1KK8B

Scallop myosin (s1-adp-befx) in the actin-detached conformation
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
139
structure length
139
Chain Sequence
PQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords Myosin Heavy Chain, Striated muscle
publication title Crystallographic findings on the internally uncoupled and near-rigor states of myosin: further insights into the mechanics of the motor.
pubmed doi rcsb
total genus 34
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2001-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kk8B01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kk8B02
1NSHA 4PE7A 4U8DA 5HKYA 1WDCB 1WRKA 2I18A 3CR2A 4N5XA 1CTRA 2K7DA 1CNPA 1BMOA 1CB1A 3O78A 1G8IA 3BUWB 3HCMA 3KF9A 1KK7Y 4YGEB 2BE4A 1N65A 4AOMA 3JVTC 2MRDA 1QXPA 2OS8C 3EK7A 1PSBA 1R6PA 2BL0C 3DVEA 1EL4A 2LHLA 1OSAA 3EVVA 1B9AA 2LE9B 5HYDA 1AJ4A 3IF7A 2WORA 2QPTA 3OX5A 1YR5A 2K61A 5IBWA 1DJXA 1YUSA 1YX7A 2LUXA 2EGDA 3FWCA 4QJ3B 1OOJA 1PALA 1QASA 2LMVA 3TUYC 1K8UA 3NSIA 4I5NB 1OQPA 1PVBA 3PLFB 1CM1A 4PHNA 2KDHA 2LVVA 3PALA 3TDZA 1SMGA 2F2OA 4Q04A 2JTTA 4GUKA 4NQGA 3EKJA 2K2FA 2LAPA 1MF8B 1NPQA 2HPSA 4QJ5B 1NIWA 1C7WA 2ZNDA 1N0YA 2MJWB 1M31A 3JTDB 2NCOA 5HKWA 2FCDA 3I5GB 5GQQC 2FCEA 2NLNA 3ICBA 1WLZA 1CDMA 1OE9B 4CIDA 2CXJA 5CSFA 3AKBA 1TNPA 2KFHA 1K94A 2KI6C 2Y1NA 1GGZA 1CFFA 4I5LB 1UHHA 1D1OA 1M63B 1UWOA 1MWNA 1S36A 1G4YR 1PVAA 1YVHA 3GK2A 1GJYA 2HQ8A 4HRHA 2PALA 3DVMA 1IH0A 2LNKA 5DKRA 1IKUA 2JXCA 2Y5IA 3PN7C 1CM4A 3H4SE 2M8UA 2WC8A 1YTZC 3DF0B 3SG6A 2LLTA 2EHBA 2PRUA 1F55A 4YGCB 4MN0A 1QV1A 1KK8C 2LVKA 3OB1B 4GGNA 1NX2A 3BUOB 3I5FB 1SPYA 4M2OA 2CT9A 1WDCC 1JFJA 2PMYA 3AAJA 4OV2A 2Q4UA 4PHKA 3M0WA 5ER5A 1DF0A 3VRQA 3EVUA 3WHTB 2G2BA 1B8LA 2KBMA 1W7JB 1S5GZ 1Y0VH 4HREE 3OX6A 2ZFDA 1NWDA 4OR9B 3I5HB 2BCXA 4MRYA 2KQYA 1TNXA 3RLZA 3CWGA 3FWBA 2R2IA 1LA0A 3CR5X 2LUCA 2BKHB 1N2DA 1IWQA 2F33A 3RM1A 2G9BA 1J1EA 4I5JA 3SG5A 5JOLA 2M29A 1IG5A 2F3YA 2I7AA 4XYNA 4YGDB 2ISDA 3VRNA 1DF0B 2L4IA 2ZN9A 3IQQA 1SCMB 2JC2A 1AK8A 4XJKA 1KWOB 2KNEA 2KOTA 1RECA 1XFUO 1ZMZA 4MSPA 1H4BA 5DKNA 4MZLA 2BECA 1SNLA 1SKTA 1YUTA 1YRUB 1KFUL 2WCEA 5B8IB 1MXLC 1UUSA 2SCPA 1LXFC 1S5GY 4MVFA 2K2AA 4OKHA 3JTDC 1EG3A 4M2PA 1CMFA 1E8AA 3I5GC 3PN7B 1ALVA 1XO5A 1UURA 1H8BA 1JUOA 1NX0A 1IGVA 4DCKA 1FI6A 3F45A 3A4UB 2WCFA 5KSZA 5D7FA 4NDBA 2B1UA 2ZRTA 3EVRA 4OVNF 1DJGA 1S1EA 2KI4B 1QV0A 4P5OE 2SASA 1CFCA 3GK1A 2JTZA 3VROA 4JWQA 1V1FA 1YVLA 2CTNA 2ZN8A 3WXAA 3MSEB 3LLEA 1BT6A 1CLLA 1B8RA 1F54A 1LINA 1QVIZ 1CLMA 1DJYA 3KEVA 3LCPC 4N1GA 1AUIB 1K95A 1JC2A 1RJVA 1SRAA 1YUUA 2JQ6A 2BBNA 2KI6D 2L51A 3I5FC 2KBIA 1EG4A 2BE6A 3K21A 1QATA 2D8NA 2DOQA 4MEWA 3CS1A 1IJ5A 1PULA 1XFXO 3DVKA 4ETOA 1A29A 1MHOA 3AKAA 1OMRA 3KHEA 4ZCUA 3DD4A 3OP0A 1CDNA 1JWDA 1B7TZ 1SBJA 2JXLA 3I5HC 1ZFSA 3GOFA 2M3WA 3BUNB 1KFXL 2E30A 4D1EA 1XFYO 2F2PA 1TOPA 3PATA 1XFVO 2KYFA 2JRFA 1LVCD 4WQ2A 1XVJA 1QTXA 3DF0A 2A4JA 2E6WA 1A2XA 1SCMC 1KWOC 5DKQA 2L2EA 1CFDA 3BYAA 3SG4A 1B1GA 1TNWA 1SYMA 2O5GA 2LMUA 4HRGA 1RWYA 1B4CA 2MA2A 4I5KA 4F0ZB 4FTGA 1F70A 1C7VA 1V1GA 2M7NA 3BUMB 3D0YA 1TCFA 4GPLB 1FPWA 1NX3A 2KGBC 1YRTB 1BR1B 3BQ3A 4YI9A 1BG1A 1CKKA 3D10A 3KO0A 5G08A 1Y1AA 1SY9A 4GGFA 1DJZA 1TNQA 1CDLA 1SR6B 2JPTA 2KAYA 2LLUA 4PDZA 1U5IA 2KI4C 1BF5A 1BOCA 4OCIA 1K93D 2HQWA 5HKZA 2M1KB 1JBAA 4ORAB 4MLWA 4JPZB 2L5XB 4MZJA 2VRGA 1XK4C 2L4HA 3SJSA 1TIZA 2GV5A 1GGWA 2GGZA 2JZIA 3D0YB 3SG7A 1IJ6A 1F4OA 2V53A 2LM5A 2JT3A 4GAOA 4C0KA 1LKJA 3FS7A 3ZWHA 1ODBA 2LCPA 1QIWA 4PE0A 1PSRA 2Y1MA 1K2HA 1XA5A 5CSIA 3EK8A 1IQ3A 1QS7A 3I5IB 1B47A 1OMVA 1SL8A 1U5IB 1NUBA 2P6BB 1DJIA 2HETA 2HF5A 2LMTA 2QACA 3VRRA 2JNFA 4DRWA 5AEQA 1WRZA 1AP4A 2MLFC 3PM8A 1DMOA 1M39A 3NXAA 2I94A 3O6BA 2LVIA 5I2OA 2Q91A 3EK4A 5AXIA 2M7LA 2LV7A 1OZSA 4ICBA 4NDDA 2K8MB 1S6JA 2IS9A 2CBLA 1G33A 3SG3A 2TN4A 1XK4A 2M9GA 3LK0A 4WRIA 1CLBA 2MLEC 1CFPA 2WCBA 1B8CA 5ER4X 4YRUA 2Y4QA 3AAKA 1KQMB 2CCMA 2LP3A 3NSOA 1SL9A 3LL8B 1UHKA 3CTNA 5AFPA 5TNCA 2BBMA 1JFKA 3SIAA 2JWWA 3HX4A 1YX8A 1W7IB 1WLMA 3OHMB 5D69A 2O60A 4L9MA 4CFQA 5K89A 4USLA 2PASA 2CNPA 3PSRA 1J55A 1KFUS 3CR4X 3CZTX 1J1DA 1VRKA 4CFRA 1AJ5A 1A03A 1NX1A 1EJ3A 4PALA 1L2OB 5HLOA 5KTYA 2BKIB 4GNKB 1KSMA 5CSNA 1R2UA 1BU3A 1C07A 1XYDA 1SR6C 2AUCA 1Q80A 1F8HA 4GFTA 4PCWA 4P2YB 2KGRA 2LVJA 1QX7A 4C0JA 2MHHA 5AANA 1L7ZA 4TNCA 1S6CA 1BLQA 1JSAA 2RGIA 3OB2B 4JQ0D 2JNXA 1DTLA 4N1FA 4A4BA 1J7RA 1ZUZA 1KCYA 2L98A 2ZKMX 1FI5A 4ORBB 1SL7A 2JULA 1M46A 2GGMA 2K7OA 2JU0A 1DGUA 1J7QA 1WRLA 2ZNEA 2PSRA 1MQ1A 1PK0D 1UP5A 1S6IA 4GGFC 5F6TA 4M2QA 3I5IC 1AHRA 1CMGA 3FIAA 2H61C 2FJUB 1F71A 1F4QA 1FF1A 2K7BA 1FW4A 1HQVA 1QVIY 2M97A 1IRJA 4E68A 4PHMA 3TS5B 1RROA 1KQVA 2KHNA 1QLKA 2LC5A 4PE4A 5I2QA 1RTP1 3SIBA 5PALA 1NP8A 1K9KA 3NSKA 3VRPA 2K0JA 2KQ6A 2COLB 1KFXS 4MZKA 1YURA 3PFVA 4BY5A 2NCPA 3CGAA 1DT7B 1FBVA 1PRWA 1TRFA 2KAXA 1MXEA 2F8PA 2OTGC 2KYCA 2ZRSA 2WOSA 1B7TY 1S3PA 1KQMC 2LP2A 1A75A 3BXKA 1RK9A 2L0PA 3LK1A 5I2LA 1TTXA 1EH2A 5BPJA 2BCBA 4R1EA 4ZCVA 2OPOA 4YGBB 4ORCB 5FYXA 4AQJA 3KPXA 1SK6D 1XFWO 2H61A 1SCVA 2EC6B 2AMIA 3QRXA 5HLVA 2LANA 3VGOA 4FQOA 2WNDA 1BJFA 4C0LA 1DGVA 2H2KA 2JT0A 3IQOA 2K7CA 2F3ZA 1J7PA 1L2OC 4CPVA 1TCOB 1A75B 5J3XA 4DUQA 1ALWA 1SW8A 3JVTB 4PHJA 4PE1A 2OS8B 1J7OA 3TZ1A 2BL0B 1NCZA 4YI8A 1OZOA 1OMDA 4HSZA 2LLSA 3ZNIA 5CSJA 4GBAA 3NSLA 1NYAA 4WQ3A 4DS7A 1GQMA 1EXRA 1QIVA 1K96A 1Y1XA 1CDPA 3A8RA 2AAOA 3EKHA 2L50A 2NZ0A 2BCAA 2KAVA 4DIRA 1BODA 1K90D 1X02A 1DJHA 2M0RA 4CLNA 1QX5B 1TN4A 2NXQA 3TUYB 4QJ4B 1HT9A 3SG2A 3TDIA 3O4YA 1UHJA 2JT8A 1K9PA 1NCXA 2FOTA 1MR8A 1A4PA 4BY4A 5CPVA 1QJTA 1KSOA 3WHUB 1JF0A 2OTGB 1ZOTB 3TDUA 1QX2A 1QLSA 1IQ5A 2KFFA 4IL1A 1LA3A 3TS5C 5AERA 3BOWA 2MBXA 1ZACA 1JF2A 2M1UA 1XFZO 1UHIA 2KFGA 2M49B 3BUXB 4YGAA 2KSPA 3O2PA 4NDCA 1KK7Z 4AQIA 1UHNA 2JOJA 4YBHB 4A4CA 1DVIA 3C1VA 2PVBA 4UPGA 1Y6WA 3CLNA 1NCYA 3DVJA 2I2RE 5KU1A 1WY9A 1BR4B 5JJGA 1MUXA 5I8NA 3BOWB 3GK4X 1AVSA 3E3RA 2LHIA 2MAZA 3WNXB 1M45A 1K9UA 4MBEA 4XJKB 1KK8B 2EC6C 1DJWA 4MRXA 1S26D 1RFJA 1Y1UA
chains in the Genus database with same CATH superfamily
3EG5B 1NSHA 4PE7A 4U8DA 3BFAA 5HKYA 1T14A 3QMEA 1WDCB 1WRKA 2I18A 3CR2A 4N5XA 1CTRA 2K7DA 1CNPA 1BMOA 1CB1A 3O78A 1G8IA 3BUWB 3HCMA 3KF9A 1KK7Y 4YGEB 2BE4A 1N65A 1OOIX 4AOMA 3JVTC 2MRDA 1QXPA 2OS8C 3EK7A 1PSBA 1R6PA 2BL0C 3DVEA 3S0FA 1EL4A 2LHLA 1OSAA 3EVVA 1B9AA 2LE9B 5HYDA 1AJ4A 3R1VA 3IF7A 2WORA 2QPTA 3OX5A 1YR5A 2K61A 5IBWA 1DJXA 1YUSA 1YX7A 2LUXA 2EGDA 3FWCA 4QJ3B 1OOJA 5FI2A 1PALA 1QASA 2LMVA 3TUYC 1K8UA 3NSIA 4I5NB 1OQPA 1PVBA 3PLFB 1CM1A 4PHNA 2KDHA 2LVVA 3PALA 3TDZA 1SMGA 2F2OA 4Q04A 2JTTA 4GUKA 4NQGA 1GM0A 3EKJA 2K2FA 2LAPA 1MF8B 1NPQA 2HPSA 4QJ5B 1NIWA 5FI7A 1C7WA 3SS4A 2ZNDA 1N0YA 2MJWB 1M31A 3JTDB 2NCOA 5HKWA 2FCDA 3I5GB 5GQQC 3SS5A 2FCEA 2NLNA 3DXLA 3ICBA 1TWOA 1WLZA 1CDMA 1OE9B 3PJIA 4CIDA 2CXJA 2QEHA 5CSFA 3AKBA 1TNPA 2KFHA 1K94A 2KI6C 2Y1NA 1GGZA 1CFFA 4I5LB 1UHHA 1D1OA 1M63B 1UWOA 3N7HA 1MWNA 1S36A 1G4YR 1PVAA 1YVHA 3GK2A 1GJYA 2HQ8A 4HRHA 2PALA 3DVMA 3B7AA 3UNWA 2LNKA 1IH0A 5DKRA 1IKUA 2JXCA 2Y5IA 3PN7C 1CM4A 3H4SE 2M8UA 2WC8A 1YTZC 3DF0B 3SG6A 2LLTA 2EHBA 2PRUA 1F55A 3D74A 4YGCB 4MN0A 1QV1A 1KK8C 2LVKA 3OB1B 4GGNA 2WCJA 1NX2A 1SSEB 1ORGA 3B86A 3BUOB 3I5FB 1SPYA 4M2OA 2CT9A 3IVTA 1WDCC 1JFJA 2PMYA 3AAJA 4OV2A 2Q4UA 4PHKA 3M0WA 5ER5A 1DF0A 3VRQA 3EVUA 3WHTB 2G2BA 1B8LA 2KBMA 1W7JB 4INXA 1S5GZ 3DZTA 1Y0VH 4HREE 3OX6A 2ZFDA 1NWDA 4OR9B 3I5HB 2BCXA 4MRYA 2KQYA 1TNXA 3RLZA 3CWGA 3FWBA 2FJYA 4INWA 2R2IA 1LA0A 3CR5X 3FE6A 2LUCA 3BJHA 2BKHB 1N2DA 1IWQA 2F33A 3RM1A 2G9BA 1J1EA 4I5JA 3SG5A 5JOLA 2M29A 1IG5A 2F3YA 2I7AA 4XYNA 4YGDB 2ISDA 3VRNA 4PT1A 1DF0B 2L4IA 2ZN9A 3IQQA 1SCMB 2JC2A 1AK8A 4XJKA 1KWOB 2KNEA 1Z4HA 2KOTA 1RECA 1XFUO 1ZMZA 4MSPA 1H4BA 5DKNA 4MZLA 2BECA 1SNLA 1SKTA 1YUTA 1YRUB 1KFUL 2WCEA 5B8IB 1MXLC 1UUSA 2SCPA 1LXFC 1S5GY 2QDIA 4MVFA 2K2AA 4OKHA 3JTDC 1EG3A 4M2PA 1CMFA 1E8AA 3I5GC 3PN7B 1ALVA 1XO5A 1UURA 1H8BA 1JUOA 2KPHA 4F7FA 1NX0A 1IGVA 4DCKA 1FI6A 3F45A 3A4UB 2WCFA 2K60A 5KSZA 5D7FA 4NDBA 2B1UA 2ZRTA 3EVRA 4OVNF 1DJGA 1S1EA 2KI4B 1QV0A 4P5OE 2SASA 1QWVA 1C3YA 1CFCA 3GK1A 2JTZA 3VROA 4JWQA 1V1FA 1YVLA 2CTNA 1DC1A 2ZN8A 1Z2CB 3MSEB 3LLEA 3WXAA 1BT6A 1CLLA 1B8RA 3B6XA 1F54A 1LINA 1QVIZ 1CLMA 1DJYA 3KEVA 3LCPC 4N1GA 1AUIB 1K95A 1JC2A 1RJVA 1SRAA 1YUUA 3VB1A 2JQ6A 2BBNA 3NHTA 2KI6D 2L51A 3I5FC 2KBIA 1EG4A 2BE6A 3K21A 1QATA 2D8NA 2DOQA 4MEWA 3CS1A 1IJ5A 1PULA 1XFXO 3DVKA 4ETOA 3CABA 1OOGA 1A29A 1MHOA 3AKAA 1OMRA 3KHEA 4ZCUA 3DD4A 2KLDA 3OP0A 1CDNA 1JWDA 2QEVA 1B7TZ 1SBJA 2JXLA 3I5HC 1ZFSA 3GOFA 2M3WA 3BUNB 1KFXL 3L4AA 2E30A 2QEBA 3O4XA 4D1EA 1XFYO 2F2PA 1C3ZA 1TOPA 3PATA 1XFVO 2KYFA 2JRFA 2KLEA 1OOHA 1LVCD 2WCHA 4WQ2A 1XVJA 1QTXA 3DF0A 2A4JA 2E6WA 1A2XA 1SCMC 2YGUA 1TUZA 5EL2A 1KWOC 5DKQA 2L2EA 1CFDA 3BYAA 3SG4A 1B1GA 1TNWA 1SYMA 2O5GA 5HL1A 2LMUA 2ERBA 4HRGA 1RWYA 1B4CA 2MA2A 4I5KA 4F0ZB 4FTGA 5I94A 2H8VA 1F70A 1C7VA 1V1GA 2M7NA 3BUMB 3D0YA 2L5YA 1TCFA 4GPLB 1FPWA 1NX3A 2KGBC 1YRTB 1BR1B 3BQ3A 1DELA 4YI9A 1BG1A 1CKKA 3D10A 3KO0A 5G08A 1Y1AA 1SY9A 4GGFA 1DJZA 1TNQA 1CDLA 1SR6B 2JPTA 2KAYA 2LLUA 4PDZA 1U5IA 2KI4C 1BF5A 3BFHA 1BOCA 4OCIA 1K93D 2BAPA 2HQWA 2M1KB 5HKZA 2GTEA 1JBAA 2QEOA 4ORAB 4MLWA 4JPZB 2L5XB 4MZJA 5D3OA 2VRGA 1XK4C 2L4HA 4OZDA 1TIZA 2GV5A 3SJSA 1GGWA 2GGZA 2JZIA 1TUJA 3D0YB 2WCLA 3SG7A 1IJ6A 1F4OA 2V53A 2LM5A 2JT3A 3D73A 4GAOA 2WC6A 1LKJA 4C0KA 3FS7A 3ZWHA 1ODBA 2LCPA 1QIWA 4PE0A 1PSRA 2Y1MA 1K2HA 1XA5A 5CSIA 3EK8A 1IQ3A 1QS7A 3I5IB 3L4LA 1B47A 1OMVA 1SL8A 1U5IB 1NUBA 2P6BB 1DJIA 2HETA 2HF5A 2LMTA 2QACA 3VRRA 3S0AA 2JNFA 4DRWA 5AEQA 1WRZA 1AP4A 2MLFC 3PM8A 1DMOA 4IJ7A 1M39A 3NXAA 2I94A 3O6BA 2LVIA 5I2OA 3D75A 2Q91A 3EK4A 5AXIA 2M7LA 2LV7A 1W9ZA 1OZSA 4ICBA 4NDDA 3OBVA 2K8MB 1S6JA 2IS9A 2CBLA 1G33A 3CZ0A 2TN4A 3SG3A 1XK4A 2M9GA 3LK0A 4WRIA 1CLBA 2MLEC 3S0BA 1CFPA 2WCBA 1B8CA 5ER4X 4YRUA 2Y4QA 3AAKA 1KQMB 2CCMA 2LP3A 3NSOA 3CZ2A 1SL9A 3LL8B 1UHKA 3CTNA 5AFPA 5TNCA 2BBMA 1JFKA 3D77A 3SIAA 3S0GA 2JWWA 3HX4A 1YX8A 1W7IB 1WLMA 3OHMB 5D69A 2O60A 4L9MA 4CFQA 5K89A 4USLA 4KYNA 2PASA 2CNPA 2P71A 1J55A 1KFUS 3CR4X 3CZTX 3PSRA 1J1DA 1VRKA 4CFRA 1AJ5A 3S0EA 1A03A 1NX1A 1EJ3A 4PALA 3R1PA 1L2OB 5HLOA 5KTYA 2BKIB 4GNKB 1KSMA 5CSNA 1R2UA 1BU3A 3DY9A 3NHIA 1C07A 1XYDA 1SR6C 2AUCA 1Q80A 1F8HA 4GFTA 4PCWA 4P2YB 2KGRA 2LVJA 1QX7A 4C0JA 2MHHA 5AANA 1L7ZA 4TNCA 1S6CA 1BLQA 1JSAA 2RGIA 3OB2B 4JQ0D 2JNXA 1DTLA 5FI6A 4N1FA 4A4BA 1J7RA 1ZUZA 3NGVA 1KCYA 2L98A 2ZKMX 1FI5A 4ORBB 1SL7A 2JULA 1M46A 2GGMA 3BFBA 1P28A 2K7OA 2JU0A 1DGUA 1J7QA 1WRLA 3UO9A 2ZNEA 2PSRA 2WCKA 1MQ1A 1PK0D 1UP5A 1S6IA 3PM2A 4GGFC 5F6TA 4M2QA 3I5IC 5DICA 1AHRA 1CMGA 3FIAA 2H61C 2FJUB 1F71A 1F4QA 3R1OA 1FF1A 2K7BA 1FW4A 2WCMA 1HQVA 1QVIY 2M97A 1OW4A 3FE9A 1IRJA 4E68A 4PHMA 3TS5B 1OOFA 1RROA 1KQVA 2KHNA 1QLKA 2LC5A 4PE4A 5I2QA 1RTP1 3DYEA 3SIBA 5PALA 1NP8A 1K9KA 3L47A 3NSKA 3VRPA 2K0JA 2KQ6A 1DEKA 2COLB 1KFXS 4JKTA 4MZKA 1YURA 3PFVA 4BY5A 2NCPA 3CGAA 1DT7B 1FBVA 1PRWA 1TRFA 2KAXA 1MXEA 2F8PA 2OTGC 3D78A 2KYCA 2ZRSA 2WOSA 3V2LA 1B7TY 1S3PA 1KQMC 2LP2A 1A75A 3BXKA 1RK9A 2L0PA 3LK1A 5I2LA 1TTXA 3B87A 1EH2A 5BPJA 1XFRA 2BCBA 4R1EA 4ZCVA 2OPOA 3OGNA 4YGBB 4ORCB 5FYXA 4AQJA 3KPXA 1IIOA 1SK6D 1XFWO 2H61A 1SCVA 2EC6B 2AMIA 2PYQA 3QRXA 5HLVA 2LANA 3VGOA 4FQOA 2WNDA 1BJFA 4C0LA 1DGVA 2H2KA 2JT0A 3IQOA 2K7CA 2F3ZA 1J7PA 1L2OC 4CPVA 1TCOB 3R72A 1A75B 5J3XA 4DUQA 1ALWA 2P70A 1SW8A 3JVTB 4PHJA 4FQTA 2OS8B 4PE1A 1J7OA 3TZ1A 2BL0B 1NCZA 4YI8A 1OZOA 1OMDA 4HSZA 2LLSA 3ZNIA 5CSJA 4GBAA 3NSLA 1NYAA 4WQ3A 4DS7A 1GQMA 1EXRA 1QIVA 1K96A 1Y1XA 1CDPA 3A8RA 2AAOA 3EKHA 3S0DA 2L50A 2NZ0A 2BCAA 2KAVA 3B88A 4DIRA 1K90D 3RZSA 3K1EA 1BODA 1X02A 1DJHA 2M0RA 4CLNA 1QX5B 1TN4A 2NXQA 3TUYB 4QJ4B 1HT9A 3SG2A 3TDIA 3O4YA 1UHJA 2JT8A 1K9PA 1NCXA 3CZ1A 2FOTA 1MR8A 1A4PA 3CDNA 4BY4A 5CPVA 1QJTA 1KSOA 3WHUB 1LS8A 1JF0A 2OTGB 1ZOTB 2WC5A 3TDUA 1QX2A 1QLSA 1IQ5A 2KFFA 2PQLA 1LA3A 4IL1A 4JD9A 3TS5C 5AERA 3BOWA 2BNXA 2L2CA 2MBXA 1ZACA 1JF2A 2M1UA 1XFZO 1UHIA 2KFGA 2M49B 3BUXB 4YGAA 2KSPA 3O2PA 4NDCA 1KK7Z 4AQIA 1UHNA 2JOJA 4YBHB 4A4CA 1DVIA 3C1VA 2PVBA 3D76A 4UPGA 1Y6WA 3SS3A 3Q8IA 3CLNA 1NCYA 3DVJA 3FE8A 2I2RE 5KU1A 1WY9A 1BR4B 2JPOA 5JJGA 1MUXA 5I8NA 3BOWB 3GK4X 1AVSA 3E3RA 2LHIA 2MAZA 3WNXB 1M45A 1K9UA 4MBEA 1DQEA 4XJKB 1KK8B 2EC6C 1DJWA 3CYZA 4MRXA 1S26D 1RFJA 1Y1UA
chains in the Genus database with same CATH topology
1NSHA 4PE7A 4U8DA 5HKYA 1WDCB 1WRKA 2I18A 3CR2A 4N5XA 1CTRA 2K7DA 1CNPA 1BMOA 1CB1A 3O78A 1G8IA 3BUWB 3HCMA 3KF9A 1KK7Y 4YGEB 2BE4A 1N65A 4AOMA 3JVTC 2MRDA 1QXPA 2OS8C 3EK7A 1PSBA 1R6PA 2BL0C 3DVEA 1EL4A 2LHLA 1OSAA 3EVVA 1B9AA 2LE9B 5HYDA 1AJ4A 3IF7A 2WORA 2QPTA 3OX5A 1YR5A 2K61A 5IBWA 1DJXA 1YUSA 1YX7A 2LUXA 2EGDA 3FWCA 4QJ3B 1OOJA 1PALA 1QASA 2LMVA 3TUYC 1K8UA 3NSIA 4I5NB 1OQPA 1PVBA 3PLFB 1CM1A 4PHNA 2KDHA 2LVVA 3PALA 3TDZA 1SMGA 2F2OA 4Q04A 2JTTA 4GUKA 4NQGA 3EKJA 2K2FA 2LAPA 1MF8B 1NPQA 2HPSA 4QJ5B 1NIWA 1C7WA 2ZNDA 1N0YA 2MJWB 1M31A 3JTDB 2NCOA 5HKWA 2FCDA 3I5GB 5GQQC 2FCEA 2NLNA 3ICBA 1WLZA 1CDMA 1OE9B 4CIDA 2CXJA 5CSFA 3AKBA 1TNPA 2KFHA 1K94A 2KI6C 2Y1NA 1GGZA 1CFFA 4I5LB 1UHHA 1D1OA 1M63B 1UWOA 1MWNA 1S36A 1G4YR 1PVAA 1YVHA 3GK2A 1GJYA 2HQ8A 4HRHA 2PALA 3DVMA 1IH0A 2LNKA 5DKRA 1IKUA 2JXCA 2Y5IA 3PN7C 1CM4A 3H4SE 2M8UA 2WC8A 1YTZC 3DF0B 3SG6A 2LLTA 2EHBA 2PRUA 1F55A 4YGCB 4MN0A 1QV1A 1KK8C 2LVKA 3OB1B 4GGNA 1NX2A 3BUOB 3I5FB 1SPYA 4M2OA 2CT9A 1WDCC 1JFJA 2PMYA 3AAJA 4OV2A 2Q4UA 4PHKA 3M0WA 5ER5A 1DF0A 3VRQA 3EVUA 3WHTB 2G2BA 1B8LA 2KBMA 1W7JB 1S5GZ 1Y0VH 4HREE 3OX6A 2ZFDA 1NWDA 4OR9B 3I5HB 2BCXA 4MRYA 2KQYA 1TNXA 3RLZA 3CWGA 3FWBA 2R2IA 1LA0A 3CR5X 2LUCA 2BKHB 1N2DA 1IWQA 2F33A 3RM1A 2G9BA 1J1EA 4I5JA 3SG5A 5JOLA 2M29A 1IG5A 2F3YA 2I7AA 4XYNA 4YGDB 2ISDA 3VRNA 1DF0B 2L4IA 2ZN9A 3IQQA 1SCMB 2JC2A 1AK8A 4XJKA 1KWOB 2KNEA 2KOTA 1RECA 1XFUO 1ZMZA 4MSPA 1H4BA 5DKNA 4MZLA 2BECA 1SNLA 1SKTA 1YUTA 1YRUB 1KFUL 2WCEA 5B8IB 1MXLC 1UUSA 2SCPA 1LXFC 1S5GY 4MVFA 2K2AA 4OKHA 3JTDC 1EG3A 4M2PA 1CMFA 1E8AA 3I5GC 3PN7B 1ALVA 1XO5A 1UURA 1H8BA 1JUOA 1NX0A 1IGVA 4DCKA 1FI6A 3F45A 3A4UB 2WCFA 5KSZA 5D7FA 4NDBA 2B1UA 2ZRTA 3EVRA 4OVNF 1DJGA 1S1EA 2KI4B 1QV0A 4P5OE 2SASA 1CFCA 3GK1A 2JTZA 3VROA 4JWQA 1V1FA 1YVLA 2CTNA 2ZN8A 3WXAA 3MSEB 3LLEA 1BT6A 1CLLA 1B8RA 1F54A 1LINA 1QVIZ 1CLMA 1DJYA 3KEVA 3LCPC 4N1GA 1AUIB 1K95A 1JC2A 1RJVA 1SRAA 1YUUA 2JQ6A 2BBNA 2KI6D 2L51A 3I5FC 2KBIA 1EG4A 2BE6A 3K21A 1QATA 2D8NA 2DOQA 4MEWA 3CS1A 1IJ5A 1PULA 1XFXO 3DVKA 4ETOA 1A29A 1MHOA 3AKAA 1OMRA 3KHEA 4ZCUA 3DD4A 3OP0A 1CDNA 1JWDA 1B7TZ 1SBJA 2JXLA 3I5HC 1ZFSA 3GOFA 2M3WA 3BUNB 1KFXL 2E30A 4D1EA 1XFYO 2F2PA 1TOPA 3PATA 1XFVO 2KYFA 2JRFA 1LVCD 4WQ2A 1XVJA 1QTXA 3DF0A 2A4JA 2E6WA 1A2XA 1SCMC 1KWOC 5DKQA 2L2EA 1CFDA 3BYAA 3SG4A 1B1GA 1TNWA 1SYMA 2O5GA 2LMUA 4HRGA 1RWYA 1B4CA 2MA2A 4I5KA 4F0ZB 4FTGA 1F70A 1C7VA 1V1GA 2M7NA 3BUMB 3D0YA 1TCFA 4GPLB 1FPWA 1NX3A 2KGBC 1YRTB 1BR1B 3BQ3A 4YI9A 1BG1A 1CKKA 3D10A 3KO0A 5G08A 1Y1AA 1SY9A 4GGFA 1DJZA 1TNQA 1CDLA 1SR6B 2JPTA 2KAYA 2LLUA 4PDZA 1U5IA 2KI4C 1BF5A 1BOCA 4OCIA 1K93D 2HQWA 5HKZA 2M1KB 1JBAA 4ORAB 4MLWA 4JPZB 2L5XB 4MZJA 2VRGA 1XK4C 2L4HA 3SJSA 1TIZA 2GV5A 1GGWA 2GGZA 2JZIA 3D0YB 3SG7A 1IJ6A 1F4OA 2V53A 2LM5A 2JT3A 4GAOA 4C0KA 1LKJA 3FS7A 3ZWHA 1ODBA 2LCPA 1QIWA 4PE0A 1PSRA 2Y1MA 1K2HA 1XA5A 5CSIA 3EK8A 1IQ3A 1QS7A 3I5IB 1B47A 1OMVA 1SL8A 1U5IB 1NUBA 2P6BB 1DJIA 2HETA 2HF5A 2LMTA 2QACA 3VRRA 2JNFA 4DRWA 5AEQA 1WRZA 1AP4A 2MLFC 3PM8A 1DMOA 1M39A 3NXAA 2I94A 3O6BA 2LVIA 5I2OA 2Q91A 3EK4A 5AXIA 2M7LA 2LV7A 1OZSA 4ICBA 4NDDA 2K8MB 1S6JA 2IS9A 2CBLA 1G33A 3SG3A 2TN4A 1XK4A 2M9GA 3LK0A 4WRIA 1CLBA 2MLEC 1CFPA 2WCBA 1B8CA 5ER4X 4YRUA 2Y4QA 3AAKA 1KQMB 2CCMA 2LP3A 3NSOA 1SL9A 3LL8B 1UHKA 3CTNA 5AFPA 5TNCA 2BBMA 1JFKA 3SIAA 2JWWA 3HX4A 1YX8A 1W7IB 1WLMA 3OHMB 5D69A 2O60A 4L9MA 4CFQA 5K89A 4USLA 2PASA 2CNPA 3PSRA 1J55A 1KFUS 3CR4X 3CZTX 1J1DA 1VRKA 4CFRA 1AJ5A 1A03A 1NX1A 1EJ3A 4PALA 1L2OB 5HLOA 5KTYA 2BKIB 4GNKB 1KSMA 5CSNA 1R2UA 1BU3A 1C07A 1XYDA 1SR6C 2AUCA 1Q80A 1F8HA 4GFTA 4PCWA 4P2YB 2KGRA 2LVJA 1QX7A 4C0JA 2MHHA 5AANA 1L7ZA 4TNCA 1S6CA 1BLQA 1JSAA 2RGIA 3OB2B 4JQ0D 2JNXA 1DTLA 4N1FA 4A4BA 1J7RA 1ZUZA 1KCYA 2L98A 2ZKMX 1FI5A 4ORBB 1SL7A 2JULA 1M46A 2GGMA 2K7OA 2JU0A 1DGUA 1J7QA 1WRLA 2ZNEA 2PSRA 1MQ1A 1PK0D 1UP5A 1S6IA 4GGFC 5F6TA 4M2QA 3I5IC 1AHRA 1CMGA 3FIAA 2H61C 2FJUB 1F71A 1F4QA 1FF1A 2K7BA 1FW4A 1HQVA 1QVIY 2M97A 1IRJA 4E68A 4PHMA 3TS5B 1RROA 1KQVA 2KHNA 1QLKA 2LC5A 4PE4A 5I2QA 1RTP1 3SIBA 5PALA 1NP8A 1K9KA 3NSKA 3VRPA 2K0JA 2KQ6A 2COLB 1KFXS 4MZKA 1YURA 3PFVA 4BY5A 2NCPA 3CGAA 1DT7B 1FBVA 1PRWA 1TRFA 2KAXA 1MXEA 2F8PA 2OTGC 2KYCA 2ZRSA 2WOSA 1B7TY 1S3PA 1KQMC 2LP2A 1A75A 3BXKA 1RK9A 2L0PA 3LK1A 5I2LA 1TTXA 1EH2A 5BPJA 2BCBA 4R1EA 4ZCVA 2OPOA 4YGBB 4ORCB 5FYXA 4AQJA 3KPXA 1SK6D 1XFWO 2H61A 1SCVA 2EC6B 2AMIA 3QRXA 5HLVA 2LANA 3VGOA 4FQOA 2WNDA 1BJFA 4C0LA 1DGVA 2H2KA 2JT0A 3IQOA 2K7CA 2F3ZA 1J7PA 1L2OC 4CPVA 1TCOB 1A75B 5J3XA 4DUQA 1ALWA 1SW8A 3JVTB 4PHJA 4PE1A 2OS8B 1J7OA 3TZ1A 2BL0B 1NCZA 4YI8A 1OZOA 1OMDA 4HSZA 2LLSA 3ZNIA 5CSJA 4GBAA 3NSLA 1NYAA 4WQ3A 4DS7A 1GQMA 1EXRA 1QIVA 1K96A 1Y1XA 1CDPA 3A8RA 2AAOA 3EKHA 2L50A 2NZ0A 2BCAA 2KAVA 4DIRA 1BODA 1K90D 1X02A 1DJHA 2M0RA 4CLNA 1QX5B 1TN4A 2NXQA 3TUYB 4QJ4B 1HT9A 3SG2A 3TDIA 3O4YA 1UHJA 2JT8A 1K9PA 1NCXA 2FOTA 1MR8A 1A4PA 4BY4A 5CPVA 1QJTA 1KSOA 3WHUB 1JF0A 2OTGB 1ZOTB 3TDUA 1QX2A 1QLSA 1IQ5A 2KFFA 4IL1A 1LA3A 3TS5C 5AERA 3BOWA 2MBXA 1ZACA 1JF2A 2M1UA 1XFZO 1UHIA 2KFGA 2M49B 3BUXB 4YGAA 2KSPA 3O2PA 4NDCA 1KK7Z 4AQIA 1UHNA 2JOJA 4YBHB 4A4CA 1DVIA 3C1VA 2PVBA 4UPGA 1Y6WA 3CLNA 1NCYA 3DVJA 2I2RE 5KU1A 1WY9A 1BR4B 5JJGA 1MUXA 5I8NA 3BOWB 3GK4X 1AVSA 3E3RA 2LHIA 2MAZA 3WNXB 1M45A 1K9UA 4MBEA 4XJKB 1KK8B 2EC6C 1DJWA 4MRXA 1S26D 1RFJA 1Y1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NSH A;  4PE7 A;  4U8D A;  5HKY A;  1WDC B;  1WRK A;  2I18 A;  3CR2 A;  4N5X A;  1CTR A;  2K7D A;  1CNP A;  1BMO A;  1CB1 A;  3O78 A;  1G8I A;  3BUW B;  3HCM A;  3KF9 A;  1KK7 Y;  4YGE B;  2BE4 A;  1N65 A;  4AOM A;  3JVT C;  2MRD A;  1QXP A;  2OS8 C;  3EK7 A;  1PSB A;  1R6P A;  2BL0 C;  3DVE A;  1EL4 A;  2LHL A;  1OSA A;  3EVV A;  1B9A A;  2LE9 B;  5HYD A;  1AJ4 A;  3IF7 A;  2WOR A;  2QPT A;  3OX5 A;  1YR5 A;  2K61 A;  5IBW A;  1DJX A;  1YUS A;  1YX7 A;  2LUX A;  2EGD A;  3FWC A;  4QJ3 B;  1OOJ A;  1PAL A;  1QAS A;  2LMV A;  3TUY C;  1K8U A;  3NSI A;  4I5N B;  1OQP A;  1PVB A;  3PLF B;  1CM1 A;  4PHN A;  2KDH A;  2LVV A;  3PAL A;  3TDZ A;  1SMG A;  2F2O A;  4Q04 A;  2JTT A;  4GUK A;  4NQG A;  3EKJ A;  2K2F A;  2LAP A;  1MF8 B;  1NPQ A;  2HPS A;  4QJ5 B;  1NIW A;  1C7W A;  2ZND A;  1N0Y A;  2MJW B;  1M31 A;  3JTD B;  2NCO A;  5HKW A;  2FCD A;  3I5G B;  5GQQ C;  2FCE A;  2NLN A;  3ICB A;  1WLZ A;  1CDM A;  1OE9 B;  4CID A;  2CXJ A;  5CSF A;  3AKB A;  1TNP A;  2KFH A;  1K94 A;  2KI6 C;  2Y1N A;  1GGZ A;  1CFF A;  4I5L B;  1UHH A;  1D1O A;  1M63 B;  1UWO A;  1MWN A;  1S36 A;  1G4Y R;  1PVA A;  1YVH A;  3GK2 A;  1GJY A;  2HQ8 A;  4HRH A;  2PAL A;  3DVM A;  1IH0 A;  2LNK A;  5DKR A;  1IKU A;  2JXC A;  2Y5I A;  3PN7 C;  1CM4 A;  3H4S E;  2M8U A;  2WC8 A;  1YTZ C;  3DF0 B;  3SG6 A;  2LLT A;  2EHB A;  2PRU A;  1F55 A;  4YGC B;  4MN0 A;  1QV1 A;  1KK8 C;  2LVK A;  3OB1 B;  4GGN A;  1NX2 A;  3BUO B;  3I5F B;  1SPY A;  4M2O A;  2CT9 A;  1WDC C;  1JFJ A;  2PMY A;  3AAJ A;  4OV2 A;  2Q4U A;  4PHK A;  3M0W A;  5ER5 A;  1DF0 A;  3VRQ A;  3EVU A;  3WHT B;  2G2B A;  1B8L A;  2KBM A;  1W7J B;  1S5G Z;  1Y0V H;  4HRE E;  3OX6 A;  2ZFD A;  1NWD A;  4OR9 B;  3I5H B;  2BCX A;  4MRY A;  2KQY A;  1TNX A;  3RLZ A;  3CWG A;  3FWB A;  2R2I A;  1LA0 A;  3CR5 X;  2LUC A;  2BKH B;  1N2D A;  1IWQ A;  2F33 A;  3RM1 A;  2G9B A;  1J1E A;  4I5J A;  3SG5 A;  5JOL A;  2M29 A;  1IG5 A;  2F3Y A;  2I7A A;  4XYN A;  4YGD B;  2ISD A;  3VRN A;  1DF0 B;  2L4I A;  2ZN9 A;  3IQQ A;  1SCM B;  2JC2 A;  1AK8 A;  4XJK A;  1KWO B;  2KNE A;  2KOT A;  1REC A;  1XFU O;  1ZMZ A;  4MSP A;  1H4B A;  5DKN A;  4MZL A;  2BEC A;  1SNL A;  1SKT A;  1YUT A;  1YRU B;  1KFU L;  2WCE A;  5B8I B;  1MXL C;  1UUS A;  2SCP A;  1LXF C;  1S5G Y;  4MVF A;  2K2A A;  4OKH A;  3JTD C;  1EG3 A;  4M2P A;  1CMF A;  1E8A A;  3I5G C;  3PN7 B;  1ALV A;  1XO5 A;  1UUR A;  1H8B A;  1JUO A;  1NX0 A;  1IGV A;  4DCK A;  1FI6 A;  3F45 A;  3A4U B;  2WCF A;  5KSZ A;  5D7F A;  4NDB A;  2B1U A;  2ZRT A;  3EVR A;  4OVN F;  1DJG A;  1S1E A;  2KI4 B;  1QV0 A;  4P5O E;  2SAS A;  1CFC A;  3GK1 A;  2JTZ A;  3VRO A;  4JWQ A;  1V1F A;  1YVL A;  2CTN A;  2ZN8 A;  3WXA A;  3MSE B;  3LLE A;  1BT6 A;  1CLL A;  1B8R A;  1F54 A;  1LIN A;  1QVI Z;  1CLM A;  1DJY A;  3KEV A;  3LCP C;  4N1G A;  1AUI B;  1K95 A;  1JC2 A;  1RJV A;  1SRA A;  1YUU A;  2JQ6 A;  2BBN A;  2KI6 D;  2L51 A;  3I5F C;  2KBI A;  1EG4 A;  2BE6 A;  3K21 A;  1QAT A;  2D8N A;  2DOQ A;  4MEW A;  3CS1 A;  1IJ5 A;  1PUL A;  1XFX O;  3DVK A;  4ETO A;  1A29 A;  1MHO A;  3AKA A;  1OMR A;  3KHE A;  4ZCU A;  3DD4 A;  3OP0 A;  1CDN A;  1JWD A;  1B7T Z;  1SBJ A;  2JXL A;  3I5H C;  1ZFS A;  3GOF A;  2M3W A;  3BUN B;  1KFX L;  2E30 A;  4D1E A;  1XFY O;  2F2P A;  1TOP A;  3PAT A;  1XFV O;  2KYF A;  2JRF A;  1LVC D;  4WQ2 A;  1XVJ A;  1QTX A;  3DF0 A;  2A4J A;  2E6W A;  1A2X A;  1SCM C;  1KWO C;  5DKQ A;  2L2E A;  1CFD A;  3BYA A;  3SG4 A;  1B1G A;  1TNW A;  1SYM A;  2O5G A;  2LMU A;  4HRG A;  1RWY A;  1B4C A;  2MA2 A;  4I5K A;  4F0Z B;  4FTG A;  1F70 A;  1C7V A;  1V1G A;  2M7N A;  3BUM B;  3D0Y A;  1TCF A;  4GPL B;  1FPW A;  1NX3 A;  2KGB C;  1YRT B;  1BR1 B;  3BQ3 A;  4YI9 A;  1BG1 A;  1CKK A;  3D10 A;  3KO0 A;  5G08 A;  1Y1A A;  1SY9 A;  4GGF A;  1DJZ A;  1TNQ A;  1CDL A;  1SR6 B;  2JPT A;  2KAY A;  2LLU A;  4PDZ A;  1U5I A;  2KI4 C;  1BF5 A;  1BOC A;  4OCI A;  1K93 D;  2HQW A;  5HKZ A;  2M1K B;  1JBA A;  4ORA B;  4MLW A;  4JPZ B;  2L5X B;  4MZJ A;  2VRG A;  1XK4 C;  2L4H A;  3SJS A;  1TIZ A;  2GV5 A;  1GGW A;  2GGZ A;  2JZI A;  3D0Y B;  3SG7 A;  1IJ6 A;  1F4O A;  2V53 A;  2LM5 A;  2JT3 A;  4GAO A;  4C0K A;  1LKJ A;  3FS7 A;  3ZWH A;  1ODB A;  2LCP A;  1QIW A;  4PE0 A;  1PSR A;  2Y1M A;  1K2H A;  1XA5 A;  5CSI A;  3EK8 A;  1IQ3 A;  1QS7 A;  3I5I B;  1B47 A;  1OMV A;  1SL8 A;  1U5I B;  1NUB A;  2P6B B;  1DJI A;  2HET A;  2HF5 A;  2LMT A;  2QAC A;  3VRR A;  2JNF A;  4DRW A;  5AEQ A;  1WRZ A;  1AP4 A;  2MLF C;  3PM8 A;  1DMO A;  1M39 A;  3NXA A;  2I94 A;  3O6B A;  2LVI A;  5I2O A;  2Q91 A;  3EK4 A;  5AXI A;  2M7L A;  2LV7 A;  1OZS A;  4ICB A;  4NDD A;  2K8M B;  1S6J A;  2IS9 A;  2CBL A;  1G33 A;  3SG3 A;  2TN4 A;  1XK4 A;  2M9G A;  3LK0 A;  4WRI A;  1CLB A;  2MLE C;  1CFP A;  2WCB A;  1B8C A;  5ER4 X;  4YRU A;  2Y4Q A;  3AAK A;  1KQM B;  2CCM A;  2LP3 A;  3NSO A;  1SL9 A;  3LL8 B;  1UHK A;  3CTN A;  5AFP A;  5TNC A;  2BBM A;  1JFK A;  3SIA A;  2JWW A;  3HX4 A;  1YX8 A;  1W7I B;  1WLM A;  3OHM B;  5D69 A;  2O60 A;  4L9M A;  4CFQ A;  5K89 A;  4USL A;  2PAS A;  2CNP A;  3PSR A;  1J55 A;  1KFU S;  3CR4 X;  3CZT X;  1J1D A;  1VRK A;  4CFR A;  1AJ5 A;  1A03 A;  1NX1 A;  1EJ3 A;  4PAL A;  1L2O B;  5HLO A;  5KTY A;  2BKI B;  4GNK B;  1KSM A;  5CSN A;  1R2U A;  1BU3 A;  1C07 A;  1XYD A;  1SR6 C;  2AUC A;  1Q80 A;  1F8H A;  4GFT A;  4PCW A;  4P2Y B;  2KGR A;  2LVJ A;  1QX7 A;  4C0J A;  2MHH A;  5AAN A;  1L7Z A;  4TNC A;  1S6C A;  1BLQ A;  1JSA A;  2RGI A;  3OB2 B;  4JQ0 D;  2JNX A;  1DTL A;  4N1F A;  4A4B A;  1J7R A;  1ZUZ A;  1KCY A;  2L98 A;  2ZKM X;  1FI5 A;  4ORB B;  1SL7 A;  2JUL A;  1M46 A;  2GGM A;  2K7O A;  2JU0 A;  1DGU A;  1J7Q A;  1WRL A;  2ZNE A;  2PSR A;  1MQ1 A;  1PK0 D;  1UP5 A;  1S6I A;  4GGF C;  5F6T A;  4M2Q A;  3I5I C;  1AHR A;  1CMG A;  3FIA A;  2H61 C;  2FJU B;  1F71 A;  1F4Q A;  1FF1 A;  2K7B A;  1FW4 A;  1HQV A;  1QVI Y;  2M97 A;  1IRJ A;  4E68 A;  4PHM A;  3TS5 B;  1RRO A;  1KQV A;  2KHN A;  1QLK A;  2LC5 A;  4PE4 A;  5I2Q A;  1RTP 1;  3SIB A;  5PAL A;  1NP8 A;  1K9K A;  3NSK A;  3VRP A;  2K0J A;  2KQ6 A;  2COL B;  1KFX S;  4MZK A;  1YUR A;  3PFV A;  4BY5 A;  2NCP A;  3CGA A;  1DT7 B;  1FBV A;  1PRW A;  1TRF A;  2KAX A;  1MXE A;  2F8P A;  2OTG C;  2KYC A;  2ZRS A;  2WOS A;  1B7T Y;  1S3P A;  1KQM C;  2LP2 A;  1A75 A;  3BXK A;  1RK9 A;  2L0P A;  3LK1 A;  5I2L A;  1TTX A;  1EH2 A;  5BPJ A;  2BCB A;  4R1E A;  4ZCV A;  2OPO A;  4YGB B;  4ORC B;  5FYX A;  4AQJ A;  3KPX A;  1SK6 D;  1XFW O;  2H61 A;  1SCV A;  2EC6 B;  2AMI A;  3QRX A;  5HLV A;  2LAN A;  3VGO A;  4FQO A;  2WND A;  1BJF A;  4C0L A;  1DGV A;  2H2K A;  2JT0 A;  3IQO A;  2K7C A;  2F3Z A;  1J7P A;  1L2O C;  4CPV A;  1TCO B;  1A75 B;  5J3X A;  4DUQ A;  1ALW A;  1SW8 A;  3JVT B;  4PHJ A;  4PE1 A;  2OS8 B;  1J7O A;  3TZ1 A;  2BL0 B;  1NCZ A;  4YI8 A;  1OZO A;  1OMD A;  4HSZ A;  2LLS A;  3ZNI A;  5CSJ A;  4GBA A;  3NSL A;  1NYA A;  4WQ3 A;  4DS7 A;  1GQM A;  1EXR A;  1QIV A;  1K96 A;  1Y1X A;  1CDP A;  3A8R A;  2AAO A;  3EKH A;  2L50 A;  2NZ0 A;  2BCA A;  2KAV A;  4DIR A;  1BOD A;  1K90 D;  1X02 A;  1DJH A;  2M0R A;  4CLN A;  1QX5 B;  1TN4 A;  2NXQ A;  3TUY B;  4QJ4 B;  1HT9 A;  3SG2 A;  3TDI A;  3O4Y A;  1UHJ A;  2JT8 A;  1K9P A;  1NCX A;  2FOT A;  1MR8 A;  1A4P A;  4BY4 A;  5CPV A;  1QJT A;  1KSO A;  3WHU B;  1JF0 A;  2OTG B;  1ZOT B;  3TDU A;  1QX2 A;  1QLS A;  1IQ5 A;  2KFF A;  4IL1 A;  1LA3 A;  3TS5 C;  5AER A;  3BOW A;  2MBX A;  1ZAC A;  1JF2 A;  2M1U A;  1XFZ O;  1UHI A;  2KFG A;  2M49 B;  3BUX B;  4YGA A;  2KSP A;  3O2P A;  4NDC A;  1KK7 Z;  4AQI A;  1UHN A;  2JOJ A;  4YBH B;  4A4C A;  1DVI A;  3C1V A;  2PVB A;  4UPG A;  1Y6W A;  3CLN A;  1NCY A;  3DVJ A;  2I2R E;  5KU1 A;  1WY9 A;  1BR4 B;  5JJG A;  1MUX A;  5I8N A;  3BOW B;  3GK4 X;  1AVS A;  3E3R A;  2LHI A;  2MAZ A;  3WNX B;  1M45 A;  1K9U A;  4MBE A;  4XJK B;  1KK8 B;  2EC6 C;  1DJW A;  4MRX A;  1S26 D;  1RFJ A;  1Y1U A; 
#chains in the Genus database with same CATH topology
 3EG5 B;  1NSH A;  4PE7 A;  4U8D A;  3BFA A;  5HKY A;  1T14 A;  3QME A;  1WDC B;  1WRK A;  2I18 A;  3CR2 A;  4N5X A;  1CTR A;  2K7D A;  1CNP A;  1BMO A;  1CB1 A;  3O78 A;  1G8I A;  3BUW B;  3HCM A;  3KF9 A;  1KK7 Y;  4YGE B;  2BE4 A;  1N65 A;  1OOI X;  4AOM A;  3JVT C;  2MRD A;  1QXP A;  2OS8 C;  3EK7 A;  1PSB A;  1R6P A;  2BL0 C;  3DVE A;  3S0F A;  1EL4 A;  2LHL A;  1OSA A;  3EVV A;  1B9A A;  2LE9 B;  5HYD A;  1AJ4 A;  3R1V A;  3IF7 A;  2WOR A;  2QPT A;  3OX5 A;  1YR5 A;  2K61 A;  5IBW A;  1DJX A;  1YUS A;  1YX7 A;  2LUX A;  2EGD A;  3FWC A;  4QJ3 B;  1OOJ A;  5FI2 A;  1PAL A;  1QAS A;  2LMV A;  3TUY C;  1K8U A;  3NSI A;  4I5N B;  1OQP A;  1PVB A;  3PLF B;  1CM1 A;  4PHN A;  2KDH A;  2LVV A;  3PAL A;  3TDZ A;  1SMG A;  2F2O A;  4Q04 A;  2JTT A;  4GUK A;  4NQG A;  1GM0 A;  3EKJ A;  2K2F A;  2LAP A;  1MF8 B;  1NPQ A;  2HPS A;  4QJ5 B;  1NIW A;  5FI7 A;  1C7W A;  3SS4 A;  2ZND A;  1N0Y A;  2MJW B;  1M31 A;  3JTD B;  2NCO A;  5HKW A;  2FCD A;  3I5G B;  5GQQ C;  3SS5 A;  2FCE A;  2NLN A;  3DXL A;  3ICB A;  1TWO A;  1WLZ A;  1CDM A;  1OE9 B;  3PJI A;  4CID A;  2CXJ A;  2QEH A;  5CSF A;  3AKB A;  1TNP A;  2KFH A;  1K94 A;  2KI6 C;  2Y1N A;  1GGZ A;  1CFF A;  4I5L B;  1UHH A;  1D1O A;  1M63 B;  1UWO A;  3N7H A;  1MWN A;  1S36 A;  1G4Y R;  1PVA A;  1YVH A;  3GK2 A;  1GJY A;  2HQ8 A;  4HRH A;  2PAL A;  3DVM A;  3B7A A;  3UNW A;  2LNK A;  1IH0 A;  5DKR A;  1IKU A;  2JXC A;  2Y5I A;  3PN7 C;  1CM4 A;  3H4S E;  2M8U A;  2WC8 A;  1YTZ C;  3DF0 B;  3SG6 A;  2LLT A;  2EHB A;  2PRU A;  1F55 A;  3D74 A;  4YGC B;  4MN0 A;  1QV1 A;  1KK8 C;  2LVK A;  3OB1 B;  4GGN A;  2WCJ A;  1NX2 A;  1SSE B;  1ORG A;  3B86 A;  3BUO B;  3I5F B;  1SPY A;  4M2O A;  2CT9 A;  3IVT A;  1WDC C;  1JFJ A;  2PMY A;  3AAJ A;  4OV2 A;  2Q4U A;  4PHK A;  3M0W A;  5ER5 A;  1DF0 A;  3VRQ A;  3EVU A;  3WHT B;  2G2B A;  1B8L A;  2KBM A;  1W7J B;  4INX A;  1S5G Z;  3DZT A;  1Y0V H;  4HRE E;  3OX6 A;  2ZFD A;  1NWD A;  4OR9 B;  3I5H B;  2BCX A;  4MRY A;  2KQY A;  1TNX A;  3RLZ A;  3CWG A;  3FWB A;  2FJY A;  4INW A;  2R2I A;  1LA0 A;  3CR5 X;  3FE6 A;  2LUC A;  3BJH A;  2BKH B;  1N2D A;  1IWQ A;  2F33 A;  3RM1 A;  2G9B A;  1J1E A;  4I5J A;  3SG5 A;  5JOL A;  2M29 A;  1IG5 A;  2F3Y A;  2I7A A;  4XYN A;  4YGD B;  2ISD A;  3VRN A;  4PT1 A;  1DF0 B;  2L4I A;  2ZN9 A;  3IQQ A;  1SCM B;  2JC2 A;  1AK8 A;  4XJK A;  1KWO B;  2KNE A;  1Z4H A;  2KOT A;  1REC A;  1XFU O;  1ZMZ A;  4MSP A;  1H4B A;  5DKN A;  4MZL A;  2BEC A;  1SNL A;  1SKT A;  1YUT A;  1YRU B;  1KFU L;  2WCE A;  5B8I B;  1MXL C;  1UUS A;  2SCP A;  1LXF C;  1S5G Y;  2QDI A;  4MVF A;  2K2A A;  4OKH A;  3JTD C;  1EG3 A;  4M2P A;  1CMF A;  1E8A A;  3I5G C;  3PN7 B;  1ALV A;  1XO5 A;  1UUR A;  1H8B A;  1JUO A;  2KPH A;  4F7F A;  1NX0 A;  1IGV A;  4DCK A;  1FI6 A;  3F45 A;  3A4U B;  2WCF A;  2K60 A;  5KSZ A;  5D7F A;  4NDB A;  2B1U A;  2ZRT A;  3EVR A;  4OVN F;  1DJG A;  1S1E A;  2KI4 B;  1QV0 A;  4P5O E;  2SAS A;  1QWV A;  1C3Y A;  1CFC A;  3GK1 A;  2JTZ A;  3VRO A;  4JWQ A;  1V1F A;  1YVL A;  2CTN A;  1DC1 A;  2ZN8 A;  1Z2C B;  3MSE B;  3LLE A;  3WXA A;  1BT6 A;  1CLL A;  1B8R A;  3B6X A;  1F54 A;  1LIN A;  1QVI Z;  1CLM A;  1DJY A;  3KEV A;  3LCP C;  4N1G A;  1AUI B;  1K95 A;  1JC2 A;  1RJV A;  1SRA A;  1YUU A;  3VB1 A;  2JQ6 A;  2BBN A;  3NHT A;  2KI6 D;  2L51 A;  3I5F C;  2KBI A;  1EG4 A;  2BE6 A;  3K21 A;  1QAT A;  2D8N A;  2DOQ A;  4MEW A;  3CS1 A;  1IJ5 A;  1PUL A;  1XFX O;  3DVK A;  4ETO A;  3CAB A;  1OOG A;  1A29 A;  1MHO A;  3AKA A;  1OMR A;  3KHE A;  4ZCU A;  3DD4 A;  2KLD A;  3OP0 A;  1CDN A;  1JWD A;  2QEV A;  1B7T Z;  1SBJ A;  2JXL A;  3I5H C;  1ZFS A;  3GOF A;  2M3W A;  3BUN B;  1KFX L;  3L4A A;  2E30 A;  2QEB A;  3O4X A;  4D1E A;  1XFY O;  2F2P A;  1C3Z A;  1TOP A;  3PAT A;  1XFV O;  2KYF A;  2JRF A;  2KLE A;  1OOH A;  1LVC D;  2WCH A;  4WQ2 A;  1XVJ A;  1QTX A;  3DF0 A;  2A4J A;  2E6W A;  1A2X A;  1SCM C;  2YGU A;  1TUZ A;  5EL2 A;  1KWO C;  5DKQ A;  2L2E A;  1CFD A;  3BYA A;  3SG4 A;  1B1G A;  1TNW A;  1SYM A;  2O5G A;  5HL1 A;  2LMU A;  2ERB A;  4HRG A;  1RWY A;  1B4C A;  2MA2 A;  4I5K A;  4F0Z B;  4FTG A;  5I94 A;  2H8V A;  1F70 A;  1C7V A;  1V1G A;  2M7N A;  3BUM B;  3D0Y A;  2L5Y A;  1TCF A;  4GPL B;  1FPW A;  1NX3 A;  2KGB C;  1YRT B;  1BR1 B;  3BQ3 A;  1DEL A;  4YI9 A;  1BG1 A;  1CKK A;  3D10 A;  3KO0 A;  5G08 A;  1Y1A A;  1SY9 A;  4GGF A;  1DJZ A;  1TNQ A;  1CDL A;  1SR6 B;  2JPT A;  2KAY A;  2LLU A;  4PDZ A;  1U5I A;  2KI4 C;  1BF5 A;  3BFH A;  1BOC A;  4OCI A;  1K93 D;  2BAP A;  2HQW A;  2M1K B;  5HKZ A;  2GTE A;  1JBA A;  2QEO A;  4ORA B;  4MLW A;  4JPZ B;  2L5X B;  4MZJ A;  5D3O A;  2VRG A;  1XK4 C;  2L4H A;  4OZD A;  1TIZ A;  2GV5 A;  3SJS A;  1GGW A;  2GGZ A;  2JZI A;  1TUJ A;  3D0Y B;  2WCL A;  3SG7 A;  1IJ6 A;  1F4O A;  2V53 A;  2LM5 A;  2JT3 A;  3D73 A;  4GAO A;  2WC6 A;  1LKJ A;  4C0K A;  3FS7 A;  3ZWH A;  1ODB A;  2LCP A;  1QIW A;  4PE0 A;  1PSR A;  2Y1M A;  1K2H A;  1XA5 A;  5CSI A;  3EK8 A;  1IQ3 A;  1QS7 A;  3I5I B;  3L4L A;  1B47 A;  1OMV A;  1SL8 A;  1U5I B;  1NUB A;  2P6B B;  1DJI A;  2HET A;  2HF5 A;  2LMT A;  2QAC A;  3VRR A;  3S0A A;  2JNF A;  4DRW A;  5AEQ A;  1WRZ A;  1AP4 A;  2MLF C;  3PM8 A;  1DMO A;  4IJ7 A;  1M39 A;  3NXA A;  2I94 A;  3O6B A;  2LVI A;  5I2O A;  3D75 A;  2Q91 A;  3EK4 A;  5AXI A;  2M7L A;  2LV7 A;  1W9Z A;  1OZS A;  4ICB A;  4NDD A;  3OBV A;  2K8M B;  1S6J A;  2IS9 A;  2CBL A;  1G33 A;  3CZ0 A;  2TN4 A;  3SG3 A;  1XK4 A;  2M9G A;  3LK0 A;  4WRI A;  1CLB A;  2MLE C;  3S0B A;  1CFP A;  2WCB A;  1B8C A;  5ER4 X;  4YRU A;  2Y4Q A;  3AAK A;  1KQM B;  2CCM A;  2LP3 A;  3NSO A;  3CZ2 A;  1SL9 A;  3LL8 B;  1UHK A;  3CTN A;  5AFP A;  5TNC A;  2BBM A;  1JFK A;  3D77 A;  3SIA A;  3S0G A;  2JWW A;  3HX4 A;  1YX8 A;  1W7I B;  1WLM A;  3OHM B;  5D69 A;  2O60 A;  4L9M A;  4CFQ A;  5K89 A;  4USL A;  4KYN A;  2PAS A;  2CNP A;  2P71 A;  1J55 A;  1KFU S;  3CR4 X;  3CZT X;  3PSR A;  1J1D A;  1VRK A;  4CFR A;  1AJ5 A;  3S0E A;  1A03 A;  1NX1 A;  1EJ3 A;  4PAL A;  3R1P A;  1L2O B;  5HLO A;  5KTY A;  2BKI B;  4GNK B;  1KSM A;  5CSN A;  1R2U A;  1BU3 A;  3DY9 A;  3NHI A;  1C07 A;  1XYD A;  1SR6 C;  2AUC A;  1Q80 A;  1F8H A;  4GFT A;  4PCW A;  4P2Y B;  2KGR A;  2LVJ A;  1QX7 A;  4C0J A;  2MHH A;  5AAN A;  1L7Z A;  4TNC A;  1S6C A;  1BLQ A;  1JSA A;  2RGI A;  3OB2 B;  4JQ0 D;  2JNX A;  1DTL A;  5FI6 A;  4N1F A;  4A4B A;  1J7R A;  1ZUZ A;  3NGV A;  1KCY A;  2L98 A;  2ZKM X;  1FI5 A;  4ORB B;  1SL7 A;  2JUL A;  1M46 A;  2GGM A;  3BFB A;  1P28 A;  2K7O A;  2JU0 A;  1DGU A;  1J7Q A;  1WRL A;  3UO9 A;  2ZNE A;  2PSR A;  2WCK A;  1MQ1 A;  1PK0 D;  1UP5 A;  1S6I A;  3PM2 A;  4GGF C;  5F6T A;  4M2Q A;  3I5I C;  5DIC A;  1AHR A;  1CMG A;  3FIA A;  2H61 C;  2FJU B;  1F71 A;  1F4Q A;  3R1O A;  1FF1 A;  2K7B A;  1FW4 A;  2WCM A;  1HQV A;  1QVI Y;  2M97 A;  1OW4 A;  3FE9 A;  1IRJ A;  4E68 A;  4PHM A;  3TS5 B;  1OOF A;  1RRO A;  1KQV A;  2KHN A;  1QLK A;  2LC5 A;  4PE4 A;  5I2Q A;  1RTP 1;  3DYE A;  3SIB A;  5PAL A;  1NP8 A;  1K9K A;  3L47 A;  3NSK A;  3VRP A;  2K0J A;  2KQ6 A;  1DEK A;  2COL B;  1KFX S;  4JKT A;  4MZK A;  1YUR A;  3PFV A;  4BY5 A;  2NCP A;  3CGA A;  1DT7 B;  1FBV A;  1PRW A;  1TRF A;  2KAX A;  1MXE A;  2F8P A;  2OTG C;  3D78 A;  2KYC A;  2ZRS A;  2WOS A;  3V2L A;  1B7T Y;  1S3P A;  1KQM C;  2LP2 A;  1A75 A;  3BXK A;  1RK9 A;  2L0P A;  3LK1 A;  5I2L A;  1TTX A;  3B87 A;  1EH2 A;  5BPJ A;  1XFR A;  2BCB A;  4R1E A;  4ZCV A;  2OPO A;  3OGN A;  4YGB B;  4ORC B;  5FYX A;  4AQJ A;  3KPX A;  1IIO A;  1SK6 D;  1XFW O;  2H61 A;  1SCV A;  2EC6 B;  2AMI A;  2PYQ A;  3QRX A;  5HLV A;  2LAN A;  3VGO A;  4FQO A;  2WND A;  1BJF A;  4C0L A;  1DGV A;  2H2K A;  2JT0 A;  3IQO A;  2K7C A;  2F3Z A;  1J7P A;  1L2O C;  4CPV A;  1TCO B;  3R72 A;  1A75 B;  5J3X A;  4DUQ A;  1ALW A;  2P70 A;  1SW8 A;  3JVT B;  4PHJ A;  4FQT A;  2OS8 B;  4PE1 A;  1J7O A;  3TZ1 A;  2BL0 B;  1NCZ A;  4YI8 A;  1OZO A;  1OMD A;  4HSZ A;  2LLS A;  3ZNI A;  5CSJ A;  4GBA A;  3NSL A;  1NYA A;  4WQ3 A;  4DS7 A;  1GQM A;  1EXR A;  1QIV A;  1K96 A;  1Y1X A;  1CDP A;  3A8R A;  2AAO A;  3EKH A;  3S0D A;  2L50 A;  2NZ0 A;  2BCA A;  2KAV A;  3B88 A;  4DIR A;  1K90 D;  3RZS A;  3K1E A;  1BOD A;  1X02 A;  1DJH A;  2M0R A;  4CLN A;  1QX5 B;  1TN4 A;  2NXQ A;  3TUY B;  4QJ4 B;  1HT9 A;  3SG2 A;  3TDI A;  3O4Y A;  1UHJ A;  2JT8 A;  1K9P A;  1NCX A;  3CZ1 A;  2FOT A;  1MR8 A;  1A4P A;  3CDN A;  4BY4 A;  5CPV A;  1QJT A;  1KSO A;  3WHU B;  1LS8 A;  1JF0 A;  2OTG B;  1ZOT B;  2WC5 A;  3TDU A;  1QX2 A;  1QLS A;  1IQ5 A;  2KFF A;  2PQL A;  1LA3 A;  4IL1 A;  4JD9 A;  3TS5 C;  5AER A;  3BOW A;  2BNX A;  2L2C A;  2MBX A;  1ZAC A;  1JF2 A;  2M1U A;  1XFZ O;  1UHI A;  2KFG A;  2M49 B;  3BUX B;  4YGA A;  2KSP A;  3O2P A;  4NDC A;  1KK7 Z;  4AQI A;  1UHN A;  2JOJ A;  4YBH B;  4A4C A;  1DVI A;  3C1V A;  2PVB A;  3D76 A;  4UPG A;  1Y6W A;  3SS3 A;  3Q8I A;  3CLN A;  1NCY A;  3DVJ A;  3FE8 A;  2I2R E;  5KU1 A;  1WY9 A;  1BR4 B;  2JPO A;  5JJG A;  1MUX A;  5I8N A;  3BOW B;  3GK4 X;  1AVS A;  3E3R A;  2LHI A;  2MAZ A;  3WNX B;  1M45 A;  1K9U A;  4MBE A;  1DQE A;  4XJK B;  1KK8 B;  2EC6 C;  1DJW A;  3CYZ A;  4MRX A;  1S26 D;  1RFJ A;  1Y1U A; 
#chains in the Genus database with same CATH homology
 1NSH A;  4PE7 A;  4U8D A;  5HKY A;  1WDC B;  1WRK A;  2I18 A;  3CR2 A;  4N5X A;  1CTR A;  2K7D A;  1CNP A;  1BMO A;  1CB1 A;  3O78 A;  1G8I A;  3BUW B;  3HCM A;  3KF9 A;  1KK7 Y;  4YGE B;  2BE4 A;  1N65 A;  4AOM A;  3JVT C;  2MRD A;  1QXP A;  2OS8 C;  3EK7 A;  1PSB A;  1R6P A;  2BL0 C;  3DVE A;  1EL4 A;  2LHL A;  1OSA A;  3EVV A;  1B9A A;  2LE9 B;  5HYD A;  1AJ4 A;  3IF7 A;  2WOR A;  2QPT A;  3OX5 A;  1YR5 A;  2K61 A;  5IBW A;  1DJX A;  1YUS A;  1YX7 A;  2LUX A;  2EGD A;  3FWC A;  4QJ3 B;  1OOJ A;  1PAL A;  1QAS A;  2LMV A;  3TUY C;  1K8U A;  3NSI A;  4I5N B;  1OQP A;  1PVB A;  3PLF B;  1CM1 A;  4PHN A;  2KDH A;  2LVV A;  3PAL A;  3TDZ A;  1SMG A;  2F2O A;  4Q04 A;  2JTT A;  4GUK A;  4NQG A;  3EKJ A;  2K2F A;  2LAP A;  1MF8 B;  1NPQ A;  2HPS A;  4QJ5 B;  1NIW A;  1C7W A;  2ZND A;  1N0Y A;  2MJW B;  1M31 A;  3JTD B;  2NCO A;  5HKW A;  2FCD A;  3I5G B;  5GQQ C;  2FCE A;  2NLN A;  3ICB A;  1WLZ A;  1CDM A;  1OE9 B;  4CID A;  2CXJ A;  5CSF A;  3AKB A;  1TNP A;  2KFH A;  1K94 A;  2KI6 C;  2Y1N A;  1GGZ A;  1CFF A;  4I5L B;  1UHH A;  1D1O A;  1M63 B;  1UWO A;  1MWN A;  1S36 A;  1G4Y R;  1PVA A;  1YVH A;  3GK2 A;  1GJY A;  2HQ8 A;  4HRH A;  2PAL A;  3DVM A;  1IH0 A;  2LNK A;  5DKR A;  1IKU A;  2JXC A;  2Y5I A;  3PN7 C;  1CM4 A;  3H4S E;  2M8U A;  2WC8 A;  1YTZ C;  3DF0 B;  3SG6 A;  2LLT A;  2EHB A;  2PRU A;  1F55 A;  4YGC B;  4MN0 A;  1QV1 A;  1KK8 C;  2LVK A;  3OB1 B;  4GGN A;  1NX2 A;  3BUO B;  3I5F B;  1SPY A;  4M2O A;  2CT9 A;  1WDC C;  1JFJ A;  2PMY A;  3AAJ A;  4OV2 A;  2Q4U A;  4PHK A;  3M0W A;  5ER5 A;  1DF0 A;  3VRQ A;  3EVU A;  3WHT B;  2G2B A;  1B8L A;  2KBM A;  1W7J B;  1S5G Z;  1Y0V H;  4HRE E;  3OX6 A;  2ZFD A;  1NWD A;  4OR9 B;  3I5H B;  2BCX A;  4MRY A;  2KQY A;  1TNX A;  3RLZ A;  3CWG A;  3FWB A;  2R2I A;  1LA0 A;  3CR5 X;  2LUC A;  2BKH B;  1N2D A;  1IWQ A;  2F33 A;  3RM1 A;  2G9B A;  1J1E A;  4I5J A;  3SG5 A;  5JOL A;  2M29 A;  1IG5 A;  2F3Y A;  2I7A A;  4XYN A;  4YGD B;  2ISD A;  3VRN A;  1DF0 B;  2L4I A;  2ZN9 A;  3IQQ A;  1SCM B;  2JC2 A;  1AK8 A;  4XJK A;  1KWO B;  2KNE A;  2KOT A;  1REC A;  1XFU O;  1ZMZ A;  4MSP A;  1H4B A;  5DKN A;  4MZL A;  2BEC A;  1SNL A;  1SKT A;  1YUT A;  1YRU B;  1KFU L;  2WCE A;  5B8I B;  1MXL C;  1UUS A;  2SCP A;  1LXF C;  1S5G Y;  4MVF A;  2K2A A;  4OKH A;  3JTD C;  1EG3 A;  4M2P A;  1CMF A;  1E8A A;  3I5G C;  3PN7 B;  1ALV A;  1XO5 A;  1UUR A;  1H8B A;  1JUO A;  1NX0 A;  1IGV A;  4DCK A;  1FI6 A;  3F45 A;  3A4U B;  2WCF A;  5KSZ A;  5D7F A;  4NDB A;  2B1U A;  2ZRT A;  3EVR A;  4OVN F;  1DJG A;  1S1E A;  2KI4 B;  1QV0 A;  4P5O E;  2SAS A;  1CFC A;  3GK1 A;  2JTZ A;  3VRO A;  4JWQ A;  1V1F A;  1YVL A;  2CTN A;  2ZN8 A;  3WXA A;  3MSE B;  3LLE A;  1BT6 A;  1CLL A;  1B8R A;  1F54 A;  1LIN A;  1QVI Z;  1CLM A;  1DJY A;  3KEV A;  3LCP C;  4N1G A;  1AUI B;  1K95 A;  1JC2 A;  1RJV A;  1SRA A;  1YUU A;  2JQ6 A;  2BBN A;  2KI6 D;  2L51 A;  3I5F C;  2KBI A;  1EG4 A;  2BE6 A;  3K21 A;  1QAT A;  2D8N A;  2DOQ A;  4MEW A;  3CS1 A;  1IJ5 A;  1PUL A;  1XFX O;  3DVK A;  4ETO A;  1A29 A;  1MHO A;  3AKA A;  1OMR A;  3KHE A;  4ZCU A;  3DD4 A;  3OP0 A;  1CDN A;  1JWD A;  1B7T Z;  1SBJ A;  2JXL A;  3I5H C;  1ZFS A;  3GOF A;  2M3W A;  3BUN B;  1KFX L;  2E30 A;  4D1E A;  1XFY O;  2F2P A;  1TOP A;  3PAT A;  1XFV O;  2KYF A;  2JRF A;  1LVC D;  4WQ2 A;  1XVJ A;  1QTX A;  3DF0 A;  2A4J A;  2E6W A;  1A2X A;  1SCM C;  1KWO C;  5DKQ A;  2L2E A;  1CFD A;  3BYA A;  3SG4 A;  1B1G A;  1TNW A;  1SYM A;  2O5G A;  2LMU A;  4HRG A;  1RWY A;  1B4C A;  2MA2 A;  4I5K A;  4F0Z B;  4FTG A;  1F70 A;  1C7V A;  1V1G A;  2M7N A;  3BUM B;  3D0Y A;  1TCF A;  4GPL B;  1FPW A;  1NX3 A;  2KGB C;  1YRT B;  1BR1 B;  3BQ3 A;  4YI9 A;  1BG1 A;  1CKK A;  3D10 A;  3KO0 A;  5G08 A;  1Y1A A;  1SY9 A;  4GGF A;  1DJZ A;  1TNQ A;  1CDL A;  1SR6 B;  2JPT A;  2KAY A;  2LLU A;  4PDZ A;  1U5I A;  2KI4 C;  1BF5 A;  1BOC A;  4OCI A;  1K93 D;  2HQW A;  5HKZ A;  2M1K B;  1JBA A;  4ORA B;  4MLW A;  4JPZ B;  2L5X B;  4MZJ A;  2VRG A;  1XK4 C;  2L4H A;  3SJS A;  1TIZ A;  2GV5 A;  1GGW A;  2GGZ A;  2JZI A;  3D0Y B;  3SG7 A;  1IJ6 A;  1F4O A;  2V53 A;  2LM5 A;  2JT3 A;  4GAO A;  4C0K A;  1LKJ A;  3FS7 A;  3ZWH A;  1ODB A;  2LCP A;  1QIW A;  4PE0 A;  1PSR A;  2Y1M A;  1K2H A;  1XA5 A;  5CSI A;  3EK8 A;  1IQ3 A;  1QS7 A;  3I5I B;  1B47 A;  1OMV A;  1SL8 A;  1U5I B;  1NUB A;  2P6B B;  1DJI A;  2HET A;  2HF5 A;  2LMT A;  2QAC A;  3VRR A;  2JNF A;  4DRW A;  5AEQ A;  1WRZ A;  1AP4 A;  2MLF C;  3PM8 A;  1DMO A;  1M39 A;  3NXA A;  2I94 A;  3O6B A;  2LVI A;  5I2O A;  2Q91 A;  3EK4 A;  5AXI A;  2M7L A;  2LV7 A;  1OZS A;  4ICB A;  4NDD A;  2K8M B;  1S6J A;  2IS9 A;  2CBL A;  1G33 A;  3SG3 A;  2TN4 A;  1XK4 A;  2M9G A;  3LK0 A;  4WRI A;  1CLB A;  2MLE C;  1CFP A;  2WCB A;  1B8C A;  5ER4 X;  4YRU A;  2Y4Q A;  3AAK A;  1KQM B;  2CCM A;  2LP3 A;  3NSO A;  1SL9 A;  3LL8 B;  1UHK A;  3CTN A;  5AFP A;  5TNC A;  2BBM A;  1JFK A;  3SIA A;  2JWW A;  3HX4 A;  1YX8 A;  1W7I B;  1WLM A;  3OHM B;  5D69 A;  2O60 A;  4L9M A;  4CFQ A;  5K89 A;  4USL A;  2PAS A;  2CNP A;  3PSR A;  1J55 A;  1KFU S;  3CR4 X;  3CZT X;  1J1D A;  1VRK A;  4CFR A;  1AJ5 A;  1A03 A;  1NX1 A;  1EJ3 A;  4PAL A;  1L2O B;  5HLO A;  5KTY A;  2BKI B;  4GNK B;  1KSM A;  5CSN A;  1R2U A;  1BU3 A;  1C07 A;  1XYD A;  1SR6 C;  2AUC A;  1Q80 A;  1F8H A;  4GFT A;  4PCW A;  4P2Y B;  2KGR A;  2LVJ A;  1QX7 A;  4C0J A;  2MHH A;  5AAN A;  1L7Z A;  4TNC A;  1S6C A;  1BLQ A;  1JSA A;  2RGI A;  3OB2 B;  4JQ0 D;  2JNX A;  1DTL A;  4N1F A;  4A4B A;  1J7R A;  1ZUZ A;  1KCY A;  2L98 A;  2ZKM X;  1FI5 A;  4ORB B;  1SL7 A;  2JUL A;  1M46 A;  2GGM A;  2K7O A;  2JU0 A;  1DGU A;  1J7Q A;  1WRL A;  2ZNE A;  2PSR A;  1MQ1 A;  1PK0 D;  1UP5 A;  1S6I A;  4GGF C;  5F6T A;  4M2Q A;  3I5I C;  1AHR A;  1CMG A;  3FIA A;  2H61 C;  2FJU B;  1F71 A;  1F4Q A;  1FF1 A;  2K7B A;  1FW4 A;  1HQV A;  1QVI Y;  2M97 A;  1IRJ A;  4E68 A;  4PHM A;  3TS5 B;  1RRO A;  1KQV A;  2KHN A;  1QLK A;  2LC5 A;  4PE4 A;  5I2Q A;  1RTP 1;  3SIB A;  5PAL A;  1NP8 A;  1K9K A;  3NSK A;  3VRP A;  2K0J A;  2KQ6 A;  2COL B;  1KFX S;  4MZK A;  1YUR A;  3PFV A;  4BY5 A;  2NCP A;  3CGA A;  1DT7 B;  1FBV A;  1PRW A;  1TRF A;  2KAX A;  1MXE A;  2F8P A;  2OTG C;  2KYC A;  2ZRS A;  2WOS A;  1B7T Y;  1S3P A;  1KQM C;  2LP2 A;  1A75 A;  3BXK A;  1RK9 A;  2L0P A;  3LK1 A;  5I2L A;  1TTX A;  1EH2 A;  5BPJ A;  2BCB A;  4R1E A;  4ZCV A;  2OPO A;  4YGB B;  4ORC B;  5FYX A;  4AQJ A;  3KPX A;  1SK6 D;  1XFW O;  2H61 A;  1SCV A;  2EC6 B;  2AMI A;  3QRX A;  5HLV A;  2LAN A;  3VGO A;  4FQO A;  2WND A;  1BJF A;  4C0L A;  1DGV A;  2H2K A;  2JT0 A;  3IQO A;  2K7C A;  2F3Z A;  1J7P A;  1L2O C;  4CPV A;  1TCO B;  1A75 B;  5J3X A;  4DUQ A;  1ALW A;  1SW8 A;  3JVT B;  4PHJ A;  4PE1 A;  2OS8 B;  1J7O A;  3TZ1 A;  2BL0 B;  1NCZ A;  4YI8 A;  1OZO A;  1OMD A;  4HSZ A;  2LLS A;  3ZNI A;  5CSJ A;  4GBA A;  3NSL A;  1NYA A;  4WQ3 A;  4DS7 A;  1GQM A;  1EXR A;  1QIV A;  1K96 A;  1Y1X A;  1CDP A;  3A8R A;  2AAO A;  3EKH A;  2L50 A;  2NZ0 A;  2BCA A;  2KAV A;  4DIR A;  1BOD A;  1K90 D;  1X02 A;  1DJH A;  2M0R A;  4CLN A;  1QX5 B;  1TN4 A;  2NXQ A;  3TUY B;  4QJ4 B;  1HT9 A;  3SG2 A;  3TDI A;  3O4Y A;  1UHJ A;  2JT8 A;  1K9P A;  1NCX A;  2FOT A;  1MR8 A;  1A4P A;  4BY4 A;  5CPV A;  1QJT A;  1KSO A;  3WHU B;  1JF0 A;  2OTG B;  1ZOT B;  3TDU A;  1QX2 A;  1QLS A;  1IQ5 A;  2KFF A;  4IL1 A;  1LA3 A;  3TS5 C;  5AER A;  3BOW A;  2MBX A;  1ZAC A;  1JF2 A;  2M1U A;  1XFZ O;  1UHI A;  2KFG A;  2M49 B;  3BUX B;  4YGA A;  2KSP A;  3O2P A;  4NDC A;  1KK7 Z;  4AQI A;  1UHN A;  2JOJ A;  4YBH B;  4A4C A;  1DVI A;  3C1V A;  2PVB A;  4UPG A;  1Y6W A;  3CLN A;  1NCY A;  3DVJ A;  2I2R E;  5KU1 A;  1WY9 A;  1BR4 B;  5JJG A;  1MUX A;  5I8N A;  3BOW B;  3GK4 X;  1AVS A;  3E3R A;  2LHI A;  2MAZ A;  3WNX B;  1M45 A;  1K9U A;  4MBE A;  4XJK B;  1KK8 B;  2EC6 C;  1DJW A;  4MRX A;  1S26 D;  1RFJ A;  1Y1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...