  1N0Y A;  1FI6 A;  1C7W A;  4YGD B;  1W7J B;  1W7I B;  2E6W A;  1SCM B;  4OVN F;  3VRQ A;  2WC8 A;  5HLO A;  1G33 A;  4XYN A;  4DRW A;  3TUY C;  2KYC A;  1CFD A;  2BCX A;  1UHJ A;  1XFU O;  1B9A A;  1NX0 A;  1B1G A;  2VRG A;  2L2E A;  2LHL A;  5KTY A;  1TNP A;  1REC A;  1DJX A;  2F8P A;  1B7T Z;  2O60 A;  3TDU A;  2JT0 A;  2K2F A;  1WRL A;  1YUU A;  4C0L A;  2KI6 D;  2ZN9 A;  5JJG A;  1WDC C;  4GPL B;  2K7B A;  1EL4 A;  2K2A A;  4MRX A;  5AAN A;  5KSZ A;  1EXR A;  1SK6 D;  1QLS A;  4PE4 A;  2M7N A;  3GK4 X;  3NSL A;  1QVI Z;  1IH0 A;  2ZN8 A;  2QPT A;  3NXA A;  1J1D A;  3OX5 A;  4HRH A;  4CLN A;  2M1K B;  1SR6 C;  1UUR A;  2HPS A;  2KAY A;  2M3W A;  4GBA A;  5HYD A;  1JBA A;  4NDD A;  1J7P A;  5J3X A;  1CNP A;  4PDZ A;  4XJK A;  1DJY A;  3A8R A;  1TCO B;  1XO5 A;  2MAZ A;  1CDP A;  4DUQ A;  2F3Z A;  3DVM A;  2PSR A;  4OV2 A;  1QV1 A;  4D1E A;  3CS1 A;  4ICB A;  2BCB A;  2LP3 A;  1OMD A;  3EVV A;  4NQG A;  1PAL A;  3FIA A;  2D8N A;  1L2O C;  1KQV A;  2WCE A;  3I5I B;  2OPO A;  3RM1 A;  2HET A;  2Q4U A;  1SCM C;  4MZJ A;  5JOL A;  4C0J A;  5I2O A;  1B4C A;  1FF1 A;  4A4B A;  2L4I A;  3KF9 A;  1QJT A;  2KGB C;  3CR2 A;  1TOP A;  2KDH A;  1HQV A;  5BPJ A;  2LNK A;  1UWO A;  5TNC A;  2LUX A;  1ZFS A;  2WCB A;  3KEV A;  1RRO A;  1SY9 A;  1UP5 A;  1J7Q A;  1IWQ A;  1NUB A;  1TNX A;  2LLT A;  1DGV A;  2Q91 A;  1QXP A;  2JT3 A;  2MRD A;  2OS8 B;  3C1V A;  2LMT A;  4HSZ A;  4PE0 A;  5CSN A;  2KFG A;  1KFU L;  1A75 B;  1DJG A;  3WHU B;  3NSI A;  1YRU B;  1R6P A;  4YI9 A;  2Y4Q A;  2KQY A;  3VGO A;  5IBW A;  2HQW A;  1Y1U A;  3EKH A;  5D7F A;  1JF2 A;  4L9M A;  1S5G Y;  1TN4 A;  1EG4 A;  2KHN A;  4ORA B;  2PRU A;  3I5H B;  1DVI A;  3LK1 A;  4OCI A;  1QAT A;  3AAJ A;  1M45 A;  1F55 A;  2LE9 B;  2MLE C;  2K7O A;  2FOT A;  1KFX L;  2LVI A;  2MJW B;  2FCE A;  1CFP A;  1KQM B;  4GGF A;  3LK0 A;  4PHM A;  1JF0 A;  2NZ0 A;  2H61 A;  1S1E A;  3ZWH A;  1ALW A;  1OZS A;  4MLW A;  3PN7 C;  2JZI A;  1JWD A;  2MLF C;  4GGF C;  4YGB B;  2BKI B;  1LA3 A;  1BF5 A;  3CLN A;  2H61 C;  4USL A;  3D0Y B;  1K96 A;  3I5I C;  2CNP A;  4GFT A;  1BOC A;  3K21 A;  1Y1A A;  3VRN A;  1NIW A;  2JNX A;  4HRE E;  5DKN A;  2LAP A;  1CFF A;  3SG6 A;  4I5K A;  1PK0 D;  5AEQ A;  1MXE A;  2Y1N A;  4M2P A;  2K0J A;  3MSE B;  3OB2 B;  1PSB A;  2JQ6 A;  1KFU S;  1SR6 B;  4E68 A;  1A75 A;  1NSH A;  3BUW B;  3F45 A;  1ZAC A;  3LLE A;  5F6T A;  1SNL A;  4BY4 A;  2BEC A;  1OSA A;  1UHN A;  2B1U A;  1NCZ A;  2CXJ A;  2LVV A;  2NCO A;  4QJ3 B;  1DTL A;  2KI6 C;  4ZCU A;  1D1O A;  5CSJ A;  4M2Q A;  4WRI A;  2LAN A;  1XFZ O;  3AAK A;  4GUK A;  1NX1 A;  2OTG B;  1AVS A;  1QTX A;  2WND A;  2JC2 A;  1FBV A;  2JXL A;  1C7V A;  4MZL A;  1QAS A;  1S36 A;  3EVU A;  2CCM A;  1YR5 A;  4CFR A;  3PLF B;  2MA2 A;  5K89 A;  1KCY A;  1NCY A;  1YX8 A;  2JU0 A;  3GOF A;  1NPQ A;  2JTT A;  4IL1 A;  1TIZ A;  1KQM C;  4FQO A;  1AJ4 A;  3H4S E;  1F70 A;  4JWQ A;  4PCW A;  2KBI A;  1RTP 1;  3GK2 A;  4NDC A;  1GGZ A;  3D0Y A;  3TDZ A;  1F71 A;  3HX4 A;  1IRJ A;  1MR8 A;  1TCF A;  2G9B A;  1X02 A;  3AKA A;  1JFJ A;  2FCD A;  1FI5 A;  1XA5 A;  4M2O A;  2EHB A;  1M63 B;  4AOM A;  4ZCV A;  1QX7 A;  2L50 A;  4MN0 A;  1NX2 A;  1BR4 B;  1A03 A;  1LIN A;  3BQ3 A;  2SCP A;  4TNC A;  1JC2 A;  1S26 D;  1YTZ C;  5I2Q A;  5HKY A;  1ODB A;  3JTD B;  1WRZ A;  2LP2 A;  5AER A;  2LMU A;  3O2P A;  1BT6 A;  3FWC A;  2M97 A;  3CR4 X;  1GQM A;  3I5F B;  2K7D A;  5DKR A;  1IJ5 A;  2I18 A;  2ISD A;  1B8L A;  4PHJ A;  5KU1 A;  1XYD A;  1K2H A;  1OOJ A;  3IQO A;  1U5I B;  2G2B A;  2NLN A;  3KHE A;  1GJY A;  1EG3 A;  1NCX A;  3KO0 A;  1M39 A;  2OTG C;  2PMY A;  3PN7 B;  1J1E A;  1XFV O;  2WOS A;  3JVT B;  2PAS A;  1HT9 A;  3BXK A;  1CM4 A;  3O4Y A;  3SG7 A;  1RJV A;  1R2U A;  3LCP C;  3DD4 A;  2AMI A;  3KPX A;  2RGI A;  4I5N B;  3EKJ A;  1K94 A;  2LVK A;  3SIB A;  1DJH A;  2F33 A;  4YGE B;  3CTN A;  1CMG A;  4I5J A;  1KK8 B;  2COL B;  1BG1 A;  1MHO A;  2NCP A;  1J55 A;  1UHH A;  3SIA A;  2KBM A;  3RLZ A;  3DVJ A;  3BUN B;  2HF5 A;  3FS7 A;  3WXA A;  2KSP A;  4AQI A;  2EGD A;  5I8N A;  1S5G Z;  1C07 A;  3BUX B;  2BBN A;  1CTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...