4PHKA

The structural basis of differential inhibition of human calpain by indole and phenyl alpha-mercaptoacrylic acids. the complex with (z)-3-(4-chlorophenyl)-2-mercaptoacrylic acid
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
173
structure length
173
Chain Sequence
EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Calpain small subunit 1
publication title The structural basis of differential inhibition of human calpain by indole and phenyl alpha-mercaptoacrylic acids.
pubmed doi rcsb
source organism Homo sapiens
total genus 64
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4phkA00
2QACA 3O78A 4TNCA 2KFHA 2K7OA 3K21A 1IGVA 3SJSA 1NCYA 1AJ5A 2KGRA 4NDCA 4YGDB 4CLNA 5KTYA 2HQWA 4GAOA 1UHKA 5HKYA 1YRUB 5AERA 1JF2A 1L2OB 2OTGB 4DUQA 3MSEB 1V1GA 1CM1A 3IQQA 1YUTA 1G8IA 4QJ4B 3VRRA 2BL0B 1UUSA 2K8MB 4A4CA 2E30A 3WNXB 1UHNA 3TDUA 1IJ6A 3TZ1A 4MVFA 2CCMA 1F4QA 2PSRA 1X02A 2KYCA 2ISDA 1K94A 2KAVA 2LUCA 2NLNA 3BUNB 1N0YA 1K9UA 2KHNA 3D0YA 3H4SE 4MRXA 1KWOC 2TN4A 3NSIA 2P6BB 3KF9A 4NQGA 1TRFA 1M31A 3DVMA 2L50A 1LXFC 4R1EA 3LK1A 2JTZA 5GQQC 1B7TY 1SKTA 3CTNA 3LLEA 4PDZA 2M7NA 1GQMA 2GGMA 1MR8A 1NSHA 1DJXA 1BR4B 1J7QA 1CM4A 5DKRA 1XFZO 4P2YB 2WOSA 2CTNA 1Y6WA 2HF5A 2L5XB 1B9AA 1QX2A 1LKJA 4JWQA 2Y4QA 1U5IA 4ZCUA 2FJUB 2L4IA 4NDBA 2JT3A 3BUXB 4E68A 2WORA 1IG5A 2K2AA 2M7LA 2ZFDA 4MBEA 3KPXA 2KBIA 2KI6D 4YBHB 4Q04A 4C0LA 2JT0A 1SL8A 4PHJA 5DKNA 4PALA 1MXLC 2LV7A 2WCEA 2BE6A 2MAZA 1GGZA 1SK6D 3I5FB 2EC6B 3AKAA 1CDLA 1N65A 2HQ8A 2PVBA 1JC2A 4XJKA 1J7PA 1QVIY 2LVJA 5TNCA 2K7BA 1LA3A 4C0JA 2LP2A 1YVLA 1XFUO 2F2OA 3I5IC 3I5GC 2MLFC 1S5GY 2Y1MA 2R2IA 3SG6A 2QPTA 2G9BA 1AK8A 5AANA 1C7VA 1B8CA 1J1EA 1XFWO 4YGEB 1JSAA 2JULA 4HSZA 1L2OC 4A4BA 1CTRA 2AAOA 1FBVA 1HT9A 4D1EA 3PN7B 4QJ5B 1M63B 2F8PA 1KFXS 5CSFA 3SG5A 1Y1UA 1NUBA 4PHKA 2F3YA 1NX1A 1EG4A 1J7RA 3OB2B 1XVJA 3CR5X 4ORCB 1SCVA 2LMTA 1DJGA 3GK1A 3BOWB 5I8NA 1YUUA 3LCPC 1IWQA 1CKKA 3TUYB 1KQMB 2Q4UA 1S36A 3NSLA 3KO0A 1BODA 3HX4A 2KDHA 1TNPA 2PASA 3DD4A 4GFTA 2M9GA 1DMOA 1DGUA 2FOTA 1MQ1A 4QJ3B 4PCWA 1QX7A 2LNKA 3OHMB 2RGIA 2ZRSA 3JVTB 3F45A 4M2OA 3OX5A 3DF0A 5AXIA 1UWOA 4DRWA 1AP4A 2I2RE 2CXJA 3BYAA 4ETOA 3SG3A 1F4OA 2BKHB 1KK7Z 1MF8B 1RECA 2NCOA 5AEQA 1M39A 4N1GA 1BOCA 1YRTB 1S3PA 4MZKA 1GJYA 5HLOA 2FCDA 3CGAA 3EVUA 1CLBA 3WHUB 3EVRA 2M97A 1NX3A 3GOFA 3GK4X 1KCYA 1PVBA 1B8RA 1S26D 2O5GA 1KK8C 1IRJA 2LM5A 2PALA 3CZTX 2EHBA 1SPYA 4WQ3A 1L7ZA 2LCPA 2ZN8A 1CFFA 3SIBA 2ZN9A 2SCPA 1QV0A 2H61A 2F33A 3NXAA 4OV2A 2AMIA 2I94A 1OE9B 5B8IB 2KOTA 1BJFA 1JF0A 3BXKA 4BY5A 2Y5IA 4BY4A 1AUIB 4MZJA 3D0YB 4OCIA 4CFQA 3I5HB 4YGAA 2COLB 3KEVA 2EGDA 1TNWA 1NIWA 2LP3A 2OPOA 3PM8A 1CLMA 1EXRA 2LLSA 3PN7C 1UURA 1FI6A 2LHLA 2E6WA 1SCMB 1B7TZ 2KQYA 2Q91A 1DTLA 1K93D 1OZSA 1QXPA 1SR6C 1LA0A 2JQ6A 4GGNA 1W7JB 4MEWA 3PFVA 3SG7A 3NSOA 4GBAA 5J3XA 1XA5A 4DS7A 5K89A 1A03A 1OQPA 1NPQA 2D8NA 4MRYA 4PE0A 5HKZA 4YI9A 1BT6A 1WRKA 1Y0VH 1DJHA 1U5IB 2K2FA 1F54A 1FI5A 3BUOB 3TUYC 1OSAA 3AAKA 1RTP1 3BUMB 4CFRA 5CSJA 5FYXA 1SY9A 3CR2A 3DVEA 1SYMA 1TCOB 2ZRTA 2ZKMX 1A2XA 2JNXA 4GGFC 3O6BA 1DT7B 2KI6C 3OP0A 1WY9A 1YVHA 2NCPA 2CNPA 3ZNIA 2K0JA 3QRXA 1YUSA 4AOMA 2MLEC 1CNPA 2L51A 1MWNA 4XJKB 1S1EA 4YI8A 1CFCA 2OS8C 1NX0A 1D1OA 4L9MA 4M2QA 3RLZA 2KGBC 5IBWA 1K2HA 4I5JA 3C1VA 1QTXA 1KSOA 1QVIZ 2BBMA 5BPJA 2BE4A 1BMOA 1DJYA 2GGZA 2M0RA 3EVVA 1OMVA 3IQOA 4MSPA 4GUKA 1ZACA 1NX2A 1KFXL 1S5GZ 2BECA 2LLTA 1CLLA 1NP8A 2KAYA 2KAXA 2OTGC 3LL8B 3SG4A 1DJZA 4XYNA 1KFUS 2BL0C 1QLKA 5I2QA 1K9KA 3O4YA 2KSPA 2KYFA 2BCXA 1XYDA 1S6CA 2F3ZA 1PALA 1OZOA 2LE9B 1XK4C 2AUCA 3WXAA 1BU3A 1S6IA 1YX7A 4JPZB 1RFJA 1QJTA 1DGVA 5KU1A 1QASA 1XO5A 3JTDB 1PULA 3WHTB 4C0KA 1PRWA 1TIZA 1YX8A 4WQ2A 1F71A 1JFJA 1SMGA 3AKBA 1EH2A 2M49B 5KSZA 2WNDA 2A4JA 2KI4B 2ZNEA 3HCMA 4NDDA 2NZ0A 1DF0A 2Y1NA 3ZWHA 5I2LA 4CPVA 2K7DA 1Q80A 1LINA 1XFXO 3BQ3A 1YR5A 1QIVA 1R2UA 3EKJA 4YGCB 4DIRA 1F70A 2NXQA 3EK7A 3DF0B 5JJGA 2JT8A 2DOQA 1QIWA 4ORBB 2M29A 1TNXA 1KQVA 2MRDA 3ICBA 1UHHA 5G08A 2M1KB 4ZCVA 5DKQA 1ZMZA 1PSBA 5ER4X 4USLA 4PHMA 2L4HA 3VRQA 1SBJA 1MHOA 2IS9A 1JWDA 1G4YR 2FCEA 2ZNDA 2BKIB 5CPVA 1EL4A 2MBXA 2SASA 1DVIA 1MXEA 2JWWA 2VRGA 1FF1A 3I5FC 2EC6C 3EK4A 2I7AA 1DJIA 2MJWB 1A75A 1K8UA 4N1FA 4FTGA 1TNQA 1CB1A 1SNLA 2JRFA 5HYDA 1B4CA 3D10A 3I5IB 1W7IB 3I5GB 3TDIA 3OB1B 3CWGA 2KNEA 3OX6A 1BF5A 1J7OA 1H4BA 1IQ5A 2F2PA 1ZOTB 4PHNA 2JZIA 1ZUZA 1RJVA 1WLMA 2M1UA 1AJ4A 1J55A 1VRKA 3TS5B 1XFVO 1QLSA 1BG1A 3CR4X 2LHIA 1SRAA 1K9PA 3SG2A 1Y1AA 1RK9A 1TN4A 4AQJA 1DJWA 4P5OE 3VRNA 2LANA 1XK4A 3IF7A 3VROA 1WRZA 1NCZA 2L98A 1B8LA 1WDCB 1YTZC 1G33A 2GV5A 3O2PA 1H8BA 1JUOA 4YRUA 2M3WA 1RROA 2JTTA 2V53A 4PE1A 3JTDC 1BR1B 4M2PA 3RM1A 1KQMC 4DCKA 4F0ZB 1C7WA 1JBAA 1J1DA 3A4UB 1ALWA 2KI4C 2JXLA 1EG3A 4UPGA 2KQ6A 1K96A 2MHHA 4PE7A 2KFFA 1CDNA 1QATA 2HETA 2BBNA 1N2DA 4ORAB 4PE4A 1ALVA 1NYAA 2KBMA 1M46A 1TOPA 4HRGA 1SL7A 4IL1A 4YGBB 2JOJA 2K7CA 3EK8A 2PRUA 2LLUA 2LVKA 1B47A 1OOJA 1E8AA 3FIAA 1ZFSA 3JVTC 1QV1A 4WRIA 1CFDA 1HQVA 2I18A 1BLQA 3PLFB 2WCBA 3VGOA 1C07A 1CFPA 1K90D 2BCBA 5AFPA 2JPTA 2CT9A 2LUXA 3PSRA 1V1FA 1NCXA 3EKHA 1SW8A 1UHIA 4OKHA 5HLVA 1KFUL 1F55A 1UHJA 5ER5A 5CSIA 1A29A 1KSMA 5D69A 2WCFA 4I5KA 1KK8B 2JU0A 2LVIA 4I5NB 2B1UA 3BUWB 2M8UA 3E3RA 3LK0A 2K61A 4OVNF 1WLZA 4N5XA 5I2OA 5CSNA 3VRPA 1CMGA 2H61C 2HPSA 1ODBA 2PMYA 3A8RA 3NSKA 1K95A 1UP5A 1OMRA 4GPLB 5D7FA 1NWDA 1IH0A 4GNKB 3FWBA 1QS7A 1AVSA 1MUXA 1R6PA 1KWOB 2LAPA 3SIAA 2LC5A 1IQ3A 1QX5B 1PSRA 3I5HC 2O60A 4HREE 1IKUA 5JOLA 1S6JA 5F6TA 1TCFA 2LMVA 3TS5C 4MN0A 4I5LB 1AHRA 1PVAA 3GK2A 1DF0B 1M45A 1CDMA 3DVJA 1B1GA 1RWYA 4MZLA 4FQOA 4CIDA 3KHEA 1A4PA 2KFGA 3CS1A 3FWCA 2JC2A 1Y1XA 3PALA 4ICBA 4MLWA 1SCMC 1SR6B 2BCAA 1WDCC 3DVKA 4HRHA 2JNFA 4AQIA 3FS7A 1FPWA 2MA2A 1LVCD 1WRLA 1IJ5A 3BOWA 1F8HA 1CMFA 1GGWA 2L0PA 1FW4A 3CLNA 1OMDA 2CBLA 2JXCA 1PK0D 5PALA 2LMUA 4OR9B 1YURA 3PATA 4GGFA 3TDZA 3AAJA 1TTXA 2G2BA 2LVVA 1XFYO 4JQ0D 2H2KA 2L2EA 1CDPA 3M0WA 5HKWA 2OS8B 1SL9A 2WC8A 1JFKA 1KK7Y 4U8DA 1A75B 1EJ3A
chains in the Genus database with same CATH superfamily
2QACA 3D73A 3O78A 4TNCA 2KFHA 2K7OA 3K21A 1IGVA 3SJSA 1NCYA 1AJ5A 2KGRA 4NDCA 4YGDB 4CLNA 5KTYA 2HQWA 3CZ1A 4GAOA 1UHKA 5HKYA 1YRUB 5AERA 2GTEA 1JF2A 1L2OB 2OTGB 4DUQA 3MSEB 1V1GA 1CM1A 3IQQA 1YUTA 1G8IA 4QJ4B 3D75A 3VRRA 2BL0B 1UUSA 2K8MB 4A4CA 2E30A 3WNXB 1UHNA 3TDUA 1IJ6A 3TZ1A 4MVFA 2CCMA 1F4QA 2PSRA 1X02A 2KYCA 2ISDA 1K94A 2KAVA 2LUCA 2NLNA 3BUNB 2PYQA 1N0YA 1K9UA 2KHNA 3BFBA 3D0YA 3H4SE 3L4AA 4MRXA 1KWOC 2TN4A 3NSIA 1OOFA 2P6BB 3KF9A 4NQGA 1TRFA 1M31A 3DVMA 2L50A 4JD9A 1LXFC 4R1EA 3LK1A 2JTZA 5GQQC 1B7TY 1SKTA 2WCKA 1T14A 3CTNA 3LLEA 4PDZA 2WCHA 2M7NA 2QDIA 1GQMA 2GGMA 1OW4A 1MR8A 2FJYA 3L47A 3BFAA 1NSHA 1DJXA 1BR4B 2KLDA 3NHTA 1J7QA 2WC5A 1CM4A 5DKRA 1XFZO 4P2YB 2WOSA 2CTNA 1Y6WA 2HF5A 2L5XB 1B9AA 1QX2A 1LKJA 3QMEA 2Y4QA 4JWQA 1U5IA 4ZCUA 2FJUB 3RZSA 2L4IA 4NDBA 2JT3A 3BUXB 4E68A 2WORA 1IG5A 2K2AA 2M7LA 2ZFDA 3FE6A 4MBEA 3KPXA 2KBIA 2KI6D 3D74A 4Q04A 4YBHB 4C0LA 3B87A 2JT0A 1SL8A 4PHJA 5DKNA 2YGUA 4PALA 1MXLC 2LV7A 2WCEA 2BE6A 4INWA 2MAZA 1GGZA 1SK6D 3I5FB 2EC6B 3AKAA 1CDLA 1N65A 2HQ8A 2PVBA 1JC2A 4XJKA 1J7PA 1QVIY 2LVJA 5TNCA 2K7BA 1LA3A 4C0JA 2LP2A 1YVLA 1XFUO 2F2OA 3I5IC 3I5GC 2MLFC 1S5GY 2Y1MA 2R2IA 3SG6A 2QPTA 2G9BA 1AK8A 5AANA 1C7VA 1B8CA 1J1EA 1XFWO 4YGEB 1JSAA 2JULA 4HSZA 1L2OC 4A4BA 1DEKA 1CTRA 2AAOA 1FBVA 1HT9A 4D1EA 2P71A 3PN7B 4QJ5B 1M63B 2QEHA 2F8PA 1KFXS 5CSFA 3SG5A 1Y1UA 2WCMA 1NUBA 4PHKA 2F3YA 3EG5B 1NX1A 4F7FA 1EG4A 1J7RA 1SSEB 3OB2B 3CDNA 2H8VA 1XVJA 3CR5X 4ORCB 1SCVA 2LMTA 1DJGA 3GK1A 3BOWB 5I8NA 1YUUA 3LCPC 1IWQA 1CKKA 3TUYB 1KQMB 2Q4UA 1S36A 3NSLA 5HL1A 3KO0A 1BODA 3HX4A 2KDHA 1TNPA 2PASA 3DD4A 4GFTA 2M9GA 1DMOA 1DGUA 2FOTA 1MQ1A 4QJ3B 4PCWA 3NGVA 1QX7A 2LNKA 5EL2A 3OHMB 2RGIA 2ZRSA 3JVTB 3F45A 4M2OA 3OX5A 3DF0A 5AXIA 1UWOA 4DRWA 1AP4A 3CZ0A 2I2RE 2CXJA 3BYAA 3S0EA 4ETOA 3SG3A 1F4OA 2BKHB 4IJ7A 1KK7Z 1MF8B 1RECA 2NCOA 5AEQA 1M39A 4N1GA 1BOCA 1YRTB 1S3PA 4MZKA 1GJYA 5HLOA 4PT1A 2FCDA 3CGAA 3EVUA 1CLBA 3WHUB 3EVRA 2M97A 1NX3A 2KPHA 3GOFA 2JPOA 3GK4X 1KCYA 1PVBA 1B8RA 1S26D 2O5GA 1KK8C 1IRJA 2LM5A 2PALA 3CZTX 2EHBA 1SPYA 4WQ3A 1L7ZA 3SS5A 2LCPA 2ZN8A 1CFFA 3SIBA 2ZN9A 2SCPA 1QV0A 2H61A 2F33A 3NXAA 4OV2A 2AMIA 2I94A 1OE9B 2ERBA 2KOTA 5B8IB 1BJFA 1JF0A 3BXKA 4BY5A 3FE9A 2Y5IA 4BY4A 3S0FA 1AUIB 4MZJA 3D0YB 4OCIA 4CFQA 3I5HB 3PM2A 4YGAA 2COLB 3KEVA 2EGDA 1TNWA 1NIWA 2LP3A 2OPOA 3B88A 3PM8A 1CLMA 1EXRA 1TUZA 2LLSA 3PN7C 1UURA 2BAPA 1FI6A 1QWVA 2LHLA 3DXLA 2E6WA 5FI6A 1SCMB 1B7TZ 3B6XA 2KQYA 3CYZA 1C3ZA 2Q91A 1DTLA 1K93D 1OZSA 1QXPA 1SR6C 1LA0A 2JQ6A 4GGNA 1W7JB 4MEWA 3PFVA 3SG7A 3NSOA 4GBAA 5J3XA 1XA5A 4DS7A 5K89A 1A03A 1OQPA 1NPQA 2D8NA 4MRYA 4PE0A 5HKZA 4YI9A 1BT6A 1WRKA 1Y0VH 1DJHA 1U5IB 2K2FA 1F54A 1FI5A 3BUOB 3TUYC 1OSAA 3AAKA 1RTP1 3BUMB 3D77A 4CFRA 5CSJA 5FYXA 1SY9A 2WCLA 3CR2A 1SYMA 1TCOB 2ZRTA 2ZKMX 3DVEA 1A2XA 2JNXA 4GGFC 3O6BA 1DT7B 2KI6C 3OP0A 3PJIA 1WY9A 1YVHA 2PQLA 2NCPA 2CNPA 3ZNIA 1IIOA 2K0JA 3QRXA 1YUSA 4AOMA 2MLEC 1CNPA 2L51A 1MWNA 4XJKB 1S1EA 2KLEA 4YI8A 3NHIA 2L5YA 2OS8C 1NX0A 3IVTA 4L9MA 4M2QA 1CFCA 1D1OA 3RLZA 2KGBC 5IBWA 1K2HA 4I5JA 3C1VA 1QTXA 1KSOA 1QVIZ 2BBMA 5BPJA 2BE4A 3UNWA 1BMOA 1DJYA 2GGZA 2M0RA 3EVVA 1OMVA 3B7AA 3IQOA 4MSPA 4GUKA 2P70A 1ZACA 4FQTA 1NX2A 1KFXL 1S5GZ 2BECA 2LLTA 1CLLA 1NP8A 2KAYA 2KAXA 2OTGC 3LL8B 3SG4A 1DJZA 4XYNA 1KFUS 5FI2A 2BL0C 1QLKA 5I2QA 1K9KA 3O4YA 2KSPA 4JKTA 2KYFA 2BCXA 1XYDA 1S6CA 2F3ZA 2L2CA 1PALA 1OZOA 2LE9B 1XK4C 2AUCA 3WXAA 1BU3A 1S6IA 1YX7A 1C3YA 4JPZB 1RFJA 1QJTA 1DGVA 5KU1A 1QASA 1XO5A 3JTDB 1PULA 3WHTB 4C0KA 1PRWA 1TIZA 1YX8A 4WQ2A 1F71A 1JFJA 1SMGA 3AKBA 1EH2A 2M49B 5KSZA 2WNDA 2A4JA 2KI4B 2ZNEA 3HCMA 4NDDA 2NZ0A 1DF0A 2Y1NA 3ZWHA 3R1PA 5I2LA 4CPVA 2K7DA 1Q80A 1LINA 1P28A 1XFXO 1YR5A 3BQ3A 1QIVA 1R2UA 3EKJA 3OBVA 4YGCB 4DIRA 1DC1A 1F70A 2NXQA 3EK7A 1DELA 3DF0B 5JJGA 2JT8A 2DOQA 1QIWA 4ORBB 2M29A 1TNXA 3R1VA 1KQVA 2MRDA 3BJHA 3B86A 3ICBA 1UHHA 3FE8A 2M1KB 5G08A 4ZCVA 5DKQA 1ZMZA 1PSBA 5ER4X 4USLA 3DY9A 4PHMA 2L4HA 3VRQA 1SBJA 1MHOA 2IS9A 2BNXA 2QEVA 1JWDA 1G4YR 2FCEA 2ZNDA 3SS3A 2BKIB 5CPVA 1EL4A 4INXA 2MBXA 2SASA 1DVIA 1GM0A 1MXEA 2JWWA 2VRGA 1FF1A 3I5FC 2EC6C 3EK4A 2I7AA 1DJIA 2MJWB 1A75A 5DICA 1K8UA 4N1FA 4FTGA 1TNQA 1CB1A 1SNLA 2JRFA 3V2LA 5HYDA 1B4CA 3D10A 2WC6A 3I5IB 1W7IB 3I5GB 3TDIA 3K1EA 3OB1B 3CWGA 2KNEA 3DZTA 3OX6A 1BF5A 1J7OA 1H4BA 1IQ5A 2F2PA 1ZOTB 4PHNA 2JZIA 1ZUZA 3UO9A 1RJVA 1WLMA 2M1UA 1AJ4A 1J55A 1VRKA 2QEBA 3CZ2A 3TS5B 1XFVO 1QLSA 1BG1A 3CR4X 2LHIA 1SRAA 1K9PA 3SG2A 1Y1AA 1RK9A 1TN4A 4AQJA 1DJWA 3S0GA 4P5OE 3VRNA 5FI7A 2LANA 1XK4A 3IF7A 3VROA 1WRZA 1NCZA 3R1OA 2L98A 1B8LA 1WDCB 1YTZC 1G33A 2GV5A 5D3OA 3Q8IA 3O2PA 3SS4A 1H8BA 1JUOA 4YRUA 2M3WA 1RROA 2JTTA 2V53A 3DYEA 4PE1A 3JTDC 1BR1B 4M2PA 1DQEA 3RM1A 1KQMC 4DCKA 1LS8A 1C7WA 4F0ZB 1JBAA 1J1DA 1ORGA 1ALWA 3A4UB 2KI4C 2JXLA 1EG3A 4UPGA 2KQ6A 1K96A 2MHHA 4PE7A 2KFFA 1CDNA 1QATA 2HETA 1Z4HA 1N2DA 2BBNA 4ORAB 1ALVA 4PE4A 1NYAA 2KBMA 1M46A 1TOPA 4HRGA 1SL7A 4IL1A 4YGBB 2JOJA 2K7CA 3EK8A 2PRUA 2LLUA 2LVKA 1B47A 1OOJA 3D78A 1E8AA 3FIAA 1ZFSA 3JVTC 1QV1A 3OGNA 4WRIA 1CFDA 1HQVA 2I18A 1BLQA 3L4LA 3PLFB 2WCBA 3VGOA 1C07A 1CFPA 1K90D 1OOGA 2BCBA 5AFPA 2JPTA 2CT9A 2LUXA 3PSRA 1V1FA 1NCXA 3EKHA 1SW8A 1UHIA 4OKHA 5HLVA 1KFUL 1F55A 1UHJA 5ER5A 5CSIA 1A29A 1KSMA 5D69A 2WCFA 4I5KA 1KK8B 2JU0A 2LVIA 4I5NB 2B1UA 2QEOA 3BUWB 2M8UA 3E3RA 3LK0A 2K61A 4OVNF 1WLZA 1XFRA 4N5XA 5I2OA 5CSNA 3VRPA 1CMGA 3S0BA 2H61C 2HPSA 1ODBA 2PMYA 3A8RA 3NSKA 1W9ZA 2WCJA 1K95A 1UP5A 1OMRA 4GPLB 5D7FA 1NWDA 1IH0A 3VB1A 4GNKB 3FWBA 1QS7A 1AVSA 1MUXA 1R6PA 1KWOB 2LAPA 3SIAA 2LC5A 1IQ3A 1QX5B 1PSRA 3I5HC 2O60A 4HREE 1IKUA 5JOLA 1S6JA 1OOIX 5F6TA 3D76A 3S0DA 1TCFA 2LMVA 3TS5C 4MN0A 4I5LB 1AHRA 1PVAA 3GK2A 1DF0B 4OZDA 1M45A 3BFHA 1CDMA 1TUJA 3DVJA 1B1GA 1RWYA 4MZLA 4FQOA 4CIDA 3KHEA 1A4PA 2KFGA 3CS1A 3FWCA 2JC2A 1Y1XA 3PALA 4ICBA 4MLWA 1SCMC 1SR6B 2BCAA 1WDCC 3DVKA 4HRHA 2JNFA 4AQIA 4KYNA 3FS7A 1Z2CB 1FPWA 2MA2A 1LVCD 1WRLA 1IJ5A 3BOWA 5I94A 3S0AA 1F8HA 3CABA 1CMFA 3N7HA 1GGWA 3O4XA 2L0PA 1FW4A 3CLNA 1OMDA 2CBLA 2JXCA 1PK0D 5PALA 2LMUA 4OR9B 1YURA 3PATA 4GGFA 2K60A 3TDZA 3AAJA 1TTXA 2G2BA 1OOHA 1TWOA 2LVVA 1XFYO 4JQ0D 2H2KA 2L2EA 1CDPA 3M0WA 5HKWA 2OS8B 1SL9A 3R72A 2WC8A 1JFKA 1KK7Y 4U8DA 1A75B 1EJ3A
chains in the Genus database with same CATH topology
2QACA 3O78A 4TNCA 2KFHA 2K7OA 3K21A 1IGVA 3SJSA 1NCYA 1AJ5A 2KGRA 4NDCA 4YGDB 4CLNA 5KTYA 2HQWA 4GAOA 1UHKA 5HKYA 1YRUB 5AERA 1JF2A 1L2OB 2OTGB 4DUQA 3MSEB 1V1GA 1CM1A 3IQQA 1YUTA 1G8IA 4QJ4B 3VRRA 2BL0B 1UUSA 2K8MB 4A4CA 2E30A 3WNXB 1UHNA 3TDUA 1IJ6A 3TZ1A 4MVFA 2CCMA 1F4QA 2PSRA 1X02A 2KYCA 2ISDA 1K94A 2KAVA 2LUCA 2NLNA 3BUNB 1N0YA 1K9UA 2KHNA 3D0YA 3H4SE 4MRXA 1KWOC 2TN4A 3NSIA 2P6BB 3KF9A 4NQGA 1TRFA 1M31A 3DVMA 2L50A 1LXFC 4R1EA 3LK1A 2JTZA 5GQQC 1B7TY 1SKTA 3CTNA 3LLEA 4PDZA 2M7NA 1GQMA 2GGMA 1MR8A 1NSHA 1DJXA 1BR4B 1J7QA 1CM4A 5DKRA 1XFZO 4P2YB 2WOSA 2CTNA 1Y6WA 2HF5A 2L5XB 1B9AA 1QX2A 1LKJA 4JWQA 2Y4QA 1U5IA 4ZCUA 2FJUB 2L4IA 4NDBA 2JT3A 3BUXB 4E68A 2WORA 1IG5A 2K2AA 2M7LA 2ZFDA 4MBEA 3KPXA 2KBIA 2KI6D 4YBHB 4Q04A 4C0LA 2JT0A 1SL8A 4PHJA 5DKNA 4PALA 1MXLC 2LV7A 2WCEA 2BE6A 2MAZA 1GGZA 1SK6D 3I5FB 2EC6B 3AKAA 1CDLA 1N65A 2HQ8A 2PVBA 1JC2A 4XJKA 1J7PA 1QVIY 2LVJA 5TNCA 2K7BA 1LA3A 4C0JA 2LP2A 1YVLA 1XFUO 2F2OA 3I5IC 3I5GC 2MLFC 1S5GY 2Y1MA 2R2IA 3SG6A 2QPTA 2G9BA 1AK8A 5AANA 1C7VA 1B8CA 1J1EA 1XFWO 4YGEB 1JSAA 2JULA 4HSZA 1L2OC 4A4BA 1CTRA 2AAOA 1FBVA 1HT9A 4D1EA 3PN7B 4QJ5B 1M63B 2F8PA 1KFXS 5CSFA 3SG5A 1Y1UA 1NUBA 4PHKA 2F3YA 1NX1A 1EG4A 1J7RA 3OB2B 1XVJA 3CR5X 4ORCB 1SCVA 2LMTA 1DJGA 3GK1A 3BOWB 5I8NA 1YUUA 3LCPC 1IWQA 1CKKA 3TUYB 1KQMB 2Q4UA 1S36A 3NSLA 3KO0A 1BODA 3HX4A 2KDHA 1TNPA 2PASA 3DD4A 4GFTA 2M9GA 1DMOA 1DGUA 2FOTA 1MQ1A 4QJ3B 4PCWA 1QX7A 2LNKA 3OHMB 2RGIA 2ZRSA 3JVTB 3F45A 4M2OA 3OX5A 3DF0A 5AXIA 1UWOA 4DRWA 1AP4A 2I2RE 2CXJA 3BYAA 4ETOA 3SG3A 1F4OA 2BKHB 1KK7Z 1MF8B 1RECA 2NCOA 5AEQA 1M39A 4N1GA 1BOCA 1YRTB 1S3PA 4MZKA 1GJYA 5HLOA 2FCDA 3CGAA 3EVUA 1CLBA 3WHUB 3EVRA 2M97A 1NX3A 3GOFA 3GK4X 1KCYA 1PVBA 1B8RA 1S26D 2O5GA 1KK8C 1IRJA 2LM5A 2PALA 3CZTX 2EHBA 1SPYA 4WQ3A 1L7ZA 2LCPA 2ZN8A 1CFFA 3SIBA 2ZN9A 2SCPA 1QV0A 2H61A 2F33A 3NXAA 4OV2A 2AMIA 2I94A 1OE9B 5B8IB 2KOTA 1BJFA 1JF0A 3BXKA 4BY5A 2Y5IA 4BY4A 1AUIB 4MZJA 3D0YB 4OCIA 4CFQA 3I5HB 4YGAA 2COLB 3KEVA 2EGDA 1TNWA 1NIWA 2LP3A 2OPOA 3PM8A 1CLMA 1EXRA 2LLSA 3PN7C 1UURA 1FI6A 2LHLA 2E6WA 1SCMB 1B7TZ 2KQYA 2Q91A 1DTLA 1K93D 1OZSA 1QXPA 1SR6C 1LA0A 2JQ6A 4GGNA 1W7JB 4MEWA 3PFVA 3SG7A 3NSOA 4GBAA 5J3XA 1XA5A 4DS7A 5K89A 1A03A 1OQPA 1NPQA 2D8NA 4MRYA 4PE0A 5HKZA 4YI9A 1BT6A 1WRKA 1Y0VH 1DJHA 1U5IB 2K2FA 1F54A 1FI5A 3BUOB 3TUYC 1OSAA 3AAKA 1RTP1 3BUMB 4CFRA 5CSJA 5FYXA 1SY9A 3CR2A 3DVEA 1SYMA 1TCOB 2ZRTA 2ZKMX 1A2XA 2JNXA 4GGFC 3O6BA 1DT7B 2KI6C 3OP0A 1WY9A 1YVHA 2NCPA 2CNPA 3ZNIA 2K0JA 3QRXA 1YUSA 4AOMA 2MLEC 1CNPA 2L51A 1MWNA 4XJKB 1S1EA 4YI8A 1CFCA 2OS8C 1NX0A 1D1OA 4L9MA 4M2QA 3RLZA 2KGBC 5IBWA 1K2HA 4I5JA 3C1VA 1QTXA 1KSOA 1QVIZ 2BBMA 5BPJA 2BE4A 1BMOA 1DJYA 2GGZA 2M0RA 3EVVA 1OMVA 3IQOA 4MSPA 4GUKA 1ZACA 1NX2A 1KFXL 1S5GZ 2BECA 2LLTA 1CLLA 1NP8A 2KAYA 2KAXA 2OTGC 3LL8B 3SG4A 1DJZA 4XYNA 1KFUS 2BL0C 1QLKA 5I2QA 1K9KA 3O4YA 2KSPA 2KYFA 2BCXA 1XYDA 1S6CA 2F3ZA 1PALA 1OZOA 2LE9B 1XK4C 2AUCA 3WXAA 1BU3A 1S6IA 1YX7A 4JPZB 1RFJA 1QJTA 1DGVA 5KU1A 1QASA 1XO5A 3JTDB 1PULA 3WHTB 4C0KA 1PRWA 1TIZA 1YX8A 4WQ2A 1F71A 1JFJA 1SMGA 3AKBA 1EH2A 2M49B 5KSZA 2WNDA 2A4JA 2KI4B 2ZNEA 3HCMA 4NDDA 2NZ0A 1DF0A 2Y1NA 3ZWHA 5I2LA 4CPVA 2K7DA 1Q80A 1LINA 1XFXO 3BQ3A 1YR5A 1QIVA 1R2UA 3EKJA 4YGCB 4DIRA 1F70A 2NXQA 3EK7A 3DF0B 5JJGA 2JT8A 2DOQA 1QIWA 4ORBB 2M29A 1TNXA 1KQVA 2MRDA 3ICBA 1UHHA 5G08A 2M1KB 4ZCVA 5DKQA 1ZMZA 1PSBA 5ER4X 4USLA 4PHMA 2L4HA 3VRQA 1SBJA 1MHOA 2IS9A 1JWDA 1G4YR 2FCEA 2ZNDA 2BKIB 5CPVA 1EL4A 2MBXA 2SASA 1DVIA 1MXEA 2JWWA 2VRGA 1FF1A 3I5FC 2EC6C 3EK4A 2I7AA 1DJIA 2MJWB 1A75A 1K8UA 4N1FA 4FTGA 1TNQA 1CB1A 1SNLA 2JRFA 5HYDA 1B4CA 3D10A 3I5IB 1W7IB 3I5GB 3TDIA 3OB1B 3CWGA 2KNEA 3OX6A 1BF5A 1J7OA 1H4BA 1IQ5A 2F2PA 1ZOTB 4PHNA 2JZIA 1ZUZA 1RJVA 1WLMA 2M1UA 1AJ4A 1J55A 1VRKA 3TS5B 1XFVO 1QLSA 1BG1A 3CR4X 2LHIA 1SRAA 1K9PA 3SG2A 1Y1AA 1RK9A 1TN4A 4AQJA 1DJWA 4P5OE 3VRNA 2LANA 1XK4A 3IF7A 3VROA 1WRZA 1NCZA 2L98A 1B8LA 1WDCB 1YTZC 1G33A 2GV5A 3O2PA 1H8BA 1JUOA 4YRUA 2M3WA 1RROA 2JTTA 2V53A 4PE1A 3JTDC 1BR1B 4M2PA 3RM1A 1KQMC 4DCKA 4F0ZB 1C7WA 1JBAA 1J1DA 3A4UB 1ALWA 2KI4C 2JXLA 1EG3A 4UPGA 2KQ6A 1K96A 2MHHA 4PE7A 2KFFA 1CDNA 1QATA 2HETA 2BBNA 1N2DA 4ORAB 4PE4A 1ALVA 1NYAA 2KBMA 1M46A 1TOPA 4HRGA 1SL7A 4IL1A 4YGBB 2JOJA 2K7CA 3EK8A 2PRUA 2LLUA 2LVKA 1B47A 1OOJA 1E8AA 3FIAA 1ZFSA 3JVTC 1QV1A 4WRIA 1CFDA 1HQVA 2I18A 1BLQA 3PLFB 2WCBA 3VGOA 1C07A 1CFPA 1K90D 2BCBA 5AFPA 2JPTA 2CT9A 2LUXA 3PSRA 1V1FA 1NCXA 3EKHA 1SW8A 1UHIA 4OKHA 5HLVA 1KFUL 1F55A 1UHJA 5ER5A 5CSIA 1A29A 1KSMA 5D69A 2WCFA 4I5KA 1KK8B 2JU0A 2LVIA 4I5NB 2B1UA 3BUWB 2M8UA 3E3RA 3LK0A 2K61A 4OVNF 1WLZA 4N5XA 5I2OA 5CSNA 3VRPA 1CMGA 2H61C 2HPSA 1ODBA 2PMYA 3A8RA 3NSKA 1K95A 1UP5A 1OMRA 4GPLB 5D7FA 1NWDA 1IH0A 4GNKB 3FWBA 1QS7A 1AVSA 1MUXA 1R6PA 1KWOB 2LAPA 3SIAA 2LC5A 1IQ3A 1QX5B 1PSRA 3I5HC 2O60A 4HREE 1IKUA 5JOLA 1S6JA 5F6TA 1TCFA 2LMVA 3TS5C 4MN0A 4I5LB 1AHRA 1PVAA 3GK2A 1DF0B 1M45A 1CDMA 3DVJA 1B1GA 1RWYA 4MZLA 4FQOA 4CIDA 3KHEA 1A4PA 2KFGA 3CS1A 3FWCA 2JC2A 1Y1XA 3PALA 4ICBA 4MLWA 1SCMC 1SR6B 2BCAA 1WDCC 3DVKA 4HRHA 2JNFA 4AQIA 3FS7A 1FPWA 2MA2A 1LVCD 1WRLA 1IJ5A 3BOWA 1F8HA 1CMFA 1GGWA 2L0PA 1FW4A 3CLNA 1OMDA 2CBLA 2JXCA 1PK0D 5PALA 2LMUA 4OR9B 1YURA 3PATA 4GGFA 3TDZA 3AAJA 1TTXA 2G2BA 2LVVA 1XFYO 4JQ0D 2H2KA 2L2EA 1CDPA 3M0WA 5HKWA 2OS8B 1SL9A 2WC8A 1JFKA 1KK7Y 4U8DA 1A75B 1EJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QAC A;  3O78 A;  4TNC A;  2KFH A;  2K7O A;  3K21 A;  1IGV A;  3SJS A;  1NCY A;  1AJ5 A;  2KGR A;  4NDC A;  4YGD B;  4CLN A;  5KTY A;  2HQW A;  4GAO A;  1UHK A;  5HKY A;  1YRU B;  5AER A;  1JF2 A;  1L2O B;  2OTG B;  4DUQ A;  3MSE B;  1V1G A;  1CM1 A;  3IQQ A;  1YUT A;  1G8I A;  4QJ4 B;  3VRR A;  2BL0 B;  1UUS A;  2K8M B;  4A4C A;  2E30 A;  3WNX B;  1UHN A;  3TDU A;  1IJ6 A;  3TZ1 A;  4MVF A;  2CCM A;  1F4Q A;  2PSR A;  1X02 A;  2KYC A;  2ISD A;  1K94 A;  2KAV A;  2LUC A;  2NLN A;  3BUN B;  1N0Y A;  1K9U A;  2KHN A;  3D0Y A;  3H4S E;  4MRX A;  1KWO C;  2TN4 A;  3NSI A;  2P6B B;  3KF9 A;  4NQG A;  1TRF A;  1M31 A;  3DVM A;  2L50 A;  1LXF C;  4R1E A;  3LK1 A;  2JTZ A;  5GQQ C;  1B7T Y;  1SKT A;  3CTN A;  3LLE A;  4PDZ A;  2M7N A;  1GQM A;  2GGM A;  1MR8 A;  1NSH A;  1DJX A;  1BR4 B;  1J7Q A;  1CM4 A;  5DKR A;  1XFZ O;  4P2Y B;  2WOS A;  2CTN A;  1Y6W A;  2HF5 A;  2L5X B;  1B9A A;  1QX2 A;  1LKJ A;  4JWQ A;  2Y4Q A;  1U5I A;  4ZCU A;  2FJU B;  2L4I A;  4NDB A;  2JT3 A;  3BUX B;  4E68 A;  2WOR A;  1IG5 A;  2K2A A;  2M7L A;  2ZFD A;  4MBE A;  3KPX A;  2KBI A;  2KI6 D;  4YBH B;  4Q04 A;  4C0L A;  2JT0 A;  1SL8 A;  4PHJ A;  5DKN A;  4PAL A;  1MXL C;  2LV7 A;  2WCE A;  2BE6 A;  2MAZ A;  1GGZ A;  1SK6 D;  3I5F B;  2EC6 B;  3AKA A;  1CDL A;  1N65 A;  2HQ8 A;  2PVB A;  1JC2 A;  4XJK A;  1J7P A;  1QVI Y;  2LVJ A;  5TNC A;  2K7B A;  1LA3 A;  4C0J A;  2LP2 A;  1YVL A;  1XFU O;  2F2O A;  3I5I C;  3I5G C;  2MLF C;  1S5G Y;  2Y1M A;  2R2I A;  3SG6 A;  2QPT A;  2G9B A;  1AK8 A;  5AAN A;  1C7V A;  1B8C A;  1J1E A;  1XFW O;  4YGE B;  1JSA A;  2JUL A;  4HSZ A;  1L2O C;  4A4B A;  1CTR A;  2AAO A;  1FBV A;  1HT9 A;  4D1E A;  3PN7 B;  4QJ5 B;  1M63 B;  2F8P A;  1KFX S;  5CSF A;  3SG5 A;  1Y1U A;  1NUB A;  4PHK A;  2F3Y A;  1NX1 A;  1EG4 A;  1J7R A;  3OB2 B;  1XVJ A;  3CR5 X;  4ORC B;  1SCV A;  2LMT A;  1DJG A;  3GK1 A;  3BOW B;  5I8N A;  1YUU A;  3LCP C;  1IWQ A;  1CKK A;  3TUY B;  1KQM B;  2Q4U A;  1S36 A;  3NSL A;  3KO0 A;  1BOD A;  3HX4 A;  2KDH A;  1TNP A;  2PAS A;  3DD4 A;  4GFT A;  2M9G A;  1DMO A;  1DGU A;  2FOT A;  1MQ1 A;  4QJ3 B;  4PCW A;  1QX7 A;  2LNK A;  3OHM B;  2RGI A;  2ZRS A;  3JVT B;  3F45 A;  4M2O A;  3OX5 A;  3DF0 A;  5AXI A;  1UWO A;  4DRW A;  1AP4 A;  2I2R E;  2CXJ A;  3BYA A;  4ETO A;  3SG3 A;  1F4O A;  2BKH B;  1KK7 Z;  1MF8 B;  1REC A;  2NCO A;  5AEQ A;  1M39 A;  4N1G A;  1BOC A;  1YRT B;  1S3P A;  4MZK A;  1GJY A;  5HLO A;  2FCD A;  3CGA A;  3EVU A;  1CLB A;  3WHU B;  3EVR A;  2M97 A;  1NX3 A;  3GOF A;  3GK4 X;  1KCY A;  1PVB A;  1B8R A;  1S26 D;  2O5G A;  1KK8 C;  1IRJ A;  2LM5 A;  2PAL A;  3CZT X;  2EHB A;  1SPY A;  4WQ3 A;  1L7Z A;  2LCP A;  2ZN8 A;  1CFF A;  3SIB A;  2ZN9 A;  2SCP A;  1QV0 A;  2H61 A;  2F33 A;  3NXA A;  4OV2 A;  2AMI A;  2I94 A;  1OE9 B;  5B8I B;  2KOT A;  1BJF A;  1JF0 A;  3BXK A;  4BY5 A;  2Y5I A;  4BY4 A;  1AUI B;  4MZJ A;  3D0Y B;  4OCI A;  4CFQ A;  3I5H B;  4YGA A;  2COL B;  3KEV A;  2EGD A;  1TNW A;  1NIW A;  2LP3 A;  2OPO A;  3PM8 A;  1CLM A;  1EXR A;  2LLS A;  3PN7 C;  1UUR A;  1FI6 A;  2LHL A;  2E6W A;  1SCM B;  1B7T Z;  2KQY A;  2Q91 A;  1DTL A;  1K93 D;  1OZS A;  1QXP A;  1SR6 C;  1LA0 A;  2JQ6 A;  4GGN A;  1W7J B;  4MEW A;  3PFV A;  3SG7 A;  3NSO A;  4GBA A;  5J3X A;  1XA5 A;  4DS7 A;  5K89 A;  1A03 A;  1OQP A;  1NPQ A;  2D8N A;  4MRY A;  4PE0 A;  5HKZ A;  4YI9 A;  1BT6 A;  1WRK A;  1Y0V H;  1DJH A;  1U5I B;  2K2F A;  1F54 A;  1FI5 A;  3BUO B;  3TUY C;  1OSA A;  3AAK A;  1RTP 1;  3BUM B;  4CFR A;  5CSJ A;  5FYX A;  1SY9 A;  3CR2 A;  3DVE A;  1SYM A;  1TCO B;  2ZRT A;  2ZKM X;  1A2X A;  2JNX A;  4GGF C;  3O6B A;  1DT7 B;  2KI6 C;  3OP0 A;  1WY9 A;  1YVH A;  2NCP A;  2CNP A;  3ZNI A;  2K0J A;  3QRX A;  1YUS A;  4AOM A;  2MLE C;  1CNP A;  2L51 A;  1MWN A;  4XJK B;  1S1E A;  4YI8 A;  1CFC A;  2OS8 C;  1NX0 A;  1D1O A;  4L9M A;  4M2Q A;  3RLZ A;  2KGB C;  5IBW A;  1K2H A;  4I5J A;  3C1V A;  1QTX A;  1KSO A;  1QVI Z;  2BBM A;  5BPJ A;  2BE4 A;  1BMO A;  1DJY A;  2GGZ A;  2M0R A;  3EVV A;  1OMV A;  3IQO A;  4MSP A;  4GUK A;  1ZAC A;  1NX2 A;  1KFX L;  1S5G Z;  2BEC A;  2LLT A;  1CLL A;  1NP8 A;  2KAY A;  2KAX A;  2OTG C;  3LL8 B;  3SG4 A;  1DJZ A;  4XYN A;  1KFU S;  2BL0 C;  1QLK A;  5I2Q A;  1K9K A;  3O4Y A;  2KSP A;  2KYF A;  2BCX A;  1XYD A;  1S6C A;  2F3Z A;  1PAL A;  1OZO A;  2LE9 B;  1XK4 C;  2AUC A;  3WXA A;  1BU3 A;  1S6I A;  1YX7 A;  4JPZ B;  1RFJ A;  1QJT A;  1DGV A;  5KU1 A;  1QAS A;  1XO5 A;  3JTD B;  1PUL A;  3WHT B;  4C0K A;  1PRW A;  1TIZ A;  1YX8 A;  4WQ2 A;  1F71 A;  1JFJ A;  1SMG A;  3AKB A;  1EH2 A;  2M49 B;  5KSZ A;  2WND A;  2A4J A;  2KI4 B;  2ZNE A;  3HCM A;  4NDD A;  2NZ0 A;  1DF0 A;  2Y1N A;  3ZWH A;  5I2L A;  4CPV A;  2K7D A;  1Q80 A;  1LIN A;  1XFX O;  3BQ3 A;  1YR5 A;  1QIV A;  1R2U A;  3EKJ A;  4YGC B;  4DIR A;  1F70 A;  2NXQ A;  3EK7 A;  3DF0 B;  5JJG A;  2JT8 A;  2DOQ A;  1QIW A;  4ORB B;  2M29 A;  1TNX A;  1KQV A;  2MRD A;  3ICB A;  1UHH A;  5G08 A;  2M1K B;  4ZCV A;  5DKQ A;  1ZMZ A;  1PSB A;  5ER4 X;  4USL A;  4PHM A;  2L4H A;  3VRQ A;  1SBJ A;  1MHO A;  2IS9 A;  1JWD A;  1G4Y R;  2FCE A;  2ZND A;  2BKI B;  5CPV A;  1EL4 A;  2MBX A;  2SAS A;  1DVI A;  1MXE A;  2JWW A;  2VRG A;  1FF1 A;  3I5F C;  2EC6 C;  3EK4 A;  2I7A A;  1DJI A;  2MJW B;  1A75 A;  1K8U A;  4N1F A;  4FTG A;  1TNQ A;  1CB1 A;  1SNL A;  2JRF A;  5HYD A;  1B4C A;  3D10 A;  3I5I B;  1W7I B;  3I5G B;  3TDI A;  3OB1 B;  3CWG A;  2KNE A;  3OX6 A;  1BF5 A;  1J7O A;  1H4B A;  1IQ5 A;  2F2P A;  1ZOT B;  4PHN A;  2JZI A;  1ZUZ A;  1RJV A;  1WLM A;  2M1U A;  1AJ4 A;  1J55 A;  1VRK A;  3TS5 B;  1XFV O;  1QLS A;  1BG1 A;  3CR4 X;  2LHI A;  1SRA A;  1K9P A;  3SG2 A;  1Y1A A;  1RK9 A;  1TN4 A;  4AQJ A;  1DJW A;  4P5O E;  3VRN A;  2LAN A;  1XK4 A;  3IF7 A;  3VRO A;  1WRZ A;  1NCZ A;  2L98 A;  1B8L A;  1WDC B;  1YTZ C;  1G33 A;  2GV5 A;  3O2P A;  1H8B A;  1JUO A;  4YRU A;  2M3W A;  1RRO A;  2JTT A;  2V53 A;  4PE1 A;  3JTD C;  1BR1 B;  4M2P A;  3RM1 A;  1KQM C;  4DCK A;  4F0Z B;  1C7W A;  1JBA A;  1J1D A;  3A4U B;  1ALW A;  2KI4 C;  2JXL A;  1EG3 A;  4UPG A;  2KQ6 A;  1K96 A;  2MHH A;  4PE7 A;  2KFF A;  1CDN A;  1QAT A;  2HET A;  2BBN A;  1N2D A;  4ORA B;  4PE4 A;  1ALV A;  1NYA A;  2KBM A;  1M46 A;  1TOP A;  4HRG A;  1SL7 A;  4IL1 A;  4YGB B;  2JOJ A;  2K7C A;  3EK8 A;  2PRU A;  2LLU A;  2LVK A;  1B47 A;  1OOJ A;  1E8A A;  3FIA A;  1ZFS A;  3JVT C;  1QV1 A;  4WRI A;  1CFD A;  1HQV A;  2I18 A;  1BLQ A;  3PLF B;  2WCB A;  3VGO A;  1C07 A;  1CFP A;  1K90 D;  2BCB A;  5AFP A;  2JPT A;  2CT9 A;  2LUX A;  3PSR A;  1V1F A;  1NCX A;  3EKH A;  1SW8 A;  1UHI A;  4OKH A;  5HLV A;  1KFU L;  1F55 A;  1UHJ A;  5ER5 A;  5CSI A;  1A29 A;  1KSM A;  5D69 A;  2WCF A;  4I5K A;  1KK8 B;  2JU0 A;  2LVI A;  4I5N B;  2B1U A;  3BUW B;  2M8U A;  3E3R A;  3LK0 A;  2K61 A;  4OVN F;  1WLZ A;  4N5X A;  5I2O A;  5CSN A;  3VRP A;  1CMG A;  2H61 C;  2HPS A;  1ODB A;  2PMY A;  3A8R A;  3NSK A;  1K95 A;  1UP5 A;  1OMR A;  4GPL B;  5D7F A;  1NWD A;  1IH0 A;  4GNK B;  3FWB A;  1QS7 A;  1AVS A;  1MUX A;  1R6P A;  1KWO B;  2LAP A;  3SIA A;  2LC5 A;  1IQ3 A;  1QX5 B;  1PSR A;  3I5H C;  2O60 A;  4HRE E;  1IKU A;  5JOL A;  1S6J A;  5F6T A;  1TCF A;  2LMV A;  3TS5 C;  4MN0 A;  4I5L B;  1AHR A;  1PVA A;  3GK2 A;  1DF0 B;  1M45 A;  1CDM A;  3DVJ A;  1B1G A;  1RWY A;  4MZL A;  4FQO A;  4CID A;  3KHE A;  1A4P A;  2KFG A;  3CS1 A;  3FWC A;  2JC2 A;  1Y1X A;  3PAL A;  4ICB A;  4MLW A;  1SCM C;  1SR6 B;  2BCA A;  1WDC C;  3DVK A;  4HRH A;  2JNF A;  4AQI A;  3FS7 A;  1FPW A;  2MA2 A;  1LVC D;  1WRL A;  1IJ5 A;  3BOW A;  1F8H A;  1CMF A;  1GGW A;  2L0P A;  1FW4 A;  3CLN A;  1OMD A;  2CBL A;  2JXC A;  1PK0 D;  5PAL A;  2LMU A;  4OR9 B;  1YUR A;  3PAT A;  4GGF A;  3TDZ A;  3AAJ A;  1TTX A;  2G2B A;  2LVV A;  1XFY O;  4JQ0 D;  2H2K A;  2L2E A;  1CDP A;  3M0W A;  5HKW A;  2OS8 B;  1SL9 A;  2WC8 A;  1JFK A;  1KK7 Y;  4U8D A;  1A75 B;  1EJ3 A; 
#chains in the Genus database with same CATH topology
 2QAC A;  3D73 A;  3O78 A;  4TNC A;  2KFH A;  2K7O A;  3K21 A;  1IGV A;  3SJS A;  1NCY A;  1AJ5 A;  2KGR A;  4NDC A;  4YGD B;  4CLN A;  5KTY A;  2HQW A;  3CZ1 A;  4GAO A;  1UHK A;  5HKY A;  1YRU B;  5AER A;  2GTE A;  1JF2 A;  1L2O B;  2OTG B;  4DUQ A;  3MSE B;  1V1G A;  1CM1 A;  3IQQ A;  1YUT A;  1G8I A;  4QJ4 B;  3D75 A;  3VRR A;  2BL0 B;  1UUS A;  2K8M B;  4A4C A;  2E30 A;  3WNX B;  1UHN A;  3TDU A;  1IJ6 A;  3TZ1 A;  4MVF A;  2CCM A;  1F4Q A;  2PSR A;  1X02 A;  2KYC A;  2ISD A;  1K94 A;  2KAV A;  2LUC A;  2NLN A;  3BUN B;  2PYQ A;  1N0Y A;  1K9U A;  2KHN A;  3BFB A;  3D0Y A;  3H4S E;  3L4A A;  4MRX A;  1KWO C;  2TN4 A;  3NSI A;  1OOF A;  2P6B B;  3KF9 A;  4NQG A;  1TRF A;  1M31 A;  3DVM A;  2L50 A;  4JD9 A;  1LXF C;  4R1E A;  3LK1 A;  2JTZ A;  5GQQ C;  1B7T Y;  1SKT A;  2WCK A;  1T14 A;  3CTN A;  3LLE A;  4PDZ A;  2WCH A;  2M7N A;  2QDI A;  1GQM A;  2GGM A;  1OW4 A;  1MR8 A;  2FJY A;  3L47 A;  3BFA A;  1NSH A;  1DJX A;  1BR4 B;  2KLD A;  3NHT A;  1J7Q A;  2WC5 A;  1CM4 A;  5DKR A;  1XFZ O;  4P2Y B;  2WOS A;  2CTN A;  1Y6W A;  2HF5 A;  2L5X B;  1B9A A;  1QX2 A;  1LKJ A;  3QME A;  2Y4Q A;  4JWQ A;  1U5I A;  4ZCU A;  2FJU B;  3RZS A;  2L4I A;  4NDB A;  2JT3 A;  3BUX B;  4E68 A;  2WOR A;  1IG5 A;  2K2A A;  2M7L A;  2ZFD A;  3FE6 A;  4MBE A;  3KPX A;  2KBI A;  2KI6 D;  3D74 A;  4Q04 A;  4YBH B;  4C0L A;  3B87 A;  2JT0 A;  1SL8 A;  4PHJ A;  5DKN A;  2YGU A;  4PAL A;  1MXL C;  2LV7 A;  2WCE A;  2BE6 A;  4INW A;  2MAZ A;  1GGZ A;  1SK6 D;  3I5F B;  2EC6 B;  3AKA A;  1CDL A;  1N65 A;  2HQ8 A;  2PVB A;  1JC2 A;  4XJK A;  1J7P A;  1QVI Y;  2LVJ A;  5TNC A;  2K7B A;  1LA3 A;  4C0J A;  2LP2 A;  1YVL A;  1XFU O;  2F2O A;  3I5I C;  3I5G C;  2MLF C;  1S5G Y;  2Y1M A;  2R2I A;  3SG6 A;  2QPT A;  2G9B A;  1AK8 A;  5AAN A;  1C7V A;  1B8C A;  1J1E A;  1XFW O;  4YGE B;  1JSA A;  2JUL A;  4HSZ A;  1L2O C;  4A4B A;  1DEK A;  1CTR A;  2AAO A;  1FBV A;  1HT9 A;  4D1E A;  2P71 A;  3PN7 B;  4QJ5 B;  1M63 B;  2QEH A;  2F8P A;  1KFX S;  5CSF A;  3SG5 A;  1Y1U A;  2WCM A;  1NUB A;  4PHK A;  2F3Y A;  3EG5 B;  1NX1 A;  4F7F A;  1EG4 A;  1J7R A;  1SSE B;  3OB2 B;  3CDN A;  2H8V A;  1XVJ A;  3CR5 X;  4ORC B;  1SCV A;  2LMT A;  1DJG A;  3GK1 A;  3BOW B;  5I8N A;  1YUU A;  3LCP C;  1IWQ A;  1CKK A;  3TUY B;  1KQM B;  2Q4U A;  1S36 A;  3NSL A;  5HL1 A;  3KO0 A;  1BOD A;  3HX4 A;  2KDH A;  1TNP A;  2PAS A;  3DD4 A;  4GFT A;  2M9G A;  1DMO A;  1DGU A;  2FOT A;  1MQ1 A;  4QJ3 B;  4PCW A;  3NGV A;  1QX7 A;  2LNK A;  5EL2 A;  3OHM B;  2RGI A;  2ZRS A;  3JVT B;  3F45 A;  4M2O A;  3OX5 A;  3DF0 A;  5AXI A;  1UWO A;  4DRW A;  1AP4 A;  3CZ0 A;  2I2R E;  2CXJ A;  3BYA A;  3S0E A;  4ETO A;  3SG3 A;  1F4O A;  2BKH B;  4IJ7 A;  1KK7 Z;  1MF8 B;  1REC A;  2NCO A;  5AEQ A;  1M39 A;  4N1G A;  1BOC A;  1YRT B;  1S3P A;  4MZK A;  1GJY A;  5HLO A;  4PT1 A;  2FCD A;  3CGA A;  3EVU A;  1CLB A;  3WHU B;  3EVR A;  2M97 A;  1NX3 A;  2KPH A;  3GOF A;  2JPO A;  3GK4 X;  1KCY A;  1PVB A;  1B8R A;  1S26 D;  2O5G A;  1KK8 C;  1IRJ A;  2LM5 A;  2PAL A;  3CZT X;  2EHB A;  1SPY A;  4WQ3 A;  1L7Z A;  3SS5 A;  2LCP A;  2ZN8 A;  1CFF A;  3SIB A;  2ZN9 A;  2SCP A;  1QV0 A;  2H61 A;  2F33 A;  3NXA A;  4OV2 A;  2AMI A;  2I94 A;  1OE9 B;  2ERB A;  2KOT A;  5B8I B;  1BJF A;  1JF0 A;  3BXK A;  4BY5 A;  3FE9 A;  2Y5I A;  4BY4 A;  3S0F A;  1AUI B;  4MZJ A;  3D0Y B;  4OCI A;  4CFQ A;  3I5H B;  3PM2 A;  4YGA A;  2COL B;  3KEV A;  2EGD A;  1TNW A;  1NIW A;  2LP3 A;  2OPO A;  3B88 A;  3PM8 A;  1CLM A;  1EXR A;  1TUZ A;  2LLS A;  3PN7 C;  1UUR A;  2BAP A;  1FI6 A;  1QWV A;  2LHL A;  3DXL A;  2E6W A;  5FI6 A;  1SCM B;  1B7T Z;  3B6X A;  2KQY A;  3CYZ A;  1C3Z A;  2Q91 A;  1DTL A;  1K93 D;  1OZS A;  1QXP A;  1SR6 C;  1LA0 A;  2JQ6 A;  4GGN A;  1W7J B;  4MEW A;  3PFV A;  3SG7 A;  3NSO A;  4GBA A;  5J3X A;  1XA5 A;  4DS7 A;  5K89 A;  1A03 A;  1OQP A;  1NPQ A;  2D8N A;  4MRY A;  4PE0 A;  5HKZ A;  4YI9 A;  1BT6 A;  1WRK A;  1Y0V H;  1DJH A;  1U5I B;  2K2F A;  1F54 A;  1FI5 A;  3BUO B;  3TUY C;  1OSA A;  3AAK A;  1RTP 1;  3BUM B;  3D77 A;  4CFR A;  5CSJ A;  5FYX A;  1SY9 A;  2WCL A;  3CR2 A;  1SYM A;  1TCO B;  2ZRT A;  2ZKM X;  3DVE A;  1A2X A;  2JNX A;  4GGF C;  3O6B A;  1DT7 B;  2KI6 C;  3OP0 A;  3PJI A;  1WY9 A;  1YVH A;  2PQL A;  2NCP A;  2CNP A;  3ZNI A;  1IIO A;  2K0J A;  3QRX A;  1YUS A;  4AOM A;  2MLE C;  1CNP A;  2L51 A;  1MWN A;  4XJK B;  1S1E A;  2KLE A;  4YI8 A;  3NHI A;  2L5Y A;  2OS8 C;  1NX0 A;  3IVT A;  4L9M A;  4M2Q A;  1CFC A;  1D1O A;  3RLZ A;  2KGB C;  5IBW A;  1K2H A;  4I5J A;  3C1V A;  1QTX A;  1KSO A;  1QVI Z;  2BBM A;  5BPJ A;  2BE4 A;  3UNW A;  1BMO A;  1DJY A;  2GGZ A;  2M0R A;  3EVV A;  1OMV A;  3B7A A;  3IQO A;  4MSP A;  4GUK A;  2P70 A;  1ZAC A;  4FQT A;  1NX2 A;  1KFX L;  1S5G Z;  2BEC A;  2LLT A;  1CLL A;  1NP8 A;  2KAY A;  2KAX A;  2OTG C;  3LL8 B;  3SG4 A;  1DJZ A;  4XYN A;  1KFU S;  5FI2 A;  2BL0 C;  1QLK A;  5I2Q A;  1K9K A;  3O4Y A;  2KSP A;  4JKT A;  2KYF A;  2BCX A;  1XYD A;  1S6C A;  2F3Z A;  2L2C A;  1PAL A;  1OZO A;  2LE9 B;  1XK4 C;  2AUC A;  3WXA A;  1BU3 A;  1S6I A;  1YX7 A;  1C3Y A;  4JPZ B;  1RFJ A;  1QJT A;  1DGV A;  5KU1 A;  1QAS A;  1XO5 A;  3JTD B;  1PUL A;  3WHT B;  4C0K A;  1PRW A;  1TIZ A;  1YX8 A;  4WQ2 A;  1F71 A;  1JFJ A;  1SMG A;  3AKB A;  1EH2 A;  2M49 B;  5KSZ A;  2WND A;  2A4J A;  2KI4 B;  2ZNE A;  3HCM A;  4NDD A;  2NZ0 A;  1DF0 A;  2Y1N A;  3ZWH A;  3R1P A;  5I2L A;  4CPV A;  2K7D A;  1Q80 A;  1LIN A;  1P28 A;  1XFX O;  1YR5 A;  3BQ3 A;  1QIV A;  1R2U A;  3EKJ A;  3OBV A;  4YGC B;  4DIR A;  1DC1 A;  1F70 A;  2NXQ A;  3EK7 A;  1DEL A;  3DF0 B;  5JJG A;  2JT8 A;  2DOQ A;  1QIW A;  4ORB B;  2M29 A;  1TNX A;  3R1V A;  1KQV A;  2MRD A;  3BJH A;  3B86 A;  3ICB A;  1UHH A;  3FE8 A;  2M1K B;  5G08 A;  4ZCV A;  5DKQ A;  1ZMZ A;  1PSB A;  5ER4 X;  4USL A;  3DY9 A;  4PHM A;  2L4H A;  3VRQ A;  1SBJ A;  1MHO A;  2IS9 A;  2BNX A;  2QEV A;  1JWD A;  1G4Y R;  2FCE A;  2ZND A;  3SS3 A;  2BKI B;  5CPV A;  1EL4 A;  4INX A;  2MBX A;  2SAS A;  1DVI A;  1GM0 A;  1MXE A;  2JWW A;  2VRG A;  1FF1 A;  3I5F C;  2EC6 C;  3EK4 A;  2I7A A;  1DJI A;  2MJW B;  1A75 A;  5DIC A;  1K8U A;  4N1F A;  4FTG A;  1TNQ A;  1CB1 A;  1SNL A;  2JRF A;  3V2L A;  5HYD A;  1B4C A;  3D10 A;  2WC6 A;  3I5I B;  1W7I B;  3I5G B;  3TDI A;  3K1E A;  3OB1 B;  3CWG A;  2KNE A;  3DZT A;  3OX6 A;  1BF5 A;  1J7O A;  1H4B A;  1IQ5 A;  2F2P A;  1ZOT B;  4PHN A;  2JZI A;  1ZUZ A;  3UO9 A;  1RJV A;  1WLM A;  2M1U A;  1AJ4 A;  1J55 A;  1VRK A;  2QEB A;  3CZ2 A;  3TS5 B;  1XFV O;  1QLS A;  1BG1 A;  3CR4 X;  2LHI A;  1SRA A;  1K9P A;  3SG2 A;  1Y1A A;  1RK9 A;  1TN4 A;  4AQJ A;  1DJW A;  3S0G A;  4P5O E;  3VRN A;  5FI7 A;  2LAN A;  1XK4 A;  3IF7 A;  3VRO A;  1WRZ A;  1NCZ A;  3R1O A;  2L98 A;  1B8L A;  1WDC B;  1YTZ C;  1G33 A;  2GV5 A;  5D3O A;  3Q8I A;  3O2P A;  3SS4 A;  1H8B A;  1JUO A;  4YRU A;  2M3W A;  1RRO A;  2JTT A;  2V53 A;  3DYE A;  4PE1 A;  3JTD C;  1BR1 B;  4M2P A;  1DQE A;  3RM1 A;  1KQM C;  4DCK A;  1LS8 A;  1C7W A;  4F0Z B;  1JBA A;  1J1D A;  1ORG A;  1ALW A;  3A4U B;  2KI4 C;  2JXL A;  1EG3 A;  4UPG A;  2KQ6 A;  1K96 A;  2MHH A;  4PE7 A;  2KFF A;  1CDN A;  1QAT A;  2HET A;  1Z4H A;  1N2D A;  2BBN A;  4ORA B;  1ALV A;  4PE4 A;  1NYA A;  2KBM A;  1M46 A;  1TOP A;  4HRG A;  1SL7 A;  4IL1 A;  4YGB B;  2JOJ A;  2K7C A;  3EK8 A;  2PRU A;  2LLU A;  2LVK A;  1B47 A;  1OOJ A;  3D78 A;  1E8A A;  3FIA A;  1ZFS A;  3JVT C;  1QV1 A;  3OGN A;  4WRI A;  1CFD A;  1HQV A;  2I18 A;  1BLQ A;  3L4L A;  3PLF B;  2WCB A;  3VGO A;  1C07 A;  1CFP A;  1K90 D;  1OOG A;  2BCB A;  5AFP A;  2JPT A;  2CT9 A;  2LUX A;  3PSR A;  1V1F A;  1NCX A;  3EKH A;  1SW8 A;  1UHI A;  4OKH A;  5HLV A;  1KFU L;  1F55 A;  1UHJ A;  5ER5 A;  5CSI A;  1A29 A;  1KSM A;  5D69 A;  2WCF A;  4I5K A;  1KK8 B;  2JU0 A;  2LVI A;  4I5N B;  2B1U A;  2QEO A;  3BUW B;  2M8U A;  3E3R A;  3LK0 A;  2K61 A;  4OVN F;  1WLZ A;  1XFR A;  4N5X A;  5I2O A;  5CSN A;  3VRP A;  1CMG A;  3S0B A;  2H61 C;  2HPS A;  1ODB A;  2PMY A;  3A8R A;  3NSK A;  1W9Z A;  2WCJ A;  1K95 A;  1UP5 A;  1OMR A;  4GPL B;  5D7F A;  1NWD A;  1IH0 A;  3VB1 A;  4GNK B;  3FWB A;  1QS7 A;  1AVS A;  1MUX A;  1R6P A;  1KWO B;  2LAP A;  3SIA A;  2LC5 A;  1IQ3 A;  1QX5 B;  1PSR A;  3I5H C;  2O60 A;  4HRE E;  1IKU A;  5JOL A;  1S6J A;  1OOI X;  5F6T A;  3D76 A;  3S0D A;  1TCF A;  2LMV A;  3TS5 C;  4MN0 A;  4I5L B;  1AHR A;  1PVA A;  3GK2 A;  1DF0 B;  4OZD A;  1M45 A;  3BFH A;  1CDM A;  1TUJ A;  3DVJ A;  1B1G A;  1RWY A;  4MZL A;  4FQO A;  4CID A;  3KHE A;  1A4P A;  2KFG A;  3CS1 A;  3FWC A;  2JC2 A;  1Y1X A;  3PAL A;  4ICB A;  4MLW A;  1SCM C;  1SR6 B;  2BCA A;  1WDC C;  3DVK A;  4HRH A;  2JNF A;  4AQI A;  4KYN A;  3FS7 A;  1Z2C B;  1FPW A;  2MA2 A;  1LVC D;  1WRL A;  1IJ5 A;  3BOW A;  5I94 A;  3S0A A;  1F8H A;  3CAB A;  1CMF A;  3N7H A;  1GGW A;  3O4X A;  2L0P A;  1FW4 A;  3CLN A;  1OMD A;  2CBL A;  2JXC A;  1PK0 D;  5PAL A;  2LMU A;  4OR9 B;  1YUR A;  3PAT A;  4GGF A;  2K60 A;  3TDZ A;  3AAJ A;  1TTX A;  2G2B A;  1OOH A;  1TWO A;  2LVV A;  1XFY O;  4JQ0 D;  2H2K A;  2L2E A;  1CDP A;  3M0W A;  5HKW A;  2OS8 B;  1SL9 A;  3R72 A;  2WC8 A;  1JFK A;  1KK7 Y;  4U8D A;  1A75 B;  1EJ3 A; 
#chains in the Genus database with same CATH homology
 2QAC A;  3O78 A;  4TNC A;  2KFH A;  2K7O A;  3K21 A;  1IGV A;  3SJS A;  1NCY A;  1AJ5 A;  2KGR A;  4NDC A;  4YGD B;  4CLN A;  5KTY A;  2HQW A;  4GAO A;  1UHK A;  5HKY A;  1YRU B;  5AER A;  1JF2 A;  1L2O B;  2OTG B;  4DUQ A;  3MSE B;  1V1G A;  1CM1 A;  3IQQ A;  1YUT A;  1G8I A;  4QJ4 B;  3VRR A;  2BL0 B;  1UUS A;  2K8M B;  4A4C A;  2E30 A;  3WNX B;  1UHN A;  3TDU A;  1IJ6 A;  3TZ1 A;  4MVF A;  2CCM A;  1F4Q A;  2PSR A;  1X02 A;  2KYC A;  2ISD A;  1K94 A;  2KAV A;  2LUC A;  2NLN A;  3BUN B;  1N0Y A;  1K9U A;  2KHN A;  3D0Y A;  3H4S E;  4MRX A;  1KWO C;  2TN4 A;  3NSI A;  2P6B B;  3KF9 A;  4NQG A;  1TRF A;  1M31 A;  3DVM A;  2L50 A;  1LXF C;  4R1E A;  3LK1 A;  2JTZ A;  5GQQ C;  1B7T Y;  1SKT A;  3CTN A;  3LLE A;  4PDZ A;  2M7N A;  1GQM A;  2GGM A;  1MR8 A;  1NSH A;  1DJX A;  1BR4 B;  1J7Q A;  1CM4 A;  5DKR A;  1XFZ O;  4P2Y B;  2WOS A;  2CTN A;  1Y6W A;  2HF5 A;  2L5X B;  1B9A A;  1QX2 A;  1LKJ A;  4JWQ A;  2Y4Q A;  1U5I A;  4ZCU A;  2FJU B;  2L4I A;  4NDB A;  2JT3 A;  3BUX B;  4E68 A;  2WOR A;  1IG5 A;  2K2A A;  2M7L A;  2ZFD A;  4MBE A;  3KPX A;  2KBI A;  2KI6 D;  4YBH B;  4Q04 A;  4C0L A;  2JT0 A;  1SL8 A;  4PHJ A;  5DKN A;  4PAL A;  1MXL C;  2LV7 A;  2WCE A;  2BE6 A;  2MAZ A;  1GGZ A;  1SK6 D;  3I5F B;  2EC6 B;  3AKA A;  1CDL A;  1N65 A;  2HQ8 A;  2PVB A;  1JC2 A;  4XJK A;  1J7P A;  1QVI Y;  2LVJ A;  5TNC A;  2K7B A;  1LA3 A;  4C0J A;  2LP2 A;  1YVL A;  1XFU O;  2F2O A;  3I5I C;  3I5G C;  2MLF C;  1S5G Y;  2Y1M A;  2R2I A;  3SG6 A;  2QPT A;  2G9B A;  1AK8 A;  5AAN A;  1C7V A;  1B8C A;  1J1E A;  1XFW O;  4YGE B;  1JSA A;  2JUL A;  4HSZ A;  1L2O C;  4A4B A;  1CTR A;  2AAO A;  1FBV A;  1HT9 A;  4D1E A;  3PN7 B;  4QJ5 B;  1M63 B;  2F8P A;  1KFX S;  5CSF A;  3SG5 A;  1Y1U A;  1NUB A;  4PHK A;  2F3Y A;  1NX1 A;  1EG4 A;  1J7R A;  3OB2 B;  1XVJ A;  3CR5 X;  4ORC B;  1SCV A;  2LMT A;  1DJG A;  3GK1 A;  3BOW B;  5I8N A;  1YUU A;  3LCP C;  1IWQ A;  1CKK A;  3TUY B;  1KQM B;  2Q4U A;  1S36 A;  3NSL A;  3KO0 A;  1BOD A;  3HX4 A;  2KDH A;  1TNP A;  2PAS A;  3DD4 A;  4GFT A;  2M9G A;  1DMO A;  1DGU A;  2FOT A;  1MQ1 A;  4QJ3 B;  4PCW A;  1QX7 A;  2LNK A;  3OHM B;  2RGI A;  2ZRS A;  3JVT B;  3F45 A;  4M2O A;  3OX5 A;  3DF0 A;  5AXI A;  1UWO A;  4DRW A;  1AP4 A;  2I2R E;  2CXJ A;  3BYA A;  4ETO A;  3SG3 A;  1F4O A;  2BKH B;  1KK7 Z;  1MF8 B;  1REC A;  2NCO A;  5AEQ A;  1M39 A;  4N1G A;  1BOC A;  1YRT B;  1S3P A;  4MZK A;  1GJY A;  5HLO A;  2FCD A;  3CGA A;  3EVU A;  1CLB A;  3WHU B;  3EVR A;  2M97 A;  1NX3 A;  3GOF A;  3GK4 X;  1KCY A;  1PVB A;  1B8R A;  1S26 D;  2O5G A;  1KK8 C;  1IRJ A;  2LM5 A;  2PAL A;  3CZT X;  2EHB A;  1SPY A;  4WQ3 A;  1L7Z A;  2LCP A;  2ZN8 A;  1CFF A;  3SIB A;  2ZN9 A;  2SCP A;  1QV0 A;  2H61 A;  2F33 A;  3NXA A;  4OV2 A;  2AMI A;  2I94 A;  1OE9 B;  5B8I B;  2KOT A;  1BJF A;  1JF0 A;  3BXK A;  4BY5 A;  2Y5I A;  4BY4 A;  1AUI B;  4MZJ A;  3D0Y B;  4OCI A;  4CFQ A;  3I5H B;  4YGA A;  2COL B;  3KEV A;  2EGD A;  1TNW A;  1NIW A;  2LP3 A;  2OPO A;  3PM8 A;  1CLM A;  1EXR A;  2LLS A;  3PN7 C;  1UUR A;  1FI6 A;  2LHL A;  2E6W A;  1SCM B;  1B7T Z;  2KQY A;  2Q91 A;  1DTL A;  1K93 D;  1OZS A;  1QXP A;  1SR6 C;  1LA0 A;  2JQ6 A;  4GGN A;  1W7J B;  4MEW A;  3PFV A;  3SG7 A;  3NSO A;  4GBA A;  5J3X A;  1XA5 A;  4DS7 A;  5K89 A;  1A03 A;  1OQP A;  1NPQ A;  2D8N A;  4MRY A;  4PE0 A;  5HKZ A;  4YI9 A;  1BT6 A;  1WRK A;  1Y0V H;  1DJH A;  1U5I B;  2K2F A;  1F54 A;  1FI5 A;  3BUO B;  3TUY C;  1OSA A;  3AAK A;  1RTP 1;  3BUM B;  4CFR A;  5CSJ A;  5FYX A;  1SY9 A;  3CR2 A;  3DVE A;  1SYM A;  1TCO B;  2ZRT A;  2ZKM X;  1A2X A;  2JNX A;  4GGF C;  3O6B A;  1DT7 B;  2KI6 C;  3OP0 A;  1WY9 A;  1YVH A;  2NCP A;  2CNP A;  3ZNI A;  2K0J A;  3QRX A;  1YUS A;  4AOM A;  2MLE C;  1CNP A;  2L51 A;  1MWN A;  4XJK B;  1S1E A;  4YI8 A;  1CFC A;  2OS8 C;  1NX0 A;  1D1O A;  4L9M A;  4M2Q A;  3RLZ A;  2KGB C;  5IBW A;  1K2H A;  4I5J A;  3C1V A;  1QTX A;  1KSO A;  1QVI Z;  2BBM A;  5BPJ A;  2BE4 A;  1BMO A;  1DJY A;  2GGZ A;  2M0R A;  3EVV A;  1OMV A;  3IQO A;  4MSP A;  4GUK A;  1ZAC A;  1NX2 A;  1KFX L;  1S5G Z;  2BEC A;  2LLT A;  1CLL A;  1NP8 A;  2KAY A;  2KAX A;  2OTG C;  3LL8 B;  3SG4 A;  1DJZ A;  4XYN A;  1KFU S;  2BL0 C;  1QLK A;  5I2Q A;  1K9K A;  3O4Y A;  2KSP A;  2KYF A;  2BCX A;  1XYD A;  1S6C A;  2F3Z A;  1PAL A;  1OZO A;  2LE9 B;  1XK4 C;  2AUC A;  3WXA A;  1BU3 A;  1S6I A;  1YX7 A;  4JPZ B;  1RFJ A;  1QJT A;  1DGV A;  5KU1 A;  1QAS A;  1XO5 A;  3JTD B;  1PUL A;  3WHT B;  4C0K A;  1PRW A;  1TIZ A;  1YX8 A;  4WQ2 A;  1F71 A;  1JFJ A;  1SMG A;  3AKB A;  1EH2 A;  2M49 B;  5KSZ A;  2WND A;  2A4J A;  2KI4 B;  2ZNE A;  3HCM A;  4NDD A;  2NZ0 A;  1DF0 A;  2Y1N A;  3ZWH A;  5I2L A;  4CPV A;  2K7D A;  1Q80 A;  1LIN A;  1XFX O;  3BQ3 A;  1YR5 A;  1QIV A;  1R2U A;  3EKJ A;  4YGC B;  4DIR A;  1F70 A;  2NXQ A;  3EK7 A;  3DF0 B;  5JJG A;  2JT8 A;  2DOQ A;  1QIW A;  4ORB B;  2M29 A;  1TNX A;  1KQV A;  2MRD A;  3ICB A;  1UHH A;  5G08 A;  2M1K B;  4ZCV A;  5DKQ A;  1ZMZ A;  1PSB A;  5ER4 X;  4USL A;  4PHM A;  2L4H A;  3VRQ A;  1SBJ A;  1MHO A;  2IS9 A;  1JWD A;  1G4Y R;  2FCE A;  2ZND A;  2BKI B;  5CPV A;  1EL4 A;  2MBX A;  2SAS A;  1DVI A;  1MXE A;  2JWW A;  2VRG A;  1FF1 A;  3I5F C;  2EC6 C;  3EK4 A;  2I7A A;  1DJI A;  2MJW B;  1A75 A;  1K8U A;  4N1F A;  4FTG A;  1TNQ A;  1CB1 A;  1SNL A;  2JRF A;  5HYD A;  1B4C A;  3D10 A;  3I5I B;  1W7I B;  3I5G B;  3TDI A;  3OB1 B;  3CWG A;  2KNE A;  3OX6 A;  1BF5 A;  1J7O A;  1H4B A;  1IQ5 A;  2F2P A;  1ZOT B;  4PHN A;  2JZI A;  1ZUZ A;  1RJV A;  1WLM A;  2M1U A;  1AJ4 A;  1J55 A;  1VRK A;  3TS5 B;  1XFV O;  1QLS A;  1BG1 A;  3CR4 X;  2LHI A;  1SRA A;  1K9P A;  3SG2 A;  1Y1A A;  1RK9 A;  1TN4 A;  4AQJ A;  1DJW A;  4P5O E;  3VRN A;  2LAN A;  1XK4 A;  3IF7 A;  3VRO A;  1WRZ A;  1NCZ A;  2L98 A;  1B8L A;  1WDC B;  1YTZ C;  1G33 A;  2GV5 A;  3O2P A;  1H8B A;  1JUO A;  4YRU A;  2M3W A;  1RRO A;  2JTT A;  2V53 A;  4PE1 A;  3JTD C;  1BR1 B;  4M2P A;  3RM1 A;  1KQM C;  4DCK A;  4F0Z B;  1C7W A;  1JBA A;  1J1D A;  3A4U B;  1ALW A;  2KI4 C;  2JXL A;  1EG3 A;  4UPG A;  2KQ6 A;  1K96 A;  2MHH A;  4PE7 A;  2KFF A;  1CDN A;  1QAT A;  2HET A;  2BBN A;  1N2D A;  4ORA B;  4PE4 A;  1ALV A;  1NYA A;  2KBM A;  1M46 A;  1TOP A;  4HRG A;  1SL7 A;  4IL1 A;  4YGB B;  2JOJ A;  2K7C A;  3EK8 A;  2PRU A;  2LLU A;  2LVK A;  1B47 A;  1OOJ A;  1E8A A;  3FIA A;  1ZFS A;  3JVT C;  1QV1 A;  4WRI A;  1CFD A;  1HQV A;  2I18 A;  1BLQ A;  3PLF B;  2WCB A;  3VGO A;  1C07 A;  1CFP A;  1K90 D;  2BCB A;  5AFP A;  2JPT A;  2CT9 A;  2LUX A;  3PSR A;  1V1F A;  1NCX A;  3EKH A;  1SW8 A;  1UHI A;  4OKH A;  5HLV A;  1KFU L;  1F55 A;  1UHJ A;  5ER5 A;  5CSI A;  1A29 A;  1KSM A;  5D69 A;  2WCF A;  4I5K A;  1KK8 B;  2JU0 A;  2LVI A;  4I5N B;  2B1U A;  3BUW B;  2M8U A;  3E3R A;  3LK0 A;  2K61 A;  4OVN F;  1WLZ A;  4N5X A;  5I2O A;  5CSN A;  3VRP A;  1CMG A;  2H61 C;  2HPS A;  1ODB A;  2PMY A;  3A8R A;  3NSK A;  1K95 A;  1UP5 A;  1OMR A;  4GPL B;  5D7F A;  1NWD A;  1IH0 A;  4GNK B;  3FWB A;  1QS7 A;  1AVS A;  1MUX A;  1R6P A;  1KWO B;  2LAP A;  3SIA A;  2LC5 A;  1IQ3 A;  1QX5 B;  1PSR A;  3I5H C;  2O60 A;  4HRE E;  1IKU A;  5JOL A;  1S6J A;  5F6T A;  1TCF A;  2LMV A;  3TS5 C;  4MN0 A;  4I5L B;  1AHR A;  1PVA A;  3GK2 A;  1DF0 B;  1M45 A;  1CDM A;  3DVJ A;  1B1G A;  1RWY A;  4MZL A;  4FQO A;  4CID A;  3KHE A;  1A4P A;  2KFG A;  3CS1 A;  3FWC A;  2JC2 A;  1Y1X A;  3PAL A;  4ICB A;  4MLW A;  1SCM C;  1SR6 B;  2BCA A;  1WDC C;  3DVK A;  4HRH A;  2JNF A;  4AQI A;  3FS7 A;  1FPW A;  2MA2 A;  1LVC D;  1WRL A;  1IJ5 A;  3BOW A;  1F8H A;  1CMF A;  1GGW A;  2L0P A;  1FW4 A;  3CLN A;  1OMD A;  2CBL A;  2JXC A;  1PK0 D;  5PAL A;  2LMU A;  4OR9 B;  1YUR A;  3PAT A;  4GGF A;  3TDZ A;  3AAJ A;  1TTX A;  2G2B A;  2LVV A;  1XFY O;  4JQ0 D;  2H2K A;  2L2E A;  1CDP A;  3M0W A;  5HKW A;  2OS8 B;  1SL9 A;  2WC8 A;  1JFK A;  1KK7 Y;  4U8D A;  1A75 B;  1EJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...