3NSKA

Crystal structure of the post-refolded s100a3 r51a mutant expressed in insect cell
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
91
structure length
91
Chain Sequence
RPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFAECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A3
publication title Refined crystal structures of human Ca(2+)/Zn(2+)-binding S100A3 protein characterized by two disulfide bridges
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 30
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3nskA00
2LV7A 2IS9A 1SR6B 1VRKA 4C0LA 2EGDA 5G08A 1B4CA 1PSBA 5CSNA 1A03A 1LINA 2CCMA 1QX2A 1GGZA 3AAKA 1CM1A 1MF8B 1KFXL 2K8MB 2LMVA 2ZKMX 1RECA 2M1UA 2ZN8A 2QACA 1YUTA 1HT9A 2BCBA 1NYAA 5KSZA 1KFUL 3FS7A 1ZOTB 1PULA 1S36A 2MLEC 1PVAA 3PN7B 1KQVA 1K94A 1BT6A 1RTP1 1UHKA 4ORBB 2KDHA 4CFRA 4L9MA 2KI4B 3OX5A 1FPWA 2MHHA 3KO0A 3DVJA 3BUMB 2BE6A 4USLA 3EKJA 2KHNA 4MRYA 5FYXA 2Y1NA 1S1EA 1SRAA 2LVJA 4MZKA 1RJVA 4AQJA 3DF0A 1MHOA 1AUIB 1IWQA 3FWCA 1J1EA 4N1FA 4NQGA 1K95A 1TCOB 1A75B 3PM8A 2JXLA 5D69A 3NSKA 4I5KA 3DVMA 2MAZA 3QRXA 3I5IC 3ZNIA 1CFPA 3EK4A 4P5OE 1YRUB 5HYDA 1JFKA 3CLNA 2ZN9A 4OKHA 4U8DA 5J3XA 1AJ4A 3VRRA 1OZSA 2FJUB 3JVTB 2K0JA 1QASA 3BOWA 1ZMZA 1B1GA 2OS8C 2L4HA 3A4UB 2K2FA 2KGBC 3AAJA 1TIZA 1DVIA 4YI8A 1XFUO 2M0RA 1WRLA 1XFVO 1S26D 2F2PA 4YBHB 3ZWHA 1M45A 1UHNA 1YRTB 4HRHA 1DJYA 4HREE 1DT7B 4PHKA 2SASA 2K7BA 1WLMA 3IQOA 3OHMB 2GV5A 5AXIA 4C0KA 1V1GA 4MLWA 1DTLA 1E8AA 1XVJA 2G9BA 1TNWA 2PALA 1SL8A 1NCYA 2WCBA 4DUQA 4M2OA 1GJYA 5HKWA 4M2QA 3E3RA 2KOTA 3GOFA 2M3WA 4A4CA 1ALVA 3SIBA 1AJ5A 5BPJA 1ALWA 1Y1XA 1PALA 2JNFA 1KWOB 2M97A 2CNPA 2KGRA 4P2YB 1WY9A 2BBMA 1YUSA 4PDZA 2M29A 3VRPA 1QATA 1FI5A 1AP4A 2LE9B 1QVIZ 3GK2A 4MZLA 1DJXA 1F8HA 3I5FB 3SG2A 1NPQA 3EVUA 1AVSA 2JQ6A 1OQPA 2LVKA 3EVRA 4YGDB 5DKRA 4HRGA 3VROA 3AKAA 3O6BA 1H8BA 1SMGA 1SW8A 4MZJA 2LUXA 4XYNA 4ORCB 2MRDA 1BF5A 2F2OA 1SR6C 2LANA 3AKBA 5K89A 1U5IA 2JT0A 3CR5X 2BCXA 4Q04A 1UP5A 2M8UA 1S6IA 1AK8A 4DIRA 1QXPA 1R6PA 2LM5A 3K21A 1FBVA 1NP8A 1YTZC 2L4IA 3EK8A 5JOLA 1BU3A 1B8LA 2JOJA 2F3ZA 2KQYA 1QV0A 4GGFA 1A4PA 5CPVA 2RGIA 3SG6A 4JQ0D 2CBLA 3RLZA 4PE0A 4MBEA 3PN7C 4PHNA 1MWNA 1RFJA 1C7WA 2KI4C 1C07A 1SY9A 3FIAA 2K7DA 4GUKA 1JFJA 2BECA 1YX7A 1TRFA 1CM4A 1QLSA 2SCPA 2KI6D 1FF1A 2L51A 1CB1A 2MA2A 1EJ3A 1SL7A 2G2BA 4IL1A 4A4BA 1MR8A 3RM1A 1FW4A 1YVLA 3WXAA 1SYMA 3D0YB 2LHLA 3CGAA 5AEQA 1DMOA 1Y1AA 2JTTA 4PE1A 1KSOA 4ETOA 1QS7A 4AOMA 1F4OA 1CDLA 2I18A 2BCAA 2LVIA 1K2HA 1NX1A 1ODBA 1OOJA 1SKTA 1JBAA 3BUXB 4AQIA 1PVBA 1F70A 1Y0VH 1Y6WA 3LK1A 2LLUA 2WOSA 3GK4X 1KQMB 2KYCA 3OB1B 4GGNA 1LKJA 3JVTC 5AFPA 1WLZA 1JF2A 4QJ3B 1F71A 1NSHA 2A4JA 1BOCA 4ZCUA 2I94A 1S6JA 3DVEA 3CS1A 1WDCB 4GFTA 1K90D 3IF7A 2HQWA 1DJHA 1CLMA 2QPTA 1D1OA 3WNXB 2KQ6A 3EKHA 2MBXA 3DVKA 1PRWA 1YR5A 3SG5A 3TDUA 2JU0A 3DD4A 4JWQA 4WRIA 4DCKA 5ER5A 2JTZA 2KBMA 2LVVA 1NIWA 3SG7A 3A8RA 1CLBA 1F54A 3KF9A 4MVFA 1OMRA 4WQ2A 4YGAA 4HSZA 1CMGA 3HCMA 1QJTA 1SPYA 1A2XA 2AAOA 4MSPA 2F3YA 1SCVA 3PALA 1KCYA 3F45A 1N65A 1S3PA 1S5GZ 1TTXA 4WQ3A 4CIDA 1EG4A 1EG3A 1KWOC 2OPOA 1J55A 4BY4A 1QTXA 1UHJA 1XA5A 2K7OA 4QJ4B 1YVHA 1YX8A 1TNPA 1KK8B 1NUBA 2M49B 2WNDA 2LAPA 3DF0B 2KYFA 1DJZA 2OTGB 3JTDB 1AHRA 2L50A 1DF0B 3SIAA 1M31A 4FTGA 1CFDA 4ICBA 3TZ1A 3I5FC 1SL9A 1EXRA 2BKIB 2PMYA 1JSAA 2CXJA 4YGBB 3TS5B 4CPVA 1MXEA 4YI9A 4MRXA 3LK0A 2KAVA 1R2UA 2NZ0A 4NDBA 4OR9B 4YGCB 1SCMB 3IQQA 3PSRA 4TNCA 2BL0B 2PASA 1W7IB 3BOWB 1IJ6A 2WORA 2Y5IA 1UUSA 1UWOA 3I5GB 1ZUZA 1IJ5A 4YRUA 4XJKB 1PK0D 1CFFA 2EC6B 3C1VA 4OVNF 3TUYC 1C7VA 1DGVA 1JWDA 1RWYA 3CZTX 3SG3A 4QJ5B 1IH0A 1F55A 4DS7A 2KFGA 1XK4C 2WC8A 3OP0A 5HLOA 3BYAA 1K9PA 3HX4A 2JWWA 4GPLB 2V53A 1B7TZ 4GBAA 2AUCA 1M39A 2K2AA 2L0PA 1DJIA 4OCIA 1JC2A 3I5HB 1QV1A 2COLB 1KSMA 2L5XB 1SNLA 1J7RA 1NCZA 1G4YR 3NXAA 5JJGA 3LL8B 4GAOA 1UHHA 2LC5A 3TDZA 1DJGA 2GGMA 4PHMA 2DOQA 1CDPA 1J7QA 1NX3A 2R2IA 1OZOA 2MLFC 1IQ5A 2L2EA 2JT8A 1J1DA 3LLEA 2H61C 1CNPA 1XFYO 4ZCVA 1RK9A 1OMDA 2LMUA 1IG5A 1QX5B 1B8CA 1W7JB 3O4YA 4PALA 1Q80A 1NX2A 1KQMC 1UURA 1CDNA 1XFZO 1ZFSA 4N1GA 4R1EA 4PE7A 3O2PA 4OV2A 1XFXO 1M63B 2JT3A 3VGOA 2M9GA 1K93D 2Y4QA 2L98A 3EK7A 1K96A 4FQOA 3D10A 1IRJA 5HLVA 1U5IB 3PATA 1HQVA 2GGZA 3BXKA 1WDCC 1QVIY 2KI6C 3SG4A 1TNQA 3KPXA 3OX6A 2KAXA 3NSLA 3VRQA 1CTRA 2F8PA 2E6WA 2HETA 2O5GA 4PHJA 3WHTB 1TOPA 4N5XA 1XYDA 1A75A 2WCEA 2K7CA 2VRGA 5HKZA 3TDIA 1GGWA 1B8RA 2ISDA 5AANA 2LP3A 1B7TY 2FCDA 1N2DA 2FOTA 1OE9B 1KFXS 1PSRA 2HPSA 3BQ3A 5D7FA 2JNXA 1CDMA 1KK7Z 2KFFA 4E68A 3NSOA 5ER4X 1OMVA 1L2OB 1QIWA 2M7NA 5PALA 2HQ8A 1KFUS 1LA3A 2PVBA 2Q91A 3BUWB 4MEWA 5I2QA 1H4BA 1B9AA 1NX0A 4CFQA 1NCXA 3MSEB 4I5NB 1TCFA 2FCEA 4D1EA 1J7OA 1KK8C 2TN4A 1BJFA 2JZIA 4I5JA 1QX7A 3OB2B 1V1FA 2OTGC 4PE4A 1M46A 3JTDC 1IGVA 2KAYA 2LMTA 1K9UA 2NLNA 3TS5C 1J7PA 4PCWA 1DF0A 2KSPA 1F4QA 2HF5A 1TN4A 2P6BB 4NDCA 1SCMC 1K9KA 2H2KA 1WRKA 2BL0C 4NDDA 5CSFA 1LVCD 1NWDA 3CTNA 4DRWA 5I8NA 4UPGA 1X02A 3CWGA 3I5GC 1QIVA 1CLLA 1G8IA 1XFWO 3H4SE 3CR2A 4JPZB 4YGEB 5TNCA 2EC6C 3GK1A 3ICBA 1CFCA 4GNKB 1IQ3A 2LLTA 1ZACA 3PFVA 3LCPC 2EHBA 4XJKA 5HKYA 2Q4UA 1DGUA 2I2RE 1BR1B 2M1KB 2E30A 1JF0A 1BMOA 2ZRTA 3KEVA 1BG1A 3FWBA 2PSRA 3I5IB 3I5HC 4C0JA 2MJWB 1MQ1A 1OSAA 1FI6A 2NCPA 1XO5A 2JULA 2ZFDA 5CSIA 4BY5A 5KU1A 2K61A 1B47A 1YURA 4I5LB 1MUXA 1KK7Y 3BUNB 3VRNA 2OS8B 5I2OA 1CKKA 3O78A 2JRFA 2JPTA 1YUUA 2JC2A 2WCFA 1BLQA 5DKNA 5GQQC 4F0ZB 2PRUA 2LCPA 1WRZA 1XK4A 5AERA 1K8UA 2LHIA 2CTNA 1Y1UA 2D8NA 1EH2A 1TNXA 2LUCA 1G33A 1RROA 2ZNEA 2KBIA 3PLFB 4ORAB 2AMIA 2F33A 2CT9A 1BR4B 1S5GY 2I7AA 2LP2A 2M7LA 2BBNA 4CLNA 1UHIA 2ZNDA 3SJSA 2BKHB 1QLKA 3NSIA 1IKUA 2B1UA 1BODA 1SK6D 1SBJA 1GQMA 2LLSA 5KTYA 5CSJA 4MN0A 2KFHA 2KNEA 2ZRSA 5IBWA 1CMFA 3WHUB 1LXFC 3CR4X 2LNKA 1A29A 2O60A 3D0YA 1DJWA 1MXLC 1S6CA 1EL4A 2H61A 2NXQA 5B8IB 1N0YA 3BUOB 3TUYB 2JXCA 2NCOA 4GGFC 3M0WA 3KHEA 5I2LA 4M2PA 1JUOA 3EVVA 2Y1MA 2BE4A 5DKQA 1LA0A 5F6TA 1L7ZA 1L2OC
chains in the Genus database with same CATH superfamily
1TWOA 2LV7A 2IS9A 1SR6B 1VRKA 3K1EA 4C0LA 2EGDA 5G08A 1B4CA 1PSBA 5CSNA 1A03A 1LINA 2CCMA 1QX2A 1GGZA 3AAKA 1CM1A 1MF8B 1KFXL 2KLEA 3NGVA 2K8MB 2LMVA 2ZKMX 1RECA 2M1UA 2ZN8A 2QACA 1YUTA 1HT9A 2BCBA 3R1OA 1NYAA 5KSZA 4KYNA 1KFUL 3FS7A 1ZOTB 1PULA 1S36A 1Z2CB 2BNXA 2MLEC 1PVAA 3PN7B 2P71A 1K94A 1BT6A 1RTP1 1UHKA 1KQVA 4ORBB 2KDHA 4CFRA 3S0AA 4L9MA 2KI4B 3OX5A 1FPWA 2MHHA 3KO0A 3DVJA 3BUMB 2BE6A 4USLA 3EKJA 2KHNA 4MRYA 5FYXA 2Y1NA 1S1EA 1SRAA 3FE8A 3R1PA 2LVJA 4MZKA 1RJVA 4AQJA 3B7AA 3DF0A 1MHOA 1AUIB 1IWQA 3FWCA 1J1EA 4N1FA 4NQGA 1K95A 1TCOB 1A75B 5HL1A 3PM8A 2JXLA 5D69A 3NSKA 4I5KA 3DVMA 2MAZA 3QRXA 3I5IC 3L4AA 3L4LA 3ZNIA 1CFPA 3EK4A 4P5OE 1YRUB 5HYDA 1OOIX 1JFKA 3CLNA 2ZN9A 4OKHA 4U8DA 5J3XA 1AJ4A 3VRRA 1OZSA 1TUZA 2FJUB 3JVTB 2K0JA 1QASA 3BOWA 1P28A 1ZMZA 1B1GA 2OS8C 2L4HA 3A4UB 2K2FA 2KGBC 3AAJA 1TIZA 1DVIA 4YI8A 1XFUO 2M0RA 1WRLA 1XFVO 1S26D 2F2PA 4YBHB 3ZWHA 1M45A 1UHNA 1YRTB 4HRHA 1DJYA 4HREE 1DT7B 4PHKA 2SASA 2K7BA 1WLMA 3IQOA 3OHMB 2GV5A 5AXIA 4C0KA 3QMEA 1V1GA 4MLWA 1DTLA 1E8AA 1XVJA 2G9BA 1TNWA 3S0GA 2PALA 1OOGA 1SL8A 1NCYA 2WCBA 1C3ZA 3CZ0A 4DUQA 4M2OA 1GJYA 5HKWA 4M2QA 3E3RA 2KOTA 3GOFA 2M3WA 4A4CA 1ALVA 3SIBA 1AJ5A 5BPJA 1ALWA 1Y1XA 1PALA 2JNFA 1KWOB 2M97A 1DEKA 2CNPA 2KGRA 2KPHA 2WCJA 3O4XA 1WY9A 4P2YB 2BBMA 1YUSA 4PDZA 2M29A 3VRPA 1GM0A 1QATA 2PYQA 1FI5A 3D74A 1AP4A 2LE9B 1QVIZ 3GK2A 4MZLA 1DJXA 1F8HA 2PQLA 3I5FB 3SG2A 1NPQA 3EVUA 1AVSA 2JQ6A 1OQPA 2LVKA 3EVRA 3OBVA 4YGDB 1OOHA 5DKRA 4HRGA 3VROA 3AKAA 3O6BA 1H8BA 1SMGA 1SW8A 3FE9A 4MZJA 2LUXA 4XYNA 3CYZA 4JD9A 4ORCB 2MRDA 1BF5A 2F2OA 1SR6C 2LANA 3AKBA 5K89A 2P70A 1U5IA 2JT0A 3CR5X 2BCXA 4Q04A 1UP5A 2M8UA 1S6IA 5D3OA 4DIRA 1AK8A 1QXPA 1R6PA 2LM5A 3K21A 1FBVA 1NP8A 1YTZC 2L4IA 3EK8A 5JOLA 1BU3A 1B8LA 2WCHA 2JOJA 2F3ZA 2KQYA 1QV0A 3OGNA 4GGFA 1A4PA 3B88A 5CPVA 2RGIA 3CABA 3SG6A 4JQ0D 1QWVA 2CBLA 3RLZA 4PE0A 4MBEA 3PN7C 4PHNA 1MWNA 1RFJA 1C7WA 2KI4C 3FE6A 1C07A 1SY9A 3FIAA 2K7DA 4GUKA 1JFJA 2BECA 2H8VA 1YX7A 1TRFA 1CM4A 1QLSA 2SCPA 4JKTA 2KI6D 3D78A 3RZSA 1FF1A 2L51A 1CB1A 2MA2A 1EJ3A 1SL7A 2G2BA 4IL1A 4A4BA 1MR8A 3RM1A 1FW4A 1YVLA 3WXAA 1SYMA 3D0YB 2LHLA 3CGAA 5AEQA 1DMOA 1Y1AA 2JTTA 4PE1A 1KSOA 3S0BA 1QS7A 4AOMA 4ETOA 1F4OA 1CDLA 2I18A 2BCAA 3DY9A 2LVIA 1K2HA 3DXLA 1NX1A 1ODBA 1OOJA 1SKTA 1JBAA 3BUXB 4AQIA 1PVBA 1F70A 1Y0VH 1Y6WA 3LK1A 5FI6A 2LLUA 2WOSA 3GK4X 1KQMB 1XFRA 2KYCA 3OB1B 4GGNA 1LKJA 3JVTC 5AFPA 1WLZA 1JF2A 4QJ3B 1F71A 1NSHA 2QEBA 3V2LA 1OW4A 2A4JA 1BOCA 4ZCUA 2L2CA 1LS8A 3L47A 2I94A 1S6JA 3DVEA 3CS1A 1WDCB 4GFTA 1K90D 3KEVA 3IF7A 2HQWA 1DJHA 1CLMA 2QPTA 1D1OA 3WNXB 2KQ6A 3EKHA 1TUJA 4IJ7A 2MBXA 3DVKA 1PRWA 1YR5A 3SG5A 3TDUA 2JU0A 3DD4A 4JWQA 4WRIA 4DCKA 5ER5A 2JTZA 3B6XA 2KBMA 2LVVA 1NIWA 3SG7A 3IVTA 3A8RA 1CLBA 1F54A 3KF9A 4MVFA 1OMRA 4WQ2A 4YGAA 4HSZA 1CMGA 3HCMA 1QJTA 1SPYA 1A2XA 5DICA 2AAOA 4MSPA 2F3YA 1SCVA 3PALA 1KCYA 3F45A 2KLDA 1N65A 1S3PA 2L5YA 1S5GZ 1TTXA 4WQ3A 4CIDA 1EG4A 1EG3A 1KWOC 2OPOA 1J55A 4BY4A 1QTXA 1UHJA 1XA5A 2K7OA 4QJ4B 1YVHA 1YX8A 1TNPA 1KK8B 1NUBA 2M49B 2WNDA 2LAPA 3DF0B 2KYFA 1DJZA 2OTGB 3JTDB 1AHRA 2L50A 1DF0B 3SIAA 1M31A 4FTGA 1CFDA 4ICBA 3TZ1A 3SS5A 3S0FA 3I5FC 1SL9A 1EXRA 2BKIB 2PMYA 1JSAA 2CXJA 3CZ1A 4YGBB 3TS5B 4CPVA 1MXEA 4YI9A 4MRXA 2BAPA 2KAVA 1R2UA 2NZ0A 3LK0A 4NDBA 4OR9B 4YGCB 1SCMB 3IQQA 3DYEA 3PSRA 4TNCA 2BL0B 2PASA 1W7IB 3BOWB 1IJ6A 2FJYA 2WORA 2Y5IA 1UUSA 1UWOA 3BFAA 1ZUZA 3I5GB 1IJ5A 3SS4A 1IIOA 4YRUA 4XJKB 1PK0D 1CFFA 2EC6B 3C1VA 4OVNF 3TUYC 1C7VA 1DGVA 2WCMA 1RWYA 1JWDA 3NHIA 3CZTX 2WCKA 3SG3A 4QJ5B 1IH0A 1F55A 4DS7A 2KFGA 1XK4C 2WC8A 3OP0A 5HLOA 3BYAA 1K9PA 3HX4A 2JWWA 4GPLB 2V53A 4INWA 1B7TZ 4GBAA 3D75A 2AUCA 1M39A 2K2AA 2L0PA 1DJIA 3D73A 4OCIA 1JC2A 3I5HB 1QV1A 2COLB 1KSMA 2L5XB 1SSEB 1SNLA 1J7RA 1NCZA 1G4YR 3NXAA 5JJGA 3LL8B 4GAOA 3NHTA 1UHHA 2WC5A 2LC5A 2GTEA 3R72A 1DJGA 3TDZA 2GGMA 4PHMA 2DOQA 1CDPA 1J7QA 1NX3A 1T14A 1OZOA 2MLFC 2R2IA 1IQ5A 3PM2A 4OZDA 1Z4HA 2L2EA 2JT8A 1J1DA 2WCLA 3LLEA 5EL2A 2H61C 1CNPA 1XFYO 4ZCVA 1RK9A 1OMDA 2LMUA 1IG5A 1QX5B 3SS3A 4F7FA 1B8CA 1W7JB 3O4YA 4PALA 1Q80A 1NX2A 1KQMC 1UURA 1CDNA 1XFZO 1ZFSA 4N1GA 4R1EA 4PE7A 3O2PA 4OV2A 1XFXO 1M63B 2JT3A 3VGOA 2M9GA 1K93D 2Y4QA 2L98A 3EK7A 1K96A 4FQOA 3D10A 1ORGA 1IRJA 5HLVA 1U5IB 3PATA 1HQVA 2GGZA 3BXKA 1WDCC 1QVIY 2KI6C 3SG4A 1TNQA 3KPXA 3OX6A 2KAXA 3NSLA 3VRQA 1CTRA 2F8PA 2E6WA 2HETA 2O5GA 2WC6A 3D77A 4PHJA 3WHTB 1TOPA 4N5XA 1XYDA 1A75A 2WCEA 2K7CA 2VRGA 3D76A 3Q8IA 5HKZA 3TDIA 1B8RA 2ISDA 5AANA 1GGWA 2LP3A 4INXA 1B7TY 2FCDA 1N2DA 2FOTA 1OE9B 1KFXS 1PSRA 2HPSA 3BQ3A 4PT1A 5D7FA 2JNXA 3B87A 1CDMA 1KK7Z 2KFFA 4E68A 3NSOA 5ER4X 1OMVA 1L2OB 1DQEA 1QIWA 2M7NA 5PALA 2HQ8A 1KFUS 1LA3A 1DELA 2PVBA 2Q91A 3BUWB 4MEWA 5I2QA 1H4BA 1B9AA 1NX0A 4CFQA 1NCXA 3MSEB 4I5NB 1TCFA 2FCEA 4D1EA 1J7OA 1KK8C 2TN4A 1BJFA 2JZIA 4I5JA 1QX7A 3OB2B 1V1FA 2OTGC 4PE4A 1M46A 3JTDC 1IGVA 2KAYA 2LMTA 3DZTA 1K9UA 2NLNA 3TS5C 1J7PA 4PCWA 1DF0A 2KSPA 1F4QA 2HF5A 1TN4A 2P6BB 2YGUA 4NDCA 1SCMC 1K9KA 2H2KA 1WRKA 2BL0C 4NDDA 5CSFA 1LVCD 1NWDA 3CTNA 4DRWA 5I8NA 4UPGA 3N7HA 1X02A 3CWGA 3I5GC 1QIVA 1CLLA 1G8IA 1XFWO 3H4SE 3CR2A 4JPZB 4YGEB 5TNCA 3B86A 2EC6C 3GK1A 3ICBA 1CFCA 4GNKB 1IQ3A 2LLTA 1ZACA 3PFVA 3LCPC 2EHBA 4XJKA 5HKYA 2Q4UA 1DGUA 2I2RE 1BR1B 2K60A 2E30A 1JF0A 1BMOA 2M1KB 2ZRTA 2QEOA 3R1VA 1BG1A 3CDNA 3UNWA 3FWBA 2PSRA 3I5IB 3I5HC 4C0JA 2MJWB 1MQ1A 1OSAA 4FQTA 1FI6A 2NCPA 1XO5A 2JULA 2ZFDA 5CSIA 4BY5A 5KU1A 2K61A 2QEHA 1B47A 1YURA 4I5LB 1MUXA 1KK7Y 3BUNB 3VRNA 3S0EA 2OS8B 5I2OA 1CKKA 3O78A 2JRFA 3EG5B 2JPTA 2ERBA 1YUUA 3VB1A 2JC2A 2WCFA 1BLQA 5DKNA 5GQQC 4F0ZB 2PRUA 2LCPA 1WRZA 1XK4A 5AERA 1K8UA 2QEVA 2LHIA 2CTNA 1Y1UA 2D8NA 1EH2A 3BJHA 1TNXA 2LUCA 1G33A 1RROA 2ZNEA 2KBIA 3PLFB 4ORAB 2AMIA 2F33A 2CT9A 1BR4B 1S5GY 2I7AA 3BFBA 2LP2A 1OOFA 2BBNA 2M7LA 5I94A 4CLNA 1UHIA 2ZNDA 3SJSA 2BKHB 1QLKA 3NSIA 1IKUA 2B1UA 1BODA 1SK6D 1SBJA 1GQMA 2LLSA 3S0DA 5CSJA 5KTYA 4MN0A 2KFHA 2KNEA 2ZRSA 3UO9A 2JPOA 5IBWA 1CMFA 1W9ZA 3WHUB 3PJIA 1LXFC 3CR4X 2LNKA 1A29A 2O60A 3D0YA 5FI7A 1DJWA 1MXLC 1S6CA 1EL4A 2H61A 2NXQA 5B8IB 1N0YA 3BUOB 3BFHA 3TUYB 2JXCA 2NCOA 4GGFC 3M0WA 1C3YA 2QDIA 3KHEA 5I2LA 4M2PA 3CZ2A 1JUOA 3EVVA 2Y1MA 2BE4A 5DKQA 5FI2A 1LA0A 5F6TA 1L7ZA 1L2OC 1DC1A
chains in the Genus database with same CATH topology
2LV7A 2IS9A 1SR6B 1VRKA 4C0LA 2EGDA 5G08A 1B4CA 1PSBA 5CSNA 1A03A 1LINA 2CCMA 1QX2A 1GGZA 3AAKA 1CM1A 1MF8B 1KFXL 2K8MB 2LMVA 2ZKMX 1RECA 2M1UA 2ZN8A 2QACA 1YUTA 1HT9A 2BCBA 1NYAA 5KSZA 1KFUL 3FS7A 1ZOTB 1PULA 1S36A 2MLEC 1PVAA 3PN7B 1KQVA 1K94A 1BT6A 1RTP1 1UHKA 4ORBB 2KDHA 4CFRA 4L9MA 2KI4B 3OX5A 1FPWA 2MHHA 3KO0A 3DVJA 3BUMB 2BE6A 4USLA 3EKJA 2KHNA 4MRYA 5FYXA 2Y1NA 1S1EA 1SRAA 2LVJA 4MZKA 1RJVA 4AQJA 3DF0A 1MHOA 1AUIB 1IWQA 3FWCA 1J1EA 4N1FA 4NQGA 1K95A 1TCOB 1A75B 3PM8A 2JXLA 5D69A 3NSKA 4I5KA 3DVMA 2MAZA 3QRXA 3I5IC 3ZNIA 1CFPA 3EK4A 4P5OE 1YRUB 5HYDA 1JFKA 3CLNA 2ZN9A 4OKHA 4U8DA 5J3XA 1AJ4A 3VRRA 1OZSA 2FJUB 3JVTB 2K0JA 1QASA 3BOWA 1ZMZA 1B1GA 2OS8C 2L4HA 3A4UB 2K2FA 2KGBC 3AAJA 1TIZA 1DVIA 4YI8A 1XFUO 2M0RA 1WRLA 1XFVO 1S26D 2F2PA 4YBHB 3ZWHA 1M45A 1UHNA 1YRTB 4HRHA 1DJYA 4HREE 1DT7B 4PHKA 2SASA 2K7BA 1WLMA 3IQOA 3OHMB 2GV5A 5AXIA 4C0KA 1V1GA 4MLWA 1DTLA 1E8AA 1XVJA 2G9BA 1TNWA 2PALA 1SL8A 1NCYA 2WCBA 4DUQA 4M2OA 1GJYA 5HKWA 4M2QA 3E3RA 2KOTA 3GOFA 2M3WA 4A4CA 1ALVA 3SIBA 1AJ5A 5BPJA 1ALWA 1Y1XA 1PALA 2JNFA 1KWOB 2M97A 2CNPA 2KGRA 4P2YB 1WY9A 2BBMA 1YUSA 4PDZA 2M29A 3VRPA 1QATA 1FI5A 1AP4A 2LE9B 1QVIZ 3GK2A 4MZLA 1DJXA 1F8HA 3I5FB 3SG2A 1NPQA 3EVUA 1AVSA 2JQ6A 1OQPA 2LVKA 3EVRA 4YGDB 5DKRA 4HRGA 3VROA 3AKAA 3O6BA 1H8BA 1SMGA 1SW8A 4MZJA 2LUXA 4XYNA 4ORCB 2MRDA 1BF5A 2F2OA 1SR6C 2LANA 3AKBA 5K89A 1U5IA 2JT0A 3CR5X 2BCXA 4Q04A 1UP5A 2M8UA 1S6IA 1AK8A 4DIRA 1QXPA 1R6PA 2LM5A 3K21A 1FBVA 1NP8A 1YTZC 2L4IA 3EK8A 5JOLA 1BU3A 1B8LA 2JOJA 2F3ZA 2KQYA 1QV0A 4GGFA 1A4PA 5CPVA 2RGIA 3SG6A 4JQ0D 2CBLA 3RLZA 4PE0A 4MBEA 3PN7C 4PHNA 1MWNA 1RFJA 1C7WA 2KI4C 1C07A 1SY9A 3FIAA 2K7DA 4GUKA 1JFJA 2BECA 1YX7A 1TRFA 1CM4A 1QLSA 2SCPA 2KI6D 1FF1A 2L51A 1CB1A 2MA2A 1EJ3A 1SL7A 2G2BA 4IL1A 4A4BA 1MR8A 3RM1A 1FW4A 1YVLA 3WXAA 1SYMA 3D0YB 2LHLA 3CGAA 5AEQA 1DMOA 1Y1AA 2JTTA 4PE1A 1KSOA 4ETOA 1QS7A 4AOMA 1F4OA 1CDLA 2I18A 2BCAA 2LVIA 1K2HA 1NX1A 1ODBA 1OOJA 1SKTA 1JBAA 3BUXB 4AQIA 1PVBA 1F70A 1Y0VH 1Y6WA 3LK1A 2LLUA 2WOSA 3GK4X 1KQMB 2KYCA 3OB1B 4GGNA 1LKJA 3JVTC 5AFPA 1WLZA 1JF2A 4QJ3B 1F71A 1NSHA 2A4JA 1BOCA 4ZCUA 2I94A 1S6JA 3DVEA 3CS1A 1WDCB 4GFTA 1K90D 3IF7A 2HQWA 1DJHA 1CLMA 2QPTA 1D1OA 3WNXB 2KQ6A 3EKHA 2MBXA 3DVKA 1PRWA 1YR5A 3SG5A 3TDUA 2JU0A 3DD4A 4JWQA 4WRIA 4DCKA 5ER5A 2JTZA 2KBMA 2LVVA 1NIWA 3SG7A 3A8RA 1CLBA 1F54A 3KF9A 4MVFA 1OMRA 4WQ2A 4YGAA 4HSZA 1CMGA 3HCMA 1QJTA 1SPYA 1A2XA 2AAOA 4MSPA 2F3YA 1SCVA 3PALA 1KCYA 3F45A 1N65A 1S3PA 1S5GZ 1TTXA 4WQ3A 4CIDA 1EG4A 1EG3A 1KWOC 2OPOA 1J55A 4BY4A 1QTXA 1UHJA 1XA5A 2K7OA 4QJ4B 1YVHA 1YX8A 1TNPA 1KK8B 1NUBA 2M49B 2WNDA 2LAPA 3DF0B 2KYFA 1DJZA 2OTGB 3JTDB 1AHRA 2L50A 1DF0B 3SIAA 1M31A 4FTGA 1CFDA 4ICBA 3TZ1A 3I5FC 1SL9A 1EXRA 2BKIB 2PMYA 1JSAA 2CXJA 4YGBB 3TS5B 4CPVA 1MXEA 4YI9A 4MRXA 3LK0A 2KAVA 1R2UA 2NZ0A 4NDBA 4OR9B 4YGCB 1SCMB 3IQQA 3PSRA 4TNCA 2BL0B 2PASA 1W7IB 3BOWB 1IJ6A 2WORA 2Y5IA 1UUSA 1UWOA 3I5GB 1ZUZA 1IJ5A 4YRUA 4XJKB 1PK0D 1CFFA 2EC6B 3C1VA 4OVNF 3TUYC 1C7VA 1DGVA 1JWDA 1RWYA 3CZTX 3SG3A 4QJ5B 1IH0A 1F55A 4DS7A 2KFGA 1XK4C 2WC8A 3OP0A 5HLOA 3BYAA 1K9PA 3HX4A 2JWWA 4GPLB 2V53A 1B7TZ 4GBAA 2AUCA 1M39A 2K2AA 2L0PA 1DJIA 4OCIA 1JC2A 3I5HB 1QV1A 2COLB 1KSMA 2L5XB 1SNLA 1J7RA 1NCZA 1G4YR 3NXAA 5JJGA 3LL8B 4GAOA 1UHHA 2LC5A 3TDZA 1DJGA 2GGMA 4PHMA 2DOQA 1CDPA 1J7QA 1NX3A 2R2IA 1OZOA 2MLFC 1IQ5A 2L2EA 2JT8A 1J1DA 3LLEA 2H61C 1CNPA 1XFYO 4ZCVA 1RK9A 1OMDA 2LMUA 1IG5A 1QX5B 1B8CA 1W7JB 3O4YA 4PALA 1Q80A 1NX2A 1KQMC 1UURA 1CDNA 1XFZO 1ZFSA 4N1GA 4R1EA 4PE7A 3O2PA 4OV2A 1XFXO 1M63B 2JT3A 3VGOA 2M9GA 1K93D 2Y4QA 2L98A 3EK7A 1K96A 4FQOA 3D10A 1IRJA 5HLVA 1U5IB 3PATA 1HQVA 2GGZA 3BXKA 1WDCC 1QVIY 2KI6C 3SG4A 1TNQA 3KPXA 3OX6A 2KAXA 3NSLA 3VRQA 1CTRA 2F8PA 2E6WA 2HETA 2O5GA 4PHJA 3WHTB 1TOPA 4N5XA 1XYDA 1A75A 2WCEA 2K7CA 2VRGA 5HKZA 3TDIA 1GGWA 1B8RA 2ISDA 5AANA 2LP3A 1B7TY 2FCDA 1N2DA 2FOTA 1OE9B 1KFXS 1PSRA 2HPSA 3BQ3A 5D7FA 2JNXA 1CDMA 1KK7Z 2KFFA 4E68A 3NSOA 5ER4X 1OMVA 1L2OB 1QIWA 2M7NA 5PALA 2HQ8A 1KFUS 1LA3A 2PVBA 2Q91A 3BUWB 4MEWA 5I2QA 1H4BA 1B9AA 1NX0A 4CFQA 1NCXA 3MSEB 4I5NB 1TCFA 2FCEA 4D1EA 1J7OA 1KK8C 2TN4A 1BJFA 2JZIA 4I5JA 1QX7A 3OB2B 1V1FA 2OTGC 4PE4A 1M46A 3JTDC 1IGVA 2KAYA 2LMTA 1K9UA 2NLNA 3TS5C 1J7PA 4PCWA 1DF0A 2KSPA 1F4QA 2HF5A 1TN4A 2P6BB 4NDCA 1SCMC 1K9KA 2H2KA 1WRKA 2BL0C 4NDDA 5CSFA 1LVCD 1NWDA 3CTNA 4DRWA 5I8NA 4UPGA 1X02A 3CWGA 3I5GC 1QIVA 1CLLA 1G8IA 1XFWO 3H4SE 3CR2A 4JPZB 4YGEB 5TNCA 2EC6C 3GK1A 3ICBA 1CFCA 4GNKB 1IQ3A 2LLTA 1ZACA 3PFVA 3LCPC 2EHBA 4XJKA 5HKYA 2Q4UA 1DGUA 2I2RE 1BR1B 2M1KB 2E30A 1JF0A 1BMOA 2ZRTA 3KEVA 1BG1A 3FWBA 2PSRA 3I5IB 3I5HC 4C0JA 2MJWB 1MQ1A 1OSAA 1FI6A 2NCPA 1XO5A 2JULA 2ZFDA 5CSIA 4BY5A 5KU1A 2K61A 1B47A 1YURA 4I5LB 1MUXA 1KK7Y 3BUNB 3VRNA 2OS8B 5I2OA 1CKKA 3O78A 2JRFA 2JPTA 1YUUA 2JC2A 2WCFA 1BLQA 5DKNA 5GQQC 4F0ZB 2PRUA 2LCPA 1WRZA 1XK4A 5AERA 1K8UA 2LHIA 2CTNA 1Y1UA 2D8NA 1EH2A 1TNXA 2LUCA 1G33A 1RROA 2ZNEA 2KBIA 3PLFB 4ORAB 2AMIA 2F33A 2CT9A 1BR4B 1S5GY 2I7AA 2LP2A 2M7LA 2BBNA 4CLNA 1UHIA 2ZNDA 3SJSA 2BKHB 1QLKA 3NSIA 1IKUA 2B1UA 1BODA 1SK6D 1SBJA 1GQMA 2LLSA 5KTYA 5CSJA 4MN0A 2KFHA 2KNEA 2ZRSA 5IBWA 1CMFA 3WHUB 1LXFC 3CR4X 2LNKA 1A29A 2O60A 3D0YA 1DJWA 1MXLC 1S6CA 1EL4A 2H61A 2NXQA 5B8IB 1N0YA 3BUOB 3TUYB 2JXCA 2NCOA 4GGFC 3M0WA 3KHEA 5I2LA 4M2PA 1JUOA 3EVVA 2Y1MA 2BE4A 5DKQA 1LA0A 5F6TA 1L7ZA 1L2OC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LV7 A;  2IS9 A;  1SR6 B;  1VRK A;  4C0L A;  2EGD A;  5G08 A;  1B4C A;  1PSB A;  5CSN A;  1A03 A;  1LIN A;  2CCM A;  1QX2 A;  1GGZ A;  3AAK A;  1CM1 A;  1MF8 B;  1KFX L;  2K8M B;  2LMV A;  2ZKM X;  1REC A;  2M1U A;  2ZN8 A;  2QAC A;  1YUT A;  1HT9 A;  2BCB A;  1NYA A;  5KSZ A;  1KFU L;  3FS7 A;  1ZOT B;  1PUL A;  1S36 A;  2MLE C;  1PVA A;  3PN7 B;  1KQV A;  1K94 A;  1BT6 A;  1RTP 1;  1UHK A;  4ORB B;  2KDH A;  4CFR A;  4L9M A;  2KI4 B;  3OX5 A;  1FPW A;  2MHH A;  3KO0 A;  3DVJ A;  3BUM B;  2BE6 A;  4USL A;  3EKJ A;  2KHN A;  4MRY A;  5FYX A;  2Y1N A;  1S1E A;  1SRA A;  2LVJ A;  4MZK A;  1RJV A;  4AQJ A;  3DF0 A;  1MHO A;  1AUI B;  1IWQ A;  3FWC A;  1J1E A;  4N1F A;  4NQG A;  1K95 A;  1TCO B;  1A75 B;  3PM8 A;  2JXL A;  5D69 A;  3NSK A;  4I5K A;  3DVM A;  2MAZ A;  3QRX A;  3I5I C;  3ZNI A;  1CFP A;  3EK4 A;  4P5O E;  1YRU B;  5HYD A;  1JFK A;  3CLN A;  2ZN9 A;  4OKH A;  4U8D A;  5J3X A;  1AJ4 A;  3VRR A;  1OZS A;  2FJU B;  3JVT B;  2K0J A;  1QAS A;  3BOW A;  1ZMZ A;  1B1G A;  2OS8 C;  2L4H A;  3A4U B;  2K2F A;  2KGB C;  3AAJ A;  1TIZ A;  1DVI A;  4YI8 A;  1XFU O;  2M0R A;  1WRL A;  1XFV O;  1S26 D;  2F2P A;  4YBH B;  3ZWH A;  1M45 A;  1UHN A;  1YRT B;  4HRH A;  1DJY A;  4HRE E;  1DT7 B;  4PHK A;  2SAS A;  2K7B A;  1WLM A;  3IQO A;  3OHM B;  2GV5 A;  5AXI A;  4C0K A;  1V1G A;  4MLW A;  1DTL A;  1E8A A;  1XVJ A;  2G9B A;  1TNW A;  2PAL A;  1SL8 A;  1NCY A;  2WCB A;  4DUQ A;  4M2O A;  1GJY A;  5HKW A;  4M2Q A;  3E3R A;  2KOT A;  3GOF A;  2M3W A;  4A4C A;  1ALV A;  3SIB A;  1AJ5 A;  5BPJ A;  1ALW A;  1Y1X A;  1PAL A;  2JNF A;  1KWO B;  2M97 A;  2CNP A;  2KGR A;  4P2Y B;  1WY9 A;  2BBM A;  1YUS A;  4PDZ A;  2M29 A;  3VRP A;  1QAT A;  1FI5 A;  1AP4 A;  2LE9 B;  1QVI Z;  3GK2 A;  4MZL A;  1DJX A;  1F8H A;  3I5F B;  3SG2 A;  1NPQ A;  3EVU A;  1AVS A;  2JQ6 A;  1OQP A;  2LVK A;  3EVR A;  4YGD B;  5DKR A;  4HRG A;  3VRO A;  3AKA A;  3O6B A;  1H8B A;  1SMG A;  1SW8 A;  4MZJ A;  2LUX A;  4XYN A;  4ORC B;  2MRD A;  1BF5 A;  2F2O A;  1SR6 C;  2LAN A;  3AKB A;  5K89 A;  1U5I A;  2JT0 A;  3CR5 X;  2BCX A;  4Q04 A;  1UP5 A;  2M8U A;  1S6I A;  1AK8 A;  4DIR A;  1QXP A;  1R6P A;  2LM5 A;  3K21 A;  1FBV A;  1NP8 A;  1YTZ C;  2L4I A;  3EK8 A;  5JOL A;  1BU3 A;  1B8L A;  2JOJ A;  2F3Z A;  2KQY A;  1QV0 A;  4GGF A;  1A4P A;  5CPV A;  2RGI A;  3SG6 A;  4JQ0 D;  2CBL A;  3RLZ A;  4PE0 A;  4MBE A;  3PN7 C;  4PHN A;  1MWN A;  1RFJ A;  1C7W A;  2KI4 C;  1C07 A;  1SY9 A;  3FIA A;  2K7D A;  4GUK A;  1JFJ A;  2BEC A;  1YX7 A;  1TRF A;  1CM4 A;  1QLS A;  2SCP A;  2KI6 D;  1FF1 A;  2L51 A;  1CB1 A;  2MA2 A;  1EJ3 A;  1SL7 A;  2G2B A;  4IL1 A;  4A4B A;  1MR8 A;  3RM1 A;  1FW4 A;  1YVL A;  3WXA A;  1SYM A;  3D0Y B;  2LHL A;  3CGA A;  5AEQ A;  1DMO A;  1Y1A A;  2JTT A;  4PE1 A;  1KSO A;  4ETO A;  1QS7 A;  4AOM A;  1F4O A;  1CDL A;  2I18 A;  2BCA A;  2LVI A;  1K2H A;  1NX1 A;  1ODB A;  1OOJ A;  1SKT A;  1JBA A;  3BUX B;  4AQI A;  1PVB A;  1F70 A;  1Y0V H;  1Y6W A;  3LK1 A;  2LLU A;  2WOS A;  3GK4 X;  1KQM B;  2KYC A;  3OB1 B;  4GGN A;  1LKJ A;  3JVT C;  5AFP A;  1WLZ A;  1JF2 A;  4QJ3 B;  1F71 A;  1NSH A;  2A4J A;  1BOC A;  4ZCU A;  2I94 A;  1S6J A;  3DVE A;  3CS1 A;  1WDC B;  4GFT A;  1K90 D;  3IF7 A;  2HQW A;  1DJH A;  1CLM A;  2QPT A;  1D1O A;  3WNX B;  2KQ6 A;  3EKH A;  2MBX A;  3DVK A;  1PRW A;  1YR5 A;  3SG5 A;  3TDU A;  2JU0 A;  3DD4 A;  4JWQ A;  4WRI A;  4DCK A;  5ER5 A;  2JTZ A;  2KBM A;  2LVV A;  1NIW A;  3SG7 A;  3A8R A;  1CLB A;  1F54 A;  3KF9 A;  4MVF A;  1OMR A;  4WQ2 A;  4YGA A;  4HSZ A;  1CMG A;  3HCM A;  1QJT A;  1SPY A;  1A2X A;  2AAO A;  4MSP A;  2F3Y A;  1SCV A;  3PAL A;  1KCY A;  3F45 A;  1N65 A;  1S3P A;  1S5G Z;  1TTX A;  4WQ3 A;  4CID A;  1EG4 A;  1EG3 A;  1KWO C;  2OPO A;  1J55 A;  4BY4 A;  1QTX A;  1UHJ A;  1XA5 A;  2K7O A;  4QJ4 B;  1YVH A;  1YX8 A;  1TNP A;  1KK8 B;  1NUB A;  2M49 B;  2WND A;  2LAP A;  3DF0 B;  2KYF A;  1DJZ A;  2OTG B;  3JTD B;  1AHR A;  2L50 A;  1DF0 B;  3SIA A;  1M31 A;  4FTG A;  1CFD A;  4ICB A;  3TZ1 A;  3I5F C;  1SL9 A;  1EXR A;  2BKI B;  2PMY A;  1JSA A;  2CXJ A;  4YGB B;  3TS5 B;  4CPV A;  1MXE A;  4YI9 A;  4MRX A;  3LK0 A;  2KAV A;  1R2U A;  2NZ0 A;  4NDB A;  4OR9 B;  4YGC B;  1SCM B;  3IQQ A;  3PSR A;  4TNC A;  2BL0 B;  2PAS A;  1W7I B;  3BOW B;  1IJ6 A;  2WOR A;  2Y5I A;  1UUS A;  1UWO A;  3I5G B;  1ZUZ A;  1IJ5 A;  4YRU A;  4XJK B;  1PK0 D;  1CFF A;  2EC6 B;  3C1V A;  4OVN F;  3TUY C;  1C7V A;  1DGV A;  1JWD A;  1RWY A;  3CZT X;  3SG3 A;  4QJ5 B;  1IH0 A;  1F55 A;  4DS7 A;  2KFG A;  1XK4 C;  2WC8 A;  3OP0 A;  5HLO A;  3BYA A;  1K9P A;  3HX4 A;  2JWW A;  4GPL B;  2V53 A;  1B7T Z;  4GBA A;  2AUC A;  1M39 A;  2K2A A;  2L0P A;  1DJI A;  4OCI A;  1JC2 A;  3I5H B;  1QV1 A;  2COL B;  1KSM A;  2L5X B;  1SNL A;  1J7R A;  1NCZ A;  1G4Y R;  3NXA A;  5JJG A;  3LL8 B;  4GAO A;  1UHH A;  2LC5 A;  3TDZ A;  1DJG A;  2GGM A;  4PHM A;  2DOQ A;  1CDP A;  1J7Q A;  1NX3 A;  2R2I A;  1OZO A;  2MLF C;  1IQ5 A;  2L2E A;  2JT8 A;  1J1D A;  3LLE A;  2H61 C;  1CNP A;  1XFY O;  4ZCV A;  1RK9 A;  1OMD A;  2LMU A;  1IG5 A;  1QX5 B;  1B8C A;  1W7J B;  3O4Y A;  4PAL A;  1Q80 A;  1NX2 A;  1KQM C;  1UUR A;  1CDN A;  1XFZ O;  1ZFS A;  4N1G A;  4R1E A;  4PE7 A;  3O2P A;  4OV2 A;  1XFX O;  1M63 B;  2JT3 A;  3VGO A;  2M9G A;  1K93 D;  2Y4Q A;  2L98 A;  3EK7 A;  1K96 A;  4FQO A;  3D10 A;  1IRJ A;  5HLV A;  1U5I B;  3PAT A;  1HQV A;  2GGZ A;  3BXK A;  1WDC C;  1QVI Y;  2KI6 C;  3SG4 A;  1TNQ A;  3KPX A;  3OX6 A;  2KAX A;  3NSL A;  3VRQ A;  1CTR A;  2F8P A;  2E6W A;  2HET A;  2O5G A;  4PHJ A;  3WHT B;  1TOP A;  4N5X A;  1XYD A;  1A75 A;  2WCE A;  2K7C A;  2VRG A;  5HKZ A;  3TDI A;  1GGW A;  1B8R A;  2ISD A;  5AAN A;  2LP3 A;  1B7T Y;  2FCD A;  1N2D A;  2FOT A;  1OE9 B;  1KFX S;  1PSR A;  2HPS A;  3BQ3 A;  5D7F A;  2JNX A;  1CDM A;  1KK7 Z;  2KFF A;  4E68 A;  3NSO A;  5ER4 X;  1OMV A;  1L2O B;  1QIW A;  2M7N A;  5PAL A;  2HQ8 A;  1KFU S;  1LA3 A;  2PVB A;  2Q91 A;  3BUW B;  4MEW A;  5I2Q A;  1H4B A;  1B9A A;  1NX0 A;  4CFQ A;  1NCX A;  3MSE B;  4I5N B;  1TCF A;  2FCE A;  4D1E A;  1J7O A;  1KK8 C;  2TN4 A;  1BJF A;  2JZI A;  4I5J A;  1QX7 A;  3OB2 B;  1V1F A;  2OTG C;  4PE4 A;  1M46 A;  3JTD C;  1IGV A;  2KAY A;  2LMT A;  1K9U A;  2NLN A;  3TS5 C;  1J7P A;  4PCW A;  1DF0 A;  2KSP A;  1F4Q A;  2HF5 A;  1TN4 A;  2P6B B;  4NDC A;  1SCM C;  1K9K A;  2H2K A;  1WRK A;  2BL0 C;  4NDD A;  5CSF A;  1LVC D;  1NWD A;  3CTN A;  4DRW A;  5I8N A;  4UPG A;  1X02 A;  3CWG A;  3I5G C;  1QIV A;  1CLL A;  1G8I A;  1XFW O;  3H4S E;  3CR2 A;  4JPZ B;  4YGE B;  5TNC A;  2EC6 C;  3GK1 A;  3ICB A;  1CFC A;  4GNK B;  1IQ3 A;  2LLT A;  1ZAC A;  3PFV A;  3LCP C;  2EHB A;  4XJK A;  5HKY A;  2Q4U A;  1DGU A;  2I2R E;  1BR1 B;  2M1K B;  2E30 A;  1JF0 A;  1BMO A;  2ZRT A;  3KEV A;  1BG1 A;  3FWB A;  2PSR A;  3I5I B;  3I5H C;  4C0J A;  2MJW B;  1MQ1 A;  1OSA A;  1FI6 A;  2NCP A;  1XO5 A;  2JUL A;  2ZFD A;  5CSI A;  4BY5 A;  5KU1 A;  2K61 A;  1B47 A;  1YUR A;  4I5L B;  1MUX A;  1KK7 Y;  3BUN B;  3VRN A;  2OS8 B;  5I2O A;  1CKK A;  3O78 A;  2JRF A;  2JPT A;  1YUU A;  2JC2 A;  2WCF A;  1BLQ A;  5DKN A;  5GQQ C;  4F0Z B;  2PRU A;  2LCP A;  1WRZ A;  1XK4 A;  5AER A;  1K8U A;  2LHI A;  2CTN A;  1Y1U A;  2D8N A;  1EH2 A;  1TNX A;  2LUC A;  1G33 A;  1RRO A;  2ZNE A;  2KBI A;  3PLF B;  4ORA B;  2AMI A;  2F33 A;  2CT9 A;  1BR4 B;  1S5G Y;  2I7A A;  2LP2 A;  2M7L A;  2BBN A;  4CLN A;  1UHI A;  2ZND A;  3SJS A;  2BKH B;  1QLK A;  3NSI A;  1IKU A;  2B1U A;  1BOD A;  1SK6 D;  1SBJ A;  1GQM A;  2LLS A;  5KTY A;  5CSJ A;  4MN0 A;  2KFH A;  2KNE A;  2ZRS A;  5IBW A;  1CMF A;  3WHU B;  1LXF C;  3CR4 X;  2LNK A;  1A29 A;  2O60 A;  3D0Y A;  1DJW A;  1MXL C;  1S6C A;  1EL4 A;  2H61 A;  2NXQ A;  5B8I B;  1N0Y A;  3BUO B;  3TUY B;  2JXC A;  2NCO A;  4GGF C;  3M0W A;  3KHE A;  5I2L A;  4M2P A;  1JUO A;  3EVV A;  2Y1M A;  2BE4 A;  5DKQ A;  1LA0 A;  5F6T A;  1L7Z A;  1L2O C; 
#chains in the Genus database with same CATH topology
 1TWO A;  2LV7 A;  2IS9 A;  1SR6 B;  1VRK A;  3K1E A;  4C0L A;  2EGD A;  5G08 A;  1B4C A;  1PSB A;  5CSN A;  1A03 A;  1LIN A;  2CCM A;  1QX2 A;  1GGZ A;  3AAK A;  1CM1 A;  1MF8 B;  1KFX L;  2KLE A;  3NGV A;  2K8M B;  2LMV A;  2ZKM X;  1REC A;  2M1U A;  2ZN8 A;  2QAC A;  1YUT A;  1HT9 A;  2BCB A;  3R1O A;  1NYA A;  5KSZ A;  4KYN A;  1KFU L;  3FS7 A;  1ZOT B;  1PUL A;  1S36 A;  1Z2C B;  2BNX A;  2MLE C;  1PVA A;  3PN7 B;  2P71 A;  1K94 A;  1BT6 A;  1RTP 1;  1UHK A;  1KQV A;  4ORB B;  2KDH A;  4CFR A;  3S0A A;  4L9M A;  2KI4 B;  3OX5 A;  1FPW A;  2MHH A;  3KO0 A;  3DVJ A;  3BUM B;  2BE6 A;  4USL A;  3EKJ A;  2KHN A;  4MRY A;  5FYX A;  2Y1N A;  1S1E A;  1SRA A;  3FE8 A;  3R1P A;  2LVJ A;  4MZK A;  1RJV A;  4AQJ A;  3B7A A;  3DF0 A;  1MHO A;  1AUI B;  1IWQ A;  3FWC A;  1J1E A;  4N1F A;  4NQG A;  1K95 A;  1TCO B;  1A75 B;  5HL1 A;  3PM8 A;  2JXL A;  5D69 A;  3NSK A;  4I5K A;  3DVM A;  2MAZ A;  3QRX A;  3I5I C;  3L4A A;  3L4L A;  3ZNI A;  1CFP A;  3EK4 A;  4P5O E;  1YRU B;  5HYD A;  1OOI X;  1JFK A;  3CLN A;  2ZN9 A;  4OKH A;  4U8D A;  5J3X A;  1AJ4 A;  3VRR A;  1OZS A;  1TUZ A;  2FJU B;  3JVT B;  2K0J A;  1QAS A;  3BOW A;  1P28 A;  1ZMZ A;  1B1G A;  2OS8 C;  2L4H A;  3A4U B;  2K2F A;  2KGB C;  3AAJ A;  1TIZ A;  1DVI A;  4YI8 A;  1XFU O;  2M0R A;  1WRL A;  1XFV O;  1S26 D;  2F2P A;  4YBH B;  3ZWH A;  1M45 A;  1UHN A;  1YRT B;  4HRH A;  1DJY A;  4HRE E;  1DT7 B;  4PHK A;  2SAS A;  2K7B A;  1WLM A;  3IQO A;  3OHM B;  2GV5 A;  5AXI A;  4C0K A;  3QME A;  1V1G A;  4MLW A;  1DTL A;  1E8A A;  1XVJ A;  2G9B A;  1TNW A;  3S0G A;  2PAL A;  1OOG A;  1SL8 A;  1NCY A;  2WCB A;  1C3Z A;  3CZ0 A;  4DUQ A;  4M2O A;  1GJY A;  5HKW A;  4M2Q A;  3E3R A;  2KOT A;  3GOF A;  2M3W A;  4A4C A;  1ALV A;  3SIB A;  1AJ5 A;  5BPJ A;  1ALW A;  1Y1X A;  1PAL A;  2JNF A;  1KWO B;  2M97 A;  1DEK A;  2CNP A;  2KGR A;  2KPH A;  2WCJ A;  3O4X A;  1WY9 A;  4P2Y B;  2BBM A;  1YUS A;  4PDZ A;  2M29 A;  3VRP A;  1GM0 A;  1QAT A;  2PYQ A;  1FI5 A;  3D74 A;  1AP4 A;  2LE9 B;  1QVI Z;  3GK2 A;  4MZL A;  1DJX A;  1F8H A;  2PQL A;  3I5F B;  3SG2 A;  1NPQ A;  3EVU A;  1AVS A;  2JQ6 A;  1OQP A;  2LVK A;  3EVR A;  3OBV A;  4YGD B;  1OOH A;  5DKR A;  4HRG A;  3VRO A;  3AKA A;  3O6B A;  1H8B A;  1SMG A;  1SW8 A;  3FE9 A;  4MZJ A;  2LUX A;  4XYN A;  3CYZ A;  4JD9 A;  4ORC B;  2MRD A;  1BF5 A;  2F2O A;  1SR6 C;  2LAN A;  3AKB A;  5K89 A;  2P70 A;  1U5I A;  2JT0 A;  3CR5 X;  2BCX A;  4Q04 A;  1UP5 A;  2M8U A;  1S6I A;  5D3O A;  4DIR A;  1AK8 A;  1QXP A;  1R6P A;  2LM5 A;  3K21 A;  1FBV A;  1NP8 A;  1YTZ C;  2L4I A;  3EK8 A;  5JOL A;  1BU3 A;  1B8L A;  2WCH A;  2JOJ A;  2F3Z A;  2KQY A;  1QV0 A;  3OGN A;  4GGF A;  1A4P A;  3B88 A;  5CPV A;  2RGI A;  3CAB A;  3SG6 A;  4JQ0 D;  1QWV A;  2CBL A;  3RLZ A;  4PE0 A;  4MBE A;  3PN7 C;  4PHN A;  1MWN A;  1RFJ A;  1C7W A;  2KI4 C;  3FE6 A;  1C07 A;  1SY9 A;  3FIA A;  2K7D A;  4GUK A;  1JFJ A;  2BEC A;  2H8V A;  1YX7 A;  1TRF A;  1CM4 A;  1QLS A;  2SCP A;  4JKT A;  2KI6 D;  3D78 A;  3RZS A;  1FF1 A;  2L51 A;  1CB1 A;  2MA2 A;  1EJ3 A;  1SL7 A;  2G2B A;  4IL1 A;  4A4B A;  1MR8 A;  3RM1 A;  1FW4 A;  1YVL A;  3WXA A;  1SYM A;  3D0Y B;  2LHL A;  3CGA A;  5AEQ A;  1DMO A;  1Y1A A;  2JTT A;  4PE1 A;  1KSO A;  3S0B A;  1QS7 A;  4AOM A;  4ETO A;  1F4O A;  1CDL A;  2I18 A;  2BCA A;  3DY9 A;  2LVI A;  1K2H A;  3DXL A;  1NX1 A;  1ODB A;  1OOJ A;  1SKT A;  1JBA A;  3BUX B;  4AQI A;  1PVB A;  1F70 A;  1Y0V H;  1Y6W A;  3LK1 A;  5FI6 A;  2LLU A;  2WOS A;  3GK4 X;  1KQM B;  1XFR A;  2KYC A;  3OB1 B;  4GGN A;  1LKJ A;  3JVT C;  5AFP A;  1WLZ A;  1JF2 A;  4QJ3 B;  1F71 A;  1NSH A;  2QEB A;  3V2L A;  1OW4 A;  2A4J A;  1BOC A;  4ZCU A;  2L2C A;  1LS8 A;  3L47 A;  2I94 A;  1S6J A;  3DVE A;  3CS1 A;  1WDC B;  4GFT A;  1K90 D;  3KEV A;  3IF7 A;  2HQW A;  1DJH A;  1CLM A;  2QPT A;  1D1O A;  3WNX B;  2KQ6 A;  3EKH A;  1TUJ A;  4IJ7 A;  2MBX A;  3DVK A;  1PRW A;  1YR5 A;  3SG5 A;  3TDU A;  2JU0 A;  3DD4 A;  4JWQ A;  4WRI A;  4DCK A;  5ER5 A;  2JTZ A;  3B6X A;  2KBM A;  2LVV A;  1NIW A;  3SG7 A;  3IVT A;  3A8R A;  1CLB A;  1F54 A;  3KF9 A;  4MVF A;  1OMR A;  4WQ2 A;  4YGA A;  4HSZ A;  1CMG A;  3HCM A;  1QJT A;  1SPY A;  1A2X A;  5DIC A;  2AAO A;  4MSP A;  2F3Y A;  1SCV A;  3PAL A;  1KCY A;  3F45 A;  2KLD A;  1N65 A;  1S3P A;  2L5Y A;  1S5G Z;  1TTX A;  4WQ3 A;  4CID A;  1EG4 A;  1EG3 A;  1KWO C;  2OPO A;  1J55 A;  4BY4 A;  1QTX A;  1UHJ A;  1XA5 A;  2K7O A;  4QJ4 B;  1YVH A;  1YX8 A;  1TNP A;  1KK8 B;  1NUB A;  2M49 B;  2WND A;  2LAP A;  3DF0 B;  2KYF A;  1DJZ A;  2OTG B;  3JTD B;  1AHR A;  2L50 A;  1DF0 B;  3SIA A;  1M31 A;  4FTG A;  1CFD A;  4ICB A;  3TZ1 A;  3SS5 A;  3S0F A;  3I5F C;  1SL9 A;  1EXR A;  2BKI B;  2PMY A;  1JSA A;  2CXJ A;  3CZ1 A;  4YGB B;  3TS5 B;  4CPV A;  1MXE A;  4YI9 A;  4MRX A;  2BAP A;  2KAV A;  1R2U A;  2NZ0 A;  3LK0 A;  4NDB A;  4OR9 B;  4YGC B;  1SCM B;  3IQQ A;  3DYE A;  3PSR A;  4TNC A;  2BL0 B;  2PAS A;  1W7I B;  3BOW B;  1IJ6 A;  2FJY A;  2WOR A;  2Y5I A;  1UUS A;  1UWO A;  3BFA A;  1ZUZ A;  3I5G B;  1IJ5 A;  3SS4 A;  1IIO A;  4YRU A;  4XJK B;  1PK0 D;  1CFF A;  2EC6 B;  3C1V A;  4OVN F;  3TUY C;  1C7V A;  1DGV A;  2WCM A;  1RWY A;  1JWD A;  3NHI A;  3CZT X;  2WCK A;  3SG3 A;  4QJ5 B;  1IH0 A;  1F55 A;  4DS7 A;  2KFG A;  1XK4 C;  2WC8 A;  3OP0 A;  5HLO A;  3BYA A;  1K9P A;  3HX4 A;  2JWW A;  4GPL B;  2V53 A;  4INW A;  1B7T Z;  4GBA A;  3D75 A;  2AUC A;  1M39 A;  2K2A A;  2L0P A;  1DJI A;  3D73 A;  4OCI A;  1JC2 A;  3I5H B;  1QV1 A;  2COL B;  1KSM A;  2L5X B;  1SSE B;  1SNL A;  1J7R A;  1NCZ A;  1G4Y R;  3NXA A;  5JJG A;  3LL8 B;  4GAO A;  3NHT A;  1UHH A;  2WC5 A;  2LC5 A;  2GTE A;  3R72 A;  1DJG A;  3TDZ A;  2GGM A;  4PHM A;  2DOQ A;  1CDP A;  1J7Q A;  1NX3 A;  1T14 A;  1OZO A;  2MLF C;  2R2I A;  1IQ5 A;  3PM2 A;  4OZD A;  1Z4H A;  2L2E A;  2JT8 A;  1J1D A;  2WCL A;  3LLE A;  5EL2 A;  2H61 C;  1CNP A;  1XFY O;  4ZCV A;  1RK9 A;  1OMD A;  2LMU A;  1IG5 A;  1QX5 B;  3SS3 A;  4F7F A;  1B8C A;  1W7J B;  3O4Y A;  4PAL A;  1Q80 A;  1NX2 A;  1KQM C;  1UUR A;  1CDN A;  1XFZ O;  1ZFS A;  4N1G A;  4R1E A;  4PE7 A;  3O2P A;  4OV2 A;  1XFX O;  1M63 B;  2JT3 A;  3VGO A;  2M9G A;  1K93 D;  2Y4Q A;  2L98 A;  3EK7 A;  1K96 A;  4FQO A;  3D10 A;  1ORG A;  1IRJ A;  5HLV A;  1U5I B;  3PAT A;  1HQV A;  2GGZ A;  3BXK A;  1WDC C;  1QVI Y;  2KI6 C;  3SG4 A;  1TNQ A;  3KPX A;  3OX6 A;  2KAX A;  3NSL A;  3VRQ A;  1CTR A;  2F8P A;  2E6W A;  2HET A;  2O5G A;  2WC6 A;  3D77 A;  4PHJ A;  3WHT B;  1TOP A;  4N5X A;  1XYD A;  1A75 A;  2WCE A;  2K7C A;  2VRG A;  3D76 A;  3Q8I A;  5HKZ A;  3TDI A;  1B8R A;  2ISD A;  5AAN A;  1GGW A;  2LP3 A;  4INX A;  1B7T Y;  2FCD A;  1N2D A;  2FOT A;  1OE9 B;  1KFX S;  1PSR A;  2HPS A;  3BQ3 A;  4PT1 A;  5D7F A;  2JNX A;  3B87 A;  1CDM A;  1KK7 Z;  2KFF A;  4E68 A;  3NSO A;  5ER4 X;  1OMV A;  1L2O B;  1DQE A;  1QIW A;  2M7N A;  5PAL A;  2HQ8 A;  1KFU S;  1LA3 A;  1DEL A;  2PVB A;  2Q91 A;  3BUW B;  4MEW A;  5I2Q A;  1H4B A;  1B9A A;  1NX0 A;  4CFQ A;  1NCX A;  3MSE B;  4I5N B;  1TCF A;  2FCE A;  4D1E A;  1J7O A;  1KK8 C;  2TN4 A;  1BJF A;  2JZI A;  4I5J A;  1QX7 A;  3OB2 B;  1V1F A;  2OTG C;  4PE4 A;  1M46 A;  3JTD C;  1IGV A;  2KAY A;  2LMT A;  3DZT A;  1K9U A;  2NLN A;  3TS5 C;  1J7P A;  4PCW A;  1DF0 A;  2KSP A;  1F4Q A;  2HF5 A;  1TN4 A;  2P6B B;  2YGU A;  4NDC A;  1SCM C;  1K9K A;  2H2K A;  1WRK A;  2BL0 C;  4NDD A;  5CSF A;  1LVC D;  1NWD A;  3CTN A;  4DRW A;  5I8N A;  4UPG A;  3N7H A;  1X02 A;  3CWG A;  3I5G C;  1QIV A;  1CLL A;  1G8I A;  1XFW O;  3H4S E;  3CR2 A;  4JPZ B;  4YGE B;  5TNC A;  3B86 A;  2EC6 C;  3GK1 A;  3ICB A;  1CFC A;  4GNK B;  1IQ3 A;  2LLT A;  1ZAC A;  3PFV A;  3LCP C;  2EHB A;  4XJK A;  5HKY A;  2Q4U A;  1DGU A;  2I2R E;  1BR1 B;  2K60 A;  2E30 A;  1JF0 A;  1BMO A;  2M1K B;  2ZRT A;  2QEO A;  3R1V A;  1BG1 A;  3CDN A;  3UNW A;  3FWB A;  2PSR A;  3I5I B;  3I5H C;  4C0J A;  2MJW B;  1MQ1 A;  1OSA A;  4FQT A;  1FI6 A;  2NCP A;  1XO5 A;  2JUL A;  2ZFD A;  5CSI A;  4BY5 A;  5KU1 A;  2K61 A;  2QEH A;  1B47 A;  1YUR A;  4I5L B;  1MUX A;  1KK7 Y;  3BUN B;  3VRN A;  3S0E A;  2OS8 B;  5I2O A;  1CKK A;  3O78 A;  2JRF A;  3EG5 B;  2JPT A;  2ERB A;  1YUU A;  3VB1 A;  2JC2 A;  2WCF A;  1BLQ A;  5DKN A;  5GQQ C;  4F0Z B;  2PRU A;  2LCP A;  1WRZ A;  1XK4 A;  5AER A;  1K8U A;  2QEV A;  2LHI A;  2CTN A;  1Y1U A;  2D8N A;  1EH2 A;  3BJH A;  1TNX A;  2LUC A;  1G33 A;  1RRO A;  2ZNE A;  2KBI A;  3PLF B;  4ORA B;  2AMI A;  2F33 A;  2CT9 A;  1BR4 B;  1S5G Y;  2I7A A;  3BFB A;  2LP2 A;  1OOF A;  2BBN A;  2M7L A;  5I94 A;  4CLN A;  1UHI A;  2ZND A;  3SJS A;  2BKH B;  1QLK A;  3NSI A;  1IKU A;  2B1U A;  1BOD A;  1SK6 D;  1SBJ A;  1GQM A;  2LLS A;  3S0D A;  5CSJ A;  5KTY A;  4MN0 A;  2KFH A;  2KNE A;  2ZRS A;  3UO9 A;  2JPO A;  5IBW A;  1CMF A;  1W9Z A;  3WHU B;  3PJI A;  1LXF C;  3CR4 X;  2LNK A;  1A29 A;  2O60 A;  3D0Y A;  5FI7 A;  1DJW A;  1MXL C;  1S6C A;  1EL4 A;  2H61 A;  2NXQ A;  5B8I B;  1N0Y A;  3BUO B;  3BFH A;  3TUY B;  2JXC A;  2NCO A;  4GGF C;  3M0W A;  1C3Y A;  2QDI A;  3KHE A;  5I2L A;  4M2P A;  3CZ2 A;  1JUO A;  3EVV A;  2Y1M A;  2BE4 A;  5DKQ A;  5FI2 A;  1LA0 A;  5F6T A;  1L7Z A;  1L2O C;  1DC1 A; 
#chains in the Genus database with same CATH homology
 2LV7 A;  2IS9 A;  1SR6 B;  1VRK A;  4C0L A;  2EGD A;  5G08 A;  1B4C A;  1PSB A;  5CSN A;  1A03 A;  1LIN A;  2CCM A;  1QX2 A;  1GGZ A;  3AAK A;  1CM1 A;  1MF8 B;  1KFX L;  2K8M B;  2LMV A;  2ZKM X;  1REC A;  2M1U A;  2ZN8 A;  2QAC A;  1YUT A;  1HT9 A;  2BCB A;  1NYA A;  5KSZ A;  1KFU L;  3FS7 A;  1ZOT B;  1PUL A;  1S36 A;  2MLE C;  1PVA A;  3PN7 B;  1KQV A;  1K94 A;  1BT6 A;  1RTP 1;  1UHK A;  4ORB B;  2KDH A;  4CFR A;  4L9M A;  2KI4 B;  3OX5 A;  1FPW A;  2MHH A;  3KO0 A;  3DVJ A;  3BUM B;  2BE6 A;  4USL A;  3EKJ A;  2KHN A;  4MRY A;  5FYX A;  2Y1N A;  1S1E A;  1SRA A;  2LVJ A;  4MZK A;  1RJV A;  4AQJ A;  3DF0 A;  1MHO A;  1AUI B;  1IWQ A;  3FWC A;  1J1E A;  4N1F A;  4NQG A;  1K95 A;  1TCO B;  1A75 B;  3PM8 A;  2JXL A;  5D69 A;  3NSK A;  4I5K A;  3DVM A;  2MAZ A;  3QRX A;  3I5I C;  3ZNI A;  1CFP A;  3EK4 A;  4P5O E;  1YRU B;  5HYD A;  1JFK A;  3CLN A;  2ZN9 A;  4OKH A;  4U8D A;  5J3X A;  1AJ4 A;  3VRR A;  1OZS A;  2FJU B;  3JVT B;  2K0J A;  1QAS A;  3BOW A;  1ZMZ A;  1B1G A;  2OS8 C;  2L4H A;  3A4U B;  2K2F A;  2KGB C;  3AAJ A;  1TIZ A;  1DVI A;  4YI8 A;  1XFU O;  2M0R A;  1WRL A;  1XFV O;  1S26 D;  2F2P A;  4YBH B;  3ZWH A;  1M45 A;  1UHN A;  1YRT B;  4HRH A;  1DJY A;  4HRE E;  1DT7 B;  4PHK A;  2SAS A;  2K7B A;  1WLM A;  3IQO A;  3OHM B;  2GV5 A;  5AXI A;  4C0K A;  1V1G A;  4MLW A;  1DTL A;  1E8A A;  1XVJ A;  2G9B A;  1TNW A;  2PAL A;  1SL8 A;  1NCY A;  2WCB A;  4DUQ A;  4M2O A;  1GJY A;  5HKW A;  4M2Q A;  3E3R A;  2KOT A;  3GOF A;  2M3W A;  4A4C A;  1ALV A;  3SIB A;  1AJ5 A;  5BPJ A;  1ALW A;  1Y1X A;  1PAL A;  2JNF A;  1KWO B;  2M97 A;  2CNP A;  2KGR A;  4P2Y B;  1WY9 A;  2BBM A;  1YUS A;  4PDZ A;  2M29 A;  3VRP A;  1QAT A;  1FI5 A;  1AP4 A;  2LE9 B;  1QVI Z;  3GK2 A;  4MZL A;  1DJX A;  1F8H A;  3I5F B;  3SG2 A;  1NPQ A;  3EVU A;  1AVS A;  2JQ6 A;  1OQP A;  2LVK A;  3EVR A;  4YGD B;  5DKR A;  4HRG A;  3VRO A;  3AKA A;  3O6B A;  1H8B A;  1SMG A;  1SW8 A;  4MZJ A;  2LUX A;  4XYN A;  4ORC B;  2MRD A;  1BF5 A;  2F2O A;  1SR6 C;  2LAN A;  3AKB A;  5K89 A;  1U5I A;  2JT0 A;  3CR5 X;  2BCX A;  4Q04 A;  1UP5 A;  2M8U A;  1S6I A;  1AK8 A;  4DIR A;  1QXP A;  1R6P A;  2LM5 A;  3K21 A;  1FBV A;  1NP8 A;  1YTZ C;  2L4I A;  3EK8 A;  5JOL A;  1BU3 A;  1B8L A;  2JOJ A;  2F3Z A;  2KQY A;  1QV0 A;  4GGF A;  1A4P A;  5CPV A;  2RGI A;  3SG6 A;  4JQ0 D;  2CBL A;  3RLZ A;  4PE0 A;  4MBE A;  3PN7 C;  4PHN A;  1MWN A;  1RFJ A;  1C7W A;  2KI4 C;  1C07 A;  1SY9 A;  3FIA A;  2K7D A;  4GUK A;  1JFJ A;  2BEC A;  1YX7 A;  1TRF A;  1CM4 A;  1QLS A;  2SCP A;  2KI6 D;  1FF1 A;  2L51 A;  1CB1 A;  2MA2 A;  1EJ3 A;  1SL7 A;  2G2B A;  4IL1 A;  4A4B A;  1MR8 A;  3RM1 A;  1FW4 A;  1YVL A;  3WXA A;  1SYM A;  3D0Y B;  2LHL A;  3CGA A;  5AEQ A;  1DMO A;  1Y1A A;  2JTT A;  4PE1 A;  1KSO A;  4ETO A;  1QS7 A;  4AOM A;  1F4O A;  1CDL A;  2I18 A;  2BCA A;  2LVI A;  1K2H A;  1NX1 A;  1ODB A;  1OOJ A;  1SKT A;  1JBA A;  3BUX B;  4AQI A;  1PVB A;  1F70 A;  1Y0V H;  1Y6W A;  3LK1 A;  2LLU A;  2WOS A;  3GK4 X;  1KQM B;  2KYC A;  3OB1 B;  4GGN A;  1LKJ A;  3JVT C;  5AFP A;  1WLZ A;  1JF2 A;  4QJ3 B;  1F71 A;  1NSH A;  2A4J A;  1BOC A;  4ZCU A;  2I94 A;  1S6J A;  3DVE A;  3CS1 A;  1WDC B;  4GFT A;  1K90 D;  3IF7 A;  2HQW A;  1DJH A;  1CLM A;  2QPT A;  1D1O A;  3WNX B;  2KQ6 A;  3EKH A;  2MBX A;  3DVK A;  1PRW A;  1YR5 A;  3SG5 A;  3TDU A;  2JU0 A;  3DD4 A;  4JWQ A;  4WRI A;  4DCK A;  5ER5 A;  2JTZ A;  2KBM A;  2LVV A;  1NIW A;  3SG7 A;  3A8R A;  1CLB A;  1F54 A;  3KF9 A;  4MVF A;  1OMR A;  4WQ2 A;  4YGA A;  4HSZ A;  1CMG A;  3HCM A;  1QJT A;  1SPY A;  1A2X A;  2AAO A;  4MSP A;  2F3Y A;  1SCV A;  3PAL A;  1KCY A;  3F45 A;  1N65 A;  1S3P A;  1S5G Z;  1TTX A;  4WQ3 A;  4CID A;  1EG4 A;  1EG3 A;  1KWO C;  2OPO A;  1J55 A;  4BY4 A;  1QTX A;  1UHJ A;  1XA5 A;  2K7O A;  4QJ4 B;  1YVH A;  1YX8 A;  1TNP A;  1KK8 B;  1NUB A;  2M49 B;  2WND A;  2LAP A;  3DF0 B;  2KYF A;  1DJZ A;  2OTG B;  3JTD B;  1AHR A;  2L50 A;  1DF0 B;  3SIA A;  1M31 A;  4FTG A;  1CFD A;  4ICB A;  3TZ1 A;  3I5F C;  1SL9 A;  1EXR A;  2BKI B;  2PMY A;  1JSA A;  2CXJ A;  4YGB B;  3TS5 B;  4CPV A;  1MXE A;  4YI9 A;  4MRX A;  3LK0 A;  2KAV A;  1R2U A;  2NZ0 A;  4NDB A;  4OR9 B;  4YGC B;  1SCM B;  3IQQ A;  3PSR A;  4TNC A;  2BL0 B;  2PAS A;  1W7I B;  3BOW B;  1IJ6 A;  2WOR A;  2Y5I A;  1UUS A;  1UWO A;  3I5G B;  1ZUZ A;  1IJ5 A;  4YRU A;  4XJK B;  1PK0 D;  1CFF A;  2EC6 B;  3C1V A;  4OVN F;  3TUY C;  1C7V A;  1DGV A;  1JWD A;  1RWY A;  3CZT X;  3SG3 A;  4QJ5 B;  1IH0 A;  1F55 A;  4DS7 A;  2KFG A;  1XK4 C;  2WC8 A;  3OP0 A;  5HLO A;  3BYA A;  1K9P A;  3HX4 A;  2JWW A;  4GPL B;  2V53 A;  1B7T Z;  4GBA A;  2AUC A;  1M39 A;  2K2A A;  2L0P A;  1DJI A;  4OCI A;  1JC2 A;  3I5H B;  1QV1 A;  2COL B;  1KSM A;  2L5X B;  1SNL A;  1J7R A;  1NCZ A;  1G4Y R;  3NXA A;  5JJG A;  3LL8 B;  4GAO A;  1UHH A;  2LC5 A;  3TDZ A;  1DJG A;  2GGM A;  4PHM A;  2DOQ A;  1CDP A;  1J7Q A;  1NX3 A;  2R2I A;  1OZO A;  2MLF C;  1IQ5 A;  2L2E A;  2JT8 A;  1J1D A;  3LLE A;  2H61 C;  1CNP A;  1XFY O;  4ZCV A;  1RK9 A;  1OMD A;  2LMU A;  1IG5 A;  1QX5 B;  1B8C A;  1W7J B;  3O4Y A;  4PAL A;  1Q80 A;  1NX2 A;  1KQM C;  1UUR A;  1CDN A;  1XFZ O;  1ZFS A;  4N1G A;  4R1E A;  4PE7 A;  3O2P A;  4OV2 A;  1XFX O;  1M63 B;  2JT3 A;  3VGO A;  2M9G A;  1K93 D;  2Y4Q A;  2L98 A;  3EK7 A;  1K96 A;  4FQO A;  3D10 A;  1IRJ A;  5HLV A;  1U5I B;  3PAT A;  1HQV A;  2GGZ A;  3BXK A;  1WDC C;  1QVI Y;  2KI6 C;  3SG4 A;  1TNQ A;  3KPX A;  3OX6 A;  2KAX A;  3NSL A;  3VRQ A;  1CTR A;  2F8P A;  2E6W A;  2HET A;  2O5G A;  4PHJ A;  3WHT B;  1TOP A;  4N5X A;  1XYD A;  1A75 A;  2WCE A;  2K7C A;  2VRG A;  5HKZ A;  3TDI A;  1GGW A;  1B8R A;  2ISD A;  5AAN A;  2LP3 A;  1B7T Y;  2FCD A;  1N2D A;  2FOT A;  1OE9 B;  1KFX S;  1PSR A;  2HPS A;  3BQ3 A;  5D7F A;  2JNX A;  1CDM A;  1KK7 Z;  2KFF A;  4E68 A;  3NSO A;  5ER4 X;  1OMV A;  1L2O B;  1QIW A;  2M7N A;  5PAL A;  2HQ8 A;  1KFU S;  1LA3 A;  2PVB A;  2Q91 A;  3BUW B;  4MEW A;  5I2Q A;  1H4B A;  1B9A A;  1NX0 A;  4CFQ A;  1NCX A;  3MSE B;  4I5N B;  1TCF A;  2FCE A;  4D1E A;  1J7O A;  1KK8 C;  2TN4 A;  1BJF A;  2JZI A;  4I5J A;  1QX7 A;  3OB2 B;  1V1F A;  2OTG C;  4PE4 A;  1M46 A;  3JTD C;  1IGV A;  2KAY A;  2LMT A;  1K9U A;  2NLN A;  3TS5 C;  1J7P A;  4PCW A;  1DF0 A;  2KSP A;  1F4Q A;  2HF5 A;  1TN4 A;  2P6B B;  4NDC A;  1SCM C;  1K9K A;  2H2K A;  1WRK A;  2BL0 C;  4NDD A;  5CSF A;  1LVC D;  1NWD A;  3CTN A;  4DRW A;  5I8N A;  4UPG A;  1X02 A;  3CWG A;  3I5G C;  1QIV A;  1CLL A;  1G8I A;  1XFW O;  3H4S E;  3CR2 A;  4JPZ B;  4YGE B;  5TNC A;  2EC6 C;  3GK1 A;  3ICB A;  1CFC A;  4GNK B;  1IQ3 A;  2LLT A;  1ZAC A;  3PFV A;  3LCP C;  2EHB A;  4XJK A;  5HKY A;  2Q4U A;  1DGU A;  2I2R E;  1BR1 B;  2M1K B;  2E30 A;  1JF0 A;  1BMO A;  2ZRT A;  3KEV A;  1BG1 A;  3FWB A;  2PSR A;  3I5I B;  3I5H C;  4C0J A;  2MJW B;  1MQ1 A;  1OSA A;  1FI6 A;  2NCP A;  1XO5 A;  2JUL A;  2ZFD A;  5CSI A;  4BY5 A;  5KU1 A;  2K61 A;  1B47 A;  1YUR A;  4I5L B;  1MUX A;  1KK7 Y;  3BUN B;  3VRN A;  2OS8 B;  5I2O A;  1CKK A;  3O78 A;  2JRF A;  2JPT A;  1YUU A;  2JC2 A;  2WCF A;  1BLQ A;  5DKN A;  5GQQ C;  4F0Z B;  2PRU A;  2LCP A;  1WRZ A;  1XK4 A;  5AER A;  1K8U A;  2LHI A;  2CTN A;  1Y1U A;  2D8N A;  1EH2 A;  1TNX A;  2LUC A;  1G33 A;  1RRO A;  2ZNE A;  2KBI A;  3PLF B;  4ORA B;  2AMI A;  2F33 A;  2CT9 A;  1BR4 B;  1S5G Y;  2I7A A;  2LP2 A;  2M7L A;  2BBN A;  4CLN A;  1UHI A;  2ZND A;  3SJS A;  2BKH B;  1QLK A;  3NSI A;  1IKU A;  2B1U A;  1BOD A;  1SK6 D;  1SBJ A;  1GQM A;  2LLS A;  5KTY A;  5CSJ A;  4MN0 A;  2KFH A;  2KNE A;  2ZRS A;  5IBW A;  1CMF A;  3WHU B;  1LXF C;  3CR4 X;  2LNK A;  1A29 A;  2O60 A;  3D0Y A;  1DJW A;  1MXL C;  1S6C A;  1EL4 A;  2H61 A;  2NXQ A;  5B8I B;  1N0Y A;  3BUO B;  3TUY B;  2JXC A;  2NCO A;  4GGF C;  3M0W A;  3KHE A;  5I2L A;  4M2P A;  1JUO A;  3EVV A;  2Y1M A;  2BE4 A;  5DKQ A;  1LA0 A;  5F6T A;  1L7Z A;  1L2O C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...