4INWA

Structure of pheromone-binding protein 1 in complex with (11z,13z)-hexadecadienal
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
140
structure length
140
Chain Sequence
SPEIMKDLSINFGKALDTCKKELDLPDSINEDFYKFWKEDYEITNRLTGCAIKCLSEKLEMVDADGKLHHGNAREFAMKHGADDAMAKQLVDLIHGCEKSIPPNDDRCMEVLSIAMCFKKEIHNLKWAPNMEVVVGEVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Pheromone-binding protein
molecule keywords Pheromone-binding protein 1
publication title Crystallographic Observation of pH-Induced Conformational Changes in the Amyelois transitella Pheromone-Binding Protein AtraPBP1.
pubmed doi rcsb
source organism Amyelois transitella
total genus 53
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 4inwA00
3S0DA 3L4LA 3BFHA 3DXLA 3L47A 1QWVA 1XFRA 2P70A 4PT1A 2WC6A 5EL2A 2QEHA 3NHIA 3CYZA 1C3YA 4INXA 3D74A 1OOGA 3CZ1A 2QDIA 3D75A 3V2LA 2P71A 3B86A 3R1OA 2FJYA 2ERBA 3K1EA 2JPOA 1OOHA 3DY9A 2QEVA 2WCHA 3B6XA 3S0FA 3FE9A 1DQEA 2WCMA 3B87A 3DYEA 3Q8IA 1GM0A 1ORGA 3CZ2A 3S0GA 2WCKA 3CZ0A 1TWOA 3BFAA 1OW4A 2QEBA 3N7HA 3R72A 3R1PA 3BJHA 3RZSA 4JD9A 3NGVA 3D73A 3QMEA 1TUJA 2WCLA 2PQLA 3R1VA 2KPHA 4F7FA 3D77A 2QEOA 3B88A 3CABA 2L2CA 1P28A 1T14A 3NHTA 1C3ZA 3BFBA 2H8VA 3B7AA 3D78A 1OOFA 1OOIX 3PJIA 4OZDA 2WC5A 4INWA 3VB1A 5DICA 1LS8A 4FQTA 2WCJA 3OGNA 3FE8A 2GTEA 3CDNA 3S0BA 3L4AA 3S0AA 3S0EA 3FE6A 3DZTA 3D76A
chains in the Genus database with same CATH superfamily
2JT0A 4HRHA 1R2UA 1TNXA 2LP3A 2M7LA 4DS7A 4IJ7A 1OMVA 2JXLA 2I7AA 2JRFA 3L47A 1DGUA 2P70A 1CFCA 1W7IB 2M3WA 2WC8A 4ETOA 1JBAA 3PM2A 1DTLA 1TRFA 4I5NB 1OMRA 3NXAA 1C3YA 4WQ3A 3LK0A 1FPWA 1SCVA 1LKJA 2JWWA 2LC5A 4DCKA 2KHNA 1B4CA 4NQGA 1QIVA 1H8BA 1OOGA 3SG2A 5IBWA 3C1VA 1TOPA 1XFXO 1N2DA 5CPVA 2QDIA 1VRKA 1UURA 3OX6A 2OS8B 1W9ZA 3DD4A 2K61A 4CFRA 1BF5A 2ZN8A 1H4BA 3TDZA 5FI2A 5HKWA 3R1OA 3IQQA 3OX5A 2BE6A 1B7TY 1DJZA 3K1EA 2K2FA 5ER4X 5K89A 2JPOA 2M97A 1IG5A 1BMOA 3PN7B 1MR8A 1MWNA 1KQVA 4DRWA 2O5GA 2JXCA 2WCHA 4MRXA 1K95A 1QATA 1YX8A 1S36A 1B47A 4IL1A 1Q80A 4PDZA 1HT9A 2JU0A 3BUXB 4PALA 3HCMA 3VRPA 2LAPA 1RJVA 2LCPA 4YI9A 1GM0A 4QJ5B 2F2OA 1ORGA 3FWCA 4MVFA 2KLEA 3SG4A 2BKHB 1CM4A 2WCKA 1UHKA 3PFVA 2KFFA 4OCIA 1A4PA 3PLFB 4MEWA 3SIBA 3I5FC 3FWBA 4NDCA 2OS8C 3O4YA 1JWDA 5AEQA 1DJHA 1B8RA 3JVTB 2LNKA 1UHNA 1WRZA 1A75B 1U5IB 1XFZO 4N1GA 1ZMZA 2F3YA 2G9BA 1B7TZ 2QACA 1RTP1 2L51A 1PULA 3FIAA 2E6WA 3NSOA 1WDCB 2PQLA 2GGZA 3R1VA 1IQ5A 1SSEB 2QPTA 1V1FA 2LMUA 2COLB 2QEOA 2EC6C 2Y1NA 2LVIA 2MLFC 2KGBC 1JC2A 3KF9A 3NSIA 1CDLA 4U8DA 2BL0C 1EG4A 1L2OC 1IKUA 1C3ZA 1IWQA 1UHIA 3TDIA 3GK1A 2JNFA 3D78A 4PHKA 4XYNA 4BY4A 4OZDA 1AVSA 2WC5A 4INWA 1K9KA 2F8PA 2JOJA 4YBHB 1TCFA 1MUXA 2FOTA 3JVTC 4GUKA 5DICA 3TDUA 3UNWA 1CLMA 2Y1MA 2BCAA 3BOWB 1ZOTB 2BECA 1NYAA 3OGNA 3CR4X 2JTTA 2Q91A 3DF0B 1QJTA 4C0LA 4OVNF 1RWYA 2K7CA 1NIWA 2AMIA 3S0BA 2HETA 4AOMA 3VRQA 3S0AA 1WDCC 1QS7A 2JTZA 2YGUA 4OR9B 3S0DA 1XFUO 1CDMA 1G4YR 1KWOC 2KI6C 1M46A 1XO5A 2WCFA 3D0YA 4GBAA 2LVKA 4L9MA 3WXAA 1XFRA 1GJYA 1K9UA 4PT1A 4MRYA 5HL1A 1EL4A 1QX5B 3CTNA 2QEHA 4BY5A 2PALA 1F70A 1K93D 5KTYA 2WOSA 1NCYA 3EVRA 1QIWA 1MHOA 4AQJA 1N0YA 1GGWA 2ZRSA 2SCPA 1FF1A 4F0ZB 2ZRTA 3PSRA 1B1GA 2VRGA 3D74A 4TNCA 3E3RA 3M0WA 1DGVA 2LUXA 4PE1A 4YGCB 3TUYB 3CZ1A 1KFXS 1OMDA 3O4XA 1MF8B 2LVJA 2KBIA 2BE4A 4GAOA 3GK2A 5KSZA 1K94A 1OQPA 2O60A 1IJ6A 3OB1B 2FJYA 5PALA 2ERBA 4XJKA 5HLVA 4QJ4B 4ORCB 3VRRA 1M45A 5I2QA 1LA3A 1TNQA 1K9PA 5GQQC 3LK1A 1G33A 1M39A 2KFHA 1KCYA 1EG3A 1UP5A 3FS7A 4JQ0D 2KYFA 1OZOA 3S0FA 3QRXA 1TIZA 1QV0A 1J55A 1DEKA 2LLUA 1FI5A 2EGDA 1DQEA 1QVIY 4Q04A 4YGBB 4C0JA 1AHRA 2HQWA 1SL9A 3Q8IA 3CS1A 3CLNA 3VROA 1SR6C 1ZACA 4JKTA 5I2LA 3TUYC 5DKQA 4NDBA 2WORA 3I5FB 3KHEA 2LE9B 2Q4UA 3SS4A 3CZ0A 1NP8A 2RGIA 2PYQA 1KFUS 3NSKA 1CKKA 1KSMA 2KNEA 2V53A 5CSFA 3BFAA 1OW4A 1WRKA 1NCZA 2QEBA 3SG3A 1OZSA 5F6TA 2ZFDA 2I2RE 2KI6D 3R72A 2KQ6A 5I2OA 1DJXA 1SBJA 4FQOA 2AAOA 3OHMB 1DF0A 4ZCUA 3JTDC 5TNCA 1A03A 2CBLA 2NCPA 5D3OA 3D73A 1DT7B 2E30A 1S1EA 1TUJA 4P2YB 1J7QA 4DIRA 2HPSA 3PATA 2EC6B 2JT3A 3BUNB 4M2QA 2ISDA 3I5HC 2NXQA 3WHTB 1SCMB 1ODBA 3O78A 1JFKA 2BBMA 3D10A 4YRUA 2BL0B 1B8CA 1P28A 1L2OB 1XYDA 1WY9A 1SRAA 2D8NA 2TN4A 3AAKA 3O6BA 4JPZB 5AXIA 1JSAA 1Y6WA 3MSEB 1K8UA 1M63B 2L50A 1QVIZ 4I5KA 3BFBA 1LVCD 1DJIA 1NX3A 1WRLA 2A4JA 3SS3A 5JOLA 4A4BA 4P5OE 1BOCA 1K2HA 1AP4A 1OOIX 2OTGB 2F3ZA 2M0RA 4GNKB 1DMOA 1K96A 1NCXA 2KAXA 1DJWA 1R6PA 3AAJA 4KYNA 1OOJA 3O2PA 5AFPA 3EVUA 1QX2A 3CGAA 1TN4A 3AKAA 1OE9B 3DVMA 4NDDA 4CFQA 5CSNA 1QASA 3CWGA 4FTGA 3SG7A 2GTEA 1J1DA 1YUUA 2CXJA 1KWOB 1F55A 1EH2A 1XVJA 3FE6A 3DZTA 3CZTX 3I5GC 2B1UA 1YRUB 3D76A 4AQIA 4GPLB 1Y1XA 2BBNA 1A2XA 1SCMC 3DXLA 2KYCA 3PM8A 2WC6A 3KO0A 5AERA 2LANA 5EL2A 2WNDA 1DJYA 4WRIA 2L2EA 1S26D 2KDHA 4PE7A 5FYXA 3CYZA 5B8IB 2M7NA 5FI6A 2OTGC 1JF0A 2CNPA 1FW4A 1TCOB 2G2BA 4R1EA 3A4UB 2BNXA 2M49B 1NX1A 2PVBA 2Y5IA 1CFFA 2K2AA 1CB1A 1NUBA 2ZNEA 1TTXA 2JULA 1X02A 3I5IB 1CDPA 1UUSA 5AANA 1Y1AA 2GGMA 1PVBA 2BAPA 1ALVA 1ZUZA 1EXRA 3V2LA 1PRWA 1UHHA 1BT6A 2JT8A 1YUTA 3OB2B 1J7OA 1AUIB 2JPTA 3SS5A 3EKHA 1C07A 4YGEB 3F45A 5G08A 2L5YA 2R2IA 1OOHA 3TS5C 4I5LB 3SG5A 1PSBA 1QXPA 2K0JA 2L98A 3DY9A 2QEVA 1S6JA 3B6XA 3PALA 3SG6A 2F33A 1KK8B 1TNWA 2L4IA 2P6BB 3CR2A 2KBMA 5I94A 1XA5A 1YURA 2K7OA 3FE9A 1S5GZ 3D0YB 3EK8A 1SR6B 1XFYO 2FJUB 1K90D 2LHLA 2WCMA 4M2OA 4ZCVA 5HKYA 1CFPA 2K60A 4CLNA 4MN0A 1TNPA 1Y1UA 3UO9A 2L0PA 3AKBA 3ZNIA 4C0KA 1HQVA 1QTXA 2CTNA 2MJWB 2SASA 2WCEA 3RLZA 3I5IC 2BCXA 2JZIA 1NX0A 1JUOA 3SIAA 1CMFA 1QLKA 1WLMA 3N7HA 1N65A 1PSRA 2KI4C 3JTDB 3R1PA 5I8NA 4DUQA 4N5XA 5D69A 2M1UA 4WQ2A 1D1OA 2FCDA 3EG5B 3H4SE 3IQOA 1SMGA 1KK7Z 1XK4A 4JD9A 5D7FA 1F54A 1QLSA 1CTRA 1CLBA 2LP2A 1SPYA 1JF2A 2LV7A 2WCLA 3I5HB 1BLQA 2PSRA 2DOQA 2F2PA 2KPHA 2HQ8A 3KEVA 4ORBB 1KK8C 1NSHA 1MXEA 4PE0A 2MBXA 5HYDA 3D77A 2MLEC 1BODA 4CPVA 2LM5A 1B9AA 4XJKB 4PE4A 1TUZA 2L2CA 2LLTA 1YTZC 2MHHA 1B8LA 1SW8A 2ZNDA 1S6CA 1T14A 1UHJA 2ZN9A 3NHTA 2LHIA 3BYAA 1RROA 2H8VA 1ALWA 5JJGA 5KU1A 4E68A 2IS9A 4JWQA 3PJIA 1BG1A 4MLWA 1OSAA 2CCMA 1SNLA 4PHJA 1Y0VH 1SK6D 3DVKA 1LS8A 4FQTA 1J7RA 4A4CA 1KFXL 1F8HA 5FI7A 2I18A 4OKHA 1BJFA 4YI8A 3FE8A 4QJ3B 4PHNA 1S6IA 3CDNA 3I5GB 1LINA 2KGRA 3L4AA 2KOTA 3BQ3A 1F4QA 3S0EA 1Z4HA 1YX7A 1IGVA 3WNXB 4MBEA 1CNPA 3L4LA 3BFHA 3GOFA 1NX2A 2NZ0A 3WHUB 1Z2CB 4N1FA 2M1KB 5DKRA 1QWVA 2MRDA 2H61A 1DF0B 3ZWHA 1CFDA 2GV5A 2M9GA 3OBVA 1BR1B 1J1EA 2L5XB 2K7BA 3LL8B 2NLNA 3NHIA 1IQ3A 3DVEA 1C7VA 1JFJA 1XK4C 1DJGA 2KFGA 1IH0A 1EJ3A 3EK4A 2PMYA 1FBVA 4PHMA 4ORAB 1ZFSA 1DC1A 1CDNA 4INXA 3HX4A 5DKNA 1RECA 2LMTA 1A75A 1U5IA 5HLOA 1IJ5A 5J3XA 2PASA 1S3PA 2Y4QA 4MSPA 2EHBA 1RFJA 1KFUL 4PCWA 1LA0A 3LCPC 3D75A 1DVIA 2NCOA 1J7PA 1YVHA 2P71A 1AJ4A 3B86A 1LXFC 3SJSA 3VGOA 3K21A 1NPQA 2FCEA 4HRGA 1YVLA 1YUSA 5CSIA 1AJ5A 3TS5B 4GGFA 1S5GY 1XFVO 1BR4B 4YGDB 3PN7C 3EK7A 1DELA 2JNXA 3IVTA 4CIDA 4D1EA 4YGAA 3BUWB 3RM1A 1FI6A 1KQMB 1PVAA 3KPXA 4GGNA 1IRJA 5HKZA 4OV2A 3TZ1A 4MZKA 3B87A 3DYEA 2PRUA 3BOWA 3NSLA 5BPJA 3CZ2A 3EKJA 1IIOA 3DF0A 2JC2A 2H61C 3S0GA 2HF5A 2KLDA 2MA2A 1YRTB 2ZKMX 4GFTA 1PALA 2BKIB 1A29A 1W7JB 1TWOA 2KI4B 1KK7Y 1F71A 4USLA 2LUCA 3EVVA 1GGZA 3LLEA 3BJHA 1RK9A 1SL7A 2LMVA 4UPGA 1SKTA 3RZSA 4ICBA 1BU3A 2H2KA 3NGVA 1SYMA 3GK4X 2KAVA 2K7DA 2BCBA 3QMEA 3ICBA 1E8AA 2KAYA 4I5JA 4HSZA 1CMGA 2CT9A 1PK0D 4MZJA 2LVVA 4F7FA 1NWDA 2I94A 2KQYA 1KQMC 2MAZA 3B88A 5ER5A 3CABA 1QV1A 2KSPA 1XFWO 2M29A 1G8IA 5CSJA 1UWOA 2OPOA 2K8MB 2WCBA 1YR5A 4MZLA 2AUCA 3A8RA 4GGFC 3B7AA 3BUMB 1WLZA 4HREE 2M8UA 4M2PA 1OOFA 1V1GA 1C7WA 1M31A 3BUOB 3BXKA 3IF7A 1MXLC 1CLLA 3CR5X 1GQMA 3VB1A 1SY9A 2WCJA 1L7ZA 3OP0A 1F4OA 3VRNA 2L4HA 1QX7A 2LLSA 1CM1A 1SL8A 1MQ1A 1KSOA 3DVJA 2JQ6A 1AK8A
chains in the Genus database with same CATH topology
3S0DA 3L4LA 3BFHA 3DXLA 3L47A 1QWVA 1XFRA 2P70A 4PT1A 2WC6A 5EL2A 2QEHA 3NHIA 3CYZA 1C3YA 4INXA 3D74A 1OOGA 3CZ1A 2QDIA 3D75A 3V2LA 2P71A 3B86A 3R1OA 2FJYA 2ERBA 3K1EA 2JPOA 1OOHA 3DY9A 2QEVA 2WCHA 3B6XA 3S0FA 3FE9A 1DQEA 2WCMA 3B87A 3DYEA 3Q8IA 1GM0A 1ORGA 3CZ2A 3S0GA 2WCKA 3CZ0A 1TWOA 3BFAA 1OW4A 2QEBA 3N7HA 3R72A 3R1PA 3BJHA 3RZSA 4JD9A 3NGVA 3D73A 3QMEA 1TUJA 2WCLA 2PQLA 3R1VA 2KPHA 4F7FA 3D77A 2QEOA 3B88A 3CABA 2L2CA 1P28A 1T14A 3NHTA 1C3ZA 3BFBA 2H8VA 3B7AA 3D78A 1OOFA 1OOIX 3PJIA 4OZDA 2WC5A 4INWA 3VB1A 5DICA 1LS8A 4FQTA 2WCJA 3OGNA 3FE8A 2GTEA 3CDNA 3S0BA 3L4AA 3S0AA 3S0EA 3FE6A 3DZTA 3D76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S0D A;  3L4L A;  3BFH A;  3DXL A;  3L47 A;  1QWV A;  1XFR A;  2P70 A;  4PT1 A;  2WC6 A;  5EL2 A;  2QEH A;  3NHI A;  3CYZ A;  1C3Y A;  4INX A;  3D74 A;  1OOG A;  3CZ1 A;  2QDI A;  3D75 A;  3V2L A;  2P71 A;  3B86 A;  3R1O A;  2FJY A;  2ERB A;  3K1E A;  2JPO A;  1OOH A;  3DY9 A;  2QEV A;  2WCH A;  3B6X A;  3S0F A;  3FE9 A;  1DQE A;  2WCM A;  3B87 A;  3DYE A;  3Q8I A;  1GM0 A;  1ORG A;  3CZ2 A;  3S0G A;  2WCK A;  3CZ0 A;  1TWO A;  3BFA A;  1OW4 A;  2QEB A;  3N7H A;  3R72 A;  3R1P A;  3BJH A;  3RZS A;  4JD9 A;  3NGV A;  3D73 A;  3QME A;  1TUJ A;  2WCL A;  2PQL A;  3R1V A;  2KPH A;  4F7F A;  3D77 A;  2QEO A;  3B88 A;  3CAB A;  2L2C A;  1P28 A;  1T14 A;  3NHT A;  1C3Z A;  3BFB A;  2H8V A;  3B7A A;  3D78 A;  1OOF A;  1OOI X;  3PJI A;  4OZD A;  2WC5 A;  4INW A;  3VB1 A;  5DIC A;  1LS8 A;  4FQT A;  2WCJ A;  3OGN A;  3FE8 A;  2GTE A;  3CDN A;  3S0B A;  3L4A A;  3S0A A;  3S0E A;  3FE6 A;  3DZT A;  3D76 A; 
#chains in the Genus database with same CATH topology
 2JT0 A;  4HRH A;  1R2U A;  1TNX A;  2LP3 A;  2M7L A;  4DS7 A;  4IJ7 A;  1OMV A;  2JXL A;  2I7A A;  2JRF A;  3L47 A;  1DGU A;  2P70 A;  1CFC A;  1W7I B;  2M3W A;  2WC8 A;  4ETO A;  1JBA A;  3PM2 A;  1DTL A;  1TRF A;  4I5N B;  1OMR A;  3NXA A;  1C3Y A;  4WQ3 A;  3LK0 A;  1FPW A;  1SCV A;  1LKJ A;  2JWW A;  2LC5 A;  4DCK A;  2KHN A;  1B4C A;  4NQG A;  1QIV A;  1H8B A;  1OOG A;  3SG2 A;  5IBW A;  3C1V A;  1TOP A;  1XFX O;  1N2D A;  5CPV A;  2QDI A;  1VRK A;  1UUR A;  3OX6 A;  2OS8 B;  1W9Z A;  3DD4 A;  2K61 A;  4CFR A;  1BF5 A;  2ZN8 A;  1H4B A;  3TDZ A;  5FI2 A;  5HKW A;  3R1O A;  3IQQ A;  3OX5 A;  2BE6 A;  1B7T Y;  1DJZ A;  3K1E A;  2K2F A;  5ER4 X;  5K89 A;  2JPO A;  2M97 A;  1IG5 A;  1BMO A;  3PN7 B;  1MR8 A;  1MWN A;  1KQV A;  4DRW A;  2O5G A;  2JXC A;  2WCH A;  4MRX A;  1K95 A;  1QAT A;  1YX8 A;  1S36 A;  1B47 A;  4IL1 A;  1Q80 A;  4PDZ A;  1HT9 A;  2JU0 A;  3BUX B;  4PAL A;  3HCM A;  3VRP A;  2LAP A;  1RJV A;  2LCP A;  4YI9 A;  1GM0 A;  4QJ5 B;  2F2O A;  1ORG A;  3FWC A;  4MVF A;  2KLE A;  3SG4 A;  2BKH B;  1CM4 A;  2WCK A;  1UHK A;  3PFV A;  2KFF A;  4OCI A;  1A4P A;  3PLF B;  4MEW A;  3SIB A;  3I5F C;  3FWB A;  4NDC A;  2OS8 C;  3O4Y A;  1JWD A;  5AEQ A;  1DJH A;  1B8R A;  3JVT B;  2LNK A;  1UHN A;  1WRZ A;  1A75 B;  1U5I B;  1XFZ O;  4N1G A;  1ZMZ A;  2F3Y A;  2G9B A;  1B7T Z;  2QAC A;  1RTP 1;  2L51 A;  1PUL A;  3FIA A;  2E6W A;  3NSO A;  1WDC B;  2PQL A;  2GGZ A;  3R1V A;  1IQ5 A;  1SSE B;  2QPT A;  1V1F A;  2LMU A;  2COL B;  2QEO A;  2EC6 C;  2Y1N A;  2LVI A;  2MLF C;  2KGB C;  1JC2 A;  3KF9 A;  3NSI A;  1CDL A;  4U8D A;  2BL0 C;  1EG4 A;  1L2O C;  1IKU A;  1C3Z A;  1IWQ A;  1UHI A;  3TDI A;  3GK1 A;  2JNF A;  3D78 A;  4PHK A;  4XYN A;  4BY4 A;  4OZD A;  1AVS A;  2WC5 A;  4INW A;  1K9K A;  2F8P A;  2JOJ A;  4YBH B;  1TCF A;  1MUX A;  2FOT A;  3JVT C;  4GUK A;  5DIC A;  3TDU A;  3UNW A;  1CLM A;  2Y1M A;  2BCA A;  3BOW B;  1ZOT B;  2BEC A;  1NYA A;  3OGN A;  3CR4 X;  2JTT A;  2Q91 A;  3DF0 B;  1QJT A;  4C0L A;  4OVN F;  1RWY A;  2K7C A;  1NIW A;  2AMI A;  3S0B A;  2HET A;  4AOM A;  3VRQ A;  3S0A A;  1WDC C;  1QS7 A;  2JTZ A;  2YGU A;  4OR9 B;  3S0D A;  1XFU O;  1CDM A;  1G4Y R;  1KWO C;  2KI6 C;  1M46 A;  1XO5 A;  2WCF A;  3D0Y A;  4GBA A;  2LVK A;  4L9M A;  3WXA A;  1XFR A;  1GJY A;  1K9U A;  4PT1 A;  4MRY A;  5HL1 A;  1EL4 A;  1QX5 B;  3CTN A;  2QEH A;  4BY5 A;  2PAL A;  1F70 A;  1K93 D;  5KTY A;  2WOS A;  1NCY A;  3EVR A;  1QIW A;  1MHO A;  4AQJ A;  1N0Y A;  1GGW A;  2ZRS A;  2SCP A;  1FF1 A;  4F0Z B;  2ZRT A;  3PSR A;  1B1G A;  2VRG A;  3D74 A;  4TNC A;  3E3R A;  3M0W A;  1DGV A;  2LUX A;  4PE1 A;  4YGC B;  3TUY B;  3CZ1 A;  1KFX S;  1OMD A;  3O4X A;  1MF8 B;  2LVJ A;  2KBI A;  2BE4 A;  4GAO A;  3GK2 A;  5KSZ A;  1K94 A;  1OQP A;  2O60 A;  1IJ6 A;  3OB1 B;  2FJY A;  5PAL A;  2ERB A;  4XJK A;  5HLV A;  4QJ4 B;  4ORC B;  3VRR A;  1M45 A;  5I2Q A;  1LA3 A;  1TNQ A;  1K9P A;  5GQQ C;  3LK1 A;  1G33 A;  1M39 A;  2KFH A;  1KCY A;  1EG3 A;  1UP5 A;  3FS7 A;  4JQ0 D;  2KYF A;  1OZO A;  3S0F A;  3QRX A;  1TIZ A;  1QV0 A;  1J55 A;  1DEK A;  2LLU A;  1FI5 A;  2EGD A;  1DQE A;  1QVI Y;  4Q04 A;  4YGB B;  4C0J A;  1AHR A;  2HQW A;  1SL9 A;  3Q8I A;  3CS1 A;  3CLN A;  3VRO A;  1SR6 C;  1ZAC A;  4JKT A;  5I2L A;  3TUY C;  5DKQ A;  4NDB A;  2WOR A;  3I5F B;  3KHE A;  2LE9 B;  2Q4U A;  3SS4 A;  3CZ0 A;  1NP8 A;  2RGI A;  2PYQ A;  1KFU S;  3NSK A;  1CKK A;  1KSM A;  2KNE A;  2V53 A;  5CSF A;  3BFA A;  1OW4 A;  1WRK A;  1NCZ A;  2QEB A;  3SG3 A;  1OZS A;  5F6T A;  2ZFD A;  2I2R E;  2KI6 D;  3R72 A;  2KQ6 A;  5I2O A;  1DJX A;  1SBJ A;  4FQO A;  2AAO A;  3OHM B;  1DF0 A;  4ZCU A;  3JTD C;  5TNC A;  1A03 A;  2CBL A;  2NCP A;  5D3O A;  3D73 A;  1DT7 B;  2E30 A;  1S1E A;  1TUJ A;  4P2Y B;  1J7Q A;  4DIR A;  2HPS A;  3PAT A;  2EC6 B;  2JT3 A;  3BUN B;  4M2Q A;  2ISD A;  3I5H C;  2NXQ A;  3WHT B;  1SCM B;  1ODB A;  3O78 A;  1JFK A;  2BBM A;  3D10 A;  4YRU A;  2BL0 B;  1B8C A;  1P28 A;  1L2O B;  1XYD A;  1WY9 A;  1SRA A;  2D8N A;  2TN4 A;  3AAK A;  3O6B A;  4JPZ B;  5AXI A;  1JSA A;  1Y6W A;  3MSE B;  1K8U A;  1M63 B;  2L50 A;  1QVI Z;  4I5K A;  3BFB A;  1LVC D;  1DJI A;  1NX3 A;  1WRL A;  2A4J A;  3SS3 A;  5JOL A;  4A4B A;  4P5O E;  1BOC A;  1K2H A;  1AP4 A;  1OOI X;  2OTG B;  2F3Z A;  2M0R A;  4GNK B;  1DMO A;  1K96 A;  1NCX A;  2KAX A;  1DJW A;  1R6P A;  3AAJ A;  4KYN A;  1OOJ A;  3O2P A;  5AFP A;  3EVU A;  1QX2 A;  3CGA A;  1TN4 A;  3AKA A;  1OE9 B;  3DVM A;  4NDD A;  4CFQ A;  5CSN A;  1QAS A;  3CWG A;  4FTG A;  3SG7 A;  2GTE A;  1J1D A;  1YUU A;  2CXJ A;  1KWO B;  1F55 A;  1EH2 A;  1XVJ A;  3FE6 A;  3DZT A;  3CZT X;  3I5G C;  2B1U A;  1YRU B;  3D76 A;  4AQI A;  4GPL B;  1Y1X A;  2BBN A;  1A2X A;  1SCM C;  3DXL A;  2KYC A;  3PM8 A;  2WC6 A;  3KO0 A;  5AER A;  2LAN A;  5EL2 A;  2WND A;  1DJY A;  4WRI A;  2L2E A;  1S26 D;  2KDH A;  4PE7 A;  5FYX A;  3CYZ A;  5B8I B;  2M7N A;  5FI6 A;  2OTG C;  1JF0 A;  2CNP A;  1FW4 A;  1TCO B;  2G2B A;  4R1E A;  3A4U B;  2BNX A;  2M49 B;  1NX1 A;  2PVB A;  2Y5I A;  1CFF A;  2K2A A;  1CB1 A;  1NUB A;  2ZNE A;  1TTX A;  2JUL A;  1X02 A;  3I5I B;  1CDP A;  1UUS A;  5AAN A;  1Y1A A;  2GGM A;  1PVB A;  2BAP A;  1ALV A;  1ZUZ A;  1EXR A;  3V2L A;  1PRW A;  1UHH A;  1BT6 A;  2JT8 A;  1YUT A;  3OB2 B;  1J7O A;  1AUI B;  2JPT A;  3SS5 A;  3EKH A;  1C07 A;  4YGE B;  3F45 A;  5G08 A;  2L5Y A;  2R2I A;  1OOH A;  3TS5 C;  4I5L B;  3SG5 A;  1PSB A;  1QXP A;  2K0J A;  2L98 A;  3DY9 A;  2QEV A;  1S6J A;  3B6X A;  3PAL A;  3SG6 A;  2F33 A;  1KK8 B;  1TNW A;  2L4I A;  2P6B B;  3CR2 A;  2KBM A;  5I94 A;  1XA5 A;  1YUR A;  2K7O A;  3FE9 A;  1S5G Z;  3D0Y B;  3EK8 A;  1SR6 B;  1XFY O;  2FJU B;  1K90 D;  2LHL A;  2WCM A;  4M2O A;  4ZCV A;  5HKY A;  1CFP A;  2K60 A;  4CLN A;  4MN0 A;  1TNP A;  1Y1U A;  3UO9 A;  2L0P A;  3AKB A;  3ZNI A;  4C0K A;  1HQV A;  1QTX A;  2CTN A;  2MJW B;  2SAS A;  2WCE A;  3RLZ A;  3I5I C;  2BCX A;  2JZI A;  1NX0 A;  1JUO A;  3SIA A;  1CMF A;  1QLK A;  1WLM A;  3N7H A;  1N65 A;  1PSR A;  2KI4 C;  3JTD B;  3R1P A;  5I8N A;  4DUQ A;  4N5X A;  5D69 A;  2M1U A;  4WQ2 A;  1D1O A;  2FCD A;  3EG5 B;  3H4S E;  3IQO A;  1SMG A;  1KK7 Z;  1XK4 A;  4JD9 A;  5D7F A;  1F54 A;  1QLS A;  1CTR A;  1CLB A;  2LP2 A;  1SPY A;  1JF2 A;  2LV7 A;  2WCL A;  3I5H B;  1BLQ A;  2PSR A;  2DOQ A;  2F2P A;  2KPH A;  2HQ8 A;  3KEV A;  4ORB B;  1KK8 C;  1NSH A;  1MXE A;  4PE0 A;  2MBX A;  5HYD A;  3D77 A;  2MLE C;  1BOD A;  4CPV A;  2LM5 A;  1B9A A;  4XJK B;  4PE4 A;  1TUZ A;  2L2C A;  2LLT A;  1YTZ C;  2MHH A;  1B8L A;  1SW8 A;  2ZND A;  1S6C A;  1T14 A;  1UHJ A;  2ZN9 A;  3NHT A;  2LHI A;  3BYA A;  1RRO A;  2H8V A;  1ALW A;  5JJG A;  5KU1 A;  4E68 A;  2IS9 A;  4JWQ A;  3PJI A;  1BG1 A;  4MLW A;  1OSA A;  2CCM A;  1SNL A;  4PHJ A;  1Y0V H;  1SK6 D;  3DVK A;  1LS8 A;  4FQT A;  1J7R A;  4A4C A;  1KFX L;  1F8H A;  5FI7 A;  2I18 A;  4OKH A;  1BJF A;  4YI8 A;  3FE8 A;  4QJ3 B;  4PHN A;  1S6I A;  3CDN A;  3I5G B;  1LIN A;  2KGR A;  3L4A A;  2KOT A;  3BQ3 A;  1F4Q A;  3S0E A;  1Z4H A;  1YX7 A;  1IGV A;  3WNX B;  4MBE A;  1CNP A;  3L4L A;  3BFH A;  3GOF A;  1NX2 A;  2NZ0 A;  3WHU B;  1Z2C B;  4N1F A;  2M1K B;  5DKR A;  1QWV A;  2MRD A;  2H61 A;  1DF0 B;  3ZWH A;  1CFD A;  2GV5 A;  2M9G A;  3OBV A;  1BR1 B;  1J1E A;  2L5X B;  2K7B A;  3LL8 B;  2NLN A;  3NHI A;  1IQ3 A;  3DVE A;  1C7V A;  1JFJ A;  1XK4 C;  1DJG A;  2KFG A;  1IH0 A;  1EJ3 A;  3EK4 A;  2PMY A;  1FBV A;  4PHM A;  4ORA B;  1ZFS A;  1DC1 A;  1CDN A;  4INX A;  3HX4 A;  5DKN A;  1REC A;  2LMT A;  1A75 A;  1U5I A;  5HLO A;  1IJ5 A;  5J3X A;  2PAS A;  1S3P A;  2Y4Q A;  4MSP A;  2EHB A;  1RFJ A;  1KFU L;  4PCW A;  1LA0 A;  3LCP C;  3D75 A;  1DVI A;  2NCO A;  1J7P A;  1YVH A;  2P71 A;  1AJ4 A;  3B86 A;  1LXF C;  3SJS A;  3VGO A;  3K21 A;  1NPQ A;  2FCE A;  4HRG A;  1YVL A;  1YUS A;  5CSI A;  1AJ5 A;  3TS5 B;  4GGF A;  1S5G Y;  1XFV O;  1BR4 B;  4YGD B;  3PN7 C;  3EK7 A;  1DEL A;  2JNX A;  3IVT A;  4CID A;  4D1E A;  4YGA A;  3BUW B;  3RM1 A;  1FI6 A;  1KQM B;  1PVA A;  3KPX A;  4GGN A;  1IRJ A;  5HKZ A;  4OV2 A;  3TZ1 A;  4MZK A;  3B87 A;  3DYE A;  2PRU A;  3BOW A;  3NSL A;  5BPJ A;  3CZ2 A;  3EKJ A;  1IIO A;  3DF0 A;  2JC2 A;  2H61 C;  3S0G A;  2HF5 A;  2KLD A;  2MA2 A;  1YRT B;  2ZKM X;  4GFT A;  1PAL A;  2BKI B;  1A29 A;  1W7J B;  1TWO A;  2KI4 B;  1KK7 Y;  1F71 A;  4USL A;  2LUC A;  3EVV A;  1GGZ A;  3LLE A;  3BJH A;  1RK9 A;  1SL7 A;  2LMV A;  4UPG A;  1SKT A;  3RZS A;  4ICB A;  1BU3 A;  2H2K A;  3NGV A;  1SYM A;  3GK4 X;  2KAV A;  2K7D A;  2BCB A;  3QME A;  3ICB A;  1E8A A;  2KAY A;  4I5J A;  4HSZ A;  1CMG A;  2CT9 A;  1PK0 D;  4MZJ A;  2LVV A;  4F7F A;  1NWD A;  2I94 A;  2KQY A;  1KQM C;  2MAZ A;  3B88 A;  5ER5 A;  3CAB A;  1QV1 A;  2KSP A;  1XFW O;  2M29 A;  1G8I A;  5CSJ A;  1UWO A;  2OPO A;  2K8M B;  2WCB A;  1YR5 A;  4MZL A;  2AUC A;  3A8R A;  4GGF C;  3B7A A;  3BUM B;  1WLZ A;  4HRE E;  2M8U A;  4M2P A;  1OOF A;  1V1G A;  1C7W A;  1M31 A;  3BUO B;  3BXK A;  3IF7 A;  1MXL C;  1CLL A;  3CR5 X;  1GQM A;  3VB1 A;  1SY9 A;  2WCJ A;  1L7Z A;  3OP0 A;  1F4O A;  3VRN A;  2L4H A;  1QX7 A;  2LLS A;  1CM1 A;  1SL8 A;  1MQ1 A;  1KSO A;  3DVJ A;  2JQ6 A;  1AK8 A; 
#chains in the Genus database with same CATH homology
 3S0D A;  3L4L A;  3BFH A;  3DXL A;  3L47 A;  1QWV A;  1XFR A;  2P70 A;  4PT1 A;  2WC6 A;  5EL2 A;  2QEH A;  3NHI A;  3CYZ A;  1C3Y A;  4INX A;  3D74 A;  1OOG A;  3CZ1 A;  2QDI A;  3D75 A;  3V2L A;  2P71 A;  3B86 A;  3R1O A;  2FJY A;  2ERB A;  3K1E A;  2JPO A;  1OOH A;  3DY9 A;  2QEV A;  2WCH A;  3B6X A;  3S0F A;  3FE9 A;  1DQE A;  2WCM A;  3B87 A;  3DYE A;  3Q8I A;  1GM0 A;  1ORG A;  3CZ2 A;  3S0G A;  2WCK A;  3CZ0 A;  1TWO A;  3BFA A;  1OW4 A;  2QEB A;  3N7H A;  3R72 A;  3R1P A;  3BJH A;  3RZS A;  4JD9 A;  3NGV A;  3D73 A;  3QME A;  1TUJ A;  2WCL A;  2PQL A;  3R1V A;  2KPH A;  4F7F A;  3D77 A;  2QEO A;  3B88 A;  3CAB A;  2L2C A;  1P28 A;  1T14 A;  3NHT A;  1C3Z A;  3BFB A;  2H8V A;  3B7A A;  3D78 A;  1OOF A;  1OOI X;  3PJI A;  4OZD A;  2WC5 A;  4INW A;  3VB1 A;  5DIC A;  1LS8 A;  4FQT A;  2WCJ A;  3OGN A;  3FE8 A;  2GTE A;  3CDN A;  3S0B A;  3L4A A;  3S0A A;  3S0E A;  3FE6 A;  3DZT A;  3D76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...