1KK8B

Scallop myosin (s1-adp-befx) in the actin-detached conformation
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
139
structure length
139
Chain Sequence
PQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic findings on the internally uncoupled and near-rigor states of myosin: further insights into the mechanics of the motor.
pubmed doi rcsb
molecule tags Contractile protein
molecule keywords Myosin Heavy Chain, Striated muscle
total genus 34
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2001-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kk8B01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kk8B02
2Y1MA 2GGZA 4HRHA 1OOJA 2M29A 2OPOA 1WRKA 1NUBA 1QV1A 1LXFC 1SRAA 1YUSA 2M7LA 2DOQA 2F2PA 4OVNF 4I5NB 1JBAA 1NPQA 2LP2A 2BCAA 1IQ5A 4MVFA 1BR4B 1DGVA 2SCPA 2OS8B 1BLQA 1ZOTB 1YVHA 1B4CA 1YVLA 1IWQA 3MSEB 1DTLA 1UURA 4ORCB 3O4YA 3WXAA 1MHOA 4PCWA 1LKJA 5KTYA 2ZN8A 3GK2A 1GGWA 1CFCA 1JSAA 1UHJA 2EGDA 5AANA 1W7JB 2HETA 2M3WA 2SASA 2F8PA 4NDBA 1CMFA 1MWNA 2A4JA 1OMDA 2QPTA 4M2QA 5ER5A 2L4HA 1L2OC 1KFUL 1MR8A 3I5GB 2M97A 1WRZA 3OB1B 1EG4A 3VRNA 3PFVA 2BE6A 3TDUA 3WNXB 2O60A 1FBVA 1SPYA 2MBXA 1BR1B 3BOWA 5J3XA 1TIZA 2KBMA 1QLKA 1ODBA 3RLZA 2BKHB 1J1EA 1OE9B 3CWGA 2HPSA 2K7OA 1N65A 1BF5A 2F3YA 2E30A 2M0RA 2BL0B 2Q91A 2K0JA 3PN7C 1TNWA 4N5XA 1IG5A 1NCYA 1G33A 1J7OA 2NCOA 3LLEA 4A4CA 2WCFA 3I5FC 1GGZA 2KBIA 2K61A 1MXLC 3BOWB 3QRXA 1CLLA 2WNDA 5DKQA 4GNKB 1TNQA 2HF5A 4GUKA 1CDPA 1OMVA 4XJKA 1CLMA 1KK7Z 5DKRA 1D1OA 1KCYA 2PRUA 3LK0A 2O5GA 3NSIA 4MEWA 1A03A 2OTGC 3CLNA 4N1FA 2LMVA 3AAJA 5I8NA 1SR6B 1CKKA 2Q4UA 5G08A 1C07A 1JFJA 1NP8A 1UHKA 1BJFA 1CM4A 1B8LA 5AEQA 2LVJA 3CR5X 2KGBC 3EK8A 4OCIA 2BE4A 2LMUA 3CTNA 1DT7B 1JF2A 4FQOA 2L98A 1G8IA 2LANA 5CSFA 3KHEA 3SIBA 3SG5A 1S6JA 2KFHA 5AFPA 2MLEC 5JJGA 1KK8B 1UHNA 1XO5A 3SG2A 3JVTC 1M63B 1XFXO 3TDZA 4UPGA 3O2PA 2Y5IA 2OS8C 1WY9A 4HSZA 2JXLA 2KAVA 2H2KA 4DIRA 3HCMA 4HREE 1OZSA 2CNPA 3DF0A 4PHNA 3VGOA 1DGUA 3VROA 4QJ4B 1OSAA 4PHKA 1JF0A 3BQ3A 1SL7A 1HT9A 2NLNA 2M9GA 2FOTA 4MSPA 1S1EA 3SG6A 3O6BA 3EKHA 1JC2A 1YTZC 2JTTA 3RM1A 1FF1A 1BOCA 1KWOB 2F2OA 2ZKMX 2KOTA 4JPZB 1CDLA 2NCPA 4GGFC 2K8MB 4PHJA 4JQ0D 1R6PA 3LL8B 2JXCA 1B8RA 2LLSA 1CB1A 5CSIA 4QJ3B 3E3RA 1SY9A 5CPVA 3OX5A 4GGNA 4CLNA 1RROA 1TOPA 4MRYA 4GBAA 1YUUA 2H61C 1KSOA 1OMRA 3KPXA 5HKYA 1X02A 4NDCA 3NXAA 2KQYA 3BUOB 2K2AA 3FIAA 2KNEA 1B8CA 1UHHA 1V1FA 3OX6A 2JT3A 4D1EA 1AHRA 1WLZA 1ZUZA 5I2LA 2VRGA 1U5IB 2KYCA 3I5HB 1A4PA 3GOFA 3DF0B 3JVTB 3PN7B 1XK4C 1J7QA 3OHMB 2R2IA 1NSHA 1PULA 2BCBA 3EKJA 5I2QA 1CDMA 1YRUB 2LP3A 2F33A 3IQQA 2LCPA 1KQMB 1QJTA 4BY4A 1YR5A 1LINA 2WOSA 2K7CA 4PE1A 1TN4A 1PVAA 2WORA 2ZNEA 2BCXA 3EK7A 4L9MA 3NSOA 3I5HC 2PVBA 1IJ6A 1CFPA 1JWDA 1K95A 2LE9B 3I5GC 5K89A 2JT8A 1NYAA 1MUXA 2EC6B 1NX0A 2KI4C 2MA2A 4ORAB 3TS5C 1KQVA 3CGAA 2KHNA 1FW4A 1RFJA 1XFWO 2EC6C 3AKAA 1DJGA 1ALWA 1DJXA 1DJYA 1A75B 2BKIB 1K90D 1ZMZA 2KI6C 2LV7A 1GJYA 3CR4X 2V53A 4ICBA 2MLFC 4PE0A 5HLOA 4DRWA 1XFZO 1MQ1A 3WHUB 3VRQA 1CM1A 1DF0A 4FTGA 2HQ8A 1Y1XA 4XYNA 1MF8B 1K9KA 1KQMC 2P6BB 1WRLA 1WDCB 1B9AA 2LAPA 4BY5A 2KAXA 4PDZA 1CFFA 2LHLA 1TCOB 2GGMA 2PALA 4M2PA 1FI5A 2JU0A 1XFYO 2M8UA 3H4SE 3AAKA 1UUSA 4R1EA 5JOLA 3NSLA 2CTNA 4PE7A 2G9BA 1C7VA 1BU3A 2H61A 1IH0A 4MZJA 2I94A 2KDHA 2M1UA 3K21A 1BT6A 3A4UB 2LMTA 1KFUS 3PM8A 5HYDA 1F4OA 4I5KA 3ZWHA 4I5JA 4C0JA 1PALA 1SCVA 2IS9A 3WHTB 3PALA 2B1UA 1SL9A 1K94A 1S6IA 3BUWB 2BBNA 3DD4A 1XYDA 1OZOA 3LK1A 4M2OA 1KFXL 1SNLA 2K2FA 1SKTA 2AMIA 2WC8A 3IF7A 4YGCB 5FYXA 4YI9A 4NDDA 1QXPA 2CXJA 3PLFB 4MRXA 1KFXS 1EH2A 1QASA 3TUYB 1R2UA 1RJVA 4YGAA 3IQOA 1QATA 2COLB 5AERA 5IBWA 1S5GZ 1SYMA 1U5IA 4YI8A 4CIDA 3F45A 2KFFA 1QX7A 2KI4B 4ORBB 1M31A 1CFDA 4C0LA 1RECA 3PATA 3GK1A 5DKNA 1AP4A 1LA0A 1NIWA 1QS7A 1TRFA 2LLTA 2LLUA 2L50A 2M49B 2QACA 1ZACA 1NWDA 1TNPA 2L5XB 4AQJA 1UHIA 3JTDB 1SK6D 2GV5A 3CS1A 3PSRA 1DMOA 2PASA 3GK4X 3O78A 3VRPA 1F55A 1A2XA 1EJ3A 2JZIA 4C0KA 2MAZA 3I5IC 1DVIA 1A75A 1SCMC 2PMYA 2I18A 3SJSA 4CFQA 2PSRA 3CZTX 1EG3A 4XJKB 1H4BA 1KK8C 1K9PA 1EXRA 3OP0A 3TDIA 3C1VA 1SL8A 1SCMB 3M0WA 4U8DA 4OV2A 2JC2A 2KSPA 1JUOA 1M45A 1QX5B 1S36A 1K8UA 1PVBA 3LCPC 1Y0VH 2NZ0A 2BBMA 1NX1A 4YBHB 1UWOA 5D7FA 2AUCA 1K96A 1Y1AA 1QIVA 4USLA 5F6TA 1EL4A 4MN0A 4CFRA 4P5OE 1VRKA 4P2YB 1SR6C 4ZCUA 2BECA 2L4IA 3DVJA 1J55A 2OTGB 2JWWA 1TTXA 1RK9A 2JOJA 1J7RA 1HQVA 3A8RA 1NCXA 4WQ2A 5BPJA 2MJWB 1CTRA 1W7IB 1J7PA 1CNPA 3SIAA 3BUXB 1XVJA 1NX2A 2I2RE 2LC5A 1B7TZ 1QVIZ 1PSRA 3KEVA 3BUMB 4WQ3A 3VRRA 2LUCA 2EHBA 5I2OA 1F54A 1F8HA 4YRUA 1KSMA 3BXKA 1AJ5A 1V1GA 4TNCA 1YRTB 3DVEA 4PE4A 3EVUA 3OB2B 1PK0D 1B7TY 1QVIY 2KGRA 5HLVA 3ZNIA 4CPVA 2ZFDA 1A29A 2WCEA 3CR2A 2F3ZA 1QX2A 2WCBA 1QIWA 1Y6WA 4MZKA 5HKZA 1M39A 5ER4X 2G2BA 1E8AA 2MRDA 4JWQA 2LVKA 1JFKA 3ICBA 1CLBA 3JTDC 1XA5A 4MZLA 4HRGA 2FCEA 2L2EA 2TN4A 4QJ5B 2LNKA 1FI6A 4WRIA 2JNXA 2JNFA 2KYFA 4N1GA 1ZFSA 3D0YA 1QLSA 1DF0B 5AXIA 2RGIA 4YGEB 2ZN9A 2CBLA 1SW8A 3BYAA 5TNCA 4AQIA 2ZNDA 2LHIA 1QTXA 1YUTA 4I5LB 1F70A 1KWOC 3DVMA 3EK4A 3TUYC 1CMGA 1TCFA 2JPTA 2JULA 1B47A 1F4QA 1PSBA 3D0YB 2KQ6A 2FCDA 4DUQA 1F71A 1ALVA 3FWCA 4IL1A 4ZCVA 1YX7A 1S6CA 3TZ1A 1BODA 2LM5A 1UP5A 1YURA 1FPWA 3TS5B 1J1DA 1XFUO 4NQGA 1RTP1 2CCMA 1TNXA 1BG1A 2MHHA 1IJ5A 3SG4A 2Y4QA 1C7WA 4DS7A 3I5FB 2ZRTA 2AAOA 2ZRSA 1H8BA 1RWYA 1XFVO 2KI6D 2BL0C 3HX4A 3EVVA 4MLWA 1OQPA 3I5IB 2L51A 1S26D 5B8IB 1SBJA 2M1KB 3NSKA 3KO0A 4YGDB 1IGVA 1WDCC 4YGBB 1AK8A 2FJUB 2D8NA 3SG3A 5PALA 1Q80A 4GGFA 1PRWA 3SG7A 5D69A 1IQ3A 3FS7A 1NCZA 2NXQA 5GQQC 2CT9A 4E68A 3BUNB 5CSNA 2LVIA 2K7BA 2KFGA 1S5GY 1Y1UA 4OKHA 4OR9B 2K7DA 1K93D 1N0YA 5KSZA 2JQ6A 3DVKA 1L2OB 5KU1A 1MXEA 1DJZA 4A4BA 1CDNA 4GPLB 3KF9A 5HKWA 1NX3A 1AVSA 2I7AA 4DCKA 5CSJA 1IRJA 2L0PA 1DJIA 2Y1NA 1LA3A 1AUIB 2JRFA 2LVVA 1IKUA 1B1GA 2E6WA 4GAOA 4F0ZB 1LVCD 2JT0A 1G4YR 4Q04A 2ISDA 1K2HA 1KK7Y 1M46A 2KAYA 1L7ZA 2M7NA 3FWBA 4PALA 1BMOA 4ETOA 1XK4A 1YX8A 2JTZA 1AJ4A 1WLMA 3EVRA 1GQMA 2HQWA 1K9UA 1N2DA 4AOMA 4GFTA 1QV0A 4PHMA 2LUXA 3AKBA 1DJWA 3D10A 1S3PA 4MBEA 1DJHA 1SMGA
chains in the Genus database with same CATH superfamily
2Y1MA 2GGZA 4HRHA 1OOJA 2M29A 2OPOA 1WRKA 1NUBA 1QV1A 1LXFC 1SRAA 1YUSA 2M7LA 2DOQA 2F2PA 2WCKA 3CABA 3CZ2A 4OVNF 4I5NB 1JBAA 1NPQA 2LP2A 2BCAA 1IQ5A 4MVFA 1BR4B 1DGVA 2SCPA 2OS8B 1BLQA 1ZOTB 1YVHA 1B4CA 1YVLA 1IWQA 3MSEB 1DTLA 1UURA 4ORCB 3PM2A 3O4YA 3WXAA 1MHOA 4PCWA 1LKJA 5KTYA 2ZN8A 3GK2A 1GGWA 1CFCA 1JSAA 1UHJA 2EGDA 5AANA 1W7JB 2HETA 2M3WA 2SASA 2F8PA 4NDBA 1CMFA 1MWNA 2A4JA 1OMDA 2QPTA 4M2QA 5ER5A 1TUZA 2L4HA 1L2OC 3UO9A 1KFUL 1MR8A 3I5GB 3D78A 2QEOA 2M97A 1WRZA 3OB1B 3S0EA 1EG4A 3VRNA 3PFVA 2BE6A 3TDUA 3WNXB 2O60A 1FBVA 1SPYA 2MBXA 1BR1B 3BOWA 5J3XA 1TIZA 2KBMA 3R1OA 1QLKA 1ODBA 3RLZA 1OOFA 2BKHB 1J1EA 3K1EA 1OE9B 3CWGA 2HPSA 2K7OA 1N65A 2WCMA 1BF5A 2F3YA 2E30A 2M0RA 3D74A 2BL0B 2Q91A 2K0JA 3PN7C 1TNWA 4N5XA 1IG5A 1NCYA 1G33A 1J7OA 2NCOA 3LLEA 4A4CA 2WCFA 3I5FC 1GGZA 2KBIA 2K61A 1MXLC 3BOWB 3QRXA 1CLLA 2WNDA 5DKQA 4GNKB 1TNQA 2HF5A 4GUKA 1CDPA 1OMVA 2KLDA 1CLMA 1KK7Z 4XJKA 5DKRA 1D1OA 1KCYA 3N7HA 1C3ZA 2PRUA 3LK0A 2O5GA 3NSIA 4MEWA 1A03A 2OTGC 3CLNA 4N1FA 2LMVA 3AAJA 5I8NA 1SR6B 1P28A 1DC1A 1CKKA 2Q4UA 5G08A 1C07A 1JFJA 1NP8A 1UHKA 1BJFA 1CM4A 1B8LA 5AEQA 2LVJA 3BJHA 3CR5X 2KGBC 2KLEA 3EK8A 3S0FA 4OCIA 2BE4A 2LMUA 3CTNA 2QEHA 1DT7B 1JF2A 1C3YA 2L5YA 4FQOA 2L98A 1G8IA 2LANA 1XFRA 5CSFA 3KHEA 2WC5A 2P70A 3SIBA 3SG5A 1S6JA 2KFHA 5AFPA 2MLEC 5JJGA 1KK8B 1UHNA 1XO5A 3SG2A 3JVTC 1M63B 1XFXO 1Z2CB 3TDZA 3CYZA 3O2PA 2Y5IA 2OS8C 4UPGA 1WY9A 4HSZA 2JXLA 2KAVA 1OW4A 2H2KA 4DIRA 3DY9A 3HCMA 4HREE 1OZSA 2CNPA 3DF0A 4PHNA 3VGOA 1DGUA 3VROA 4QJ4B 1OSAA 4PHKA 1JF0A 3BQ3A 1SL7A 1HT9A 5HL1A 2WC6A 2NLNA 2M9GA 2FOTA 4MSPA 1S1EA 3SG6A 2WCJA 3O6BA 3EKHA 1JC2A 3NHIA 1YTZC 2JTTA 3RM1A 1FF1A 1BOCA 1KWOB 2F2OA 2ZKMX 2KOTA 4JPZB 1CDLA 2NCPA 4GGFC 2K8MB 3D75A 4PHJA 3B87A 4JQ0D 1R6PA 3NHTA 3LL8B 2JXCA 1B8RA 2LLSA 3PJIA 1CB1A 5CSIA 4QJ3B 3E3RA 1SY9A 5CPVA 3OX5A 4GGNA 4CLNA 1RROA 1TOPA 2BNXA 2JPOA 4GBAA 4MRYA 1YUUA 2H61C 1KSOA 1OMRA 3KPXA 5HKYA 1IIOA 1OOIX 1X02A 4NDCA 3NXAA 2KQYA 3BUOB 2K2AA 4OZDA 3FIAA 2KNEA 3CDNA 1B8CA 1UHHA 1V1FA 3OX6A 2JT3A 3V2LA 4D1EA 1AHRA 1WLZA 1ZUZA 5I2LA 2VRGA 1U5IB 2KYCA 2P71A 3I5HB 1A4PA 5FI2A 3VB1A 3GOFA 3DF0B 3JVTB 3PN7B 1XK4C 1J7QA 3OHMB 2R2IA 1NSHA 1PULA 2BCBA 3EKJA 5I2QA 1CDMA 5EL2A 1YRUB 2LP3A 2F33A 1DEKA 3IQQA 1OOGA 2LCPA 1KQMB 1QJTA 4BY4A 1YR5A 1DQEA 1LINA 2WOSA 2K7CA 4PE1A 1TN4A 1PVAA 2WORA 2ZNEA 2BCXA 3EK7A 4INXA 4L9MA 3NSOA 3I5HC 3S0BA 2PVBA 1IJ6A 1CFPA 1JWDA 1K95A 2LE9B 3I5GC 2WCLA 5K89A 2JT8A 1NYAA 1MUXA 2EC6B 1NX0A 2KI4C 2MA2A 4ORAB 3TS5C 1KQVA 3CGAA 2KHNA 5I94A 1FW4A 1RFJA 1TUJA 1XFWO 2EC6C 3AKAA 1DJGA 1ALWA 1DJXA 1DJYA 1A75B 2BKIB 1K90D 1ZMZA 2KI6C 2LV7A 1GJYA 3CR4X 2V53A 4ICBA 2MLFC 4JKTA 4PE0A 5HLOA 4DRWA 1XFZO 3Q8IA 1MQ1A 3WHUB 5FI7A 4KYNA 3VRQA 1CM1A 1TWOA 1DF0A 4FTGA 2HQ8A 1Y1XA 4XYNA 1MF8B 1K9KA 1KQMC 1GM0A 2P6BB 1WRLA 1WDCB 1B9AA 2LAPA 4BY5A 2KAXA 4PDZA 1CFFA 2LHLA 1TCOB 2GGMA 2PALA 4JD9A 4M2PA 1FI5A 2JU0A 1XFYO 2M8UA 3H4SE 3AAKA 1UUSA 3DYEA 4R1EA 3NSLA 2CTNA 3B88A 4PE7A 5JOLA 2G9BA 3SS3A 1C7VA 1BU3A 2H61A 1QWVA 3BFAA 4MZJA 2I94A 2KDHA 2M1UA 3FE9A 3K21A 1IH0A 1BT6A 3A4UB 2LMTA 1KFUS 3PM8A 5HYDA 1ORGA 1F4OA 4I5KA 3ZWHA 2YGUA 4I5JA 4C0JA 1PALA 1SCVA 2IS9A 3WHTB 3PALA 2B1UA 1SL9A 1K94A 1S6IA 3BUWB 2BBNA 3DD4A 1XYDA 1OZOA 3LK1A 3CZ1A 4M2OA 1KFXL 1SNLA 2K2FA 1SKTA 2AMIA 2WC8A 3IF7A 4YGCB 5FYXA 4YI9A 4NDDA 1QXPA 2CXJA 3PLFB 3NGVA 4MRXA 1KFXS 2K60A 1EH2A 1QASA 3TUYB 1R2UA 1RJVA 4YGAA 3IQOA 1QATA 3B7AA 2COLB 5AERA 5IBWA 3CZ0A 1S5GZ 1SYMA 1U5IA 4YI8A 4CIDA 3F45A 3S0AA 2KFFA 1QX7A 2KI4B 4ORBB 1M31A 1CFDA 4C0LA 3S0GA 1RECA 3PATA 3GK1A 5DKNA 1AP4A 1LA0A 1NIWA 1QS7A 1TRFA 2LLTA 2LLUA 2L50A 2M49B 2QACA 1ZACA 1NWDA 3QMEA 1TNPA 2L5XB 4AQJA 1UHIA 3JTDB 1SK6D 2GV5A 3CS1A 3PSRA 1DMOA 2PASA 3BFBA 3GK4X 3O78A 3B6XA 3VRPA 1F55A 1A2XA 1EJ3A 2JZIA 4C0KA 2MAZA 3I5IC 1DVIA 3OBVA 1A75A 1SCMC 1DELA 3D76A 2PMYA 2I18A 3SJSA 4CFQA 1SSEB 2PSRA 2H8VA 4PT1A 2FJYA 3CZTX 1EG3A 4XJKB 1H4BA 1KK8C 1K9PA 1EXRA 3OP0A 3SS4A 3TDIA 3C1VA 1SL8A 1SCMB 3M0WA 4U8DA 4OV2A 4FQTA 2JC2A 2KSPA 1JUOA 1M45A 1QX5B 1S36A 1K8UA 3R72A 1PVBA 3LCPC 1Y0VH 2NZ0A 2BBMA 1NX1A 4YBHB 1UWOA 5D7FA 2AUCA 1K96A 1Y1AA 1QIVA 4USLA 5F6TA 1EL4A 4MN0A 4CFRA 4P5OE 1VRKA 2L2CA 4P2YB 1SR6C 4ZCUA 2BECA 1W9ZA 2L4IA 3DVJA 1J55A 2OTGB 2WCHA 2JWWA 1TTXA 1RK9A 2JOJA 1J7RA 1HQVA 3A8RA 1NCXA 4WQ2A 5BPJA 2MJWB 3L4AA 1CTRA 1W7IB 1J7PA 1CNPA 3SIAA 3BUXB 1XVJA 1NX2A 2I2RE 2LC5A 1QVIZ 1B7TZ 1LS8A 1PSRA 3BUMB 3KEVA 4WQ3A 2KPHA 2EHBA 2LUCA 3VRRA 5I2OA 4YRUA 1F54A 1F8HA 1KSMA 3BXKA 1AJ5A 1V1GA 4TNCA 5D3OA 1YRTB 3DVEA 3D77A 4PE4A 3EVUA 3OB2B 1PK0D 3RZSA 1B7TY 1QVIY 2KGRA 3OGNA 5HLVA 3ZNIA 3DXLA 3D73A 4CPVA 2ZFDA 1A29A 2WCEA 2BAPA 5DICA 2PQLA 3CR2A 2F3ZA 1QX2A 2WCBA 1QIWA 2ERBA 1Y6WA 4MZKA 3FE8A 5HKZA 1M39A 5ER4X 2G2BA 3L47A 1E8AA 2MRDA 4JWQA 2LVKA 1JFKA 3ICBA 1CLBA 3JTDC 1XA5A 4MZLA 4HRGA 2FCEA 2L2EA 2TN4A 3EG5B 4QJ5B 2LNKA 4INWA 1FI6A 4WRIA 2JNXA 2JNFA 2KYFA 4N1GA 3R1PA 1ZFSA 3D0YA 1QLSA 1DF0B 5AXIA 2RGIA 4YGEB 2ZN9A 2CBLA 1SW8A 3BYAA 5TNCA 3IVTA 2QDIA 4AQIA 2ZNDA 4F7FA 2LHIA 2GTEA 1QTXA 1YUTA 4I5LB 1F70A 1KWOC 3DVMA 3EK4A 3TUYC 4IJ7A 1CMGA 3BFHA 1TCFA 2JPTA 3B86A 2JULA 1B47A 1F4QA 1PSBA 3D0YB 2KQ6A 2FCDA 4DUQA 1F71A 1ALVA 3FWCA 4IL1A 4ZCVA 1YX7A 1S6CA 3TZ1A 1BODA 2LM5A 1UP5A 1YURA 1FPWA 3SS5A 1J1DA 1XFUO 4NQGA 1RTP1 3TS5B 2CCMA 1TNXA 1BG1A 2MHHA 1IJ5A 3SG4A 2Y4QA 5FI6A 1C7WA 4DS7A 3I5FB 2ZRTA 2AAOA 3FE6A 2ZRSA 1H8BA 1RWYA 1XFVO 2KI6D 1Z4HA 2BL0C 3HX4A 3R1VA 3DZTA 3EVVA 4MLWA 1OQPA 3I5IB 2L51A 1S26D 5B8IB 1OOHA 1SBJA 2M1KB 3NSKA 3KO0A 4YGDB 1IGVA 1WDCC 4YGBB 1AK8A 2FJUB 2D8NA 3SG3A 5PALA 1Q80A 4GGFA 1PRWA 3SG7A 5D69A 1IQ3A 3FS7A 1NCZA 2NXQA 5GQQC 2CT9A 4E68A 3BUNB 5CSNA 2QEBA 2LVIA 2K7BA 2KFGA 1S5GY 1Y1UA 2PYQA 4OKHA 4OR9B 2K7DA 1K93D 1N0YA 5KSZA 2JQ6A 3DVKA 1L2OB 5KU1A 1MXEA 1DJZA 3S0DA 4A4BA 3L4LA 4GPLB 3KF9A 2QEVA 5HKWA 1CDNA 1NX3A 1AVSA 2I7AA 4DCKA 5CSJA 1IRJA 2L0PA 1DJIA 2Y1NA 1LA3A 1AUIB 2JRFA 2LVVA 1IKUA 1B1GA 2E6WA 4GAOA 4F0ZB 1LVCD 3UNWA 2JT0A 1G4YR 4Q04A 2ISDA 1K2HA 1KK7Y 1M46A 2KAYA 1L7ZA 2M7NA 3FWBA 4PALA 1BMOA 4ETOA 1XK4A 1T14A 1YX8A 2JTZA 1AJ4A 1WLMA 3EVRA 1GQMA 2HQWA 1K9UA 1N2DA 4AOMA 3O4XA 4GFTA 1QV0A 4PHMA 2LUXA 3AKBA 1DJWA 3D10A 1S3PA 4MBEA 1DJHA 1SMGA
chains in the Genus database with same CATH topology
2Y1MA 2GGZA 4HRHA 1OOJA 2M29A 2OPOA 1WRKA 1NUBA 1QV1A 1LXFC 1SRAA 1YUSA 2M7LA 2DOQA 2F2PA 4OVNF 4I5NB 1JBAA 1NPQA 2LP2A 2BCAA 1IQ5A 4MVFA 1BR4B 1DGVA 2SCPA 2OS8B 1BLQA 1ZOTB 1YVHA 1B4CA 1YVLA 1IWQA 3MSEB 1DTLA 1UURA 4ORCB 3O4YA 3WXAA 1MHOA 4PCWA 1LKJA 5KTYA 2ZN8A 3GK2A 1GGWA 1CFCA 1JSAA 1UHJA 2EGDA 5AANA 1W7JB 2HETA 2M3WA 2SASA 2F8PA 4NDBA 1CMFA 1MWNA 2A4JA 1OMDA 2QPTA 4M2QA 5ER5A 2L4HA 1L2OC 1KFUL 1MR8A 3I5GB 2M97A 1WRZA 3OB1B 1EG4A 3VRNA 3PFVA 2BE6A 3TDUA 3WNXB 2O60A 1FBVA 1SPYA 2MBXA 1BR1B 3BOWA 5J3XA 1TIZA 2KBMA 1QLKA 1ODBA 3RLZA 2BKHB 1J1EA 1OE9B 3CWGA 2HPSA 2K7OA 1N65A 1BF5A 2F3YA 2E30A 2M0RA 2BL0B 2Q91A 2K0JA 3PN7C 1TNWA 4N5XA 1IG5A 1NCYA 1G33A 1J7OA 2NCOA 3LLEA 4A4CA 2WCFA 3I5FC 1GGZA 2KBIA 2K61A 1MXLC 3BOWB 3QRXA 1CLLA 2WNDA 5DKQA 4GNKB 1TNQA 2HF5A 4GUKA 1CDPA 1OMVA 4XJKA 1CLMA 1KK7Z 5DKRA 1D1OA 1KCYA 2PRUA 3LK0A 2O5GA 3NSIA 4MEWA 1A03A 2OTGC 3CLNA 4N1FA 2LMVA 3AAJA 5I8NA 1SR6B 1CKKA 2Q4UA 5G08A 1C07A 1JFJA 1NP8A 1UHKA 1BJFA 1CM4A 1B8LA 5AEQA 2LVJA 3CR5X 2KGBC 3EK8A 4OCIA 2BE4A 2LMUA 3CTNA 1DT7B 1JF2A 4FQOA 2L98A 1G8IA 2LANA 5CSFA 3KHEA 3SIBA 3SG5A 1S6JA 2KFHA 5AFPA 2MLEC 5JJGA 1KK8B 1UHNA 1XO5A 3SG2A 3JVTC 1M63B 1XFXO 3TDZA 4UPGA 3O2PA 2Y5IA 2OS8C 1WY9A 4HSZA 2JXLA 2KAVA 2H2KA 4DIRA 3HCMA 4HREE 1OZSA 2CNPA 3DF0A 4PHNA 3VGOA 1DGUA 3VROA 4QJ4B 1OSAA 4PHKA 1JF0A 3BQ3A 1SL7A 1HT9A 2NLNA 2M9GA 2FOTA 4MSPA 1S1EA 3SG6A 3O6BA 3EKHA 1JC2A 1YTZC 2JTTA 3RM1A 1FF1A 1BOCA 1KWOB 2F2OA 2ZKMX 2KOTA 4JPZB 1CDLA 2NCPA 4GGFC 2K8MB 4PHJA 4JQ0D 1R6PA 3LL8B 2JXCA 1B8RA 2LLSA 1CB1A 5CSIA 4QJ3B 3E3RA 1SY9A 5CPVA 3OX5A 4GGNA 4CLNA 1RROA 1TOPA 4MRYA 4GBAA 1YUUA 2H61C 1KSOA 1OMRA 3KPXA 5HKYA 1X02A 4NDCA 3NXAA 2KQYA 3BUOB 2K2AA 3FIAA 2KNEA 1B8CA 1UHHA 1V1FA 3OX6A 2JT3A 4D1EA 1AHRA 1WLZA 1ZUZA 5I2LA 2VRGA 1U5IB 2KYCA 3I5HB 1A4PA 3GOFA 3DF0B 3JVTB 3PN7B 1XK4C 1J7QA 3OHMB 2R2IA 1NSHA 1PULA 2BCBA 3EKJA 5I2QA 1CDMA 1YRUB 2LP3A 2F33A 3IQQA 2LCPA 1KQMB 1QJTA 4BY4A 1YR5A 1LINA 2WOSA 2K7CA 4PE1A 1TN4A 1PVAA 2WORA 2ZNEA 2BCXA 3EK7A 4L9MA 3NSOA 3I5HC 2PVBA 1IJ6A 1CFPA 1JWDA 1K95A 2LE9B 3I5GC 5K89A 2JT8A 1NYAA 1MUXA 2EC6B 1NX0A 2KI4C 2MA2A 4ORAB 3TS5C 1KQVA 3CGAA 2KHNA 1FW4A 1RFJA 1XFWO 2EC6C 3AKAA 1DJGA 1ALWA 1DJXA 1DJYA 1A75B 2BKIB 1K90D 1ZMZA 2KI6C 2LV7A 1GJYA 3CR4X 2V53A 4ICBA 2MLFC 4PE0A 5HLOA 4DRWA 1XFZO 1MQ1A 3WHUB 3VRQA 1CM1A 1DF0A 4FTGA 2HQ8A 1Y1XA 4XYNA 1MF8B 1K9KA 1KQMC 2P6BB 1WRLA 1WDCB 1B9AA 2LAPA 4BY5A 2KAXA 4PDZA 1CFFA 2LHLA 1TCOB 2GGMA 2PALA 4M2PA 1FI5A 2JU0A 1XFYO 2M8UA 3H4SE 3AAKA 1UUSA 4R1EA 5JOLA 3NSLA 2CTNA 4PE7A 2G9BA 1C7VA 1BU3A 2H61A 1IH0A 4MZJA 2I94A 2KDHA 2M1UA 3K21A 1BT6A 3A4UB 2LMTA 1KFUS 3PM8A 5HYDA 1F4OA 4I5KA 3ZWHA 4I5JA 4C0JA 1PALA 1SCVA 2IS9A 3WHTB 3PALA 2B1UA 1SL9A 1K94A 1S6IA 3BUWB 2BBNA 3DD4A 1XYDA 1OZOA 3LK1A 4M2OA 1KFXL 1SNLA 2K2FA 1SKTA 2AMIA 2WC8A 3IF7A 4YGCB 5FYXA 4YI9A 4NDDA 1QXPA 2CXJA 3PLFB 4MRXA 1KFXS 1EH2A 1QASA 3TUYB 1R2UA 1RJVA 4YGAA 3IQOA 1QATA 2COLB 5AERA 5IBWA 1S5GZ 1SYMA 1U5IA 4YI8A 4CIDA 3F45A 2KFFA 1QX7A 2KI4B 4ORBB 1M31A 1CFDA 4C0LA 1RECA 3PATA 3GK1A 5DKNA 1AP4A 1LA0A 1NIWA 1QS7A 1TRFA 2LLTA 2LLUA 2L50A 2M49B 2QACA 1ZACA 1NWDA 1TNPA 2L5XB 4AQJA 1UHIA 3JTDB 1SK6D 2GV5A 3CS1A 3PSRA 1DMOA 2PASA 3GK4X 3O78A 3VRPA 1F55A 1A2XA 1EJ3A 2JZIA 4C0KA 2MAZA 3I5IC 1DVIA 1A75A 1SCMC 2PMYA 2I18A 3SJSA 4CFQA 2PSRA 3CZTX 1EG3A 4XJKB 1H4BA 1KK8C 1K9PA 1EXRA 3OP0A 3TDIA 3C1VA 1SL8A 1SCMB 3M0WA 4U8DA 4OV2A 2JC2A 2KSPA 1JUOA 1M45A 1QX5B 1S36A 1K8UA 1PVBA 3LCPC 1Y0VH 2NZ0A 2BBMA 1NX1A 4YBHB 1UWOA 5D7FA 2AUCA 1K96A 1Y1AA 1QIVA 4USLA 5F6TA 1EL4A 4MN0A 4CFRA 4P5OE 1VRKA 4P2YB 1SR6C 4ZCUA 2BECA 2L4IA 3DVJA 1J55A 2OTGB 2JWWA 1TTXA 1RK9A 2JOJA 1J7RA 1HQVA 3A8RA 1NCXA 4WQ2A 5BPJA 2MJWB 1CTRA 1W7IB 1J7PA 1CNPA 3SIAA 3BUXB 1XVJA 1NX2A 2I2RE 2LC5A 1B7TZ 1QVIZ 1PSRA 3KEVA 3BUMB 4WQ3A 3VRRA 2LUCA 2EHBA 5I2OA 1F54A 1F8HA 4YRUA 1KSMA 3BXKA 1AJ5A 1V1GA 4TNCA 1YRTB 3DVEA 4PE4A 3EVUA 3OB2B 1PK0D 1B7TY 1QVIY 2KGRA 5HLVA 3ZNIA 4CPVA 2ZFDA 1A29A 2WCEA 3CR2A 2F3ZA 1QX2A 2WCBA 1QIWA 1Y6WA 4MZKA 5HKZA 1M39A 5ER4X 2G2BA 1E8AA 2MRDA 4JWQA 2LVKA 1JFKA 3ICBA 1CLBA 3JTDC 1XA5A 4MZLA 4HRGA 2FCEA 2L2EA 2TN4A 4QJ5B 2LNKA 1FI6A 4WRIA 2JNXA 2JNFA 2KYFA 4N1GA 1ZFSA 3D0YA 1QLSA 1DF0B 5AXIA 2RGIA 4YGEB 2ZN9A 2CBLA 1SW8A 3BYAA 5TNCA 4AQIA 2ZNDA 2LHIA 1QTXA 1YUTA 4I5LB 1F70A 1KWOC 3DVMA 3EK4A 3TUYC 1CMGA 1TCFA 2JPTA 2JULA 1B47A 1F4QA 1PSBA 3D0YB 2KQ6A 2FCDA 4DUQA 1F71A 1ALVA 3FWCA 4IL1A 4ZCVA 1YX7A 1S6CA 3TZ1A 1BODA 2LM5A 1UP5A 1YURA 1FPWA 3TS5B 1J1DA 1XFUO 4NQGA 1RTP1 2CCMA 1TNXA 1BG1A 2MHHA 1IJ5A 3SG4A 2Y4QA 1C7WA 4DS7A 3I5FB 2ZRTA 2AAOA 2ZRSA 1H8BA 1RWYA 1XFVO 2KI6D 2BL0C 3HX4A 3EVVA 4MLWA 1OQPA 3I5IB 2L51A 1S26D 5B8IB 1SBJA 2M1KB 3NSKA 3KO0A 4YGDB 1IGVA 1WDCC 4YGBB 1AK8A 2FJUB 2D8NA 3SG3A 5PALA 1Q80A 4GGFA 1PRWA 3SG7A 5D69A 1IQ3A 3FS7A 1NCZA 2NXQA 5GQQC 2CT9A 4E68A 3BUNB 5CSNA 2LVIA 2K7BA 2KFGA 1S5GY 1Y1UA 4OKHA 4OR9B 2K7DA 1K93D 1N0YA 5KSZA 2JQ6A 3DVKA 1L2OB 5KU1A 1MXEA 1DJZA 4A4BA 1CDNA 4GPLB 3KF9A 5HKWA 1NX3A 1AVSA 2I7AA 4DCKA 5CSJA 1IRJA 2L0PA 1DJIA 2Y1NA 1LA3A 1AUIB 2JRFA 2LVVA 1IKUA 1B1GA 2E6WA 4GAOA 4F0ZB 1LVCD 2JT0A 1G4YR 4Q04A 2ISDA 1K2HA 1KK7Y 1M46A 2KAYA 1L7ZA 2M7NA 3FWBA 4PALA 1BMOA 4ETOA 1XK4A 1YX8A 2JTZA 1AJ4A 1WLMA 3EVRA 1GQMA 2HQWA 1K9UA 1N2DA 4AOMA 4GFTA 1QV0A 4PHMA 2LUXA 3AKBA 1DJWA 3D10A 1S3PA 4MBEA 1DJHA 1SMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y1M A;  2GGZ A;  4HRH A;  1OOJ A;  2M29 A;  2OPO A;  1WRK A;  1NUB A;  1QV1 A;  1LXF C;  1SRA A;  1YUS A;  2M7L A;  2DOQ A;  2F2P A;  4OVN F;  4I5N B;  1JBA A;  1NPQ A;  2LP2 A;  2BCA A;  1IQ5 A;  4MVF A;  1BR4 B;  1DGV A;  2SCP A;  2OS8 B;  1BLQ A;  1ZOT B;  1YVH A;  1B4C A;  1YVL A;  1IWQ A;  3MSE B;  1DTL A;  1UUR A;  4ORC B;  3O4Y A;  3WXA A;  1MHO A;  4PCW A;  1LKJ A;  5KTY A;  2ZN8 A;  3GK2 A;  1GGW A;  1CFC A;  1JSA A;  1UHJ A;  2EGD A;  5AAN A;  1W7J B;  2HET A;  2M3W A;  2SAS A;  2F8P A;  4NDB A;  1CMF A;  1MWN A;  2A4J A;  1OMD A;  2QPT A;  4M2Q A;  5ER5 A;  2L4H A;  1L2O C;  1KFU L;  1MR8 A;  3I5G B;  2M97 A;  1WRZ A;  3OB1 B;  1EG4 A;  3VRN A;  3PFV A;  2BE6 A;  3TDU A;  3WNX B;  2O60 A;  1FBV A;  1SPY A;  2MBX A;  1BR1 B;  3BOW A;  5J3X A;  1TIZ A;  2KBM A;  1QLK A;  1ODB A;  3RLZ A;  2BKH B;  1J1E A;  1OE9 B;  3CWG A;  2HPS A;  2K7O A;  1N65 A;  1BF5 A;  2F3Y A;  2E30 A;  2M0R A;  2BL0 B;  2Q91 A;  2K0J A;  3PN7 C;  1TNW A;  4N5X A;  1IG5 A;  1NCY A;  1G33 A;  1J7O A;  2NCO A;  3LLE A;  4A4C A;  2WCF A;  3I5F C;  1GGZ A;  2KBI A;  2K61 A;  1MXL C;  3BOW B;  3QRX A;  1CLL A;  2WND A;  5DKQ A;  4GNK B;  1TNQ A;  2HF5 A;  4GUK A;  1CDP A;  1OMV A;  4XJK A;  1CLM A;  1KK7 Z;  5DKR A;  1D1O A;  1KCY A;  2PRU A;  3LK0 A;  2O5G A;  3NSI A;  4MEW A;  1A03 A;  2OTG C;  3CLN A;  4N1F A;  2LMV A;  3AAJ A;  5I8N A;  1SR6 B;  1CKK A;  2Q4U A;  5G08 A;  1C07 A;  1JFJ A;  1NP8 A;  1UHK A;  1BJF A;  1CM4 A;  1B8L A;  5AEQ A;  2LVJ A;  3CR5 X;  2KGB C;  3EK8 A;  4OCI A;  2BE4 A;  2LMU A;  3CTN A;  1DT7 B;  1JF2 A;  4FQO A;  2L98 A;  1G8I A;  2LAN A;  5CSF A;  3KHE A;  3SIB A;  3SG5 A;  1S6J A;  2KFH A;  5AFP A;  2MLE C;  5JJG A;  1KK8 B;  1UHN A;  1XO5 A;  3SG2 A;  3JVT C;  1M63 B;  1XFX O;  3TDZ A;  4UPG A;  3O2P A;  2Y5I A;  2OS8 C;  1WY9 A;  4HSZ A;  2JXL A;  2KAV A;  2H2K A;  4DIR A;  3HCM A;  4HRE E;  1OZS A;  2CNP A;  3DF0 A;  4PHN A;  3VGO A;  1DGU A;  3VRO A;  4QJ4 B;  1OSA A;  4PHK A;  1JF0 A;  3BQ3 A;  1SL7 A;  1HT9 A;  2NLN A;  2M9G A;  2FOT A;  4MSP A;  1S1E A;  3SG6 A;  3O6B A;  3EKH A;  1JC2 A;  1YTZ C;  2JTT A;  3RM1 A;  1FF1 A;  1BOC A;  1KWO B;  2F2O A;  2ZKM X;  2KOT A;  4JPZ B;  1CDL A;  2NCP A;  4GGF C;  2K8M B;  4PHJ A;  4JQ0 D;  1R6P A;  3LL8 B;  2JXC A;  1B8R A;  2LLS A;  1CB1 A;  5CSI A;  4QJ3 B;  3E3R A;  1SY9 A;  5CPV A;  3OX5 A;  4GGN A;  4CLN A;  1RRO A;  1TOP A;  4MRY A;  4GBA A;  1YUU A;  2H61 C;  1KSO A;  1OMR A;  3KPX A;  5HKY A;  1X02 A;  4NDC A;  3NXA A;  2KQY A;  3BUO B;  2K2A A;  3FIA A;  2KNE A;  1B8C A;  1UHH A;  1V1F A;  3OX6 A;  2JT3 A;  4D1E A;  1AHR A;  1WLZ A;  1ZUZ A;  5I2L A;  2VRG A;  1U5I B;  2KYC A;  3I5H B;  1A4P A;  3GOF A;  3DF0 B;  3JVT B;  3PN7 B;  1XK4 C;  1J7Q A;  3OHM B;  2R2I A;  1NSH A;  1PUL A;  2BCB A;  3EKJ A;  5I2Q A;  1CDM A;  1YRU B;  2LP3 A;  2F33 A;  3IQQ A;  2LCP A;  1KQM B;  1QJT A;  4BY4 A;  1YR5 A;  1LIN A;  2WOS A;  2K7C A;  4PE1 A;  1TN4 A;  1PVA A;  2WOR A;  2ZNE A;  2BCX A;  3EK7 A;  4L9M A;  3NSO A;  3I5H C;  2PVB A;  1IJ6 A;  1CFP A;  1JWD A;  1K95 A;  2LE9 B;  3I5G C;  5K89 A;  2JT8 A;  1NYA A;  1MUX A;  2EC6 B;  1NX0 A;  2KI4 C;  2MA2 A;  4ORA B;  3TS5 C;  1KQV A;  3CGA A;  2KHN A;  1FW4 A;  1RFJ A;  1XFW O;  2EC6 C;  3AKA A;  1DJG A;  1ALW A;  1DJX A;  1DJY A;  1A75 B;  2BKI B;  1K90 D;  1ZMZ A;  2KI6 C;  2LV7 A;  1GJY A;  3CR4 X;  2V53 A;  4ICB A;  2MLF C;  4PE0 A;  5HLO A;  4DRW A;  1XFZ O;  1MQ1 A;  3WHU B;  3VRQ A;  1CM1 A;  1DF0 A;  4FTG A;  2HQ8 A;  1Y1X A;  4XYN A;  1MF8 B;  1K9K A;  1KQM C;  2P6B B;  1WRL A;  1WDC B;  1B9A A;  2LAP A;  4BY5 A;  2KAX A;  4PDZ A;  1CFF A;  2LHL A;  1TCO B;  2GGM A;  2PAL A;  4M2P A;  1FI5 A;  2JU0 A;  1XFY O;  2M8U A;  3H4S E;  3AAK A;  1UUS A;  4R1E A;  5JOL A;  3NSL A;  2CTN A;  4PE7 A;  2G9B A;  1C7V A;  1BU3 A;  2H61 A;  1IH0 A;  4MZJ A;  2I94 A;  2KDH A;  2M1U A;  3K21 A;  1BT6 A;  3A4U B;  2LMT A;  1KFU S;  3PM8 A;  5HYD A;  1F4O A;  4I5K A;  3ZWH A;  4I5J A;  4C0J A;  1PAL A;  1SCV A;  2IS9 A;  3WHT B;  3PAL A;  2B1U A;  1SL9 A;  1K94 A;  1S6I A;  3BUW B;  2BBN A;  3DD4 A;  1XYD A;  1OZO A;  3LK1 A;  4M2O A;  1KFX L;  1SNL A;  2K2F A;  1SKT A;  2AMI A;  2WC8 A;  3IF7 A;  4YGC B;  5FYX A;  4YI9 A;  4NDD A;  1QXP A;  2CXJ A;  3PLF B;  4MRX A;  1KFX S;  1EH2 A;  1QAS A;  3TUY B;  1R2U A;  1RJV A;  4YGA A;  3IQO A;  1QAT A;  2COL B;  5AER A;  5IBW A;  1S5G Z;  1SYM A;  1U5I A;  4YI8 A;  4CID A;  3F45 A;  2KFF A;  1QX7 A;  2KI4 B;  4ORB B;  1M31 A;  1CFD A;  4C0L A;  1REC A;  3PAT A;  3GK1 A;  5DKN A;  1AP4 A;  1LA0 A;  1NIW A;  1QS7 A;  1TRF A;  2LLT A;  2LLU A;  2L50 A;  2M49 B;  2QAC A;  1ZAC A;  1NWD A;  1TNP A;  2L5X B;  4AQJ A;  1UHI A;  3JTD B;  1SK6 D;  2GV5 A;  3CS1 A;  3PSR A;  1DMO A;  2PAS A;  3GK4 X;  3O78 A;  3VRP A;  1F55 A;  1A2X A;  1EJ3 A;  2JZI A;  4C0K A;  2MAZ A;  3I5I C;  1DVI A;  1A75 A;  1SCM C;  2PMY A;  2I18 A;  3SJS A;  4CFQ A;  2PSR A;  3CZT X;  1EG3 A;  4XJK B;  1H4B A;  1KK8 C;  1K9P A;  1EXR A;  3OP0 A;  3TDI A;  3C1V A;  1SL8 A;  1SCM B;  3M0W A;  4U8D A;  4OV2 A;  2JC2 A;  2KSP A;  1JUO A;  1M45 A;  1QX5 B;  1S36 A;  1K8U A;  1PVB A;  3LCP C;  1Y0V H;  2NZ0 A;  2BBM A;  1NX1 A;  4YBH B;  1UWO A;  5D7F A;  2AUC A;  1K96 A;  1Y1A A;  1QIV A;  4USL A;  5F6T A;  1EL4 A;  4MN0 A;  4CFR A;  4P5O E;  1VRK A;  4P2Y B;  1SR6 C;  4ZCU A;  2BEC A;  2L4I A;  3DVJ A;  1J55 A;  2OTG B;  2JWW A;  1TTX A;  1RK9 A;  2JOJ A;  1J7R A;  1HQV A;  3A8R A;  1NCX A;  4WQ2 A;  5BPJ A;  2MJW B;  1CTR A;  1W7I B;  1J7P A;  1CNP A;  3SIA A;  3BUX B;  1XVJ A;  1NX2 A;  2I2R E;  2LC5 A;  1B7T Z;  1QVI Z;  1PSR A;  3KEV A;  3BUM B;  4WQ3 A;  3VRR A;  2LUC A;  2EHB A;  5I2O A;  1F54 A;  1F8H A;  4YRU A;  1KSM A;  3BXK A;  1AJ5 A;  1V1G A;  4TNC A;  1YRT B;  3DVE A;  4PE4 A;  3EVU A;  3OB2 B;  1PK0 D;  1B7T Y;  1QVI Y;  2KGR A;  5HLV A;  3ZNI A;  4CPV A;  2ZFD A;  1A29 A;  2WCE A;  3CR2 A;  2F3Z A;  1QX2 A;  2WCB A;  1QIW A;  1Y6W A;  4MZK A;  5HKZ A;  1M39 A;  5ER4 X;  2G2B A;  1E8A A;  2MRD A;  4JWQ A;  2LVK A;  1JFK A;  3ICB A;  1CLB A;  3JTD C;  1XA5 A;  4MZL A;  4HRG A;  2FCE A;  2L2E A;  2TN4 A;  4QJ5 B;  2LNK A;  1FI6 A;  4WRI A;  2JNX A;  2JNF A;  2KYF A;  4N1G A;  1ZFS A;  3D0Y A;  1QLS A;  1DF0 B;  5AXI A;  2RGI A;  4YGE B;  2ZN9 A;  2CBL A;  1SW8 A;  3BYA A;  5TNC A;  4AQI A;  2ZND A;  2LHI A;  1QTX A;  1YUT A;  4I5L B;  1F70 A;  1KWO C;  3DVM A;  3EK4 A;  3TUY C;  1CMG A;  1TCF A;  2JPT A;  2JUL A;  1B47 A;  1F4Q A;  1PSB A;  3D0Y B;  2KQ6 A;  2FCD A;  4DUQ A;  1F71 A;  1ALV A;  3FWC A;  4IL1 A;  4ZCV A;  1YX7 A;  1S6C A;  3TZ1 A;  1BOD A;  2LM5 A;  1UP5 A;  1YUR A;  1FPW A;  3TS5 B;  1J1D A;  1XFU O;  4NQG A;  1RTP 1;  2CCM A;  1TNX A;  1BG1 A;  2MHH A;  1IJ5 A;  3SG4 A;  2Y4Q A;  1C7W A;  4DS7 A;  3I5F B;  2ZRT A;  2AAO A;  2ZRS A;  1H8B A;  1RWY A;  1XFV O;  2KI6 D;  2BL0 C;  3HX4 A;  3EVV A;  4MLW A;  1OQP A;  3I5I B;  2L51 A;  1S26 D;  5B8I B;  1SBJ A;  2M1K B;  3NSK A;  3KO0 A;  4YGD B;  1IGV A;  1WDC C;  4YGB B;  1AK8 A;  2FJU B;  2D8N A;  3SG3 A;  5PAL A;  1Q80 A;  4GGF A;  1PRW A;  3SG7 A;  5D69 A;  1IQ3 A;  3FS7 A;  1NCZ A;  2NXQ A;  5GQQ C;  2CT9 A;  4E68 A;  3BUN B;  5CSN A;  2LVI A;  2K7B A;  2KFG A;  1S5G Y;  1Y1U A;  4OKH A;  4OR9 B;  2K7D A;  1K93 D;  1N0Y A;  5KSZ A;  2JQ6 A;  3DVK A;  1L2O B;  5KU1 A;  1MXE A;  1DJZ A;  4A4B A;  1CDN A;  4GPL B;  3KF9 A;  5HKW A;  1NX3 A;  1AVS A;  2I7A A;  4DCK A;  5CSJ A;  1IRJ A;  2L0P A;  1DJI A;  2Y1N A;  1LA3 A;  1AUI B;  2JRF A;  2LVV A;  1IKU A;  1B1G A;  2E6W A;  4GAO A;  4F0Z B;  1LVC D;  2JT0 A;  1G4Y R;  4Q04 A;  2ISD A;  1K2H A;  1KK7 Y;  1M46 A;  2KAY A;  1L7Z A;  2M7N A;  3FWB A;  4PAL A;  1BMO A;  4ETO A;  1XK4 A;  1YX8 A;  2JTZ A;  1AJ4 A;  1WLM A;  3EVR A;  1GQM A;  2HQW A;  1K9U A;  1N2D A;  4AOM A;  4GFT A;  1QV0 A;  4PHM A;  2LUX A;  3AKB A;  1DJW A;  3D10 A;  1S3P A;  4MBE A;  1DJH A;  1SMG A; 
#chains in the Genus database with same CATH topology
 2Y1M A;  2GGZ A;  4HRH A;  1OOJ A;  2M29 A;  2OPO A;  1WRK A;  1NUB A;  1QV1 A;  1LXF C;  1SRA A;  1YUS A;  2M7L A;  2DOQ A;  2F2P A;  2WCK A;  3CAB A;  3CZ2 A;  4OVN F;  4I5N B;  1JBA A;  1NPQ A;  2LP2 A;  2BCA A;  1IQ5 A;  4MVF A;  1BR4 B;  1DGV A;  2SCP A;  2OS8 B;  1BLQ A;  1ZOT B;  1YVH A;  1B4C A;  1YVL A;  1IWQ A;  3MSE B;  1DTL A;  1UUR A;  4ORC B;  3PM2 A;  3O4Y A;  3WXA A;  1MHO A;  4PCW A;  1LKJ A;  5KTY A;  2ZN8 A;  3GK2 A;  1GGW A;  1CFC A;  1JSA A;  1UHJ A;  2EGD A;  5AAN A;  1W7J B;  2HET A;  2M3W A;  2SAS A;  2F8P A;  4NDB A;  1CMF A;  1MWN A;  2A4J A;  1OMD A;  2QPT A;  4M2Q A;  5ER5 A;  1TUZ A;  2L4H A;  1L2O C;  3UO9 A;  1KFU L;  1MR8 A;  3I5G B;  3D78 A;  2QEO A;  2M97 A;  1WRZ A;  3OB1 B;  3S0E A;  1EG4 A;  3VRN A;  3PFV A;  2BE6 A;  3TDU A;  3WNX B;  2O60 A;  1FBV A;  1SPY A;  2MBX A;  1BR1 B;  3BOW A;  5J3X A;  1TIZ A;  2KBM A;  3R1O A;  1QLK A;  1ODB A;  3RLZ A;  1OOF A;  2BKH B;  1J1E A;  3K1E A;  1OE9 B;  3CWG A;  2HPS A;  2K7O A;  1N65 A;  2WCM A;  1BF5 A;  2F3Y A;  2E30 A;  2M0R A;  3D74 A;  2BL0 B;  2Q91 A;  2K0J A;  3PN7 C;  1TNW A;  4N5X A;  1IG5 A;  1NCY A;  1G33 A;  1J7O A;  2NCO A;  3LLE A;  4A4C A;  2WCF A;  3I5F C;  1GGZ A;  2KBI A;  2K61 A;  1MXL C;  3BOW B;  3QRX A;  1CLL A;  2WND A;  5DKQ A;  4GNK B;  1TNQ A;  2HF5 A;  4GUK A;  1CDP A;  1OMV A;  2KLD A;  1CLM A;  1KK7 Z;  4XJK A;  5DKR A;  1D1O A;  1KCY A;  3N7H A;  1C3Z A;  2PRU A;  3LK0 A;  2O5G A;  3NSI A;  4MEW A;  1A03 A;  2OTG C;  3CLN A;  4N1F A;  2LMV A;  3AAJ A;  5I8N A;  1SR6 B;  1P28 A;  1DC1 A;  1CKK A;  2Q4U A;  5G08 A;  1C07 A;  1JFJ A;  1NP8 A;  1UHK A;  1BJF A;  1CM4 A;  1B8L A;  5AEQ A;  2LVJ A;  3BJH A;  3CR5 X;  2KGB C;  2KLE A;  3EK8 A;  3S0F A;  4OCI A;  2BE4 A;  2LMU A;  3CTN A;  2QEH A;  1DT7 B;  1JF2 A;  1C3Y A;  2L5Y A;  4FQO A;  2L98 A;  1G8I A;  2LAN A;  1XFR A;  5CSF A;  3KHE A;  2WC5 A;  2P70 A;  3SIB A;  3SG5 A;  1S6J A;  2KFH A;  5AFP A;  2MLE C;  5JJG A;  1KK8 B;  1UHN A;  1XO5 A;  3SG2 A;  3JVT C;  1M63 B;  1XFX O;  1Z2C B;  3TDZ A;  3CYZ A;  3O2P A;  2Y5I A;  2OS8 C;  4UPG A;  1WY9 A;  4HSZ A;  2JXL A;  2KAV A;  1OW4 A;  2H2K A;  4DIR A;  3DY9 A;  3HCM A;  4HRE E;  1OZS A;  2CNP A;  3DF0 A;  4PHN A;  3VGO A;  1DGU A;  3VRO A;  4QJ4 B;  1OSA A;  4PHK A;  1JF0 A;  3BQ3 A;  1SL7 A;  1HT9 A;  5HL1 A;  2WC6 A;  2NLN A;  2M9G A;  2FOT A;  4MSP A;  1S1E A;  3SG6 A;  2WCJ A;  3O6B A;  3EKH A;  1JC2 A;  3NHI A;  1YTZ C;  2JTT A;  3RM1 A;  1FF1 A;  1BOC A;  1KWO B;  2F2O A;  2ZKM X;  2KOT A;  4JPZ B;  1CDL A;  2NCP A;  4GGF C;  2K8M B;  3D75 A;  4PHJ A;  3B87 A;  4JQ0 D;  1R6P A;  3NHT A;  3LL8 B;  2JXC A;  1B8R A;  2LLS A;  3PJI A;  1CB1 A;  5CSI A;  4QJ3 B;  3E3R A;  1SY9 A;  5CPV A;  3OX5 A;  4GGN A;  4CLN A;  1RRO A;  1TOP A;  2BNX A;  2JPO A;  4GBA A;  4MRY A;  1YUU A;  2H61 C;  1KSO A;  1OMR A;  3KPX A;  5HKY A;  1IIO A;  1OOI X;  1X02 A;  4NDC A;  3NXA A;  2KQY A;  3BUO B;  2K2A A;  4OZD A;  3FIA A;  2KNE A;  3CDN A;  1B8C A;  1UHH A;  1V1F A;  3OX6 A;  2JT3 A;  3V2L A;  4D1E A;  1AHR A;  1WLZ A;  1ZUZ A;  5I2L A;  2VRG A;  1U5I B;  2KYC A;  2P71 A;  3I5H B;  1A4P A;  5FI2 A;  3VB1 A;  3GOF A;  3DF0 B;  3JVT B;  3PN7 B;  1XK4 C;  1J7Q A;  3OHM B;  2R2I A;  1NSH A;  1PUL A;  2BCB A;  3EKJ A;  5I2Q A;  1CDM A;  5EL2 A;  1YRU B;  2LP3 A;  2F33 A;  1DEK A;  3IQQ A;  1OOG A;  2LCP A;  1KQM B;  1QJT A;  4BY4 A;  1YR5 A;  1DQE A;  1LIN A;  2WOS A;  2K7C A;  4PE1 A;  1TN4 A;  1PVA A;  2WOR A;  2ZNE A;  2BCX A;  3EK7 A;  4INX A;  4L9M A;  3NSO A;  3I5H C;  3S0B A;  2PVB A;  1IJ6 A;  1CFP A;  1JWD A;  1K95 A;  2LE9 B;  3I5G C;  2WCL A;  5K89 A;  2JT8 A;  1NYA A;  1MUX A;  2EC6 B;  1NX0 A;  2KI4 C;  2MA2 A;  4ORA B;  3TS5 C;  1KQV A;  3CGA A;  2KHN A;  5I94 A;  1FW4 A;  1RFJ A;  1TUJ A;  1XFW O;  2EC6 C;  3AKA A;  1DJG A;  1ALW A;  1DJX A;  1DJY A;  1A75 B;  2BKI B;  1K90 D;  1ZMZ A;  2KI6 C;  2LV7 A;  1GJY A;  3CR4 X;  2V53 A;  4ICB A;  2MLF C;  4JKT A;  4PE0 A;  5HLO A;  4DRW A;  1XFZ O;  3Q8I A;  1MQ1 A;  3WHU B;  5FI7 A;  4KYN A;  3VRQ A;  1CM1 A;  1TWO A;  1DF0 A;  4FTG A;  2HQ8 A;  1Y1X A;  4XYN A;  1MF8 B;  1K9K A;  1KQM C;  1GM0 A;  2P6B B;  1WRL A;  1WDC B;  1B9A A;  2LAP A;  4BY5 A;  2KAX A;  4PDZ A;  1CFF A;  2LHL A;  1TCO B;  2GGM A;  2PAL A;  4JD9 A;  4M2P A;  1FI5 A;  2JU0 A;  1XFY O;  2M8U A;  3H4S E;  3AAK A;  1UUS A;  3DYE A;  4R1E A;  3NSL A;  2CTN A;  3B88 A;  4PE7 A;  5JOL A;  2G9B A;  3SS3 A;  1C7V A;  1BU3 A;  2H61 A;  1QWV A;  3BFA A;  4MZJ A;  2I94 A;  2KDH A;  2M1U A;  3FE9 A;  3K21 A;  1IH0 A;  1BT6 A;  3A4U B;  2LMT A;  1KFU S;  3PM8 A;  5HYD A;  1ORG A;  1F4O A;  4I5K A;  3ZWH A;  2YGU A;  4I5J A;  4C0J A;  1PAL A;  1SCV A;  2IS9 A;  3WHT B;  3PAL A;  2B1U A;  1SL9 A;  1K94 A;  1S6I A;  3BUW B;  2BBN A;  3DD4 A;  1XYD A;  1OZO A;  3LK1 A;  3CZ1 A;  4M2O A;  1KFX L;  1SNL A;  2K2F A;  1SKT A;  2AMI A;  2WC8 A;  3IF7 A;  4YGC B;  5FYX A;  4YI9 A;  4NDD A;  1QXP A;  2CXJ A;  3PLF B;  3NGV A;  4MRX A;  1KFX S;  2K60 A;  1EH2 A;  1QAS A;  3TUY B;  1R2U A;  1RJV A;  4YGA A;  3IQO A;  1QAT A;  3B7A A;  2COL B;  5AER A;  5IBW A;  3CZ0 A;  1S5G Z;  1SYM A;  1U5I A;  4YI8 A;  4CID A;  3F45 A;  3S0A A;  2KFF A;  1QX7 A;  2KI4 B;  4ORB B;  1M31 A;  1CFD A;  4C0L A;  3S0G A;  1REC A;  3PAT A;  3GK1 A;  5DKN A;  1AP4 A;  1LA0 A;  1NIW A;  1QS7 A;  1TRF A;  2LLT A;  2LLU A;  2L50 A;  2M49 B;  2QAC A;  1ZAC A;  1NWD A;  3QME A;  1TNP A;  2L5X B;  4AQJ A;  1UHI A;  3JTD B;  1SK6 D;  2GV5 A;  3CS1 A;  3PSR A;  1DMO A;  2PAS A;  3BFB A;  3GK4 X;  3O78 A;  3B6X A;  3VRP A;  1F55 A;  1A2X A;  1EJ3 A;  2JZI A;  4C0K A;  2MAZ A;  3I5I C;  1DVI A;  3OBV A;  1A75 A;  1SCM C;  1DEL A;  3D76 A;  2PMY A;  2I18 A;  3SJS A;  4CFQ A;  1SSE B;  2PSR A;  2H8V A;  4PT1 A;  2FJY A;  3CZT X;  1EG3 A;  4XJK B;  1H4B A;  1KK8 C;  1K9P A;  1EXR A;  3OP0 A;  3SS4 A;  3TDI A;  3C1V A;  1SL8 A;  1SCM B;  3M0W A;  4U8D A;  4OV2 A;  4FQT A;  2JC2 A;  2KSP A;  1JUO A;  1M45 A;  1QX5 B;  1S36 A;  1K8U A;  3R72 A;  1PVB A;  3LCP C;  1Y0V H;  2NZ0 A;  2BBM A;  1NX1 A;  4YBH B;  1UWO A;  5D7F A;  2AUC A;  1K96 A;  1Y1A A;  1QIV A;  4USL A;  5F6T A;  1EL4 A;  4MN0 A;  4CFR A;  4P5O E;  1VRK A;  2L2C A;  4P2Y B;  1SR6 C;  4ZCU A;  2BEC A;  1W9Z A;  2L4I A;  3DVJ A;  1J55 A;  2OTG B;  2WCH A;  2JWW A;  1TTX A;  1RK9 A;  2JOJ A;  1J7R A;  1HQV A;  3A8R A;  1NCX A;  4WQ2 A;  5BPJ A;  2MJW B;  3L4A A;  1CTR A;  1W7I B;  1J7P A;  1CNP A;  3SIA A;  3BUX B;  1XVJ A;  1NX2 A;  2I2R E;  2LC5 A;  1QVI Z;  1B7T Z;  1LS8 A;  1PSR A;  3BUM B;  3KEV A;  4WQ3 A;  2KPH A;  2EHB A;  2LUC A;  3VRR A;  5I2O A;  4YRU A;  1F54 A;  1F8H A;  1KSM A;  3BXK A;  1AJ5 A;  1V1G A;  4TNC A;  5D3O A;  1YRT B;  3DVE A;  3D77 A;  4PE4 A;  3EVU A;  3OB2 B;  1PK0 D;  3RZS A;  1B7T Y;  1QVI Y;  2KGR A;  3OGN A;  5HLV A;  3ZNI A;  3DXL A;  3D73 A;  4CPV A;  2ZFD A;  1A29 A;  2WCE A;  2BAP A;  5DIC A;  2PQL A;  3CR2 A;  2F3Z A;  1QX2 A;  2WCB A;  1QIW A;  2ERB A;  1Y6W A;  4MZK A;  3FE8 A;  5HKZ A;  1M39 A;  5ER4 X;  2G2B A;  3L47 A;  1E8A A;  2MRD A;  4JWQ A;  2LVK A;  1JFK A;  3ICB A;  1CLB A;  3JTD C;  1XA5 A;  4MZL A;  4HRG A;  2FCE A;  2L2E A;  2TN4 A;  3EG5 B;  4QJ5 B;  2LNK A;  4INW A;  1FI6 A;  4WRI A;  2JNX A;  2JNF A;  2KYF A;  4N1G A;  3R1P A;  1ZFS A;  3D0Y A;  1QLS A;  1DF0 B;  5AXI A;  2RGI A;  4YGE B;  2ZN9 A;  2CBL A;  1SW8 A;  3BYA A;  5TNC A;  3IVT A;  2QDI A;  4AQI A;  2ZND A;  4F7F A;  2LHI A;  2GTE A;  1QTX A;  1YUT A;  4I5L B;  1F70 A;  1KWO C;  3DVM A;  3EK4 A;  3TUY C;  4IJ7 A;  1CMG A;  3BFH A;  1TCF A;  2JPT A;  3B86 A;  2JUL A;  1B47 A;  1F4Q A;  1PSB A;  3D0Y B;  2KQ6 A;  2FCD A;  4DUQ A;  1F71 A;  1ALV A;  3FWC A;  4IL1 A;  4ZCV A;  1YX7 A;  1S6C A;  3TZ1 A;  1BOD A;  2LM5 A;  1UP5 A;  1YUR A;  1FPW A;  3SS5 A;  1J1D A;  1XFU O;  4NQG A;  1RTP 1;  3TS5 B;  2CCM A;  1TNX A;  1BG1 A;  2MHH A;  1IJ5 A;  3SG4 A;  2Y4Q A;  5FI6 A;  1C7W A;  4DS7 A;  3I5F B;  2ZRT A;  2AAO A;  3FE6 A;  2ZRS A;  1H8B A;  1RWY A;  1XFV O;  2KI6 D;  1Z4H A;  2BL0 C;  3HX4 A;  3R1V A;  3DZT A;  3EVV A;  4MLW A;  1OQP A;  3I5I B;  2L51 A;  1S26 D;  5B8I B;  1OOH A;  1SBJ A;  2M1K B;  3NSK A;  3KO0 A;  4YGD B;  1IGV A;  1WDC C;  4YGB B;  1AK8 A;  2FJU B;  2D8N A;  3SG3 A;  5PAL A;  1Q80 A;  4GGF A;  1PRW A;  3SG7 A;  5D69 A;  1IQ3 A;  3FS7 A;  1NCZ A;  2NXQ A;  5GQQ C;  2CT9 A;  4E68 A;  3BUN B;  5CSN A;  2QEB A;  2LVI A;  2K7B A;  2KFG A;  1S5G Y;  1Y1U A;  2PYQ A;  4OKH A;  4OR9 B;  2K7D A;  1K93 D;  1N0Y A;  5KSZ A;  2JQ6 A;  3DVK A;  1L2O B;  5KU1 A;  1MXE A;  1DJZ A;  3S0D A;  4A4B A;  3L4L A;  4GPL B;  3KF9 A;  2QEV A;  5HKW A;  1CDN A;  1NX3 A;  1AVS A;  2I7A A;  4DCK A;  5CSJ A;  1IRJ A;  2L0P A;  1DJI A;  2Y1N A;  1LA3 A;  1AUI B;  2JRF A;  2LVV A;  1IKU A;  1B1G A;  2E6W A;  4GAO A;  4F0Z B;  1LVC D;  3UNW A;  2JT0 A;  1G4Y R;  4Q04 A;  2ISD A;  1K2H A;  1KK7 Y;  1M46 A;  2KAY A;  1L7Z A;  2M7N A;  3FWB A;  4PAL A;  1BMO A;  4ETO A;  1XK4 A;  1T14 A;  1YX8 A;  2JTZ A;  1AJ4 A;  1WLM A;  3EVR A;  1GQM A;  2HQW A;  1K9U A;  1N2D A;  4AOM A;  3O4X A;  4GFT A;  1QV0 A;  4PHM A;  2LUX A;  3AKB A;  1DJW A;  3D10 A;  1S3P A;  4MBE A;  1DJH A;  1SMG A; 
#chains in the Genus database with same CATH homology
 2Y1M A;  2GGZ A;  4HRH A;  1OOJ A;  2M29 A;  2OPO A;  1WRK A;  1NUB A;  1QV1 A;  1LXF C;  1SRA A;  1YUS A;  2M7L A;  2DOQ A;  2F2P A;  4OVN F;  4I5N B;  1JBA A;  1NPQ A;  2LP2 A;  2BCA A;  1IQ5 A;  4MVF A;  1BR4 B;  1DGV A;  2SCP A;  2OS8 B;  1BLQ A;  1ZOT B;  1YVH A;  1B4C A;  1YVL A;  1IWQ A;  3MSE B;  1DTL A;  1UUR A;  4ORC B;  3O4Y A;  3WXA A;  1MHO A;  4PCW A;  1LKJ A;  5KTY A;  2ZN8 A;  3GK2 A;  1GGW A;  1CFC A;  1JSA A;  1UHJ A;  2EGD A;  5AAN A;  1W7J B;  2HET A;  2M3W A;  2SAS A;  2F8P A;  4NDB A;  1CMF A;  1MWN A;  2A4J A;  1OMD A;  2QPT A;  4M2Q A;  5ER5 A;  2L4H A;  1L2O C;  1KFU L;  1MR8 A;  3I5G B;  2M97 A;  1WRZ A;  3OB1 B;  1EG4 A;  3VRN A;  3PFV A;  2BE6 A;  3TDU A;  3WNX B;  2O60 A;  1FBV A;  1SPY A;  2MBX A;  1BR1 B;  3BOW A;  5J3X A;  1TIZ A;  2KBM A;  1QLK A;  1ODB A;  3RLZ A;  2BKH B;  1J1E A;  1OE9 B;  3CWG A;  2HPS A;  2K7O A;  1N65 A;  1BF5 A;  2F3Y A;  2E30 A;  2M0R A;  2BL0 B;  2Q91 A;  2K0J A;  3PN7 C;  1TNW A;  4N5X A;  1IG5 A;  1NCY A;  1G33 A;  1J7O A;  2NCO A;  3LLE A;  4A4C A;  2WCF A;  3I5F C;  1GGZ A;  2KBI A;  2K61 A;  1MXL C;  3BOW B;  3QRX A;  1CLL A;  2WND A;  5DKQ A;  4GNK B;  1TNQ A;  2HF5 A;  4GUK A;  1CDP A;  1OMV A;  4XJK A;  1CLM A;  1KK7 Z;  5DKR A;  1D1O A;  1KCY A;  2PRU A;  3LK0 A;  2O5G A;  3NSI A;  4MEW A;  1A03 A;  2OTG C;  3CLN A;  4N1F A;  2LMV A;  3AAJ A;  5I8N A;  1SR6 B;  1CKK A;  2Q4U A;  5G08 A;  1C07 A;  1JFJ A;  1NP8 A;  1UHK A;  1BJF A;  1CM4 A;  1B8L A;  5AEQ A;  2LVJ A;  3CR5 X;  2KGB C;  3EK8 A;  4OCI A;  2BE4 A;  2LMU A;  3CTN A;  1DT7 B;  1JF2 A;  4FQO A;  2L98 A;  1G8I A;  2LAN A;  5CSF A;  3KHE A;  3SIB A;  3SG5 A;  1S6J A;  2KFH A;  5AFP A;  2MLE C;  5JJG A;  1KK8 B;  1UHN A;  1XO5 A;  3SG2 A;  3JVT C;  1M63 B;  1XFX O;  3TDZ A;  4UPG A;  3O2P A;  2Y5I A;  2OS8 C;  1WY9 A;  4HSZ A;  2JXL A;  2KAV A;  2H2K A;  4DIR A;  3HCM A;  4HRE E;  1OZS A;  2CNP A;  3DF0 A;  4PHN A;  3VGO A;  1DGU A;  3VRO A;  4QJ4 B;  1OSA A;  4PHK A;  1JF0 A;  3BQ3 A;  1SL7 A;  1HT9 A;  2NLN A;  2M9G A;  2FOT A;  4MSP A;  1S1E A;  3SG6 A;  3O6B A;  3EKH A;  1JC2 A;  1YTZ C;  2JTT A;  3RM1 A;  1FF1 A;  1BOC A;  1KWO B;  2F2O A;  2ZKM X;  2KOT A;  4JPZ B;  1CDL A;  2NCP A;  4GGF C;  2K8M B;  4PHJ A;  4JQ0 D;  1R6P A;  3LL8 B;  2JXC A;  1B8R A;  2LLS A;  1CB1 A;  5CSI A;  4QJ3 B;  3E3R A;  1SY9 A;  5CPV A;  3OX5 A;  4GGN A;  4CLN A;  1RRO A;  1TOP A;  4MRY A;  4GBA A;  1YUU A;  2H61 C;  1KSO A;  1OMR A;  3KPX A;  5HKY A;  1X02 A;  4NDC A;  3NXA A;  2KQY A;  3BUO B;  2K2A A;  3FIA A;  2KNE A;  1B8C A;  1UHH A;  1V1F A;  3OX6 A;  2JT3 A;  4D1E A;  1AHR A;  1WLZ A;  1ZUZ A;  5I2L A;  2VRG A;  1U5I B;  2KYC A;  3I5H B;  1A4P A;  3GOF A;  3DF0 B;  3JVT B;  3PN7 B;  1XK4 C;  1J7Q A;  3OHM B;  2R2I A;  1NSH A;  1PUL A;  2BCB A;  3EKJ A;  5I2Q A;  1CDM A;  1YRU B;  2LP3 A;  2F33 A;  3IQQ A;  2LCP A;  1KQM B;  1QJT A;  4BY4 A;  1YR5 A;  1LIN A;  2WOS A;  2K7C A;  4PE1 A;  1TN4 A;  1PVA A;  2WOR A;  2ZNE A;  2BCX A;  3EK7 A;  4L9M A;  3NSO A;  3I5H C;  2PVB A;  1IJ6 A;  1CFP A;  1JWD A;  1K95 A;  2LE9 B;  3I5G C;  5K89 A;  2JT8 A;  1NYA A;  1MUX A;  2EC6 B;  1NX0 A;  2KI4 C;  2MA2 A;  4ORA B;  3TS5 C;  1KQV A;  3CGA A;  2KHN A;  1FW4 A;  1RFJ A;  1XFW O;  2EC6 C;  3AKA A;  1DJG A;  1ALW A;  1DJX A;  1DJY A;  1A75 B;  2BKI B;  1K90 D;  1ZMZ A;  2KI6 C;  2LV7 A;  1GJY A;  3CR4 X;  2V53 A;  4ICB A;  2MLF C;  4PE0 A;  5HLO A;  4DRW A;  1XFZ O;  1MQ1 A;  3WHU B;  3VRQ A;  1CM1 A;  1DF0 A;  4FTG A;  2HQ8 A;  1Y1X A;  4XYN A;  1MF8 B;  1K9K A;  1KQM C;  2P6B B;  1WRL A;  1WDC B;  1B9A A;  2LAP A;  4BY5 A;  2KAX A;  4PDZ A;  1CFF A;  2LHL A;  1TCO B;  2GGM A;  2PAL A;  4M2P A;  1FI5 A;  2JU0 A;  1XFY O;  2M8U A;  3H4S E;  3AAK A;  1UUS A;  4R1E A;  5JOL A;  3NSL A;  2CTN A;  4PE7 A;  2G9B A;  1C7V A;  1BU3 A;  2H61 A;  1IH0 A;  4MZJ A;  2I94 A;  2KDH A;  2M1U A;  3K21 A;  1BT6 A;  3A4U B;  2LMT A;  1KFU S;  3PM8 A;  5HYD A;  1F4O A;  4I5K A;  3ZWH A;  4I5J A;  4C0J A;  1PAL A;  1SCV A;  2IS9 A;  3WHT B;  3PAL A;  2B1U A;  1SL9 A;  1K94 A;  1S6I A;  3BUW B;  2BBN A;  3DD4 A;  1XYD A;  1OZO A;  3LK1 A;  4M2O A;  1KFX L;  1SNL A;  2K2F A;  1SKT A;  2AMI A;  2WC8 A;  3IF7 A;  4YGC B;  5FYX A;  4YI9 A;  4NDD A;  1QXP A;  2CXJ A;  3PLF B;  4MRX A;  1KFX S;  1EH2 A;  1QAS A;  3TUY B;  1R2U A;  1RJV A;  4YGA A;  3IQO A;  1QAT A;  2COL B;  5AER A;  5IBW A;  1S5G Z;  1SYM A;  1U5I A;  4YI8 A;  4CID A;  3F45 A;  2KFF A;  1QX7 A;  2KI4 B;  4ORB B;  1M31 A;  1CFD A;  4C0L A;  1REC A;  3PAT A;  3GK1 A;  5DKN A;  1AP4 A;  1LA0 A;  1NIW A;  1QS7 A;  1TRF A;  2LLT A;  2LLU A;  2L50 A;  2M49 B;  2QAC A;  1ZAC A;  1NWD A;  1TNP A;  2L5X B;  4AQJ A;  1UHI A;  3JTD B;  1SK6 D;  2GV5 A;  3CS1 A;  3PSR A;  1DMO A;  2PAS A;  3GK4 X;  3O78 A;  3VRP A;  1F55 A;  1A2X A;  1EJ3 A;  2JZI A;  4C0K A;  2MAZ A;  3I5I C;  1DVI A;  1A75 A;  1SCM C;  2PMY A;  2I18 A;  3SJS A;  4CFQ A;  2PSR A;  3CZT X;  1EG3 A;  4XJK B;  1H4B A;  1KK8 C;  1K9P A;  1EXR A;  3OP0 A;  3TDI A;  3C1V A;  1SL8 A;  1SCM B;  3M0W A;  4U8D A;  4OV2 A;  2JC2 A;  2KSP A;  1JUO A;  1M45 A;  1QX5 B;  1S36 A;  1K8U A;  1PVB A;  3LCP C;  1Y0V H;  2NZ0 A;  2BBM A;  1NX1 A;  4YBH B;  1UWO A;  5D7F A;  2AUC A;  1K96 A;  1Y1A A;  1QIV A;  4USL A;  5F6T A;  1EL4 A;  4MN0 A;  4CFR A;  4P5O E;  1VRK A;  4P2Y B;  1SR6 C;  4ZCU A;  2BEC A;  2L4I A;  3DVJ A;  1J55 A;  2OTG B;  2JWW A;  1TTX A;  1RK9 A;  2JOJ A;  1J7R A;  1HQV A;  3A8R A;  1NCX A;  4WQ2 A;  5BPJ A;  2MJW B;  1CTR A;  1W7I B;  1J7P A;  1CNP A;  3SIA A;  3BUX B;  1XVJ A;  1NX2 A;  2I2R E;  2LC5 A;  1B7T Z;  1QVI Z;  1PSR A;  3KEV A;  3BUM B;  4WQ3 A;  3VRR A;  2LUC A;  2EHB A;  5I2O A;  1F54 A;  1F8H A;  4YRU A;  1KSM A;  3BXK A;  1AJ5 A;  1V1G A;  4TNC A;  1YRT B;  3DVE A;  4PE4 A;  3EVU A;  3OB2 B;  1PK0 D;  1B7T Y;  1QVI Y;  2KGR A;  5HLV A;  3ZNI A;  4CPV A;  2ZFD A;  1A29 A;  2WCE A;  3CR2 A;  2F3Z A;  1QX2 A;  2WCB A;  1QIW A;  1Y6W A;  4MZK A;  5HKZ A;  1M39 A;  5ER4 X;  2G2B A;  1E8A A;  2MRD A;  4JWQ A;  2LVK A;  1JFK A;  3ICB A;  1CLB A;  3JTD C;  1XA5 A;  4MZL A;  4HRG A;  2FCE A;  2L2E A;  2TN4 A;  4QJ5 B;  2LNK A;  1FI6 A;  4WRI A;  2JNX A;  2JNF A;  2KYF A;  4N1G A;  1ZFS A;  3D0Y A;  1QLS A;  1DF0 B;  5AXI A;  2RGI A;  4YGE B;  2ZN9 A;  2CBL A;  1SW8 A;  3BYA A;  5TNC A;  4AQI A;  2ZND A;  2LHI A;  1QTX A;  1YUT A;  4I5L B;  1F70 A;  1KWO C;  3DVM A;  3EK4 A;  3TUY C;  1CMG A;  1TCF A;  2JPT A;  2JUL A;  1B47 A;  1F4Q A;  1PSB A;  3D0Y B;  2KQ6 A;  2FCD A;  4DUQ A;  1F71 A;  1ALV A;  3FWC A;  4IL1 A;  4ZCV A;  1YX7 A;  1S6C A;  3TZ1 A;  1BOD A;  2LM5 A;  1UP5 A;  1YUR A;  1FPW A;  3TS5 B;  1J1D A;  1XFU O;  4NQG A;  1RTP 1;  2CCM A;  1TNX A;  1BG1 A;  2MHH A;  1IJ5 A;  3SG4 A;  2Y4Q A;  1C7W A;  4DS7 A;  3I5F B;  2ZRT A;  2AAO A;  2ZRS A;  1H8B A;  1RWY A;  1XFV O;  2KI6 D;  2BL0 C;  3HX4 A;  3EVV A;  4MLW A;  1OQP A;  3I5I B;  2L51 A;  1S26 D;  5B8I B;  1SBJ A;  2M1K B;  3NSK A;  3KO0 A;  4YGD B;  1IGV A;  1WDC C;  4YGB B;  1AK8 A;  2FJU B;  2D8N A;  3SG3 A;  5PAL A;  1Q80 A;  4GGF A;  1PRW A;  3SG7 A;  5D69 A;  1IQ3 A;  3FS7 A;  1NCZ A;  2NXQ A;  5GQQ C;  2CT9 A;  4E68 A;  3BUN B;  5CSN A;  2LVI A;  2K7B A;  2KFG A;  1S5G Y;  1Y1U A;  4OKH A;  4OR9 B;  2K7D A;  1K93 D;  1N0Y A;  5KSZ A;  2JQ6 A;  3DVK A;  1L2O B;  5KU1 A;  1MXE A;  1DJZ A;  4A4B A;  1CDN A;  4GPL B;  3KF9 A;  5HKW A;  1NX3 A;  1AVS A;  2I7A A;  4DCK A;  5CSJ A;  1IRJ A;  2L0P A;  1DJI A;  2Y1N A;  1LA3 A;  1AUI B;  2JRF A;  2LVV A;  1IKU A;  1B1G A;  2E6W A;  4GAO A;  4F0Z B;  1LVC D;  2JT0 A;  1G4Y R;  4Q04 A;  2ISD A;  1K2H A;  1KK7 Y;  1M46 A;  2KAY A;  1L7Z A;  2M7N A;  3FWB A;  4PAL A;  1BMO A;  4ETO A;  1XK4 A;  1YX8 A;  2JTZ A;  1AJ4 A;  1WLM A;  3EVR A;  1GQM A;  2HQW A;  1K9U A;  1N2D A;  4AOM A;  4GFT A;  1QV0 A;  4PHM A;  2LUX A;  3AKB A;  1DJW A;  3D10 A;  1S3P A;  4MBE A;  1DJH A;  1SMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...