4PHKA

The structural basis of differential inhibition of human calpain by indole and phenyl alpha-mercaptoacrylic acids. the complex with (z)-3-(4-chlorophenyl)-2-mercaptoacrylic acid
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
173
structure length
173
Chain Sequence
b'EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calpain small subunit 1
publication title The structural basis of differential inhibition of human calpain by indole and phenyl alpha-mercaptoacrylic acids.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 64
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4phkA00
4C0LA 4AQJA 1B47A 2M7NA 1LA3A 4CPVA 1K94A 1MXLC 1K9KA 2RGIA 2WORA 5B8IB 1S6CA 1TNQA 1NX0A 1QIWA 1TNXA 1ZFSA 2L4HA 2M7LA 1MXEA 4XJKA 2CBLA 4PHNA 2PASA 3NSKA 2KGRA 3M0WA 3LK1A 3TDIA 2LANA 2JT3A 1NWDA 4HRGA 4CIDA 3JVTC 3EK4A 3QRXA 3AKBA 2OPOA 1R6PA 4HREE 4PCWA 3FWCA 1S26D 1G8IA 4GBAA 1OOJA 4BY4A 3JVTB 3OHMB 3IQOA 4OR9B 4GGFA 1J7PA 5IBWA 2PSRA 4AOMA 2KFHA 4MN0A 1QJTA 2BBNA 4IL1A 1WDCC 2F3ZA 1WRZA 3BUXB 2BL0C 2LC5A 2M0RA 2M8UA 1CM4A 1DF0B 2LMUA 1KFXS 1SR6C 1TTXA 2WCBA 3KO0A 1FBVA 1QIVA 2WCEA 4A4CA 3PFVA 4HSZA 1PSRA 1YRUB 2LM5A 2K2AA 3CR2A 1WDCB 3PN7C 1CLBA 1CM1A 1M63B 2BL0B 3DVMA 1GJYA 2BCAA 1SR6B 2IS9A 2JNXA 3FIAA 4GNKB 1F54A 1XK4A 1E8AA 2ZFDA 1YVHA 5KTYA 1UHHA 4MEWA 1PVBA 1SNLA 1GQMA 2K7OA 3GK2A 4UPGA 1AP4A 3NXAA 1HQVA 2ZRTA 1W7IB 1S5GY 4GGNA 4CFQA 1S6IA 1XFUO 4QJ4B 3SG6A 2JC2A 1SL7A 4U8DA 3SG5A 5HKYA 1BF5A 4QJ3B 2Y5IA 1IG5A 2WCFA 2ISDA 3EVVA 2KHNA 1J7QA 1F4OA 4ICBA 1JWDA 4JPZB 2R2IA 4OV2A 3KHEA 1TRFA 1ALWA 2F2PA 3BYAA 1XFXO 3HX4A 1VRKA 4N5XA 4OCIA 1DJHA 2JQ6A 4AQIA 4E68A 1W7JB 1DJGA 2DOQA 1YRTB 1U5IB 1OQPA 3TUYC 2LAPA 1NX3A 1CDMA 1PSBA 2MBXA 2L2EA 1Y6WA 3A4UB 3E3RA 1V1FA 2WNDA 2JWWA 3TUYB 1M31A 1XFYO 2KYFA 2MA2A 3BUWB 5D7FA 4MZKA 1BT6A 3SJSA 2KFGA 1QX5B 1IQ5A 1CLLA 1CMGA 4YI9A 1WRLA 1JF0A 2JPTA 3SIBA 2BKIB 4R1EA 1C7VA 1DMOA 3CR5X 3EKJA 5KSZA 1CLMA 3IF7A 3KEVA 2AUCA 2M9GA 2NCOA 4FTGA 1UHJA 3NSLA 1YVLA 4NDBA 2LMVA 2H2KA 4QJ5B 2CNPA 5D69A 3VRPA 1B7TY 3NSIA 1TNPA 2LNKA 4I5NB 1XA5A 1KK8C 1ODBA 4GAOA 2L98A 5G08A 1DVIA 5J3XA 5I8NA 1FI5A 1JSAA 3DD4A 1NCXA 1XFVO 4OVNF 1KK7Z 3CS1A 4ORBB 4YGBB 2WOSA 2NLNA 1SBJA 3I5FC 1QVIY 1KK8B 1WLZA 2CT9A 2LVIA 2O5GA 1ZOTB 3EK8A 3LCPC 3GK4X 2I94A 4YGEB 1KCYA 1GGZA 3AAKA 1SCMC 1A75B 2HETA 3CGAA 1H4BA 1DGVA 3I5FB 4PE1A 1YURA 4PHJA 5K89A 3SG3A 1AUIB 2V53A 1M45A 2BBMA 2AAOA 3I5IC 4P5OE 1SCMB 3AAJA 5HLOA 2GGZA 3HCMA 5I2QA 3PSRA 3VROA 1G4YR 1PVAA 3SIAA 1HT9A 1NCZA 1H8BA 2LVKA 1J7RA 1DJZA 3I5IB 3LL8B 2EC6C 2NZ0A 3DF0B 1JBAA 1K8UA 2OS8B 4PDZA 5TNCA 2L4IA 1Y1AA 1QV1A 1J1EA 1KFXL 1QATA 1RTP1 2EC6B 2FJUB 4GFTA 1B8LA 4PALA 4F0ZB 1EXRA 1M46A 5AFPA 4MLWA 1KSOA 2L0PA 1RK9A 1M39A 1MQ1A 3BQ3A 2LLTA 2PMYA 3EVRA 3NSOA 1PK0D 2OTGC 3DVJA 1C07A 2K7DA 1RJVA 2MJWB 1DF0A 3BUOB 3I5GC 2G9BA 2EGDA 1QLSA 2KI4C 2MAZA 3RM1A 1QXPA 1NYAA 1MF8B 4PE7A 2OTGB 3VGOA 2NCPA 4M2PA 4I5JA 1FI6A 2FCDA 1CFFA 2KAXA 3I5GB 4N1FA 1SYMA 2BCBA 2WC8A 2KI4B 1MUXA 4P2YB 1XYDA 2LE9B 2MLFC 1N65A 4YGDB 1CNPA 5JOLA 1J7OA 1XVJA 3TDZA 1MHOA 1XFZO 1LA0A 1C7WA 3SG2A 5GQQC 2M29A 1MWNA 3CZTX 3PLFB 4CFRA 1CB1A 3D0YB 2JXCA 2Y1NA 3OB2B 2KQ6A 2LUCA 1XO5A 1Y0VH 3EKHA 2QPTA 2ZN8A 4ORAB 2KYCA 3H4SE 2JXLA 4CLNA 1B1GA 2CTNA 2JTTA 2NXQA 3A8RA 1EH2A 4L9MA 1OZOA 1U5IA 1A03A 5HYDA 1EL4A 2KI6C 1K95A 4DS7A 3DVKA 2KDHA 2PVBA 4ZCVA 5BPJA 1SPYA 5KU1A 2L50A 4N1GA 1YX8A 1L2OC 1KWOC 2JULA 3MSEB 5HKWA 3RLZA 2JT0A 2AMIA 2MLEC 1F4QA 2CCMA 1FPWA 3TZ1A 2M1UA 4I5LB 1K93D 1CFPA 4M2QA 1L2OB 1KWOB 1IKUA 1BODA 4YGCB 1B4CA 5DKNA 2M97A 1SCVA 3LK0A 1A29A 2E30A 2MHHA 3PALA 2F2OA 2K0JA 1AJ4A 2KGBC 4USLA 2FOTA 4HRHA 3VRNA 2GGMA 2I2RE 1JUOA 2LLUA 1RECA 3GK1A 3BOWA 3TDUA 1SL8A 4DIRA 4BY5A 1LVCD 2ZN9A 1MR8A 3OP0A 2L51A 3K21A 1IGVA 2LHLA 2BKHB 3PATA 1OSAA 1B9AA 1EJ3A 2L5XB 5AANA 5F6TA 1AK8A 1BG1A 1IJ5A 2JTZA 2K8MB 4YGAA 4C0JA 1K9UA 1RWYA 2LVVA 4ETOA 1CMFA 1RFJA 2LLSA 2LMTA 1N2DA 1QLKA 2M3WA 3JTDC 2KFFA 1IRJA 4YRUA 1K9PA 4XYNA 2BECA 1L7ZA 3WHUB 1Y1UA 3ZNIA 1GGWA 2HF5A 3DF0A 4M2OA 2I7AA 2G2BA 4I5KA 2OS8C 1NUBA 1PALA 1JF2A 1DJXA 3JTDB 3IQQA 1S36A 2EHBA 1ALVA 2KQYA 1Y1XA 1KQVA 1SY9A 1CFCA 2COLB 5FYXA 5CSFA 1QTXA 1K96A 1JC2A 2ZRSA 5CPVA 1EG3A 2VRGA 4PHKA 1BR4B 4DUQA 1CKKA 2H61C 2F33A 5ER5A 1FF1A 1SKTA 2M1KB 1PULA 1YX7A 4YBHB 1NIWA 4C0KA 3BXKA 1QVIZ 1LINA 1FW4A 2JRFA 1DT7B 5ER4X 1F70A 1S3PA 3SG7A 4MRXA 1WRKA 1IQ3A 2SCPA 2LCPA 4GPLB 1UHIA 2SASA 4TNCA 2F3YA 3TS5C 1UHNA 4FQOA 4DCKA 2LP2A 1TNWA 4WRIA 5CSIA 3CLNA 1XFWO 1NPQA 3O2PA 2ZNDA 3TS5B 1QX7A 5PALA 2BE6A 1DJIA 1QX2A 5I2LA 2TN4A 2KAYA 1LKJA 1J1DA 1UWOA 1YUUA 4XJKB 3D0YA 1N0YA 2K7BA 1R2UA 1TIZA 1S1EA 4YI8A 1PRWA 1UURA 5AEQA 4MRYA 2QACA 4A4BA 5HLVA 5HKZA 1NP8A 2ZKMX 4GGFC 1SRAA 2Q4UA 4NDCA 5CSNA 1AHRA 1AJ5A 2E6WA 1ZMZA 4PE4A 2D8NA 1OZSA 1Q80A 2O60A 1ZUZA 1DJYA 4ORCB 3GOFA 2BE4A 2P6BB 1A2XA 1G33A 3DVEA 1KQMC 3AKAA 1F8HA 3CWGA 3FS7A 3PN7B 1XK4C 1BU3A 2FCEA 2CXJA 4GUKA 1OMRA 1J55A 1CTRA 1KQMB 2LUXA 1X02A 1CDPA 1YUSA 1QV0A 2LP3A 3KF9A 1BOCA 1OE9B 4D1EA 3OX6A 1CFDA 1IWQA 2K7CA 2GV5A 2LV7A 1K2HA 4MBEA 3SG4A 3D10A 1EG4A 3WNXB 2K61A 4MZLA 2KNEA 1YTZC 3LLEA 1TCFA 1CDNA 2LHIA 1ZACA 4NDDA 1S5GZ 1SK6D 1UP5A 3OB1B 1LXFC 1CDLA 2HQWA 5AERA 3EVUA 1IH0A 3BUNB 3O78A 2A4JA 2F8PA 1S6JA 3O4YA 4PE0A 1BR1B 1A4PA 1QASA 4MVFA 3CR4X 3ZWHA 1NX2A 4Q04A 3WHTB 1BJFA 2M49B 3FWBA 5CSJA 1D1OA 2LVJA 3BUMB 1KK7Y 4PHMA 1YUTA 3WXAA 1UHKA 2HPSA 1JFKA 3C1VA 5AXIA 1UUSA 2KAVA 3O6BA 4WQ2A 1WY9A 5JJGA 3KPXA 1SMGA 4JQ0D 1F55A 4JWQA 1NSHA 1NX1A 1WLMA 2KBIA 4WQ3A 3PM8A 1A75A 2PRUA 2ZNEA 5I2OA 2JOJA 1JFJA 1OMDA 1SL9A 1V1GA 1QS7A 1OMVA 2JZIA 4MZJA 5DKRA 5DKQA 3OX5A 4OKHA 4ZCUA 4DRWA 3I5HC 1B8CA 1TOPA 2KSPA 3VRRA 3VRQA 2I18A 2KBMA 1TCOB 2BCXA 1DTLA 2JT8A 1KFUL 4NQGA 1BLQA 2B1UA 2PALA 3I5HB 3CTNA 4MSPA 3ICBA 2Y4QA 1AVSA 3BOWB 1SW8A 2HQ8A 1IJ6A 1KSMA 1F71A 2KI6D 2MRDA 1DGUA 1K90D 3EK7A 1BMOA 1YR5A 1B7TZ 1B8RA 1RROA 1TN4A 2JNFA 2KOTA 2Y1MA 3F45A 2Q91A 1DJWA 1NCYA 2H61A 2JU0A 2K2FA 1KFUS
chains in the Genus database with same CATH superfamily
4C0LA 4AQJA 1B47A 2WCKA 2M7NA 1LA3A 4CPVA 1K94A 2KPHA 2QEHA 1MXLC 1K9KA 2RGIA 2WORA 5B8IB 1S6CA 1TNQA 1NX0A 1QIWA 1TNXA 1ZFSA 5FI6A 2L4HA 2M7LA 1MXEA 4XJKA 2CBLA 2P71A 4PHNA 2PASA 3NSKA 2KGRA 3M0WA 3LK1A 3TDIA 2LANA 2JT3A 3S0BA 1NWDA 2BNXA 4HRGA 4CIDA 3JVTC 3EK4A 3QRXA 3UNWA 3AKBA 2OPOA 1R6PA 4HREE 4PCWA 3FWCA 1S26D 1G8IA 4GBAA 1OOJA 4BY4A 3JVTB 3OHMB 3IQOA 4OR9B 4GGFA 1J7PA 3CZ2A 5IBWA 2PSRA 4AOMA 2KFHA 4MN0A 1QJTA 2BBNA 4IL1A 3SS3A 1WDCC 2F3ZA 1WRZA 3BUXB 2BL0C 2LC5A 2M0RA 2M8UA 1CM4A 1DF0B 2LMUA 1KFXS 1SR6C 1TTXA 2WCBA 3KO0A 1FBVA 1QIVA 2WCEA 3PM2A 4A4CA 3PFVA 3R72A 1PSRA 1YRUB 2LM5A 2K2AA 3CR2A 1WDCB 3PN7C 4HSZA 1CLBA 3OBVA 1CM1A 1M63B 2BL0B 3DVMA 4FQTA 1GJYA 2BCAA 1SR6B 2IS9A 2JNXA 1TWOA 3FIAA 4GNKB 4JKTA 1XK4A 1F54A 1DQEA 1E8AA 2ZFDA 1YVHA 5KTYA 1UHHA 3D78A 4MEWA 3UO9A 1Z2CB 1PVBA 2PYQA 1SNLA 1GQMA 2K7OA 2QDIA 3GK2A 4UPGA 1AP4A 3NXAA 3PJIA 1HQVA 2ZRTA 1W7IB 1S5GY 4GGNA 4CFQA 3K1EA 1S6IA 1XFUO 2WCJA 4QJ4B 3SG6A 2JC2A 1SL7A 4U8DA 3SG5A 5HKYA 1BF5A 4QJ3B 2Y5IA 1IG5A 2WCFA 2ISDA 3EVVA 2KHNA 1J7QA 1F4OA 4ICBA 1JWDA 4JPZB 2R2IA 4OV2A 3KHEA 1TRFA 1ALWA 2F2PA 3BYAA 1XFXO 2L5YA 3HX4A 5DICA 1VRKA 4N5XA 4OCIA 1DJHA 2JQ6A 4AQIA 3DYEA 4E68A 1W7JB 1DJGA 2DOQA 1YRTB 1U5IB 1OQPA 3TUYC 2LAPA 1NX3A 1CDMA 1PSBA 2K60A 2MBXA 2L2EA 1Y6WA 1T14A 3A4UB 1V1FA 3E3RA 2WNDA 2JWWA 3TUYB 1M31A 1XFYO 2KYFA 2MA2A 3BUWB 5D7FA 4MZKA 1BT6A 3SJSA 2KFGA 1QX5B 1IQ5A 1CLLA 1CMGA 4YI9A 1WRLA 1JF0A 2JPTA 3SIBA 2BKIB 3FE9A 4R1EA 3BFHA 1C7VA 5EL2A 1DMOA 5FI7A 3CR5X 1OW4A 3EKJA 3OGNA 5KSZA 1CLMA 3IF7A 3KEVA 2AUCA 2M9GA 2NCOA 3CABA 4FTGA 5HL1A 1UHJA 1OOFA 3NSLA 1YVLA 4JD9A 4NDBA 2LMVA 2H2KA 4QJ5B 2CNPA 3CZ1A 5D69A 3VRPA 1B7TY 3NSIA 1TNPA 2LNKA 4I5NB 1XA5A 1KK8C 3NHIA 1ODBA 4GAOA 2L98A 5G08A 1DVIA 5J3XA 5I8NA 1FI5A 1JSAA 3DD4A 1NCXA 1XFVO 4OVNF 1KK7Z 3CS1A 4ORBB 1P28A 4YGBB 2WOSA 2NLNA 1SBJA 3I5FC 1QVIY 1KK8B 1WLZA 2CT9A 2LVIA 2O5GA 1ZOTB 3EK8A 3LCPC 3GK4X 2I94A 4YGEB 1KCYA 1GGZA 3AAKA 1SCMC 1A75B 2HETA 3CGAA 3L4AA 1H4BA 1DGVA 3I5FB 4PE1A 1YURA 3CZ0A 4PHJA 5K89A 2YGUA 3SG3A 1AUIB 2V53A 1M45A 2BBMA 2AAOA 3I5IC 4P5OE 1SCMB 3AAJA 5HLOA 2GGZA 2WC6A 3HCMA 5I2QA 3PSRA 3VROA 1G4YR 1PVAA 3SIAA 1HT9A 1NCZA 1H8BA 2LVKA 1J7RA 1DJZA 3I5IB 3LL8B 2EC6C 2NZ0A 3DF0B 1JBAA 1K8UA 2OS8B 4PDZA 5TNCA 5FI2A 2L4IA 1Y1AA 3SS5A 1QV1A 1J1EA 1KFXL 1QATA 1RTP1 2EC6B 2FJUB 4GFTA 1B8LA 4PALA 4F0ZB 1EXRA 1M46A 5AFPA 4MLWA 1KSOA 2L0PA 1RK9A 1M39A 1MQ1A 3BQ3A 2LLTA 2PMYA 3EVRA 3NSOA 1PK0D 2OTGC 3DVJA 3V2LA 2K7DA 1RJVA 1C07A 2MJWB 1DF0A 3BUOB 3I5GC 2G9BA 2EGDA 1QLSA 2KI4C 2KLDA 2MAZA 1QXPA 3RM1A 1NYAA 1MF8B 4PE7A 2OTGB 3VGOA 2NCPA 4KYNA 4M2PA 4I5JA 1FI6A 2FCDA 1CFFA 2KAXA 3I5GB 4N1FA 1SYMA 2BCBA 2WC8A 2KI4B 1MUXA 4P2YB 1XYDA 2LE9B 2MLFC 3IVTA 1N65A 3D76A 1DC1A 4YGDB 1CNPA 5JOLA 3BJHA 1J7OA 1XVJA 3TDZA 1MHOA 1XFZO 1LA0A 1C7WA 3RZSA 3SG2A 5GQQC 2M29A 1MWNA 3CZTX 3PLFB 4CFRA 1CB1A 2ERBA 3D0YB 2JXCA 2Y1NA 3OB2B 2KQ6A 3QMEA 2LUCA 1XO5A 1Y0VH 3EKHA 2QPTA 2ZN8A 3CDNA 4ORAB 2KYCA 3H4SE 2JXLA 4CLNA 1B1GA 2CTNA 1SSEB 2JTTA 2NXQA 3A8RA 1EH2A 4L9MA 1OZOA 1U5IA 1A03A 5HYDA 1OOHA 1EL4A 2KI6C 1K95A 4DS7A 1DELA 3DVKA 2PQLA 2KDHA 2PVBA 4ZCVA 5BPJA 1SPYA 5KU1A 2L50A 4N1GA 1YX8A 1L2OC 1KWOC 2JULA 2QEOA 3MSEB 5HKWA 2JT0A 2AMIA 2MLEC 1F4QA 3RLZA 2CCMA 1FPWA 3TZ1A 2M1UA 4I5LB 1K93D 1CFPA 4M2QA 1W9ZA 1L2OB 1KWOB 1IKUA 1BODA 4YGCB 1B4CA 3VB1A 5DKNA 2M97A 1SCVA 2GTEA 3LK0A 5D3OA 3B6XA 1A29A 2E30A 2MHHA 5I94A 3PALA 2F2OA 1LS8A 2K0JA 1AJ4A 2KGBC 3O4XA 4USLA 2FOTA 3B88A 1ORGA 4HRHA 2GGMA 3VRNA 2I2RE 1JUOA 2LLUA 1RECA 3GK1A 3BOWA 3TDUA 3S0FA 1SL8A 4DIRA 4BY5A 2L2CA 4IJ7A 1LVCD 2ZN9A 1MR8A 3OP0A 2L51A 3K21A 1IGVA 2LHLA 2BKHB 3PATA 1OSAA 1B9AA 1EJ3A 2L5XB 5AANA 5F6TA 1AK8A 1BG1A 1IJ5A 1OOGA 3D75A 2JTZA 2K8MB 1OOIX 4PT1A 4YGAA 4C0JA 1K9UA 1C3ZA 1RWYA 2LVVA 3EG5B 4ETOA 1CMFA 1RFJA 2LLSA 2LMTA 1N2DA 1QLKA 2M3WA 3JTDC 2KFFA 1IRJA 4YRUA 1K9PA 4XYNA 2BECA 1L7ZA 3WHUB 1Y1UA 3ZNIA 1GGWA 2HF5A 3DF0A 4M2OA 2I7AA 2G2BA 2KLEA 4I5KA 2OS8C 1NUBA 1PALA 1JF2A 1DJXA 3JTDB 3IQQA 1S36A 2EHBA 1ALVA 2KQYA 4OZDA 1Y1XA 3L4LA 1KQVA 1SY9A 1CFCA 2COLB 5FYXA 5CSFA 3BFBA 1QTXA 1K96A 1JC2A 3B86A 2ZRSA 3NGVA 5CPVA 1EG3A 2VRGA 4PHKA 3B87A 1BR4B 4DUQA 1CKKA 2H61C 2F33A 5ER5A 1FF1A 1SKTA 2M1KB 1PULA 1YX7A 4YBHB 1NIWA 3S0DA 4C0KA 3BXKA 1QVIZ 1LINA 1FW4A 2JRFA 1DT7B 5ER4X 1F70A 1S3PA 3SG7A 4MRXA 1WRKA 1IQ3A 2SCPA 2LCPA 4GPLB 3B7AA 3SS4A 1UHIA 2SASA 4TNCA 2F3YA 3CYZA 3D77A 1IIOA 3TS5C 1UHNA 1C3YA 4FQOA 4DCKA 2LP2A 1TNWA 4WRIA 5CSIA 3S0EA 3CLNA 1XFWO 1NPQA 3D74A 3O2PA 2ZNDA 3TS5B 1QX7A 5PALA 2BE6A 1DJIA 1QX2A 5I2LA 2TN4A 2KAYA 1LKJA 1J1DA 1UWOA 1YUUA 4XJKB 3D0YA 1N0YA 2K7BA 1R2UA 1TIZA 1S1EA 4YI8A 1PRWA 1UURA 5AEQA 4MRYA 2QACA 4A4BA 5HLVA 5HKZA 1NP8A 2ZKMX 4GGFC 1SRAA 2Q4UA 4NDCA 5CSNA 1AHRA 1AJ5A 2E6WA 1ZMZA 4PE4A 2D8NA 1OZSA 3L47A 1Q80A 2O60A 1ZUZA 1DJYA 4ORCB 3R1VA 3GOFA 1TUJA 3Q8IA 2BE4A 2P6BB 1A2XA 1G33A 2WCLA 1KQMC 3AKAA 3DVEA 1F8HA 3CWGA 1Z4HA 3FS7A 3PN7B 1XK4C 3BFAA 1BU3A 2FCEA 2CXJA 4GUKA 1OMRA 1J55A 1CTRA 1KQMB 2LUXA 1X02A 1CDPA 1YUSA 1QV0A 2LP3A 3KF9A 1BOCA 1OE9B 4D1EA 3OX6A 1CFDA 1IWQA 4INWA 2K7CA 2GV5A 2H8VA 2LV7A 2P70A 4MBEA 3SG4A 1K2HA 3D10A 3S0GA 4F7FA 1EG4A 4INXA 3WNXB 2K61A 4MZLA 2KNEA 1YTZC 3LLEA 1TCFA 1CDNA 2LHIA 3S0AA 1DEKA 1ZACA 4NDDA 1S5GZ 1SK6D 1UP5A 3OB1B 1LXFC 1CDLA 2HQWA 5AERA 3EVUA 1IH0A 3BUNB 3O78A 2A4JA 2F8PA 1S6JA 3O4YA 4PE0A 1BR1B 1A4PA 2BAPA 2WC5A 1QASA 4MVFA 3CR4X 3ZWHA 1NX2A 3FE6A 4Q04A 1TUZA 3WHTB 1BJFA 2M49B 3FWBA 5CSJA 1D1OA 2LVJA 3BUMB 1KK7Y 3N7HA 1YUTA 4PHMA 1UHKA 3WXAA 2HPSA 1JFKA 3C1VA 5AXIA 2QEBA 3DXLA 3D73A 1UUSA 2KAVA 3O6BA 4WQ2A 2WCMA 1WY9A 5JJGA 3KPXA 1SMGA 4JQ0D 1F55A 4JWQA 1NSHA 1NX1A 1WLMA 2JPOA 2KBIA 3PM8A 4WQ3A 3DZTA 1A75A 2PRUA 2ZNEA 5I2OA 2JOJA 3R1PA 1JFJA 1OMDA 1SL9A 1V1GA 1QS7A 1OMVA 2JZIA 3R1OA 4MZJA 5DKRA 5DKQA 3OX5A 4OKHA 4ZCUA 4DRWA 3I5HC 1B8CA 1TOPA 2KSPA 3VRRA 2FJYA 3VRQA 2I18A 2KBMA 1TCOB 2BCXA 1DTLA 2JT8A 3DY9A 1KFUL 4NQGA 1BLQA 2B1UA 2PALA 3I5HB 3CTNA 3NHTA 4MSPA 3ICBA 2Y4QA 1AVSA 2QEVA 3BOWB 1SW8A 2HQ8A 1IJ6A 1KSMA 1F71A 2KI6D 2MRDA 1DGUA 1K90D 1GM0A 3EK7A 1BMOA 1YR5A 1B7TZ 1XFRA 1B8RA 1RROA 1TN4A 2JNFA 2KOTA 2WCHA 1QWVA 2Y1MA 3F45A 3FE8A 2Q91A 1DJWA 1NCYA 2H61A 2JU0A 2K2FA 1KFUS
chains in the Genus database with same CATH topology
4C0LA 4AQJA 1B47A 2M7NA 1LA3A 4CPVA 1K94A 1MXLC 1K9KA 2RGIA 2WORA 5B8IB 1S6CA 1TNQA 1NX0A 1QIWA 1TNXA 1ZFSA 2L4HA 2M7LA 1MXEA 4XJKA 2CBLA 4PHNA 2PASA 3NSKA 2KGRA 3M0WA 3LK1A 3TDIA 2LANA 2JT3A 1NWDA 4HRGA 4CIDA 3JVTC 3EK4A 3QRXA 3AKBA 2OPOA 1R6PA 4HREE 4PCWA 3FWCA 1S26D 1G8IA 4GBAA 1OOJA 4BY4A 3JVTB 3OHMB 3IQOA 4OR9B 4GGFA 1J7PA 5IBWA 2PSRA 4AOMA 2KFHA 4MN0A 1QJTA 2BBNA 4IL1A 1WDCC 2F3ZA 1WRZA 3BUXB 2BL0C 2LC5A 2M0RA 2M8UA 1CM4A 1DF0B 2LMUA 1KFXS 1SR6C 1TTXA 2WCBA 3KO0A 1FBVA 1QIVA 2WCEA 4A4CA 3PFVA 4HSZA 1PSRA 1YRUB 2LM5A 2K2AA 3CR2A 1WDCB 3PN7C 1CLBA 1CM1A 1M63B 2BL0B 3DVMA 1GJYA 2BCAA 1SR6B 2IS9A 2JNXA 3FIAA 4GNKB 1F54A 1XK4A 1E8AA 2ZFDA 1YVHA 5KTYA 1UHHA 4MEWA 1PVBA 1SNLA 1GQMA 2K7OA 3GK2A 4UPGA 1AP4A 3NXAA 1HQVA 2ZRTA 1W7IB 1S5GY 4GGNA 4CFQA 1S6IA 1XFUO 4QJ4B 3SG6A 2JC2A 1SL7A 4U8DA 3SG5A 5HKYA 1BF5A 4QJ3B 2Y5IA 1IG5A 2WCFA 2ISDA 3EVVA 2KHNA 1J7QA 1F4OA 4ICBA 1JWDA 4JPZB 2R2IA 4OV2A 3KHEA 1TRFA 1ALWA 2F2PA 3BYAA 1XFXO 3HX4A 1VRKA 4N5XA 4OCIA 1DJHA 2JQ6A 4AQIA 4E68A 1W7JB 1DJGA 2DOQA 1YRTB 1U5IB 1OQPA 3TUYC 2LAPA 1NX3A 1CDMA 1PSBA 2MBXA 2L2EA 1Y6WA 3A4UB 3E3RA 1V1FA 2WNDA 2JWWA 3TUYB 1M31A 1XFYO 2KYFA 2MA2A 3BUWB 5D7FA 4MZKA 1BT6A 3SJSA 2KFGA 1QX5B 1IQ5A 1CLLA 1CMGA 4YI9A 1WRLA 1JF0A 2JPTA 3SIBA 2BKIB 4R1EA 1C7VA 1DMOA 3CR5X 3EKJA 5KSZA 1CLMA 3IF7A 3KEVA 2AUCA 2M9GA 2NCOA 4FTGA 1UHJA 3NSLA 1YVLA 4NDBA 2LMVA 2H2KA 4QJ5B 2CNPA 5D69A 3VRPA 1B7TY 3NSIA 1TNPA 2LNKA 4I5NB 1XA5A 1KK8C 1ODBA 4GAOA 2L98A 5G08A 1DVIA 5J3XA 5I8NA 1FI5A 1JSAA 3DD4A 1NCXA 1XFVO 4OVNF 1KK7Z 3CS1A 4ORBB 4YGBB 2WOSA 2NLNA 1SBJA 3I5FC 1QVIY 1KK8B 1WLZA 2CT9A 2LVIA 2O5GA 1ZOTB 3EK8A 3LCPC 3GK4X 2I94A 4YGEB 1KCYA 1GGZA 3AAKA 1SCMC 1A75B 2HETA 3CGAA 1H4BA 1DGVA 3I5FB 4PE1A 1YURA 4PHJA 5K89A 3SG3A 1AUIB 2V53A 1M45A 2BBMA 2AAOA 3I5IC 4P5OE 1SCMB 3AAJA 5HLOA 2GGZA 3HCMA 5I2QA 3PSRA 3VROA 1G4YR 1PVAA 3SIAA 1HT9A 1NCZA 1H8BA 2LVKA 1J7RA 1DJZA 3I5IB 3LL8B 2EC6C 2NZ0A 3DF0B 1JBAA 1K8UA 2OS8B 4PDZA 5TNCA 2L4IA 1Y1AA 1QV1A 1J1EA 1KFXL 1QATA 1RTP1 2EC6B 2FJUB 4GFTA 1B8LA 4PALA 4F0ZB 1EXRA 1M46A 5AFPA 4MLWA 1KSOA 2L0PA 1RK9A 1M39A 1MQ1A 3BQ3A 2LLTA 2PMYA 3EVRA 3NSOA 1PK0D 2OTGC 3DVJA 1C07A 2K7DA 1RJVA 2MJWB 1DF0A 3BUOB 3I5GC 2G9BA 2EGDA 1QLSA 2KI4C 2MAZA 3RM1A 1QXPA 1NYAA 1MF8B 4PE7A 2OTGB 3VGOA 2NCPA 4M2PA 4I5JA 1FI6A 2FCDA 1CFFA 2KAXA 3I5GB 4N1FA 1SYMA 2BCBA 2WC8A 2KI4B 1MUXA 4P2YB 1XYDA 2LE9B 2MLFC 1N65A 4YGDB 1CNPA 5JOLA 1J7OA 1XVJA 3TDZA 1MHOA 1XFZO 1LA0A 1C7WA 3SG2A 5GQQC 2M29A 1MWNA 3CZTX 3PLFB 4CFRA 1CB1A 3D0YB 2JXCA 2Y1NA 3OB2B 2KQ6A 2LUCA 1XO5A 1Y0VH 3EKHA 2QPTA 2ZN8A 4ORAB 2KYCA 3H4SE 2JXLA 4CLNA 1B1GA 2CTNA 2JTTA 2NXQA 3A8RA 1EH2A 4L9MA 1OZOA 1U5IA 1A03A 5HYDA 1EL4A 2KI6C 1K95A 4DS7A 3DVKA 2KDHA 2PVBA 4ZCVA 5BPJA 1SPYA 5KU1A 2L50A 4N1GA 1YX8A 1L2OC 1KWOC 2JULA 3MSEB 5HKWA 3RLZA 2JT0A 2AMIA 2MLEC 1F4QA 2CCMA 1FPWA 3TZ1A 2M1UA 4I5LB 1K93D 1CFPA 4M2QA 1L2OB 1KWOB 1IKUA 1BODA 4YGCB 1B4CA 5DKNA 2M97A 1SCVA 3LK0A 1A29A 2E30A 2MHHA 3PALA 2F2OA 2K0JA 1AJ4A 2KGBC 4USLA 2FOTA 4HRHA 3VRNA 2GGMA 2I2RE 1JUOA 2LLUA 1RECA 3GK1A 3BOWA 3TDUA 1SL8A 4DIRA 4BY5A 1LVCD 2ZN9A 1MR8A 3OP0A 2L51A 3K21A 1IGVA 2LHLA 2BKHB 3PATA 1OSAA 1B9AA 1EJ3A 2L5XB 5AANA 5F6TA 1AK8A 1BG1A 1IJ5A 2JTZA 2K8MB 4YGAA 4C0JA 1K9UA 1RWYA 2LVVA 4ETOA 1CMFA 1RFJA 2LLSA 2LMTA 1N2DA 1QLKA 2M3WA 3JTDC 2KFFA 1IRJA 4YRUA 1K9PA 4XYNA 2BECA 1L7ZA 3WHUB 1Y1UA 3ZNIA 1GGWA 2HF5A 3DF0A 4M2OA 2I7AA 2G2BA 4I5KA 2OS8C 1NUBA 1PALA 1JF2A 1DJXA 3JTDB 3IQQA 1S36A 2EHBA 1ALVA 2KQYA 1Y1XA 1KQVA 1SY9A 1CFCA 2COLB 5FYXA 5CSFA 1QTXA 1K96A 1JC2A 2ZRSA 5CPVA 1EG3A 2VRGA 4PHKA 1BR4B 4DUQA 1CKKA 2H61C 2F33A 5ER5A 1FF1A 1SKTA 2M1KB 1PULA 1YX7A 4YBHB 1NIWA 4C0KA 3BXKA 1QVIZ 1LINA 1FW4A 2JRFA 1DT7B 5ER4X 1F70A 1S3PA 3SG7A 4MRXA 1WRKA 1IQ3A 2SCPA 2LCPA 4GPLB 1UHIA 2SASA 4TNCA 2F3YA 3TS5C 1UHNA 4FQOA 4DCKA 2LP2A 1TNWA 4WRIA 5CSIA 3CLNA 1XFWO 1NPQA 3O2PA 2ZNDA 3TS5B 1QX7A 5PALA 2BE6A 1DJIA 1QX2A 5I2LA 2TN4A 2KAYA 1LKJA 1J1DA 1UWOA 1YUUA 4XJKB 3D0YA 1N0YA 2K7BA 1R2UA 1TIZA 1S1EA 4YI8A 1PRWA 1UURA 5AEQA 4MRYA 2QACA 4A4BA 5HLVA 5HKZA 1NP8A 2ZKMX 4GGFC 1SRAA 2Q4UA 4NDCA 5CSNA 1AHRA 1AJ5A 2E6WA 1ZMZA 4PE4A 2D8NA 1OZSA 1Q80A 2O60A 1ZUZA 1DJYA 4ORCB 3GOFA 2BE4A 2P6BB 1A2XA 1G33A 3DVEA 1KQMC 3AKAA 1F8HA 3CWGA 3FS7A 3PN7B 1XK4C 1BU3A 2FCEA 2CXJA 4GUKA 1OMRA 1J55A 1CTRA 1KQMB 2LUXA 1X02A 1CDPA 1YUSA 1QV0A 2LP3A 3KF9A 1BOCA 1OE9B 4D1EA 3OX6A 1CFDA 1IWQA 2K7CA 2GV5A 2LV7A 1K2HA 4MBEA 3SG4A 3D10A 1EG4A 3WNXB 2K61A 4MZLA 2KNEA 1YTZC 3LLEA 1TCFA 1CDNA 2LHIA 1ZACA 4NDDA 1S5GZ 1SK6D 1UP5A 3OB1B 1LXFC 1CDLA 2HQWA 5AERA 3EVUA 1IH0A 3BUNB 3O78A 2A4JA 2F8PA 1S6JA 3O4YA 4PE0A 1BR1B 1A4PA 1QASA 4MVFA 3CR4X 3ZWHA 1NX2A 4Q04A 3WHTB 1BJFA 2M49B 3FWBA 5CSJA 1D1OA 2LVJA 3BUMB 1KK7Y 4PHMA 1YUTA 3WXAA 1UHKA 2HPSA 1JFKA 3C1VA 5AXIA 1UUSA 2KAVA 3O6BA 4WQ2A 1WY9A 5JJGA 3KPXA 1SMGA 4JQ0D 1F55A 4JWQA 1NSHA 1NX1A 1WLMA 2KBIA 4WQ3A 3PM8A 1A75A 2PRUA 2ZNEA 5I2OA 2JOJA 1JFJA 1OMDA 1SL9A 1V1GA 1QS7A 1OMVA 2JZIA 4MZJA 5DKRA 5DKQA 3OX5A 4OKHA 4ZCUA 4DRWA 3I5HC 1B8CA 1TOPA 2KSPA 3VRRA 3VRQA 2I18A 2KBMA 1TCOB 2BCXA 1DTLA 2JT8A 1KFUL 4NQGA 1BLQA 2B1UA 2PALA 3I5HB 3CTNA 4MSPA 3ICBA 2Y4QA 1AVSA 3BOWB 1SW8A 2HQ8A 1IJ6A 1KSMA 1F71A 2KI6D 2MRDA 1DGUA 1K90D 3EK7A 1BMOA 1YR5A 1B7TZ 1B8RA 1RROA 1TN4A 2JNFA 2KOTA 2Y1MA 3F45A 2Q91A 1DJWA 1NCYA 2H61A 2JU0A 2K2FA 1KFUS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C0L A;  4AQJ A;  1B47 A;  2M7N A;  1LA3 A;  4CPV A;  1K94 A;  1MXL C;  1K9K A;  2RGI A;  2WOR A;  5B8I B;  1S6C A;  1TNQ A;  1NX0 A;  1QIW A;  1TNX A;  1ZFS A;  2L4H A;  2M7L A;  1MXE A;  4XJK A;  2CBL A;  4PHN A;  2PAS A;  3NSK A;  2KGR A;  3M0W A;  3LK1 A;  3TDI A;  2LAN A;  2JT3 A;  1NWD A;  4HRG A;  4CID A;  3JVT C;  3EK4 A;  3QRX A;  3AKB A;  2OPO A;  1R6P A;  4HRE E;  4PCW A;  3FWC A;  1S26 D;  1G8I A;  4GBA A;  1OOJ A;  4BY4 A;  3JVT B;  3OHM B;  3IQO A;  4OR9 B;  4GGF A;  1J7P A;  5IBW A;  2PSR A;  4AOM A;  2KFH A;  4MN0 A;  1QJT A;  2BBN A;  4IL1 A;  1WDC C;  2F3Z A;  1WRZ A;  3BUX B;  2BL0 C;  2LC5 A;  2M0R A;  2M8U A;  1CM4 A;  1DF0 B;  2LMU A;  1KFX S;  1SR6 C;  1TTX A;  2WCB A;  3KO0 A;  1FBV A;  1QIV A;  2WCE A;  4A4C A;  3PFV A;  4HSZ A;  1PSR A;  1YRU B;  2LM5 A;  2K2A A;  3CR2 A;  1WDC B;  3PN7 C;  1CLB A;  1CM1 A;  1M63 B;  2BL0 B;  3DVM A;  1GJY A;  2BCA A;  1SR6 B;  2IS9 A;  2JNX A;  3FIA A;  4GNK B;  1F54 A;  1XK4 A;  1E8A A;  2ZFD A;  1YVH A;  5KTY A;  1UHH A;  4MEW A;  1PVB A;  1SNL A;  1GQM A;  2K7O A;  3GK2 A;  4UPG A;  1AP4 A;  3NXA A;  1HQV A;  2ZRT A;  1W7I B;  1S5G Y;  4GGN A;  4CFQ A;  1S6I A;  1XFU O;  4QJ4 B;  3SG6 A;  2JC2 A;  1SL7 A;  4U8D A;  3SG5 A;  5HKY A;  1BF5 A;  4QJ3 B;  2Y5I A;  1IG5 A;  2WCF A;  2ISD A;  3EVV A;  2KHN A;  1J7Q A;  1F4O A;  4ICB A;  1JWD A;  4JPZ B;  2R2I A;  4OV2 A;  3KHE A;  1TRF A;  1ALW A;  2F2P A;  3BYA A;  1XFX O;  3HX4 A;  1VRK A;  4N5X A;  4OCI A;  1DJH A;  2JQ6 A;  4AQI A;  4E68 A;  1W7J B;  1DJG A;  2DOQ A;  1YRT B;  1U5I B;  1OQP A;  3TUY C;  2LAP A;  1NX3 A;  1CDM A;  1PSB A;  2MBX A;  2L2E A;  1Y6W A;  3A4U B;  3E3R A;  1V1F A;  2WND A;  2JWW A;  3TUY B;  1M31 A;  1XFY O;  2KYF A;  2MA2 A;  3BUW B;  5D7F A;  4MZK A;  1BT6 A;  3SJS A;  2KFG A;  1QX5 B;  1IQ5 A;  1CLL A;  1CMG A;  4YI9 A;  1WRL A;  1JF0 A;  2JPT A;  3SIB A;  2BKI B;  4R1E A;  1C7V A;  1DMO A;  3CR5 X;  3EKJ A;  5KSZ A;  1CLM A;  3IF7 A;  3KEV A;  2AUC A;  2M9G A;  2NCO A;  4FTG A;  1UHJ A;  3NSL A;  1YVL A;  4NDB A;  2LMV A;  2H2K A;  4QJ5 B;  2CNP A;  5D69 A;  3VRP A;  1B7T Y;  3NSI A;  1TNP A;  2LNK A;  4I5N B;  1XA5 A;  1KK8 C;  1ODB A;  4GAO A;  2L98 A;  5G08 A;  1DVI A;  5J3X A;  5I8N A;  1FI5 A;  1JSA A;  3DD4 A;  1NCX A;  1XFV O;  4OVN F;  1KK7 Z;  3CS1 A;  4ORB B;  4YGB B;  2WOS A;  2NLN A;  1SBJ A;  3I5F C;  1QVI Y;  1KK8 B;  1WLZ A;  2CT9 A;  2LVI A;  2O5G A;  1ZOT B;  3EK8 A;  3LCP C;  3GK4 X;  2I94 A;  4YGE B;  1KCY A;  1GGZ A;  3AAK A;  1SCM C;  1A75 B;  2HET A;  3CGA A;  1H4B A;  1DGV A;  3I5F B;  4PE1 A;  1YUR A;  4PHJ A;  5K89 A;  3SG3 A;  1AUI B;  2V53 A;  1M45 A;  2BBM A;  2AAO A;  3I5I C;  4P5O E;  1SCM B;  3AAJ A;  5HLO A;  2GGZ A;  3HCM A;  5I2Q A;  3PSR A;  3VRO A;  1G4Y R;  1PVA A;  3SIA A;  1HT9 A;  1NCZ A;  1H8B A;  2LVK A;  1J7R A;  1DJZ A;  3I5I B;  3LL8 B;  2EC6 C;  2NZ0 A;  3DF0 B;  1JBA A;  1K8U A;  2OS8 B;  4PDZ A;  5TNC A;  2L4I A;  1Y1A A;  1QV1 A;  1J1E A;  1KFX L;  1QAT A;  1RTP 1;  2EC6 B;  2FJU B;  4GFT A;  1B8L A;  4PAL A;  4F0Z B;  1EXR A;  1M46 A;  5AFP A;  4MLW A;  1KSO A;  2L0P A;  1RK9 A;  1M39 A;  1MQ1 A;  3BQ3 A;  2LLT A;  2PMY A;  3EVR A;  3NSO A;  1PK0 D;  2OTG C;  3DVJ A;  1C07 A;  2K7D A;  1RJV A;  2MJW B;  1DF0 A;  3BUO B;  3I5G C;  2G9B A;  2EGD A;  1QLS A;  2KI4 C;  2MAZ A;  3RM1 A;  1QXP A;  1NYA A;  1MF8 B;  4PE7 A;  2OTG B;  3VGO A;  2NCP A;  4M2P A;  4I5J A;  1FI6 A;  2FCD A;  1CFF A;  2KAX A;  3I5G B;  4N1F A;  1SYM A;  2BCB A;  2WC8 A;  2KI4 B;  1MUX A;  4P2Y B;  1XYD A;  2LE9 B;  2MLF C;  1N65 A;  4YGD B;  1CNP A;  5JOL A;  1J7O A;  1XVJ A;  3TDZ A;  1MHO A;  1XFZ O;  1LA0 A;  1C7W A;  3SG2 A;  5GQQ C;  2M29 A;  1MWN A;  3CZT X;  3PLF B;  4CFR A;  1CB1 A;  3D0Y B;  2JXC A;  2Y1N A;  3OB2 B;  2KQ6 A;  2LUC A;  1XO5 A;  1Y0V H;  3EKH A;  2QPT A;  2ZN8 A;  4ORA B;  2KYC A;  3H4S E;  2JXL A;  4CLN A;  1B1G A;  2CTN A;  2JTT A;  2NXQ A;  3A8R A;  1EH2 A;  4L9M A;  1OZO A;  1U5I A;  1A03 A;  5HYD A;  1EL4 A;  2KI6 C;  1K95 A;  4DS7 A;  3DVK A;  2KDH A;  2PVB A;  4ZCV A;  5BPJ A;  1SPY A;  5KU1 A;  2L50 A;  4N1G A;  1YX8 A;  1L2O C;  1KWO C;  2JUL A;  3MSE B;  5HKW A;  3RLZ A;  2JT0 A;  2AMI A;  2MLE C;  1F4Q A;  2CCM A;  1FPW A;  3TZ1 A;  2M1U A;  4I5L B;  1K93 D;  1CFP A;  4M2Q A;  1L2O B;  1KWO B;  1IKU A;  1BOD A;  4YGC B;  1B4C A;  5DKN A;  2M97 A;  1SCV A;  3LK0 A;  1A29 A;  2E30 A;  2MHH A;  3PAL A;  2F2O A;  2K0J A;  1AJ4 A;  2KGB C;  4USL A;  2FOT A;  4HRH A;  3VRN A;  2GGM A;  2I2R E;  1JUO A;  2LLU A;  1REC A;  3GK1 A;  3BOW A;  3TDU A;  1SL8 A;  4DIR A;  4BY5 A;  1LVC D;  2ZN9 A;  1MR8 A;  3OP0 A;  2L51 A;  3K21 A;  1IGV A;  2LHL A;  2BKH B;  3PAT A;  1OSA A;  1B9A A;  1EJ3 A;  2L5X B;  5AAN A;  5F6T A;  1AK8 A;  1BG1 A;  1IJ5 A;  2JTZ A;  2K8M B;  4YGA A;  4C0J A;  1K9U A;  1RWY A;  2LVV A;  4ETO A;  1CMF A;  1RFJ A;  2LLS A;  2LMT A;  1N2D A;  1QLK A;  2M3W A;  3JTD C;  2KFF A;  1IRJ A;  4YRU A;  1K9P A;  4XYN A;  2BEC A;  1L7Z A;  3WHU B;  1Y1U A;  3ZNI A;  1GGW A;  2HF5 A;  3DF0 A;  4M2O A;  2I7A A;  2G2B A;  4I5K A;  2OS8 C;  1NUB A;  1PAL A;  1JF2 A;  1DJX A;  3JTD B;  3IQQ A;  1S36 A;  2EHB A;  1ALV A;  2KQY A;  1Y1X A;  1KQV A;  1SY9 A;  1CFC A;  2COL B;  5FYX A;  5CSF A;  1QTX A;  1K96 A;  1JC2 A;  2ZRS A;  5CPV A;  1EG3 A;  2VRG A;  4PHK A;  1BR4 B;  4DUQ A;  1CKK A;  2H61 C;  2F33 A;  5ER5 A;  1FF1 A;  1SKT A;  2M1K B;  1PUL A;  1YX7 A;  4YBH B;  1NIW A;  4C0K A;  3BXK A;  1QVI Z;  1LIN A;  1FW4 A;  2JRF A;  1DT7 B;  5ER4 X;  1F70 A;  1S3P A;  3SG7 A;  4MRX A;  1WRK A;  1IQ3 A;  2SCP A;  2LCP A;  4GPL B;  1UHI A;  2SAS A;  4TNC A;  2F3Y A;  3TS5 C;  1UHN A;  4FQO A;  4DCK A;  2LP2 A;  1TNW A;  4WRI A;  5CSI A;  3CLN A;  1XFW O;  1NPQ A;  3O2P A;  2ZND A;  3TS5 B;  1QX7 A;  5PAL A;  2BE6 A;  1DJI A;  1QX2 A;  5I2L A;  2TN4 A;  2KAY A;  1LKJ A;  1J1D A;  1UWO A;  1YUU A;  4XJK B;  3D0Y A;  1N0Y A;  2K7B A;  1R2U A;  1TIZ A;  1S1E A;  4YI8 A;  1PRW A;  1UUR A;  5AEQ A;  4MRY A;  2QAC A;  4A4B A;  5HLV A;  5HKZ A;  1NP8 A;  2ZKM X;  4GGF C;  1SRA A;  2Q4U A;  4NDC A;  5CSN A;  1AHR A;  1AJ5 A;  2E6W A;  1ZMZ A;  4PE4 A;  2D8N A;  1OZS A;  1Q80 A;  2O60 A;  1ZUZ A;  1DJY A;  4ORC B;  3GOF A;  2BE4 A;  2P6B B;  1A2X A;  1G33 A;  3DVE A;  1KQM C;  3AKA A;  1F8H A;  3CWG A;  3FS7 A;  3PN7 B;  1XK4 C;  1BU3 A;  2FCE A;  2CXJ A;  4GUK A;  1OMR A;  1J55 A;  1CTR A;  1KQM B;  2LUX A;  1X02 A;  1CDP A;  1YUS A;  1QV0 A;  2LP3 A;  3KF9 A;  1BOC A;  1OE9 B;  4D1E A;  3OX6 A;  1CFD A;  1IWQ A;  2K7C A;  2GV5 A;  2LV7 A;  1K2H A;  4MBE A;  3SG4 A;  3D10 A;  1EG4 A;  3WNX B;  2K61 A;  4MZL A;  2KNE A;  1YTZ C;  3LLE A;  1TCF A;  1CDN A;  2LHI A;  1ZAC A;  4NDD A;  1S5G Z;  1SK6 D;  1UP5 A;  3OB1 B;  1LXF C;  1CDL A;  2HQW A;  5AER A;  3EVU A;  1IH0 A;  3BUN B;  3O78 A;  2A4J A;  2F8P A;  1S6J A;  3O4Y A;  4PE0 A;  1BR1 B;  1A4P A;  1QAS A;  4MVF A;  3CR4 X;  3ZWH A;  1NX2 A;  4Q04 A;  3WHT B;  1BJF A;  2M49 B;  3FWB A;  5CSJ A;  1D1O A;  2LVJ A;  3BUM B;  1KK7 Y;  4PHM A;  1YUT A;  3WXA A;  1UHK A;  2HPS A;  1JFK A;  3C1V A;  5AXI A;  1UUS A;  2KAV A;  3O6B A;  4WQ2 A;  1WY9 A;  5JJG A;  3KPX A;  1SMG A;  4JQ0 D;  1F55 A;  4JWQ A;  1NSH A;  1NX1 A;  1WLM A;  2KBI A;  4WQ3 A;  3PM8 A;  1A75 A;  2PRU A;  2ZNE A;  5I2O A;  2JOJ A;  1JFJ A;  1OMD A;  1SL9 A;  1V1G A;  1QS7 A;  1OMV A;  2JZI A;  4MZJ A;  5DKR A;  5DKQ A;  3OX5 A;  4OKH A;  4ZCU A;  4DRW A;  3I5H C;  1B8C A;  1TOP A;  2KSP A;  3VRR A;  3VRQ A;  2I18 A;  2KBM A;  1TCO B;  2BCX A;  1DTL A;  2JT8 A;  1KFU L;  4NQG A;  1BLQ A;  2B1U A;  2PAL A;  3I5H B;  3CTN A;  4MSP A;  3ICB A;  2Y4Q A;  1AVS A;  3BOW B;  1SW8 A;  2HQ8 A;  1IJ6 A;  1KSM A;  1F71 A;  2KI6 D;  2MRD A;  1DGU A;  1K90 D;  3EK7 A;  1BMO A;  1YR5 A;  1B7T Z;  1B8R A;  1RRO A;  1TN4 A;  2JNF A;  2KOT A;  2Y1M A;  3F45 A;  2Q91 A;  1DJW A;  1NCY A;  2H61 A;  2JU0 A;  2K2F A;  1KFU S; 
#chains in the Genus database with same CATH topology
 4C0L A;  4AQJ A;  1B47 A;  2WCK A;  2M7N A;  1LA3 A;  4CPV A;  1K94 A;  2KPH A;  2QEH A;  1MXL C;  1K9K A;  2RGI A;  2WOR A;  5B8I B;  1S6C A;  1TNQ A;  1NX0 A;  1QIW A;  1TNX A;  1ZFS A;  5FI6 A;  2L4H A;  2M7L A;  1MXE A;  4XJK A;  2CBL A;  2P71 A;  4PHN A;  2PAS A;  3NSK A;  2KGR A;  3M0W A;  3LK1 A;  3TDI A;  2LAN A;  2JT3 A;  3S0B A;  1NWD A;  2BNX A;  4HRG A;  4CID A;  3JVT C;  3EK4 A;  3QRX A;  3UNW A;  3AKB A;  2OPO A;  1R6P A;  4HRE E;  4PCW A;  3FWC A;  1S26 D;  1G8I A;  4GBA A;  1OOJ A;  4BY4 A;  3JVT B;  3OHM B;  3IQO A;  4OR9 B;  4GGF A;  1J7P A;  3CZ2 A;  5IBW A;  2PSR A;  4AOM A;  2KFH A;  4MN0 A;  1QJT A;  2BBN A;  4IL1 A;  3SS3 A;  1WDC C;  2F3Z A;  1WRZ A;  3BUX B;  2BL0 C;  2LC5 A;  2M0R A;  2M8U A;  1CM4 A;  1DF0 B;  2LMU A;  1KFX S;  1SR6 C;  1TTX A;  2WCB A;  3KO0 A;  1FBV A;  1QIV A;  2WCE A;  3PM2 A;  4A4C A;  3PFV A;  3R72 A;  1PSR A;  1YRU B;  2LM5 A;  2K2A A;  3CR2 A;  1WDC B;  3PN7 C;  4HSZ A;  1CLB A;  3OBV A;  1CM1 A;  1M63 B;  2BL0 B;  3DVM A;  4FQT A;  1GJY A;  2BCA A;  1SR6 B;  2IS9 A;  2JNX A;  1TWO A;  3FIA A;  4GNK B;  4JKT A;  1XK4 A;  1F54 A;  1DQE A;  1E8A A;  2ZFD A;  1YVH A;  5KTY A;  1UHH A;  3D78 A;  4MEW A;  3UO9 A;  1Z2C B;  1PVB A;  2PYQ A;  1SNL A;  1GQM A;  2K7O A;  2QDI A;  3GK2 A;  4UPG A;  1AP4 A;  3NXA A;  3PJI A;  1HQV A;  2ZRT A;  1W7I B;  1S5G Y;  4GGN A;  4CFQ A;  3K1E A;  1S6I A;  1XFU O;  2WCJ A;  4QJ4 B;  3SG6 A;  2JC2 A;  1SL7 A;  4U8D A;  3SG5 A;  5HKY A;  1BF5 A;  4QJ3 B;  2Y5I A;  1IG5 A;  2WCF A;  2ISD A;  3EVV A;  2KHN A;  1J7Q A;  1F4O A;  4ICB A;  1JWD A;  4JPZ B;  2R2I A;  4OV2 A;  3KHE A;  1TRF A;  1ALW A;  2F2P A;  3BYA A;  1XFX O;  2L5Y A;  3HX4 A;  5DIC A;  1VRK A;  4N5X A;  4OCI A;  1DJH A;  2JQ6 A;  4AQI A;  3DYE A;  4E68 A;  1W7J B;  1DJG A;  2DOQ A;  1YRT B;  1U5I B;  1OQP A;  3TUY C;  2LAP A;  1NX3 A;  1CDM A;  1PSB A;  2K60 A;  2MBX A;  2L2E A;  1Y6W A;  1T14 A;  3A4U B;  1V1F A;  3E3R A;  2WND A;  2JWW A;  3TUY B;  1M31 A;  1XFY O;  2KYF A;  2MA2 A;  3BUW B;  5D7F A;  4MZK A;  1BT6 A;  3SJS A;  2KFG A;  1QX5 B;  1IQ5 A;  1CLL A;  1CMG A;  4YI9 A;  1WRL A;  1JF0 A;  2JPT A;  3SIB A;  2BKI B;  3FE9 A;  4R1E A;  3BFH A;  1C7V A;  5EL2 A;  1DMO A;  5FI7 A;  3CR5 X;  1OW4 A;  3EKJ A;  3OGN A;  5KSZ A;  1CLM A;  3IF7 A;  3KEV A;  2AUC A;  2M9G A;  2NCO A;  3CAB A;  4FTG A;  5HL1 A;  1UHJ A;  1OOF A;  3NSL A;  1YVL A;  4JD9 A;  4NDB A;  2LMV A;  2H2K A;  4QJ5 B;  2CNP A;  3CZ1 A;  5D69 A;  3VRP A;  1B7T Y;  3NSI A;  1TNP A;  2LNK A;  4I5N B;  1XA5 A;  1KK8 C;  3NHI A;  1ODB A;  4GAO A;  2L98 A;  5G08 A;  1DVI A;  5J3X A;  5I8N A;  1FI5 A;  1JSA A;  3DD4 A;  1NCX A;  1XFV O;  4OVN F;  1KK7 Z;  3CS1 A;  4ORB B;  1P28 A;  4YGB B;  2WOS A;  2NLN A;  1SBJ A;  3I5F C;  1QVI Y;  1KK8 B;  1WLZ A;  2CT9 A;  2LVI A;  2O5G A;  1ZOT B;  3EK8 A;  3LCP C;  3GK4 X;  2I94 A;  4YGE B;  1KCY A;  1GGZ A;  3AAK A;  1SCM C;  1A75 B;  2HET A;  3CGA A;  3L4A A;  1H4B A;  1DGV A;  3I5F B;  4PE1 A;  1YUR A;  3CZ0 A;  4PHJ A;  5K89 A;  2YGU A;  3SG3 A;  1AUI B;  2V53 A;  1M45 A;  2BBM A;  2AAO A;  3I5I C;  4P5O E;  1SCM B;  3AAJ A;  5HLO A;  2GGZ A;  2WC6 A;  3HCM A;  5I2Q A;  3PSR A;  3VRO A;  1G4Y R;  1PVA A;  3SIA A;  1HT9 A;  1NCZ A;  1H8B A;  2LVK A;  1J7R A;  1DJZ A;  3I5I B;  3LL8 B;  2EC6 C;  2NZ0 A;  3DF0 B;  1JBA A;  1K8U A;  2OS8 B;  4PDZ A;  5TNC A;  5FI2 A;  2L4I A;  1Y1A A;  3SS5 A;  1QV1 A;  1J1E A;  1KFX L;  1QAT A;  1RTP 1;  2EC6 B;  2FJU B;  4GFT A;  1B8L A;  4PAL A;  4F0Z B;  1EXR A;  1M46 A;  5AFP A;  4MLW A;  1KSO A;  2L0P A;  1RK9 A;  1M39 A;  1MQ1 A;  3BQ3 A;  2LLT A;  2PMY A;  3EVR A;  3NSO A;  1PK0 D;  2OTG C;  3DVJ A;  3V2L A;  2K7D A;  1RJV A;  1C07 A;  2MJW B;  1DF0 A;  3BUO B;  3I5G C;  2G9B A;  2EGD A;  1QLS A;  2KI4 C;  2KLD A;  2MAZ A;  1QXP A;  3RM1 A;  1NYA A;  1MF8 B;  4PE7 A;  2OTG B;  3VGO A;  2NCP A;  4KYN A;  4M2P A;  4I5J A;  1FI6 A;  2FCD A;  1CFF A;  2KAX A;  3I5G B;  4N1F A;  1SYM A;  2BCB A;  2WC8 A;  2KI4 B;  1MUX A;  4P2Y B;  1XYD A;  2LE9 B;  2MLF C;  3IVT A;  1N65 A;  3D76 A;  1DC1 A;  4YGD B;  1CNP A;  5JOL A;  3BJH A;  1J7O A;  1XVJ A;  3TDZ A;  1MHO A;  1XFZ O;  1LA0 A;  1C7W A;  3RZS A;  3SG2 A;  5GQQ C;  2M29 A;  1MWN A;  3CZT X;  3PLF B;  4CFR A;  1CB1 A;  2ERB A;  3D0Y B;  2JXC A;  2Y1N A;  3OB2 B;  2KQ6 A;  3QME A;  2LUC A;  1XO5 A;  1Y0V H;  3EKH A;  2QPT A;  2ZN8 A;  3CDN A;  4ORA B;  2KYC A;  3H4S E;  2JXL A;  4CLN A;  1B1G A;  2CTN A;  1SSE B;  2JTT A;  2NXQ A;  3A8R A;  1EH2 A;  4L9M A;  1OZO A;  1U5I A;  1A03 A;  5HYD A;  1OOH A;  1EL4 A;  2KI6 C;  1K95 A;  4DS7 A;  1DEL A;  3DVK A;  2PQL A;  2KDH A;  2PVB A;  4ZCV A;  5BPJ A;  1SPY A;  5KU1 A;  2L50 A;  4N1G A;  1YX8 A;  1L2O C;  1KWO C;  2JUL A;  2QEO A;  3MSE B;  5HKW A;  2JT0 A;  2AMI A;  2MLE C;  1F4Q A;  3RLZ A;  2CCM A;  1FPW A;  3TZ1 A;  2M1U A;  4I5L B;  1K93 D;  1CFP A;  4M2Q A;  1W9Z A;  1L2O B;  1KWO B;  1IKU A;  1BOD A;  4YGC B;  1B4C A;  3VB1 A;  5DKN A;  2M97 A;  1SCV A;  2GTE A;  3LK0 A;  5D3O A;  3B6X A;  1A29 A;  2E30 A;  2MHH A;  5I94 A;  3PAL A;  2F2O A;  1LS8 A;  2K0J A;  1AJ4 A;  2KGB C;  3O4X A;  4USL A;  2FOT A;  3B88 A;  1ORG A;  4HRH A;  2GGM A;  3VRN A;  2I2R E;  1JUO A;  2LLU A;  1REC A;  3GK1 A;  3BOW A;  3TDU A;  3S0F A;  1SL8 A;  4DIR A;  4BY5 A;  2L2C A;  4IJ7 A;  1LVC D;  2ZN9 A;  1MR8 A;  3OP0 A;  2L51 A;  3K21 A;  1IGV A;  2LHL A;  2BKH B;  3PAT A;  1OSA A;  1B9A A;  1EJ3 A;  2L5X B;  5AAN A;  5F6T A;  1AK8 A;  1BG1 A;  1IJ5 A;  1OOG A;  3D75 A;  2JTZ A;  2K8M B;  1OOI X;  4PT1 A;  4YGA A;  4C0J A;  1K9U A;  1C3Z A;  1RWY A;  2LVV A;  3EG5 B;  4ETO A;  1CMF A;  1RFJ A;  2LLS A;  2LMT A;  1N2D A;  1QLK A;  2M3W A;  3JTD C;  2KFF A;  1IRJ A;  4YRU A;  1K9P A;  4XYN A;  2BEC A;  1L7Z A;  3WHU B;  1Y1U A;  3ZNI A;  1GGW A;  2HF5 A;  3DF0 A;  4M2O A;  2I7A A;  2G2B A;  2KLE A;  4I5K A;  2OS8 C;  1NUB A;  1PAL A;  1JF2 A;  1DJX A;  3JTD B;  3IQQ A;  1S36 A;  2EHB A;  1ALV A;  2KQY A;  4OZD A;  1Y1X A;  3L4L A;  1KQV A;  1SY9 A;  1CFC A;  2COL B;  5FYX A;  5CSF A;  3BFB A;  1QTX A;  1K96 A;  1JC2 A;  3B86 A;  2ZRS A;  3NGV A;  5CPV A;  1EG3 A;  2VRG A;  4PHK A;  3B87 A;  1BR4 B;  4DUQ A;  1CKK A;  2H61 C;  2F33 A;  5ER5 A;  1FF1 A;  1SKT A;  2M1K B;  1PUL A;  1YX7 A;  4YBH B;  1NIW A;  3S0D A;  4C0K A;  3BXK A;  1QVI Z;  1LIN A;  1FW4 A;  2JRF A;  1DT7 B;  5ER4 X;  1F70 A;  1S3P A;  3SG7 A;  4MRX A;  1WRK A;  1IQ3 A;  2SCP A;  2LCP A;  4GPL B;  3B7A A;  3SS4 A;  1UHI A;  2SAS A;  4TNC A;  2F3Y A;  3CYZ A;  3D77 A;  1IIO A;  3TS5 C;  1UHN A;  1C3Y A;  4FQO A;  4DCK A;  2LP2 A;  1TNW A;  4WRI A;  5CSI A;  3S0E A;  3CLN A;  1XFW O;  1NPQ A;  3D74 A;  3O2P A;  2ZND A;  3TS5 B;  1QX7 A;  5PAL A;  2BE6 A;  1DJI A;  1QX2 A;  5I2L A;  2TN4 A;  2KAY A;  1LKJ A;  1J1D A;  1UWO A;  1YUU A;  4XJK B;  3D0Y A;  1N0Y A;  2K7B A;  1R2U A;  1TIZ A;  1S1E A;  4YI8 A;  1PRW A;  1UUR A;  5AEQ A;  4MRY A;  2QAC A;  4A4B A;  5HLV A;  5HKZ A;  1NP8 A;  2ZKM X;  4GGF C;  1SRA A;  2Q4U A;  4NDC A;  5CSN A;  1AHR A;  1AJ5 A;  2E6W A;  1ZMZ A;  4PE4 A;  2D8N A;  1OZS A;  3L47 A;  1Q80 A;  2O60 A;  1ZUZ A;  1DJY A;  4ORC B;  3R1V A;  3GOF A;  1TUJ A;  3Q8I A;  2BE4 A;  2P6B B;  1A2X A;  1G33 A;  2WCL A;  1KQM C;  3AKA A;  3DVE A;  1F8H A;  3CWG A;  1Z4H A;  3FS7 A;  3PN7 B;  1XK4 C;  3BFA A;  1BU3 A;  2FCE A;  2CXJ A;  4GUK A;  1OMR A;  1J55 A;  1CTR A;  1KQM B;  2LUX A;  1X02 A;  1CDP A;  1YUS A;  1QV0 A;  2LP3 A;  3KF9 A;  1BOC A;  1OE9 B;  4D1E A;  3OX6 A;  1CFD A;  1IWQ A;  4INW A;  2K7C A;  2GV5 A;  2H8V A;  2LV7 A;  2P70 A;  4MBE A;  3SG4 A;  1K2H A;  3D10 A;  3S0G A;  4F7F A;  1EG4 A;  4INX A;  3WNX B;  2K61 A;  4MZL A;  2KNE A;  1YTZ C;  3LLE A;  1TCF A;  1CDN A;  2LHI A;  3S0A A;  1DEK A;  1ZAC A;  4NDD A;  1S5G Z;  1SK6 D;  1UP5 A;  3OB1 B;  1LXF C;  1CDL A;  2HQW A;  5AER A;  3EVU A;  1IH0 A;  3BUN B;  3O78 A;  2A4J A;  2F8P A;  1S6J A;  3O4Y A;  4PE0 A;  1BR1 B;  1A4P A;  2BAP A;  2WC5 A;  1QAS A;  4MVF A;  3CR4 X;  3ZWH A;  1NX2 A;  3FE6 A;  4Q04 A;  1TUZ A;  3WHT B;  1BJF A;  2M49 B;  3FWB A;  5CSJ A;  1D1O A;  2LVJ A;  3BUM B;  1KK7 Y;  3N7H A;  1YUT A;  4PHM A;  1UHK A;  3WXA A;  2HPS A;  1JFK A;  3C1V A;  5AXI A;  2QEB A;  3DXL A;  3D73 A;  1UUS A;  2KAV A;  3O6B A;  4WQ2 A;  2WCM A;  1WY9 A;  5JJG A;  3KPX A;  1SMG A;  4JQ0 D;  1F55 A;  4JWQ A;  1NSH A;  1NX1 A;  1WLM A;  2JPO A;  2KBI A;  3PM8 A;  4WQ3 A;  3DZT A;  1A75 A;  2PRU A;  2ZNE A;  5I2O A;  2JOJ A;  3R1P A;  1JFJ A;  1OMD A;  1SL9 A;  1V1G A;  1QS7 A;  1OMV A;  2JZI A;  3R1O A;  4MZJ A;  5DKR A;  5DKQ A;  3OX5 A;  4OKH A;  4ZCU A;  4DRW A;  3I5H C;  1B8C A;  1TOP A;  2KSP A;  3VRR A;  2FJY A;  3VRQ A;  2I18 A;  2KBM A;  1TCO B;  2BCX A;  1DTL A;  2JT8 A;  3DY9 A;  1KFU L;  4NQG A;  1BLQ A;  2B1U A;  2PAL A;  3I5H B;  3CTN A;  3NHT A;  4MSP A;  3ICB A;  2Y4Q A;  1AVS A;  2QEV A;  3BOW B;  1SW8 A;  2HQ8 A;  1IJ6 A;  1KSM A;  1F71 A;  2KI6 D;  2MRD A;  1DGU A;  1K90 D;  1GM0 A;  3EK7 A;  1BMO A;  1YR5 A;  1B7T Z;  1XFR A;  1B8R A;  1RRO A;  1TN4 A;  2JNF A;  2KOT A;  2WCH A;  1QWV A;  2Y1M A;  3F45 A;  3FE8 A;  2Q91 A;  1DJW A;  1NCY A;  2H61 A;  2JU0 A;  2K2F A;  1KFU S; 
#chains in the Genus database with same CATH homology
 4C0L A;  4AQJ A;  1B47 A;  2M7N A;  1LA3 A;  4CPV A;  1K94 A;  1MXL C;  1K9K A;  2RGI A;  2WOR A;  5B8I B;  1S6C A;  1TNQ A;  1NX0 A;  1QIW A;  1TNX A;  1ZFS A;  2L4H A;  2M7L A;  1MXE A;  4XJK A;  2CBL A;  4PHN A;  2PAS A;  3NSK A;  2KGR A;  3M0W A;  3LK1 A;  3TDI A;  2LAN A;  2JT3 A;  1NWD A;  4HRG A;  4CID A;  3JVT C;  3EK4 A;  3QRX A;  3AKB A;  2OPO A;  1R6P A;  4HRE E;  4PCW A;  3FWC A;  1S26 D;  1G8I A;  4GBA A;  1OOJ A;  4BY4 A;  3JVT B;  3OHM B;  3IQO A;  4OR9 B;  4GGF A;  1J7P A;  5IBW A;  2PSR A;  4AOM A;  2KFH A;  4MN0 A;  1QJT A;  2BBN A;  4IL1 A;  1WDC C;  2F3Z A;  1WRZ A;  3BUX B;  2BL0 C;  2LC5 A;  2M0R A;  2M8U A;  1CM4 A;  1DF0 B;  2LMU A;  1KFX S;  1SR6 C;  1TTX A;  2WCB A;  3KO0 A;  1FBV A;  1QIV A;  2WCE A;  4A4C A;  3PFV A;  4HSZ A;  1PSR A;  1YRU B;  2LM5 A;  2K2A A;  3CR2 A;  1WDC B;  3PN7 C;  1CLB A;  1CM1 A;  1M63 B;  2BL0 B;  3DVM A;  1GJY A;  2BCA A;  1SR6 B;  2IS9 A;  2JNX A;  3FIA A;  4GNK B;  1F54 A;  1XK4 A;  1E8A A;  2ZFD A;  1YVH A;  5KTY A;  1UHH A;  4MEW A;  1PVB A;  1SNL A;  1GQM A;  2K7O A;  3GK2 A;  4UPG A;  1AP4 A;  3NXA A;  1HQV A;  2ZRT A;  1W7I B;  1S5G Y;  4GGN A;  4CFQ A;  1S6I A;  1XFU O;  4QJ4 B;  3SG6 A;  2JC2 A;  1SL7 A;  4U8D A;  3SG5 A;  5HKY A;  1BF5 A;  4QJ3 B;  2Y5I A;  1IG5 A;  2WCF A;  2ISD A;  3EVV A;  2KHN A;  1J7Q A;  1F4O A;  4ICB A;  1JWD A;  4JPZ B;  2R2I A;  4OV2 A;  3KHE A;  1TRF A;  1ALW A;  2F2P A;  3BYA A;  1XFX O;  3HX4 A;  1VRK A;  4N5X A;  4OCI A;  1DJH A;  2JQ6 A;  4AQI A;  4E68 A;  1W7J B;  1DJG A;  2DOQ A;  1YRT B;  1U5I B;  1OQP A;  3TUY C;  2LAP A;  1NX3 A;  1CDM A;  1PSB A;  2MBX A;  2L2E A;  1Y6W A;  3A4U B;  3E3R A;  1V1F A;  2WND A;  2JWW A;  3TUY B;  1M31 A;  1XFY O;  2KYF A;  2MA2 A;  3BUW B;  5D7F A;  4MZK A;  1BT6 A;  3SJS A;  2KFG A;  1QX5 B;  1IQ5 A;  1CLL A;  1CMG A;  4YI9 A;  1WRL A;  1JF0 A;  2JPT A;  3SIB A;  2BKI B;  4R1E A;  1C7V A;  1DMO A;  3CR5 X;  3EKJ A;  5KSZ A;  1CLM A;  3IF7 A;  3KEV A;  2AUC A;  2M9G A;  2NCO A;  4FTG A;  1UHJ A;  3NSL A;  1YVL A;  4NDB A;  2LMV A;  2H2K A;  4QJ5 B;  2CNP A;  5D69 A;  3VRP A;  1B7T Y;  3NSI A;  1TNP A;  2LNK A;  4I5N B;  1XA5 A;  1KK8 C;  1ODB A;  4GAO A;  2L98 A;  5G08 A;  1DVI A;  5J3X A;  5I8N A;  1FI5 A;  1JSA A;  3DD4 A;  1NCX A;  1XFV O;  4OVN F;  1KK7 Z;  3CS1 A;  4ORB B;  4YGB B;  2WOS A;  2NLN A;  1SBJ A;  3I5F C;  1QVI Y;  1KK8 B;  1WLZ A;  2CT9 A;  2LVI A;  2O5G A;  1ZOT B;  3EK8 A;  3LCP C;  3GK4 X;  2I94 A;  4YGE B;  1KCY A;  1GGZ A;  3AAK A;  1SCM C;  1A75 B;  2HET A;  3CGA A;  1H4B A;  1DGV A;  3I5F B;  4PE1 A;  1YUR A;  4PHJ A;  5K89 A;  3SG3 A;  1AUI B;  2V53 A;  1M45 A;  2BBM A;  2AAO A;  3I5I C;  4P5O E;  1SCM B;  3AAJ A;  5HLO A;  2GGZ A;  3HCM A;  5I2Q A;  3PSR A;  3VRO A;  1G4Y R;  1PVA A;  3SIA A;  1HT9 A;  1NCZ A;  1H8B A;  2LVK A;  1J7R A;  1DJZ A;  3I5I B;  3LL8 B;  2EC6 C;  2NZ0 A;  3DF0 B;  1JBA A;  1K8U A;  2OS8 B;  4PDZ A;  5TNC A;  2L4I A;  1Y1A A;  1QV1 A;  1J1E A;  1KFX L;  1QAT A;  1RTP 1;  2EC6 B;  2FJU B;  4GFT A;  1B8L A;  4PAL A;  4F0Z B;  1EXR A;  1M46 A;  5AFP A;  4MLW A;  1KSO A;  2L0P A;  1RK9 A;  1M39 A;  1MQ1 A;  3BQ3 A;  2LLT A;  2PMY A;  3EVR A;  3NSO A;  1PK0 D;  2OTG C;  3DVJ A;  1C07 A;  2K7D A;  1RJV A;  2MJW B;  1DF0 A;  3BUO B;  3I5G C;  2G9B A;  2EGD A;  1QLS A;  2KI4 C;  2MAZ A;  3RM1 A;  1QXP A;  1NYA A;  1MF8 B;  4PE7 A;  2OTG B;  3VGO A;  2NCP A;  4M2P A;  4I5J A;  1FI6 A;  2FCD A;  1CFF A;  2KAX A;  3I5G B;  4N1F A;  1SYM A;  2BCB A;  2WC8 A;  2KI4 B;  1MUX A;  4P2Y B;  1XYD A;  2LE9 B;  2MLF C;  1N65 A;  4YGD B;  1CNP A;  5JOL A;  1J7O A;  1XVJ A;  3TDZ A;  1MHO A;  1XFZ O;  1LA0 A;  1C7W A;  3SG2 A;  5GQQ C;  2M29 A;  1MWN A;  3CZT X;  3PLF B;  4CFR A;  1CB1 A;  3D0Y B;  2JXC A;  2Y1N A;  3OB2 B;  2KQ6 A;  2LUC A;  1XO5 A;  1Y0V H;  3EKH A;  2QPT A;  2ZN8 A;  4ORA B;  2KYC A;  3H4S E;  2JXL A;  4CLN A;  1B1G A;  2CTN A;  2JTT A;  2NXQ A;  3A8R A;  1EH2 A;  4L9M A;  1OZO A;  1U5I A;  1A03 A;  5HYD A;  1EL4 A;  2KI6 C;  1K95 A;  4DS7 A;  3DVK A;  2KDH A;  2PVB A;  4ZCV A;  5BPJ A;  1SPY A;  5KU1 A;  2L50 A;  4N1G A;  1YX8 A;  1L2O C;  1KWO C;  2JUL A;  3MSE B;  5HKW A;  3RLZ A;  2JT0 A;  2AMI A;  2MLE C;  1F4Q A;  2CCM A;  1FPW A;  3TZ1 A;  2M1U A;  4I5L B;  1K93 D;  1CFP A;  4M2Q A;  1L2O B;  1KWO B;  1IKU A;  1BOD A;  4YGC B;  1B4C A;  5DKN A;  2M97 A;  1SCV A;  3LK0 A;  1A29 A;  2E30 A;  2MHH A;  3PAL A;  2F2O A;  2K0J A;  1AJ4 A;  2KGB C;  4USL A;  2FOT A;  4HRH A;  3VRN A;  2GGM A;  2I2R E;  1JUO A;  2LLU A;  1REC A;  3GK1 A;  3BOW A;  3TDU A;  1SL8 A;  4DIR A;  4BY5 A;  1LVC D;  2ZN9 A;  1MR8 A;  3OP0 A;  2L51 A;  3K21 A;  1IGV A;  2LHL A;  2BKH B;  3PAT A;  1OSA A;  1B9A A;  1EJ3 A;  2L5X B;  5AAN A;  5F6T A;  1AK8 A;  1BG1 A;  1IJ5 A;  2JTZ A;  2K8M B;  4YGA A;  4C0J A;  1K9U A;  1RWY A;  2LVV A;  4ETO A;  1CMF A;  1RFJ A;  2LLS A;  2LMT A;  1N2D A;  1QLK A;  2M3W A;  3JTD C;  2KFF A;  1IRJ A;  4YRU A;  1K9P A;  4XYN A;  2BEC A;  1L7Z A;  3WHU B;  1Y1U A;  3ZNI A;  1GGW A;  2HF5 A;  3DF0 A;  4M2O A;  2I7A A;  2G2B A;  4I5K A;  2OS8 C;  1NUB A;  1PAL A;  1JF2 A;  1DJX A;  3JTD B;  3IQQ A;  1S36 A;  2EHB A;  1ALV A;  2KQY A;  1Y1X A;  1KQV A;  1SY9 A;  1CFC A;  2COL B;  5FYX A;  5CSF A;  1QTX A;  1K96 A;  1JC2 A;  2ZRS A;  5CPV A;  1EG3 A;  2VRG A;  4PHK A;  1BR4 B;  4DUQ A;  1CKK A;  2H61 C;  2F33 A;  5ER5 A;  1FF1 A;  1SKT A;  2M1K B;  1PUL A;  1YX7 A;  4YBH B;  1NIW A;  4C0K A;  3BXK A;  1QVI Z;  1LIN A;  1FW4 A;  2JRF A;  1DT7 B;  5ER4 X;  1F70 A;  1S3P A;  3SG7 A;  4MRX A;  1WRK A;  1IQ3 A;  2SCP A;  2LCP A;  4GPL B;  1UHI A;  2SAS A;  4TNC A;  2F3Y A;  3TS5 C;  1UHN A;  4FQO A;  4DCK A;  2LP2 A;  1TNW A;  4WRI A;  5CSI A;  3CLN A;  1XFW O;  1NPQ A;  3O2P A;  2ZND A;  3TS5 B;  1QX7 A;  5PAL A;  2BE6 A;  1DJI A;  1QX2 A;  5I2L A;  2TN4 A;  2KAY A;  1LKJ A;  1J1D A;  1UWO A;  1YUU A;  4XJK B;  3D0Y A;  1N0Y A;  2K7B A;  1R2U A;  1TIZ A;  1S1E A;  4YI8 A;  1PRW A;  1UUR A;  5AEQ A;  4MRY A;  2QAC A;  4A4B A;  5HLV A;  5HKZ A;  1NP8 A;  2ZKM X;  4GGF C;  1SRA A;  2Q4U A;  4NDC A;  5CSN A;  1AHR A;  1AJ5 A;  2E6W A;  1ZMZ A;  4PE4 A;  2D8N A;  1OZS A;  1Q80 A;  2O60 A;  1ZUZ A;  1DJY A;  4ORC B;  3GOF A;  2BE4 A;  2P6B B;  1A2X A;  1G33 A;  3DVE A;  1KQM C;  3AKA A;  1F8H A;  3CWG A;  3FS7 A;  3PN7 B;  1XK4 C;  1BU3 A;  2FCE A;  2CXJ A;  4GUK A;  1OMR A;  1J55 A;  1CTR A;  1KQM B;  2LUX A;  1X02 A;  1CDP A;  1YUS A;  1QV0 A;  2LP3 A;  3KF9 A;  1BOC A;  1OE9 B;  4D1E A;  3OX6 A;  1CFD A;  1IWQ A;  2K7C A;  2GV5 A;  2LV7 A;  1K2H A;  4MBE A;  3SG4 A;  3D10 A;  1EG4 A;  3WNX B;  2K61 A;  4MZL A;  2KNE A;  1YTZ C;  3LLE A;  1TCF A;  1CDN A;  2LHI A;  1ZAC A;  4NDD A;  1S5G Z;  1SK6 D;  1UP5 A;  3OB1 B;  1LXF C;  1CDL A;  2HQW A;  5AER A;  3EVU A;  1IH0 A;  3BUN B;  3O78 A;  2A4J A;  2F8P A;  1S6J A;  3O4Y A;  4PE0 A;  1BR1 B;  1A4P A;  1QAS A;  4MVF A;  3CR4 X;  3ZWH A;  1NX2 A;  4Q04 A;  3WHT B;  1BJF A;  2M49 B;  3FWB A;  5CSJ A;  1D1O A;  2LVJ A;  3BUM B;  1KK7 Y;  4PHM A;  1YUT A;  3WXA A;  1UHK A;  2HPS A;  1JFK A;  3C1V A;  5AXI A;  1UUS A;  2KAV A;  3O6B A;  4WQ2 A;  1WY9 A;  5JJG A;  3KPX A;  1SMG A;  4JQ0 D;  1F55 A;  4JWQ A;  1NSH A;  1NX1 A;  1WLM A;  2KBI A;  4WQ3 A;  3PM8 A;  1A75 A;  2PRU A;  2ZNE A;  5I2O A;  2JOJ A;  1JFJ A;  1OMD A;  1SL9 A;  1V1G A;  1QS7 A;  1OMV A;  2JZI A;  4MZJ A;  5DKR A;  5DKQ A;  3OX5 A;  4OKH A;  4ZCU A;  4DRW A;  3I5H C;  1B8C A;  1TOP A;  2KSP A;  3VRR A;  3VRQ A;  2I18 A;  2KBM A;  1TCO B;  2BCX A;  1DTL A;  2JT8 A;  1KFU L;  4NQG A;  1BLQ A;  2B1U A;  2PAL A;  3I5H B;  3CTN A;  4MSP A;  3ICB A;  2Y4Q A;  1AVS A;  3BOW B;  1SW8 A;  2HQ8 A;  1IJ6 A;  1KSM A;  1F71 A;  2KI6 D;  2MRD A;  1DGU A;  1K90 D;  3EK7 A;  1BMO A;  1YR5 A;  1B7T Z;  1B8R A;  1RRO A;  1TN4 A;  2JNF A;  2KOT A;  2Y1M A;  3F45 A;  2Q91 A;  1DJW A;  1NCY A;  2H61 A;  2JU0 A;  2K2F A;  1KFU S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...