3NSKA

Crystal structure of the post-refolded s100a3 r51a mutant expressed in insect cell
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
91
structure length
91
Chain Sequence
RPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFAECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A3
publication title Refined crystal structures of human Ca(2+)/Zn(2+)-binding S100A3 protein characterized by two disulfide bridges
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 30
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3nskA00
1VRKA 4QJ3B 5D69A 1SNLA 2I94A 2BCBA 2M7LA 1JFKA 3E3RA 2KI4B 1QV1A 1C07A 1MUXA 1K96A 4WRIA 1B8RA 2JT3A 2JC2A 1PK0D 1K9PA 4JPZB 2KQYA 2JQ6A 3AAJA 4I5JA 1RECA 2AUCA 2L98A 3EVRA 2CNPA 2BL0C 4YI9A 5CSJA 2LUXA 4I5LB 5FYXA 1JSAA 1MXEA 1KQMC 1K2HA 1RTP1 2K7DA 4DCKA 1DTLA 2Y4QA 3D10A 4QJ5B 2MLEC 2L2EA 1K90D 4M2OA 2G2BA 1TN4A 1LXFC 3I5HB 5HLOA 1CKKA 1NPQA 1JBAA 2KFGA 1LINA 2EHBA 5DKNA 4M2QA 3PLFB 3CLNA 1UURA 2ISDA 4P2YB 3JTDB 1XO5A 2JXLA 2EC6B 1BLQA 2M8UA 4HREE 2LMTA 2Y5IA 2K0JA 4PE1A 5D7FA 5CSNA 1TCFA 1Y0VH 2G9BA 4BY4A 1KK8C 1DJIA 1UWOA 1S1EA 1KQVA 2LVJA 2JTTA 1RJVA 1PSBA 2MA2A 3TDZA 3DD4A 2L4HA 3PATA 4YGCB 2I7AA 3IQOA 4CIDA 3CZTX 4D1EA 1FI6A 4WQ2A 1UP5A 2NCOA 5ER5A 4A4CA 1TNWA 4GUKA 3ZNIA 3LCPC 4YRUA 3FS7A 3LK0A 1FW4A 4OVNF 1DJWA 5I2LA 1CM4A 4ETOA 2FJUB 4ORAB 1S6IA 3VROA 2HF5A 1QS7A 1H4BA 1DVIA 2LV7A 2LVVA 1WY9A 2LCPA 1BF5A 2A4JA 1TCOB 1B8LA 2HQ8A 1BMOA 1AP4A 4CFRA 2D8NA 1A29A 3TDUA 4YGEB 2MJWB 1SRAA 1BODA 2ZNDA 2OTGC 5BPJA 1ZMZA 4NDCA 3AKAA 4PE7A 2M97A 5HLVA 4PHNA 3I5FC 1TIZA 1YX8A 2Y1NA 3CS1A 3H4SE 2LMUA 1S3PA 1S36A 1JFJA 3RLZA 2LP2A 1NYAA 1B8CA 1IH0A 3PFVA 2LANA 5TNCA 1PSRA 1DF0A 2F3ZA 1BJFA 1WDCB 2K2AA 2KI6D 2ZN8A 2P6BB 2WORA 1LKJA 1FF1A 2CCMA 3SG3A 4GGFC 2KYFA 2KGBC 2ZFDA 1B7TZ 1ZOTB 2V53A 1KK7Y 2ZNEA 2BECA 1KK7Z 1XFXO 2KYCA 2LLSA 2OS8B 1UHIA 2JWWA 2M1UA 5HKZA 1C7WA 1KWOC 3VGOA 4DUQA 1AVSA 1ZUZA 2PRUA 3PN7C 2JPTA 1TNPA 3BOWB 3CR2A 1CMFA 2MRDA 1L2OB 1WLMA 2LNKA 1IG5A 3FIAA 4PHKA 4Q04A 2MBXA 1QJTA 1CFCA 1AJ4A 2KGRA 3A4UB 1EXRA 2JNXA 3VRPA 4L9MA 1M39A 4N5XA 1KFXL 1YUSA 1CTRA 1A75A 3TUYC 1DJHA 1FBVA 1IRJA 2BE6A 2BKHB 2JXCA 4DS7A 2O5GA 3JVTC 1TNQA 2PMYA 4I5NB 1UHNA 2HETA 1QV0A 4PE0A 4C0LA 4QJ4B 4E68A 1IGVA 1NUBA 1K9UA 1SW8A 1OMDA 1GGWA 1PVAA 1XFVO 2BBNA 1DT7B 2BL0B 4YGBB 5J3XA 1N2DA 1OMVA 2LC5A 1KQMB 3BXKA 1DJZA 2LVIA 2R2IA 1SR6C 1Y1AA 3TS5C 1K9KA 4MZKA 2LE9B 2IS9A 5B8IB 1JC2A 1C7VA 1CB1A 1IQ5A 2LAPA 3TDIA 1F71A 3M0WA 1G8IA 1NCYA 1S6CA 3CWGA 4YBHB 5HYDA 1NSHA 2LLTA 1YURA 2ZRTA 1A75B 1M31A 2M7NA 3BUMB 4GFTA 1UHKA 1GGZA 1SCVA 5CSIA 3EKJA 2NXQA 3OHMB 1ALWA 2JZIA 4XJKA 3K21A 5PALA 2KI4C 4GNKB 1KSMA 2LUCA 2PASA 1DMOA 1NCZA 1B4CA 2FCDA 1KFUL 4AQJA 1EG4A 2MAZA 4YGDB 4MBEA 2SCPA 3AKBA 1NX0A 1QIWA 3IQQA 1G33A 1XFZO 1Y1XA 1EG3A 3BQ3A 1QASA 3CTNA 4GGNA 1AHRA 3FWBA 4OCIA 4WQ3A 5HKYA 4CPVA 1QVIY 2KQ6A 1QATA 1FI5A 1QVIZ 1N0YA 1DGVA 3DVEA 3LK1A 1CFFA 4M2PA 5I2QA 2L50A 4XJKB 3I5GC 4FTGA 2HQWA 1NCXA 3SIAA 3BUWB 2KHNA 3NXAA 3JTDC 1CLMA 2ZN9A 1XFYO 2O60A 2EC6C 4PHJA 3SG6A 1FPWA 1NX2A 2FOTA 2BCAA 1NX3A 4GGFA 3PSRA 3EK8A 1K94A 1OOJA 3O78A 3SIBA 4DRWA 2OTGB 1LA3A 1QIVA 3KO0A 3NSLA 2L0PA 1XA5A 2VRGA 1TNXA 1YUUA 3ICBA 4ZCUA 1SKTA 3DF0A 2MHHA 4N1FA 2JULA 1F55A 2KSPA 4MRYA 1YR5A 4FQOA 2ZKMX 1D1OA 3AAKA 3GK4X 1CFPA 2LMVA 2COLB 1TRFA 1TTXA 1YVLA 3KEVA 5KSZA 1QX5B 1PRWA 3O2PA 1M46A 4GPLB 1BOCA 1V1GA 4PE4A 1F8HA 2M49B 1EL4A 1GQMA 1ZFSA 3BYAA 1K93D 1BR4B 2H61C 4A4BA 1SCMB 1KWOB 2L4IA 2KNEA 1N65A 1XYDA 3OP0A 4JQ0D 2K7BA 1B7TY 2F2PA 2NLNA 3LL8B 4USLA 3BUXB 1G4YR 1SMGA 1XK4C 2PSRA 5AANA 3OB2B 4P5OE 1SL9A 4MZLA 1NWDA 1MQ1A 2KBMA 3TUYB 4C0JA 1SY9A 1M45A 1B9AA 3DF0B 3JVTB 3PM8A 3I5IB 1W7JB 1A2XA 2KAYA 1A03A 2LHLA 2M29A 3EVUA 1OZSA 3EK4A 1PVBA 1SL8A 1QX7A 1SBJA 4ICBA 2B1UA 3VRNA 1AK8A 1NIWA 3WHUB 1JF2A 5I2OA 4R1EA 2L51A 2LHIA 3KPXA 1DF0B 2K8MB 5DKRA 1YRUB 2CTNA 3LLEA 2L5XB 2PVBA 5KU1A 1SK6D 2RGIA 2KAXA 4MN0A 3GK2A 4BY5A 1S6JA 3QRXA 3VRQA 2WOSA 4CLNA 1TOPA 1YTZC 3IF7A 2JNFA 4U8DA 1WRKA 1F4QA 2M0RA 2H2KA 1KFXS 3O4YA 1L2OC 1NP8A 1ZACA 2F3YA 2WNDA 3BUOB 3D0YA 4PDZA 5IBWA 1WLZA 5DKQA 4F0ZB 1CLBA 3DVKA 1CMGA 4UPGA 3KHEA 2QPTA 4I5KA 3EKHA 1JWDA 2M3WA 2Q4UA 3F45A 3CGAA 1M63B 1JF0A 1MF8B 1QXPA 1UUSA 4MEWA 1XFUO 4NQGA 2E6WA 4HRHA 1MXLC 1YUTA 1L7ZA 3SG5A 1UHJA 2F2OA 4MZJA 1CDLA 5CPVA 5I8NA 2NCPA 1KK8B 1S5GY 2HPSA 2KAVA 1S5GZ 1A4PA 3BUNB 3RM1A 2JOJA 3NSKA 5JJGA 1J1EA 3KF9A 1J7RA 1KCYA 1LA0A 1OSAA 1ALVA 1F70A 5G08A 3D0YB 5GQQC 1CM1A 3HX4A 2JRFA 3I5GB 3VRRA 4AQIA 1B47A 1CDPA 3I5HC 2EGDA 3A8RA 1EH2A 2K2FA 3NSOA 1CFDA 2K7OA 1SPYA 2KI6C 1KFUS 1PALA 2AMIA 4TNCA 3WHTB 2BE4A 1QTXA 1J55A 1QLSA 1K8UA 1CDMA 1WRLA 2F33A 2I2RE 3DVJA 3GK1A 3OX5A 1CNPA 1DJGA 2WCEA 1JUOA 1CDNA 2H61A 3SJSA 4NDBA 1K95A 3MSEB 1E8AA 1WRZA 3OX6A 1W7IB 4YI8A 4NDDA 3DVMA 2JTZA 1XK4A 1RROA 1J1DA 2DOQA 2E30A 5F6TA 4DIRA 2GV5A 4CFQA 2GGZA 3EVVA 1DJXA 2KDHA 1CLLA 1Y6WA 3I5FB 1ODBA 1F54A 2GGMA 2K7CA 1DJYA 2F8PA 1KSOA 3SG7A 2KOTA 2CXJA 1H8BA 2AAOA 2JT0A 3PALA 1QX2A 1RFJA 4AOMA 3TZ1A 1F4OA 1BG1A 1R2UA 2NZ0A 2SASA 1IQ3A 2LVKA 5ER4X 5AFPA 4OV2A 2I18A 2BKIB 1OMRA 3C1VA 3SG2A 1BR1B 1GJYA 4ZCVA 4OR9B 1XVJA 2KFHA 4MSPA 1YX7A 3WXAA 3SG4A 1U5IA 1BU3A 3WNXB 1Y1UA 1SL7A 2Y1MA 2JT8A 3CR4X 1IJ5A 4ORCB 5JOLA 1J7QA 2ZRSA 3BOWA 1HT9A 1Q80A 1MHOA 3PN7B 3EK7A 4N1GA 2BBMA 4MLWA 1HQVA 4GBAA 2BCXA 2Q91A 4PHMA 1AUIB 2JU0A 2WCBA 1NX1A 4YGAA 4HRGA 1DGUA 1MWNA 2CBLA 5CSFA 4MVFA 2KBIA 5AEQA 2M9GA 1J7OA 1YRTB 1OQPA 1XFWO 1OZOA 2FCEA 4GAOA 4JWQA 4ORBB 1UHHA 2LP3A 3OB1B 1RK9A 5KTYA 3GOFA 1BT6A 2OPOA 2CT9A 1V1FA 3ZWHA 3HCMA 2KFFA 3NSIA 1LVCD 5HKWA 1QLKA 1IWQA 4OKHA 1SYMA 1J7PA 1OE9B 1WDCC 1RWYA 5K89A 1EJ3A 3O6BA 4C0KA 1SR6B 1SCMC 1U5IB 1IJ6A 4XYNA 4MRXA 1S26D 3TS5B 1X02A 2M1KB 4IL1A 4HSZA 2PALA 2WC8A 1MR8A 4PALA 2WCFA 2OS8C 2QACA 2LM5A 2TN4A 1YVHA 5AERA 2MLFC 1B1GA 1R6PA 4PCWA 5AXIA 1AJ5A 2LLUA 2K61A 1IKUA 3FWCA 1PULA 3CR5X 3I5IC
chains in the Genus database with same CATH superfamily
1VRKA 4QJ3B 5D69A 1SNLA 2L5YA 2I94A 1LS8A 2BCBA 2M7LA 1JFKA 3E3RA 2PQLA 2KI4B 1QV1A 3SS3A 3VB1A 1C07A 1MUXA 1K96A 4WRIA 1B8RA 2JT3A 2JC2A 1PK0D 1K9PA 4JPZB 5HL1A 2KQYA 2JQ6A 3AAJA 4I5JA 1RECA 2AUCA 2L98A 3EVRA 2CNPA 2BL0C 4YI9A 5CSJA 2LUXA 4I5LB 5FYXA 1JSAA 1MXEA 1KQMC 1K2HA 1RTP1 2WCJA 2K7DA 4DCKA 1DTLA 2Y4QA 3D10A 3NHIA 2MLEC 4QJ5B 2L2EA 1K90D 4M2OA 2G2BA 1TN4A 1LXFC 3I5HB 5HLOA 1CKKA 1NPQA 1JBAA 2KFGA 1LINA 2EHBA 5DKNA 4M2QA 3PLFB 3CLNA 1UURA 4IJ7A 4P2YB 2ISDA 3L47A 3JTDB 1XO5A 2JXLA 2EC6B 1BLQA 2M8UA 4HREE 2LMTA 2Y5IA 2K0JA 4PE1A 5D7FA 5CSNA 1TCFA 1Y0VH 2G9BA 4BY4A 1KK8C 1DJIA 1DC1A 1UWOA 1S1EA 1KQVA 2LVJA 2JTTA 1RJVA 1PSBA 2MA2A 3TDZA 3DD4A 2L4HA 3PATA 4YGCB 2I7AA 3IQOA 4CIDA 3CZTX 4D1EA 1FI6A 4WQ2A 1UP5A 2NCOA 5ER5A 4A4CA 1TNWA 4FQTA 4GUKA 3ZNIA 3LCPC 4YRUA 3FS7A 3LK0A 1FW4A 3CABA 4OVNF 1DJWA 5I2LA 1CM4A 4ETOA 2FJUB 4ORAB 1S6IA 3VROA 2HF5A 1QS7A 1H4BA 2KLDA 1DVIA 2LV7A 3D74A 2LVVA 1WY9A 2LCPA 1BF5A 2A4JA 1TCOB 1B8LA 2HQ8A 3OGNA 1BMOA 1AP4A 4CFRA 2D8NA 1A29A 3TDUA 4YGEB 2MJWB 1SRAA 1BODA 2WCKA 2ZNDA 2OTGC 4ORBB 5BPJA 1ZMZA 4NDCA 3AKAA 4PE7A 2M97A 5HLVA 4PHNA 3I5FC 1TIZA 1YX8A 2Y1NA 3CS1A 3H4SE 2LMUA 1S3PA 1S36A 1JFJA 3RLZA 2LP2A 1NYAA 1B8CA 3SS4A 1IH0A 4INWA 3PFVA 2P70A 2LANA 3R1PA 5TNCA 1PSRA 1DF0A 2F3ZA 1BJFA 1WDCB 2K2AA 2KI6D 2ZN8A 2P6BB 2WORA 3R1OA 1LKJA 5FI7A 2PYQA 1FF1A 2CCMA 3SG3A 4GGFC 2KYFA 2KGBC 1C3ZA 1B7TZ 1ZOTB 2V53A 1KK7Y 2ZFDA 2BECA 2ZNEA 3B87A 1KK7Z 1XFXO 2KYCA 2LLSA 2OS8B 1UHIA 2JWWA 2M1UA 5HKZA 1C7WA 1KWOC 3B88A 3VGOA 4DUQA 1AVSA 3EG5B 1ZUZA 2PRUA 3PN7C 2JPTA 1TNPA 3BOWB 3CR2A 1CMFA 2MRDA 1L2OB 1WLMA 2LNKA 1IG5A 3FIAA 4PHKA 4Q04A 2MBXA 1QJTA 2WCMA 1AJ4A 2KGRA 3A4UB 3S0AA 1EXRA 1TWOA 2JNXA 1CFCA 1OOGA 4L9MA 3VRPA 1M39A 4N5XA 1KFXL 1YUSA 3BFHA 1CTRA 1A75A 3TUYC 1DJHA 1FBVA 1IRJA 2BE6A 2BKHB 2JXCA 4DS7A 2O5GA 3JVTC 4INXA 5D3OA 1TNQA 3CZ2A 2PMYA 4I5NB 1UHNA 2HETA 1QV0A 4PE0A 4C0LA 4QJ4B 4E68A 1IGVA 1NUBA 1K9UA 1Z4HA 1Z2CB 1SW8A 1OMDA 1GGWA 1PVAA 1XFVO 2BBNA 1DT7B 2BL0B 4YGBB 5J3XA 1N2DA 3DXLA 1OMVA 1W9ZA 2LC5A 5FI2A 1KQMB 2KPHA 3BXKA 1DJZA 2LVIA 2R2IA 1SR6C 1Y1AA 3S0DA 3TS5C 1K9KA 4MZKA 2LE9B 2IS9A 5B8IB 1JC2A 1C7VA 1CB1A 1IQ5A 1T14A 2LAPA 3TDIA 3B7AA 1F71A 3M0WA 1G8IA 1NCYA 1S6CA 3CWGA 4YBHB 5HYDA 1NSHA 2LLTA 3SS5A 1YURA 2ZRTA 2WC5A 5EL2A 1A75B 1M31A 2M7NA 3BUMB 4GFTA 1UHKA 1GGZA 1SCVA 5CSIA 3EKJA 2NXQA 3OHMB 1ALWA 2JZIA 4XJKA 3K21A 5PALA 2KI4C 4GNKB 1KSMA 2LUCA 2PASA 2L2CA 1DMOA 1NCZA 1B4CA 2FCDA 1KFUL 4AQJA 1EG4A 2MAZA 4YGDB 4MBEA 2SCPA 3AKBA 1NX0A 5DICA 1QIWA 3IQQA 3PM2A 1G33A 1XFZO 1Y1XA 1EG3A 3BQ3A 1QASA 3NGVA 3CTNA 3N7HA 1AHRA 3FWBA 4GGNA 4OCIA 4WQ3A 5HKYA 4CPVA 1QVIY 2KQ6A 1QATA 3O4XA 1QVIZ 1N0YA 1DGVA 1FI5A 3UNWA 3DVEA 3LK1A 1CFFA 3CZ0A 1OW4A 2BAPA 4M2PA 5I2QA 2L50A 4XJKB 3I5GC 3D77A 2HQWA 4FTGA 2P71A 1NCXA 2ERBA 3SIAA 3BUWB 2KHNA 3NXAA 3JTDC 1CLMA 2ZN9A 1XFYO 2O60A 2EC6C 4PHJA 1P28A 3SG6A 1FPWA 1NX2A 2FOTA 2BCAA 1DEKA 1NX3A 4GGFA 3PSRA 3NHTA 3EK8A 1K94A 1OOJA 3FE6A 3O78A 3SIBA 4DRWA 3PJIA 2OTGB 1LA3A 1QIVA 3KO0A 1OOFA 3NSLA 2L0PA 1XA5A 2VRGA 1TNXA 1YUUA 3ICBA 4ZCUA 3BJHA 1DQEA 1SKTA 3DF0A 2MHHA 4N1FA 2JULA 4PT1A 1F55A 2KSPA 4MRYA 1YR5A 4FQOA 2ZKMX 1D1OA 3AAKA 3GK4X 1CFPA 2LMVA 2QEHA 2COLB 1TRFA 1TTXA 1YVLA 3KEVA 5KSZA 4KYNA 1QX5B 1PRWA 3O2PA 1M46A 4GPLB 1BOCA 1V1GA 4PE4A 1F8HA 2M49B 1EL4A 1GQMA 1ZFSA 3B6XA 3BYAA 1K93D 1BR4B 2H61C 4A4BA 1SCMB 1KWOB 2L4IA 2KNEA 1N65A 1OOIX 1XYDA 3OP0A 4JQ0D 2K7BA 1B7TY 2F2PA 2NLNA 3LL8B 4USLA 1ORGA 3BUXB 1G4YR 1SMGA 1XK4C 2PSRA 5AANA 3OB2B 4P5OE 1SL9A 4MZLA 1NWDA 1MQ1A 2KBMA 3TUYB 4F7FA 4C0JA 1SY9A 1M45A 1B9AA 3DF0B 3JVTB 2YGUA 3I5IB 3PM8A 1W7JB 1A2XA 2KAYA 1A03A 2LHLA 2M29A 3EVUA 1OZSA 3EK4A 3D76A 1PVBA 2K60A 1SL8A 1QX7A 1SBJA 4ICBA 3S0GA 1C3YA 2B1UA 3VRNA 1AK8A 1NIWA 3WHUB 1JF2A 1TUJA 5I2OA 4R1EA 2L51A 2LHIA 3KPXA 1DF0B 2K8MB 3S0EA 5DKRA 1YRUB 2CTNA 3LLEA 2L5XB 2PVBA 5KU1A 1SK6D 2RGIA 2KAXA 4MN0A 3GK2A 4BY5A 1S6JA 3QRXA 3VRQA 2WOSA 4CLNA 1TOPA 1YTZC 3IF7A 2JNFA 4U8DA 1WRKA 3D73A 1F4QA 2M0RA 2H2KA 1KFXS 3O4YA 1L2OC 1NP8A 1ZACA 2F3YA 2JPOA 2WNDA 3BUOB 3D0YA 4PDZA 5IBWA 1WLZA 1IIOA 5DKQA 4F0ZB 1CLBA 3DVKA 1CMGA 4UPGA 3KHEA 2QPTA 4I5KA 3EKHA 1JWDA 2M3WA 2Q4UA 3F45A 3CGAA 4JKTA 1M63B 1JF0A 1MF8B 2QEOA 1QXPA 1UUSA 4MEWA 3RZSA 1XFUO 4NQGA 2E6WA 2WCLA 4HRHA 1MXLC 1YUTA 1L7ZA 2QEBA 3SG5A 1UHJA 2F2OA 3BFAA 4MZJA 1CDLA 3K1EA 5CPVA 2QEVA 5I8NA 2NCPA 1KK8B 1S5GY 2HPSA 2KAVA 1S5GZ 1A4PA 3BUNB 3RM1A 4JD9A 2JOJA 3NSKA 5I94A 5JJGA 1J1EA 3KF9A 1J7RA 1KCYA 1LA0A 1OSAA 1ALVA 1F70A 5G08A 3D0YB 5GQQC 3Q8IA 1CM1A 3HX4A 2JRFA 3I5GB 3VRRA 4AQIA 1B47A 1CDPA 3I5HC 2EGDA 3A8RA 1QWVA 1EH2A 2K2FA 3NSOA 1CFDA 2K7OA 1SPYA 2KI6C 1KFUS 1OOHA 1PALA 2AMIA 4TNCA 3WHTB 2BE4A 1QTXA 3QMEA 3DYEA 1J55A 1QLSA 1K8UA 1CDMA 1WRLA 2F33A 2I2RE 3DVJA 3GK1A 3OX5A 1CNPA 1DJGA 2WCEA 1JUOA 4OZDA 1CDNA 2H61A 3SJSA 1GM0A 4NDBA 1K95A 3MSEB 1E8AA 1WRZA 3DY9A 3OX6A 1W7IB 4YI8A 4NDDA 3DVMA 2JTZA 1XK4A 3FE9A 1RROA 1J1DA 2DOQA 2E30A 5F6TA 3B86A 4DIRA 2GV5A 4CFQA 2GGZA 3EVVA 1DJXA 2KDHA 1CLLA 1Y6WA 3I5FB 2WCHA 1ODBA 1F54A 2GGMA 3D78A 3CDNA 3R1VA 2K7CA 3R72A 5KTYA 1DJYA 3L4LA 2F8PA 1KSOA 3SG7A 2KOTA 2CXJA 1XFRA 1H8BA 2AAOA 2JT0A 3CZ1A 3PALA 1QX2A 1RFJA 4AOMA 3D75A 3L4AA 3TZ1A 1F4OA 1BG1A 1R2UA 2NZ0A 2SASA 1IQ3A 2LVKA 5ER4X 5AFPA 4OV2A 2I18A 2BKIB 3CYZA 1OMRA 3C1VA 3SG2A 1BR1B 2QDIA 1GJYA 4ZCVA 4OR9B 1XVJA 2KFHA 4MSPA 1YX7A 3WXAA 1TUZA 3SG4A 1U5IA 1BU3A 3WNXB 1Y1UA 1SL7A 2FJYA 2JT8A 2Y1MA 1IJ5A 3CR4X 3IVTA 4ORCB 5JOLA 1J7QA 2ZRSA 3BOWA 1HT9A 1Q80A 1MHOA 3PN7B 3EK7A 4N1GA 2BBMA 2KLEA 1HQVA 4GBAA 4MLWA 2BCXA 2Q91A 4PHMA 1AUIB 1DELA 2JU0A 2WCBA 1NX1A 4YGAA 4HRGA 1DGUA 1MWNA 2CBLA 5CSFA 4MVFA 2H8VA 2KBIA 2M9GA 5AEQA 1J7OA 1YRTB 1OQPA 1XFWO 1OZOA 2FCEA 3FE8A 4GAOA 4JWQA 1UHHA 2LP3A 3OB1B 1RK9A 3BFBA 3GOFA 1BT6A 2OPOA 3V2LA 2CT9A 1V1FA 2GTEA 3ZWHA 3HCMA 3UO9A 2KFFA 3OBVA 2WC6A 1SSEB 3NSIA 5FI6A 1LVCD 5HKWA 1QLKA 1IWQA 4OKHA 1SYMA 1J7PA 1OE9B 1WDCC 1RWYA 5K89A 1EJ3A 3O6BA 4C0KA 1SR6B 1SCMC 1U5IB 1IJ6A 4XYNA 4MRXA 1S26D 3TS5B 1X02A 2M1KB 4IL1A 4HSZA 2PALA 2WC8A 1MR8A 4PALA 3S0FA 2WCFA 2OS8C 2QACA 2LM5A 2TN4A 1YVHA 5AERA 2MLFC 1B1GA 1R6PA 4PCWA 5AXIA 1AJ5A 2LLUA 2K61A 1IKUA 2BNXA 3FWCA 3DZTA 1PULA 3S0BA 3CR5X 3I5IC
chains in the Genus database with same CATH topology
1VRKA 4QJ3B 5D69A 1SNLA 2I94A 2BCBA 2M7LA 1JFKA 3E3RA 2KI4B 1QV1A 1C07A 1MUXA 1K96A 4WRIA 1B8RA 2JT3A 2JC2A 1PK0D 1K9PA 4JPZB 2KQYA 2JQ6A 3AAJA 4I5JA 1RECA 2AUCA 2L98A 3EVRA 2CNPA 2BL0C 4YI9A 5CSJA 2LUXA 4I5LB 5FYXA 1JSAA 1MXEA 1KQMC 1K2HA 1RTP1 2K7DA 4DCKA 1DTLA 2Y4QA 3D10A 4QJ5B 2MLEC 2L2EA 1K90D 4M2OA 2G2BA 1TN4A 1LXFC 3I5HB 5HLOA 1CKKA 1NPQA 1JBAA 2KFGA 1LINA 2EHBA 5DKNA 4M2QA 3PLFB 3CLNA 1UURA 2ISDA 4P2YB 3JTDB 1XO5A 2JXLA 2EC6B 1BLQA 2M8UA 4HREE 2LMTA 2Y5IA 2K0JA 4PE1A 5D7FA 5CSNA 1TCFA 1Y0VH 2G9BA 4BY4A 1KK8C 1DJIA 1UWOA 1S1EA 1KQVA 2LVJA 2JTTA 1RJVA 1PSBA 2MA2A 3TDZA 3DD4A 2L4HA 3PATA 4YGCB 2I7AA 3IQOA 4CIDA 3CZTX 4D1EA 1FI6A 4WQ2A 1UP5A 2NCOA 5ER5A 4A4CA 1TNWA 4GUKA 3ZNIA 3LCPC 4YRUA 3FS7A 3LK0A 1FW4A 4OVNF 1DJWA 5I2LA 1CM4A 4ETOA 2FJUB 4ORAB 1S6IA 3VROA 2HF5A 1QS7A 1H4BA 1DVIA 2LV7A 2LVVA 1WY9A 2LCPA 1BF5A 2A4JA 1TCOB 1B8LA 2HQ8A 1BMOA 1AP4A 4CFRA 2D8NA 1A29A 3TDUA 4YGEB 2MJWB 1SRAA 1BODA 2ZNDA 2OTGC 5BPJA 1ZMZA 4NDCA 3AKAA 4PE7A 2M97A 5HLVA 4PHNA 3I5FC 1TIZA 1YX8A 2Y1NA 3CS1A 3H4SE 2LMUA 1S3PA 1S36A 1JFJA 3RLZA 2LP2A 1NYAA 1B8CA 1IH0A 3PFVA 2LANA 5TNCA 1PSRA 1DF0A 2F3ZA 1BJFA 1WDCB 2K2AA 2KI6D 2ZN8A 2P6BB 2WORA 1LKJA 1FF1A 2CCMA 3SG3A 4GGFC 2KYFA 2KGBC 2ZFDA 1B7TZ 1ZOTB 2V53A 1KK7Y 2ZNEA 2BECA 1KK7Z 1XFXO 2KYCA 2LLSA 2OS8B 1UHIA 2JWWA 2M1UA 5HKZA 1C7WA 1KWOC 3VGOA 4DUQA 1AVSA 1ZUZA 2PRUA 3PN7C 2JPTA 1TNPA 3BOWB 3CR2A 1CMFA 2MRDA 1L2OB 1WLMA 2LNKA 1IG5A 3FIAA 4PHKA 4Q04A 2MBXA 1QJTA 1CFCA 1AJ4A 2KGRA 3A4UB 1EXRA 2JNXA 3VRPA 4L9MA 1M39A 4N5XA 1KFXL 1YUSA 1CTRA 1A75A 3TUYC 1DJHA 1FBVA 1IRJA 2BE6A 2BKHB 2JXCA 4DS7A 2O5GA 3JVTC 1TNQA 2PMYA 4I5NB 1UHNA 2HETA 1QV0A 4PE0A 4C0LA 4QJ4B 4E68A 1IGVA 1NUBA 1K9UA 1SW8A 1OMDA 1GGWA 1PVAA 1XFVO 2BBNA 1DT7B 2BL0B 4YGBB 5J3XA 1N2DA 1OMVA 2LC5A 1KQMB 3BXKA 1DJZA 2LVIA 2R2IA 1SR6C 1Y1AA 3TS5C 1K9KA 4MZKA 2LE9B 2IS9A 5B8IB 1JC2A 1C7VA 1CB1A 1IQ5A 2LAPA 3TDIA 1F71A 3M0WA 1G8IA 1NCYA 1S6CA 3CWGA 4YBHB 5HYDA 1NSHA 2LLTA 1YURA 2ZRTA 1A75B 1M31A 2M7NA 3BUMB 4GFTA 1UHKA 1GGZA 1SCVA 5CSIA 3EKJA 2NXQA 3OHMB 1ALWA 2JZIA 4XJKA 3K21A 5PALA 2KI4C 4GNKB 1KSMA 2LUCA 2PASA 1DMOA 1NCZA 1B4CA 2FCDA 1KFUL 4AQJA 1EG4A 2MAZA 4YGDB 4MBEA 2SCPA 3AKBA 1NX0A 1QIWA 3IQQA 1G33A 1XFZO 1Y1XA 1EG3A 3BQ3A 1QASA 3CTNA 4GGNA 1AHRA 3FWBA 4OCIA 4WQ3A 5HKYA 4CPVA 1QVIY 2KQ6A 1QATA 1FI5A 1QVIZ 1N0YA 1DGVA 3DVEA 3LK1A 1CFFA 4M2PA 5I2QA 2L50A 4XJKB 3I5GC 4FTGA 2HQWA 1NCXA 3SIAA 3BUWB 2KHNA 3NXAA 3JTDC 1CLMA 2ZN9A 1XFYO 2O60A 2EC6C 4PHJA 3SG6A 1FPWA 1NX2A 2FOTA 2BCAA 1NX3A 4GGFA 3PSRA 3EK8A 1K94A 1OOJA 3O78A 3SIBA 4DRWA 2OTGB 1LA3A 1QIVA 3KO0A 3NSLA 2L0PA 1XA5A 2VRGA 1TNXA 1YUUA 3ICBA 4ZCUA 1SKTA 3DF0A 2MHHA 4N1FA 2JULA 1F55A 2KSPA 4MRYA 1YR5A 4FQOA 2ZKMX 1D1OA 3AAKA 3GK4X 1CFPA 2LMVA 2COLB 1TRFA 1TTXA 1YVLA 3KEVA 5KSZA 1QX5B 1PRWA 3O2PA 1M46A 4GPLB 1BOCA 1V1GA 4PE4A 1F8HA 2M49B 1EL4A 1GQMA 1ZFSA 3BYAA 1K93D 1BR4B 2H61C 4A4BA 1SCMB 1KWOB 2L4IA 2KNEA 1N65A 1XYDA 3OP0A 4JQ0D 2K7BA 1B7TY 2F2PA 2NLNA 3LL8B 4USLA 3BUXB 1G4YR 1SMGA 1XK4C 2PSRA 5AANA 3OB2B 4P5OE 1SL9A 4MZLA 1NWDA 1MQ1A 2KBMA 3TUYB 4C0JA 1SY9A 1M45A 1B9AA 3DF0B 3JVTB 3PM8A 3I5IB 1W7JB 1A2XA 2KAYA 1A03A 2LHLA 2M29A 3EVUA 1OZSA 3EK4A 1PVBA 1SL8A 1QX7A 1SBJA 4ICBA 2B1UA 3VRNA 1AK8A 1NIWA 3WHUB 1JF2A 5I2OA 4R1EA 2L51A 2LHIA 3KPXA 1DF0B 2K8MB 5DKRA 1YRUB 2CTNA 3LLEA 2L5XB 2PVBA 5KU1A 1SK6D 2RGIA 2KAXA 4MN0A 3GK2A 4BY5A 1S6JA 3QRXA 3VRQA 2WOSA 4CLNA 1TOPA 1YTZC 3IF7A 2JNFA 4U8DA 1WRKA 1F4QA 2M0RA 2H2KA 1KFXS 3O4YA 1L2OC 1NP8A 1ZACA 2F3YA 2WNDA 3BUOB 3D0YA 4PDZA 5IBWA 1WLZA 5DKQA 4F0ZB 1CLBA 3DVKA 1CMGA 4UPGA 3KHEA 2QPTA 4I5KA 3EKHA 1JWDA 2M3WA 2Q4UA 3F45A 3CGAA 1M63B 1JF0A 1MF8B 1QXPA 1UUSA 4MEWA 1XFUO 4NQGA 2E6WA 4HRHA 1MXLC 1YUTA 1L7ZA 3SG5A 1UHJA 2F2OA 4MZJA 1CDLA 5CPVA 5I8NA 2NCPA 1KK8B 1S5GY 2HPSA 2KAVA 1S5GZ 1A4PA 3BUNB 3RM1A 2JOJA 3NSKA 5JJGA 1J1EA 3KF9A 1J7RA 1KCYA 1LA0A 1OSAA 1ALVA 1F70A 5G08A 3D0YB 5GQQC 1CM1A 3HX4A 2JRFA 3I5GB 3VRRA 4AQIA 1B47A 1CDPA 3I5HC 2EGDA 3A8RA 1EH2A 2K2FA 3NSOA 1CFDA 2K7OA 1SPYA 2KI6C 1KFUS 1PALA 2AMIA 4TNCA 3WHTB 2BE4A 1QTXA 1J55A 1QLSA 1K8UA 1CDMA 1WRLA 2F33A 2I2RE 3DVJA 3GK1A 3OX5A 1CNPA 1DJGA 2WCEA 1JUOA 1CDNA 2H61A 3SJSA 4NDBA 1K95A 3MSEB 1E8AA 1WRZA 3OX6A 1W7IB 4YI8A 4NDDA 3DVMA 2JTZA 1XK4A 1RROA 1J1DA 2DOQA 2E30A 5F6TA 4DIRA 2GV5A 4CFQA 2GGZA 3EVVA 1DJXA 2KDHA 1CLLA 1Y6WA 3I5FB 1ODBA 1F54A 2GGMA 2K7CA 1DJYA 2F8PA 1KSOA 3SG7A 2KOTA 2CXJA 1H8BA 2AAOA 2JT0A 3PALA 1QX2A 1RFJA 4AOMA 3TZ1A 1F4OA 1BG1A 1R2UA 2NZ0A 2SASA 1IQ3A 2LVKA 5ER4X 5AFPA 4OV2A 2I18A 2BKIB 1OMRA 3C1VA 3SG2A 1BR1B 1GJYA 4ZCVA 4OR9B 1XVJA 2KFHA 4MSPA 1YX7A 3WXAA 3SG4A 1U5IA 1BU3A 3WNXB 1Y1UA 1SL7A 2Y1MA 2JT8A 3CR4X 1IJ5A 4ORCB 5JOLA 1J7QA 2ZRSA 3BOWA 1HT9A 1Q80A 1MHOA 3PN7B 3EK7A 4N1GA 2BBMA 4MLWA 1HQVA 4GBAA 2BCXA 2Q91A 4PHMA 1AUIB 2JU0A 2WCBA 1NX1A 4YGAA 4HRGA 1DGUA 1MWNA 2CBLA 5CSFA 4MVFA 2KBIA 5AEQA 2M9GA 1J7OA 1YRTB 1OQPA 1XFWO 1OZOA 2FCEA 4GAOA 4JWQA 4ORBB 1UHHA 2LP3A 3OB1B 1RK9A 5KTYA 3GOFA 1BT6A 2OPOA 2CT9A 1V1FA 3ZWHA 3HCMA 2KFFA 3NSIA 1LVCD 5HKWA 1QLKA 1IWQA 4OKHA 1SYMA 1J7PA 1OE9B 1WDCC 1RWYA 5K89A 1EJ3A 3O6BA 4C0KA 1SR6B 1SCMC 1U5IB 1IJ6A 4XYNA 4MRXA 1S26D 3TS5B 1X02A 2M1KB 4IL1A 4HSZA 2PALA 2WC8A 1MR8A 4PALA 2WCFA 2OS8C 2QACA 2LM5A 2TN4A 1YVHA 5AERA 2MLFC 1B1GA 1R6PA 4PCWA 5AXIA 1AJ5A 2LLUA 2K61A 1IKUA 3FWCA 1PULA 3CR5X 3I5IC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VRK A;  4QJ3 B;  5D69 A;  1SNL A;  2I94 A;  2BCB A;  2M7L A;  1JFK A;  3E3R A;  2KI4 B;  1QV1 A;  1C07 A;  1MUX A;  1K96 A;  4WRI A;  1B8R A;  2JT3 A;  2JC2 A;  1PK0 D;  1K9P A;  4JPZ B;  2KQY A;  2JQ6 A;  3AAJ A;  4I5J A;  1REC A;  2AUC A;  2L98 A;  3EVR A;  2CNP A;  2BL0 C;  4YI9 A;  5CSJ A;  2LUX A;  4I5L B;  5FYX A;  1JSA A;  1MXE A;  1KQM C;  1K2H A;  1RTP 1;  2K7D A;  4DCK A;  1DTL A;  2Y4Q A;  3D10 A;  4QJ5 B;  2MLE C;  2L2E A;  1K90 D;  4M2O A;  2G2B A;  1TN4 A;  1LXF C;  3I5H B;  5HLO A;  1CKK A;  1NPQ A;  1JBA A;  2KFG A;  1LIN A;  2EHB A;  5DKN A;  4M2Q A;  3PLF B;  3CLN A;  1UUR A;  2ISD A;  4P2Y B;  3JTD B;  1XO5 A;  2JXL A;  2EC6 B;  1BLQ A;  2M8U A;  4HRE E;  2LMT A;  2Y5I A;  2K0J A;  4PE1 A;  5D7F A;  5CSN A;  1TCF A;  1Y0V H;  2G9B A;  4BY4 A;  1KK8 C;  1DJI A;  1UWO A;  1S1E A;  1KQV A;  2LVJ A;  2JTT A;  1RJV A;  1PSB A;  2MA2 A;  3TDZ A;  3DD4 A;  2L4H A;  3PAT A;  4YGC B;  2I7A A;  3IQO A;  4CID A;  3CZT X;  4D1E A;  1FI6 A;  4WQ2 A;  1UP5 A;  2NCO A;  5ER5 A;  4A4C A;  1TNW A;  4GUK A;  3ZNI A;  3LCP C;  4YRU A;  3FS7 A;  3LK0 A;  1FW4 A;  4OVN F;  1DJW A;  5I2L A;  1CM4 A;  4ETO A;  2FJU B;  4ORA B;  1S6I A;  3VRO A;  2HF5 A;  1QS7 A;  1H4B A;  1DVI A;  2LV7 A;  2LVV A;  1WY9 A;  2LCP A;  1BF5 A;  2A4J A;  1TCO B;  1B8L A;  2HQ8 A;  1BMO A;  1AP4 A;  4CFR A;  2D8N A;  1A29 A;  3TDU A;  4YGE B;  2MJW B;  1SRA A;  1BOD A;  2ZND A;  2OTG C;  5BPJ A;  1ZMZ A;  4NDC A;  3AKA A;  4PE7 A;  2M97 A;  5HLV A;  4PHN A;  3I5F C;  1TIZ A;  1YX8 A;  2Y1N A;  3CS1 A;  3H4S E;  2LMU A;  1S3P A;  1S36 A;  1JFJ A;  3RLZ A;  2LP2 A;  1NYA A;  1B8C A;  1IH0 A;  3PFV A;  2LAN A;  5TNC A;  1PSR A;  1DF0 A;  2F3Z A;  1BJF A;  1WDC B;  2K2A A;  2KI6 D;  2ZN8 A;  2P6B B;  2WOR A;  1LKJ A;  1FF1 A;  2CCM A;  3SG3 A;  4GGF C;  2KYF A;  2KGB C;  2ZFD A;  1B7T Z;  1ZOT B;  2V53 A;  1KK7 Y;  2ZNE A;  2BEC A;  1KK7 Z;  1XFX O;  2KYC A;  2LLS A;  2OS8 B;  1UHI A;  2JWW A;  2M1U A;  5HKZ A;  1C7W A;  1KWO C;  3VGO A;  4DUQ A;  1AVS A;  1ZUZ A;  2PRU A;  3PN7 C;  2JPT A;  1TNP A;  3BOW B;  3CR2 A;  1CMF A;  2MRD A;  1L2O B;  1WLM A;  2LNK A;  1IG5 A;  3FIA A;  4PHK A;  4Q04 A;  2MBX A;  1QJT A;  1CFC A;  1AJ4 A;  2KGR A;  3A4U B;  1EXR A;  2JNX A;  3VRP A;  4L9M A;  1M39 A;  4N5X A;  1KFX L;  1YUS A;  1CTR A;  1A75 A;  3TUY C;  1DJH A;  1FBV A;  1IRJ A;  2BE6 A;  2BKH B;  2JXC A;  4DS7 A;  2O5G A;  3JVT C;  1TNQ A;  2PMY A;  4I5N B;  1UHN A;  2HET A;  1QV0 A;  4PE0 A;  4C0L A;  4QJ4 B;  4E68 A;  1IGV A;  1NUB A;  1K9U A;  1SW8 A;  1OMD A;  1GGW A;  1PVA A;  1XFV O;  2BBN A;  1DT7 B;  2BL0 B;  4YGB B;  5J3X A;  1N2D A;  1OMV A;  2LC5 A;  1KQM B;  3BXK A;  1DJZ A;  2LVI A;  2R2I A;  1SR6 C;  1Y1A A;  3TS5 C;  1K9K A;  4MZK A;  2LE9 B;  2IS9 A;  5B8I B;  1JC2 A;  1C7V A;  1CB1 A;  1IQ5 A;  2LAP A;  3TDI A;  1F71 A;  3M0W A;  1G8I A;  1NCY A;  1S6C A;  3CWG A;  4YBH B;  5HYD A;  1NSH A;  2LLT A;  1YUR A;  2ZRT A;  1A75 B;  1M31 A;  2M7N A;  3BUM B;  4GFT A;  1UHK A;  1GGZ A;  1SCV A;  5CSI A;  3EKJ A;  2NXQ A;  3OHM B;  1ALW A;  2JZI A;  4XJK A;  3K21 A;  5PAL A;  2KI4 C;  4GNK B;  1KSM A;  2LUC A;  2PAS A;  1DMO A;  1NCZ A;  1B4C A;  2FCD A;  1KFU L;  4AQJ A;  1EG4 A;  2MAZ A;  4YGD B;  4MBE A;  2SCP A;  3AKB A;  1NX0 A;  1QIW A;  3IQQ A;  1G33 A;  1XFZ O;  1Y1X A;  1EG3 A;  3BQ3 A;  1QAS A;  3CTN A;  4GGN A;  1AHR A;  3FWB A;  4OCI A;  4WQ3 A;  5HKY A;  4CPV A;  1QVI Y;  2KQ6 A;  1QAT A;  1FI5 A;  1QVI Z;  1N0Y A;  1DGV A;  3DVE A;  3LK1 A;  1CFF A;  4M2P A;  5I2Q A;  2L50 A;  4XJK B;  3I5G C;  4FTG A;  2HQW A;  1NCX A;  3SIA A;  3BUW B;  2KHN A;  3NXA A;  3JTD C;  1CLM A;  2ZN9 A;  1XFY O;  2O60 A;  2EC6 C;  4PHJ A;  3SG6 A;  1FPW A;  1NX2 A;  2FOT A;  2BCA A;  1NX3 A;  4GGF A;  3PSR A;  3EK8 A;  1K94 A;  1OOJ A;  3O78 A;  3SIB A;  4DRW A;  2OTG B;  1LA3 A;  1QIV A;  3KO0 A;  3NSL A;  2L0P A;  1XA5 A;  2VRG A;  1TNX A;  1YUU A;  3ICB A;  4ZCU A;  1SKT A;  3DF0 A;  2MHH A;  4N1F A;  2JUL A;  1F55 A;  2KSP A;  4MRY A;  1YR5 A;  4FQO A;  2ZKM X;  1D1O A;  3AAK A;  3GK4 X;  1CFP A;  2LMV A;  2COL B;  1TRF A;  1TTX A;  1YVL A;  3KEV A;  5KSZ A;  1QX5 B;  1PRW A;  3O2P A;  1M46 A;  4GPL B;  1BOC A;  1V1G A;  4PE4 A;  1F8H A;  2M49 B;  1EL4 A;  1GQM A;  1ZFS A;  3BYA A;  1K93 D;  1BR4 B;  2H61 C;  4A4B A;  1SCM B;  1KWO B;  2L4I A;  2KNE A;  1N65 A;  1XYD A;  3OP0 A;  4JQ0 D;  2K7B A;  1B7T Y;  2F2P A;  2NLN A;  3LL8 B;  4USL A;  3BUX B;  1G4Y R;  1SMG A;  1XK4 C;  2PSR A;  5AAN A;  3OB2 B;  4P5O E;  1SL9 A;  4MZL A;  1NWD A;  1MQ1 A;  2KBM A;  3TUY B;  4C0J A;  1SY9 A;  1M45 A;  1B9A A;  3DF0 B;  3JVT B;  3PM8 A;  3I5I B;  1W7J B;  1A2X A;  2KAY A;  1A03 A;  2LHL A;  2M29 A;  3EVU A;  1OZS A;  3EK4 A;  1PVB A;  1SL8 A;  1QX7 A;  1SBJ A;  4ICB A;  2B1U A;  3VRN A;  1AK8 A;  1NIW A;  3WHU B;  1JF2 A;  5I2O A;  4R1E A;  2L51 A;  2LHI A;  3KPX A;  1DF0 B;  2K8M B;  5DKR A;  1YRU B;  2CTN A;  3LLE A;  2L5X B;  2PVB A;  5KU1 A;  1SK6 D;  2RGI A;  2KAX A;  4MN0 A;  3GK2 A;  4BY5 A;  1S6J A;  3QRX A;  3VRQ A;  2WOS A;  4CLN A;  1TOP A;  1YTZ C;  3IF7 A;  2JNF A;  4U8D A;  1WRK A;  1F4Q A;  2M0R A;  2H2K A;  1KFX S;  3O4Y A;  1L2O C;  1NP8 A;  1ZAC A;  2F3Y A;  2WND A;  3BUO B;  3D0Y A;  4PDZ A;  5IBW A;  1WLZ A;  5DKQ A;  4F0Z B;  1CLB A;  3DVK A;  1CMG A;  4UPG A;  3KHE A;  2QPT A;  4I5K A;  3EKH A;  1JWD A;  2M3W A;  2Q4U A;  3F45 A;  3CGA A;  1M63 B;  1JF0 A;  1MF8 B;  1QXP A;  1UUS A;  4MEW A;  1XFU O;  4NQG A;  2E6W A;  4HRH A;  1MXL C;  1YUT A;  1L7Z A;  3SG5 A;  1UHJ A;  2F2O A;  4MZJ A;  1CDL A;  5CPV A;  5I8N A;  2NCP A;  1KK8 B;  1S5G Y;  2HPS A;  2KAV A;  1S5G Z;  1A4P A;  3BUN B;  3RM1 A;  2JOJ A;  3NSK A;  5JJG A;  1J1E A;  3KF9 A;  1J7R A;  1KCY A;  1LA0 A;  1OSA A;  1ALV A;  1F70 A;  5G08 A;  3D0Y B;  5GQQ C;  1CM1 A;  3HX4 A;  2JRF A;  3I5G B;  3VRR A;  4AQI A;  1B47 A;  1CDP A;  3I5H C;  2EGD A;  3A8R A;  1EH2 A;  2K2F A;  3NSO A;  1CFD A;  2K7O A;  1SPY A;  2KI6 C;  1KFU S;  1PAL A;  2AMI A;  4TNC A;  3WHT B;  2BE4 A;  1QTX A;  1J55 A;  1QLS A;  1K8U A;  1CDM A;  1WRL A;  2F33 A;  2I2R E;  3DVJ A;  3GK1 A;  3OX5 A;  1CNP A;  1DJG A;  2WCE A;  1JUO A;  1CDN A;  2H61 A;  3SJS A;  4NDB A;  1K95 A;  3MSE B;  1E8A A;  1WRZ A;  3OX6 A;  1W7I B;  4YI8 A;  4NDD A;  3DVM A;  2JTZ A;  1XK4 A;  1RRO A;  1J1D A;  2DOQ A;  2E30 A;  5F6T A;  4DIR A;  2GV5 A;  4CFQ A;  2GGZ A;  3EVV A;  1DJX A;  2KDH A;  1CLL A;  1Y6W A;  3I5F B;  1ODB A;  1F54 A;  2GGM A;  2K7C A;  1DJY A;  2F8P A;  1KSO A;  3SG7 A;  2KOT A;  2CXJ A;  1H8B A;  2AAO A;  2JT0 A;  3PAL A;  1QX2 A;  1RFJ A;  4AOM A;  3TZ1 A;  1F4O A;  1BG1 A;  1R2U A;  2NZ0 A;  2SAS A;  1IQ3 A;  2LVK A;  5ER4 X;  5AFP A;  4OV2 A;  2I18 A;  2BKI B;  1OMR A;  3C1V A;  3SG2 A;  1BR1 B;  1GJY A;  4ZCV A;  4OR9 B;  1XVJ A;  2KFH A;  4MSP A;  1YX7 A;  3WXA A;  3SG4 A;  1U5I A;  1BU3 A;  3WNX B;  1Y1U A;  1SL7 A;  2Y1M A;  2JT8 A;  3CR4 X;  1IJ5 A;  4ORC B;  5JOL A;  1J7Q A;  2ZRS A;  3BOW A;  1HT9 A;  1Q80 A;  1MHO A;  3PN7 B;  3EK7 A;  4N1G A;  2BBM A;  4MLW A;  1HQV A;  4GBA A;  2BCX A;  2Q91 A;  4PHM A;  1AUI B;  2JU0 A;  2WCB A;  1NX1 A;  4YGA A;  4HRG A;  1DGU A;  1MWN A;  2CBL A;  5CSF A;  4MVF A;  2KBI A;  5AEQ A;  2M9G A;  1J7O A;  1YRT B;  1OQP A;  1XFW O;  1OZO A;  2FCE A;  4GAO A;  4JWQ A;  4ORB B;  1UHH A;  2LP3 A;  3OB1 B;  1RK9 A;  5KTY A;  3GOF A;  1BT6 A;  2OPO A;  2CT9 A;  1V1F A;  3ZWH A;  3HCM A;  2KFF A;  3NSI A;  1LVC D;  5HKW A;  1QLK A;  1IWQ A;  4OKH A;  1SYM A;  1J7P A;  1OE9 B;  1WDC C;  1RWY A;  5K89 A;  1EJ3 A;  3O6B A;  4C0K A;  1SR6 B;  1SCM C;  1U5I B;  1IJ6 A;  4XYN A;  4MRX A;  1S26 D;  3TS5 B;  1X02 A;  2M1K B;  4IL1 A;  4HSZ A;  2PAL A;  2WC8 A;  1MR8 A;  4PAL A;  2WCF A;  2OS8 C;  2QAC A;  2LM5 A;  2TN4 A;  1YVH A;  5AER A;  2MLF C;  1B1G A;  1R6P A;  4PCW A;  5AXI A;  1AJ5 A;  2LLU A;  2K61 A;  1IKU A;  3FWC A;  1PUL A;  3CR5 X;  3I5I C; 
#chains in the Genus database with same CATH topology
 1VRK A;  4QJ3 B;  5D69 A;  1SNL A;  2L5Y A;  2I94 A;  1LS8 A;  2BCB A;  2M7L A;  1JFK A;  3E3R A;  2PQL A;  2KI4 B;  1QV1 A;  3SS3 A;  3VB1 A;  1C07 A;  1MUX A;  1K96 A;  4WRI A;  1B8R A;  2JT3 A;  2JC2 A;  1PK0 D;  1K9P A;  4JPZ B;  5HL1 A;  2KQY A;  2JQ6 A;  3AAJ A;  4I5J A;  1REC A;  2AUC A;  2L98 A;  3EVR A;  2CNP A;  2BL0 C;  4YI9 A;  5CSJ A;  2LUX A;  4I5L B;  5FYX A;  1JSA A;  1MXE A;  1KQM C;  1K2H A;  1RTP 1;  2WCJ A;  2K7D A;  4DCK A;  1DTL A;  2Y4Q A;  3D10 A;  3NHI A;  2MLE C;  4QJ5 B;  2L2E A;  1K90 D;  4M2O A;  2G2B A;  1TN4 A;  1LXF C;  3I5H B;  5HLO A;  1CKK A;  1NPQ A;  1JBA A;  2KFG A;  1LIN A;  2EHB A;  5DKN A;  4M2Q A;  3PLF B;  3CLN A;  1UUR A;  4IJ7 A;  4P2Y B;  2ISD A;  3L47 A;  3JTD B;  1XO5 A;  2JXL A;  2EC6 B;  1BLQ A;  2M8U A;  4HRE E;  2LMT A;  2Y5I A;  2K0J A;  4PE1 A;  5D7F A;  5CSN A;  1TCF A;  1Y0V H;  2G9B A;  4BY4 A;  1KK8 C;  1DJI A;  1DC1 A;  1UWO A;  1S1E A;  1KQV A;  2LVJ A;  2JTT A;  1RJV A;  1PSB A;  2MA2 A;  3TDZ A;  3DD4 A;  2L4H A;  3PAT A;  4YGC B;  2I7A A;  3IQO A;  4CID A;  3CZT X;  4D1E A;  1FI6 A;  4WQ2 A;  1UP5 A;  2NCO A;  5ER5 A;  4A4C A;  1TNW A;  4FQT A;  4GUK A;  3ZNI A;  3LCP C;  4YRU A;  3FS7 A;  3LK0 A;  1FW4 A;  3CAB A;  4OVN F;  1DJW A;  5I2L A;  1CM4 A;  4ETO A;  2FJU B;  4ORA B;  1S6I A;  3VRO A;  2HF5 A;  1QS7 A;  1H4B A;  2KLD A;  1DVI A;  2LV7 A;  3D74 A;  2LVV A;  1WY9 A;  2LCP A;  1BF5 A;  2A4J A;  1TCO B;  1B8L A;  2HQ8 A;  3OGN A;  1BMO A;  1AP4 A;  4CFR A;  2D8N A;  1A29 A;  3TDU A;  4YGE B;  2MJW B;  1SRA A;  1BOD A;  2WCK A;  2ZND A;  2OTG C;  4ORB B;  5BPJ A;  1ZMZ A;  4NDC A;  3AKA A;  4PE7 A;  2M97 A;  5HLV A;  4PHN A;  3I5F C;  1TIZ A;  1YX8 A;  2Y1N A;  3CS1 A;  3H4S E;  2LMU A;  1S3P A;  1S36 A;  1JFJ A;  3RLZ A;  2LP2 A;  1NYA A;  1B8C A;  3SS4 A;  1IH0 A;  4INW A;  3PFV A;  2P70 A;  2LAN A;  3R1P A;  5TNC A;  1PSR A;  1DF0 A;  2F3Z A;  1BJF A;  1WDC B;  2K2A A;  2KI6 D;  2ZN8 A;  2P6B B;  2WOR A;  3R1O A;  1LKJ A;  5FI7 A;  2PYQ A;  1FF1 A;  2CCM A;  3SG3 A;  4GGF C;  2KYF A;  2KGB C;  1C3Z A;  1B7T Z;  1ZOT B;  2V53 A;  1KK7 Y;  2ZFD A;  2BEC A;  2ZNE A;  3B87 A;  1KK7 Z;  1XFX O;  2KYC A;  2LLS A;  2OS8 B;  1UHI A;  2JWW A;  2M1U A;  5HKZ A;  1C7W A;  1KWO C;  3B88 A;  3VGO A;  4DUQ A;  1AVS A;  3EG5 B;  1ZUZ A;  2PRU A;  3PN7 C;  2JPT A;  1TNP A;  3BOW B;  3CR2 A;  1CMF A;  2MRD A;  1L2O B;  1WLM A;  2LNK A;  1IG5 A;  3FIA A;  4PHK A;  4Q04 A;  2MBX A;  1QJT A;  2WCM A;  1AJ4 A;  2KGR A;  3A4U B;  3S0A A;  1EXR A;  1TWO A;  2JNX A;  1CFC A;  1OOG A;  4L9M A;  3VRP A;  1M39 A;  4N5X A;  1KFX L;  1YUS A;  3BFH A;  1CTR A;  1A75 A;  3TUY C;  1DJH A;  1FBV A;  1IRJ A;  2BE6 A;  2BKH B;  2JXC A;  4DS7 A;  2O5G A;  3JVT C;  4INX A;  5D3O A;  1TNQ A;  3CZ2 A;  2PMY A;  4I5N B;  1UHN A;  2HET A;  1QV0 A;  4PE0 A;  4C0L A;  4QJ4 B;  4E68 A;  1IGV A;  1NUB A;  1K9U A;  1Z4H A;  1Z2C B;  1SW8 A;  1OMD A;  1GGW A;  1PVA A;  1XFV O;  2BBN A;  1DT7 B;  2BL0 B;  4YGB B;  5J3X A;  1N2D A;  3DXL A;  1OMV A;  1W9Z A;  2LC5 A;  5FI2 A;  1KQM B;  2KPH A;  3BXK A;  1DJZ A;  2LVI A;  2R2I A;  1SR6 C;  1Y1A A;  3S0D A;  3TS5 C;  1K9K A;  4MZK A;  2LE9 B;  2IS9 A;  5B8I B;  1JC2 A;  1C7V A;  1CB1 A;  1IQ5 A;  1T14 A;  2LAP A;  3TDI A;  3B7A A;  1F71 A;  3M0W A;  1G8I A;  1NCY A;  1S6C A;  3CWG A;  4YBH B;  5HYD A;  1NSH A;  2LLT A;  3SS5 A;  1YUR A;  2ZRT A;  2WC5 A;  5EL2 A;  1A75 B;  1M31 A;  2M7N A;  3BUM B;  4GFT A;  1UHK A;  1GGZ A;  1SCV A;  5CSI A;  3EKJ A;  2NXQ A;  3OHM B;  1ALW A;  2JZI A;  4XJK A;  3K21 A;  5PAL A;  2KI4 C;  4GNK B;  1KSM A;  2LUC A;  2PAS A;  2L2C A;  1DMO A;  1NCZ A;  1B4C A;  2FCD A;  1KFU L;  4AQJ A;  1EG4 A;  2MAZ A;  4YGD B;  4MBE A;  2SCP A;  3AKB A;  1NX0 A;  5DIC A;  1QIW A;  3IQQ A;  3PM2 A;  1G33 A;  1XFZ O;  1Y1X A;  1EG3 A;  3BQ3 A;  1QAS A;  3NGV A;  3CTN A;  3N7H A;  1AHR A;  3FWB A;  4GGN A;  4OCI A;  4WQ3 A;  5HKY A;  4CPV A;  1QVI Y;  2KQ6 A;  1QAT A;  3O4X A;  1QVI Z;  1N0Y A;  1DGV A;  1FI5 A;  3UNW A;  3DVE A;  3LK1 A;  1CFF A;  3CZ0 A;  1OW4 A;  2BAP A;  4M2P A;  5I2Q A;  2L50 A;  4XJK B;  3I5G C;  3D77 A;  2HQW A;  4FTG A;  2P71 A;  1NCX A;  2ERB A;  3SIA A;  3BUW B;  2KHN A;  3NXA A;  3JTD C;  1CLM A;  2ZN9 A;  1XFY O;  2O60 A;  2EC6 C;  4PHJ A;  1P28 A;  3SG6 A;  1FPW A;  1NX2 A;  2FOT A;  2BCA A;  1DEK A;  1NX3 A;  4GGF A;  3PSR A;  3NHT A;  3EK8 A;  1K94 A;  1OOJ A;  3FE6 A;  3O78 A;  3SIB A;  4DRW A;  3PJI A;  2OTG B;  1LA3 A;  1QIV A;  3KO0 A;  1OOF A;  3NSL A;  2L0P A;  1XA5 A;  2VRG A;  1TNX A;  1YUU A;  3ICB A;  4ZCU A;  3BJH A;  1DQE A;  1SKT A;  3DF0 A;  2MHH A;  4N1F A;  2JUL A;  4PT1 A;  1F55 A;  2KSP A;  4MRY A;  1YR5 A;  4FQO A;  2ZKM X;  1D1O A;  3AAK A;  3GK4 X;  1CFP A;  2LMV A;  2QEH A;  2COL B;  1TRF A;  1TTX A;  1YVL A;  3KEV A;  5KSZ A;  4KYN A;  1QX5 B;  1PRW A;  3O2P A;  1M46 A;  4GPL B;  1BOC A;  1V1G A;  4PE4 A;  1F8H A;  2M49 B;  1EL4 A;  1GQM A;  1ZFS A;  3B6X A;  3BYA A;  1K93 D;  1BR4 B;  2H61 C;  4A4B A;  1SCM B;  1KWO B;  2L4I A;  2KNE A;  1N65 A;  1OOI X;  1XYD A;  3OP0 A;  4JQ0 D;  2K7B A;  1B7T Y;  2F2P A;  2NLN A;  3LL8 B;  4USL A;  1ORG A;  3BUX B;  1G4Y R;  1SMG A;  1XK4 C;  2PSR A;  5AAN A;  3OB2 B;  4P5O E;  1SL9 A;  4MZL A;  1NWD A;  1MQ1 A;  2KBM A;  3TUY B;  4F7F A;  4C0J A;  1SY9 A;  1M45 A;  1B9A A;  3DF0 B;  3JVT B;  2YGU A;  3I5I B;  3PM8 A;  1W7J B;  1A2X A;  2KAY A;  1A03 A;  2LHL A;  2M29 A;  3EVU A;  1OZS A;  3EK4 A;  3D76 A;  1PVB A;  2K60 A;  1SL8 A;  1QX7 A;  1SBJ A;  4ICB A;  3S0G A;  1C3Y A;  2B1U A;  3VRN A;  1AK8 A;  1NIW A;  3WHU B;  1JF2 A;  1TUJ A;  5I2O A;  4R1E A;  2L51 A;  2LHI A;  3KPX A;  1DF0 B;  2K8M B;  3S0E A;  5DKR A;  1YRU B;  2CTN A;  3LLE A;  2L5X B;  2PVB A;  5KU1 A;  1SK6 D;  2RGI A;  2KAX A;  4MN0 A;  3GK2 A;  4BY5 A;  1S6J A;  3QRX A;  3VRQ A;  2WOS A;  4CLN A;  1TOP A;  1YTZ C;  3IF7 A;  2JNF A;  4U8D A;  1WRK A;  3D73 A;  1F4Q A;  2M0R A;  2H2K A;  1KFX S;  3O4Y A;  1L2O C;  1NP8 A;  1ZAC A;  2F3Y A;  2JPO A;  2WND A;  3BUO B;  3D0Y A;  4PDZ A;  5IBW A;  1WLZ A;  1IIO A;  5DKQ A;  4F0Z B;  1CLB A;  3DVK A;  1CMG A;  4UPG A;  3KHE A;  2QPT A;  4I5K A;  3EKH A;  1JWD A;  2M3W A;  2Q4U A;  3F45 A;  3CGA A;  4JKT A;  1M63 B;  1JF0 A;  1MF8 B;  2QEO A;  1QXP A;  1UUS A;  4MEW A;  3RZS A;  1XFU O;  4NQG A;  2E6W A;  2WCL A;  4HRH A;  1MXL C;  1YUT A;  1L7Z A;  2QEB A;  3SG5 A;  1UHJ A;  2F2O A;  3BFA A;  4MZJ A;  1CDL A;  3K1E A;  5CPV A;  2QEV A;  5I8N A;  2NCP A;  1KK8 B;  1S5G Y;  2HPS A;  2KAV A;  1S5G Z;  1A4P A;  3BUN B;  3RM1 A;  4JD9 A;  2JOJ A;  3NSK A;  5I94 A;  5JJG A;  1J1E A;  3KF9 A;  1J7R A;  1KCY A;  1LA0 A;  1OSA A;  1ALV A;  1F70 A;  5G08 A;  3D0Y B;  5GQQ C;  3Q8I A;  1CM1 A;  3HX4 A;  2JRF A;  3I5G B;  3VRR A;  4AQI A;  1B47 A;  1CDP A;  3I5H C;  2EGD A;  3A8R A;  1QWV A;  1EH2 A;  2K2F A;  3NSO A;  1CFD A;  2K7O A;  1SPY A;  2KI6 C;  1KFU S;  1OOH A;  1PAL A;  2AMI A;  4TNC A;  3WHT B;  2BE4 A;  1QTX A;  3QME A;  3DYE A;  1J55 A;  1QLS A;  1K8U A;  1CDM A;  1WRL A;  2F33 A;  2I2R E;  3DVJ A;  3GK1 A;  3OX5 A;  1CNP A;  1DJG A;  2WCE A;  1JUO A;  4OZD A;  1CDN A;  2H61 A;  3SJS A;  1GM0 A;  4NDB A;  1K95 A;  3MSE B;  1E8A A;  1WRZ A;  3DY9 A;  3OX6 A;  1W7I B;  4YI8 A;  4NDD A;  3DVM A;  2JTZ A;  1XK4 A;  3FE9 A;  1RRO A;  1J1D A;  2DOQ A;  2E30 A;  5F6T A;  3B86 A;  4DIR A;  2GV5 A;  4CFQ A;  2GGZ A;  3EVV A;  1DJX A;  2KDH A;  1CLL A;  1Y6W A;  3I5F B;  2WCH A;  1ODB A;  1F54 A;  2GGM A;  3D78 A;  3CDN A;  3R1V A;  2K7C A;  3R72 A;  5KTY A;  1DJY A;  3L4L A;  2F8P A;  1KSO A;  3SG7 A;  2KOT A;  2CXJ A;  1XFR A;  1H8B A;  2AAO A;  2JT0 A;  3CZ1 A;  3PAL A;  1QX2 A;  1RFJ A;  4AOM A;  3D75 A;  3L4A A;  3TZ1 A;  1F4O A;  1BG1 A;  1R2U A;  2NZ0 A;  2SAS A;  1IQ3 A;  2LVK A;  5ER4 X;  5AFP A;  4OV2 A;  2I18 A;  2BKI B;  3CYZ A;  1OMR A;  3C1V A;  3SG2 A;  1BR1 B;  2QDI A;  1GJY A;  4ZCV A;  4OR9 B;  1XVJ A;  2KFH A;  4MSP A;  1YX7 A;  3WXA A;  1TUZ A;  3SG4 A;  1U5I A;  1BU3 A;  3WNX B;  1Y1U A;  1SL7 A;  2FJY A;  2JT8 A;  2Y1M A;  1IJ5 A;  3CR4 X;  3IVT A;  4ORC B;  5JOL A;  1J7Q A;  2ZRS A;  3BOW A;  1HT9 A;  1Q80 A;  1MHO A;  3PN7 B;  3EK7 A;  4N1G A;  2BBM A;  2KLE A;  1HQV A;  4GBA A;  4MLW A;  2BCX A;  2Q91 A;  4PHM A;  1AUI B;  1DEL A;  2JU0 A;  2WCB A;  1NX1 A;  4YGA A;  4HRG A;  1DGU A;  1MWN A;  2CBL A;  5CSF A;  4MVF A;  2H8V A;  2KBI A;  2M9G A;  5AEQ A;  1J7O A;  1YRT B;  1OQP A;  1XFW O;  1OZO A;  2FCE A;  3FE8 A;  4GAO A;  4JWQ A;  1UHH A;  2LP3 A;  3OB1 B;  1RK9 A;  3BFB A;  3GOF A;  1BT6 A;  2OPO A;  3V2L A;  2CT9 A;  1V1F A;  2GTE A;  3ZWH A;  3HCM A;  3UO9 A;  2KFF A;  3OBV A;  2WC6 A;  1SSE B;  3NSI A;  5FI6 A;  1LVC D;  5HKW A;  1QLK A;  1IWQ A;  4OKH A;  1SYM A;  1J7P A;  1OE9 B;  1WDC C;  1RWY A;  5K89 A;  1EJ3 A;  3O6B A;  4C0K A;  1SR6 B;  1SCM C;  1U5I B;  1IJ6 A;  4XYN A;  4MRX A;  1S26 D;  3TS5 B;  1X02 A;  2M1K B;  4IL1 A;  4HSZ A;  2PAL A;  2WC8 A;  1MR8 A;  4PAL A;  3S0F A;  2WCF A;  2OS8 C;  2QAC A;  2LM5 A;  2TN4 A;  1YVH A;  5AER A;  2MLF C;  1B1G A;  1R6P A;  4PCW A;  5AXI A;  1AJ5 A;  2LLU A;  2K61 A;  1IKU A;  2BNX A;  3FWC A;  3DZT A;  1PUL A;  3S0B A;  3CR5 X;  3I5I C; 
#chains in the Genus database with same CATH homology
 1VRK A;  4QJ3 B;  5D69 A;  1SNL A;  2I94 A;  2BCB A;  2M7L A;  1JFK A;  3E3R A;  2KI4 B;  1QV1 A;  1C07 A;  1MUX A;  1K96 A;  4WRI A;  1B8R A;  2JT3 A;  2JC2 A;  1PK0 D;  1K9P A;  4JPZ B;  2KQY A;  2JQ6 A;  3AAJ A;  4I5J A;  1REC A;  2AUC A;  2L98 A;  3EVR A;  2CNP A;  2BL0 C;  4YI9 A;  5CSJ A;  2LUX A;  4I5L B;  5FYX A;  1JSA A;  1MXE A;  1KQM C;  1K2H A;  1RTP 1;  2K7D A;  4DCK A;  1DTL A;  2Y4Q A;  3D10 A;  4QJ5 B;  2MLE C;  2L2E A;  1K90 D;  4M2O A;  2G2B A;  1TN4 A;  1LXF C;  3I5H B;  5HLO A;  1CKK A;  1NPQ A;  1JBA A;  2KFG A;  1LIN A;  2EHB A;  5DKN A;  4M2Q A;  3PLF B;  3CLN A;  1UUR A;  2ISD A;  4P2Y B;  3JTD B;  1XO5 A;  2JXL A;  2EC6 B;  1BLQ A;  2M8U A;  4HRE E;  2LMT A;  2Y5I A;  2K0J A;  4PE1 A;  5D7F A;  5CSN A;  1TCF A;  1Y0V H;  2G9B A;  4BY4 A;  1KK8 C;  1DJI A;  1UWO A;  1S1E A;  1KQV A;  2LVJ A;  2JTT A;  1RJV A;  1PSB A;  2MA2 A;  3TDZ A;  3DD4 A;  2L4H A;  3PAT A;  4YGC B;  2I7A A;  3IQO A;  4CID A;  3CZT X;  4D1E A;  1FI6 A;  4WQ2 A;  1UP5 A;  2NCO A;  5ER5 A;  4A4C A;  1TNW A;  4GUK A;  3ZNI A;  3LCP C;  4YRU A;  3FS7 A;  3LK0 A;  1FW4 A;  4OVN F;  1DJW A;  5I2L A;  1CM4 A;  4ETO A;  2FJU B;  4ORA B;  1S6I A;  3VRO A;  2HF5 A;  1QS7 A;  1H4B A;  1DVI A;  2LV7 A;  2LVV A;  1WY9 A;  2LCP A;  1BF5 A;  2A4J A;  1TCO B;  1B8L A;  2HQ8 A;  1BMO A;  1AP4 A;  4CFR A;  2D8N A;  1A29 A;  3TDU A;  4YGE B;  2MJW B;  1SRA A;  1BOD A;  2ZND A;  2OTG C;  5BPJ A;  1ZMZ A;  4NDC A;  3AKA A;  4PE7 A;  2M97 A;  5HLV A;  4PHN A;  3I5F C;  1TIZ A;  1YX8 A;  2Y1N A;  3CS1 A;  3H4S E;  2LMU A;  1S3P A;  1S36 A;  1JFJ A;  3RLZ A;  2LP2 A;  1NYA A;  1B8C A;  1IH0 A;  3PFV A;  2LAN A;  5TNC A;  1PSR A;  1DF0 A;  2F3Z A;  1BJF A;  1WDC B;  2K2A A;  2KI6 D;  2ZN8 A;  2P6B B;  2WOR A;  1LKJ A;  1FF1 A;  2CCM A;  3SG3 A;  4GGF C;  2KYF A;  2KGB C;  2ZFD A;  1B7T Z;  1ZOT B;  2V53 A;  1KK7 Y;  2ZNE A;  2BEC A;  1KK7 Z;  1XFX O;  2KYC A;  2LLS A;  2OS8 B;  1UHI A;  2JWW A;  2M1U A;  5HKZ A;  1C7W A;  1KWO C;  3VGO A;  4DUQ A;  1AVS A;  1ZUZ A;  2PRU A;  3PN7 C;  2JPT A;  1TNP A;  3BOW B;  3CR2 A;  1CMF A;  2MRD A;  1L2O B;  1WLM A;  2LNK A;  1IG5 A;  3FIA A;  4PHK A;  4Q04 A;  2MBX A;  1QJT A;  1CFC A;  1AJ4 A;  2KGR A;  3A4U B;  1EXR A;  2JNX A;  3VRP A;  4L9M A;  1M39 A;  4N5X A;  1KFX L;  1YUS A;  1CTR A;  1A75 A;  3TUY C;  1DJH A;  1FBV A;  1IRJ A;  2BE6 A;  2BKH B;  2JXC A;  4DS7 A;  2O5G A;  3JVT C;  1TNQ A;  2PMY A;  4I5N B;  1UHN A;  2HET A;  1QV0 A;  4PE0 A;  4C0L A;  4QJ4 B;  4E68 A;  1IGV A;  1NUB A;  1K9U A;  1SW8 A;  1OMD A;  1GGW A;  1PVA A;  1XFV O;  2BBN A;  1DT7 B;  2BL0 B;  4YGB B;  5J3X A;  1N2D A;  1OMV A;  2LC5 A;  1KQM B;  3BXK A;  1DJZ A;  2LVI A;  2R2I A;  1SR6 C;  1Y1A A;  3TS5 C;  1K9K A;  4MZK A;  2LE9 B;  2IS9 A;  5B8I B;  1JC2 A;  1C7V A;  1CB1 A;  1IQ5 A;  2LAP A;  3TDI A;  1F71 A;  3M0W A;  1G8I A;  1NCY A;  1S6C A;  3CWG A;  4YBH B;  5HYD A;  1NSH A;  2LLT A;  1YUR A;  2ZRT A;  1A75 B;  1M31 A;  2M7N A;  3BUM B;  4GFT A;  1UHK A;  1GGZ A;  1SCV A;  5CSI A;  3EKJ A;  2NXQ A;  3OHM B;  1ALW A;  2JZI A;  4XJK A;  3K21 A;  5PAL A;  2KI4 C;  4GNK B;  1KSM A;  2LUC A;  2PAS A;  1DMO A;  1NCZ A;  1B4C A;  2FCD A;  1KFU L;  4AQJ A;  1EG4 A;  2MAZ A;  4YGD B;  4MBE A;  2SCP A;  3AKB A;  1NX0 A;  1QIW A;  3IQQ A;  1G33 A;  1XFZ O;  1Y1X A;  1EG3 A;  3BQ3 A;  1QAS A;  3CTN A;  4GGN A;  1AHR A;  3FWB A;  4OCI A;  4WQ3 A;  5HKY A;  4CPV A;  1QVI Y;  2KQ6 A;  1QAT A;  1FI5 A;  1QVI Z;  1N0Y A;  1DGV A;  3DVE A;  3LK1 A;  1CFF A;  4M2P A;  5I2Q A;  2L50 A;  4XJK B;  3I5G C;  4FTG A;  2HQW A;  1NCX A;  3SIA A;  3BUW B;  2KHN A;  3NXA A;  3JTD C;  1CLM A;  2ZN9 A;  1XFY O;  2O60 A;  2EC6 C;  4PHJ A;  3SG6 A;  1FPW A;  1NX2 A;  2FOT A;  2BCA A;  1NX3 A;  4GGF A;  3PSR A;  3EK8 A;  1K94 A;  1OOJ A;  3O78 A;  3SIB A;  4DRW A;  2OTG B;  1LA3 A;  1QIV A;  3KO0 A;  3NSL A;  2L0P A;  1XA5 A;  2VRG A;  1TNX A;  1YUU A;  3ICB A;  4ZCU A;  1SKT A;  3DF0 A;  2MHH A;  4N1F A;  2JUL A;  1F55 A;  2KSP A;  4MRY A;  1YR5 A;  4FQO A;  2ZKM X;  1D1O A;  3AAK A;  3GK4 X;  1CFP A;  2LMV A;  2COL B;  1TRF A;  1TTX A;  1YVL A;  3KEV A;  5KSZ A;  1QX5 B;  1PRW A;  3O2P A;  1M46 A;  4GPL B;  1BOC A;  1V1G A;  4PE4 A;  1F8H A;  2M49 B;  1EL4 A;  1GQM A;  1ZFS A;  3BYA A;  1K93 D;  1BR4 B;  2H61 C;  4A4B A;  1SCM B;  1KWO B;  2L4I A;  2KNE A;  1N65 A;  1XYD A;  3OP0 A;  4JQ0 D;  2K7B A;  1B7T Y;  2F2P A;  2NLN A;  3LL8 B;  4USL A;  3BUX B;  1G4Y R;  1SMG A;  1XK4 C;  2PSR A;  5AAN A;  3OB2 B;  4P5O E;  1SL9 A;  4MZL A;  1NWD A;  1MQ1 A;  2KBM A;  3TUY B;  4C0J A;  1SY9 A;  1M45 A;  1B9A A;  3DF0 B;  3JVT B;  3PM8 A;  3I5I B;  1W7J B;  1A2X A;  2KAY A;  1A03 A;  2LHL A;  2M29 A;  3EVU A;  1OZS A;  3EK4 A;  1PVB A;  1SL8 A;  1QX7 A;  1SBJ A;  4ICB A;  2B1U A;  3VRN A;  1AK8 A;  1NIW A;  3WHU B;  1JF2 A;  5I2O A;  4R1E A;  2L51 A;  2LHI A;  3KPX A;  1DF0 B;  2K8M B;  5DKR A;  1YRU B;  2CTN A;  3LLE A;  2L5X B;  2PVB A;  5KU1 A;  1SK6 D;  2RGI A;  2KAX A;  4MN0 A;  3GK2 A;  4BY5 A;  1S6J A;  3QRX A;  3VRQ A;  2WOS A;  4CLN A;  1TOP A;  1YTZ C;  3IF7 A;  2JNF A;  4U8D A;  1WRK A;  1F4Q A;  2M0R A;  2H2K A;  1KFX S;  3O4Y A;  1L2O C;  1NP8 A;  1ZAC A;  2F3Y A;  2WND A;  3BUO B;  3D0Y A;  4PDZ A;  5IBW A;  1WLZ A;  5DKQ A;  4F0Z B;  1CLB A;  3DVK A;  1CMG A;  4UPG A;  3KHE A;  2QPT A;  4I5K A;  3EKH A;  1JWD A;  2M3W A;  2Q4U A;  3F45 A;  3CGA A;  1M63 B;  1JF0 A;  1MF8 B;  1QXP A;  1UUS A;  4MEW A;  1XFU O;  4NQG A;  2E6W A;  4HRH A;  1MXL C;  1YUT A;  1L7Z A;  3SG5 A;  1UHJ A;  2F2O A;  4MZJ A;  1CDL A;  5CPV A;  5I8N A;  2NCP A;  1KK8 B;  1S5G Y;  2HPS A;  2KAV A;  1S5G Z;  1A4P A;  3BUN B;  3RM1 A;  2JOJ A;  3NSK A;  5JJG A;  1J1E A;  3KF9 A;  1J7R A;  1KCY A;  1LA0 A;  1OSA A;  1ALV A;  1F70 A;  5G08 A;  3D0Y B;  5GQQ C;  1CM1 A;  3HX4 A;  2JRF A;  3I5G B;  3VRR A;  4AQI A;  1B47 A;  1CDP A;  3I5H C;  2EGD A;  3A8R A;  1EH2 A;  2K2F A;  3NSO A;  1CFD A;  2K7O A;  1SPY A;  2KI6 C;  1KFU S;  1PAL A;  2AMI A;  4TNC A;  3WHT B;  2BE4 A;  1QTX A;  1J55 A;  1QLS A;  1K8U A;  1CDM A;  1WRL A;  2F33 A;  2I2R E;  3DVJ A;  3GK1 A;  3OX5 A;  1CNP A;  1DJG A;  2WCE A;  1JUO A;  1CDN A;  2H61 A;  3SJS A;  4NDB A;  1K95 A;  3MSE B;  1E8A A;  1WRZ A;  3OX6 A;  1W7I B;  4YI8 A;  4NDD A;  3DVM A;  2JTZ A;  1XK4 A;  1RRO A;  1J1D A;  2DOQ A;  2E30 A;  5F6T A;  4DIR A;  2GV5 A;  4CFQ A;  2GGZ A;  3EVV A;  1DJX A;  2KDH A;  1CLL A;  1Y6W A;  3I5F B;  1ODB A;  1F54 A;  2GGM A;  2K7C A;  1DJY A;  2F8P A;  1KSO A;  3SG7 A;  2KOT A;  2CXJ A;  1H8B A;  2AAO A;  2JT0 A;  3PAL A;  1QX2 A;  1RFJ A;  4AOM A;  3TZ1 A;  1F4O A;  1BG1 A;  1R2U A;  2NZ0 A;  2SAS A;  1IQ3 A;  2LVK A;  5ER4 X;  5AFP A;  4OV2 A;  2I18 A;  2BKI B;  1OMR A;  3C1V A;  3SG2 A;  1BR1 B;  1GJY A;  4ZCV A;  4OR9 B;  1XVJ A;  2KFH A;  4MSP A;  1YX7 A;  3WXA A;  3SG4 A;  1U5I A;  1BU3 A;  3WNX B;  1Y1U A;  1SL7 A;  2Y1M A;  2JT8 A;  3CR4 X;  1IJ5 A;  4ORC B;  5JOL A;  1J7Q A;  2ZRS A;  3BOW A;  1HT9 A;  1Q80 A;  1MHO A;  3PN7 B;  3EK7 A;  4N1G A;  2BBM A;  4MLW A;  1HQV A;  4GBA A;  2BCX A;  2Q91 A;  4PHM A;  1AUI B;  2JU0 A;  2WCB A;  1NX1 A;  4YGA A;  4HRG A;  1DGU A;  1MWN A;  2CBL A;  5CSF A;  4MVF A;  2KBI A;  5AEQ A;  2M9G A;  1J7O A;  1YRT B;  1OQP A;  1XFW O;  1OZO A;  2FCE A;  4GAO A;  4JWQ A;  4ORB B;  1UHH A;  2LP3 A;  3OB1 B;  1RK9 A;  5KTY A;  3GOF A;  1BT6 A;  2OPO A;  2CT9 A;  1V1F A;  3ZWH A;  3HCM A;  2KFF A;  3NSI A;  1LVC D;  5HKW A;  1QLK A;  1IWQ A;  4OKH A;  1SYM A;  1J7P A;  1OE9 B;  1WDC C;  1RWY A;  5K89 A;  1EJ3 A;  3O6B A;  4C0K A;  1SR6 B;  1SCM C;  1U5I B;  1IJ6 A;  4XYN A;  4MRX A;  1S26 D;  3TS5 B;  1X02 A;  2M1K B;  4IL1 A;  4HSZ A;  2PAL A;  2WC8 A;  1MR8 A;  4PAL A;  2WCF A;  2OS8 C;  2QAC A;  2LM5 A;  2TN4 A;  1YVH A;  5AER A;  2MLF C;  1B1G A;  1R6P A;  4PCW A;  5AXI A;  1AJ5 A;  2LLU A;  2K61 A;  1IKU A;  3FWC A;  1PUL A;  3CR5 X;  3I5I C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...