3NSKA

Crystal structure of the post-refolded s100a3 r51a mutant expressed in insect cell
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
91
structure length
91
Chain Sequence
RPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFAECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Protein S100-A3
publication title Refined crystal structures of human Ca(2+)/Zn(2+)-binding S100A3 protein characterized by two disulfide bridges
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3nskA00
1IJ6A 5ER5A 1MHOA 2JRFA 3PSRA 1Y0VH 4GFTA 4P5OE 1QASA 3DVEA 1S6JA 2RGIA 4DRWA 2JOJA 1SW8A 4ICBA 2WCBA 2GGZA 5HKYA 1S5GY 2L5XB 4PHNA 5G08A 4CFRA 1DF0A 3IQQA 3TUYC 1D1OA 2KI4B 1LINA 1TNQA 1PULA 1A75B 3CR2A 3TDIA 4E68A 4MRYA 2K7BA 1Q80A 2D8NA 4C0JA 1YX7A 4ZCUA 4DUQA 2H2KA 1K95A 4AOMA 3BXKA 4YGEB 1S3PA 1OSAA 3O4YA 4MSPA 4PE7A 2E6WA 1SR6C 3RLZA 1NX0A 2NCPA 2JC2A 2KI6D 2KQ6A 3OB1B 4PHMA 1XA5A 4HREE 5HLVA 3I5IC 1AJ4A 1NX1A 2SCPA 1F55A 2QACA 3E3RA 3KO0A 1XFYO 4WRIA 4YBHB 4USLA 1AP4A 1FF1A 2AMIA 4OKHA 1CKKA 4OCIA 1JFKA 5AANA 3CS1A 3PLFB 4QJ3B 4DS7A 1F4OA 2F3YA 1FI5A 2F3ZA 2KAXA 2M1KB 2LNKA 2TN4A 2LP3A 2L2EA 1U5IA 2PASA 3FWBA 2ZN9A 1XFVO 1IJ5A 3OX5A 3I5HC 2LE9B 2WCEA 3EK8A 1FW4A 1JBAA 1DJHA 2L51A 1PRWA 3VRRA 3EK7A 3GK2A 1SR6B 1YUUA 4I5LB 2EC6C 1BR1B 4XYNA 3TS5B 2JXCA 1RECA 1QS7A 2A4JA 1QV1A 1TTXA 4PE4A 4ETOA 1W7JB 2KGRA 4FQOA 4MN0A 2OS8C 2JULA 3TDZA 4D1EA 1DJYA 4C0KA 1NX3A 1JFJA 3SJSA 1EXRA 3JTDB 1KWOC 4NDDA 2PVBA 4PALA 1K8UA 4N5XA 2K61A 4M2OA 3EVUA 4BY4A 1YUSA 3AAKA 4ORAB 5CSIA 1LVCD 5J3XA 2BE6A 4QJ5B 1NP8A 5K89A 1GGZA 1TRFA 2I94A 4PHJA 1QTXA 4HRHA 2JQ6A 4GAOA 2COLB 2FCEA 1UUSA 5AEQA 2NCOA 5KTYA 2Y5IA 4XJKB 3I5HB 2WC8A 1K93D 2BECA 1NX2A 1J7RA 2F33A 2LC5A 1LA3A 2P6BB 3D0YB 5CSNA 3A8RA 4IL1A 2VRGA 1S5GZ 3JVTC 1AJ5A 2LANA 3LK1A 1SL8A 1W7IB 3WHTB 1J1DA 1HT9A 2G2BA 3SG4A 1ZUZA 1TCOB 3KF9A 2PMYA 1MXEA 2JT8A 3BUOB 1RFJA 5BPJA 1QIVA 1S6IA 2ZRTA 2K7CA 1SYMA 3C1VA 3DF0B 1K2HA 2KSPA 1CLLA 1K90D 4GBAA 4PE1A 1DJXA 2EHBA 2Y1MA 1RWYA 2L0PA 2WORA 2M1UA 1FI6A 2HETA 3HX4A 1OMVA 2CNPA 4PCWA 4YGBB 3EKHA 4I5JA 1GGWA 2LLSA 3OX6A 2MA2A 4AQIA 1UWOA 3FIAA 1UP5A 2NZ0A 1Y1XA 2F8PA 4PDZA 2KAVA 1CB1A 4MZJA 5GQQC 2L50A 2R2IA 2LLUA 4Q04A 3SG3A 1NCZA 3O2PA 2M97A 4TNCA 1MWNA 1F4QA 2JXLA 2LV7A 2Y4QA 3ZWHA 3NSLA 4I5KA 4JQ0D 1CM1A 1SL9A 3A4UB 2K2FA 3VGOA 1A75A 4JWQA 1NUBA 1IH0A 3KEVA 2FCDA 1L2OC 1ALWA 1YURA 2WNDA 4CIDA 1WRKA 1SRAA 4MLWA 3I5FC 1XFZO 1GQMA 2BBMA 1DTLA 1IG5A 4NDCA 1K94A 1QXPA 3H4SE 3O78A 1PVBA 2DOQA 2I7AA 2LVJA 2M8UA 1OMDA 1PVAA 1JF2A 1QV0A 4M2PA 1IKUA 1QLSA 1BODA 3PALA 1YVLA 1CMFA 1SY9A 5KSZA 4A4CA 3PN7C 1ZACA 2H61C 3DVJA 1Y1AA 2OTGC 4WQ2A 1BU3A 1XK4C 4YGAA 4YGDB 3BUWB 1SL7A 2H61A 3WNXB 1F71A 3BUMB 3ZNIA 1XK4A 1IQ3A 1CLBA 1R2UA 2HF5A 2LMUA 4GGFC 1B9AA 1BLQA 1KFUL 1UHNA 1M46A 3FS7A 1RJVA 1WRLA 1WRZA 1PK0D 4GGFA 1SCVA 4MZLA 1SBJA 1OQPA 3HCMA 3MSEB 1E8AA 2AAOA 2MJWB 1CNPA 1BMOA 1EG3A 3CZTX 2KBIA 3TUYB 1A4PA 2B1UA 3I5FB 1CFDA 2ZFDA 1YX8A 1JSAA 1J7QA 1B7TY 2CCMA 3DVKA 2KAYA 1BG1A 4NDBA 4CLNA 1SCMC 3SG7A 4YRUA 1UHHA 1JC2A 4F0ZB 1IWQA 1HQVA 2K0JA 3NSKA 1ALVA 1RK9A 1DMOA 2BCXA 2JZIA 1CLMA 3EKJA 3I5IB 1RROA 1B4CA 1JWDA 1M63B 2KGBC 2OPOA 3GK1A 1OE9B 2M29A 4MBEA 4PE0A 1CFCA 2ZN8A 2O5GA 5AXIA 1SMGA 1EJ3A 1OOJA 1OZOA 2LP2A 2KFHA 1QX5B 3CR4X 2CT9A 2ZRSA 2BL0C 1EG4A 4OVNF 3AAJA 1WDCC 1N65A 1DJIA 2Q91A 4MZKA 1EH2A 1CDMA 1R6PA 2KI6C 2JPTA 1CMGA 3CWGA 1QATA 1UHJA 1SKTA 1AVSA 3NSIA 2CBLA 3BOWA 2L4IA 3BYAA 5DKNA 2M7LA 2ZNDA 3PATA 1AHRA 5JOLA 3DVMA 3PFVA 4OV2A 1TNXA 1DJWA 1TIZA 1C7WA 3WXAA 2I2RE 2EC6B 1J7OA 1YRTB 1YRUB 1B47A 2M9GA 1XFWO 2JU0A 5HKZA 1A03A 2LMVA 2JT3A 2OS8B 3CR5X 3DF0A 5I2QA 2CXJA 4N1GA 5B8IB 5I2LA 1LXFC 1SPYA 1XO5A 1KWOB 3KPXA 4ORCB 1G8IA 4CFQA 1UURA 5AFPA 3EVRA 1K9KA 1XYDA 3EVVA 5CPVA 1XFUO 3WHUB 4MEWA 5DKQA 1KK8C 2Y1NA 5AERA 5I8NA 3IQOA 2BKHB 2L4HA 1NWDA 1J1EA 2O60A 4I5NB 2K2AA 2ZNEA 1K9PA 4QJ4B 3I5GC 4ZCVA 1BJFA 1IGVA 2LVIA 2JWWA 2KI4C 3LL8B 4CPVA 3CLNA 1GJYA 4R1EA 2ISDA 2NLNA 3JVTB 1OMRA 1TNWA 2GV5A 1JUOA 1CFFA 5CSFA 1QX7A 4DIRA 2KQYA 1VRKA 1A29A 1B7TZ 2Q4UA 1MR8A 1KFXL 1K96A 1KK7Y 1M39A 2M7NA 3VRPA 2MAZA 4N1FA 1QVIY 3AKBA 1K9UA 1BF5A 1KCYA 5IBWA 1JF0A 3OB2B 1X02A 3IF7A 1DGVA 1G4YR 3SG2A 2F2OA 2G9BA 2M3WA 2WCFA 1QX2A 2L98A 3SG6A 4A4BA 2IS9A 2HQ8A 2KFFA 1KFXS 1TCFA 1SK6D 2GGMA 1N2DA 1UHKA 2K7DA 1NYAA 1AUIB 3I5GB 1ZMZA 4C0LA 1XVJA 2MHHA 5ER4X 4YGCB 1XFXO 2BE4A 1F70A 1BT6A 2FJUB 3CGAA 5DKRA 4UPGA 4AQJA 1CDNA 1J7PA 2JNXA 1DF0B 1KSOA 2KYFA 3AKAA 1LKJA 1TOPA 1IRJA 1B1GA 1S6CA 2EGDA 1L2OB 2E30A 2MRDA 2CTNA 3TS5C 3SIBA 1Y1UA 1WLZA 1MQ1A 4FTGA 1J55A 3VRNA 3BUNB 3OP0A 1NCXA 1KFUS 4PHKA 2LUXA 1CDPA 2JTTA 1V1GA 1N0YA 2KFGA 2K7OA 1NCYA 1DJZA 5HKWA 2ZKMX 1UHIA 3JTDC 4GUKA 3PN7B 5HYDA 2OTGB 1PSRA 2LVVA 2MLEC 3LLEA 1PSBA 1H4BA 2SASA 4U8DA 1NSHA 1TNPA 2M49B 2KOTA 1IQ5A 4NQGA 3BUXB 1F54A 2JT0A 3VROA 1YUTA 1M31A 5I2OA 1S36A 2MBXA 3DD4A 1AK8A 2HPSA 1C07A 4XJKA 3O6BA 1EL4A 1U5IB 3BQ3A 1YTZC 2BCAA 2LCPA 2I18A 2AUCA 2BKIB 2HQWA 2KNEA 4ORBB 1FBVA 1B8LA 3D0YA 4P2YB 3SIAA 4BY5A 3K21A 1G33A 1WLMA 2FOTA 2KHNA 1CTRA 1QIWA 1SCMB 1YVHA 2JNFA 3D10A 4GPLB 2LLTA 2LM5A 3ICBA 4MRXA 2MLFC 1B8RA 5HLOA 1S26D 1KSMA 1FPWA 1ZFSA 2BCBA 1YR5A 4WQ3A 3FWCA 3VRQA 2PALA 5JJGA 1KK7Z 5D69A 1QVIZ 1MXLC 3RM1A 2V53A 3PM8A 2LVKA 1ODBA 1C7VA 1KQMC 5KU1A 4MVFA 3EK4A 2BL0B 1WDCB 1DJGA 4GGNA 2PSRA 1PALA 2LHLA 5F6TA 2QPTA 2LHIA 1TN4A 3QRXA 1QLKA 3GOFA 3BOWB 4JPZB 4HSZA 3SG5A 1CM4A 1QJTA 4YI9A 3TDUA 1KQVA 4GNKB 1CDLA 2NXQA 3KHEA 1NIWA 2K8MB 2LAPA 1DGUA 1OZSA 4YI8A 2LUCA 2KYCA 3OHMB 2LMTA 1DVIA 3F45A 1B8CA 5CSJA 1L7ZA 3GK4X 2BBNA 4DCKA 2F2PA 4HRGA 1ZOTB 2KBMA 3CTNA 1CFPA 5PALA 3LK0A 1BR4B 4L9MA 2M0RA 2JTZA 2PRUA 4M2QA 3M0WA 1BOCA 1KQMB 1M45A 1NPQA 4OR9B 1MUXA 3NXAA 3LCPC 1V1FA 1S1EA 5TNCA 1RTP1 2KDHA 1A2XA 1F8HA 1WY9A 3NSOA 1LA0A 1Y6WA 1KK8B 3TZ1A 1DT7B 1SNLA 2WOSA 5FYXA 5D7FA 1H8BA 1MF8B
chains in the Genus database with same CATH superfamily
1IJ6A 3PM2A 1MHOA 5ER5A 2JRFA 3PSRA 1Y0VH 4GFTA 4P5OE 1QASA 3DVEA 3S0DA 3RZSA 1S6JA 2RGIA 2YGUA 4DRWA 2JOJA 1SW8A 2GTEA 4ICBA 2WCBA 2GGZA 2KLDA 5HKYA 1S5GY 2L5XB 4PHNA 5G08A 4CFRA 1DF0A 3IQQA 3TUYC 3DXLA 1D1OA 2KI4B 1LINA 1TNQA 1PULA 1A75B 2K60A 3CR2A 3TDIA 4E68A 4MRYA 2K7BA 1Q80A 2QDIA 2D8NA 4C0JA 1YX7A 4ZCUA 4DUQA 2H2KA 2L2CA 3L4AA 1K95A 4AOMA 3BXKA 4YGEB 1S3PA 1OSAA 3O4YA 4MSPA 4FQTA 4PE7A 2E6WA 1SR6C 3RLZA 1NX0A 2NCPA 2JC2A 3BFAA 2KI6D 2KQ6A 3OB1B 4INXA 1XA5A 2WCLA 4HREE 4PHMA 5HLVA 3I5IC 1AJ4A 1NX1A 2SCPA 1F55A 3CABA 2QACA 3E3RA 3KO0A 1XFYO 4WRIA 4YBHB 4USLA 1AP4A 1FF1A 2AMIA 3OBVA 4OKHA 1CKKA 4OCIA 1JFKA 4INWA 3CS1A 5AANA 3B7AA 3PLFB 4QJ3B 4DS7A 1F4OA 2F3YA 2QEVA 1FI5A 3CZ0A 2F3ZA 2KAXA 2M1KB 2LNKA 2TN4A 2LP3A 2L2EA 3D78A 1U5IA 2PASA 3FWBA 2ZN9A 1XFVO 1IJ5A 3OX5A 3I5HC 2LE9B 2WCEA 3CZ1A 3EK8A 1FW4A 1JBAA 3VB1A 1DJHA 2L51A 1PRWA 3VRRA 3EK7A 3GK2A 1SR6B 1YUUA 4I5LB 2EC6C 1BR1B 4XYNA 3TS5B 2JXCA 1RECA 1QS7A 2A4JA 1QV1A 1TTXA 4PE4A 1TWOA 4ETOA 1W7JB 2KGRA 4FQOA 4MN0A 1OW4A 2OS8C 2JULA 3TDZA 4D1EA 1DJYA 4C0KA 1NX3A 1JFJA 3SJSA 3UO9A 1EXRA 3JTDB 1KWOC 4NDDA 2PVBA 4PALA 1K8UA 4N5XA 2K61A 3DZTA 4M2OA 3EVUA 4BY4A 3B6XA 1YUSA 3AAKA 4ORAB 5CSIA 1LVCD 5J3XA 2BE6A 4QJ5B 1NP8A 5K89A 1GGZA 1TRFA 2I94A 3R1VA 4PHJA 1QTXA 4HRHA 2JQ6A 4GAOA 2COLB 2FCEA 1UUSA 1T14A 5AEQA 2KLEA 2NCOA 5KTYA 2Y5IA 4XJKB 3I5HB 2WC8A 1K93D 2BECA 1NX2A 5D3OA 1J7RA 2F33A 2LC5A 1LA3A 2P6BB 3D0YB 5CSNA 3A8RA 3B88A 4IL1A 2VRGA 1S5GZ 3QMEA 4PT1A 3JVTC 3L4LA 1AJ5A 2LANA 3LK1A 1SL8A 1W7IB 3WHTB 1J1DA 4F7FA 1HT9A 2G2BA 3SG4A 1ZUZA 1TCOB 3KF9A 2PMYA 1MXEA 2JT8A 3BUOB 1RFJA 5BPJA 1QIVA 1S6IA 2ZRTA 2K7CA 1SYMA 3C1VA 3DF0B 1K2HA 2KSPA 1CLLA 1K90D 4GBAA 4PE1A 1DJXA 2EHBA 2Y1MA 1RWYA 2L0PA 2WORA 2M1UA 1FI6A 2HETA 3HX4A 1OMVA 2CNPA 4PCWA 4YGBB 3EKHA 3NGVA 4I5JA 2LLSA 1GGWA 3OX6A 2MA2A 3SS4A 4AQIA 1UWOA 3FIAA 1UP5A 2NZ0A 1LS8A 1Y1XA 2F8PA 4PDZA 2KAVA 3DY9A 1CB1A 4MZJA 5GQQC 2L50A 2R2IA 2LLUA 4Q04A 3SG3A 1NCZA 3O2PA 2M97A 5FI6A 4TNCA 1MWNA 1F4QA 2JXLA 2LV7A 2Y4QA 3ZWHA 3NSLA 1Z2CB 4I5KA 4JQ0D 1CM1A 1SL9A 3A4UB 2K2FA 5DICA 2QEHA 3VGOA 1A75A 2PQLA 4JWQA 1NUBA 3S0AA 1IH0A 4KYNA 3KEVA 2FCDA 1L2OC 1ALWA 1YURA 2WNDA 4CIDA 1WRKA 1SRAA 4MLWA 1C3YA 3I5FC 1XFZO 1GQMA 2BBMA 1DTLA 1IG5A 4NDCA 1K94A 1QXPA 3H4SE 3O78A 1PVBA 2DOQA 2I7AA 2LVJA 2M8UA 1OMDA 1PVAA 1JF2A 1QV0A 4M2PA 3S0EA 1IKUA 1QLSA 1BODA 3PALA 1YVLA 2WCKA 1SY9A 1CMFA 5KSZA 4A4CA 3PN7C 1ZACA 2H61C 3DVJA 1Y1AA 2OTGC 4WQ2A 3O4XA 1BU3A 1XK4C 4YGAA 4YGDB 3BUWB 1SL7A 2H61A 3WNXB 1F71A 3BUMB 3ZNIA 1XK4A 1IQ3A 3N7HA 1CLBA 1R2UA 2HF5A 2LMUA 4GGFC 1B9AA 1BLQA 1KFUL 1UHNA 1M46A 1SSEB 3FS7A 1RJVA 1WRLA 1WRZA 1PK0D 4GGFA 1SCVA 4MZLA 3CDNA 1SBJA 1OQPA 3HCMA 3MSEB 1E8AA 2AAOA 2MJWB 1CNPA 1BMOA 1EG3A 3CZTX 2KBIA 3TUYB 1A4PA 2JPOA 2B1UA 4OZDA 3I5FB 1CFDA 2ZFDA 1YX8A 1DELA 1JSAA 1J7QA 1B7TY 2CCMA 3DVKA 2KAYA 3D77A 1BG1A 4NDBA 4CLNA 1SCMC 3SG7A 4YRUA 1UHHA 5I94A 4F0ZB 1IWQA 1JC2A 1HQVA 2K0JA 3NSKA 1ALVA 1RK9A 2BNXA 1DMOA 2BCXA 3SS3A 3EG5B 2JZIA 1CLMA 3EKJA 3I5IB 1RROA 1B4CA 1JWDA 1M63B 2KGBC 2OPOA 3GK1A 1OE9B 2M29A 4MBEA 4PE0A 1CFCA 2ZN8A 2O5GA 5AXIA 1SMGA 1EJ3A 1OOJA 1OZOA 3BJHA 3CYZA 3NHTA 2LP2A 2KFHA 1QX5B 3CR4X 2CT9A 2ZRSA 1EG4A 2BL0C 4OVNF 3AAJA 1WDCC 1N65A 1DJIA 2WC6A 2Q91A 3CZ2A 4MZKA 1EH2A 3IVTA 1CDMA 1R6PA 2KI6C 3UNWA 2JPTA 1IIOA 1CMGA 3CWGA 1QATA 1C3ZA 1UHJA 1SKTA 1AVSA 3NSIA 2CBLA 3BOWA 2L4IA 3BYAA 5DKNA 2M7LA 2ZNDA 3PATA 1AHRA 5JOLA 3DVMA 3PFVA 4OV2A 1TNXA 1DJWA 1TIZA 1C7WA 3WXAA 2I2RE 2EC6B 1J7OA 1YRTB 1YRUB 1B47A 2M9GA 1XFWO 2JU0A 5HKZA 1A03A 2WC5A 2LMVA 2JT3A 2OS8B 3CR5X 3DF0A 5I2QA 2CXJA 4N1GA 5B8IB 4JKTA 5I2LA 2P71A 1LXFC 1SPYA 1XO5A 1KWOB 3KPXA 4ORCB 1G8IA 4CFQA 1UURA 5AFPA 3EVRA 1K9KA 1XYDA 3Q8IA 3EVVA 3PJIA 5CPVA 1XFUO 3WHUB 4MEWA 5DKQA 1KK8C 2Y1NA 5AERA 5I8NA 3IQOA 2BKHB 2L4HA 1NWDA 1J1EA 2O60A 4I5NB 2K2AA 2ZNEA 1K9PA 4QJ4B 3I5GC 4ZCVA 1BJFA 1IGVA 2LVIA 2JWWA 2KI4C 3LL8B 5EL2A 4CPVA 3CLNA 1QWVA 2KPHA 1GJYA 3B86A 4R1EA 2NLNA 2ISDA 1XFRA 3JVTB 1OMRA 1TNWA 2GV5A 1JUOA 1CFFA 5CSFA 1QX7A 4DIRA 2KQYA 1VRKA 1A29A 1B7TZ 2Q4UA 1MR8A 2BAPA 1KFXL 1K96A 1KK7Y 1M39A 2M7NA 3VRPA 2MAZA 3S0FA 4N1FA 1QVIY 3AKBA 1K9UA 2WCMA 1BF5A 1KCYA 5IBWA 1JF0A 3B87A 1X02A 3D75A 3IF7A 3OB2B 1TUJA 3SS5A 1DGVA 1G4YR 3SG2A 2F2OA 2G9BA 2M3WA 2WCFA 1QX2A 2L98A 3D76A 3SG6A 4A4BA 2IS9A 2HQ8A 2KFFA 1KFXS 1DQEA 1TCFA 1SK6D 2GGMA 1N2DA 1UHKA 2ERBA 2K7DA 1NYAA 2PYQA 1AUIB 3I5GB 1ZMZA 2H8VA 4C0LA 1XVJA 2MHHA 5ER4X 4YGCB 1XFXO 2BE4A 1F70A 1BT6A 2FJUB 3CGAA 5DKRA 4UPGA 4AQJA 1CDNA 1J7PA 1W9ZA 2JNXA 3R1PA 1DF0B 1KSOA 2KYFA 3AKAA 1OOIX 1LKJA 1TOPA 1IRJA 1B1GA 1S6CA 2EGDA 1L2OB 2E30A 2MRDA 2CTNA 3S0BA 3TS5C 3R1OA 3D73A 3SIBA 1Y1UA 1WLZA 1MQ1A 4FTGA 1J55A 3VRNA 3BUNB 3OP0A 1NCXA 2P70A 1KFUS 4PHKA 2LUXA 1CDPA 2JTTA 1V1GA 1N0YA 2KFGA 2K7OA 1NCYA 1DJZA 2QEOA 5HKWA 2ZKMX 1UHIA 3JTDC 3K1EA 3PN7B 1ORGA 4GUKA 5HYDA 2OTGB 1PSRA 2LVVA 2MLEC 3LLEA 1PSBA 1H4BA 3L47A 2SASA 4U8DA 1NSHA 1TNPA 4GPLB 4IJ7A 2M49B 2KOTA 3BFHA 1IQ5A 4NQGA 3BUXB 1F54A 2JT0A 3VROA 1YUTA 1M31A 5I2OA 1S36A 2MBXA 3DD4A 1AK8A 2HPSA 1DC1A 4XJKA 3O6BA 1C07A 1EL4A 1U5IB 3BQ3A 1YTZC 3BFBA 2BCAA 2LCPA 2I18A 2AUCA 2BKIB 2HQWA 2KNEA 4ORBB 1FBVA 1B8LA 3D0YA 4P2YB 3SIAA 4BY5A 3K21A 1G33A 1WLMA 2FOTA 2KHNA 1CTRA 1QIWA 1SCMB 1YVHA 2FJYA 2JNFA 2WCHA 3D10A 3NHIA 2LLTA 3R72A 1DEKA 2LM5A 3ICBA 4MRXA 2MLFC 1B8RA 5HLOA 1S26D 1KSMA 1FPWA 1TUZA 1OOHA 1ZFSA 2BCBA 5HL1A 1YR5A 4JD9A 3DYEA 4WQ3A 3FWCA 3VRQA 2PALA 5JJGA 1KK7Z 5D69A 1QVIZ 1MXLC 3RM1A 2V53A 3PM8A 3FE9A 2LVKA 1ODBA 1C7VA 1KQMC 5KU1A 4MVFA 3V2LA 3EK4A 2BL0B 1WDCB 5FI7A 1DJGA 3OGNA 4GGNA 2PSRA 1PALA 2LHLA 5F6TA 2QPTA 2LHIA 1TN4A 3QRXA 1QLKA 3GOFA 3BOWB 4JPZB 4HSZA 5FI2A 3SG5A 1CM4A 1QJTA 3D74A 1OOGA 4YI9A 3TDUA 1KQVA 4GNKB 1CDLA 2NXQA 3FE6A 1NIWA 2K8MB 3KHEA 2LAPA 1DGUA 1Z4HA 1OZSA 4YI8A 2LUCA 1OOFA 2KYCA 2L5YA 3OHMB 2LMTA 1DVIA 3F45A 1B8CA 5CSJA 3S0GA 3FE8A 1L7ZA 3GK4X 2BBNA 4DCKA 2F2PA 4HRGA 1ZOTB 2KBMA 1GM0A 3CTNA 1CFPA 5PALA 2QEBA 3LK0A 1BR4B 4L9MA 2M0RA 2JTZA 2PRUA 4M2QA 3M0WA 1BOCA 1KQMB 1M45A 1NPQA 4OR9B 1MUXA 3NXAA 3LCPC 1P28A 1V1FA 1S1EA 5TNCA 1RTP1 2KDHA 1A2XA 1F8HA 1WY9A 3NSOA 1LA0A 1Y6WA 1KK8B 3TZ1A 1DT7B 1SNLA 2WCJA 2WOSA 5FYXA 5D7FA 1H8BA 1MF8B
chains in the Genus database with same CATH topology
1IJ6A 5ER5A 1MHOA 2JRFA 3PSRA 1Y0VH 4GFTA 4P5OE 1QASA 3DVEA 1S6JA 2RGIA 4DRWA 2JOJA 1SW8A 4ICBA 2WCBA 2GGZA 5HKYA 1S5GY 2L5XB 4PHNA 5G08A 4CFRA 1DF0A 3IQQA 3TUYC 1D1OA 2KI4B 1LINA 1TNQA 1PULA 1A75B 3CR2A 3TDIA 4E68A 4MRYA 2K7BA 1Q80A 2D8NA 4C0JA 1YX7A 4ZCUA 4DUQA 2H2KA 1K95A 4AOMA 3BXKA 4YGEB 1S3PA 1OSAA 3O4YA 4MSPA 4PE7A 2E6WA 1SR6C 3RLZA 1NX0A 2NCPA 2JC2A 2KI6D 2KQ6A 3OB1B 4PHMA 1XA5A 4HREE 5HLVA 3I5IC 1AJ4A 1NX1A 2SCPA 1F55A 2QACA 3E3RA 3KO0A 1XFYO 4WRIA 4YBHB 4USLA 1AP4A 1FF1A 2AMIA 4OKHA 1CKKA 4OCIA 1JFKA 5AANA 3CS1A 3PLFB 4QJ3B 4DS7A 1F4OA 2F3YA 1FI5A 2F3ZA 2KAXA 2M1KB 2LNKA 2TN4A 2LP3A 2L2EA 1U5IA 2PASA 3FWBA 2ZN9A 1XFVO 1IJ5A 3OX5A 3I5HC 2LE9B 2WCEA 3EK8A 1FW4A 1JBAA 1DJHA 2L51A 1PRWA 3VRRA 3EK7A 3GK2A 1SR6B 1YUUA 4I5LB 2EC6C 1BR1B 4XYNA 3TS5B 2JXCA 1RECA 1QS7A 2A4JA 1QV1A 1TTXA 4PE4A 4ETOA 1W7JB 2KGRA 4FQOA 4MN0A 2OS8C 2JULA 3TDZA 4D1EA 1DJYA 4C0KA 1NX3A 1JFJA 3SJSA 1EXRA 3JTDB 1KWOC 4NDDA 2PVBA 4PALA 1K8UA 4N5XA 2K61A 4M2OA 3EVUA 4BY4A 1YUSA 3AAKA 4ORAB 5CSIA 1LVCD 5J3XA 2BE6A 4QJ5B 1NP8A 5K89A 1GGZA 1TRFA 2I94A 4PHJA 1QTXA 4HRHA 2JQ6A 4GAOA 2COLB 2FCEA 1UUSA 5AEQA 2NCOA 5KTYA 2Y5IA 4XJKB 3I5HB 2WC8A 1K93D 2BECA 1NX2A 1J7RA 2F33A 2LC5A 1LA3A 2P6BB 3D0YB 5CSNA 3A8RA 4IL1A 2VRGA 1S5GZ 3JVTC 1AJ5A 2LANA 3LK1A 1SL8A 1W7IB 3WHTB 1J1DA 1HT9A 2G2BA 3SG4A 1ZUZA 1TCOB 3KF9A 2PMYA 1MXEA 2JT8A 3BUOB 1RFJA 5BPJA 1QIVA 1S6IA 2ZRTA 2K7CA 1SYMA 3C1VA 3DF0B 1K2HA 2KSPA 1CLLA 1K90D 4GBAA 4PE1A 1DJXA 2EHBA 2Y1MA 1RWYA 2L0PA 2WORA 2M1UA 1FI6A 2HETA 3HX4A 1OMVA 2CNPA 4PCWA 4YGBB 3EKHA 4I5JA 1GGWA 2LLSA 3OX6A 2MA2A 4AQIA 1UWOA 3FIAA 1UP5A 2NZ0A 1Y1XA 2F8PA 4PDZA 2KAVA 1CB1A 4MZJA 5GQQC 2L50A 2R2IA 2LLUA 4Q04A 3SG3A 1NCZA 3O2PA 2M97A 4TNCA 1MWNA 1F4QA 2JXLA 2LV7A 2Y4QA 3ZWHA 3NSLA 4I5KA 4JQ0D 1CM1A 1SL9A 3A4UB 2K2FA 3VGOA 1A75A 4JWQA 1NUBA 1IH0A 3KEVA 2FCDA 1L2OC 1ALWA 1YURA 2WNDA 4CIDA 1WRKA 1SRAA 4MLWA 3I5FC 1XFZO 1GQMA 2BBMA 1DTLA 1IG5A 4NDCA 1K94A 1QXPA 3H4SE 3O78A 1PVBA 2DOQA 2I7AA 2LVJA 2M8UA 1OMDA 1PVAA 1JF2A 1QV0A 4M2PA 1IKUA 1QLSA 1BODA 3PALA 1YVLA 1CMFA 1SY9A 5KSZA 4A4CA 3PN7C 1ZACA 2H61C 3DVJA 1Y1AA 2OTGC 4WQ2A 1BU3A 1XK4C 4YGAA 4YGDB 3BUWB 1SL7A 2H61A 3WNXB 1F71A 3BUMB 3ZNIA 1XK4A 1IQ3A 1CLBA 1R2UA 2HF5A 2LMUA 4GGFC 1B9AA 1BLQA 1KFUL 1UHNA 1M46A 3FS7A 1RJVA 1WRLA 1WRZA 1PK0D 4GGFA 1SCVA 4MZLA 1SBJA 1OQPA 3HCMA 3MSEB 1E8AA 2AAOA 2MJWB 1CNPA 1BMOA 1EG3A 3CZTX 2KBIA 3TUYB 1A4PA 2B1UA 3I5FB 1CFDA 2ZFDA 1YX8A 1JSAA 1J7QA 1B7TY 2CCMA 3DVKA 2KAYA 1BG1A 4NDBA 4CLNA 1SCMC 3SG7A 4YRUA 1UHHA 1JC2A 4F0ZB 1IWQA 1HQVA 2K0JA 3NSKA 1ALVA 1RK9A 1DMOA 2BCXA 2JZIA 1CLMA 3EKJA 3I5IB 1RROA 1B4CA 1JWDA 1M63B 2KGBC 2OPOA 3GK1A 1OE9B 2M29A 4MBEA 4PE0A 1CFCA 2ZN8A 2O5GA 5AXIA 1SMGA 1EJ3A 1OOJA 1OZOA 2LP2A 2KFHA 1QX5B 3CR4X 2CT9A 2ZRSA 2BL0C 1EG4A 4OVNF 3AAJA 1WDCC 1N65A 1DJIA 2Q91A 4MZKA 1EH2A 1CDMA 1R6PA 2KI6C 2JPTA 1CMGA 3CWGA 1QATA 1UHJA 1SKTA 1AVSA 3NSIA 2CBLA 3BOWA 2L4IA 3BYAA 5DKNA 2M7LA 2ZNDA 3PATA 1AHRA 5JOLA 3DVMA 3PFVA 4OV2A 1TNXA 1DJWA 1TIZA 1C7WA 3WXAA 2I2RE 2EC6B 1J7OA 1YRTB 1YRUB 1B47A 2M9GA 1XFWO 2JU0A 5HKZA 1A03A 2LMVA 2JT3A 2OS8B 3CR5X 3DF0A 5I2QA 2CXJA 4N1GA 5B8IB 5I2LA 1LXFC 1SPYA 1XO5A 1KWOB 3KPXA 4ORCB 1G8IA 4CFQA 1UURA 5AFPA 3EVRA 1K9KA 1XYDA 3EVVA 5CPVA 1XFUO 3WHUB 4MEWA 5DKQA 1KK8C 2Y1NA 5AERA 5I8NA 3IQOA 2BKHB 2L4HA 1NWDA 1J1EA 2O60A 4I5NB 2K2AA 2ZNEA 1K9PA 4QJ4B 3I5GC 4ZCVA 1BJFA 1IGVA 2LVIA 2JWWA 2KI4C 3LL8B 4CPVA 3CLNA 1GJYA 4R1EA 2ISDA 2NLNA 3JVTB 1OMRA 1TNWA 2GV5A 1JUOA 1CFFA 5CSFA 1QX7A 4DIRA 2KQYA 1VRKA 1A29A 1B7TZ 2Q4UA 1MR8A 1KFXL 1K96A 1KK7Y 1M39A 2M7NA 3VRPA 2MAZA 4N1FA 1QVIY 3AKBA 1K9UA 1BF5A 1KCYA 5IBWA 1JF0A 3OB2B 1X02A 3IF7A 1DGVA 1G4YR 3SG2A 2F2OA 2G9BA 2M3WA 2WCFA 1QX2A 2L98A 3SG6A 4A4BA 2IS9A 2HQ8A 2KFFA 1KFXS 1TCFA 1SK6D 2GGMA 1N2DA 1UHKA 2K7DA 1NYAA 1AUIB 3I5GB 1ZMZA 4C0LA 1XVJA 2MHHA 5ER4X 4YGCB 1XFXO 2BE4A 1F70A 1BT6A 2FJUB 3CGAA 5DKRA 4UPGA 4AQJA 1CDNA 1J7PA 2JNXA 1DF0B 1KSOA 2KYFA 3AKAA 1LKJA 1TOPA 1IRJA 1B1GA 1S6CA 2EGDA 1L2OB 2E30A 2MRDA 2CTNA 3TS5C 3SIBA 1Y1UA 1WLZA 1MQ1A 4FTGA 1J55A 3VRNA 3BUNB 3OP0A 1NCXA 1KFUS 4PHKA 2LUXA 1CDPA 2JTTA 1V1GA 1N0YA 2KFGA 2K7OA 1NCYA 1DJZA 5HKWA 2ZKMX 1UHIA 3JTDC 4GUKA 3PN7B 5HYDA 2OTGB 1PSRA 2LVVA 2MLEC 3LLEA 1PSBA 1H4BA 2SASA 4U8DA 1NSHA 1TNPA 2M49B 2KOTA 1IQ5A 4NQGA 3BUXB 1F54A 2JT0A 3VROA 1YUTA 1M31A 5I2OA 1S36A 2MBXA 3DD4A 1AK8A 2HPSA 1C07A 4XJKA 3O6BA 1EL4A 1U5IB 3BQ3A 1YTZC 2BCAA 2LCPA 2I18A 2AUCA 2BKIB 2HQWA 2KNEA 4ORBB 1FBVA 1B8LA 3D0YA 4P2YB 3SIAA 4BY5A 3K21A 1G33A 1WLMA 2FOTA 2KHNA 1CTRA 1QIWA 1SCMB 1YVHA 2JNFA 3D10A 4GPLB 2LLTA 2LM5A 3ICBA 4MRXA 2MLFC 1B8RA 5HLOA 1S26D 1KSMA 1FPWA 1ZFSA 2BCBA 1YR5A 4WQ3A 3FWCA 3VRQA 2PALA 5JJGA 1KK7Z 5D69A 1QVIZ 1MXLC 3RM1A 2V53A 3PM8A 2LVKA 1ODBA 1C7VA 1KQMC 5KU1A 4MVFA 3EK4A 2BL0B 1WDCB 1DJGA 4GGNA 2PSRA 1PALA 2LHLA 5F6TA 2QPTA 2LHIA 1TN4A 3QRXA 1QLKA 3GOFA 3BOWB 4JPZB 4HSZA 3SG5A 1CM4A 1QJTA 4YI9A 3TDUA 1KQVA 4GNKB 1CDLA 2NXQA 3KHEA 1NIWA 2K8MB 2LAPA 1DGUA 1OZSA 4YI8A 2LUCA 2KYCA 3OHMB 2LMTA 1DVIA 3F45A 1B8CA 5CSJA 1L7ZA 3GK4X 2BBNA 4DCKA 2F2PA 4HRGA 1ZOTB 2KBMA 3CTNA 1CFPA 5PALA 3LK0A 1BR4B 4L9MA 2M0RA 2JTZA 2PRUA 4M2QA 3M0WA 1BOCA 1KQMB 1M45A 1NPQA 4OR9B 1MUXA 3NXAA 3LCPC 1V1FA 1S1EA 5TNCA 1RTP1 2KDHA 1A2XA 1F8HA 1WY9A 3NSOA 1LA0A 1Y6WA 1KK8B 3TZ1A 1DT7B 1SNLA 2WOSA 5FYXA 5D7FA 1H8BA 1MF8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IJ6 A;  5ER5 A;  1MHO A;  2JRF A;  3PSR A;  1Y0V H;  4GFT A;  4P5O E;  1QAS A;  3DVE A;  1S6J A;  2RGI A;  4DRW A;  2JOJ A;  1SW8 A;  4ICB A;  2WCB A;  2GGZ A;  5HKY A;  1S5G Y;  2L5X B;  4PHN A;  5G08 A;  4CFR A;  1DF0 A;  3IQQ A;  3TUY C;  1D1O A;  2KI4 B;  1LIN A;  1TNQ A;  1PUL A;  1A75 B;  3CR2 A;  3TDI A;  4E68 A;  4MRY A;  2K7B A;  1Q80 A;  2D8N A;  4C0J A;  1YX7 A;  4ZCU A;  4DUQ A;  2H2K A;  1K95 A;  4AOM A;  3BXK A;  4YGE B;  1S3P A;  1OSA A;  3O4Y A;  4MSP A;  4PE7 A;  2E6W A;  1SR6 C;  3RLZ A;  1NX0 A;  2NCP A;  2JC2 A;  2KI6 D;  2KQ6 A;  3OB1 B;  4PHM A;  1XA5 A;  4HRE E;  5HLV A;  3I5I C;  1AJ4 A;  1NX1 A;  2SCP A;  1F55 A;  2QAC A;  3E3R A;  3KO0 A;  1XFY O;  4WRI A;  4YBH B;  4USL A;  1AP4 A;  1FF1 A;  2AMI A;  4OKH A;  1CKK A;  4OCI A;  1JFK A;  5AAN A;  3CS1 A;  3PLF B;  4QJ3 B;  4DS7 A;  1F4O A;  2F3Y A;  1FI5 A;  2F3Z A;  2KAX A;  2M1K B;  2LNK A;  2TN4 A;  2LP3 A;  2L2E A;  1U5I A;  2PAS A;  3FWB A;  2ZN9 A;  1XFV O;  1IJ5 A;  3OX5 A;  3I5H C;  2LE9 B;  2WCE A;  3EK8 A;  1FW4 A;  1JBA A;  1DJH A;  2L51 A;  1PRW A;  3VRR A;  3EK7 A;  3GK2 A;  1SR6 B;  1YUU A;  4I5L B;  2EC6 C;  1BR1 B;  4XYN A;  3TS5 B;  2JXC A;  1REC A;  1QS7 A;  2A4J A;  1QV1 A;  1TTX A;  4PE4 A;  4ETO A;  1W7J B;  2KGR A;  4FQO A;  4MN0 A;  2OS8 C;  2JUL A;  3TDZ A;  4D1E A;  1DJY A;  4C0K A;  1NX3 A;  1JFJ A;  3SJS A;  1EXR A;  3JTD B;  1KWO C;  4NDD A;  2PVB A;  4PAL A;  1K8U A;  4N5X A;  2K61 A;  4M2O A;  3EVU A;  4BY4 A;  1YUS A;  3AAK A;  4ORA B;  5CSI A;  1LVC D;  5J3X A;  2BE6 A;  4QJ5 B;  1NP8 A;  5K89 A;  1GGZ A;  1TRF A;  2I94 A;  4PHJ A;  1QTX A;  4HRH A;  2JQ6 A;  4GAO A;  2COL B;  2FCE A;  1UUS A;  5AEQ A;  2NCO A;  5KTY A;  2Y5I A;  4XJK B;  3I5H B;  2WC8 A;  1K93 D;  2BEC A;  1NX2 A;  1J7R A;  2F33 A;  2LC5 A;  1LA3 A;  2P6B B;  3D0Y B;  5CSN A;  3A8R A;  4IL1 A;  2VRG A;  1S5G Z;  3JVT C;  1AJ5 A;  2LAN A;  3LK1 A;  1SL8 A;  1W7I B;  3WHT B;  1J1D A;  1HT9 A;  2G2B A;  3SG4 A;  1ZUZ A;  1TCO B;  3KF9 A;  2PMY A;  1MXE A;  2JT8 A;  3BUO B;  1RFJ A;  5BPJ A;  1QIV A;  1S6I A;  2ZRT A;  2K7C A;  1SYM A;  3C1V A;  3DF0 B;  1K2H A;  2KSP A;  1CLL A;  1K90 D;  4GBA A;  4PE1 A;  1DJX A;  2EHB A;  2Y1M A;  1RWY A;  2L0P A;  2WOR A;  2M1U A;  1FI6 A;  2HET A;  3HX4 A;  1OMV A;  2CNP A;  4PCW A;  4YGB B;  3EKH A;  4I5J A;  1GGW A;  2LLS A;  3OX6 A;  2MA2 A;  4AQI A;  1UWO A;  3FIA A;  1UP5 A;  2NZ0 A;  1Y1X A;  2F8P A;  4PDZ A;  2KAV A;  1CB1 A;  4MZJ A;  5GQQ C;  2L50 A;  2R2I A;  2LLU A;  4Q04 A;  3SG3 A;  1NCZ A;  3O2P A;  2M97 A;  4TNC A;  1MWN A;  1F4Q A;  2JXL A;  2LV7 A;  2Y4Q A;  3ZWH A;  3NSL A;  4I5K A;  4JQ0 D;  1CM1 A;  1SL9 A;  3A4U B;  2K2F A;  3VGO A;  1A75 A;  4JWQ A;  1NUB A;  1IH0 A;  3KEV A;  2FCD A;  1L2O C;  1ALW A;  1YUR A;  2WND A;  4CID A;  1WRK A;  1SRA A;  4MLW A;  3I5F C;  1XFZ O;  1GQM A;  2BBM A;  1DTL A;  1IG5 A;  4NDC A;  1K94 A;  1QXP A;  3H4S E;  3O78 A;  1PVB A;  2DOQ A;  2I7A A;  2LVJ A;  2M8U A;  1OMD A;  1PVA A;  1JF2 A;  1QV0 A;  4M2P A;  1IKU A;  1QLS A;  1BOD A;  3PAL A;  1YVL A;  1CMF A;  1SY9 A;  5KSZ A;  4A4C A;  3PN7 C;  1ZAC A;  2H61 C;  3DVJ A;  1Y1A A;  2OTG C;  4WQ2 A;  1BU3 A;  1XK4 C;  4YGA A;  4YGD B;  3BUW B;  1SL7 A;  2H61 A;  3WNX B;  1F71 A;  3BUM B;  3ZNI A;  1XK4 A;  1IQ3 A;  1CLB A;  1R2U A;  2HF5 A;  2LMU A;  4GGF C;  1B9A A;  1BLQ A;  1KFU L;  1UHN A;  1M46 A;  3FS7 A;  1RJV A;  1WRL A;  1WRZ A;  1PK0 D;  4GGF A;  1SCV A;  4MZL A;  1SBJ A;  1OQP A;  3HCM A;  3MSE B;  1E8A A;  2AAO A;  2MJW B;  1CNP A;  1BMO A;  1EG3 A;  3CZT X;  2KBI A;  3TUY B;  1A4P A;  2B1U A;  3I5F B;  1CFD A;  2ZFD A;  1YX8 A;  1JSA A;  1J7Q A;  1B7T Y;  2CCM A;  3DVK A;  2KAY A;  1BG1 A;  4NDB A;  4CLN A;  1SCM C;  3SG7 A;  4YRU A;  1UHH A;  1JC2 A;  4F0Z B;  1IWQ A;  1HQV A;  2K0J A;  3NSK A;  1ALV A;  1RK9 A;  1DMO A;  2BCX A;  2JZI A;  1CLM A;  3EKJ A;  3I5I B;  1RRO A;  1B4C A;  1JWD A;  1M63 B;  2KGB C;  2OPO A;  3GK1 A;  1OE9 B;  2M29 A;  4MBE A;  4PE0 A;  1CFC A;  2ZN8 A;  2O5G A;  5AXI A;  1SMG A;  1EJ3 A;  1OOJ A;  1OZO A;  2LP2 A;  2KFH A;  1QX5 B;  3CR4 X;  2CT9 A;  2ZRS A;  2BL0 C;  1EG4 A;  4OVN F;  3AAJ A;  1WDC C;  1N65 A;  1DJI A;  2Q91 A;  4MZK A;  1EH2 A;  1CDM A;  1R6P A;  2KI6 C;  2JPT A;  1CMG A;  3CWG A;  1QAT A;  1UHJ A;  1SKT A;  1AVS A;  3NSI A;  2CBL A;  3BOW A;  2L4I A;  3BYA A;  5DKN A;  2M7L A;  2ZND A;  3PAT A;  1AHR A;  5JOL A;  3DVM A;  3PFV A;  4OV2 A;  1TNX A;  1DJW A;  1TIZ A;  1C7W A;  3WXA A;  2I2R E;  2EC6 B;  1J7O A;  1YRT B;  1YRU B;  1B47 A;  2M9G A;  1XFW O;  2JU0 A;  5HKZ A;  1A03 A;  2LMV A;  2JT3 A;  2OS8 B;  3CR5 X;  3DF0 A;  5I2Q A;  2CXJ A;  4N1G A;  5B8I B;  5I2L A;  1LXF C;  1SPY A;  1XO5 A;  1KWO B;  3KPX A;  4ORC B;  1G8I A;  4CFQ A;  1UUR A;  5AFP A;  3EVR A;  1K9K A;  1XYD A;  3EVV A;  5CPV A;  1XFU O;  3WHU B;  4MEW A;  5DKQ A;  1KK8 C;  2Y1N A;  5AER A;  5I8N A;  3IQO A;  2BKH B;  2L4H A;  1NWD A;  1J1E A;  2O60 A;  4I5N B;  2K2A A;  2ZNE A;  1K9P A;  4QJ4 B;  3I5G C;  4ZCV A;  1BJF A;  1IGV A;  2LVI A;  2JWW A;  2KI4 C;  3LL8 B;  4CPV A;  3CLN A;  1GJY A;  4R1E A;  2ISD A;  2NLN A;  3JVT B;  1OMR A;  1TNW A;  2GV5 A;  1JUO A;  1CFF A;  5CSF A;  1QX7 A;  4DIR A;  2KQY A;  1VRK A;  1A29 A;  1B7T Z;  2Q4U A;  1MR8 A;  1KFX L;  1K96 A;  1KK7 Y;  1M39 A;  2M7N A;  3VRP A;  2MAZ A;  4N1F A;  1QVI Y;  3AKB A;  1K9U A;  1BF5 A;  1KCY A;  5IBW A;  1JF0 A;  3OB2 B;  1X02 A;  3IF7 A;  1DGV A;  1G4Y R;  3SG2 A;  2F2O A;  2G9B A;  2M3W A;  2WCF A;  1QX2 A;  2L98 A;  3SG6 A;  4A4B A;  2IS9 A;  2HQ8 A;  2KFF A;  1KFX S;  1TCF A;  1SK6 D;  2GGM A;  1N2D A;  1UHK A;  2K7D A;  1NYA A;  1AUI B;  3I5G B;  1ZMZ A;  4C0L A;  1XVJ A;  2MHH A;  5ER4 X;  4YGC B;  1XFX O;  2BE4 A;  1F70 A;  1BT6 A;  2FJU B;  3CGA A;  5DKR A;  4UPG A;  4AQJ A;  1CDN A;  1J7P A;  2JNX A;  1DF0 B;  1KSO A;  2KYF A;  3AKA A;  1LKJ A;  1TOP A;  1IRJ A;  1B1G A;  1S6C A;  2EGD A;  1L2O B;  2E30 A;  2MRD A;  2CTN A;  3TS5 C;  3SIB A;  1Y1U A;  1WLZ A;  1MQ1 A;  4FTG A;  1J55 A;  3VRN A;  3BUN B;  3OP0 A;  1NCX A;  1KFU S;  4PHK A;  2LUX A;  1CDP A;  2JTT A;  1V1G A;  1N0Y A;  2KFG A;  2K7O A;  1NCY A;  1DJZ A;  5HKW A;  2ZKM X;  1UHI A;  3JTD C;  4GUK A;  3PN7 B;  5HYD A;  2OTG B;  1PSR A;  2LVV A;  2MLE C;  3LLE A;  1PSB A;  1H4B A;  2SAS A;  4U8D A;  1NSH A;  1TNP A;  2M49 B;  2KOT A;  1IQ5 A;  4NQG A;  3BUX B;  1F54 A;  2JT0 A;  3VRO A;  1YUT A;  1M31 A;  5I2O A;  1S36 A;  2MBX A;  3DD4 A;  1AK8 A;  2HPS A;  1C07 A;  4XJK A;  3O6B A;  1EL4 A;  1U5I B;  3BQ3 A;  1YTZ C;  2BCA A;  2LCP A;  2I18 A;  2AUC A;  2BKI B;  2HQW A;  2KNE A;  4ORB B;  1FBV A;  1B8L A;  3D0Y A;  4P2Y B;  3SIA A;  4BY5 A;  3K21 A;  1G33 A;  1WLM A;  2FOT A;  2KHN A;  1CTR A;  1QIW A;  1SCM B;  1YVH A;  2JNF A;  3D10 A;  4GPL B;  2LLT A;  2LM5 A;  3ICB A;  4MRX A;  2MLF C;  1B8R A;  5HLO A;  1S26 D;  1KSM A;  1FPW A;  1ZFS A;  2BCB A;  1YR5 A;  4WQ3 A;  3FWC A;  3VRQ A;  2PAL A;  5JJG A;  1KK7 Z;  5D69 A;  1QVI Z;  1MXL C;  3RM1 A;  2V53 A;  3PM8 A;  2LVK A;  1ODB A;  1C7V A;  1KQM C;  5KU1 A;  4MVF A;  3EK4 A;  2BL0 B;  1WDC B;  1DJG A;  4GGN A;  2PSR A;  1PAL A;  2LHL A;  5F6T A;  2QPT A;  2LHI A;  1TN4 A;  3QRX A;  1QLK A;  3GOF A;  3BOW B;  4JPZ B;  4HSZ A;  3SG5 A;  1CM4 A;  1QJT A;  4YI9 A;  3TDU A;  1KQV A;  4GNK B;  1CDL A;  2NXQ A;  3KHE A;  1NIW A;  2K8M B;  2LAP A;  1DGU A;  1OZS A;  4YI8 A;  2LUC A;  2KYC A;  3OHM B;  2LMT A;  1DVI A;  3F45 A;  1B8C A;  5CSJ A;  1L7Z A;  3GK4 X;  2BBN A;  4DCK A;  2F2P A;  4HRG A;  1ZOT B;  2KBM A;  3CTN A;  1CFP A;  5PAL A;  3LK0 A;  1BR4 B;  4L9M A;  2M0R A;  2JTZ A;  2PRU A;  4M2Q A;  3M0W A;  1BOC A;  1KQM B;  1M45 A;  1NPQ A;  4OR9 B;  1MUX A;  3NXA A;  3LCP C;  1V1F A;  1S1E A;  5TNC A;  1RTP 1;  2KDH A;  1A2X A;  1F8H A;  1WY9 A;  3NSO A;  1LA0 A;  1Y6W A;  1KK8 B;  3TZ1 A;  1DT7 B;  1SNL A;  2WOS A;  5FYX A;  5D7F A;  1H8B A;  1MF8 B; 
#chains in the Genus database with same CATH topology
 1IJ6 A;  3PM2 A;  1MHO A;  5ER5 A;  2JRF A;  3PSR A;  1Y0V H;  4GFT A;  4P5O E;  1QAS A;  3DVE A;  3S0D A;  3RZS A;  1S6J A;  2RGI A;  2YGU A;  4DRW A;  2JOJ A;  1SW8 A;  2GTE A;  4ICB A;  2WCB A;  2GGZ A;  2KLD A;  5HKY A;  1S5G Y;  2L5X B;  4PHN A;  5G08 A;  4CFR A;  1DF0 A;  3IQQ A;  3TUY C;  3DXL A;  1D1O A;  2KI4 B;  1LIN A;  1TNQ A;  1PUL A;  1A75 B;  2K60 A;  3CR2 A;  3TDI A;  4E68 A;  4MRY A;  2K7B A;  1Q80 A;  2QDI A;  2D8N A;  4C0J A;  1YX7 A;  4ZCU A;  4DUQ A;  2H2K A;  2L2C A;  3L4A A;  1K95 A;  4AOM A;  3BXK A;  4YGE B;  1S3P A;  1OSA A;  3O4Y A;  4MSP A;  4FQT A;  4PE7 A;  2E6W A;  1SR6 C;  3RLZ A;  1NX0 A;  2NCP A;  2JC2 A;  3BFA A;  2KI6 D;  2KQ6 A;  3OB1 B;  4INX A;  1XA5 A;  2WCL A;  4HRE E;  4PHM A;  5HLV A;  3I5I C;  1AJ4 A;  1NX1 A;  2SCP A;  1F55 A;  3CAB A;  2QAC A;  3E3R A;  3KO0 A;  1XFY O;  4WRI A;  4YBH B;  4USL A;  1AP4 A;  1FF1 A;  2AMI A;  3OBV A;  4OKH A;  1CKK A;  4OCI A;  1JFK A;  4INW A;  3CS1 A;  5AAN A;  3B7A A;  3PLF B;  4QJ3 B;  4DS7 A;  1F4O A;  2F3Y A;  2QEV A;  1FI5 A;  3CZ0 A;  2F3Z A;  2KAX A;  2M1K B;  2LNK A;  2TN4 A;  2LP3 A;  2L2E A;  3D78 A;  1U5I A;  2PAS A;  3FWB A;  2ZN9 A;  1XFV O;  1IJ5 A;  3OX5 A;  3I5H C;  2LE9 B;  2WCE A;  3CZ1 A;  3EK8 A;  1FW4 A;  1JBA A;  3VB1 A;  1DJH A;  2L51 A;  1PRW A;  3VRR A;  3EK7 A;  3GK2 A;  1SR6 B;  1YUU A;  4I5L B;  2EC6 C;  1BR1 B;  4XYN A;  3TS5 B;  2JXC A;  1REC A;  1QS7 A;  2A4J A;  1QV1 A;  1TTX A;  4PE4 A;  1TWO A;  4ETO A;  1W7J B;  2KGR A;  4FQO A;  4MN0 A;  1OW4 A;  2OS8 C;  2JUL A;  3TDZ A;  4D1E A;  1DJY A;  4C0K A;  1NX3 A;  1JFJ A;  3SJS A;  3UO9 A;  1EXR A;  3JTD B;  1KWO C;  4NDD A;  2PVB A;  4PAL A;  1K8U A;  4N5X A;  2K61 A;  3DZT A;  4M2O A;  3EVU A;  4BY4 A;  3B6X A;  1YUS A;  3AAK A;  4ORA B;  5CSI A;  1LVC D;  5J3X A;  2BE6 A;  4QJ5 B;  1NP8 A;  5K89 A;  1GGZ A;  1TRF A;  2I94 A;  3R1V A;  4PHJ A;  1QTX A;  4HRH A;  2JQ6 A;  4GAO A;  2COL B;  2FCE A;  1UUS A;  1T14 A;  5AEQ A;  2KLE A;  2NCO A;  5KTY A;  2Y5I A;  4XJK B;  3I5H B;  2WC8 A;  1K93 D;  2BEC A;  1NX2 A;  5D3O A;  1J7R A;  2F33 A;  2LC5 A;  1LA3 A;  2P6B B;  3D0Y B;  5CSN A;  3A8R A;  3B88 A;  4IL1 A;  2VRG A;  1S5G Z;  3QME A;  4PT1 A;  3JVT C;  3L4L A;  1AJ5 A;  2LAN A;  3LK1 A;  1SL8 A;  1W7I B;  3WHT B;  1J1D A;  4F7F A;  1HT9 A;  2G2B A;  3SG4 A;  1ZUZ A;  1TCO B;  3KF9 A;  2PMY A;  1MXE A;  2JT8 A;  3BUO B;  1RFJ A;  5BPJ A;  1QIV A;  1S6I A;  2ZRT A;  2K7C A;  1SYM A;  3C1V A;  3DF0 B;  1K2H A;  2KSP A;  1CLL A;  1K90 D;  4GBA A;  4PE1 A;  1DJX A;  2EHB A;  2Y1M A;  1RWY A;  2L0P A;  2WOR A;  2M1U A;  1FI6 A;  2HET A;  3HX4 A;  1OMV A;  2CNP A;  4PCW A;  4YGB B;  3EKH A;  3NGV A;  4I5J A;  2LLS A;  1GGW A;  3OX6 A;  2MA2 A;  3SS4 A;  4AQI A;  1UWO A;  3FIA A;  1UP5 A;  2NZ0 A;  1LS8 A;  1Y1X A;  2F8P A;  4PDZ A;  2KAV A;  3DY9 A;  1CB1 A;  4MZJ A;  5GQQ C;  2L50 A;  2R2I A;  2LLU A;  4Q04 A;  3SG3 A;  1NCZ A;  3O2P A;  2M97 A;  5FI6 A;  4TNC A;  1MWN A;  1F4Q A;  2JXL A;  2LV7 A;  2Y4Q A;  3ZWH A;  3NSL A;  1Z2C B;  4I5K A;  4JQ0 D;  1CM1 A;  1SL9 A;  3A4U B;  2K2F A;  5DIC A;  2QEH A;  3VGO A;  1A75 A;  2PQL A;  4JWQ A;  1NUB A;  3S0A A;  1IH0 A;  4KYN A;  3KEV A;  2FCD A;  1L2O C;  1ALW A;  1YUR A;  2WND A;  4CID A;  1WRK A;  1SRA A;  4MLW A;  1C3Y A;  3I5F C;  1XFZ O;  1GQM A;  2BBM A;  1DTL A;  1IG5 A;  4NDC A;  1K94 A;  1QXP A;  3H4S E;  3O78 A;  1PVB A;  2DOQ A;  2I7A A;  2LVJ A;  2M8U A;  1OMD A;  1PVA A;  1JF2 A;  1QV0 A;  4M2P A;  3S0E A;  1IKU A;  1QLS A;  1BOD A;  3PAL A;  1YVL A;  2WCK A;  1SY9 A;  1CMF A;  5KSZ A;  4A4C A;  3PN7 C;  1ZAC A;  2H61 C;  3DVJ A;  1Y1A A;  2OTG C;  4WQ2 A;  3O4X A;  1BU3 A;  1XK4 C;  4YGA A;  4YGD B;  3BUW B;  1SL7 A;  2H61 A;  3WNX B;  1F71 A;  3BUM B;  3ZNI A;  1XK4 A;  1IQ3 A;  3N7H A;  1CLB A;  1R2U A;  2HF5 A;  2LMU A;  4GGF C;  1B9A A;  1BLQ A;  1KFU L;  1UHN A;  1M46 A;  1SSE B;  3FS7 A;  1RJV A;  1WRL A;  1WRZ A;  1PK0 D;  4GGF A;  1SCV A;  4MZL A;  3CDN A;  1SBJ A;  1OQP A;  3HCM A;  3MSE B;  1E8A A;  2AAO A;  2MJW B;  1CNP A;  1BMO A;  1EG3 A;  3CZT X;  2KBI A;  3TUY B;  1A4P A;  2JPO A;  2B1U A;  4OZD A;  3I5F B;  1CFD A;  2ZFD A;  1YX8 A;  1DEL A;  1JSA A;  1J7Q A;  1B7T Y;  2CCM A;  3DVK A;  2KAY A;  3D77 A;  1BG1 A;  4NDB A;  4CLN A;  1SCM C;  3SG7 A;  4YRU A;  1UHH A;  5I94 A;  4F0Z B;  1IWQ A;  1JC2 A;  1HQV A;  2K0J A;  3NSK A;  1ALV A;  1RK9 A;  2BNX A;  1DMO A;  2BCX A;  3SS3 A;  3EG5 B;  2JZI A;  1CLM A;  3EKJ A;  3I5I B;  1RRO A;  1B4C A;  1JWD A;  1M63 B;  2KGB C;  2OPO A;  3GK1 A;  1OE9 B;  2M29 A;  4MBE A;  4PE0 A;  1CFC A;  2ZN8 A;  2O5G A;  5AXI A;  1SMG A;  1EJ3 A;  1OOJ A;  1OZO A;  3BJH A;  3CYZ A;  3NHT A;  2LP2 A;  2KFH A;  1QX5 B;  3CR4 X;  2CT9 A;  2ZRS A;  1EG4 A;  2BL0 C;  4OVN F;  3AAJ A;  1WDC C;  1N65 A;  1DJI A;  2WC6 A;  2Q91 A;  3CZ2 A;  4MZK A;  1EH2 A;  3IVT A;  1CDM A;  1R6P A;  2KI6 C;  3UNW A;  2JPT A;  1IIO A;  1CMG A;  3CWG A;  1QAT A;  1C3Z A;  1UHJ A;  1SKT A;  1AVS A;  3NSI A;  2CBL A;  3BOW A;  2L4I A;  3BYA A;  5DKN A;  2M7L A;  2ZND A;  3PAT A;  1AHR A;  5JOL A;  3DVM A;  3PFV A;  4OV2 A;  1TNX A;  1DJW A;  1TIZ A;  1C7W A;  3WXA A;  2I2R E;  2EC6 B;  1J7O A;  1YRT B;  1YRU B;  1B47 A;  2M9G A;  1XFW O;  2JU0 A;  5HKZ A;  1A03 A;  2WC5 A;  2LMV A;  2JT3 A;  2OS8 B;  3CR5 X;  3DF0 A;  5I2Q A;  2CXJ A;  4N1G A;  5B8I B;  4JKT A;  5I2L A;  2P71 A;  1LXF C;  1SPY A;  1XO5 A;  1KWO B;  3KPX A;  4ORC B;  1G8I A;  4CFQ A;  1UUR A;  5AFP A;  3EVR A;  1K9K A;  1XYD A;  3Q8I A;  3EVV A;  3PJI A;  5CPV A;  1XFU O;  3WHU B;  4MEW A;  5DKQ A;  1KK8 C;  2Y1N A;  5AER A;  5I8N A;  3IQO A;  2BKH B;  2L4H A;  1NWD A;  1J1E A;  2O60 A;  4I5N B;  2K2A A;  2ZNE A;  1K9P A;  4QJ4 B;  3I5G C;  4ZCV A;  1BJF A;  1IGV A;  2LVI A;  2JWW A;  2KI4 C;  3LL8 B;  5EL2 A;  4CPV A;  3CLN A;  1QWV A;  2KPH A;  1GJY A;  3B86 A;  4R1E A;  2NLN A;  2ISD A;  1XFR A;  3JVT B;  1OMR A;  1TNW A;  2GV5 A;  1JUO A;  1CFF A;  5CSF A;  1QX7 A;  4DIR A;  2KQY A;  1VRK A;  1A29 A;  1B7T Z;  2Q4U A;  1MR8 A;  2BAP A;  1KFX L;  1K96 A;  1KK7 Y;  1M39 A;  2M7N A;  3VRP A;  2MAZ A;  3S0F A;  4N1F A;  1QVI Y;  3AKB A;  1K9U A;  2WCM A;  1BF5 A;  1KCY A;  5IBW A;  1JF0 A;  3B87 A;  1X02 A;  3D75 A;  3IF7 A;  3OB2 B;  1TUJ A;  3SS5 A;  1DGV A;  1G4Y R;  3SG2 A;  2F2O A;  2G9B A;  2M3W A;  2WCF A;  1QX2 A;  2L98 A;  3D76 A;  3SG6 A;  4A4B A;  2IS9 A;  2HQ8 A;  2KFF A;  1KFX S;  1DQE A;  1TCF A;  1SK6 D;  2GGM A;  1N2D A;  1UHK A;  2ERB A;  2K7D A;  1NYA A;  2PYQ A;  1AUI B;  3I5G B;  1ZMZ A;  2H8V A;  4C0L A;  1XVJ A;  2MHH A;  5ER4 X;  4YGC B;  1XFX O;  2BE4 A;  1F70 A;  1BT6 A;  2FJU B;  3CGA A;  5DKR A;  4UPG A;  4AQJ A;  1CDN A;  1J7P A;  1W9Z A;  2JNX A;  3R1P A;  1DF0 B;  1KSO A;  2KYF A;  3AKA A;  1OOI X;  1LKJ A;  1TOP A;  1IRJ A;  1B1G A;  1S6C A;  2EGD A;  1L2O B;  2E30 A;  2MRD A;  2CTN A;  3S0B A;  3TS5 C;  3R1O A;  3D73 A;  3SIB A;  1Y1U A;  1WLZ A;  1MQ1 A;  4FTG A;  1J55 A;  3VRN A;  3BUN B;  3OP0 A;  1NCX A;  2P70 A;  1KFU S;  4PHK A;  2LUX A;  1CDP A;  2JTT A;  1V1G A;  1N0Y A;  2KFG A;  2K7O A;  1NCY A;  1DJZ A;  2QEO A;  5HKW A;  2ZKM X;  1UHI A;  3JTD C;  3K1E A;  3PN7 B;  1ORG A;  4GUK A;  5HYD A;  2OTG B;  1PSR A;  2LVV A;  2MLE C;  3LLE A;  1PSB A;  1H4B A;  3L47 A;  2SAS A;  4U8D A;  1NSH A;  1TNP A;  4GPL B;  4IJ7 A;  2M49 B;  2KOT A;  3BFH A;  1IQ5 A;  4NQG A;  3BUX B;  1F54 A;  2JT0 A;  3VRO A;  1YUT A;  1M31 A;  5I2O A;  1S36 A;  2MBX A;  3DD4 A;  1AK8 A;  2HPS A;  1DC1 A;  4XJK A;  3O6B A;  1C07 A;  1EL4 A;  1U5I B;  3BQ3 A;  1YTZ C;  3BFB A;  2BCA A;  2LCP A;  2I18 A;  2AUC A;  2BKI B;  2HQW A;  2KNE A;  4ORB B;  1FBV A;  1B8L A;  3D0Y A;  4P2Y B;  3SIA A;  4BY5 A;  3K21 A;  1G33 A;  1WLM A;  2FOT A;  2KHN A;  1CTR A;  1QIW A;  1SCM B;  1YVH A;  2FJY A;  2JNF A;  2WCH A;  3D10 A;  3NHI A;  2LLT A;  3R72 A;  1DEK A;  2LM5 A;  3ICB A;  4MRX A;  2MLF C;  1B8R A;  5HLO A;  1S26 D;  1KSM A;  1FPW A;  1TUZ A;  1OOH A;  1ZFS A;  2BCB A;  5HL1 A;  1YR5 A;  4JD9 A;  3DYE A;  4WQ3 A;  3FWC A;  3VRQ A;  2PAL A;  5JJG A;  1KK7 Z;  5D69 A;  1QVI Z;  1MXL C;  3RM1 A;  2V53 A;  3PM8 A;  3FE9 A;  2LVK A;  1ODB A;  1C7V A;  1KQM C;  5KU1 A;  4MVF A;  3V2L A;  3EK4 A;  2BL0 B;  1WDC B;  5FI7 A;  1DJG A;  3OGN A;  4GGN A;  2PSR A;  1PAL A;  2LHL A;  5F6T A;  2QPT A;  2LHI A;  1TN4 A;  3QRX A;  1QLK A;  3GOF A;  3BOW B;  4JPZ B;  4HSZ A;  5FI2 A;  3SG5 A;  1CM4 A;  1QJT A;  3D74 A;  1OOG A;  4YI9 A;  3TDU A;  1KQV A;  4GNK B;  1CDL A;  2NXQ A;  3FE6 A;  1NIW A;  2K8M B;  3KHE A;  2LAP A;  1DGU A;  1Z4H A;  1OZS A;  4YI8 A;  2LUC A;  1OOF A;  2KYC A;  2L5Y A;  3OHM B;  2LMT A;  1DVI A;  3F45 A;  1B8C A;  5CSJ A;  3S0G A;  3FE8 A;  1L7Z A;  3GK4 X;  2BBN A;  4DCK A;  2F2P A;  4HRG A;  1ZOT B;  2KBM A;  1GM0 A;  3CTN A;  1CFP A;  5PAL A;  2QEB A;  3LK0 A;  1BR4 B;  4L9M A;  2M0R A;  2JTZ A;  2PRU A;  4M2Q A;  3M0W A;  1BOC A;  1KQM B;  1M45 A;  1NPQ A;  4OR9 B;  1MUX A;  3NXA A;  3LCP C;  1P28 A;  1V1F A;  1S1E A;  5TNC A;  1RTP 1;  2KDH A;  1A2X A;  1F8H A;  1WY9 A;  3NSO A;  1LA0 A;  1Y6W A;  1KK8 B;  3TZ1 A;  1DT7 B;  1SNL A;  2WCJ A;  2WOS A;  5FYX A;  5D7F A;  1H8B A;  1MF8 B; 
#chains in the Genus database with same CATH homology
 1IJ6 A;  5ER5 A;  1MHO A;  2JRF A;  3PSR A;  1Y0V H;  4GFT A;  4P5O E;  1QAS A;  3DVE A;  1S6J A;  2RGI A;  4DRW A;  2JOJ A;  1SW8 A;  4ICB A;  2WCB A;  2GGZ A;  5HKY A;  1S5G Y;  2L5X B;  4PHN A;  5G08 A;  4CFR A;  1DF0 A;  3IQQ A;  3TUY C;  1D1O A;  2KI4 B;  1LIN A;  1TNQ A;  1PUL A;  1A75 B;  3CR2 A;  3TDI A;  4E68 A;  4MRY A;  2K7B A;  1Q80 A;  2D8N A;  4C0J A;  1YX7 A;  4ZCU A;  4DUQ A;  2H2K A;  1K95 A;  4AOM A;  3BXK A;  4YGE B;  1S3P A;  1OSA A;  3O4Y A;  4MSP A;  4PE7 A;  2E6W A;  1SR6 C;  3RLZ A;  1NX0 A;  2NCP A;  2JC2 A;  2KI6 D;  2KQ6 A;  3OB1 B;  4PHM A;  1XA5 A;  4HRE E;  5HLV A;  3I5I C;  1AJ4 A;  1NX1 A;  2SCP A;  1F55 A;  2QAC A;  3E3R A;  3KO0 A;  1XFY O;  4WRI A;  4YBH B;  4USL A;  1AP4 A;  1FF1 A;  2AMI A;  4OKH A;  1CKK A;  4OCI A;  1JFK A;  5AAN A;  3CS1 A;  3PLF B;  4QJ3 B;  4DS7 A;  1F4O A;  2F3Y A;  1FI5 A;  2F3Z A;  2KAX A;  2M1K B;  2LNK A;  2TN4 A;  2LP3 A;  2L2E A;  1U5I A;  2PAS A;  3FWB A;  2ZN9 A;  1XFV O;  1IJ5 A;  3OX5 A;  3I5H C;  2LE9 B;  2WCE A;  3EK8 A;  1FW4 A;  1JBA A;  1DJH A;  2L51 A;  1PRW A;  3VRR A;  3EK7 A;  3GK2 A;  1SR6 B;  1YUU A;  4I5L B;  2EC6 C;  1BR1 B;  4XYN A;  3TS5 B;  2JXC A;  1REC A;  1QS7 A;  2A4J A;  1QV1 A;  1TTX A;  4PE4 A;  4ETO A;  1W7J B;  2KGR A;  4FQO A;  4MN0 A;  2OS8 C;  2JUL A;  3TDZ A;  4D1E A;  1DJY A;  4C0K A;  1NX3 A;  1JFJ A;  3SJS A;  1EXR A;  3JTD B;  1KWO C;  4NDD A;  2PVB A;  4PAL A;  1K8U A;  4N5X A;  2K61 A;  4M2O A;  3EVU A;  4BY4 A;  1YUS A;  3AAK A;  4ORA B;  5CSI A;  1LVC D;  5J3X A;  2BE6 A;  4QJ5 B;  1NP8 A;  5K89 A;  1GGZ A;  1TRF A;  2I94 A;  4PHJ A;  1QTX A;  4HRH A;  2JQ6 A;  4GAO A;  2COL B;  2FCE A;  1UUS A;  5AEQ A;  2NCO A;  5KTY A;  2Y5I A;  4XJK B;  3I5H B;  2WC8 A;  1K93 D;  2BEC A;  1NX2 A;  1J7R A;  2F33 A;  2LC5 A;  1LA3 A;  2P6B B;  3D0Y B;  5CSN A;  3A8R A;  4IL1 A;  2VRG A;  1S5G Z;  3JVT C;  1AJ5 A;  2LAN A;  3LK1 A;  1SL8 A;  1W7I B;  3WHT B;  1J1D A;  1HT9 A;  2G2B A;  3SG4 A;  1ZUZ A;  1TCO B;  3KF9 A;  2PMY A;  1MXE A;  2JT8 A;  3BUO B;  1RFJ A;  5BPJ A;  1QIV A;  1S6I A;  2ZRT A;  2K7C A;  1SYM A;  3C1V A;  3DF0 B;  1K2H A;  2KSP A;  1CLL A;  1K90 D;  4GBA A;  4PE1 A;  1DJX A;  2EHB A;  2Y1M A;  1RWY A;  2L0P A;  2WOR A;  2M1U A;  1FI6 A;  2HET A;  3HX4 A;  1OMV A;  2CNP A;  4PCW A;  4YGB B;  3EKH A;  4I5J A;  1GGW A;  2LLS A;  3OX6 A;  2MA2 A;  4AQI A;  1UWO A;  3FIA A;  1UP5 A;  2NZ0 A;  1Y1X A;  2F8P A;  4PDZ A;  2KAV A;  1CB1 A;  4MZJ A;  5GQQ C;  2L50 A;  2R2I A;  2LLU A;  4Q04 A;  3SG3 A;  1NCZ A;  3O2P A;  2M97 A;  4TNC A;  1MWN A;  1F4Q A;  2JXL A;  2LV7 A;  2Y4Q A;  3ZWH A;  3NSL A;  4I5K A;  4JQ0 D;  1CM1 A;  1SL9 A;  3A4U B;  2K2F A;  3VGO A;  1A75 A;  4JWQ A;  1NUB A;  1IH0 A;  3KEV A;  2FCD A;  1L2O C;  1ALW A;  1YUR A;  2WND A;  4CID A;  1WRK A;  1SRA A;  4MLW A;  3I5F C;  1XFZ O;  1GQM A;  2BBM A;  1DTL A;  1IG5 A;  4NDC A;  1K94 A;  1QXP A;  3H4S E;  3O78 A;  1PVB A;  2DOQ A;  2I7A A;  2LVJ A;  2M8U A;  1OMD A;  1PVA A;  1JF2 A;  1QV0 A;  4M2P A;  1IKU A;  1QLS A;  1BOD A;  3PAL A;  1YVL A;  1CMF A;  1SY9 A;  5KSZ A;  4A4C A;  3PN7 C;  1ZAC A;  2H61 C;  3DVJ A;  1Y1A A;  2OTG C;  4WQ2 A;  1BU3 A;  1XK4 C;  4YGA A;  4YGD B;  3BUW B;  1SL7 A;  2H61 A;  3WNX B;  1F71 A;  3BUM B;  3ZNI A;  1XK4 A;  1IQ3 A;  1CLB A;  1R2U A;  2HF5 A;  2LMU A;  4GGF C;  1B9A A;  1BLQ A;  1KFU L;  1UHN A;  1M46 A;  3FS7 A;  1RJV A;  1WRL A;  1WRZ A;  1PK0 D;  4GGF A;  1SCV A;  4MZL A;  1SBJ A;  1OQP A;  3HCM A;  3MSE B;  1E8A A;  2AAO A;  2MJW B;  1CNP A;  1BMO A;  1EG3 A;  3CZT X;  2KBI A;  3TUY B;  1A4P A;  2B1U A;  3I5F B;  1CFD A;  2ZFD A;  1YX8 A;  1JSA A;  1J7Q A;  1B7T Y;  2CCM A;  3DVK A;  2KAY A;  1BG1 A;  4NDB A;  4CLN A;  1SCM C;  3SG7 A;  4YRU A;  1UHH A;  1JC2 A;  4F0Z B;  1IWQ A;  1HQV A;  2K0J A;  3NSK A;  1ALV A;  1RK9 A;  1DMO A;  2BCX A;  2JZI A;  1CLM A;  3EKJ A;  3I5I B;  1RRO A;  1B4C A;  1JWD A;  1M63 B;  2KGB C;  2OPO A;  3GK1 A;  1OE9 B;  2M29 A;  4MBE A;  4PE0 A;  1CFC A;  2ZN8 A;  2O5G A;  5AXI A;  1SMG A;  1EJ3 A;  1OOJ A;  1OZO A;  2LP2 A;  2KFH A;  1QX5 B;  3CR4 X;  2CT9 A;  2ZRS A;  2BL0 C;  1EG4 A;  4OVN F;  3AAJ A;  1WDC C;  1N65 A;  1DJI A;  2Q91 A;  4MZK A;  1EH2 A;  1CDM A;  1R6P A;  2KI6 C;  2JPT A;  1CMG A;  3CWG A;  1QAT A;  1UHJ A;  1SKT A;  1AVS A;  3NSI A;  2CBL A;  3BOW A;  2L4I A;  3BYA A;  5DKN A;  2M7L A;  2ZND A;  3PAT A;  1AHR A;  5JOL A;  3DVM A;  3PFV A;  4OV2 A;  1TNX A;  1DJW A;  1TIZ A;  1C7W A;  3WXA A;  2I2R E;  2EC6 B;  1J7O A;  1YRT B;  1YRU B;  1B47 A;  2M9G A;  1XFW O;  2JU0 A;  5HKZ A;  1A03 A;  2LMV A;  2JT3 A;  2OS8 B;  3CR5 X;  3DF0 A;  5I2Q A;  2CXJ A;  4N1G A;  5B8I B;  5I2L A;  1LXF C;  1SPY A;  1XO5 A;  1KWO B;  3KPX A;  4ORC B;  1G8I A;  4CFQ A;  1UUR A;  5AFP A;  3EVR A;  1K9K A;  1XYD A;  3EVV A;  5CPV A;  1XFU O;  3WHU B;  4MEW A;  5DKQ A;  1KK8 C;  2Y1N A;  5AER A;  5I8N A;  3IQO A;  2BKH B;  2L4H A;  1NWD A;  1J1E A;  2O60 A;  4I5N B;  2K2A A;  2ZNE A;  1K9P A;  4QJ4 B;  3I5G C;  4ZCV A;  1BJF A;  1IGV A;  2LVI A;  2JWW A;  2KI4 C;  3LL8 B;  4CPV A;  3CLN A;  1GJY A;  4R1E A;  2ISD A;  2NLN A;  3JVT B;  1OMR A;  1TNW A;  2GV5 A;  1JUO A;  1CFF A;  5CSF A;  1QX7 A;  4DIR A;  2KQY A;  1VRK A;  1A29 A;  1B7T Z;  2Q4U A;  1MR8 A;  1KFX L;  1K96 A;  1KK7 Y;  1M39 A;  2M7N A;  3VRP A;  2MAZ A;  4N1F A;  1QVI Y;  3AKB A;  1K9U A;  1BF5 A;  1KCY A;  5IBW A;  1JF0 A;  3OB2 B;  1X02 A;  3IF7 A;  1DGV A;  1G4Y R;  3SG2 A;  2F2O A;  2G9B A;  2M3W A;  2WCF A;  1QX2 A;  2L98 A;  3SG6 A;  4A4B A;  2IS9 A;  2HQ8 A;  2KFF A;  1KFX S;  1TCF A;  1SK6 D;  2GGM A;  1N2D A;  1UHK A;  2K7D A;  1NYA A;  1AUI B;  3I5G B;  1ZMZ A;  4C0L A;  1XVJ A;  2MHH A;  5ER4 X;  4YGC B;  1XFX O;  2BE4 A;  1F70 A;  1BT6 A;  2FJU B;  3CGA A;  5DKR A;  4UPG A;  4AQJ A;  1CDN A;  1J7P A;  2JNX A;  1DF0 B;  1KSO A;  2KYF A;  3AKA A;  1LKJ A;  1TOP A;  1IRJ A;  1B1G A;  1S6C A;  2EGD A;  1L2O B;  2E30 A;  2MRD A;  2CTN A;  3TS5 C;  3SIB A;  1Y1U A;  1WLZ A;  1MQ1 A;  4FTG A;  1J55 A;  3VRN A;  3BUN B;  3OP0 A;  1NCX A;  1KFU S;  4PHK A;  2LUX A;  1CDP A;  2JTT A;  1V1G A;  1N0Y A;  2KFG A;  2K7O A;  1NCY A;  1DJZ A;  5HKW A;  2ZKM X;  1UHI A;  3JTD C;  4GUK A;  3PN7 B;  5HYD A;  2OTG B;  1PSR A;  2LVV A;  2MLE C;  3LLE A;  1PSB A;  1H4B A;  2SAS A;  4U8D A;  1NSH A;  1TNP A;  2M49 B;  2KOT A;  1IQ5 A;  4NQG A;  3BUX B;  1F54 A;  2JT0 A;  3VRO A;  1YUT A;  1M31 A;  5I2O A;  1S36 A;  2MBX A;  3DD4 A;  1AK8 A;  2HPS A;  1C07 A;  4XJK A;  3O6B A;  1EL4 A;  1U5I B;  3BQ3 A;  1YTZ C;  2BCA A;  2LCP A;  2I18 A;  2AUC A;  2BKI B;  2HQW A;  2KNE A;  4ORB B;  1FBV A;  1B8L A;  3D0Y A;  4P2Y B;  3SIA A;  4BY5 A;  3K21 A;  1G33 A;  1WLM A;  2FOT A;  2KHN A;  1CTR A;  1QIW A;  1SCM B;  1YVH A;  2JNF A;  3D10 A;  4GPL B;  2LLT A;  2LM5 A;  3ICB A;  4MRX A;  2MLF C;  1B8R A;  5HLO A;  1S26 D;  1KSM A;  1FPW A;  1ZFS A;  2BCB A;  1YR5 A;  4WQ3 A;  3FWC A;  3VRQ A;  2PAL A;  5JJG A;  1KK7 Z;  5D69 A;  1QVI Z;  1MXL C;  3RM1 A;  2V53 A;  3PM8 A;  2LVK A;  1ODB A;  1C7V A;  1KQM C;  5KU1 A;  4MVF A;  3EK4 A;  2BL0 B;  1WDC B;  1DJG A;  4GGN A;  2PSR A;  1PAL A;  2LHL A;  5F6T A;  2QPT A;  2LHI A;  1TN4 A;  3QRX A;  1QLK A;  3GOF A;  3BOW B;  4JPZ B;  4HSZ A;  3SG5 A;  1CM4 A;  1QJT A;  4YI9 A;  3TDU A;  1KQV A;  4GNK B;  1CDL A;  2NXQ A;  3KHE A;  1NIW A;  2K8M B;  2LAP A;  1DGU A;  1OZS A;  4YI8 A;  2LUC A;  2KYC A;  3OHM B;  2LMT A;  1DVI A;  3F45 A;  1B8C A;  5CSJ A;  1L7Z A;  3GK4 X;  2BBN A;  4DCK A;  2F2P A;  4HRG A;  1ZOT B;  2KBM A;  3CTN A;  1CFP A;  5PAL A;  3LK0 A;  1BR4 B;  4L9M A;  2M0R A;  2JTZ A;  2PRU A;  4M2Q A;  3M0W A;  1BOC A;  1KQM B;  1M45 A;  1NPQ A;  4OR9 B;  1MUX A;  3NXA A;  3LCP C;  1V1F A;  1S1E A;  5TNC A;  1RTP 1;  2KDH A;  1A2X A;  1F8H A;  1WY9 A;  3NSO A;  1LA0 A;  1Y6W A;  1KK8 B;  3TZ1 A;  1DT7 B;  1SNL A;  2WOS A;  5FYX A;  5D7F A;  1H8B A;  1MF8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...