1KK8B

Scallop myosin (s1-adp-befx) in the actin-detached conformation
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
139
structure length
139
Chain Sequence
PQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin Heavy Chain, Striated muscle
publication title Crystallographic findings on the internally uncoupled and near-rigor states of myosin: further insights into the mechanics of the motor.
pubmed doi rcsb
molecule tags Contractile protein
total genus 34
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2001-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kk8B01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kk8B02
1VRKA 4P2YB 1JFJA 5D7FA 1WDCB 4I5NB 5AXIA 3CTNA 1CFFA 3I5FB 3AAKA 2G9BA 2GV5A 2M97A 2KQYA 3VRPA 2BCBA 4DUQA 1NWDA 2Q4UA 2F3ZA 3IQQA 4ORAB 3F45A 1F8HA 1K94A 2Y1MA 1SPYA 1KK8B 1NCXA 2JNFA 1EXRA 1QVIY 2CT9A 1F55A 1CTRA 2MLFC 3D10A 3ICBA 5AERA 1BG1A 3DVMA 1Y1UA 1EJ3A 1CB1A 4XJKB 5CSJA 2M8UA 5I2LA 2M7LA 1NX2A 3DVKA 1Y6WA 4JPZB 5CSIA 2VRGA 2KAVA 4GNKB 2JT0A 1K9PA 3O2PA 2KFFA 3OX5A 4A4BA 1MQ1A 3PALA 1X02A 4MSPA 2G2BA 1UHIA 3SG7A 1CDLA 1N0YA 3EK7A 1BJFA 2ZNDA 2L50A 4C0JA 1ZUZA 3CGAA 1CNPA 4CFRA 2BCAA 2TN4A 1CMGA 1J55A 1A75B 1NCYA 1TIZA 3DF0A 1TTXA 1FW4A 3VGOA 2KQ6A 3AAJA 4IL1A 4YGBB 1F4QA 2E6WA 2LLTA 4PE7A 1OOJA 3CR2A 3HX4A 2ZN9A 3OB2B 4I5KA 4A4CA 2L2EA 3KEVA 3EVUA 1UURA 3ZWHA 1CMFA 2AAOA 1XVJA 1OMDA 4L9MA 4NDBA 3WNXB 2L51A 4DCKA 1WY9A 2L0PA 3EK8A 5HYDA 1W7JB 4PHNA 4U8DA 1U5IB 1CDPA 1A03A 2ISDA 1PALA 4P5OE 4HREE 4PE4A 5HLVA 1CM1A 5HKYA 3RLZA 3SG6A 3PFVA 1A2XA 1SW8A 1NPQA 1HQVA 2LP3A 2LCPA 1TCFA 2JOJA 2R2IA 3LK1A 4YGAA 3BUMB 1ZOTB 2K7DA 1TNQA 3SIBA 5KU1A 1PULA 4HSZA 2MA2A 5KTYA 1ZFSA 4PDZA 4M2OA 4XYNA 1LINA 4GAOA 4OV2A 1XFWO 1F4OA 2KHNA 1RFJA 3MSEB 4JWQA 4BY4A 2HQ8A 4ICBA 1NX0A 2ZFDA 2BE6A 4E68A 1KCYA 3OP0A 3H4SE 1XFVO 1KFUS 1YUUA 2KBIA 1WLZA 3BUNB 2PMYA 1AVSA 1L2OC 1UUSA 3OHMB 1F54A 1KWOB 1CLMA 2CBLA 1G8IA 1XFYO 4PALA 1NUBA 3CR4X 4MRYA 1RROA 2NLNA 1RWYA 1A29A 1SR6C 5DKQA 3CS1A 1K9UA 5GQQC 1DMOA 2LLUA 1GGZA 1IG5A 2L4IA 2MLEC 3SIAA 1NSHA 1MWNA 3CWGA 1XYDA 5PALA 1OMVA 4JQ0D 2MAZA 1ZACA 1L2OB 1FBVA 1K96A 4C0LA 1YUSA 2F3YA 4I5JA 4DS7A 1YR5A 2BL0B 1SR6B 1SYMA 1Y0VH 4PE1A 1DJHA 1N2DA 1PVBA 2OPOA 3EVVA 4NQGA 1QASA 5CPVA 1KK7Z 2LM5A 4YGCB 1PRWA 3NSKA 3WHTB 5ER5A 1ODBA 5IBWA 2EC6C 1K95A 1SCMC 1SKTA 1BF5A 2A4JA 1H8BA 3IF7A 1KFXS 2LVKA 2Y5IA 1KFUL 2PVBA 2LNKA 1IJ6A 1B7TY 2KI6C 3OX6A 4QJ3B 5D69A 1B47A 1FF1A 2QACA 1QLSA 3IQOA 2OTGB 2F33A 1OE9B 3JVTC 1J1EA 2M1KB 1QIVA 2LVJA 1DJIA 1TCOB 2K2AA 3KHEA 3TS5C 1SY9A 3VRNA 2EC6B 1J7QA 1QVIZ 3BUOB 1JUOA 2LVIA 1GGWA 1SL8A 4MRXA 2EGDA 2MHHA 1DJYA 2M9GA 4WQ3A 2KBMA 1F70A 4OVNF 2OS8C 4R1EA 1BR1B 1MXEA 1N65A 1CLBA 1S36A 1TRFA 1IJ5A 3JVTB 3TS5B 2JRFA 1DF0A 1QX2A 1YTZC 2KSPA 5B8IB 1IKUA 1H4BA 1DJXA 2LE9B 2JZIA 3PM8A 4HRGA 1FPWA 2NXQA 2IS9A 1AJ5A 1M46A 5AFPA 2K61A 2KYFA 2H61A 3DF0B 2ZN8A 3QRXA 1UHHA 2M0RA 3A4UB 3BOWA 1KFXL 1PSBA 2JU0A 1DJGA 4YI8A 1NP8A 2I94A 3RM1A 1QV0A 2P6BB 3EK4A 4UPGA 3TDUA 2GGMA 1XK4A 1UWOA 3C1VA 1K93D 1QXPA 1DT7B 2I2RE 1JC2A 3PATA 2LV7A 1KSOA 3HCMA 3GOFA 3LL8B 2KYCA 1S6CA 1SL9A 1XFUO 2JC2A 1LA3A 4NDCA 4FQOA 4MN0A 1MR8A 2CNPA 1WRLA 3FWBA 2WCFA 3JTDC 1HT9A 2AUCA 1QJTA 4PCWA 5K89A 1ZMZA 2BE4A 4FTGA 2BKIB 1WLMA 4AOMA 5JJGA 3D0YA 1MHOA 1IQ3A 1K2HA 1J7RA 1NIWA 3VROA 3CR5X 1D1OA 3DD4A 2I18A 2K2FA 1BOCA 1EG4A 3DVJA 3KO0A 2CCMA 4DRWA 1SL7A 4NDDA 4YGDB 2FJUB 3JTDB 1KQMC 1YX8A 3NSIA 4OCIA 5AEQA 5HKWA 1B8RA 1IWQA 3KF9A 4AQJA 1QTXA 1S6JA 2ZNEA 1S5GY 1RJVA 1JSAA 4MVFA 1YVLA 2ZRSA 1JBAA 2EHBA 3TUYC 2FOTA 5CSNA 1SNLA 2KFHA 4AQIA 2CTNA 1B8LA 2M29A 1M45A 1ALWA 2WOSA 2LVVA 2K8MB 1TNXA 1Y1XA 2M7NA 4GUKA 4YBHB 4DIRA 5CSFA 1KQVA 2HETA 3I5GC 1NCZA 4USLA 4YRUA 1MUXA 3BUXB 2NCOA 1NYAA 1K9KA 1XA5A 1LXFC 1YX7A 5KSZA 1V1GA 3BQ3A 1AJ4A 1TN4A 1JFKA 1UHKA 1B8CA 1EH2A 1DJZA 3TUYB 1G4YR 1C7WA 3KPXA 4N1FA 2F2PA 5G08A 1LVCD 1TNWA 3VRRA 1JWDA 1OZOA 4QJ5B 1JF2A 2B1UA 4WRIA 2JULA 1TNPA 5F6TA 3I5GB 2H2KA 2HF5A 1SMGA 2KI4C 4M2QA 2JT3A 2KAYA 1PK0D 1SRAA 2DOQA 2Y4QA 1OSAA 3A8RA 4MLWA 1J1DA 1QIWA 2D8NA 2ZRTA 3M0WA 2JTTA 2MBXA 1B7TZ 1SCVA 2SASA 4YI9A 3OB1B 1YRTB 4WQ2A 3NXAA 3PN7C 1QLKA 1SCMB 1RK9A 2F2OA 1DGVA 2JWWA 1RECA 1BLQA 1AP4A 1DJWA 3PLFB 5DKNA 1BMOA 2ZKMX 2KI4B 2LLSA 1YVHA 2H61C 2KGRA 1AUIB 1S1EA 3FS7A 3SG5A 4BY5A 5DKRA 4GBAA 4GGFA 2E30A 4F0ZB 4MEWA 2KAXA 3SJSA 3WHUB 1DF0B 2KI6D 1C07A 1TOPA 3PN7B 1IH0A 2FCEA 1XK4C 2KNEA 5I2QA 4XJKA 2BECA 2PSRA 1FI5A 1J7OA 1R2UA 3BXKA 1CM4A 4ZCVA 5FYXA 1B9AA 1GJYA 1WRZA 2I7AA 3O6BA 4ORCB 2LMTA 1XO5A 3BOWB 4PE0A 2OS8B 3CLNA 2O60A 5JOLA 1A4PA 1B1GA 1S3PA 4MBEA 4MZKA 4OKHA 2WNDA 1FI6A 3WXAA 2NZ0A 1OQPA 2Y1NA 2BCXA 1S26D 1A75A 1QATA 2RGIA 2LUCA 3AKAA 3TDIA 1LA0A 2AMIA 2M1UA 3GK2A 1B4CA 1DGUA 2HQWA 2KOTA 1E8AA 1EL4A 1R6PA 2JT8A 3AKBA 5J3XA 1BODA 1OZSA 3NSOA 4ORBB 1K90D 1G33A 1SBJA 2FCDA 3DVEA 2JXLA 2O5GA 2QPTA 4CLNA 2L98A 2PRUA 4I5LB 5ER4X 2KGBC 4N5XA 3D0YB 3I5IC 3LK0A 2LAPA 1M39A 3GK4X 1U5IA 2HPSA 4PHMA 4YGEB 1YRUB 5I8NA 2JTZA 2SCPA 1RTP1 4GFTA 5I2OA 3LLEA 1J7PA 2JXCA 3EVRA 2BKHB 1QX5B 3BYAA 4ZCUA 1NX1A 3TDZA 1ALVA 2LUXA 1PVAA 3O4YA 3NSLA 4HRHA 3I5HC 4PHKA 2LMVA 1XFXO 2V53A 1KWOC 1BU3A 1SK6D 2WC8A 2WORA 4C0KA 2GGZA 1QS7A 3EKJA 5AANA 2JPTA 3I5IB 1XFZO 3PSRA 3SG2A 2M3WA 1DVIA 1L7ZA 2K7CA 2MRDA 1S5GZ 1CFDA 2MJWB 3EKHA 3SG4A 1C7VA 2JQ6A 3ZNIA 2WCBA 1K8UA 4CFQA 2LHIA 3GK1A 2LMUA 5HKZA 4QJ4B 3K21A 1WRKA 4MZJA 3CZTX 1BT6A 2WCEA 2BBNA 3I5HB 2L4HA 1F71A 1IRJA 4OR9B 1KQMB 1JF0A 1V1FA 4CIDA 4GGNA 1CFCA 1CLLA 1UHNA 2M49B 4ETOA 4CPVA 2BL0C 1CKKA 5TNCA 1UP5A 1LKJA 1MF8B 2COLB 1EG3A 1PSRA 2LHLA 4TNCA 2K0JA 2LANA 3O78A 1Q80A 2BBMA 2CXJA 1IQ5A 3FWCA 2PASA 1OMRA 2PALA 1QV1A 1YUTA 1CDNA 1QX7A 1WDCC 3LCPC 1IGVA 1M63B 3FIAA 4Q04A 3VRQA 3I5FC 1AK8A 4N1GA 1GQMA 5HLOA 3E3RA 3BUWB 4GPLB 1CFPA 1AHRA 1MXLC 1KSMA 2LC5A 1DTLA 1YURA 1S6IA 1KK7Y 1NX3A 2F8PA 2LP2A 2K7OA 4GGFC 4M2PA 4D1EA 1BR4B 1UHJA 1KK8C 2KFGA 2OTGC 2L5XB 1W7IB 2Q91A 3TZ1A 1M31A 2KDHA 1Y1AA 2K7BA 2NCPA 5BPJA 4MZLA 4PHJA 1CDMA 3SG3A 2JNXA
chains in the Genus database with same CATH superfamily
1VRKA 4P2YB 5DICA 1JFJA 5D7FA 1WDCB 4I5NB 5AXIA 3CTNA 1CFFA 3I5FB 2PYQA 2G9BA 3AAKA 2GV5A 2M97A 2KQYA 3VRPA 2BCBA 4DUQA 1NWDA 2Q4UA 2F3ZA 3IQQA 4ORAB 2QEHA 3F45A 1K94A 2Y1MA 3R1OA 1F8HA 1SPYA 1KK8B 1NCXA 2JNFA 1EXRA 1QVIY 2CT9A 1F55A 1CTRA 2MLFC 3D10A 3ICBA 5AERA 1BG1A 3DVMA 1Y1UA 1OOGA 1EJ3A 1CB1A 4F7FA 4XJKB 5CSJA 2M8UA 5I2LA 2M7LA 3V2LA 1NX2A 3DVKA 1Y6WA 4JPZB 5CSIA 3O4XA 3FE8A 2VRGA 2KAVA 4GNKB 1GM0A 2JT0A 1K9PA 3O2PA 2KFFA 3OX5A 4A4BA 1MQ1A 3PALA 1X02A 4MSPA 2G2BA 1UHIA 3SG7A 1CDLA 1N0YA 2JPOA 2KLEA 1BJFA 3EK7A 2ZNDA 2L50A 4C0JA 1ZUZA 3CGAA 1CNPA 5FI6A 4CFRA 2BCAA 2TN4A 1CMGA 1J55A 1A75B 1NCYA 1TIZA 2L5YA 3DF0A 3VB1A 1TTXA 1FW4A 3S0BA 1T14A 5I94A 3VGOA 2KQ6A 3AAJA 4IL1A 4YGBB 1F4QA 2E6WA 2LLTA 4PE7A 1OOJA 3CR2A 3HX4A 2ZN9A 3OB2B 4I5KA 4A4CA 2L2EA 3KEVA 3EVUA 1UURA 3ZWHA 1CMFA 2AAOA 1XVJA 1OMDA 4L9MA 3QMEA 4NDBA 2L51A 3WNXB 4DCKA 1WY9A 2L0PA 3NHTA 3EK8A 5HYDA 4IJ7A 1W7JB 4PHNA 4U8DA 5FI2A 1U5IB 1CDPA 1A03A 2ISDA 1PALA 4P5OE 2WC6A 4HREE 4JKTA 4PE4A 5HLVA 1CM1A 5HKYA 3D73A 2P70A 3RLZA 3SG6A 3PFVA 1A2XA 1SW8A 1NPQA 1HQVA 2LP3A 2LCPA 1TCFA 2JOJA 2R2IA 3LK1A 4OZDA 3BUMB 1ZOTB 2K7DA 1TNQA 3SIBA 5KU1A 1PULA 4HSZA 2MA2A 5KTYA 1ZFSA 4PDZA 4M2OA 4XYNA 1LINA 4GAOA 4OV2A 1XFWO 1F4OA 2KHNA 1RFJA 3MSEB 4JWQA 4BY4A 2HQ8A 1C3ZA 4ICBA 1NX0A 2ZFDA 2BE6A 4E68A 1KCYA 3OP0A 3H4SE 1XFVO 3D75A 1KFUS 1YUUA 2KBIA 1OOFA 1WLZA 3BUNB 2PMYA 1AVSA 1L2OC 1UUSA 3OHMB 1F54A 1KWOB 1CLMA 2CBLA 3D78A 1G8IA 1XFYO 4PALA 1NUBA 1W9ZA 3CR4X 3CZ1A 4MRYA 1RROA 2NLNA 1RWYA 1A29A 1SR6C 5DKQA 3CS1A 3D77A 5D3OA 1K9UA 1TUZA 5GQQC 1DMOA 2LLUA 2WCMA 1GGZA 1IG5A 2L4IA 2BNXA 2MLEC 3S0FA 3SIAA 1NSHA 1MWNA 3CWGA 1XYDA 5PALA 1OMVA 4JQ0D 2FJYA 2MAZA 1ZACA 3SS3A 1L2OB 1FBVA 1K96A 3B88A 4C0LA 1YUSA 2F3YA 4I5JA 4DS7A 1YR5A 2ERBA 2BL0B 1SR6B 1SYMA 3DYEA 1Y0VH 4PE1A 1DJHA 1N2DA 1PVBA 2OPOA 3EVVA 4NQGA 1QASA 3R1VA 1KK7Z 2LM5A 5CPVA 1PRWA 3NSKA 4YGCB 5ER5A 3WHTB 1ODBA 4PT1A 5IBWA 5EL2A 2EC6C 1K95A 1SCMC 1SKTA 1BF5A 2A4JA 1H8BA 3IF7A 1KFXS 2LVKA 2Y5IA 1KFUL 2PVBA 2LNKA 1C3YA 1IJ6A 1B7TY 2KI6C 3OX6A 4QJ3B 5D69A 1B47A 1FF1A 2QACA 3L47A 1QLSA 3IQOA 2OTGB 2F33A 1OE9B 3JVTC 1J1EA 2M1KB 1QIVA 2LVJA 1DJIA 1TCOB 2K2AA 3KHEA 3TS5C 1SY9A 2P71A 3VRNA 2EC6B 3B7AA 1J7QA 1QVIZ 3BUOB 1JUOA 2LVIA 1XFRA 2WC5A 1GGWA 3S0AA 1SL8A 4MRXA 2EGDA 2MHHA 1DJYA 2M9GA 4WQ3A 2KBMA 3D76A 1F70A 4OVNF 2OS8C 4R1EA 1SSEB 1BR1B 1MXEA 1N65A 1CLBA 1S36A 1TRFA 1IJ5A 3JVTB 3BFAA 3BJHA 4KYNA 3TS5B 2JRFA 1DF0A 1QX2A 1YTZC 2KSPA 3S0GA 5B8IB 3RZSA 1IKUA 1H4BA 1Z2CB 1DJXA 2LE9B 2JZIA 3PM8A 4HRGA 3L4AA 1FPWA 2NXQA 2IS9A 3UO9A 1AJ5A 1M46A 3D74A 2K61A 1DEKA 5AFPA 2KYFA 2H61A 3DF0B 2ZN8A 3QRXA 1UHHA 2M0RA 3A4UB 3BOWA 1KFXL 1PSBA 2JU0A 1DJGA 4YI8A 1NP8A 1ORGA 2I94A 3RM1A 1QV0A 2P6BB 3EK4A 3R72A 3TDUA 4UPGA 2GGMA 1XK4A 1UWOA 3C1VA 1K93D 1QXPA 1DT7B 2I2RE 1JC2A 3PATA 2LV7A 3B87A 1KSOA 3HCMA 3GOFA 3LL8B 2KYCA 3N7HA 1XFUO 1S6CA 1SL9A 2JC2A 1LA3A 2PQLA 4NDCA 4FQOA 4MN0A 1MR8A 2CNPA 1WRLA 3B6XA 3FWBA 2WCFA 3JTDC 1HT9A 2AUCA 1QJTA 4PCWA 5K89A 1ZMZA 1QWVA 2BE4A 4FTGA 2BKIB 1WLMA 4AOMA 5JJGA 3D0YA 1MHOA 1IQ3A 1K2HA 1J7RA 1NIWA 3VROA 3CR5X 4INXA 1D1OA 4JD9A 3DD4A 2I18A 3Q8IA 2K2FA 1BOCA 1EG4A 3DVJA 3KO0A 2CCMA 4DRWA 1SL7A 4NDDA 4YGDB 3UNWA 2FJUB 3JTDB 1KQMC 1YX8A 3NSIA 4OCIA 5AEQA 5HKWA 1DELA 1B8RA 1IWQA 3KF9A 4AQJA 1QTXA 1S6JA 4YGAA 2ZNEA 1S5GY 1RJVA 1JSAA 4MVFA 3S0EA 1YVLA 2ZRSA 1JBAA 2EHBA 3TUYC 2FOTA 5CSNA 5HL1A 1SNLA 2KFHA 4AQIA 2CTNA 1B8LA 3BFBA 2M29A 1M45A 2L2CA 1ALWA 2WOSA 1LS8A 2LVVA 2K8MB 1TNXA 1Y1XA 2M7NA 4GUKA 4YBHB 4DIRA 5CSFA 1KQVA 2HETA 3I5GC 1NCZA 4USLA 3CZ0A 1MUXA 4YRUA 3BUXB 2NCOA 1NYAA 1K9KA 1XA5A 2H8VA 1LXFC 1YX7A 5KSZA 2GTEA 1V1GA 3BQ3A 1AJ4A 3DXLA 1TN4A 1JFKA 1UHKA 1B8CA 1EH2A 1DJZA 2QDIA 1Z4HA 1G4YR 1C7WA 3FE9A 1P28A 3KPXA 3TUYB 4N1FA 2F2PA 5G08A 3S0DA 1LVCD 1TNWA 3IVTA 3VRRA 1JWDA 1OZOA 4QJ5B 1JF2A 2B1UA 4WRIA 2JULA 1TNPA 5F6TA 3I5GB 2H2KA 2HF5A 1SMGA 2WCHA 2KI4C 4M2QA 2JT3A 2KAYA 1PK0D 1SRAA 2DOQA 2Y4QA 1OSAA 3A8RA 4MLWA 1J1DA 1QIWA 2D8NA 2ZRTA 3M0WA 2JTTA 2MBXA 1B7TZ 1SCVA 2SASA 4YI9A 3OB1B 1YRTB 3BFHA 3NXAA 4WQ2A 3PN7C 1QLKA 1SCMB 1RK9A 2F2OA 1DGVA 2JWWA 2KPHA 3L4LA 1RECA 1BLQA 1AP4A 1DJWA 3PLFB 5DKNA 1BMOA 2ZKMX 2KI4B 2LLSA 1YVHA 2H61C 2KGRA 1AUIB 1S1EA 3FS7A 3SG5A 4BY5A 5DKRA 4GBAA 2WCKA 4GGFA 2E30A 5FI7A 4MEWA 4F0ZB 2KAXA 3SJSA 3NHIA 3B86A 3WHUB 3DY9A 3OGNA 2QEVA 1DF0B 1OOIX 2KI6D 1TOPA 3PN7B 1C07A 2FCEA 1XK4C 2KNEA 5I2QA 3PM2A 1IH0A 4XJKA 2BECA 2PSRA 1FI5A 1J7OA 1R2UA 3BXKA 1CM4A 4ZCVA 1OOHA 3EG5B 1B9AA 1GJYA 1WRZA 2I7AA 3O6BA 4ORCB 5FYXA 2LMTA 1XO5A 3BOWB 4PE0A 2OS8B 3CLNA 2O60A 5JOLA 1A4PA 1B1GA 1S3PA 4MBEA 4MZKA 4OKHA 2WNDA 1FI6A 3WXAA 3SS4A 2NZ0A 2KLDA 1OQPA 2Y1NA 2BCXA 1S26D 1A75A 1TUJA 1QATA 2RGIA 2LUCA 3AKAA 3TDIA 1LA0A 2AMIA 2M1UA 3GK2A 1B4CA 1DQEA 3CDNA 1DGUA 2HQWA 2KOTA 1E8AA 3K1EA 1EL4A 1R6PA 2JT8A 3AKBA 5J3XA 1BODA 1OZSA 3NSOA 4ORBB 1K90D 1G33A 1SBJA 2FCDA 3DVEA 2JXLA 2O5GA 2QPTA 3CYZA 2L98A 2PRUA 4I5LB 5ER4X 2KGBC 4CLNA 2WCLA 1OW4A 3CZ2A 4N5XA 3D0YB 3I5IC 3LK0A 2LAPA 1M39A 3GK4X 1U5IA 2HPSA 3DZTA 4PHMA 1YRUB 4YGEB 2JTZA 5I8NA 2SCPA 1RTP1 2BAPA 4GFTA 3LLEA 5I2OA 2JXCA 1J7PA 3EVRA 1DC1A 2BKHB 1QX5B 3BYAA 4ZCUA 1NX1A 3TDZA 1ALVA 2LUXA 1PVAA 3O4YA 3NSLA 4HRHA 3I5HC 4PHKA 2LMVA 1XFXO 2V53A 1KWOC 1BU3A 1SK6D 2WC8A 2WORA 4C0KA 2GGZA 1QS7A 3EKJA 5AANA 2JPTA 3I5IB 1XFZO 3PSRA 4INWA 3SG2A 2M3WA 1DVIA 1L7ZA 2K7CA 2MRDA 1S5GZ 1CFDA 2MJWB 3EKHA 3NGVA 3SG4A 1C7VA 2JQ6A 3ZNIA 2WCBA 1K8UA 4CFQA 2LHIA 3FE6A 3GK1A 2LMUA 5HKZA 4QJ4B 3K21A 1WRKA 4MZJA 3CZTX 1BT6A 2WCEA 2BBNA 3I5HB 2L4HA 3PJIA 4FQTA 1F71A 1IRJA 4OR9B 1KQMB 1JF0A 1V1FA 3OBVA 4CIDA 4GGNA 1CFCA 1CLLA 1UHNA 2M49B 4ETOA 3R1PA 4CPVA 2BL0C 1CKKA 5TNCA 1UP5A 1LKJA 1MF8B 2COLB 1EG3A 1PSRA 2LHLA 4TNCA 2K0JA 2LANA 3O78A 1Q80A 3SS5A 2BBMA 2CXJA 1IQ5A 3FWCA 2PASA 2QEBA 1OMRA 2PALA 1QV1A 1YUTA 2WCJA 1CDNA 1QX7A 1WDCC 3LCPC 3CABA 1IGVA 1M63B 1TWOA 2QEOA 3FIAA 3I5FC 4Q04A 4N1GA 1GQMA 5HLOA 3E3RA 3VRQA 1AK8A 3BUWB 4GPLB 1CFPA 1AHRA 1MXLC 1KSMA 2LC5A 1DTLA 1YURA 1S6IA 1KK7Y 1NX3A 2F8PA 2LP2A 2K7OA 2YGUA 4GGFC 4M2PA 4D1EA 1BR4B 1UHJA 1KK8C 2KFGA 2OTGC 2L5XB 1W7IB 2Q91A 3TZ1A 1M31A 2KDHA 2K60A 1Y1AA 1IIOA 2K7BA 2NCPA 5BPJA 4MZLA 4PHJA 1CDMA 3SG3A 2JNXA
chains in the Genus database with same CATH topology
1VRKA 4P2YB 1JFJA 5D7FA 1WDCB 4I5NB 5AXIA 3CTNA 1CFFA 3I5FB 3AAKA 2G9BA 2GV5A 2M97A 2KQYA 3VRPA 2BCBA 4DUQA 1NWDA 2Q4UA 2F3ZA 3IQQA 4ORAB 3F45A 1F8HA 1K94A 2Y1MA 1SPYA 1KK8B 1NCXA 2JNFA 1EXRA 1QVIY 2CT9A 1F55A 1CTRA 2MLFC 3D10A 3ICBA 5AERA 1BG1A 3DVMA 1Y1UA 1EJ3A 1CB1A 4XJKB 5CSJA 2M8UA 5I2LA 2M7LA 1NX2A 3DVKA 1Y6WA 4JPZB 5CSIA 2VRGA 2KAVA 4GNKB 2JT0A 1K9PA 3O2PA 2KFFA 3OX5A 4A4BA 1MQ1A 3PALA 1X02A 4MSPA 2G2BA 1UHIA 3SG7A 1CDLA 1N0YA 3EK7A 1BJFA 2ZNDA 2L50A 4C0JA 1ZUZA 3CGAA 1CNPA 4CFRA 2BCAA 2TN4A 1CMGA 1J55A 1A75B 1NCYA 1TIZA 3DF0A 1TTXA 1FW4A 3VGOA 2KQ6A 3AAJA 4IL1A 4YGBB 1F4QA 2E6WA 2LLTA 4PE7A 1OOJA 3CR2A 3HX4A 2ZN9A 3OB2B 4I5KA 4A4CA 2L2EA 3KEVA 3EVUA 1UURA 3ZWHA 1CMFA 2AAOA 1XVJA 1OMDA 4L9MA 4NDBA 3WNXB 2L51A 4DCKA 1WY9A 2L0PA 3EK8A 5HYDA 1W7JB 4PHNA 4U8DA 1U5IB 1CDPA 1A03A 2ISDA 1PALA 4P5OE 4HREE 4PE4A 5HLVA 1CM1A 5HKYA 3RLZA 3SG6A 3PFVA 1A2XA 1SW8A 1NPQA 1HQVA 2LP3A 2LCPA 1TCFA 2JOJA 2R2IA 3LK1A 4YGAA 3BUMB 1ZOTB 2K7DA 1TNQA 3SIBA 5KU1A 1PULA 4HSZA 2MA2A 5KTYA 1ZFSA 4PDZA 4M2OA 4XYNA 1LINA 4GAOA 4OV2A 1XFWO 1F4OA 2KHNA 1RFJA 3MSEB 4JWQA 4BY4A 2HQ8A 4ICBA 1NX0A 2ZFDA 2BE6A 4E68A 1KCYA 3OP0A 3H4SE 1XFVO 1KFUS 1YUUA 2KBIA 1WLZA 3BUNB 2PMYA 1AVSA 1L2OC 1UUSA 3OHMB 1F54A 1KWOB 1CLMA 2CBLA 1G8IA 1XFYO 4PALA 1NUBA 3CR4X 4MRYA 1RROA 2NLNA 1RWYA 1A29A 1SR6C 5DKQA 3CS1A 1K9UA 5GQQC 1DMOA 2LLUA 1GGZA 1IG5A 2L4IA 2MLEC 3SIAA 1NSHA 1MWNA 3CWGA 1XYDA 5PALA 1OMVA 4JQ0D 2MAZA 1ZACA 1L2OB 1FBVA 1K96A 4C0LA 1YUSA 2F3YA 4I5JA 4DS7A 1YR5A 2BL0B 1SR6B 1SYMA 1Y0VH 4PE1A 1DJHA 1N2DA 1PVBA 2OPOA 3EVVA 4NQGA 1QASA 5CPVA 1KK7Z 2LM5A 4YGCB 1PRWA 3NSKA 3WHTB 5ER5A 1ODBA 5IBWA 2EC6C 1K95A 1SCMC 1SKTA 1BF5A 2A4JA 1H8BA 3IF7A 1KFXS 2LVKA 2Y5IA 1KFUL 2PVBA 2LNKA 1IJ6A 1B7TY 2KI6C 3OX6A 4QJ3B 5D69A 1B47A 1FF1A 2QACA 1QLSA 3IQOA 2OTGB 2F33A 1OE9B 3JVTC 1J1EA 2M1KB 1QIVA 2LVJA 1DJIA 1TCOB 2K2AA 3KHEA 3TS5C 1SY9A 3VRNA 2EC6B 1J7QA 1QVIZ 3BUOB 1JUOA 2LVIA 1GGWA 1SL8A 4MRXA 2EGDA 2MHHA 1DJYA 2M9GA 4WQ3A 2KBMA 1F70A 4OVNF 2OS8C 4R1EA 1BR1B 1MXEA 1N65A 1CLBA 1S36A 1TRFA 1IJ5A 3JVTB 3TS5B 2JRFA 1DF0A 1QX2A 1YTZC 2KSPA 5B8IB 1IKUA 1H4BA 1DJXA 2LE9B 2JZIA 3PM8A 4HRGA 1FPWA 2NXQA 2IS9A 1AJ5A 1M46A 5AFPA 2K61A 2KYFA 2H61A 3DF0B 2ZN8A 3QRXA 1UHHA 2M0RA 3A4UB 3BOWA 1KFXL 1PSBA 2JU0A 1DJGA 4YI8A 1NP8A 2I94A 3RM1A 1QV0A 2P6BB 3EK4A 4UPGA 3TDUA 2GGMA 1XK4A 1UWOA 3C1VA 1K93D 1QXPA 1DT7B 2I2RE 1JC2A 3PATA 2LV7A 1KSOA 3HCMA 3GOFA 3LL8B 2KYCA 1S6CA 1SL9A 1XFUO 2JC2A 1LA3A 4NDCA 4FQOA 4MN0A 1MR8A 2CNPA 1WRLA 3FWBA 2WCFA 3JTDC 1HT9A 2AUCA 1QJTA 4PCWA 5K89A 1ZMZA 2BE4A 4FTGA 2BKIB 1WLMA 4AOMA 5JJGA 3D0YA 1MHOA 1IQ3A 1K2HA 1J7RA 1NIWA 3VROA 3CR5X 1D1OA 3DD4A 2I18A 2K2FA 1BOCA 1EG4A 3DVJA 3KO0A 2CCMA 4DRWA 1SL7A 4NDDA 4YGDB 2FJUB 3JTDB 1KQMC 1YX8A 3NSIA 4OCIA 5AEQA 5HKWA 1B8RA 1IWQA 3KF9A 4AQJA 1QTXA 1S6JA 2ZNEA 1S5GY 1RJVA 1JSAA 4MVFA 1YVLA 2ZRSA 1JBAA 2EHBA 3TUYC 2FOTA 5CSNA 1SNLA 2KFHA 4AQIA 2CTNA 1B8LA 2M29A 1M45A 1ALWA 2WOSA 2LVVA 2K8MB 1TNXA 1Y1XA 2M7NA 4GUKA 4YBHB 4DIRA 5CSFA 1KQVA 2HETA 3I5GC 1NCZA 4USLA 4YRUA 1MUXA 3BUXB 2NCOA 1NYAA 1K9KA 1XA5A 1LXFC 1YX7A 5KSZA 1V1GA 3BQ3A 1AJ4A 1TN4A 1JFKA 1UHKA 1B8CA 1EH2A 1DJZA 3TUYB 1G4YR 1C7WA 3KPXA 4N1FA 2F2PA 5G08A 1LVCD 1TNWA 3VRRA 1JWDA 1OZOA 4QJ5B 1JF2A 2B1UA 4WRIA 2JULA 1TNPA 5F6TA 3I5GB 2H2KA 2HF5A 1SMGA 2KI4C 4M2QA 2JT3A 2KAYA 1PK0D 1SRAA 2DOQA 2Y4QA 1OSAA 3A8RA 4MLWA 1J1DA 1QIWA 2D8NA 2ZRTA 3M0WA 2JTTA 2MBXA 1B7TZ 1SCVA 2SASA 4YI9A 3OB1B 1YRTB 4WQ2A 3NXAA 3PN7C 1QLKA 1SCMB 1RK9A 2F2OA 1DGVA 2JWWA 1RECA 1BLQA 1AP4A 1DJWA 3PLFB 5DKNA 1BMOA 2ZKMX 2KI4B 2LLSA 1YVHA 2H61C 2KGRA 1AUIB 1S1EA 3FS7A 3SG5A 4BY5A 5DKRA 4GBAA 4GGFA 2E30A 4F0ZB 4MEWA 2KAXA 3SJSA 3WHUB 1DF0B 2KI6D 1C07A 1TOPA 3PN7B 1IH0A 2FCEA 1XK4C 2KNEA 5I2QA 4XJKA 2BECA 2PSRA 1FI5A 1J7OA 1R2UA 3BXKA 1CM4A 4ZCVA 5FYXA 1B9AA 1GJYA 1WRZA 2I7AA 3O6BA 4ORCB 2LMTA 1XO5A 3BOWB 4PE0A 2OS8B 3CLNA 2O60A 5JOLA 1A4PA 1B1GA 1S3PA 4MBEA 4MZKA 4OKHA 2WNDA 1FI6A 3WXAA 2NZ0A 1OQPA 2Y1NA 2BCXA 1S26D 1A75A 1QATA 2RGIA 2LUCA 3AKAA 3TDIA 1LA0A 2AMIA 2M1UA 3GK2A 1B4CA 1DGUA 2HQWA 2KOTA 1E8AA 1EL4A 1R6PA 2JT8A 3AKBA 5J3XA 1BODA 1OZSA 3NSOA 4ORBB 1K90D 1G33A 1SBJA 2FCDA 3DVEA 2JXLA 2O5GA 2QPTA 4CLNA 2L98A 2PRUA 4I5LB 5ER4X 2KGBC 4N5XA 3D0YB 3I5IC 3LK0A 2LAPA 1M39A 3GK4X 1U5IA 2HPSA 4PHMA 4YGEB 1YRUB 5I8NA 2JTZA 2SCPA 1RTP1 4GFTA 5I2OA 3LLEA 1J7PA 2JXCA 3EVRA 2BKHB 1QX5B 3BYAA 4ZCUA 1NX1A 3TDZA 1ALVA 2LUXA 1PVAA 3O4YA 3NSLA 4HRHA 3I5HC 4PHKA 2LMVA 1XFXO 2V53A 1KWOC 1BU3A 1SK6D 2WC8A 2WORA 4C0KA 2GGZA 1QS7A 3EKJA 5AANA 2JPTA 3I5IB 1XFZO 3PSRA 3SG2A 2M3WA 1DVIA 1L7ZA 2K7CA 2MRDA 1S5GZ 1CFDA 2MJWB 3EKHA 3SG4A 1C7VA 2JQ6A 3ZNIA 2WCBA 1K8UA 4CFQA 2LHIA 3GK1A 2LMUA 5HKZA 4QJ4B 3K21A 1WRKA 4MZJA 3CZTX 1BT6A 2WCEA 2BBNA 3I5HB 2L4HA 1F71A 1IRJA 4OR9B 1KQMB 1JF0A 1V1FA 4CIDA 4GGNA 1CFCA 1CLLA 1UHNA 2M49B 4ETOA 4CPVA 2BL0C 1CKKA 5TNCA 1UP5A 1LKJA 1MF8B 2COLB 1EG3A 1PSRA 2LHLA 4TNCA 2K0JA 2LANA 3O78A 1Q80A 2BBMA 2CXJA 1IQ5A 3FWCA 2PASA 1OMRA 2PALA 1QV1A 1YUTA 1CDNA 1QX7A 1WDCC 3LCPC 1IGVA 1M63B 3FIAA 4Q04A 3VRQA 3I5FC 1AK8A 4N1GA 1GQMA 5HLOA 3E3RA 3BUWB 4GPLB 1CFPA 1AHRA 1MXLC 1KSMA 2LC5A 1DTLA 1YURA 1S6IA 1KK7Y 1NX3A 2F8PA 2LP2A 2K7OA 4GGFC 4M2PA 4D1EA 1BR4B 1UHJA 1KK8C 2KFGA 2OTGC 2L5XB 1W7IB 2Q91A 3TZ1A 1M31A 2KDHA 1Y1AA 2K7BA 2NCPA 5BPJA 4MZLA 4PHJA 1CDMA 3SG3A 2JNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VRK A;  4P2Y B;  1JFJ A;  5D7F A;  1WDC B;  4I5N B;  5AXI A;  3CTN A;  1CFF A;  3I5F B;  3AAK A;  2G9B A;  2GV5 A;  2M97 A;  2KQY A;  3VRP A;  2BCB A;  4DUQ A;  1NWD A;  2Q4U A;  2F3Z A;  3IQQ A;  4ORA B;  3F45 A;  1F8H A;  1K94 A;  2Y1M A;  1SPY A;  1KK8 B;  1NCX A;  2JNF A;  1EXR A;  1QVI Y;  2CT9 A;  1F55 A;  1CTR A;  2MLF C;  3D10 A;  3ICB A;  5AER A;  1BG1 A;  3DVM A;  1Y1U A;  1EJ3 A;  1CB1 A;  4XJK B;  5CSJ A;  2M8U A;  5I2L A;  2M7L A;  1NX2 A;  3DVK A;  1Y6W A;  4JPZ B;  5CSI A;  2VRG A;  2KAV A;  4GNK B;  2JT0 A;  1K9P A;  3O2P A;  2KFF A;  3OX5 A;  4A4B A;  1MQ1 A;  3PAL A;  1X02 A;  4MSP A;  2G2B A;  1UHI A;  3SG7 A;  1CDL A;  1N0Y A;  3EK7 A;  1BJF A;  2ZND A;  2L50 A;  4C0J A;  1ZUZ A;  3CGA A;  1CNP A;  4CFR A;  2BCA A;  2TN4 A;  1CMG A;  1J55 A;  1A75 B;  1NCY A;  1TIZ A;  3DF0 A;  1TTX A;  1FW4 A;  3VGO A;  2KQ6 A;  3AAJ A;  4IL1 A;  4YGB B;  1F4Q A;  2E6W A;  2LLT A;  4PE7 A;  1OOJ A;  3CR2 A;  3HX4 A;  2ZN9 A;  3OB2 B;  4I5K A;  4A4C A;  2L2E A;  3KEV A;  3EVU A;  1UUR A;  3ZWH A;  1CMF A;  2AAO A;  1XVJ A;  1OMD A;  4L9M A;  4NDB A;  3WNX B;  2L51 A;  4DCK A;  1WY9 A;  2L0P A;  3EK8 A;  5HYD A;  1W7J B;  4PHN A;  4U8D A;  1U5I B;  1CDP A;  1A03 A;  2ISD A;  1PAL A;  4P5O E;  4HRE E;  4PE4 A;  5HLV A;  1CM1 A;  5HKY A;  3RLZ A;  3SG6 A;  3PFV A;  1A2X A;  1SW8 A;  1NPQ A;  1HQV A;  2LP3 A;  2LCP A;  1TCF A;  2JOJ A;  2R2I A;  3LK1 A;  4YGA A;  3BUM B;  1ZOT B;  2K7D A;  1TNQ A;  3SIB A;  5KU1 A;  1PUL A;  4HSZ A;  2MA2 A;  5KTY A;  1ZFS A;  4PDZ A;  4M2O A;  4XYN A;  1LIN A;  4GAO A;  4OV2 A;  1XFW O;  1F4O A;  2KHN A;  1RFJ A;  3MSE B;  4JWQ A;  4BY4 A;  2HQ8 A;  4ICB A;  1NX0 A;  2ZFD A;  2BE6 A;  4E68 A;  1KCY A;  3OP0 A;  3H4S E;  1XFV O;  1KFU S;  1YUU A;  2KBI A;  1WLZ A;  3BUN B;  2PMY A;  1AVS A;  1L2O C;  1UUS A;  3OHM B;  1F54 A;  1KWO B;  1CLM A;  2CBL A;  1G8I A;  1XFY O;  4PAL A;  1NUB A;  3CR4 X;  4MRY A;  1RRO A;  2NLN A;  1RWY A;  1A29 A;  1SR6 C;  5DKQ A;  3CS1 A;  1K9U A;  5GQQ C;  1DMO A;  2LLU A;  1GGZ A;  1IG5 A;  2L4I A;  2MLE C;  3SIA A;  1NSH A;  1MWN A;  3CWG A;  1XYD A;  5PAL A;  1OMV A;  4JQ0 D;  2MAZ A;  1ZAC A;  1L2O B;  1FBV A;  1K96 A;  4C0L A;  1YUS A;  2F3Y A;  4I5J A;  4DS7 A;  1YR5 A;  2BL0 B;  1SR6 B;  1SYM A;  1Y0V H;  4PE1 A;  1DJH A;  1N2D A;  1PVB A;  2OPO A;  3EVV A;  4NQG A;  1QAS A;  5CPV A;  1KK7 Z;  2LM5 A;  4YGC B;  1PRW A;  3NSK A;  3WHT B;  5ER5 A;  1ODB A;  5IBW A;  2EC6 C;  1K95 A;  1SCM C;  1SKT A;  1BF5 A;  2A4J A;  1H8B A;  3IF7 A;  1KFX S;  2LVK A;  2Y5I A;  1KFU L;  2PVB A;  2LNK A;  1IJ6 A;  1B7T Y;  2KI6 C;  3OX6 A;  4QJ3 B;  5D69 A;  1B47 A;  1FF1 A;  2QAC A;  1QLS A;  3IQO A;  2OTG B;  2F33 A;  1OE9 B;  3JVT C;  1J1E A;  2M1K B;  1QIV A;  2LVJ A;  1DJI A;  1TCO B;  2K2A A;  3KHE A;  3TS5 C;  1SY9 A;  3VRN A;  2EC6 B;  1J7Q A;  1QVI Z;  3BUO B;  1JUO A;  2LVI A;  1GGW A;  1SL8 A;  4MRX A;  2EGD A;  2MHH A;  1DJY A;  2M9G A;  4WQ3 A;  2KBM A;  1F70 A;  4OVN F;  2OS8 C;  4R1E A;  1BR1 B;  1MXE A;  1N65 A;  1CLB A;  1S36 A;  1TRF A;  1IJ5 A;  3JVT B;  3TS5 B;  2JRF A;  1DF0 A;  1QX2 A;  1YTZ C;  2KSP A;  5B8I B;  1IKU A;  1H4B A;  1DJX A;  2LE9 B;  2JZI A;  3PM8 A;  4HRG A;  1FPW A;  2NXQ A;  2IS9 A;  1AJ5 A;  1M46 A;  5AFP A;  2K61 A;  2KYF A;  2H61 A;  3DF0 B;  2ZN8 A;  3QRX A;  1UHH A;  2M0R A;  3A4U B;  3BOW A;  1KFX L;  1PSB A;  2JU0 A;  1DJG A;  4YI8 A;  1NP8 A;  2I94 A;  3RM1 A;  1QV0 A;  2P6B B;  3EK4 A;  4UPG A;  3TDU A;  2GGM A;  1XK4 A;  1UWO A;  3C1V A;  1K93 D;  1QXP A;  1DT7 B;  2I2R E;  1JC2 A;  3PAT A;  2LV7 A;  1KSO A;  3HCM A;  3GOF A;  3LL8 B;  2KYC A;  1S6C A;  1SL9 A;  1XFU O;  2JC2 A;  1LA3 A;  4NDC A;  4FQO A;  4MN0 A;  1MR8 A;  2CNP A;  1WRL A;  3FWB A;  2WCF A;  3JTD C;  1HT9 A;  2AUC A;  1QJT A;  4PCW A;  5K89 A;  1ZMZ A;  2BE4 A;  4FTG A;  2BKI B;  1WLM A;  4AOM A;  5JJG A;  3D0Y A;  1MHO A;  1IQ3 A;  1K2H A;  1J7R A;  1NIW A;  3VRO A;  3CR5 X;  1D1O A;  3DD4 A;  2I18 A;  2K2F A;  1BOC A;  1EG4 A;  3DVJ A;  3KO0 A;  2CCM A;  4DRW A;  1SL7 A;  4NDD A;  4YGD B;  2FJU B;  3JTD B;  1KQM C;  1YX8 A;  3NSI A;  4OCI A;  5AEQ A;  5HKW A;  1B8R A;  1IWQ A;  3KF9 A;  4AQJ A;  1QTX A;  1S6J A;  2ZNE A;  1S5G Y;  1RJV A;  1JSA A;  4MVF A;  1YVL A;  2ZRS A;  1JBA A;  2EHB A;  3TUY C;  2FOT A;  5CSN A;  1SNL A;  2KFH A;  4AQI A;  2CTN A;  1B8L A;  2M29 A;  1M45 A;  1ALW A;  2WOS A;  2LVV A;  2K8M B;  1TNX A;  1Y1X A;  2M7N A;  4GUK A;  4YBH B;  4DIR A;  5CSF A;  1KQV A;  2HET A;  3I5G C;  1NCZ A;  4USL A;  4YRU A;  1MUX A;  3BUX B;  2NCO A;  1NYA A;  1K9K A;  1XA5 A;  1LXF C;  1YX7 A;  5KSZ A;  1V1G A;  3BQ3 A;  1AJ4 A;  1TN4 A;  1JFK A;  1UHK A;  1B8C A;  1EH2 A;  1DJZ A;  3TUY B;  1G4Y R;  1C7W A;  3KPX A;  4N1F A;  2F2P A;  5G08 A;  1LVC D;  1TNW A;  3VRR A;  1JWD A;  1OZO A;  4QJ5 B;  1JF2 A;  2B1U A;  4WRI A;  2JUL A;  1TNP A;  5F6T A;  3I5G B;  2H2K A;  2HF5 A;  1SMG A;  2KI4 C;  4M2Q A;  2JT3 A;  2KAY A;  1PK0 D;  1SRA A;  2DOQ A;  2Y4Q A;  1OSA A;  3A8R A;  4MLW A;  1J1D A;  1QIW A;  2D8N A;  2ZRT A;  3M0W A;  2JTT A;  2MBX A;  1B7T Z;  1SCV A;  2SAS A;  4YI9 A;  3OB1 B;  1YRT B;  4WQ2 A;  3NXA A;  3PN7 C;  1QLK A;  1SCM B;  1RK9 A;  2F2O A;  1DGV A;  2JWW A;  1REC A;  1BLQ A;  1AP4 A;  1DJW A;  3PLF B;  5DKN A;  1BMO A;  2ZKM X;  2KI4 B;  2LLS A;  1YVH A;  2H61 C;  2KGR A;  1AUI B;  1S1E A;  3FS7 A;  3SG5 A;  4BY5 A;  5DKR A;  4GBA A;  4GGF A;  2E30 A;  4F0Z B;  4MEW A;  2KAX A;  3SJS A;  3WHU B;  1DF0 B;  2KI6 D;  1C07 A;  1TOP A;  3PN7 B;  1IH0 A;  2FCE A;  1XK4 C;  2KNE A;  5I2Q A;  4XJK A;  2BEC A;  2PSR A;  1FI5 A;  1J7O A;  1R2U A;  3BXK A;  1CM4 A;  4ZCV A;  5FYX A;  1B9A A;  1GJY A;  1WRZ A;  2I7A A;  3O6B A;  4ORC B;  2LMT A;  1XO5 A;  3BOW B;  4PE0 A;  2OS8 B;  3CLN A;  2O60 A;  5JOL A;  1A4P A;  1B1G A;  1S3P A;  4MBE A;  4MZK A;  4OKH A;  2WND A;  1FI6 A;  3WXA A;  2NZ0 A;  1OQP A;  2Y1N A;  2BCX A;  1S26 D;  1A75 A;  1QAT A;  2RGI A;  2LUC A;  3AKA A;  3TDI A;  1LA0 A;  2AMI A;  2M1U A;  3GK2 A;  1B4C A;  1DGU A;  2HQW A;  2KOT A;  1E8A A;  1EL4 A;  1R6P A;  2JT8 A;  3AKB A;  5J3X A;  1BOD A;  1OZS A;  3NSO A;  4ORB B;  1K90 D;  1G33 A;  1SBJ A;  2FCD A;  3DVE A;  2JXL A;  2O5G A;  2QPT A;  4CLN A;  2L98 A;  2PRU A;  4I5L B;  5ER4 X;  2KGB C;  4N5X A;  3D0Y B;  3I5I C;  3LK0 A;  2LAP A;  1M39 A;  3GK4 X;  1U5I A;  2HPS A;  4PHM A;  4YGE B;  1YRU B;  5I8N A;  2JTZ A;  2SCP A;  1RTP 1;  4GFT A;  5I2O A;  3LLE A;  1J7P A;  2JXC A;  3EVR A;  2BKH B;  1QX5 B;  3BYA A;  4ZCU A;  1NX1 A;  3TDZ A;  1ALV A;  2LUX A;  1PVA A;  3O4Y A;  3NSL A;  4HRH A;  3I5H C;  4PHK A;  2LMV A;  1XFX O;  2V53 A;  1KWO C;  1BU3 A;  1SK6 D;  2WC8 A;  2WOR A;  4C0K A;  2GGZ A;  1QS7 A;  3EKJ A;  5AAN A;  2JPT A;  3I5I B;  1XFZ O;  3PSR A;  3SG2 A;  2M3W A;  1DVI A;  1L7Z A;  2K7C A;  2MRD A;  1S5G Z;  1CFD A;  2MJW B;  3EKH A;  3SG4 A;  1C7V A;  2JQ6 A;  3ZNI A;  2WCB A;  1K8U A;  4CFQ A;  2LHI A;  3GK1 A;  2LMU A;  5HKZ A;  4QJ4 B;  3K21 A;  1WRK A;  4MZJ A;  3CZT X;  1BT6 A;  2WCE A;  2BBN A;  3I5H B;  2L4H A;  1F71 A;  1IRJ A;  4OR9 B;  1KQM B;  1JF0 A;  1V1F A;  4CID A;  4GGN A;  1CFC A;  1CLL A;  1UHN A;  2M49 B;  4ETO A;  4CPV A;  2BL0 C;  1CKK A;  5TNC A;  1UP5 A;  1LKJ A;  1MF8 B;  2COL B;  1EG3 A;  1PSR A;  2LHL A;  4TNC A;  2K0J A;  2LAN A;  3O78 A;  1Q80 A;  2BBM A;  2CXJ A;  1IQ5 A;  3FWC A;  2PAS A;  1OMR A;  2PAL A;  1QV1 A;  1YUT A;  1CDN A;  1QX7 A;  1WDC C;  3LCP C;  1IGV A;  1M63 B;  3FIA A;  4Q04 A;  3VRQ A;  3I5F C;  1AK8 A;  4N1G A;  1GQM A;  5HLO A;  3E3R A;  3BUW B;  4GPL B;  1CFP A;  1AHR A;  1MXL C;  1KSM A;  2LC5 A;  1DTL A;  1YUR A;  1S6I A;  1KK7 Y;  1NX3 A;  2F8P A;  2LP2 A;  2K7O A;  4GGF C;  4M2P A;  4D1E A;  1BR4 B;  1UHJ A;  1KK8 C;  2KFG A;  2OTG C;  2L5X B;  1W7I B;  2Q91 A;  3TZ1 A;  1M31 A;  2KDH A;  1Y1A A;  2K7B A;  2NCP A;  5BPJ A;  4MZL A;  4PHJ A;  1CDM A;  3SG3 A;  2JNX A; 
#chains in the Genus database with same CATH topology
 1VRK A;  4P2Y B;  5DIC A;  1JFJ A;  5D7F A;  1WDC B;  4I5N B;  5AXI A;  3CTN A;  1CFF A;  3I5F B;  2PYQ A;  2G9B A;  3AAK A;  2GV5 A;  2M97 A;  2KQY A;  3VRP A;  2BCB A;  4DUQ A;  1NWD A;  2Q4U A;  2F3Z A;  3IQQ A;  4ORA B;  2QEH A;  3F45 A;  1K94 A;  2Y1M A;  3R1O A;  1F8H A;  1SPY A;  1KK8 B;  1NCX A;  2JNF A;  1EXR A;  1QVI Y;  2CT9 A;  1F55 A;  1CTR A;  2MLF C;  3D10 A;  3ICB A;  5AER A;  1BG1 A;  3DVM A;  1Y1U A;  1OOG A;  1EJ3 A;  1CB1 A;  4F7F A;  4XJK B;  5CSJ A;  2M8U A;  5I2L A;  2M7L A;  3V2L A;  1NX2 A;  3DVK A;  1Y6W A;  4JPZ B;  5CSI A;  3O4X A;  3FE8 A;  2VRG A;  2KAV A;  4GNK B;  1GM0 A;  2JT0 A;  1K9P A;  3O2P A;  2KFF A;  3OX5 A;  4A4B A;  1MQ1 A;  3PAL A;  1X02 A;  4MSP A;  2G2B A;  1UHI A;  3SG7 A;  1CDL A;  1N0Y A;  2JPO A;  2KLE A;  1BJF A;  3EK7 A;  2ZND A;  2L50 A;  4C0J A;  1ZUZ A;  3CGA A;  1CNP A;  5FI6 A;  4CFR A;  2BCA A;  2TN4 A;  1CMG A;  1J55 A;  1A75 B;  1NCY A;  1TIZ A;  2L5Y A;  3DF0 A;  3VB1 A;  1TTX A;  1FW4 A;  3S0B A;  1T14 A;  5I94 A;  3VGO A;  2KQ6 A;  3AAJ A;  4IL1 A;  4YGB B;  1F4Q A;  2E6W A;  2LLT A;  4PE7 A;  1OOJ A;  3CR2 A;  3HX4 A;  2ZN9 A;  3OB2 B;  4I5K A;  4A4C A;  2L2E A;  3KEV A;  3EVU A;  1UUR A;  3ZWH A;  1CMF A;  2AAO A;  1XVJ A;  1OMD A;  4L9M A;  3QME A;  4NDB A;  2L51 A;  3WNX B;  4DCK A;  1WY9 A;  2L0P A;  3NHT A;  3EK8 A;  5HYD A;  4IJ7 A;  1W7J B;  4PHN A;  4U8D A;  5FI2 A;  1U5I B;  1CDP A;  1A03 A;  2ISD A;  1PAL A;  4P5O E;  2WC6 A;  4HRE E;  4JKT A;  4PE4 A;  5HLV A;  1CM1 A;  5HKY A;  3D73 A;  2P70 A;  3RLZ A;  3SG6 A;  3PFV A;  1A2X A;  1SW8 A;  1NPQ A;  1HQV A;  2LP3 A;  2LCP A;  1TCF A;  2JOJ A;  2R2I A;  3LK1 A;  4OZD A;  3BUM B;  1ZOT B;  2K7D A;  1TNQ A;  3SIB A;  5KU1 A;  1PUL A;  4HSZ A;  2MA2 A;  5KTY A;  1ZFS A;  4PDZ A;  4M2O A;  4XYN A;  1LIN A;  4GAO A;  4OV2 A;  1XFW O;  1F4O A;  2KHN A;  1RFJ A;  3MSE B;  4JWQ A;  4BY4 A;  2HQ8 A;  1C3Z A;  4ICB A;  1NX0 A;  2ZFD A;  2BE6 A;  4E68 A;  1KCY A;  3OP0 A;  3H4S E;  1XFV O;  3D75 A;  1KFU S;  1YUU A;  2KBI A;  1OOF A;  1WLZ A;  3BUN B;  2PMY A;  1AVS A;  1L2O C;  1UUS A;  3OHM B;  1F54 A;  1KWO B;  1CLM A;  2CBL A;  3D78 A;  1G8I A;  1XFY O;  4PAL A;  1NUB A;  1W9Z A;  3CR4 X;  3CZ1 A;  4MRY A;  1RRO A;  2NLN A;  1RWY A;  1A29 A;  1SR6 C;  5DKQ A;  3CS1 A;  3D77 A;  5D3O A;  1K9U A;  1TUZ A;  5GQQ C;  1DMO A;  2LLU A;  2WCM A;  1GGZ A;  1IG5 A;  2L4I A;  2BNX A;  2MLE C;  3S0F A;  3SIA A;  1NSH A;  1MWN A;  3CWG A;  1XYD A;  5PAL A;  1OMV A;  4JQ0 D;  2FJY A;  2MAZ A;  1ZAC A;  3SS3 A;  1L2O B;  1FBV A;  1K96 A;  3B88 A;  4C0L A;  1YUS A;  2F3Y A;  4I5J A;  4DS7 A;  1YR5 A;  2ERB A;  2BL0 B;  1SR6 B;  1SYM A;  3DYE A;  1Y0V H;  4PE1 A;  1DJH A;  1N2D A;  1PVB A;  2OPO A;  3EVV A;  4NQG A;  1QAS A;  3R1V A;  1KK7 Z;  2LM5 A;  5CPV A;  1PRW A;  3NSK A;  4YGC B;  5ER5 A;  3WHT B;  1ODB A;  4PT1 A;  5IBW A;  5EL2 A;  2EC6 C;  1K95 A;  1SCM C;  1SKT A;  1BF5 A;  2A4J A;  1H8B A;  3IF7 A;  1KFX S;  2LVK A;  2Y5I A;  1KFU L;  2PVB A;  2LNK A;  1C3Y A;  1IJ6 A;  1B7T Y;  2KI6 C;  3OX6 A;  4QJ3 B;  5D69 A;  1B47 A;  1FF1 A;  2QAC A;  3L47 A;  1QLS A;  3IQO A;  2OTG B;  2F33 A;  1OE9 B;  3JVT C;  1J1E A;  2M1K B;  1QIV A;  2LVJ A;  1DJI A;  1TCO B;  2K2A A;  3KHE A;  3TS5 C;  1SY9 A;  2P71 A;  3VRN A;  2EC6 B;  3B7A A;  1J7Q A;  1QVI Z;  3BUO B;  1JUO A;  2LVI A;  1XFR A;  2WC5 A;  1GGW A;  3S0A A;  1SL8 A;  4MRX A;  2EGD A;  2MHH A;  1DJY A;  2M9G A;  4WQ3 A;  2KBM A;  3D76 A;  1F70 A;  4OVN F;  2OS8 C;  4R1E A;  1SSE B;  1BR1 B;  1MXE A;  1N65 A;  1CLB A;  1S36 A;  1TRF A;  1IJ5 A;  3JVT B;  3BFA A;  3BJH A;  4KYN A;  3TS5 B;  2JRF A;  1DF0 A;  1QX2 A;  1YTZ C;  2KSP A;  3S0G A;  5B8I B;  3RZS A;  1IKU A;  1H4B A;  1Z2C B;  1DJX A;  2LE9 B;  2JZI A;  3PM8 A;  4HRG A;  3L4A A;  1FPW A;  2NXQ A;  2IS9 A;  3UO9 A;  1AJ5 A;  1M46 A;  3D74 A;  2K61 A;  1DEK A;  5AFP A;  2KYF A;  2H61 A;  3DF0 B;  2ZN8 A;  3QRX A;  1UHH A;  2M0R A;  3A4U B;  3BOW A;  1KFX L;  1PSB A;  2JU0 A;  1DJG A;  4YI8 A;  1NP8 A;  1ORG A;  2I94 A;  3RM1 A;  1QV0 A;  2P6B B;  3EK4 A;  3R72 A;  3TDU A;  4UPG A;  2GGM A;  1XK4 A;  1UWO A;  3C1V A;  1K93 D;  1QXP A;  1DT7 B;  2I2R E;  1JC2 A;  3PAT A;  2LV7 A;  3B87 A;  1KSO A;  3HCM A;  3GOF A;  3LL8 B;  2KYC A;  3N7H A;  1XFU O;  1S6C A;  1SL9 A;  2JC2 A;  1LA3 A;  2PQL A;  4NDC A;  4FQO A;  4MN0 A;  1MR8 A;  2CNP A;  1WRL A;  3B6X A;  3FWB A;  2WCF A;  3JTD C;  1HT9 A;  2AUC A;  1QJT A;  4PCW A;  5K89 A;  1ZMZ A;  1QWV A;  2BE4 A;  4FTG A;  2BKI B;  1WLM A;  4AOM A;  5JJG A;  3D0Y A;  1MHO A;  1IQ3 A;  1K2H A;  1J7R A;  1NIW A;  3VRO A;  3CR5 X;  4INX A;  1D1O A;  4JD9 A;  3DD4 A;  2I18 A;  3Q8I A;  2K2F A;  1BOC A;  1EG4 A;  3DVJ A;  3KO0 A;  2CCM A;  4DRW A;  1SL7 A;  4NDD A;  4YGD B;  3UNW A;  2FJU B;  3JTD B;  1KQM C;  1YX8 A;  3NSI A;  4OCI A;  5AEQ A;  5HKW A;  1DEL A;  1B8R A;  1IWQ A;  3KF9 A;  4AQJ A;  1QTX A;  1S6J A;  4YGA A;  2ZNE A;  1S5G Y;  1RJV A;  1JSA A;  4MVF A;  3S0E A;  1YVL A;  2ZRS A;  1JBA A;  2EHB A;  3TUY C;  2FOT A;  5CSN A;  5HL1 A;  1SNL A;  2KFH A;  4AQI A;  2CTN A;  1B8L A;  3BFB A;  2M29 A;  1M45 A;  2L2C A;  1ALW A;  2WOS A;  1LS8 A;  2LVV A;  2K8M B;  1TNX A;  1Y1X A;  2M7N A;  4GUK A;  4YBH B;  4DIR A;  5CSF A;  1KQV A;  2HET A;  3I5G C;  1NCZ A;  4USL A;  3CZ0 A;  1MUX A;  4YRU A;  3BUX B;  2NCO A;  1NYA A;  1K9K A;  1XA5 A;  2H8V A;  1LXF C;  1YX7 A;  5KSZ A;  2GTE A;  1V1G A;  3BQ3 A;  1AJ4 A;  3DXL A;  1TN4 A;  1JFK A;  1UHK A;  1B8C A;  1EH2 A;  1DJZ A;  2QDI A;  1Z4H A;  1G4Y R;  1C7W A;  3FE9 A;  1P28 A;  3KPX A;  3TUY B;  4N1F A;  2F2P A;  5G08 A;  3S0D A;  1LVC D;  1TNW A;  3IVT A;  3VRR A;  1JWD A;  1OZO A;  4QJ5 B;  1JF2 A;  2B1U A;  4WRI A;  2JUL A;  1TNP A;  5F6T A;  3I5G B;  2H2K A;  2HF5 A;  1SMG A;  2WCH A;  2KI4 C;  4M2Q A;  2JT3 A;  2KAY A;  1PK0 D;  1SRA A;  2DOQ A;  2Y4Q A;  1OSA A;  3A8R A;  4MLW A;  1J1D A;  1QIW A;  2D8N A;  2ZRT A;  3M0W A;  2JTT A;  2MBX A;  1B7T Z;  1SCV A;  2SAS A;  4YI9 A;  3OB1 B;  1YRT B;  3BFH A;  3NXA A;  4WQ2 A;  3PN7 C;  1QLK A;  1SCM B;  1RK9 A;  2F2O A;  1DGV A;  2JWW A;  2KPH A;  3L4L A;  1REC A;  1BLQ A;  1AP4 A;  1DJW A;  3PLF B;  5DKN A;  1BMO A;  2ZKM X;  2KI4 B;  2LLS A;  1YVH A;  2H61 C;  2KGR A;  1AUI B;  1S1E A;  3FS7 A;  3SG5 A;  4BY5 A;  5DKR A;  4GBA A;  2WCK A;  4GGF A;  2E30 A;  5FI7 A;  4MEW A;  4F0Z B;  2KAX A;  3SJS A;  3NHI A;  3B86 A;  3WHU B;  3DY9 A;  3OGN A;  2QEV A;  1DF0 B;  1OOI X;  2KI6 D;  1TOP A;  3PN7 B;  1C07 A;  2FCE A;  1XK4 C;  2KNE A;  5I2Q A;  3PM2 A;  1IH0 A;  4XJK A;  2BEC A;  2PSR A;  1FI5 A;  1J7O A;  1R2U A;  3BXK A;  1CM4 A;  4ZCV A;  1OOH A;  3EG5 B;  1B9A A;  1GJY A;  1WRZ A;  2I7A A;  3O6B A;  4ORC B;  5FYX A;  2LMT A;  1XO5 A;  3BOW B;  4PE0 A;  2OS8 B;  3CLN A;  2O60 A;  5JOL A;  1A4P A;  1B1G A;  1S3P A;  4MBE A;  4MZK A;  4OKH A;  2WND A;  1FI6 A;  3WXA A;  3SS4 A;  2NZ0 A;  2KLD A;  1OQP A;  2Y1N A;  2BCX A;  1S26 D;  1A75 A;  1TUJ A;  1QAT A;  2RGI A;  2LUC A;  3AKA A;  3TDI A;  1LA0 A;  2AMI A;  2M1U A;  3GK2 A;  1B4C A;  1DQE A;  3CDN A;  1DGU A;  2HQW A;  2KOT A;  1E8A A;  3K1E A;  1EL4 A;  1R6P A;  2JT8 A;  3AKB A;  5J3X A;  1BOD A;  1OZS A;  3NSO A;  4ORB B;  1K90 D;  1G33 A;  1SBJ A;  2FCD A;  3DVE A;  2JXL A;  2O5G A;  2QPT A;  3CYZ A;  2L98 A;  2PRU A;  4I5L B;  5ER4 X;  2KGB C;  4CLN A;  2WCL A;  1OW4 A;  3CZ2 A;  4N5X A;  3D0Y B;  3I5I C;  3LK0 A;  2LAP A;  1M39 A;  3GK4 X;  1U5I A;  2HPS A;  3DZT A;  4PHM A;  1YRU B;  4YGE B;  2JTZ A;  5I8N A;  2SCP A;  1RTP 1;  2BAP A;  4GFT A;  3LLE A;  5I2O A;  2JXC A;  1J7P A;  3EVR A;  1DC1 A;  2BKH B;  1QX5 B;  3BYA A;  4ZCU A;  1NX1 A;  3TDZ A;  1ALV A;  2LUX A;  1PVA A;  3O4Y A;  3NSL A;  4HRH A;  3I5H C;  4PHK A;  2LMV A;  1XFX O;  2V53 A;  1KWO C;  1BU3 A;  1SK6 D;  2WC8 A;  2WOR A;  4C0K A;  2GGZ A;  1QS7 A;  3EKJ A;  5AAN A;  2JPT A;  3I5I B;  1XFZ O;  3PSR A;  4INW A;  3SG2 A;  2M3W A;  1DVI A;  1L7Z A;  2K7C A;  2MRD A;  1S5G Z;  1CFD A;  2MJW B;  3EKH A;  3NGV A;  3SG4 A;  1C7V A;  2JQ6 A;  3ZNI A;  2WCB A;  1K8U A;  4CFQ A;  2LHI A;  3FE6 A;  3GK1 A;  2LMU A;  5HKZ A;  4QJ4 B;  3K21 A;  1WRK A;  4MZJ A;  3CZT X;  1BT6 A;  2WCE A;  2BBN A;  3I5H B;  2L4H A;  3PJI A;  4FQT A;  1F71 A;  1IRJ A;  4OR9 B;  1KQM B;  1JF0 A;  1V1F A;  3OBV A;  4CID A;  4GGN A;  1CFC A;  1CLL A;  1UHN A;  2M49 B;  4ETO A;  3R1P A;  4CPV A;  2BL0 C;  1CKK A;  5TNC A;  1UP5 A;  1LKJ A;  1MF8 B;  2COL B;  1EG3 A;  1PSR A;  2LHL A;  4TNC A;  2K0J A;  2LAN A;  3O78 A;  1Q80 A;  3SS5 A;  2BBM A;  2CXJ A;  1IQ5 A;  3FWC A;  2PAS A;  2QEB A;  1OMR A;  2PAL A;  1QV1 A;  1YUT A;  2WCJ A;  1CDN A;  1QX7 A;  1WDC C;  3LCP C;  3CAB A;  1IGV A;  1M63 B;  1TWO A;  2QEO A;  3FIA A;  3I5F C;  4Q04 A;  4N1G A;  1GQM A;  5HLO A;  3E3R A;  3VRQ A;  1AK8 A;  3BUW B;  4GPL B;  1CFP A;  1AHR A;  1MXL C;  1KSM A;  2LC5 A;  1DTL A;  1YUR A;  1S6I A;  1KK7 Y;  1NX3 A;  2F8P A;  2LP2 A;  2K7O A;  2YGU A;  4GGF C;  4M2P A;  4D1E A;  1BR4 B;  1UHJ A;  1KK8 C;  2KFG A;  2OTG C;  2L5X B;  1W7I B;  2Q91 A;  3TZ1 A;  1M31 A;  2KDH A;  2K60 A;  1Y1A A;  1IIO A;  2K7B A;  2NCP A;  5BPJ A;  4MZL A;  4PHJ A;  1CDM A;  3SG3 A;  2JNX A; 
#chains in the Genus database with same CATH homology
 1VRK A;  4P2Y B;  1JFJ A;  5D7F A;  1WDC B;  4I5N B;  5AXI A;  3CTN A;  1CFF A;  3I5F B;  3AAK A;  2G9B A;  2GV5 A;  2M97 A;  2KQY A;  3VRP A;  2BCB A;  4DUQ A;  1NWD A;  2Q4U A;  2F3Z A;  3IQQ A;  4ORA B;  3F45 A;  1F8H A;  1K94 A;  2Y1M A;  1SPY A;  1KK8 B;  1NCX A;  2JNF A;  1EXR A;  1QVI Y;  2CT9 A;  1F55 A;  1CTR A;  2MLF C;  3D10 A;  3ICB A;  5AER A;  1BG1 A;  3DVM A;  1Y1U A;  1EJ3 A;  1CB1 A;  4XJK B;  5CSJ A;  2M8U A;  5I2L A;  2M7L A;  1NX2 A;  3DVK A;  1Y6W A;  4JPZ B;  5CSI A;  2VRG A;  2KAV A;  4GNK B;  2JT0 A;  1K9P A;  3O2P A;  2KFF A;  3OX5 A;  4A4B A;  1MQ1 A;  3PAL A;  1X02 A;  4MSP A;  2G2B A;  1UHI A;  3SG7 A;  1CDL A;  1N0Y A;  3EK7 A;  1BJF A;  2ZND A;  2L50 A;  4C0J A;  1ZUZ A;  3CGA A;  1CNP A;  4CFR A;  2BCA A;  2TN4 A;  1CMG A;  1J55 A;  1A75 B;  1NCY A;  1TIZ A;  3DF0 A;  1TTX A;  1FW4 A;  3VGO A;  2KQ6 A;  3AAJ A;  4IL1 A;  4YGB B;  1F4Q A;  2E6W A;  2LLT A;  4PE7 A;  1OOJ A;  3CR2 A;  3HX4 A;  2ZN9 A;  3OB2 B;  4I5K A;  4A4C A;  2L2E A;  3KEV A;  3EVU A;  1UUR A;  3ZWH A;  1CMF A;  2AAO A;  1XVJ A;  1OMD A;  4L9M A;  4NDB A;  3WNX B;  2L51 A;  4DCK A;  1WY9 A;  2L0P A;  3EK8 A;  5HYD A;  1W7J B;  4PHN A;  4U8D A;  1U5I B;  1CDP A;  1A03 A;  2ISD A;  1PAL A;  4P5O E;  4HRE E;  4PE4 A;  5HLV A;  1CM1 A;  5HKY A;  3RLZ A;  3SG6 A;  3PFV A;  1A2X A;  1SW8 A;  1NPQ A;  1HQV A;  2LP3 A;  2LCP A;  1TCF A;  2JOJ A;  2R2I A;  3LK1 A;  4YGA A;  3BUM B;  1ZOT B;  2K7D A;  1TNQ A;  3SIB A;  5KU1 A;  1PUL A;  4HSZ A;  2MA2 A;  5KTY A;  1ZFS A;  4PDZ A;  4M2O A;  4XYN A;  1LIN A;  4GAO A;  4OV2 A;  1XFW O;  1F4O A;  2KHN A;  1RFJ A;  3MSE B;  4JWQ A;  4BY4 A;  2HQ8 A;  4ICB A;  1NX0 A;  2ZFD A;  2BE6 A;  4E68 A;  1KCY A;  3OP0 A;  3H4S E;  1XFV O;  1KFU S;  1YUU A;  2KBI A;  1WLZ A;  3BUN B;  2PMY A;  1AVS A;  1L2O C;  1UUS A;  3OHM B;  1F54 A;  1KWO B;  1CLM A;  2CBL A;  1G8I A;  1XFY O;  4PAL A;  1NUB A;  3CR4 X;  4MRY A;  1RRO A;  2NLN A;  1RWY A;  1A29 A;  1SR6 C;  5DKQ A;  3CS1 A;  1K9U A;  5GQQ C;  1DMO A;  2LLU A;  1GGZ A;  1IG5 A;  2L4I A;  2MLE C;  3SIA A;  1NSH A;  1MWN A;  3CWG A;  1XYD A;  5PAL A;  1OMV A;  4JQ0 D;  2MAZ A;  1ZAC A;  1L2O B;  1FBV A;  1K96 A;  4C0L A;  1YUS A;  2F3Y A;  4I5J A;  4DS7 A;  1YR5 A;  2BL0 B;  1SR6 B;  1SYM A;  1Y0V H;  4PE1 A;  1DJH A;  1N2D A;  1PVB A;  2OPO A;  3EVV A;  4NQG A;  1QAS A;  5CPV A;  1KK7 Z;  2LM5 A;  4YGC B;  1PRW A;  3NSK A;  3WHT B;  5ER5 A;  1ODB A;  5IBW A;  2EC6 C;  1K95 A;  1SCM C;  1SKT A;  1BF5 A;  2A4J A;  1H8B A;  3IF7 A;  1KFX S;  2LVK A;  2Y5I A;  1KFU L;  2PVB A;  2LNK A;  1IJ6 A;  1B7T Y;  2KI6 C;  3OX6 A;  4QJ3 B;  5D69 A;  1B47 A;  1FF1 A;  2QAC A;  1QLS A;  3IQO A;  2OTG B;  2F33 A;  1OE9 B;  3JVT C;  1J1E A;  2M1K B;  1QIV A;  2LVJ A;  1DJI A;  1TCO B;  2K2A A;  3KHE A;  3TS5 C;  1SY9 A;  3VRN A;  2EC6 B;  1J7Q A;  1QVI Z;  3BUO B;  1JUO A;  2LVI A;  1GGW A;  1SL8 A;  4MRX A;  2EGD A;  2MHH A;  1DJY A;  2M9G A;  4WQ3 A;  2KBM A;  1F70 A;  4OVN F;  2OS8 C;  4R1E A;  1BR1 B;  1MXE A;  1N65 A;  1CLB A;  1S36 A;  1TRF A;  1IJ5 A;  3JVT B;  3TS5 B;  2JRF A;  1DF0 A;  1QX2 A;  1YTZ C;  2KSP A;  5B8I B;  1IKU A;  1H4B A;  1DJX A;  2LE9 B;  2JZI A;  3PM8 A;  4HRG A;  1FPW A;  2NXQ A;  2IS9 A;  1AJ5 A;  1M46 A;  5AFP A;  2K61 A;  2KYF A;  2H61 A;  3DF0 B;  2ZN8 A;  3QRX A;  1UHH A;  2M0R A;  3A4U B;  3BOW A;  1KFX L;  1PSB A;  2JU0 A;  1DJG A;  4YI8 A;  1NP8 A;  2I94 A;  3RM1 A;  1QV0 A;  2P6B B;  3EK4 A;  4UPG A;  3TDU A;  2GGM A;  1XK4 A;  1UWO A;  3C1V A;  1K93 D;  1QXP A;  1DT7 B;  2I2R E;  1JC2 A;  3PAT A;  2LV7 A;  1KSO A;  3HCM A;  3GOF A;  3LL8 B;  2KYC A;  1S6C A;  1SL9 A;  1XFU O;  2JC2 A;  1LA3 A;  4NDC A;  4FQO A;  4MN0 A;  1MR8 A;  2CNP A;  1WRL A;  3FWB A;  2WCF A;  3JTD C;  1HT9 A;  2AUC A;  1QJT A;  4PCW A;  5K89 A;  1ZMZ A;  2BE4 A;  4FTG A;  2BKI B;  1WLM A;  4AOM A;  5JJG A;  3D0Y A;  1MHO A;  1IQ3 A;  1K2H A;  1J7R A;  1NIW A;  3VRO A;  3CR5 X;  1D1O A;  3DD4 A;  2I18 A;  2K2F A;  1BOC A;  1EG4 A;  3DVJ A;  3KO0 A;  2CCM A;  4DRW A;  1SL7 A;  4NDD A;  4YGD B;  2FJU B;  3JTD B;  1KQM C;  1YX8 A;  3NSI A;  4OCI A;  5AEQ A;  5HKW A;  1B8R A;  1IWQ A;  3KF9 A;  4AQJ A;  1QTX A;  1S6J A;  2ZNE A;  1S5G Y;  1RJV A;  1JSA A;  4MVF A;  1YVL A;  2ZRS A;  1JBA A;  2EHB A;  3TUY C;  2FOT A;  5CSN A;  1SNL A;  2KFH A;  4AQI A;  2CTN A;  1B8L A;  2M29 A;  1M45 A;  1ALW A;  2WOS A;  2LVV A;  2K8M B;  1TNX A;  1Y1X A;  2M7N A;  4GUK A;  4YBH B;  4DIR A;  5CSF A;  1KQV A;  2HET A;  3I5G C;  1NCZ A;  4USL A;  4YRU A;  1MUX A;  3BUX B;  2NCO A;  1NYA A;  1K9K A;  1XA5 A;  1LXF C;  1YX7 A;  5KSZ A;  1V1G A;  3BQ3 A;  1AJ4 A;  1TN4 A;  1JFK A;  1UHK A;  1B8C A;  1EH2 A;  1DJZ A;  3TUY B;  1G4Y R;  1C7W A;  3KPX A;  4N1F A;  2F2P A;  5G08 A;  1LVC D;  1TNW A;  3VRR A;  1JWD A;  1OZO A;  4QJ5 B;  1JF2 A;  2B1U A;  4WRI A;  2JUL A;  1TNP A;  5F6T A;  3I5G B;  2H2K A;  2HF5 A;  1SMG A;  2KI4 C;  4M2Q A;  2JT3 A;  2KAY A;  1PK0 D;  1SRA A;  2DOQ A;  2Y4Q A;  1OSA A;  3A8R A;  4MLW A;  1J1D A;  1QIW A;  2D8N A;  2ZRT A;  3M0W A;  2JTT A;  2MBX A;  1B7T Z;  1SCV A;  2SAS A;  4YI9 A;  3OB1 B;  1YRT B;  4WQ2 A;  3NXA A;  3PN7 C;  1QLK A;  1SCM B;  1RK9 A;  2F2O A;  1DGV A;  2JWW A;  1REC A;  1BLQ A;  1AP4 A;  1DJW A;  3PLF B;  5DKN A;  1BMO A;  2ZKM X;  2KI4 B;  2LLS A;  1YVH A;  2H61 C;  2KGR A;  1AUI B;  1S1E A;  3FS7 A;  3SG5 A;  4BY5 A;  5DKR A;  4GBA A;  4GGF A;  2E30 A;  4F0Z B;  4MEW A;  2KAX A;  3SJS A;  3WHU B;  1DF0 B;  2KI6 D;  1C07 A;  1TOP A;  3PN7 B;  1IH0 A;  2FCE A;  1XK4 C;  2KNE A;  5I2Q A;  4XJK A;  2BEC A;  2PSR A;  1FI5 A;  1J7O A;  1R2U A;  3BXK A;  1CM4 A;  4ZCV A;  5FYX A;  1B9A A;  1GJY A;  1WRZ A;  2I7A A;  3O6B A;  4ORC B;  2LMT A;  1XO5 A;  3BOW B;  4PE0 A;  2OS8 B;  3CLN A;  2O60 A;  5JOL A;  1A4P A;  1B1G A;  1S3P A;  4MBE A;  4MZK A;  4OKH A;  2WND A;  1FI6 A;  3WXA A;  2NZ0 A;  1OQP A;  2Y1N A;  2BCX A;  1S26 D;  1A75 A;  1QAT A;  2RGI A;  2LUC A;  3AKA A;  3TDI A;  1LA0 A;  2AMI A;  2M1U A;  3GK2 A;  1B4C A;  1DGU A;  2HQW A;  2KOT A;  1E8A A;  1EL4 A;  1R6P A;  2JT8 A;  3AKB A;  5J3X A;  1BOD A;  1OZS A;  3NSO A;  4ORB B;  1K90 D;  1G33 A;  1SBJ A;  2FCD A;  3DVE A;  2JXL A;  2O5G A;  2QPT A;  4CLN A;  2L98 A;  2PRU A;  4I5L B;  5ER4 X;  2KGB C;  4N5X A;  3D0Y B;  3I5I C;  3LK0 A;  2LAP A;  1M39 A;  3GK4 X;  1U5I A;  2HPS A;  4PHM A;  4YGE B;  1YRU B;  5I8N A;  2JTZ A;  2SCP A;  1RTP 1;  4GFT A;  5I2O A;  3LLE A;  1J7P A;  2JXC A;  3EVR A;  2BKH B;  1QX5 B;  3BYA A;  4ZCU A;  1NX1 A;  3TDZ A;  1ALV A;  2LUX A;  1PVA A;  3O4Y A;  3NSL A;  4HRH A;  3I5H C;  4PHK A;  2LMV A;  1XFX O;  2V53 A;  1KWO C;  1BU3 A;  1SK6 D;  2WC8 A;  2WOR A;  4C0K A;  2GGZ A;  1QS7 A;  3EKJ A;  5AAN A;  2JPT A;  3I5I B;  1XFZ O;  3PSR A;  3SG2 A;  2M3W A;  1DVI A;  1L7Z A;  2K7C A;  2MRD A;  1S5G Z;  1CFD A;  2MJW B;  3EKH A;  3SG4 A;  1C7V A;  2JQ6 A;  3ZNI A;  2WCB A;  1K8U A;  4CFQ A;  2LHI A;  3GK1 A;  2LMU A;  5HKZ A;  4QJ4 B;  3K21 A;  1WRK A;  4MZJ A;  3CZT X;  1BT6 A;  2WCE A;  2BBN A;  3I5H B;  2L4H A;  1F71 A;  1IRJ A;  4OR9 B;  1KQM B;  1JF0 A;  1V1F A;  4CID A;  4GGN A;  1CFC A;  1CLL A;  1UHN A;  2M49 B;  4ETO A;  4CPV A;  2BL0 C;  1CKK A;  5TNC A;  1UP5 A;  1LKJ A;  1MF8 B;  2COL B;  1EG3 A;  1PSR A;  2LHL A;  4TNC A;  2K0J A;  2LAN A;  3O78 A;  1Q80 A;  2BBM A;  2CXJ A;  1IQ5 A;  3FWC A;  2PAS A;  1OMR A;  2PAL A;  1QV1 A;  1YUT A;  1CDN A;  1QX7 A;  1WDC C;  3LCP C;  1IGV A;  1M63 B;  3FIA A;  4Q04 A;  3VRQ A;  3I5F C;  1AK8 A;  4N1G A;  1GQM A;  5HLO A;  3E3R A;  3BUW B;  4GPL B;  1CFP A;  1AHR A;  1MXL C;  1KSM A;  2LC5 A;  1DTL A;  1YUR A;  1S6I A;  1KK7 Y;  1NX3 A;  2F8P A;  2LP2 A;  2K7O A;  4GGF C;  4M2P A;  4D1E A;  1BR4 B;  1UHJ A;  1KK8 C;  2KFG A;  2OTG C;  2L5X B;  1W7I B;  2Q91 A;  3TZ1 A;  1M31 A;  2KDH A;  1Y1A A;  2K7B A;  2NCP A;  5BPJ A;  4MZL A;  4PHJ A;  1CDM A;  3SG3 A;  2JNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...