4INWA

Structure of pheromone-binding protein 1 in complex with (11z,13z)-hexadecadienal
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
140
structure length
140
Chain Sequence
SPEIMKDLSINFGKALDTCKKELDLPDSINEDFYKFWKEDYEITNRLTGCAIKCLSEKLEMVDADGKLHHGNAREFAMKHGADDAMAKQLVDLIHGCEKSIPPNDDRCMEVLSIAMCFKKEIHNLKWAPNMEVVVGEVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein 1
publication title Crystallographic Observation of pH-Induced Conformational Changes in the Amyelois transitella Pheromone-Binding Protein AtraPBP1.
pubmed doi rcsb
source organism Amyelois transitella
molecule tags Pheromone-binding protein
total genus 53
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 4inwA00
3CZ2A 3BFAA 2WCJA 2FJYA 3S0FA 3FE9A 3NGVA 3CZ1A 1LS8A 2QDIA 1T14A 3DYEA 2WCKA 2WC5A 3N7HA 3S0EA 4JD9A 3DZTA 2KPHA 3CZ0A 3D75A 3R1OA 1OOGA 4PT1A 1TWOA 3FE6A 1GM0A 3B87A 1QWVA 3D73A 3R1PA 2QEOA 3CYZA 1XFRA 2ERBA 3B6XA 3DY9A 2L2CA 3VB1A 3D77A 2JPOA 3D78A 3R72A 4F7FA 3NHIA 4INXA 3L4AA 3D76A 2QEHA 1OOHA 3K1EA 1DQEA 2QEVA 3B86A 4OZDA 5DICA 3BFHA 3S0GA 1ORGA 2WCHA 3R1VA 1OW4A 3BJHA 2QEBA 1OOIX 2WCLA 3S0DA 5EL2A 3L47A 2H8VA 3S0BA 3B88A 2P71A 4FQTA 2P70A 3FE8A 3QMEA 1TUJA 3S0AA 3CDNA 2PQLA 3DXLA 3PJIA 1C3YA 3D74A 2WC6A 1P28A 3L4LA 3RZSA 3OGNA 2WCMA 1OOFA 1C3ZA 3B7AA 3NHTA 3V2LA 3Q8IA 3BFBA 4INWA 2GTEA 3CABA
chains in the Genus database with same CATH superfamily
1OSAA 2FCDA 1JFJA 1JSAA 1LS8A 2JOJA 5ER5A 1NSHA 1JFKA 1A75B 3DVJA 2BBMA 3TDUA 4PE7A 2RGIA 3AKAA 1FPWA 2WCKA 2M1KB 1TNQA 3JVTC 2KI6D 4ORAB 2ISDA 1WY9A 2KPHA 3D75A 4JWQA 1KWOB 2KAYA 2L4HA 3SJSA 1OOGA 1S6CA 1IJ5A 3FE6A 3PSRA 4HREE 1Y0VH 1OMRA 2TN4A 2FOTA 4XJKA 1G8IA 3R1PA 2QEOA 3CYZA 1N2DA 2KFGA 1XK4A 3AKBA 3DVEA 2K60A 2KFHA 3B6XA 3VGOA 5KTYA 1BJFA 2JULA 1XK4C 1NX2A 5I2OA 1BR4B 1B7TY 3PFVA 1B7TZ 2L50A 1SNLA 3EKHA 3R72A 3GK2A 2I2RE 5IBWA 2JRFA 2CT9A 2JZIA 3A8RA 1IJ6A 3NHIA 4A4CA 2OPOA 4PHJA 5DKRA 2BBNA 2MJWB 1E8AA 1WLMA 1S5GZ 3D76A 1NCZA 1QJTA 4DRWA 3ICBA 4OZDA 1CMGA 1MWNA 4DIRA 1JBAA 2LVIA 2ZRTA 2QACA 1X02A 1S36A 2F8PA 4BY5A 2QEBA 2LLSA 5D7FA 1OOIX 1FBVA 1PVAA 5CSNA 2JTZA 1SR6B 1AJ4A 1SCMB 2HPSA 3BYAA 3EK7A 5I2QA 3B88A 3PLFB 4JQ0D 4M2PA 4FQTA 1NIWA 4GAOA 3RLZA 1SCVA 3FWCA 4ORCB 1H4BA 2WCBA 1GGWA 3FE8A 4YI9A 3GK4X 1J1EA 2PVBA 1TNXA 2ZNDA 3S0AA 5HLOA 2M7NA 4YBHB 4PHKA 2JT0A 1MR8A 1Y1XA 1YX8A 4ICBA 3RM1A 3DXLA 3D74A 4CFQA 4QJ4B 1ODBA 1RWYA 4IJ7A 1B1GA 2KFFA 4CLNA 1SL8A 2G9BA 3I5FC 1Y6WA 3ZWHA 2HQWA 3CLNA 2JWWA 2I7AA 1NCXA 2LMUA 1QV0A 1JC2A 4M2OA 2KI6C 2OTGB 3VRRA 3B7AA 3GOFA 2NLNA 1D1OA 2PRUA 1PULA 5HKYA 1M31A 1PSRA 1A4PA 1IWQA 1MQ1A 1SK6D 2F3ZA 1F55A 5AEQA 4TNCA 2KQYA 3K21A 1CFFA 2F3YA 1CFDA 1SL7A 3I5IB 3WHTB 5GQQC 1AP4A 1NPQA 2I18A 3BUOB 1KK8B 3BUWB 3Q8IA 4INWA 5D69A 2HETA 1J1DA 1KFUL 1TCOB 2MBXA 1W9ZA 2WNDA 1F54A 4PE4A 1YURA 2V53A 1AK8A 1K96A 1V1GA 3QRXA 1GJYA 1XFUO 3E3RA 4CPVA 1XFXO 1K9UA 4U8DA 1R6PA 2GV5A 5AFPA 3PATA 3HCMA 1YRUB 1S1EA 1WDCB 3WHUB 2LP2A 2LVJA 1NYAA 3EK4A 3SS5A 2NXQA 5HL1A 4E68A 2EC6C 4BY4A 2EGDA 4XJKB 3D0YB 1CDMA 4HSZA 1G33A 1MXEA 5JOLA 3NSKA 3PM2A 1QVIY 1J7PA 3OB2B 5JJGA 2ZNEA 2L98A 1MXLC 4JD9A 2JNFA 1BF5A 1ALVA 1OOJA 2EHBA 1HT9A 1QLKA 4PT1A 3WXAA 2MLEC 2KAXA 4YGDB 3PALA 1QWVA 2LMVA 2WCEA 3OB1B 4MZKA 1K8UA 1SBJA 1XFRA 1YRTB 1JF2A 2ZN9A 2O60A 2L5YA 3I5GB 1BU3A 4PALA 4R1EA 1C7WA 1B4CA 3DF0A 2L2CA 5KU1A 4ZCUA 2KLEA 1WLZA 3SG6A 3EVVA 1N0YA 3BOWB 4OKHA 2LANA 4P5OE 2L4IA 5I8NA 1QATA 1RJVA 2P6BB 3IQOA 3TUYB 1UHKA 2E6WA 2K2AA 2H61A 2NCOA 2MLFC 2KI4B 4OR9B 2MRDA 2K7OA 1JWDA 1OOHA 2BNXA 2QEVA 3O78A 1YUTA 1TNWA 2JXLA 2H61C 1WRKA 2JTTA 2WCHA 3NSLA 3OP0A 2OS8B 3R1VA 3TZ1A 1IQ3A 1NX3A 2M29A 1OW4A 4JKTA 5FYXA 1KQMB 3LK0A 1DJGA 1EG4A 2PMYA 2ZKMX 2WCLA 2R2IA 5I2LA 4MSPA 2KQ6A 3L47A 1SKTA 3PN7C 5F6TA 5HKWA 1QV1A 2O5GA 1ZOTB 1FI5A 2P70A 1B8CA 2M8UA 1B47A 1DTLA 2KBIA 4AQIA 1OZSA 1DT7B 1DGVA 1CKKA 3CDNA 2AUCA 4OVNF 1IRJA 2JNXA 1LINA 5DKQA 2YGUA 3TDZA 1C3YA 2FJUB 1XFYO 2K61A 1DF0B 3L4LA 2K7BA 1U5IB 3I5HB 1BG1A 4GNKB 1F4OA 4MVFA 3OX6A 1LA3A 2NZ0A 2BL0B 1SYMA 4PCWA 1XFWO 1LXFC 1CM4A 1C3ZA 1L2OC 2ZRSA 3BUXB 4N5XA 1A2XA 1N65A 1J7RA 2L2EA 2M3WA 1EL4A 3CS1A 2LNKA 4L9MA 1CFPA 2VRGA 5FI6A 1BT6A 5CSIA 2M0RA 3NXAA 4MRYA 1CDPA 4CFRA 2LHIA 4HRHA 4PDZA 1QS7A 1DJZA 4MN0A 2M1UA 1YTZC 1A75A 3O4YA 3M0WA 3SIBA 2L0PA 1KSOA 1CDNA 1K90D 1MHOA 4MRXA 4FTGA 5CSFA 3CZ2A 2LP3A 1S3PA 1F70A 1GGZA 2CXJA 2K7DA 3TS5B 1UHIA 3BUMB 1PK0D 2WCJA 3KHEA 2FJYA 4NQGA 3FE9A 3C1VA 3JTDB 3FIAA 3NGVA 4F0ZB 3CZ1A 1ZFSA 2LVVA 1T14A 2KGRA 1K9PA 1UURA 1QXPA 1OE9B 1SY9A 1KWOC 2LC5A 3SG2A 3BXKA 1G4YR 3EK8A 1SSEB 1SPYA 2WC5A 3N7HA 4I5NB 1EG3A 2LUCA 1QTXA 1CMFA 1YUUA 1KFXL 3D10A 3O2PA 1H8BA 1IH0A 1QX7A 1SL9A 3O6BA 2KSPA 3FWBA 1TWOA 1GM0A 1CM1A 3JVTB 2LV7A 2BKIB 2HF5A 2AAOA 4D1EA 3GK1A 2BCBA 1XA5A 4GGNA 3SIAA 1A29A 1MUXA 4YI8A 5FI2A 2Q91A 3VRPA 1BLQA 3TDIA 4YRUA 3EVUA 3NSIA 2LMTA 1M45A 1WRLA 5ER4X 2ERBA 1M39A 2JC2A 1J7QA 1NX1A 1ZUZA 5J3XA 4AOMA 1DJHA 1K94A 4GPLB 2K2FA 4CIDA 2K8MB 3OBVA 4KYNA 3VB1A 3D77A 2M9GA 4N1FA 3VROA 2L51A 5HYDA 4QJ3B 1IG5A 1QASA 1MF8B 4UPGA 4NDDA 1Y1UA 4JPZB 3ZNIA 4AQJA 2LM5A 1QVIZ 4I5KA 3SG5A 5I94A 2Q4UA 2SASA 4QJ5B 2DOQA 1B8LA 2BCAA 2K7CA 3L4AA 2M49B 1DJXA 3K1EA 1DQEA 1EJ3A 4MZLA 5DICA 1QIVA 1FF1A 2WOSA 2L5XB 1ORGA 2F2OA 3F45A 1SR6C 1F8HA 2LE9B 1NX0A 1UP5A 1YUSA 4YGEB 1GQMA 2K0JA 2Y1MA 1Q80A 1DELA 3S0DA 2FCEA 2Y1NA 4FQOA 1TOPA 2COLB 1NUBA 1XFZO 4WQ3A 1YVLA 3VRNA 2CTNA 4PHNA 1TNPA 2JPTA 1IIOA 1JF0A 3QMEA 1W7JB 5BPJA 1TUJA 1YX7A 3LL8B 1RROA 1KSMA 3IQQA 3IF7A 4MBEA 3PJIA 3CWGA 4YGAA 1C07A 1TIZA 2OTGC 4GUKA 1LVCD 2KDHA 1OQPA 2WCMA 2G2BA 1KFXS 1R2UA 1TRFA 3SG3A 2KGBC 2LLTA 2KNEA 4MEWA 2JT8A 3I5FB 2CNPA 1KFUS 3I5IC 3NHTA 1VRKA 1AUIB 2Y4QA 1UHHA 2BE6A 2PYQA 1DJIA 1KK8C 1K2HA 1NCYA 5D3OA 3V2LA 4DUQA 1K93D 1TCFA 1WRZA 1CB1A 2JT3A 2BE4A 1NWDA 2M97A 4PE0A 2ZFDA 1IQ5A 3DVKA 3H4SE 1WDCC 3D0YA 3CABA 1DC1A 1Z4HA 1SW8A 1M46A 1DGUA 3BFAA 1PSBA 1K9KA 2IS9A 4GBAA 1PRWA 4WRIA 3S0FA 2SCPA 4XYNA 2QDIA 2CBLA 4I5JA 2GGZA 5HLVA 3IVTA 2BCXA 1YVHA 1BR1B 2LUXA 3KEVA 3LK1A 3CR2A 2E30A 4WQ2A 4Q04A 2Y5IA 1BODA 3A4UB 3EG5B 3DYEA 3MSEB 4MZJA 2CCMA 1F71A 1RK9A 2EC6B 3WNXB 3S0EA 1XFVO 3DZTA 1S5GY 3CZ0A 3R1OA 1CLLA 1FW4A 2MAZA 3EKJA 3VRQA 2KAVA 1Z2CB 3O4XA 1DJWA 4HRGA 2KBMA 1OMVA 3B87A 2BAPA 4ORBB 1EXRA 2AMIA 1J7OA 1CLMA 1CNPA 3NSOA 1AJ5A 3D73A 3I5GC 3BOWA 4NDBA 1UHNA 1B9AA 3DVMA 3SG4A 3FS7A 4IL1A 5HKZA 4DS7A 1CDLA 4N1GA 3DY9A 1SMGA 1ZACA 1XO5A 3OHMB 1OMDA 1AVSA 3DD4A 4PE1A 3TUYC 4USLA 1BMOA 1W7IB 2JPOA 3D78A 2D8NA 3KO0A 2BKHB 2WCFA 5TNCA 2H2KA 2KI4C 3LLEA 4F7FA 4PHMA 1SRAA 1LKJA 1DEKA 1V1FA 3CGAA 1F4QA 2B1UA 1RECA 1EH2A 3KPXA 5FI7A 1KQVA 2OS8C 4INXA 1LA0A 4A4BA 1J55A 4OV2A 2LHLA 3CZTX 4ZCVA 3DF0B 2QEHA 4P2YB 4YGCB 1KQMC 3B86A 4NDCA 3BFHA 3S0GA 1A03A 1UWOA 2PALA 3PM8A 5CPVA 2NCPA 1CTRA 1S6JA 1UHJA 1AHRA 3BJHA 3BQ3A 2JQ6A 1CFCA 2QPTA 2WC8A 5EL2A 2H8VA 3S0BA 3BUNB 3UO9A 1KK7Y 2P71A 4C0LA 1KK7Z 2HQ8A 5AANA 4C0JA 5G08A 1ZMZA 5AERA 1BOCA 1DF0A 1DJYA 1M63B 1U5IA 4C0KA 4MLWA 1QX2A 3SG7A 1C7VA 3LCPC 3PN7B 4M2QA 4YGBB 1QX5B 3AAKA 4GGFA 1DVIA 3UNWA 5K89A 1S6IA 1DMOA 1JUOA 1NP8A 1L7ZA 3I5HC 2BECA 2KOTA 2LAPA 1PALA 2PQLA 4GGFC 1HQVA 1UUSA 2BL0C 3OX5A 2WC6A 1P28A 2KHNA 2KYFA 4I5LB 3HX4A 3RZSA 5KSZA 2JU0A 3OGNA 2F2PA 1SCMC 2PASA 3CTNA 2I94A 1OOFA 2ZN8A 2JXCA 1IKUA 1CLBA 1XVJA 5DKNA 3SS4A 1IGVA 1RTP1 2PSRA 1QLSA 1KCYA 4OCIA 1Y1AA 5B8IB 3CR5X 1FI6A 1RFJA 1YR5A 2MHHA 4DCKA 1L2OB 2A4JA 1QIWA 2F33A 1TN4A 2LLUA 2LVKA 1S26D 4GFTA 2WORA 3CR4X 1TUZA 3BFBA 2GGMA 1XYDA 5PALA 3EVRA 2KLDA 5AXIA 2GTEA 1K95A 1OZOA 3AAJA 2M7LA 5CSJA 1PVBA 1TTXA 3KF9A 2LCPA 1ALWA 3TS5C 3SS3A 2MA2A 1B8RA 4ETOA 2KYCA 3JTDC
chains in the Genus database with same CATH topology
3CZ2A 3BFAA 2WCJA 2FJYA 3S0FA 3FE9A 3NGVA 3CZ1A 1LS8A 2QDIA 1T14A 3DYEA 2WCKA 2WC5A 3N7HA 3S0EA 4JD9A 3DZTA 2KPHA 3CZ0A 3D75A 3R1OA 1OOGA 4PT1A 1TWOA 3FE6A 1GM0A 3B87A 1QWVA 3D73A 3R1PA 2QEOA 3CYZA 1XFRA 2ERBA 3B6XA 3DY9A 2L2CA 3VB1A 3D77A 2JPOA 3D78A 3R72A 4F7FA 3NHIA 4INXA 3L4AA 3D76A 2QEHA 1OOHA 3K1EA 1DQEA 2QEVA 3B86A 4OZDA 5DICA 3BFHA 3S0GA 1ORGA 2WCHA 3R1VA 1OW4A 3BJHA 2QEBA 1OOIX 2WCLA 3S0DA 5EL2A 3L47A 2H8VA 3S0BA 3B88A 2P71A 4FQTA 2P70A 3FE8A 3QMEA 1TUJA 3S0AA 3CDNA 2PQLA 3DXLA 3PJIA 1C3YA 3D74A 2WC6A 1P28A 3L4LA 3RZSA 3OGNA 2WCMA 1OOFA 1C3ZA 3B7AA 3NHTA 3V2LA 3Q8IA 3BFBA 4INWA 2GTEA 3CABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CZ2 A;  3BFA A;  2WCJ A;  2FJY A;  3S0F A;  3FE9 A;  3NGV A;  3CZ1 A;  1LS8 A;  2QDI A;  1T14 A;  3DYE A;  2WCK A;  2WC5 A;  3N7H A;  3S0E A;  4JD9 A;  3DZT A;  2KPH A;  3CZ0 A;  3D75 A;  3R1O A;  1OOG A;  4PT1 A;  1TWO A;  3FE6 A;  1GM0 A;  3B87 A;  1QWV A;  3D73 A;  3R1P A;  2QEO A;  3CYZ A;  1XFR A;  2ERB A;  3B6X A;  3DY9 A;  2L2C A;  3VB1 A;  3D77 A;  2JPO A;  3D78 A;  3R72 A;  4F7F A;  3NHI A;  4INX A;  3L4A A;  3D76 A;  2QEH A;  1OOH A;  3K1E A;  1DQE A;  2QEV A;  3B86 A;  4OZD A;  5DIC A;  3BFH A;  3S0G A;  1ORG A;  2WCH A;  3R1V A;  1OW4 A;  3BJH A;  2QEB A;  1OOI X;  2WCL A;  3S0D A;  5EL2 A;  3L47 A;  2H8V A;  3S0B A;  3B88 A;  2P71 A;  4FQT A;  2P70 A;  3FE8 A;  3QME A;  1TUJ A;  3S0A A;  3CDN A;  2PQL A;  3DXL A;  3PJI A;  1C3Y A;  3D74 A;  2WC6 A;  1P28 A;  3L4L A;  3RZS A;  3OGN A;  2WCM A;  1OOF A;  1C3Z A;  3B7A A;  3NHT A;  3V2L A;  3Q8I A;  3BFB A;  4INW A;  2GTE A;  3CAB A; 
#chains in the Genus database with same CATH topology
 1OSA A;  2FCD A;  1JFJ A;  1JSA A;  1LS8 A;  2JOJ A;  5ER5 A;  1NSH A;  1JFK A;  1A75 B;  3DVJ A;  2BBM A;  3TDU A;  4PE7 A;  2RGI A;  3AKA A;  1FPW A;  2WCK A;  2M1K B;  1TNQ A;  3JVT C;  2KI6 D;  4ORA B;  2ISD A;  1WY9 A;  2KPH A;  3D75 A;  4JWQ A;  1KWO B;  2KAY A;  2L4H A;  3SJS A;  1OOG A;  1S6C A;  1IJ5 A;  3FE6 A;  3PSR A;  4HRE E;  1Y0V H;  1OMR A;  2TN4 A;  2FOT A;  4XJK A;  1G8I A;  3R1P A;  2QEO A;  3CYZ A;  1N2D A;  2KFG A;  1XK4 A;  3AKB A;  3DVE A;  2K60 A;  2KFH A;  3B6X A;  3VGO A;  5KTY A;  1BJF A;  2JUL A;  1XK4 C;  1NX2 A;  5I2O A;  1BR4 B;  1B7T Y;  3PFV A;  1B7T Z;  2L50 A;  1SNL A;  3EKH A;  3R72 A;  3GK2 A;  2I2R E;  5IBW A;  2JRF A;  2CT9 A;  2JZI A;  3A8R A;  1IJ6 A;  3NHI A;  4A4C A;  2OPO A;  4PHJ A;  5DKR A;  2BBN A;  2MJW B;  1E8A A;  1WLM A;  1S5G Z;  3D76 A;  1NCZ A;  1QJT A;  4DRW A;  3ICB A;  4OZD A;  1CMG A;  1MWN A;  4DIR A;  1JBA A;  2LVI A;  2ZRT A;  2QAC A;  1X02 A;  1S36 A;  2F8P A;  4BY5 A;  2QEB A;  2LLS A;  5D7F A;  1OOI X;  1FBV A;  1PVA A;  5CSN A;  2JTZ A;  1SR6 B;  1AJ4 A;  1SCM B;  2HPS A;  3BYA A;  3EK7 A;  5I2Q A;  3B88 A;  3PLF B;  4JQ0 D;  4M2P A;  4FQT A;  1NIW A;  4GAO A;  3RLZ A;  1SCV A;  3FWC A;  4ORC B;  1H4B A;  2WCB A;  1GGW A;  3FE8 A;  4YI9 A;  3GK4 X;  1J1E A;  2PVB A;  1TNX A;  2ZND A;  3S0A A;  5HLO A;  2M7N A;  4YBH B;  4PHK A;  2JT0 A;  1MR8 A;  1Y1X A;  1YX8 A;  4ICB A;  3RM1 A;  3DXL A;  3D74 A;  4CFQ A;  4QJ4 B;  1ODB A;  1RWY A;  4IJ7 A;  1B1G A;  2KFF A;  4CLN A;  1SL8 A;  2G9B A;  3I5F C;  1Y6W A;  3ZWH A;  2HQW A;  3CLN A;  2JWW A;  2I7A A;  1NCX A;  2LMU A;  1QV0 A;  1JC2 A;  4M2O A;  2KI6 C;  2OTG B;  3VRR A;  3B7A A;  3GOF A;  2NLN A;  1D1O A;  2PRU A;  1PUL A;  5HKY A;  1M31 A;  1PSR A;  1A4P A;  1IWQ A;  1MQ1 A;  1SK6 D;  2F3Z A;  1F55 A;  5AEQ A;  4TNC A;  2KQY A;  3K21 A;  1CFF A;  2F3Y A;  1CFD A;  1SL7 A;  3I5I B;  3WHT B;  5GQQ C;  1AP4 A;  1NPQ A;  2I18 A;  3BUO B;  1KK8 B;  3BUW B;  3Q8I A;  4INW A;  5D69 A;  2HET A;  1J1D A;  1KFU L;  1TCO B;  2MBX A;  1W9Z A;  2WND A;  1F54 A;  4PE4 A;  1YUR A;  2V53 A;  1AK8 A;  1K96 A;  1V1G A;  3QRX A;  1GJY A;  1XFU O;  3E3R A;  4CPV A;  1XFX O;  1K9U A;  4U8D A;  1R6P A;  2GV5 A;  5AFP A;  3PAT A;  3HCM A;  1YRU B;  1S1E A;  1WDC B;  3WHU B;  2LP2 A;  2LVJ A;  1NYA A;  3EK4 A;  3SS5 A;  2NXQ A;  5HL1 A;  4E68 A;  2EC6 C;  4BY4 A;  2EGD A;  4XJK B;  3D0Y B;  1CDM A;  4HSZ A;  1G33 A;  1MXE A;  5JOL A;  3NSK A;  3PM2 A;  1QVI Y;  1J7P A;  3OB2 B;  5JJG A;  2ZNE A;  2L98 A;  1MXL C;  4JD9 A;  2JNF A;  1BF5 A;  1ALV A;  1OOJ A;  2EHB A;  1HT9 A;  1QLK A;  4PT1 A;  3WXA A;  2MLE C;  2KAX A;  4YGD B;  3PAL A;  1QWV A;  2LMV A;  2WCE A;  3OB1 B;  4MZK A;  1K8U A;  1SBJ A;  1XFR A;  1YRT B;  1JF2 A;  2ZN9 A;  2O60 A;  2L5Y A;  3I5G B;  1BU3 A;  4PAL A;  4R1E A;  1C7W A;  1B4C A;  3DF0 A;  2L2C A;  5KU1 A;  4ZCU A;  2KLE A;  1WLZ A;  3SG6 A;  3EVV A;  1N0Y A;  3BOW B;  4OKH A;  2LAN A;  4P5O E;  2L4I A;  5I8N A;  1QAT A;  1RJV A;  2P6B B;  3IQO A;  3TUY B;  1UHK A;  2E6W A;  2K2A A;  2H61 A;  2NCO A;  2MLF C;  2KI4 B;  4OR9 B;  2MRD A;  2K7O A;  1JWD A;  1OOH A;  2BNX A;  2QEV A;  3O78 A;  1YUT A;  1TNW A;  2JXL A;  2H61 C;  1WRK A;  2JTT A;  2WCH A;  3NSL A;  3OP0 A;  2OS8 B;  3R1V A;  3TZ1 A;  1IQ3 A;  1NX3 A;  2M29 A;  1OW4 A;  4JKT A;  5FYX A;  1KQM B;  3LK0 A;  1DJG A;  1EG4 A;  2PMY A;  2ZKM X;  2WCL A;  2R2I A;  5I2L A;  4MSP A;  2KQ6 A;  3L47 A;  1SKT A;  3PN7 C;  5F6T A;  5HKW A;  1QV1 A;  2O5G A;  1ZOT B;  1FI5 A;  2P70 A;  1B8C A;  2M8U A;  1B47 A;  1DTL A;  2KBI A;  4AQI A;  1OZS A;  1DT7 B;  1DGV A;  1CKK A;  3CDN A;  2AUC A;  4OVN F;  1IRJ A;  2JNX A;  1LIN A;  5DKQ A;  2YGU A;  3TDZ A;  1C3Y A;  2FJU B;  1XFY O;  2K61 A;  1DF0 B;  3L4L A;  2K7B A;  1U5I B;  3I5H B;  1BG1 A;  4GNK B;  1F4O A;  4MVF A;  3OX6 A;  1LA3 A;  2NZ0 A;  2BL0 B;  1SYM A;  4PCW A;  1XFW O;  1LXF C;  1CM4 A;  1C3Z A;  1L2O C;  2ZRS A;  3BUX B;  4N5X A;  1A2X A;  1N65 A;  1J7R A;  2L2E A;  2M3W A;  1EL4 A;  3CS1 A;  2LNK A;  4L9M A;  1CFP A;  2VRG A;  5FI6 A;  1BT6 A;  5CSI A;  2M0R A;  3NXA A;  4MRY A;  1CDP A;  4CFR A;  2LHI A;  4HRH A;  4PDZ A;  1QS7 A;  1DJZ A;  4MN0 A;  2M1U A;  1YTZ C;  1A75 A;  3O4Y A;  3M0W A;  3SIB A;  2L0P A;  1KSO A;  1CDN A;  1K90 D;  1MHO A;  4MRX A;  4FTG A;  5CSF A;  3CZ2 A;  2LP3 A;  1S3P A;  1F70 A;  1GGZ A;  2CXJ A;  2K7D A;  3TS5 B;  1UHI A;  3BUM B;  1PK0 D;  2WCJ A;  3KHE A;  2FJY A;  4NQG A;  3FE9 A;  3C1V A;  3JTD B;  3FIA A;  3NGV A;  4F0Z B;  3CZ1 A;  1ZFS A;  2LVV A;  1T14 A;  2KGR A;  1K9P A;  1UUR A;  1QXP A;  1OE9 B;  1SY9 A;  1KWO C;  2LC5 A;  3SG2 A;  3BXK A;  1G4Y R;  3EK8 A;  1SSE B;  1SPY A;  2WC5 A;  3N7H A;  4I5N B;  1EG3 A;  2LUC A;  1QTX A;  1CMF A;  1YUU A;  1KFX L;  3D10 A;  3O2P A;  1H8B A;  1IH0 A;  1QX7 A;  1SL9 A;  3O6B A;  2KSP A;  3FWB A;  1TWO A;  1GM0 A;  1CM1 A;  3JVT B;  2LV7 A;  2BKI B;  2HF5 A;  2AAO A;  4D1E A;  3GK1 A;  2BCB A;  1XA5 A;  4GGN A;  3SIA A;  1A29 A;  1MUX A;  4YI8 A;  5FI2 A;  2Q91 A;  3VRP A;  1BLQ A;  3TDI A;  4YRU A;  3EVU A;  3NSI A;  2LMT A;  1M45 A;  1WRL A;  5ER4 X;  2ERB A;  1M39 A;  2JC2 A;  1J7Q A;  1NX1 A;  1ZUZ A;  5J3X A;  4AOM A;  1DJH A;  1K94 A;  4GPL B;  2K2F A;  4CID A;  2K8M B;  3OBV A;  4KYN A;  3VB1 A;  3D77 A;  2M9G A;  4N1F A;  3VRO A;  2L51 A;  5HYD A;  4QJ3 B;  1IG5 A;  1QAS A;  1MF8 B;  4UPG A;  4NDD A;  1Y1U A;  4JPZ B;  3ZNI A;  4AQJ A;  2LM5 A;  1QVI Z;  4I5K A;  3SG5 A;  5I94 A;  2Q4U A;  2SAS A;  4QJ5 B;  2DOQ A;  1B8L A;  2BCA A;  2K7C A;  3L4A A;  2M49 B;  1DJX A;  3K1E A;  1DQE A;  1EJ3 A;  4MZL A;  5DIC A;  1QIV A;  1FF1 A;  2WOS A;  2L5X B;  1ORG A;  2F2O A;  3F45 A;  1SR6 C;  1F8H A;  2LE9 B;  1NX0 A;  1UP5 A;  1YUS A;  4YGE B;  1GQM A;  2K0J A;  2Y1M A;  1Q80 A;  1DEL A;  3S0D A;  2FCE A;  2Y1N A;  4FQO A;  1TOP A;  2COL B;  1NUB A;  1XFZ O;  4WQ3 A;  1YVL A;  3VRN A;  2CTN A;  4PHN A;  1TNP A;  2JPT A;  1IIO A;  1JF0 A;  3QME A;  1W7J B;  5BPJ A;  1TUJ A;  1YX7 A;  3LL8 B;  1RRO A;  1KSM A;  3IQQ A;  3IF7 A;  4MBE A;  3PJI A;  3CWG A;  4YGA A;  1C07 A;  1TIZ A;  2OTG C;  4GUK A;  1LVC D;  2KDH A;  1OQP A;  2WCM A;  2G2B A;  1KFX S;  1R2U A;  1TRF A;  3SG3 A;  2KGB C;  2LLT A;  2KNE A;  4MEW A;  2JT8 A;  3I5F B;  2CNP A;  1KFU S;  3I5I C;  3NHT A;  1VRK A;  1AUI B;  2Y4Q A;  1UHH A;  2BE6 A;  2PYQ A;  1DJI A;  1KK8 C;  1K2H A;  1NCY A;  5D3O A;  3V2L A;  4DUQ A;  1K93 D;  1TCF A;  1WRZ A;  1CB1 A;  2JT3 A;  2BE4 A;  1NWD A;  2M97 A;  4PE0 A;  2ZFD A;  1IQ5 A;  3DVK A;  3H4S E;  1WDC C;  3D0Y A;  3CAB A;  1DC1 A;  1Z4H A;  1SW8 A;  1M46 A;  1DGU A;  3BFA A;  1PSB A;  1K9K A;  2IS9 A;  4GBA A;  1PRW A;  4WRI A;  3S0F A;  2SCP A;  4XYN A;  2QDI A;  2CBL A;  4I5J A;  2GGZ A;  5HLV A;  3IVT A;  2BCX A;  1YVH A;  1BR1 B;  2LUX A;  3KEV A;  3LK1 A;  3CR2 A;  2E30 A;  4WQ2 A;  4Q04 A;  2Y5I A;  1BOD A;  3A4U B;  3EG5 B;  3DYE A;  3MSE B;  4MZJ A;  2CCM A;  1F71 A;  1RK9 A;  2EC6 B;  3WNX B;  3S0E A;  1XFV O;  3DZT A;  1S5G Y;  3CZ0 A;  3R1O A;  1CLL A;  1FW4 A;  2MAZ A;  3EKJ A;  3VRQ A;  2KAV A;  1Z2C B;  3O4X A;  1DJW A;  4HRG A;  2KBM A;  1OMV A;  3B87 A;  2BAP A;  4ORB B;  1EXR A;  2AMI A;  1J7O A;  1CLM A;  1CNP A;  3NSO A;  1AJ5 A;  3D73 A;  3I5G C;  3BOW A;  4NDB A;  1UHN A;  1B9A A;  3DVM A;  3SG4 A;  3FS7 A;  4IL1 A;  5HKZ A;  4DS7 A;  1CDL A;  4N1G A;  3DY9 A;  1SMG A;  1ZAC A;  1XO5 A;  3OHM B;  1OMD A;  1AVS A;  3DD4 A;  4PE1 A;  3TUY C;  4USL A;  1BMO A;  1W7I B;  2JPO A;  3D78 A;  2D8N A;  3KO0 A;  2BKH B;  2WCF A;  5TNC A;  2H2K A;  2KI4 C;  3LLE A;  4F7F A;  4PHM A;  1SRA A;  1LKJ A;  1DEK A;  1V1F A;  3CGA A;  1F4Q A;  2B1U A;  1REC A;  1EH2 A;  3KPX A;  5FI7 A;  1KQV A;  2OS8 C;  4INX A;  1LA0 A;  4A4B A;  1J55 A;  4OV2 A;  2LHL A;  3CZT X;  4ZCV A;  3DF0 B;  2QEH A;  4P2Y B;  4YGC B;  1KQM C;  3B86 A;  4NDC A;  3BFH A;  3S0G A;  1A03 A;  1UWO A;  2PAL A;  3PM8 A;  5CPV A;  2NCP A;  1CTR A;  1S6J A;  1UHJ A;  1AHR A;  3BJH A;  3BQ3 A;  2JQ6 A;  1CFC A;  2QPT A;  2WC8 A;  5EL2 A;  2H8V A;  3S0B A;  3BUN B;  3UO9 A;  1KK7 Y;  2P71 A;  4C0L A;  1KK7 Z;  2HQ8 A;  5AAN A;  4C0J A;  5G08 A;  1ZMZ A;  5AER A;  1BOC A;  1DF0 A;  1DJY A;  1M63 B;  1U5I A;  4C0K A;  4MLW A;  1QX2 A;  3SG7 A;  1C7V A;  3LCP C;  3PN7 B;  4M2Q A;  4YGB B;  1QX5 B;  3AAK A;  4GGF A;  1DVI A;  3UNW A;  5K89 A;  1S6I A;  1DMO A;  1JUO A;  1NP8 A;  1L7Z A;  3I5H C;  2BEC A;  2KOT A;  2LAP A;  1PAL A;  2PQL A;  4GGF C;  1HQV A;  1UUS A;  2BL0 C;  3OX5 A;  2WC6 A;  1P28 A;  2KHN A;  2KYF A;  4I5L B;  3HX4 A;  3RZS A;  5KSZ A;  2JU0 A;  3OGN A;  2F2P A;  1SCM C;  2PAS A;  3CTN A;  2I94 A;  1OOF A;  2ZN8 A;  2JXC A;  1IKU A;  1CLB A;  1XVJ A;  5DKN A;  3SS4 A;  1IGV A;  1RTP 1;  2PSR A;  1QLS A;  1KCY A;  4OCI A;  1Y1A A;  5B8I B;  3CR5 X;  1FI6 A;  1RFJ A;  1YR5 A;  2MHH A;  4DCK A;  1L2O B;  2A4J A;  1QIW A;  2F33 A;  1TN4 A;  2LLU A;  2LVK A;  1S26 D;  4GFT A;  2WOR A;  3CR4 X;  1TUZ A;  3BFB A;  2GGM A;  1XYD A;  5PAL A;  3EVR A;  2KLD A;  5AXI A;  2GTE A;  1K95 A;  1OZO A;  3AAJ A;  2M7L A;  5CSJ A;  1PVB A;  1TTX A;  3KF9 A;  2LCP A;  1ALW A;  3TS5 C;  3SS3 A;  2MA2 A;  1B8R A;  4ETO A;  2KYC A;  3JTD C; 
#chains in the Genus database with same CATH homology
 3CZ2 A;  3BFA A;  2WCJ A;  2FJY A;  3S0F A;  3FE9 A;  3NGV A;  3CZ1 A;  1LS8 A;  2QDI A;  1T14 A;  3DYE A;  2WCK A;  2WC5 A;  3N7H A;  3S0E A;  4JD9 A;  3DZT A;  2KPH A;  3CZ0 A;  3D75 A;  3R1O A;  1OOG A;  4PT1 A;  1TWO A;  3FE6 A;  1GM0 A;  3B87 A;  1QWV A;  3D73 A;  3R1P A;  2QEO A;  3CYZ A;  1XFR A;  2ERB A;  3B6X A;  3DY9 A;  2L2C A;  3VB1 A;  3D77 A;  2JPO A;  3D78 A;  3R72 A;  4F7F A;  3NHI A;  4INX A;  3L4A A;  3D76 A;  2QEH A;  1OOH A;  3K1E A;  1DQE A;  2QEV A;  3B86 A;  4OZD A;  5DIC A;  3BFH A;  3S0G A;  1ORG A;  2WCH A;  3R1V A;  1OW4 A;  3BJH A;  2QEB A;  1OOI X;  2WCL A;  3S0D A;  5EL2 A;  3L47 A;  2H8V A;  3S0B A;  3B88 A;  2P71 A;  4FQT A;  2P70 A;  3FE8 A;  3QME A;  1TUJ A;  3S0A A;  3CDN A;  2PQL A;  3DXL A;  3PJI A;  1C3Y A;  3D74 A;  2WC6 A;  1P28 A;  3L4L A;  3RZS A;  3OGN A;  2WCM A;  1OOF A;  1C3Z A;  3B7A A;  3NHT A;  3V2L A;  3Q8I A;  3BFB A;  4INW A;  2GTE A;  3CAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...