1KK8B

Scallop myosin (s1-adp-befx) in the actin-detached conformation
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
139
structure length
139
Chain Sequence
PQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin Heavy Chain, Striated muscle
publication title Crystallographic findings on the internally uncoupled and near-rigor states of myosin: further insights into the mechanics of the motor.
pubmed doi rcsb
molecule tags Contractile protein
total genus 34
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2001-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kk8B01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kk8B02
2MRDA 1DF0B 2JRFA 3I5HB 1SR6C 1UUSA 1A03A 1XFWO 2KI4B 4MN0A 1NUBA 3RLZA 4AOMA 1TNPA 3TUYC 1YR5A 1DJZA 1UHNA 3EVVA 1U5IB 1A75B 2LP3A 3PSRA 4PDZA 4YI9A 2KBMA 1QX7A 2M0RA 2JPTA 1EG3A 3EVRA 2SASA 3D0YA 4ORAB 2K7BA 1QV1A 3BOWB 3PLFB 1J7RA 2HETA 4PCWA 1FW4A 2HQ8A 1CB1A 2BE4A 1BOCA 1TNXA 3CGAA 3KEVA 1FF1A 3EK7A 4YI8A 1NCZA 1QVIY 4D1EA 1AK8A 1M46A 4ICBA 2L51A 2WC8A 4YGDB 1L2OC 2KI6C 1HQVA 3I5FC 2G9BA 2EHBA 3OX6A 1CMFA 4AQJA 1CDLA 1KK8B 5HLVA 1Q80A 4GPLB 4MLWA 1WDCB 2LUXA 4N1GA 2BE6A 1WRZA 3WHUB 1UURA 1DTLA 1NX0A 2JT0A 1QTXA 3CLNA 1ALVA 2OS8C 5I8NA 1QVIZ 3IQQA 2O5GA 4PHJA 1FI5A 1S5GY 1CKKA 1KSOA 4AQIA 1YRTB 2LHIA 3GOFA 1TCOB 1ZACA 2H61A 1XFYO 3NSLA 4GNKB 3DD4A 2V53A 3DVKA 4YGCB 1IH0A 1G8IA 2OTGB 3PM8A 4C0KA 2E6WA 2LAPA 3QRXA 1X02A 2BKHB 2LVVA 3SJSA 1DMOA 2MLEC 4MBEA 1J7PA 3EK8A 5DKNA 1N65A 3A8RA 1YURA 3BXKA 1S5GZ 1TIZA 5GQQC 4PE1A 4BY4A 4QJ3B 5F6TA 2ZNEA 1JF2A 3PATA 2D8NA 1CFPA 2ZN8A 5PALA 2LVKA 1WRLA 1YUTA 2PRUA 2KFFA 1A2XA 2KQYA 2LMVA 1A4PA 1QJTA 3SG2A 4NDBA 2NZ0A 4JPZB 3GK4X 1S26D 1V1GA 3I5HC 3SIBA 3TZ1A 2MBXA 1CDMA 5I2QA 2KYCA 2WNDA 2M29A 3PFVA 2KOTA 1KSMA 4YBHB 1N2DA 1G33A 1ZFSA 3GK2A 1MR8A 1QIWA 1PALA 2BCXA 2K8MB 1JC2A 1B9AA 4F0ZB 2K2FA 2PALA 3CWGA 2OPOA 3I5IB 2KYFA 4MVFA 3BQ3A 3O2PA 1YX8A 1IQ5A 1S6JA 1OMRA 2L2EA 5AEQA 2O60A 1RROA 1OMVA 5AERA 5KTYA 4OV2A 1XFXO 1QXPA 2Y5IA 5G08A 1IWQA 1DGUA 3RM1A 4MZLA 2BKIB 4M2QA 4GAOA 1N0YA 1B8LA 1KK8C 2SCPA 4ORCB 1WDCC 5JJGA 3TDIA 1EJ3A 2BBMA 1DJHA 1JSAA 5BPJA 1KFUS 1LINA 2NCOA 1DJIA 4C0JA 1BF5A 2AAOA 1J55A 1EL4A 1ZUZA 1SCMB 3OX5A 2LUCA 3DVJA 1YVHA 3LL8B 3NSIA 2FOTA 5AANA 1WLZA 3OB1B 1MQ1A 1FBVA 1SL8A 3H4SE 1JFJA 1XFUO 2F3YA 3GK1A 2Y4QA 1MF8B 4CPVA 3FWBA 4Q04A 4U8DA 1DJXA 2KAYA 1CFFA 1NCYA 1QLKA 4GGFC 2P6BB 2CTNA 3A4UB 3AAJA 4HRGA 4M2OA 1NYAA 1LA0A 4PE7A 2ISDA 2M7LA 3O78A 1B4CA 1OZOA 1KQMB 1F54A 2LHLA 1MXLC 1NWDA 2DOQA 1AJ4A 2LLTA 3IF7A 1SL9A 4OKHA 1KCYA 2PVBA 3EKJA 3I5GB 1M63B 4OCIA 1HT9A 2BECA 2M1KB 3D0YB 4XYNA 3CZTX 4I5NB 3MSEB 4ETOA 5CSIA 1CLBA 2MA2A 4E68A 1GJYA 5CSFA 4MEWA 4XJKA 1EG4A 1S36A 1B8CA 4N5XA 2JXCA 2A4JA 1F70A 2M97A 5HKYA 1DF0A 2BL0B 4CIDA 4L9MA 1WLMA 1IQ3A 4I5KA 2E30A 2CNPA 4JQ0D 1GGWA 5JOLA 1NPQA 1KWOB 2M9GA 1SCVA 4I5JA 2VRGA 1FPWA 2LC5A 2AMIA 1DT7B 5I2LA 3BOWA 1Y1XA 1ZMZA 1M45A 4YGBB 1JWDA 1IRJA 1YVLA 2F8PA 2KNEA 4HSZA 4DRWA 5AXIA 3WHTB 1XYDA 2KGRA 4M2PA 1OMDA 1KFXS 5ER5A 2Y1MA 1UP5A 1YUSA 3TS5B 2KSPA 2KHNA 2M1UA 1F8HA 1QX2A 2L0PA 2K7CA 3ICBA 2MHHA 1F55A 1XK4C 1Y1AA 1R6PA 3JVTC 2L50A 3BUNB 1SL7A 2JU0A 2EC6B 1M31A 2LLSA 4MSPA 5IBWA 4OR9B 1PRWA 3ZNIA 2ZN9A 2KI6D 5DKRA 3JTDB 1NCXA 1KFUL 3KHEA 3WXAA 4YGAA 1B7TY 2F2PA 3DF0B 2KDHA 1CLMA 3K21A 1QS7A 2JULA 2LP2A 2RGIA 4GGFA 2IS9A 3FWCA 3SG3A 3AKAA 1SR6B 4MZJA 2KI4C 3CR5X 4CFQA 1NIWA 1TTXA 2I18A 1KQMC 1DJGA 2LV7A 3BUWB 1A29A 3D10A 1SMGA 5HLOA 4DS7A 5HKWA 3I5GC 2COLB 1B8RA 3TDUA 1KK7Y 1PVAA 2JXLA 2HQWA 1K9PA 2KBIA 3OP0A 4JWQA 1D1OA 3DVEA 1BMOA 2QPTA 1BT6A 2L4HA 1OSAA 1G4YR 3VRQA 3NSKA 1J7QA 1TNWA 1GGZA 1YTZC 5K89A 1PSBA 1QASA 1S1EA 2CBLA 3I5FB 1S6CA 2JTTA 1KK7Z 3CR4X 1LKJA 4A4CA 3CTNA 4QJ5B 2M7NA 1FI6A 1M39A 3KF9A 1IJ5A 1YUUA 2LANA 3EKHA 4FQOA 2GGZA 2OS8B 2ZNDA 4OVNF 1IG5A 2QACA 2Y1NA 1B47A 4QJ4B 2LVJA 4BY5A 4C0LA 1UHJA 1PK0D 1BLQA 2KAXA 5D69A 3E3RA 2OTGC 2R2IA 1IJ6A 3NXAA 1CLLA 1WRKA 2PASA 2NLNA 2MAZA 5CSJA 1KFXL 1XK4A 1QATA 2HF5A 4MRYA 2GGMA 4DCKA 5KSZA 4DIRA 2EC6C 1OZSA 3VGOA 1DVIA 1PSRA 1QX5B 3KPXA 5DKQA 2M49B 1EH2A 1UHHA 1SK6D 3JTDC 1JF0A 4IL1A 5HYDA 1BR1B 1C7VA 4GBAA 1AJ5A 1DGVA 4USLA 4XJKB 5HKZA 1CFCA 3O4YA 2JT8A 1CDNA 1UHKA 2JOJA 1TN4A 1SY9A 2KAVA 1MWNA 1ZOTB 2MJWB 3VROA 1MHOA 4CLNA 3OHMB 4HREE 4ORBB 4UPGA 5KU1A 3PALA 1B1GA 2JNFA 4CFRA 2LVIA 1NX2A 1K94A 1RJVA 2K2AA 2WCBA 4A4BA 5CPVA 1CDPA 2ZFDA 5FYXA 1OOJA 4MZKA 3LK1A 1U5IA 1A75A 2B1UA 1Y0VH 2FJUB 3SIAA 4PE4A 1C07A 2BCBA 2KFGA 1K93D 2M8UA 2LMTA 1JBAA 2CXJA 1MUXA 2I2RE 3I5IC 2KGBC 1CTRA 3AKBA 2JNXA 2HPSA 1DJYA 3C1VA 1OQPA 2LNKA 1F4OA 1YX7A 3EK4A 3KO0A 1K8UA 2LM5A 1R2UA 3IQOA 1KQVA 1V1FA 3PN7B 1J7OA 4FTGA 3BYAA 5ER4X 5B8IB 1S3PA 1QLSA 2LE9B 3ZWHA 4ZCUA 1RTP1 1BU3A 2LLUA 3SG4A 2I94A 1K9KA 1K90D 1SW8A 2JQ6A 4NDDA 1CMGA 1XVJA 1SCMC 1GQMA 2GV5A 5I2OA 1QV0A 2KQ6A 2I7AA 1XFVO 2FCEA 4P2YB 2KFHA 3M0WA 1TRFA 2G2BA 1F71A 1BR4B 2FCDA 1SNLA 1IKUA 1SRAA 4HRHA 1TCFA 3FIAA 2CCMA 5TNCA 1LA3A 4P5OE 1C7WA 1CM1A 1BJFA 3BUXB 2K0JA 4R1EA 2WCFA 1TOPA 2L5XB 2M3WA 3O6BA 5J3XA 4PALA 2JZIA 3AAKA 3TUYB 1NSHA 4WRIA 1JUOA 1SKTA 2K61A 3TDZA 2Q91A 1MXEA 1WY9A 1VRKA 2CT9A 1RECA 1XA5A 3HX4A 2L98A 3DVMA 2Q4UA 1B7TZ 1ALWA 1JFKA 1UHIA 2K7OA 1RK9A 4YRUA 1OE9B 1LVCD 3NSOA 1H8BA 1AVSA 3DF0A 2BCAA 3LCPC 4PHNA 2LMUA 1RFJA 1H4BA 2LCPA 3FS7A 2EGDA 2BL0C 4ZCVA 1Y6WA 3LLEA 1AHRA 1L2OB 2PSRA 3VRPA 3SG5A 1SPYA 1CNPA 2JT3A 1J1EA 2K7DA 1XO5A 4WQ3A 2JC2A 2H2KA 3CR2A 1S6IA 3VRNA 1KWOC 1EXRA 1IGVA 2MLFC 1BG1A 4PHMA 1E8AA 1RWYA 1K9UA 2JTZA 2JWWA 3CS1A 1NP8A 1L7ZA 1Y1UA 2WORA 4PE0A 1W7IB 2F3ZA 2ZRTA 2ZRSA 4GFTA 1YRUB 3SG6A 5CSNA 3WNXB 4YGEB 1TNQA 1DJWA 2ZKMX 1SBJA 1LXFC 1XFZO 2H61C 4PHKA 5D7FA 2TN4A 2F33A 1CFDA 1ODBA 3PN7C 4NQGA 3SG7A 1SYMA 3TS5C 4WQ2A 2BBNA 4N1FA 1NX3A 4I5LB 4DUQA 2AUCA 3BUMB 2L4IA 3BUOB 3OB2B 1CM4A 4GGNA 1PULA 1QIVA 3JVTB 4TNCA 1K95A 1AP4A 1BODA 4NDCA 3LK0A 1K96A 1NX1A 2NCPA 2NXQA 3EVUA 5AFPA 1PVBA 1UWOA 3F45A 2PMYA 4MRXA 3VRRA 1F4QA 1W7JB 2WCEA 1AUIB 1J1DA 4GUKA 2WOSA 3HCMA 2F2OA 1K2HA
chains in the Genus database with same CATH superfamily
2MRDA 1DF0B 2JRFA 3I5HB 1SR6C 1UUSA 2BAPA 3DYEA 3K1EA 1XFWO 3CDNA 3D78A 1A03A 2KI4B 4MN0A 1NUBA 3RLZA 4AOMA 1TNPA 3TUYC 1YR5A 1DJZA 2GTEA 1UHNA 2QEVA 3EVVA 1U5IB 1A75B 2LP3A 3PSRA 4PDZA 4YI9A 2KBMA 1QX7A 1OOFA 2M0RA 2JPTA 1EG3A 3EVRA 2SASA 3D0YA 4ORAB 2K7BA 3B88A 1QV1A 3BOWB 3PLFB 1J7RA 2HETA 4PCWA 1FW4A 2HQ8A 1CB1A 2BE4A 4INXA 3V2LA 1BOCA 1TNXA 3CGAA 3KEVA 3S0FA 1FF1A 3EK7A 4YI8A 1NCZA 1QVIY 4D1EA 3PJIA 1AK8A 1M46A 4ICBA 2L51A 2WC8A 4YGDB 1L2OC 2KI6C 3VB1A 1HQVA 3I5FC 2G9BA 2EHBA 3OX6A 2KPHA 1CMFA 4AQJA 2FJYA 1CDLA 1KK8B 5HLVA 1Q80A 4GPLB 3CZ0A 1WDCB 4MLWA 4INWA 2LUXA 4N1GA 2BE6A 1WRZA 3WHUB 1UURA 1DTLA 1NX0A 2JT0A 1QTXA 3CLNA 1ALVA 2OS8C 3R1PA 5I8NA 4PT1A 1QVIZ 3IQQA 2O5GA 4PHJA 1FI5A 1S5GY 1CKKA 1KSOA 4AQIA 1YRTB 2LHIA 3S0AA 1C3ZA 3GOFA 1TCOB 1ZACA 2H61A 1XFYO 3NSLA 3R1VA 3DD4A 3OBVA 4GNKB 2V53A 3DVKA 4YGCB 1IH0A 1G8IA 2OTGB 3PM8A 4C0KA 2E6WA 2LAPA 3QRXA 1X02A 2BKHB 2LVVA 3SJSA 3D73A 1DMOA 2MLEC 4MBEA 1J7PA 3EK8A 5DKNA 1N65A 3A8RA 1YURA 3BXKA 1S5GZ 1TIZA 5GQQC 4PE1A 4BY4A 4QJ3B 5F6TA 2ZNEA 1JF2A 3PATA 2D8NA 1CFPA 3DY9A 2ZN8A 5PALA 2LVKA 1WRLA 1YUTA 2PRUA 2KFFA 1A2XA 2KQYA 2LMVA 3SS3A 1A4PA 1QJTA 3SG2A 4NDBA 2NZ0A 4JPZB 3GK4X 1S26D 1V1GA 3I5HC 3SIBA 3TZ1A 2MBXA 1CDMA 5I2QA 2KYCA 2WNDA 2M29A 3PFVA 3L4LA 1IIOA 2KOTA 1KSMA 4YBHB 1N2DA 1G33A 1ZFSA 3GK2A 3O4XA 1MR8A 1QIWA 1PALA 2BCXA 2K8MB 1JC2A 1B9AA 4F0ZB 2K2FA 3PM2A 4OZDA 2PALA 3CWGA 2OPOA 3I5IB 1P28A 2KYFA 3CZ2A 4MVFA 3BQ3A 3O2PA 1YX8A 1IQ5A 1S6JA 1OMRA 2L2EA 5AEQA 2O60A 1RROA 1OMVA 5AERA 5KTYA 4OV2A 1XFXO 1QXPA 2Y5IA 4JKTA 1SSEB 5G08A 1IWQA 1DGUA 3RM1A 4MZLA 1OOIX 2BKIB 4M2QA 4GAOA 1N0YA 1B8LA 1KK8C 2SCPA 4ORCB 1WDCC 3R1OA 5JJGA 3TDIA 1EJ3A 2BBMA 1DJHA 1JSAA 5BPJA 1KFUS 1LINA 2NCOA 1DJIA 4C0JA 1BF5A 2AAOA 1J55A 1EL4A 1ZUZA 1SCMB 3OX5A 2LUCA 3DVJA 1YVHA 3LL8B 3NSIA 2FOTA 5EL2A 1WLZA 3OB1B 5AANA 3RZSA 1MQ1A 1FBVA 1SL8A 3H4SE 3S0DA 3NHIA 1XFUO 1JFJA 2F3YA 3GK1A 2Y4QA 1MF8B 4CPVA 3FWBA 4Q04A 4U8DA 1DJXA 2KAYA 1CFFA 1NCYA 1QLKA 3NGVA 4GGFC 2P6BB 2CTNA 1DQEA 3A4UB 3AAJA 4HRGA 1NYAA 1LA0A 4M2OA 4PE7A 2M7LA 3O78A 1B4CA 1OZOA 1KQMB 1F54A 2LHLA 1MXLC 1NWDA 2DOQA 1AJ4A 2LLTA 3IF7A 1SL9A 4OKHA 1KCYA 2PVBA 3EKJA 3I5GB 4F7FA 1M63B 4OCIA 1HT9A 2BECA 3S0EA 2M1KB 3D0YB 4XYNA 3CZTX 4I5NB 3MSEB 4ETOA 5CSIA 1CLBA 2MA2A 4E68A 1GJYA 5CSFA 2P70A 4MEWA 1EG4A 4XJKA 3DXLA 1W9ZA 1S36A 1B8CA 4N5XA 2JXCA 2A4JA 1F70A 3EG5B 2M97A 5HKYA 1DF0A 2BL0B 4CIDA 4L9MA 1WLMA 1IQ3A 4I5KA 5I94A 2ISDA 2E30A 2CNPA 4JQ0D 2PQLA 4IJ7A 1GGWA 1Z4HA 5JOLA 1NPQA 1KWOB 2M9GA 1SCVA 4I5JA 2VRGA 3BFBA 1FPWA 2LC5A 2AMIA 1DT7B 5I2LA 3BOWA 1Y1XA 1ZMZA 1M45A 3D76A 4YGBB 1JWDA 1IRJA 1YVLA 2F8PA 2KNEA 4HSZA 4DRWA 2WCLA 2P71A 5AXIA 3UNWA 3WHTB 1XYDA 2KGRA 3QMEA 4M2PA 1OMDA 1KFXS 5ER5A 2Y1MA 1UP5A 1YUSA 3TS5B 1ORGA 2KSPA 2KHNA 2M1UA 2WCJA 1F8HA 1QX2A 2L0PA 2K7CA 3ICBA 5FI2A 2MHHA 1F55A 1XK4C 1Y1AA 1R6PA 3JVTC 5FI7A 2L50A 3BUNB 1SL7A 2JU0A 2EC6B 3Q8IA 1M31A 2LLSA 4MSPA 5IBWA 4OR9B 1PRWA 3ZNIA 2ZN9A 2KI6D 3SS5A 5DKRA 3JTDB 1NCXA 1KFUL 2BNXA 3KHEA 3FE9A 3WXAA 4YGAA 1B7TY 2F2PA 3DF0B 2KDHA 2PYQA 1CLMA 3FE8A 3K21A 1QS7A 2JULA 2LP2A 2RGIA 4GGFA 2IS9A 3FWCA 3SG3A 3AKAA 1SR6B 4MZJA 2KI4C 3CR5X 4CFQA 1NIWA 1TTXA 2I18A 1KQMC 1DJGA 2LV7A 3BFHA 3BUWB 1A29A 3D10A 1SMGA 5HLOA 4DS7A 5HKWA 3I5GC 2COLB 1B8RA 3TDUA 1KK7Y 1PVAA 2JXLA 2HQWA 1K9PA 2KBIA 3OP0A 4JWQA 1D1OA 3D74A 3DVEA 1BMOA 2QPTA 2ERBA 3NHTA 1BT6A 2L4HA 1OSAA 3B7AA 1G4YR 3VRQA 3NSKA 1J7QA 3S0BA 1TNWA 1GGZA 1YTZC 5K89A 1PSBA 1QASA 1S1EA 2CBLA 3I5FB 1S6CA 4KYNA 2JTTA 1KK7Z 3CR4X 1LKJA 1DC1A 1GM0A 4A4CA 3IVTA 3CTNA 4QJ5B 3SS4A 2M7NA 1FI6A 2JPOA 1M39A 3KF9A 1IJ5A 3R72A 1YUUA 2LANA 2KLDA 3EKHA 2GGZA 2OS8B 2ZNDA 4FQOA 1IG5A 2QACA 4OVNF 2Y1NA 1B47A 4QJ4B 2LVJA 4BY5A 1TWOA 4C0LA 1OW4A 3L47A 1UHJA 1PK0D 2L5YA 1BLQA 1OOGA 2KAXA 5D69A 3E3RA 2OTGC 2QEOA 1IJ6A 2R2IA 3NXAA 1CLLA 1WRKA 2PASA 2NLNA 2YGUA 2MAZA 5CSJA 2WC5A 1KFXL 1XK4A 3BFAA 1QATA 2HF5A 4MRYA 2GGMA 4DCKA 5KSZA 4DIRA 2EC6C 1OZSA 3VGOA 1DVIA 1PSRA 1QX5B 3KPXA 3S0GA 5DKQA 2M49B 1EH2A 1UHHA 1SK6D 3JTDC 3L4AA 1JF0A 1LS8A 1DEKA 4IL1A 5D3OA 5HYDA 1BR1B 1C7VA 4GBAA 1AJ5A 1DGVA 4USLA 4XJKB 5HKZA 1CFCA 3O4YA 2JT8A 1CDNA 1UHKA 2JOJA 1TN4A 1SY9A 2KAVA 1MWNA 1ZOTB 2MJWB 3VROA 1MHOA 4CLNA 3OHMB 4HREE 4ORBB 4UPGA 5KU1A 3PALA 1B1GA 2JNFA 1OOHA 4FQTA 4CFRA 2LVIA 1NX2A 1K94A 1RJVA 2K2AA 2WCBA 3D75A 4A4BA 5CPVA 1CDPA 2ZFDA 5FYXA 1OOJA 4MZKA 3LK1A 1U5IA 1A75A 1Y0VH 2B1UA 2FJUB 3SIAA 4PE4A 1C07A 2BCBA 2KFGA 1K93D 2M8UA 2LMTA 1JBAA 2CXJA 2QEHA 1MUXA 2I2RE 3I5IC 2KGBC 1CTRA 3AKBA 2JNXA 2HPSA 1DJYA 3CABA 1TUZA 2WC6A 3C1VA 1OQPA 2LNKA 1F4OA 1YX7A 3EK4A 3KO0A 1K8UA 2LM5A 1R2UA 3CYZA 3IQOA 1TUJA 1KQVA 3N7HA 1V1FA 3PN7B 1J7OA 4FTGA 3BYAA 5ER4X 3FE6A 5B8IB 1S3PA 1QLSA 2LE9B 3ZWHA 2L2CA 1RTP1 4ZCUA 1BU3A 2LLUA 3SG4A 2I94A 1K9KA 1K90D 1SW8A 2JQ6A 4NDDA 1CMGA 1XVJA 4JD9A 3B87A 1SCMC 1GQMA 2GV5A 3UO9A 5I2OA 1QV0A 2KQ6A 2I7AA 1XFVO 2FCEA 4P2YB 2KFHA 3M0WA 1TRFA 2G2BA 1F71A 1BR4B 2FCDA 1SNLA 3CZ1A 1IKUA 1SRAA 4HRHA 1TCFA 3FIAA 2CCMA 5TNCA 1LA3A 4P5OE 1C7WA 1CM1A 1BJFA 3B6XA 2K0JA 3BUXB 4R1EA 2WCFA 1TOPA 2L5XB 2M3WA 1DELA 2QEBA 3O6BA 5J3XA 4PALA 2JZIA 3AAKA 3TUYB 1NSHA 4WRIA 1JUOA 1SKTA 2K61A 3TDZA 2Q91A 1MXEA 1WY9A 1VRKA 2CT9A 1RECA 1XA5A 3HX4A 2L98A 3DVMA 2Q4UA 1B7TZ 1ALWA 1JFKA 1UHIA 2K7OA 2QDIA 1RK9A 4YRUA 1OE9B 1LVCD 3NSOA 1H8BA 1AVSA 3DF0A 2BCAA 3LCPC 4PHNA 2LMUA 1RFJA 1H4BA 2LCPA 3FS7A 2EGDA 2BL0C 4ZCVA 1Y6WA 2H8VA 3LLEA 1AHRA 1L2OB 1QWVA 2PSRA 3VRPA 1C3YA 3SG5A 1SPYA 1CNPA 2JT3A 1J1EA 2K7DA 1XO5A 3BJHA 4WQ3A 2JC2A 2H2KA 3CR2A 1S6IA 3VRNA 1KWOC 1EXRA 1IGVA 2MLFC 1BG1A 4PHMA 1Z2CB 1E8AA 1XFRA 1RWYA 1K9UA 2JTZA 2JWWA 3CS1A 1NP8A 1L7ZA 1Y1UA 2WORA 3D77A 4PE0A 1W7IB 2F3ZA 2ZRTA 2ZRSA 4GFTA 1YRUB 3SG6A 5CSNA 3WNXB 4YGEB 1TNQA 5FI6A 1DJWA 2ZKMX 1SBJA 1LXFC 1XFZO 2H61C 4PHKA 5D7FA 2TN4A 2F33A 1CFDA 1ODBA 3PN7C 4NQGA 3SG7A 1SYMA 3TS5C 4WQ2A 2BBNA 5DICA 4N1FA 1NX3A 3B86A 4I5LB 4DUQA 2AUCA 3BUMB 2L4IA 3BUOB 3OB2B 1CM4A 2KLEA 4GGNA 1PULA 1QIVA 3JVTB 4TNCA 1K95A 1AP4A 1BODA 4NDCA 3LK0A 2WCKA 1K96A 1NX1A 2NCPA 2NXQA 3EVUA 2K60A 5AFPA 5HL1A 2WCMA 1PVBA 1UWOA 3F45A 2PMYA 4MRXA 3VRRA 1F4QA 1W7JB 2WCEA 1AUIB 1T14A 1J1DA 2WCHA 4GUKA 2WOSA 3DZTA 3OGNA 3HCMA 2F2OA 1K2HA
chains in the Genus database with same CATH topology
2MRDA 1DF0B 2JRFA 3I5HB 1SR6C 1UUSA 1A03A 1XFWO 2KI4B 4MN0A 1NUBA 3RLZA 4AOMA 1TNPA 3TUYC 1YR5A 1DJZA 1UHNA 3EVVA 1U5IB 1A75B 2LP3A 3PSRA 4PDZA 4YI9A 2KBMA 1QX7A 2M0RA 2JPTA 1EG3A 3EVRA 2SASA 3D0YA 4ORAB 2K7BA 1QV1A 3BOWB 3PLFB 1J7RA 2HETA 4PCWA 1FW4A 2HQ8A 1CB1A 2BE4A 1BOCA 1TNXA 3CGAA 3KEVA 1FF1A 3EK7A 4YI8A 1NCZA 1QVIY 4D1EA 1AK8A 1M46A 4ICBA 2L51A 2WC8A 4YGDB 1L2OC 2KI6C 1HQVA 3I5FC 2G9BA 2EHBA 3OX6A 1CMFA 4AQJA 1CDLA 1KK8B 5HLVA 1Q80A 4GPLB 4MLWA 1WDCB 2LUXA 4N1GA 2BE6A 1WRZA 3WHUB 1UURA 1DTLA 1NX0A 2JT0A 1QTXA 3CLNA 1ALVA 2OS8C 5I8NA 1QVIZ 3IQQA 2O5GA 4PHJA 1FI5A 1S5GY 1CKKA 1KSOA 4AQIA 1YRTB 2LHIA 3GOFA 1TCOB 1ZACA 2H61A 1XFYO 3NSLA 4GNKB 3DD4A 2V53A 3DVKA 4YGCB 1IH0A 1G8IA 2OTGB 3PM8A 4C0KA 2E6WA 2LAPA 3QRXA 1X02A 2BKHB 2LVVA 3SJSA 1DMOA 2MLEC 4MBEA 1J7PA 3EK8A 5DKNA 1N65A 3A8RA 1YURA 3BXKA 1S5GZ 1TIZA 5GQQC 4PE1A 4BY4A 4QJ3B 5F6TA 2ZNEA 1JF2A 3PATA 2D8NA 1CFPA 2ZN8A 5PALA 2LVKA 1WRLA 1YUTA 2PRUA 2KFFA 1A2XA 2KQYA 2LMVA 1A4PA 1QJTA 3SG2A 4NDBA 2NZ0A 4JPZB 3GK4X 1S26D 1V1GA 3I5HC 3SIBA 3TZ1A 2MBXA 1CDMA 5I2QA 2KYCA 2WNDA 2M29A 3PFVA 2KOTA 1KSMA 4YBHB 1N2DA 1G33A 1ZFSA 3GK2A 1MR8A 1QIWA 1PALA 2BCXA 2K8MB 1JC2A 1B9AA 4F0ZB 2K2FA 2PALA 3CWGA 2OPOA 3I5IB 2KYFA 4MVFA 3BQ3A 3O2PA 1YX8A 1IQ5A 1S6JA 1OMRA 2L2EA 5AEQA 2O60A 1RROA 1OMVA 5AERA 5KTYA 4OV2A 1XFXO 1QXPA 2Y5IA 5G08A 1IWQA 1DGUA 3RM1A 4MZLA 2BKIB 4M2QA 4GAOA 1N0YA 1B8LA 1KK8C 2SCPA 4ORCB 1WDCC 5JJGA 3TDIA 1EJ3A 2BBMA 1DJHA 1JSAA 5BPJA 1KFUS 1LINA 2NCOA 1DJIA 4C0JA 1BF5A 2AAOA 1J55A 1EL4A 1ZUZA 1SCMB 3OX5A 2LUCA 3DVJA 1YVHA 3LL8B 3NSIA 2FOTA 5AANA 1WLZA 3OB1B 1MQ1A 1FBVA 1SL8A 3H4SE 1JFJA 1XFUO 2F3YA 3GK1A 2Y4QA 1MF8B 4CPVA 3FWBA 4Q04A 4U8DA 1DJXA 2KAYA 1CFFA 1NCYA 1QLKA 4GGFC 2P6BB 2CTNA 3A4UB 3AAJA 4HRGA 4M2OA 1NYAA 1LA0A 4PE7A 2ISDA 2M7LA 3O78A 1B4CA 1OZOA 1KQMB 1F54A 2LHLA 1MXLC 1NWDA 2DOQA 1AJ4A 2LLTA 3IF7A 1SL9A 4OKHA 1KCYA 2PVBA 3EKJA 3I5GB 1M63B 4OCIA 1HT9A 2BECA 2M1KB 3D0YB 4XYNA 3CZTX 4I5NB 3MSEB 4ETOA 5CSIA 1CLBA 2MA2A 4E68A 1GJYA 5CSFA 4MEWA 4XJKA 1EG4A 1S36A 1B8CA 4N5XA 2JXCA 2A4JA 1F70A 2M97A 5HKYA 1DF0A 2BL0B 4CIDA 4L9MA 1WLMA 1IQ3A 4I5KA 2E30A 2CNPA 4JQ0D 1GGWA 5JOLA 1NPQA 1KWOB 2M9GA 1SCVA 4I5JA 2VRGA 1FPWA 2LC5A 2AMIA 1DT7B 5I2LA 3BOWA 1Y1XA 1ZMZA 1M45A 4YGBB 1JWDA 1IRJA 1YVLA 2F8PA 2KNEA 4HSZA 4DRWA 5AXIA 3WHTB 1XYDA 2KGRA 4M2PA 1OMDA 1KFXS 5ER5A 2Y1MA 1UP5A 1YUSA 3TS5B 2KSPA 2KHNA 2M1UA 1F8HA 1QX2A 2L0PA 2K7CA 3ICBA 2MHHA 1F55A 1XK4C 1Y1AA 1R6PA 3JVTC 2L50A 3BUNB 1SL7A 2JU0A 2EC6B 1M31A 2LLSA 4MSPA 5IBWA 4OR9B 1PRWA 3ZNIA 2ZN9A 2KI6D 5DKRA 3JTDB 1NCXA 1KFUL 3KHEA 3WXAA 4YGAA 1B7TY 2F2PA 3DF0B 2KDHA 1CLMA 3K21A 1QS7A 2JULA 2LP2A 2RGIA 4GGFA 2IS9A 3FWCA 3SG3A 3AKAA 1SR6B 4MZJA 2KI4C 3CR5X 4CFQA 1NIWA 1TTXA 2I18A 1KQMC 1DJGA 2LV7A 3BUWB 1A29A 3D10A 1SMGA 5HLOA 4DS7A 5HKWA 3I5GC 2COLB 1B8RA 3TDUA 1KK7Y 1PVAA 2JXLA 2HQWA 1K9PA 2KBIA 3OP0A 4JWQA 1D1OA 3DVEA 1BMOA 2QPTA 1BT6A 2L4HA 1OSAA 1G4YR 3VRQA 3NSKA 1J7QA 1TNWA 1GGZA 1YTZC 5K89A 1PSBA 1QASA 1S1EA 2CBLA 3I5FB 1S6CA 2JTTA 1KK7Z 3CR4X 1LKJA 4A4CA 3CTNA 4QJ5B 2M7NA 1FI6A 1M39A 3KF9A 1IJ5A 1YUUA 2LANA 3EKHA 4FQOA 2GGZA 2OS8B 2ZNDA 4OVNF 1IG5A 2QACA 2Y1NA 1B47A 4QJ4B 2LVJA 4BY5A 4C0LA 1UHJA 1PK0D 1BLQA 2KAXA 5D69A 3E3RA 2OTGC 2R2IA 1IJ6A 3NXAA 1CLLA 1WRKA 2PASA 2NLNA 2MAZA 5CSJA 1KFXL 1XK4A 1QATA 2HF5A 4MRYA 2GGMA 4DCKA 5KSZA 4DIRA 2EC6C 1OZSA 3VGOA 1DVIA 1PSRA 1QX5B 3KPXA 5DKQA 2M49B 1EH2A 1UHHA 1SK6D 3JTDC 1JF0A 4IL1A 5HYDA 1BR1B 1C7VA 4GBAA 1AJ5A 1DGVA 4USLA 4XJKB 5HKZA 1CFCA 3O4YA 2JT8A 1CDNA 1UHKA 2JOJA 1TN4A 1SY9A 2KAVA 1MWNA 1ZOTB 2MJWB 3VROA 1MHOA 4CLNA 3OHMB 4HREE 4ORBB 4UPGA 5KU1A 3PALA 1B1GA 2JNFA 4CFRA 2LVIA 1NX2A 1K94A 1RJVA 2K2AA 2WCBA 4A4BA 5CPVA 1CDPA 2ZFDA 5FYXA 1OOJA 4MZKA 3LK1A 1U5IA 1A75A 2B1UA 1Y0VH 2FJUB 3SIAA 4PE4A 1C07A 2BCBA 2KFGA 1K93D 2M8UA 2LMTA 1JBAA 2CXJA 1MUXA 2I2RE 3I5IC 2KGBC 1CTRA 3AKBA 2JNXA 2HPSA 1DJYA 3C1VA 1OQPA 2LNKA 1F4OA 1YX7A 3EK4A 3KO0A 1K8UA 2LM5A 1R2UA 3IQOA 1KQVA 1V1FA 3PN7B 1J7OA 4FTGA 3BYAA 5ER4X 5B8IB 1S3PA 1QLSA 2LE9B 3ZWHA 4ZCUA 1RTP1 1BU3A 2LLUA 3SG4A 2I94A 1K9KA 1K90D 1SW8A 2JQ6A 4NDDA 1CMGA 1XVJA 1SCMC 1GQMA 2GV5A 5I2OA 1QV0A 2KQ6A 2I7AA 1XFVO 2FCEA 4P2YB 2KFHA 3M0WA 1TRFA 2G2BA 1F71A 1BR4B 2FCDA 1SNLA 1IKUA 1SRAA 4HRHA 1TCFA 3FIAA 2CCMA 5TNCA 1LA3A 4P5OE 1C7WA 1CM1A 1BJFA 3BUXB 2K0JA 4R1EA 2WCFA 1TOPA 2L5XB 2M3WA 3O6BA 5J3XA 4PALA 2JZIA 3AAKA 3TUYB 1NSHA 4WRIA 1JUOA 1SKTA 2K61A 3TDZA 2Q91A 1MXEA 1WY9A 1VRKA 2CT9A 1RECA 1XA5A 3HX4A 2L98A 3DVMA 2Q4UA 1B7TZ 1ALWA 1JFKA 1UHIA 2K7OA 1RK9A 4YRUA 1OE9B 1LVCD 3NSOA 1H8BA 1AVSA 3DF0A 2BCAA 3LCPC 4PHNA 2LMUA 1RFJA 1H4BA 2LCPA 3FS7A 2EGDA 2BL0C 4ZCVA 1Y6WA 3LLEA 1AHRA 1L2OB 2PSRA 3VRPA 3SG5A 1SPYA 1CNPA 2JT3A 1J1EA 2K7DA 1XO5A 4WQ3A 2JC2A 2H2KA 3CR2A 1S6IA 3VRNA 1KWOC 1EXRA 1IGVA 2MLFC 1BG1A 4PHMA 1E8AA 1RWYA 1K9UA 2JTZA 2JWWA 3CS1A 1NP8A 1L7ZA 1Y1UA 2WORA 4PE0A 1W7IB 2F3ZA 2ZRTA 2ZRSA 4GFTA 1YRUB 3SG6A 5CSNA 3WNXB 4YGEB 1TNQA 1DJWA 2ZKMX 1SBJA 1LXFC 1XFZO 2H61C 4PHKA 5D7FA 2TN4A 2F33A 1CFDA 1ODBA 3PN7C 4NQGA 3SG7A 1SYMA 3TS5C 4WQ2A 2BBNA 4N1FA 1NX3A 4I5LB 4DUQA 2AUCA 3BUMB 2L4IA 3BUOB 3OB2B 1CM4A 4GGNA 1PULA 1QIVA 3JVTB 4TNCA 1K95A 1AP4A 1BODA 4NDCA 3LK0A 1K96A 1NX1A 2NCPA 2NXQA 3EVUA 5AFPA 1PVBA 1UWOA 3F45A 2PMYA 4MRXA 3VRRA 1F4QA 1W7JB 2WCEA 1AUIB 1J1DA 4GUKA 2WOSA 3HCMA 2F2OA 1K2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MRD A;  1DF0 B;  2JRF A;  3I5H B;  1SR6 C;  1UUS A;  1A03 A;  1XFW O;  2KI4 B;  4MN0 A;  1NUB A;  3RLZ A;  4AOM A;  1TNP A;  3TUY C;  1YR5 A;  1DJZ A;  1UHN A;  3EVV A;  1U5I B;  1A75 B;  2LP3 A;  3PSR A;  4PDZ A;  4YI9 A;  2KBM A;  1QX7 A;  2M0R A;  2JPT A;  1EG3 A;  3EVR A;  2SAS A;  3D0Y A;  4ORA B;  2K7B A;  1QV1 A;  3BOW B;  3PLF B;  1J7R A;  2HET A;  4PCW A;  1FW4 A;  2HQ8 A;  1CB1 A;  2BE4 A;  1BOC A;  1TNX A;  3CGA A;  3KEV A;  1FF1 A;  3EK7 A;  4YI8 A;  1NCZ A;  1QVI Y;  4D1E A;  1AK8 A;  1M46 A;  4ICB A;  2L51 A;  2WC8 A;  4YGD B;  1L2O C;  2KI6 C;  1HQV A;  3I5F C;  2G9B A;  2EHB A;  3OX6 A;  1CMF A;  4AQJ A;  1CDL A;  1KK8 B;  5HLV A;  1Q80 A;  4GPL B;  4MLW A;  1WDC B;  2LUX A;  4N1G A;  2BE6 A;  1WRZ A;  3WHU B;  1UUR A;  1DTL A;  1NX0 A;  2JT0 A;  1QTX A;  3CLN A;  1ALV A;  2OS8 C;  5I8N A;  1QVI Z;  3IQQ A;  2O5G A;  4PHJ A;  1FI5 A;  1S5G Y;  1CKK A;  1KSO A;  4AQI A;  1YRT B;  2LHI A;  3GOF A;  1TCO B;  1ZAC A;  2H61 A;  1XFY O;  3NSL A;  4GNK B;  3DD4 A;  2V53 A;  3DVK A;  4YGC B;  1IH0 A;  1G8I A;  2OTG B;  3PM8 A;  4C0K A;  2E6W A;  2LAP A;  3QRX A;  1X02 A;  2BKH B;  2LVV A;  3SJS A;  1DMO A;  2MLE C;  4MBE A;  1J7P A;  3EK8 A;  5DKN A;  1N65 A;  3A8R A;  1YUR A;  3BXK A;  1S5G Z;  1TIZ A;  5GQQ C;  4PE1 A;  4BY4 A;  4QJ3 B;  5F6T A;  2ZNE A;  1JF2 A;  3PAT A;  2D8N A;  1CFP A;  2ZN8 A;  5PAL A;  2LVK A;  1WRL A;  1YUT A;  2PRU A;  2KFF A;  1A2X A;  2KQY A;  2LMV A;  1A4P A;  1QJT A;  3SG2 A;  4NDB A;  2NZ0 A;  4JPZ B;  3GK4 X;  1S26 D;  1V1G A;  3I5H C;  3SIB A;  3TZ1 A;  2MBX A;  1CDM A;  5I2Q A;  2KYC A;  2WND A;  2M29 A;  3PFV A;  2KOT A;  1KSM A;  4YBH B;  1N2D A;  1G33 A;  1ZFS A;  3GK2 A;  1MR8 A;  1QIW A;  1PAL A;  2BCX A;  2K8M B;  1JC2 A;  1B9A A;  4F0Z B;  2K2F A;  2PAL A;  3CWG A;  2OPO A;  3I5I B;  2KYF A;  4MVF A;  3BQ3 A;  3O2P A;  1YX8 A;  1IQ5 A;  1S6J A;  1OMR A;  2L2E A;  5AEQ A;  2O60 A;  1RRO A;  1OMV A;  5AER A;  5KTY A;  4OV2 A;  1XFX O;  1QXP A;  2Y5I A;  5G08 A;  1IWQ A;  1DGU A;  3RM1 A;  4MZL A;  2BKI B;  4M2Q A;  4GAO A;  1N0Y A;  1B8L A;  1KK8 C;  2SCP A;  4ORC B;  1WDC C;  5JJG A;  3TDI A;  1EJ3 A;  2BBM A;  1DJH A;  1JSA A;  5BPJ A;  1KFU S;  1LIN A;  2NCO A;  1DJI A;  4C0J A;  1BF5 A;  2AAO A;  1J55 A;  1EL4 A;  1ZUZ A;  1SCM B;  3OX5 A;  2LUC A;  3DVJ A;  1YVH A;  3LL8 B;  3NSI A;  2FOT A;  5AAN A;  1WLZ A;  3OB1 B;  1MQ1 A;  1FBV A;  1SL8 A;  3H4S E;  1JFJ A;  1XFU O;  2F3Y A;  3GK1 A;  2Y4Q A;  1MF8 B;  4CPV A;  3FWB A;  4Q04 A;  4U8D A;  1DJX A;  2KAY A;  1CFF A;  1NCY A;  1QLK A;  4GGF C;  2P6B B;  2CTN A;  3A4U B;  3AAJ A;  4HRG A;  4M2O A;  1NYA A;  1LA0 A;  4PE7 A;  2ISD A;  2M7L A;  3O78 A;  1B4C A;  1OZO A;  1KQM B;  1F54 A;  2LHL A;  1MXL C;  1NWD A;  2DOQ A;  1AJ4 A;  2LLT A;  3IF7 A;  1SL9 A;  4OKH A;  1KCY A;  2PVB A;  3EKJ A;  3I5G B;  1M63 B;  4OCI A;  1HT9 A;  2BEC A;  2M1K B;  3D0Y B;  4XYN A;  3CZT X;  4I5N B;  3MSE B;  4ETO A;  5CSI A;  1CLB A;  2MA2 A;  4E68 A;  1GJY A;  5CSF A;  4MEW A;  4XJK A;  1EG4 A;  1S36 A;  1B8C A;  4N5X A;  2JXC A;  2A4J A;  1F70 A;  2M97 A;  5HKY A;  1DF0 A;  2BL0 B;  4CID A;  4L9M A;  1WLM A;  1IQ3 A;  4I5K A;  2E30 A;  2CNP A;  4JQ0 D;  1GGW A;  5JOL A;  1NPQ A;  1KWO B;  2M9G A;  1SCV A;  4I5J A;  2VRG A;  1FPW A;  2LC5 A;  2AMI A;  1DT7 B;  5I2L A;  3BOW A;  1Y1X A;  1ZMZ A;  1M45 A;  4YGB B;  1JWD A;  1IRJ A;  1YVL A;  2F8P A;  2KNE A;  4HSZ A;  4DRW A;  5AXI A;  3WHT B;  1XYD A;  2KGR A;  4M2P A;  1OMD A;  1KFX S;  5ER5 A;  2Y1M A;  1UP5 A;  1YUS A;  3TS5 B;  2KSP A;  2KHN A;  2M1U A;  1F8H A;  1QX2 A;  2L0P A;  2K7C A;  3ICB A;  2MHH A;  1F55 A;  1XK4 C;  1Y1A A;  1R6P A;  3JVT C;  2L50 A;  3BUN B;  1SL7 A;  2JU0 A;  2EC6 B;  1M31 A;  2LLS A;  4MSP A;  5IBW A;  4OR9 B;  1PRW A;  3ZNI A;  2ZN9 A;  2KI6 D;  5DKR A;  3JTD B;  1NCX A;  1KFU L;  3KHE A;  3WXA A;  4YGA A;  1B7T Y;  2F2P A;  3DF0 B;  2KDH A;  1CLM A;  3K21 A;  1QS7 A;  2JUL A;  2LP2 A;  2RGI A;  4GGF A;  2IS9 A;  3FWC A;  3SG3 A;  3AKA A;  1SR6 B;  4MZJ A;  2KI4 C;  3CR5 X;  4CFQ A;  1NIW A;  1TTX A;  2I18 A;  1KQM C;  1DJG A;  2LV7 A;  3BUW B;  1A29 A;  3D10 A;  1SMG A;  5HLO A;  4DS7 A;  5HKW A;  3I5G C;  2COL B;  1B8R A;  3TDU A;  1KK7 Y;  1PVA A;  2JXL A;  2HQW A;  1K9P A;  2KBI A;  3OP0 A;  4JWQ A;  1D1O A;  3DVE A;  1BMO A;  2QPT A;  1BT6 A;  2L4H A;  1OSA A;  1G4Y R;  3VRQ A;  3NSK A;  1J7Q A;  1TNW A;  1GGZ A;  1YTZ C;  5K89 A;  1PSB A;  1QAS A;  1S1E A;  2CBL A;  3I5F B;  1S6C A;  2JTT A;  1KK7 Z;  3CR4 X;  1LKJ A;  4A4C A;  3CTN A;  4QJ5 B;  2M7N A;  1FI6 A;  1M39 A;  3KF9 A;  1IJ5 A;  1YUU A;  2LAN A;  3EKH A;  4FQO A;  2GGZ A;  2OS8 B;  2ZND A;  4OVN F;  1IG5 A;  2QAC A;  2Y1N A;  1B47 A;  4QJ4 B;  2LVJ A;  4BY5 A;  4C0L A;  1UHJ A;  1PK0 D;  1BLQ A;  2KAX A;  5D69 A;  3E3R A;  2OTG C;  2R2I A;  1IJ6 A;  3NXA A;  1CLL A;  1WRK A;  2PAS A;  2NLN A;  2MAZ A;  5CSJ A;  1KFX L;  1XK4 A;  1QAT A;  2HF5 A;  4MRY A;  2GGM A;  4DCK A;  5KSZ A;  4DIR A;  2EC6 C;  1OZS A;  3VGO A;  1DVI A;  1PSR A;  1QX5 B;  3KPX A;  5DKQ A;  2M49 B;  1EH2 A;  1UHH A;  1SK6 D;  3JTD C;  1JF0 A;  4IL1 A;  5HYD A;  1BR1 B;  1C7V A;  4GBA A;  1AJ5 A;  1DGV A;  4USL A;  4XJK B;  5HKZ A;  1CFC A;  3O4Y A;  2JT8 A;  1CDN A;  1UHK A;  2JOJ A;  1TN4 A;  1SY9 A;  2KAV A;  1MWN A;  1ZOT B;  2MJW B;  3VRO A;  1MHO A;  4CLN A;  3OHM B;  4HRE E;  4ORB B;  4UPG A;  5KU1 A;  3PAL A;  1B1G A;  2JNF A;  4CFR A;  2LVI A;  1NX2 A;  1K94 A;  1RJV A;  2K2A A;  2WCB A;  4A4B A;  5CPV A;  1CDP A;  2ZFD A;  5FYX A;  1OOJ A;  4MZK A;  3LK1 A;  1U5I A;  1A75 A;  2B1U A;  1Y0V H;  2FJU B;  3SIA A;  4PE4 A;  1C07 A;  2BCB A;  2KFG A;  1K93 D;  2M8U A;  2LMT A;  1JBA A;  2CXJ A;  1MUX A;  2I2R E;  3I5I C;  2KGB C;  1CTR A;  3AKB A;  2JNX A;  2HPS A;  1DJY A;  3C1V A;  1OQP A;  2LNK A;  1F4O A;  1YX7 A;  3EK4 A;  3KO0 A;  1K8U A;  2LM5 A;  1R2U A;  3IQO A;  1KQV A;  1V1F A;  3PN7 B;  1J7O A;  4FTG A;  3BYA A;  5ER4 X;  5B8I B;  1S3P A;  1QLS A;  2LE9 B;  3ZWH A;  4ZCU A;  1RTP 1;  1BU3 A;  2LLU A;  3SG4 A;  2I94 A;  1K9K A;  1K90 D;  1SW8 A;  2JQ6 A;  4NDD A;  1CMG A;  1XVJ A;  1SCM C;  1GQM A;  2GV5 A;  5I2O A;  1QV0 A;  2KQ6 A;  2I7A A;  1XFV O;  2FCE A;  4P2Y B;  2KFH A;  3M0W A;  1TRF A;  2G2B A;  1F71 A;  1BR4 B;  2FCD A;  1SNL A;  1IKU A;  1SRA A;  4HRH A;  1TCF A;  3FIA A;  2CCM A;  5TNC A;  1LA3 A;  4P5O E;  1C7W A;  1CM1 A;  1BJF A;  3BUX B;  2K0J A;  4R1E A;  2WCF A;  1TOP A;  2L5X B;  2M3W A;  3O6B A;  5J3X A;  4PAL A;  2JZI A;  3AAK A;  3TUY B;  1NSH A;  4WRI A;  1JUO A;  1SKT A;  2K61 A;  3TDZ A;  2Q91 A;  1MXE A;  1WY9 A;  1VRK A;  2CT9 A;  1REC A;  1XA5 A;  3HX4 A;  2L98 A;  3DVM A;  2Q4U A;  1B7T Z;  1ALW A;  1JFK A;  1UHI A;  2K7O A;  1RK9 A;  4YRU A;  1OE9 B;  1LVC D;  3NSO A;  1H8B A;  1AVS A;  3DF0 A;  2BCA A;  3LCP C;  4PHN A;  2LMU A;  1RFJ A;  1H4B A;  2LCP A;  3FS7 A;  2EGD A;  2BL0 C;  4ZCV A;  1Y6W A;  3LLE A;  1AHR A;  1L2O B;  2PSR A;  3VRP A;  3SG5 A;  1SPY A;  1CNP A;  2JT3 A;  1J1E A;  2K7D A;  1XO5 A;  4WQ3 A;  2JC2 A;  2H2K A;  3CR2 A;  1S6I A;  3VRN A;  1KWO C;  1EXR A;  1IGV A;  2MLF C;  1BG1 A;  4PHM A;  1E8A A;  1RWY A;  1K9U A;  2JTZ A;  2JWW A;  3CS1 A;  1NP8 A;  1L7Z A;  1Y1U A;  2WOR A;  4PE0 A;  1W7I B;  2F3Z A;  2ZRT A;  2ZRS A;  4GFT A;  1YRU B;  3SG6 A;  5CSN A;  3WNX B;  4YGE B;  1TNQ A;  1DJW A;  2ZKM X;  1SBJ A;  1LXF C;  1XFZ O;  2H61 C;  4PHK A;  5D7F A;  2TN4 A;  2F33 A;  1CFD A;  1ODB A;  3PN7 C;  4NQG A;  3SG7 A;  1SYM A;  3TS5 C;  4WQ2 A;  2BBN A;  4N1F A;  1NX3 A;  4I5L B;  4DUQ A;  2AUC A;  3BUM B;  2L4I A;  3BUO B;  3OB2 B;  1CM4 A;  4GGN A;  1PUL A;  1QIV A;  3JVT B;  4TNC A;  1K95 A;  1AP4 A;  1BOD A;  4NDC A;  3LK0 A;  1K96 A;  1NX1 A;  2NCP A;  2NXQ A;  3EVU A;  5AFP A;  1PVB A;  1UWO A;  3F45 A;  2PMY A;  4MRX A;  3VRR A;  1F4Q A;  1W7J B;  2WCE A;  1AUI B;  1J1D A;  4GUK A;  2WOS A;  3HCM A;  2F2O A;  1K2H A; 
#chains in the Genus database with same CATH topology
 2MRD A;  1DF0 B;  2JRF A;  3I5H B;  1SR6 C;  1UUS A;  2BAP A;  3DYE A;  3K1E A;  1XFW O;  3CDN A;  3D78 A;  1A03 A;  2KI4 B;  4MN0 A;  1NUB A;  3RLZ A;  4AOM A;  1TNP A;  3TUY C;  1YR5 A;  1DJZ A;  2GTE A;  1UHN A;  2QEV A;  3EVV A;  1U5I B;  1A75 B;  2LP3 A;  3PSR A;  4PDZ A;  4YI9 A;  2KBM A;  1QX7 A;  1OOF A;  2M0R A;  2JPT A;  1EG3 A;  3EVR A;  2SAS A;  3D0Y A;  4ORA B;  2K7B A;  3B88 A;  1QV1 A;  3BOW B;  3PLF B;  1J7R A;  2HET A;  4PCW A;  1FW4 A;  2HQ8 A;  1CB1 A;  2BE4 A;  4INX A;  3V2L A;  1BOC A;  1TNX A;  3CGA A;  3KEV A;  3S0F A;  1FF1 A;  3EK7 A;  4YI8 A;  1NCZ A;  1QVI Y;  4D1E A;  3PJI A;  1AK8 A;  1M46 A;  4ICB A;  2L51 A;  2WC8 A;  4YGD B;  1L2O C;  2KI6 C;  3VB1 A;  1HQV A;  3I5F C;  2G9B A;  2EHB A;  3OX6 A;  2KPH A;  1CMF A;  4AQJ A;  2FJY A;  1CDL A;  1KK8 B;  5HLV A;  1Q80 A;  4GPL B;  3CZ0 A;  1WDC B;  4MLW A;  4INW A;  2LUX A;  4N1G A;  2BE6 A;  1WRZ A;  3WHU B;  1UUR A;  1DTL A;  1NX0 A;  2JT0 A;  1QTX A;  3CLN A;  1ALV A;  2OS8 C;  3R1P A;  5I8N A;  4PT1 A;  1QVI Z;  3IQQ A;  2O5G A;  4PHJ A;  1FI5 A;  1S5G Y;  1CKK A;  1KSO A;  4AQI A;  1YRT B;  2LHI A;  3S0A A;  1C3Z A;  3GOF A;  1TCO B;  1ZAC A;  2H61 A;  1XFY O;  3NSL A;  3R1V A;  3DD4 A;  3OBV A;  4GNK B;  2V53 A;  3DVK A;  4YGC B;  1IH0 A;  1G8I A;  2OTG B;  3PM8 A;  4C0K A;  2E6W A;  2LAP A;  3QRX A;  1X02 A;  2BKH B;  2LVV A;  3SJS A;  3D73 A;  1DMO A;  2MLE C;  4MBE A;  1J7P A;  3EK8 A;  5DKN A;  1N65 A;  3A8R A;  1YUR A;  3BXK A;  1S5G Z;  1TIZ A;  5GQQ C;  4PE1 A;  4BY4 A;  4QJ3 B;  5F6T A;  2ZNE A;  1JF2 A;  3PAT A;  2D8N A;  1CFP A;  3DY9 A;  2ZN8 A;  5PAL A;  2LVK A;  1WRL A;  1YUT A;  2PRU A;  2KFF A;  1A2X A;  2KQY A;  2LMV A;  3SS3 A;  1A4P A;  1QJT A;  3SG2 A;  4NDB A;  2NZ0 A;  4JPZ B;  3GK4 X;  1S26 D;  1V1G A;  3I5H C;  3SIB A;  3TZ1 A;  2MBX A;  1CDM A;  5I2Q A;  2KYC A;  2WND A;  2M29 A;  3PFV A;  3L4L A;  1IIO A;  2KOT A;  1KSM A;  4YBH B;  1N2D A;  1G33 A;  1ZFS A;  3GK2 A;  3O4X A;  1MR8 A;  1QIW A;  1PAL A;  2BCX A;  2K8M B;  1JC2 A;  1B9A A;  4F0Z B;  2K2F A;  3PM2 A;  4OZD A;  2PAL A;  3CWG A;  2OPO A;  3I5I B;  1P28 A;  2KYF A;  3CZ2 A;  4MVF A;  3BQ3 A;  3O2P A;  1YX8 A;  1IQ5 A;  1S6J A;  1OMR A;  2L2E A;  5AEQ A;  2O60 A;  1RRO A;  1OMV A;  5AER A;  5KTY A;  4OV2 A;  1XFX O;  1QXP A;  2Y5I A;  4JKT A;  1SSE B;  5G08 A;  1IWQ A;  1DGU A;  3RM1 A;  4MZL A;  1OOI X;  2BKI B;  4M2Q A;  4GAO A;  1N0Y A;  1B8L A;  1KK8 C;  2SCP A;  4ORC B;  1WDC C;  3R1O A;  5JJG A;  3TDI A;  1EJ3 A;  2BBM A;  1DJH A;  1JSA A;  5BPJ A;  1KFU S;  1LIN A;  2NCO A;  1DJI A;  4C0J A;  1BF5 A;  2AAO A;  1J55 A;  1EL4 A;  1ZUZ A;  1SCM B;  3OX5 A;  2LUC A;  3DVJ A;  1YVH A;  3LL8 B;  3NSI A;  2FOT A;  5EL2 A;  1WLZ A;  3OB1 B;  5AAN A;  3RZS A;  1MQ1 A;  1FBV A;  1SL8 A;  3H4S E;  3S0D A;  3NHI A;  1XFU O;  1JFJ A;  2F3Y A;  3GK1 A;  2Y4Q A;  1MF8 B;  4CPV A;  3FWB A;  4Q04 A;  4U8D A;  1DJX A;  2KAY A;  1CFF A;  1NCY A;  1QLK A;  3NGV A;  4GGF C;  2P6B B;  2CTN A;  1DQE A;  3A4U B;  3AAJ A;  4HRG A;  1NYA A;  1LA0 A;  4M2O A;  4PE7 A;  2M7L A;  3O78 A;  1B4C A;  1OZO A;  1KQM B;  1F54 A;  2LHL A;  1MXL C;  1NWD A;  2DOQ A;  1AJ4 A;  2LLT A;  3IF7 A;  1SL9 A;  4OKH A;  1KCY A;  2PVB A;  3EKJ A;  3I5G B;  4F7F A;  1M63 B;  4OCI A;  1HT9 A;  2BEC A;  3S0E A;  2M1K B;  3D0Y B;  4XYN A;  3CZT X;  4I5N B;  3MSE B;  4ETO A;  5CSI A;  1CLB A;  2MA2 A;  4E68 A;  1GJY A;  5CSF A;  2P70 A;  4MEW A;  1EG4 A;  4XJK A;  3DXL A;  1W9Z A;  1S36 A;  1B8C A;  4N5X A;  2JXC A;  2A4J A;  1F70 A;  3EG5 B;  2M97 A;  5HKY A;  1DF0 A;  2BL0 B;  4CID A;  4L9M A;  1WLM A;  1IQ3 A;  4I5K A;  5I94 A;  2ISD A;  2E30 A;  2CNP A;  4JQ0 D;  2PQL A;  4IJ7 A;  1GGW A;  1Z4H A;  5JOL A;  1NPQ A;  1KWO B;  2M9G A;  1SCV A;  4I5J A;  2VRG A;  3BFB A;  1FPW A;  2LC5 A;  2AMI A;  1DT7 B;  5I2L A;  3BOW A;  1Y1X A;  1ZMZ A;  1M45 A;  3D76 A;  4YGB B;  1JWD A;  1IRJ A;  1YVL A;  2F8P A;  2KNE A;  4HSZ A;  4DRW A;  2WCL A;  2P71 A;  5AXI A;  3UNW A;  3WHT B;  1XYD A;  2KGR A;  3QME A;  4M2P A;  1OMD A;  1KFX S;  5ER5 A;  2Y1M A;  1UP5 A;  1YUS A;  3TS5 B;  1ORG A;  2KSP A;  2KHN A;  2M1U A;  2WCJ A;  1F8H A;  1QX2 A;  2L0P A;  2K7C A;  3ICB A;  5FI2 A;  2MHH A;  1F55 A;  1XK4 C;  1Y1A A;  1R6P A;  3JVT C;  5FI7 A;  2L50 A;  3BUN B;  1SL7 A;  2JU0 A;  2EC6 B;  3Q8I A;  1M31 A;  2LLS A;  4MSP A;  5IBW A;  4OR9 B;  1PRW A;  3ZNI A;  2ZN9 A;  2KI6 D;  3SS5 A;  5DKR A;  3JTD B;  1NCX A;  1KFU L;  2BNX A;  3KHE A;  3FE9 A;  3WXA A;  4YGA A;  1B7T Y;  2F2P A;  3DF0 B;  2KDH A;  2PYQ A;  1CLM A;  3FE8 A;  3K21 A;  1QS7 A;  2JUL A;  2LP2 A;  2RGI A;  4GGF A;  2IS9 A;  3FWC A;  3SG3 A;  3AKA A;  1SR6 B;  4MZJ A;  2KI4 C;  3CR5 X;  4CFQ A;  1NIW A;  1TTX A;  2I18 A;  1KQM C;  1DJG A;  2LV7 A;  3BFH A;  3BUW B;  1A29 A;  3D10 A;  1SMG A;  5HLO A;  4DS7 A;  5HKW A;  3I5G C;  2COL B;  1B8R A;  3TDU A;  1KK7 Y;  1PVA A;  2JXL A;  2HQW A;  1K9P A;  2KBI A;  3OP0 A;  4JWQ A;  1D1O A;  3D74 A;  3DVE A;  1BMO A;  2QPT A;  2ERB A;  3NHT A;  1BT6 A;  2L4H A;  1OSA A;  3B7A A;  1G4Y R;  3VRQ A;  3NSK A;  1J7Q A;  3S0B A;  1TNW A;  1GGZ A;  1YTZ C;  5K89 A;  1PSB A;  1QAS A;  1S1E A;  2CBL A;  3I5F B;  1S6C A;  4KYN A;  2JTT A;  1KK7 Z;  3CR4 X;  1LKJ A;  1DC1 A;  1GM0 A;  4A4C A;  3IVT A;  3CTN A;  4QJ5 B;  3SS4 A;  2M7N A;  1FI6 A;  2JPO A;  1M39 A;  3KF9 A;  1IJ5 A;  3R72 A;  1YUU A;  2LAN A;  2KLD A;  3EKH A;  2GGZ A;  2OS8 B;  2ZND A;  4FQO A;  1IG5 A;  2QAC A;  4OVN F;  2Y1N A;  1B47 A;  4QJ4 B;  2LVJ A;  4BY5 A;  1TWO A;  4C0L A;  1OW4 A;  3L47 A;  1UHJ A;  1PK0 D;  2L5Y A;  1BLQ A;  1OOG A;  2KAX A;  5D69 A;  3E3R A;  2OTG C;  2QEO A;  1IJ6 A;  2R2I A;  3NXA A;  1CLL A;  1WRK A;  2PAS A;  2NLN A;  2YGU A;  2MAZ A;  5CSJ A;  2WC5 A;  1KFX L;  1XK4 A;  3BFA A;  1QAT A;  2HF5 A;  4MRY A;  2GGM A;  4DCK A;  5KSZ A;  4DIR A;  2EC6 C;  1OZS A;  3VGO A;  1DVI A;  1PSR A;  1QX5 B;  3KPX A;  3S0G A;  5DKQ A;  2M49 B;  1EH2 A;  1UHH A;  1SK6 D;  3JTD C;  3L4A A;  1JF0 A;  1LS8 A;  1DEK A;  4IL1 A;  5D3O A;  5HYD A;  1BR1 B;  1C7V A;  4GBA A;  1AJ5 A;  1DGV A;  4USL A;  4XJK B;  5HKZ A;  1CFC A;  3O4Y A;  2JT8 A;  1CDN A;  1UHK A;  2JOJ A;  1TN4 A;  1SY9 A;  2KAV A;  1MWN A;  1ZOT B;  2MJW B;  3VRO A;  1MHO A;  4CLN A;  3OHM B;  4HRE E;  4ORB B;  4UPG A;  5KU1 A;  3PAL A;  1B1G A;  2JNF A;  1OOH A;  4FQT A;  4CFR A;  2LVI A;  1NX2 A;  1K94 A;  1RJV A;  2K2A A;  2WCB A;  3D75 A;  4A4B A;  5CPV A;  1CDP A;  2ZFD A;  5FYX A;  1OOJ A;  4MZK A;  3LK1 A;  1U5I A;  1A75 A;  1Y0V H;  2B1U A;  2FJU B;  3SIA A;  4PE4 A;  1C07 A;  2BCB A;  2KFG A;  1K93 D;  2M8U A;  2LMT A;  1JBA A;  2CXJ A;  2QEH A;  1MUX A;  2I2R E;  3I5I C;  2KGB C;  1CTR A;  3AKB A;  2JNX A;  2HPS A;  1DJY A;  3CAB A;  1TUZ A;  2WC6 A;  3C1V A;  1OQP A;  2LNK A;  1F4O A;  1YX7 A;  3EK4 A;  3KO0 A;  1K8U A;  2LM5 A;  1R2U A;  3CYZ A;  3IQO A;  1TUJ A;  1KQV A;  3N7H A;  1V1F A;  3PN7 B;  1J7O A;  4FTG A;  3BYA A;  5ER4 X;  3FE6 A;  5B8I B;  1S3P A;  1QLS A;  2LE9 B;  3ZWH A;  2L2C A;  1RTP 1;  4ZCU A;  1BU3 A;  2LLU A;  3SG4 A;  2I94 A;  1K9K A;  1K90 D;  1SW8 A;  2JQ6 A;  4NDD A;  1CMG A;  1XVJ A;  4JD9 A;  3B87 A;  1SCM C;  1GQM A;  2GV5 A;  3UO9 A;  5I2O A;  1QV0 A;  2KQ6 A;  2I7A A;  1XFV O;  2FCE A;  4P2Y B;  2KFH A;  3M0W A;  1TRF A;  2G2B A;  1F71 A;  1BR4 B;  2FCD A;  1SNL A;  3CZ1 A;  1IKU A;  1SRA A;  4HRH A;  1TCF A;  3FIA A;  2CCM A;  5TNC A;  1LA3 A;  4P5O E;  1C7W A;  1CM1 A;  1BJF A;  3B6X A;  2K0J A;  3BUX B;  4R1E A;  2WCF A;  1TOP A;  2L5X B;  2M3W A;  1DEL A;  2QEB A;  3O6B A;  5J3X A;  4PAL A;  2JZI A;  3AAK A;  3TUY B;  1NSH A;  4WRI A;  1JUO A;  1SKT A;  2K61 A;  3TDZ A;  2Q91 A;  1MXE A;  1WY9 A;  1VRK A;  2CT9 A;  1REC A;  1XA5 A;  3HX4 A;  2L98 A;  3DVM A;  2Q4U A;  1B7T Z;  1ALW A;  1JFK A;  1UHI A;  2K7O A;  2QDI A;  1RK9 A;  4YRU A;  1OE9 B;  1LVC D;  3NSO A;  1H8B A;  1AVS A;  3DF0 A;  2BCA A;  3LCP C;  4PHN A;  2LMU A;  1RFJ A;  1H4B A;  2LCP A;  3FS7 A;  2EGD A;  2BL0 C;  4ZCV A;  1Y6W A;  2H8V A;  3LLE A;  1AHR A;  1L2O B;  1QWV A;  2PSR A;  3VRP A;  1C3Y A;  3SG5 A;  1SPY A;  1CNP A;  2JT3 A;  1J1E A;  2K7D A;  1XO5 A;  3BJH A;  4WQ3 A;  2JC2 A;  2H2K A;  3CR2 A;  1S6I A;  3VRN A;  1KWO C;  1EXR A;  1IGV A;  2MLF C;  1BG1 A;  4PHM A;  1Z2C B;  1E8A A;  1XFR A;  1RWY A;  1K9U A;  2JTZ A;  2JWW A;  3CS1 A;  1NP8 A;  1L7Z A;  1Y1U A;  2WOR A;  3D77 A;  4PE0 A;  1W7I B;  2F3Z A;  2ZRT A;  2ZRS A;  4GFT A;  1YRU B;  3SG6 A;  5CSN A;  3WNX B;  4YGE B;  1TNQ A;  5FI6 A;  1DJW A;  2ZKM X;  1SBJ A;  1LXF C;  1XFZ O;  2H61 C;  4PHK A;  5D7F A;  2TN4 A;  2F33 A;  1CFD A;  1ODB A;  3PN7 C;  4NQG A;  3SG7 A;  1SYM A;  3TS5 C;  4WQ2 A;  2BBN A;  5DIC A;  4N1F A;  1NX3 A;  3B86 A;  4I5L B;  4DUQ A;  2AUC A;  3BUM B;  2L4I A;  3BUO B;  3OB2 B;  1CM4 A;  2KLE A;  4GGN A;  1PUL A;  1QIV A;  3JVT B;  4TNC A;  1K95 A;  1AP4 A;  1BOD A;  4NDC A;  3LK0 A;  2WCK A;  1K96 A;  1NX1 A;  2NCP A;  2NXQ A;  3EVU A;  2K60 A;  5AFP A;  5HL1 A;  2WCM A;  1PVB A;  1UWO A;  3F45 A;  2PMY A;  4MRX A;  3VRR A;  1F4Q A;  1W7J B;  2WCE A;  1AUI B;  1T14 A;  1J1D A;  2WCH A;  4GUK A;  2WOS A;  3DZT A;  3OGN A;  3HCM A;  2F2O A;  1K2H A; 
#chains in the Genus database with same CATH homology
 2MRD A;  1DF0 B;  2JRF A;  3I5H B;  1SR6 C;  1UUS A;  1A03 A;  1XFW O;  2KI4 B;  4MN0 A;  1NUB A;  3RLZ A;  4AOM A;  1TNP A;  3TUY C;  1YR5 A;  1DJZ A;  1UHN A;  3EVV A;  1U5I B;  1A75 B;  2LP3 A;  3PSR A;  4PDZ A;  4YI9 A;  2KBM A;  1QX7 A;  2M0R A;  2JPT A;  1EG3 A;  3EVR A;  2SAS A;  3D0Y A;  4ORA B;  2K7B A;  1QV1 A;  3BOW B;  3PLF B;  1J7R A;  2HET A;  4PCW A;  1FW4 A;  2HQ8 A;  1CB1 A;  2BE4 A;  1BOC A;  1TNX A;  3CGA A;  3KEV A;  1FF1 A;  3EK7 A;  4YI8 A;  1NCZ A;  1QVI Y;  4D1E A;  1AK8 A;  1M46 A;  4ICB A;  2L51 A;  2WC8 A;  4YGD B;  1L2O C;  2KI6 C;  1HQV A;  3I5F C;  2G9B A;  2EHB A;  3OX6 A;  1CMF A;  4AQJ A;  1CDL A;  1KK8 B;  5HLV A;  1Q80 A;  4GPL B;  4MLW A;  1WDC B;  2LUX A;  4N1G A;  2BE6 A;  1WRZ A;  3WHU B;  1UUR A;  1DTL A;  1NX0 A;  2JT0 A;  1QTX A;  3CLN A;  1ALV A;  2OS8 C;  5I8N A;  1QVI Z;  3IQQ A;  2O5G A;  4PHJ A;  1FI5 A;  1S5G Y;  1CKK A;  1KSO A;  4AQI A;  1YRT B;  2LHI A;  3GOF A;  1TCO B;  1ZAC A;  2H61 A;  1XFY O;  3NSL A;  4GNK B;  3DD4 A;  2V53 A;  3DVK A;  4YGC B;  1IH0 A;  1G8I A;  2OTG B;  3PM8 A;  4C0K A;  2E6W A;  2LAP A;  3QRX A;  1X02 A;  2BKH B;  2LVV A;  3SJS A;  1DMO A;  2MLE C;  4MBE A;  1J7P A;  3EK8 A;  5DKN A;  1N65 A;  3A8R A;  1YUR A;  3BXK A;  1S5G Z;  1TIZ A;  5GQQ C;  4PE1 A;  4BY4 A;  4QJ3 B;  5F6T A;  2ZNE A;  1JF2 A;  3PAT A;  2D8N A;  1CFP A;  2ZN8 A;  5PAL A;  2LVK A;  1WRL A;  1YUT A;  2PRU A;  2KFF A;  1A2X A;  2KQY A;  2LMV A;  1A4P A;  1QJT A;  3SG2 A;  4NDB A;  2NZ0 A;  4JPZ B;  3GK4 X;  1S26 D;  1V1G A;  3I5H C;  3SIB A;  3TZ1 A;  2MBX A;  1CDM A;  5I2Q A;  2KYC A;  2WND A;  2M29 A;  3PFV A;  2KOT A;  1KSM A;  4YBH B;  1N2D A;  1G33 A;  1ZFS A;  3GK2 A;  1MR8 A;  1QIW A;  1PAL A;  2BCX A;  2K8M B;  1JC2 A;  1B9A A;  4F0Z B;  2K2F A;  2PAL A;  3CWG A;  2OPO A;  3I5I B;  2KYF A;  4MVF A;  3BQ3 A;  3O2P A;  1YX8 A;  1IQ5 A;  1S6J A;  1OMR A;  2L2E A;  5AEQ A;  2O60 A;  1RRO A;  1OMV A;  5AER A;  5KTY A;  4OV2 A;  1XFX O;  1QXP A;  2Y5I A;  5G08 A;  1IWQ A;  1DGU A;  3RM1 A;  4MZL A;  2BKI B;  4M2Q A;  4GAO A;  1N0Y A;  1B8L A;  1KK8 C;  2SCP A;  4ORC B;  1WDC C;  5JJG A;  3TDI A;  1EJ3 A;  2BBM A;  1DJH A;  1JSA A;  5BPJ A;  1KFU S;  1LIN A;  2NCO A;  1DJI A;  4C0J A;  1BF5 A;  2AAO A;  1J55 A;  1EL4 A;  1ZUZ A;  1SCM B;  3OX5 A;  2LUC A;  3DVJ A;  1YVH A;  3LL8 B;  3NSI A;  2FOT A;  5AAN A;  1WLZ A;  3OB1 B;  1MQ1 A;  1FBV A;  1SL8 A;  3H4S E;  1JFJ A;  1XFU O;  2F3Y A;  3GK1 A;  2Y4Q A;  1MF8 B;  4CPV A;  3FWB A;  4Q04 A;  4U8D A;  1DJX A;  2KAY A;  1CFF A;  1NCY A;  1QLK A;  4GGF C;  2P6B B;  2CTN A;  3A4U B;  3AAJ A;  4HRG A;  4M2O A;  1NYA A;  1LA0 A;  4PE7 A;  2ISD A;  2M7L A;  3O78 A;  1B4C A;  1OZO A;  1KQM B;  1F54 A;  2LHL A;  1MXL C;  1NWD A;  2DOQ A;  1AJ4 A;  2LLT A;  3IF7 A;  1SL9 A;  4OKH A;  1KCY A;  2PVB A;  3EKJ A;  3I5G B;  1M63 B;  4OCI A;  1HT9 A;  2BEC A;  2M1K B;  3D0Y B;  4XYN A;  3CZT X;  4I5N B;  3MSE B;  4ETO A;  5CSI A;  1CLB A;  2MA2 A;  4E68 A;  1GJY A;  5CSF A;  4MEW A;  4XJK A;  1EG4 A;  1S36 A;  1B8C A;  4N5X A;  2JXC A;  2A4J A;  1F70 A;  2M97 A;  5HKY A;  1DF0 A;  2BL0 B;  4CID A;  4L9M A;  1WLM A;  1IQ3 A;  4I5K A;  2E30 A;  2CNP A;  4JQ0 D;  1GGW A;  5JOL A;  1NPQ A;  1KWO B;  2M9G A;  1SCV A;  4I5J A;  2VRG A;  1FPW A;  2LC5 A;  2AMI A;  1DT7 B;  5I2L A;  3BOW A;  1Y1X A;  1ZMZ A;  1M45 A;  4YGB B;  1JWD A;  1IRJ A;  1YVL A;  2F8P A;  2KNE A;  4HSZ A;  4DRW A;  5AXI A;  3WHT B;  1XYD A;  2KGR A;  4M2P A;  1OMD A;  1KFX S;  5ER5 A;  2Y1M A;  1UP5 A;  1YUS A;  3TS5 B;  2KSP A;  2KHN A;  2M1U A;  1F8H A;  1QX2 A;  2L0P A;  2K7C A;  3ICB A;  2MHH A;  1F55 A;  1XK4 C;  1Y1A A;  1R6P A;  3JVT C;  2L50 A;  3BUN B;  1SL7 A;  2JU0 A;  2EC6 B;  1M31 A;  2LLS A;  4MSP A;  5IBW A;  4OR9 B;  1PRW A;  3ZNI A;  2ZN9 A;  2KI6 D;  5DKR A;  3JTD B;  1NCX A;  1KFU L;  3KHE A;  3WXA A;  4YGA A;  1B7T Y;  2F2P A;  3DF0 B;  2KDH A;  1CLM A;  3K21 A;  1QS7 A;  2JUL A;  2LP2 A;  2RGI A;  4GGF A;  2IS9 A;  3FWC A;  3SG3 A;  3AKA A;  1SR6 B;  4MZJ A;  2KI4 C;  3CR5 X;  4CFQ A;  1NIW A;  1TTX A;  2I18 A;  1KQM C;  1DJG A;  2LV7 A;  3BUW B;  1A29 A;  3D10 A;  1SMG A;  5HLO A;  4DS7 A;  5HKW A;  3I5G C;  2COL B;  1B8R A;  3TDU A;  1KK7 Y;  1PVA A;  2JXL A;  2HQW A;  1K9P A;  2KBI A;  3OP0 A;  4JWQ A;  1D1O A;  3DVE A;  1BMO A;  2QPT A;  1BT6 A;  2L4H A;  1OSA A;  1G4Y R;  3VRQ A;  3NSK A;  1J7Q A;  1TNW A;  1GGZ A;  1YTZ C;  5K89 A;  1PSB A;  1QAS A;  1S1E A;  2CBL A;  3I5F B;  1S6C A;  2JTT A;  1KK7 Z;  3CR4 X;  1LKJ A;  4A4C A;  3CTN A;  4QJ5 B;  2M7N A;  1FI6 A;  1M39 A;  3KF9 A;  1IJ5 A;  1YUU A;  2LAN A;  3EKH A;  4FQO A;  2GGZ A;  2OS8 B;  2ZND A;  4OVN F;  1IG5 A;  2QAC A;  2Y1N A;  1B47 A;  4QJ4 B;  2LVJ A;  4BY5 A;  4C0L A;  1UHJ A;  1PK0 D;  1BLQ A;  2KAX A;  5D69 A;  3E3R A;  2OTG C;  2R2I A;  1IJ6 A;  3NXA A;  1CLL A;  1WRK A;  2PAS A;  2NLN A;  2MAZ A;  5CSJ A;  1KFX L;  1XK4 A;  1QAT A;  2HF5 A;  4MRY A;  2GGM A;  4DCK A;  5KSZ A;  4DIR A;  2EC6 C;  1OZS A;  3VGO A;  1DVI A;  1PSR A;  1QX5 B;  3KPX A;  5DKQ A;  2M49 B;  1EH2 A;  1UHH A;  1SK6 D;  3JTD C;  1JF0 A;  4IL1 A;  5HYD A;  1BR1 B;  1C7V A;  4GBA A;  1AJ5 A;  1DGV A;  4USL A;  4XJK B;  5HKZ A;  1CFC A;  3O4Y A;  2JT8 A;  1CDN A;  1UHK A;  2JOJ A;  1TN4 A;  1SY9 A;  2KAV A;  1MWN A;  1ZOT B;  2MJW B;  3VRO A;  1MHO A;  4CLN A;  3OHM B;  4HRE E;  4ORB B;  4UPG A;  5KU1 A;  3PAL A;  1B1G A;  2JNF A;  4CFR A;  2LVI A;  1NX2 A;  1K94 A;  1RJV A;  2K2A A;  2WCB A;  4A4B A;  5CPV A;  1CDP A;  2ZFD A;  5FYX A;  1OOJ A;  4MZK A;  3LK1 A;  1U5I A;  1A75 A;  2B1U A;  1Y0V H;  2FJU B;  3SIA A;  4PE4 A;  1C07 A;  2BCB A;  2KFG A;  1K93 D;  2M8U A;  2LMT A;  1JBA A;  2CXJ A;  1MUX A;  2I2R E;  3I5I C;  2KGB C;  1CTR A;  3AKB A;  2JNX A;  2HPS A;  1DJY A;  3C1V A;  1OQP A;  2LNK A;  1F4O A;  1YX7 A;  3EK4 A;  3KO0 A;  1K8U A;  2LM5 A;  1R2U A;  3IQO A;  1KQV A;  1V1F A;  3PN7 B;  1J7O A;  4FTG A;  3BYA A;  5ER4 X;  5B8I B;  1S3P A;  1QLS A;  2LE9 B;  3ZWH A;  4ZCU A;  1RTP 1;  1BU3 A;  2LLU A;  3SG4 A;  2I94 A;  1K9K A;  1K90 D;  1SW8 A;  2JQ6 A;  4NDD A;  1CMG A;  1XVJ A;  1SCM C;  1GQM A;  2GV5 A;  5I2O A;  1QV0 A;  2KQ6 A;  2I7A A;  1XFV O;  2FCE A;  4P2Y B;  2KFH A;  3M0W A;  1TRF A;  2G2B A;  1F71 A;  1BR4 B;  2FCD A;  1SNL A;  1IKU A;  1SRA A;  4HRH A;  1TCF A;  3FIA A;  2CCM A;  5TNC A;  1LA3 A;  4P5O E;  1C7W A;  1CM1 A;  1BJF A;  3BUX B;  2K0J A;  4R1E A;  2WCF A;  1TOP A;  2L5X B;  2M3W A;  3O6B A;  5J3X A;  4PAL A;  2JZI A;  3AAK A;  3TUY B;  1NSH A;  4WRI A;  1JUO A;  1SKT A;  2K61 A;  3TDZ A;  2Q91 A;  1MXE A;  1WY9 A;  1VRK A;  2CT9 A;  1REC A;  1XA5 A;  3HX4 A;  2L98 A;  3DVM A;  2Q4U A;  1B7T Z;  1ALW A;  1JFK A;  1UHI A;  2K7O A;  1RK9 A;  4YRU A;  1OE9 B;  1LVC D;  3NSO A;  1H8B A;  1AVS A;  3DF0 A;  2BCA A;  3LCP C;  4PHN A;  2LMU A;  1RFJ A;  1H4B A;  2LCP A;  3FS7 A;  2EGD A;  2BL0 C;  4ZCV A;  1Y6W A;  3LLE A;  1AHR A;  1L2O B;  2PSR A;  3VRP A;  3SG5 A;  1SPY A;  1CNP A;  2JT3 A;  1J1E A;  2K7D A;  1XO5 A;  4WQ3 A;  2JC2 A;  2H2K A;  3CR2 A;  1S6I A;  3VRN A;  1KWO C;  1EXR A;  1IGV A;  2MLF C;  1BG1 A;  4PHM A;  1E8A A;  1RWY A;  1K9U A;  2JTZ A;  2JWW A;  3CS1 A;  1NP8 A;  1L7Z A;  1Y1U A;  2WOR A;  4PE0 A;  1W7I B;  2F3Z A;  2ZRT A;  2ZRS A;  4GFT A;  1YRU B;  3SG6 A;  5CSN A;  3WNX B;  4YGE B;  1TNQ A;  1DJW A;  2ZKM X;  1SBJ A;  1LXF C;  1XFZ O;  2H61 C;  4PHK A;  5D7F A;  2TN4 A;  2F33 A;  1CFD A;  1ODB A;  3PN7 C;  4NQG A;  3SG7 A;  1SYM A;  3TS5 C;  4WQ2 A;  2BBN A;  4N1F A;  1NX3 A;  4I5L B;  4DUQ A;  2AUC A;  3BUM B;  2L4I A;  3BUO B;  3OB2 B;  1CM4 A;  4GGN A;  1PUL A;  1QIV A;  3JVT B;  4TNC A;  1K95 A;  1AP4 A;  1BOD A;  4NDC A;  3LK0 A;  1K96 A;  1NX1 A;  2NCP A;  2NXQ A;  3EVU A;  5AFP A;  1PVB A;  1UWO A;  3F45 A;  2PMY A;  4MRX A;  3VRR A;  1F4Q A;  1W7J B;  2WCE A;  1AUI B;  1J1D A;  4GUK A;  2WOS A;  3HCM A;  2F2O A;  1K2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...