1B8CA

Parvalbumin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
108
structure length
108
Chain Sequence
AFAGVLNDADIAAALEACKAADSFNHKAFFAKVGLTSKSADDVKKAFAIIAQDKSGFIEEDELKLFLQNFKADARALTDGETKTFLKAGDSDGDGKIGVDDWTALVKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PARVALBUMIN)
publication title Metal-ion affinity and specificity in EF-hand proteins: coordination geometry and domain plasticity in parvalbumin.
pubmed doi rcsb
source organism Cyprinus carpio
molecule tags Calcium binding protein
total genus 34
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1b8cA00
2E30A 1K8UA 1DJGA 1LVCD 1BR4B 1M46A 2CBLA 3OX6A 1UUSA 1KFXL 1Y1AA 2KBIA 1XFVO 2HETA 3LK1A 4ZCVA 3TUYB 1XYDA 3KF9A 4PE1A 3KHEA 1OE9B 2COLB 1K2HA 2PASA 1UURA 2CCMA 2KI6D 2L5XB 4OCIA 5DKRA 2M49B 1FI5A 1UHNA 1SY9A 4PE7A 1Y1XA 2BL0B 1QTXA 4MBEA 1S6CA 2G2BA 1PRWA 4GAOA 5HKWA 1CTRA 2SCPA 1EH2A 2Y1MA 3VRQA 1S36A 3GK2A 2JQ6A 4DS7A 2LVKA 1QIWA 2Y1NA 1K94A 1IKUA 2L98A 1CMGA 2M9GA 4GGFA 3PLFB 2LLUA 3VRNA 2KYCA 1QVIZ 2JPTA 1L2OB 2F8PA 2VRGA 3ZNIA 3EK7A 3CWGA 1J7QA 2PALA 2KGRA 2L51A 1XFXO 3LK0A 4JQ0D 2K2FA 4NDDA 1TCOB 5GQQC 4QJ4B 2PVBA 2EC6C 3LCPC 1QV1A 1G8IA 3PFVA 1OMRA 3AKAA 2KFHA 2WC8A 2LHIA 2Q91A 3LLEA 2F3ZA 2G9BA 5D69A 2BKHB 1LKJA 2NCOA 3O78A 3O6BA 4I5LB 2EHBA 4FQOA 2WCEA 2K7DA 5JJGA 4GUKA 1CM1A 1CB1A 2BCXA 1OOJA 4C0LA 1C7WA 3DVEA 3A4UB 1ZMZA 1N2DA 2WCBA 3BOWA 3GK4X 2LAPA 2AUCA 1KK8B 1OZOA 2LCPA 2CTNA 3OP0A 3CR5X 3JTDB 3CS1A 1B7TZ 3I5HB 3FWCA 2ZKMX 2ZN8A 3TDIA 5HYDA 2MRDA 1BODA 1CKKA 2R2IA 5ER4X 4M2QA 2K7BA 2F33A 3WHTB 4ZCUA 5CPVA 4F0ZB 1KSMA 3SG3A 1TNXA 1UP5A 2P6BB 1SCMB 3RM1A 4CLNA 2BE6A 1B4CA 3OHMB 2OS8B 1KQVA 3VROA 1K9PA 1XK4A 4I5NB 1ALWA 3CGAA 4MRXA 1ZFSA 1JC2A 1K93D 1NX1A 4WRIA 3DVKA 5CSNA 1RWYA 1IWQA 5CSFA 3WNXB 1TOPA 1S26D 2EGDA 5HKZA 1B1GA 4M2OA 2OTGB 1YUUA 1PALA 4HRGA 4TNCA 1UHJA 3NXAA 4NQGA 1K95A 1EG3A 2ISDA 2KDHA 3AKBA 2JT8A 4PE0A 1SRAA 5BPJA 1UHHA 2M3WA 1A75A 4M2PA 1YURA 5KTYA 1DF0B 2FOTA 1HT9A 1SR6C 1TN4A 2MLEC 2PSRA 1K9KA 1B9AA 1JFJA 4OR9B 1EJ3A 2MBXA 2JT0A 1AK8A 1XVJA 2LVIA 1WRKA 2M8UA 5ER5A 3OB1B 5I2QA 3NSLA 1A75B 4BY4A 4CFQA 1AUIB 5FYXA 3VGOA 2L2EA 1PVBA 5AERA 5AFPA 3DVJA 1DJYA 5AEQA 2Y4QA 3I5FC 1HQVA 4C0JA 1DJXA 2KAXA 4MZKA 3CTNA 4HSZA 4PDZA 1FW4A 3CR2A 4YI8A 3PN7C 1DVIA 1J1DA 1EXRA 4YGBB 1G4YR 1JUOA 1NPQA 2H61C 5D7FA 1A29A 1AVSA 1JWDA 1NX3A 1XFWO 2L0PA 1DJHA 4ICBA 1J7PA 4C0KA 4MZJA 1LINA 3LL8B 1FPWA 1RTP1 2LUCA 4N1FA 1KFUL 1YVHA 2EC6B 2L50A 2WCFA 4NDCA 2FCEA 5I2LA 4BY5A 1Q80A 4IL1A 2TN4A 2JNXA 5CSJA 2CNPA 1SL9A 1B8RA 3GOFA 1MXLC 3TS5C 2M1KB 1YUTA 3EKJA 4PCWA 1QX7A 2M7LA 1ALVA 3JVTC 4I5JA 2Y5IA 2LE9B 3HCMA 3EVVA 1H4BA 1NX0A 2BKIB 5I8NA 1NCZA 4MEWA 2JNFA 1TNWA 3A8RA 1F4OA 1UHIA 1M45A 1F55A 1BT6A 4A4BA 2WNDA 2FCDA 2LC5A 5J3XA 3FIAA 3I5IC 3EVRA 2AMIA 2NZ0A 1NX2A 1MQ1A 1DJWA 4USLA 1XO5A 1N0YA 3H4SE 2GV5A 1YVLA 2NCPA 3TDUA 1DT7B 1G33A 3O2PA 1CFDA 1WLMA 1KFXS 4CFRA 2D8NA 2KNEA 5I2OA 1QLKA 4GGNA 3VRRA 5DKQA 3EKHA 1KK7Z 4ORBB 1FBVA 1S6IA 2KYFA 2LANA 5F6TA 1LA0A 1UWOA 1R2UA 1CLMA 1YX7A 5AANA 4L9MA 2L4IA 1X02A 4PALA 1OMVA 1W7IB 3NSIA 1WDCB 4PHJA 4I5KA 1S5GY 2GGMA 2JTTA 3BOWB 1Y0VH 3SJSA 1J7OA 2DOQA 1KWOC 1RJVA 1WY9A 5HLOA 1CFCA 2LP2A 4GBAA 2KSPA 2V53A 4N1GA 4WQ3A 3IQQA 2MHHA 2Q4UA 4N5XA 1SKTA 5AXIA 1SL8A 1QX5B 1RFJA 1PULA 3QRXA 2LNKA 1SL7A 1SR6B 2I94A 5TNCA 1TCFA 2ZRSA 1JBAA 1BOCA 1F71A 1SK6D 1BG1A 4HREE 3TZ1A 2LMUA 3M0WA 4AQIA 3EK4A 4NDBA 1QIVA 1QVIY 4PE4A 3O4YA 3KPXA 3PM8A 5PALA 1MR8A 2H61A 1S3PA 1FF1A 1F54A 1AJ5A 1JFKA 4UPGA 1BLQA 3IF7A 1KQMC 4A4CA 1FI6A 1J7RA 1GGZA 1KK8C 1NIWA 2K8MB 1OMDA 2ZNEA 1CLBA 3SIAA 4DIRA 1YTZC 2SASA 2BCAA 2KI4C 3WHUB 1CFFA 4JPZB 1SPYA 3OX5A 1ZACA 1DGVA 2LP3A 3D10A 3PN7B 4JWQA 1TTXA 1QXPA 3GK1A 1B8LA 2M29A 2JU0A 2MLFC 3EK8A 3KO0A 1DJZA 1QASA 2K7OA 3FWBA 4ORAB 2KGBC 2QPTA 3BUOB 1IQ5A 2CXJA 1SNLA 2KAYA 1MXEA 2RGIA 1S6JA 2JRFA 4YGCB 1QV0A 2OS8C 1OZSA 3K21A 1H8BA 3ICBA 2F3YA 2E6WA 2PRUA 3SG4A 1GGWA 4PHKA 1VRKA 2LMVA 2K61A 4QJ3B 4PHNA 1ODBA 1B7TY 3TS5B 1IH0A 2KFGA 5HKYA 2LVVA 1YX8A 2OTGC 1CNPA 1TNPA 1U5IA 3JVTB 1CDMA 3DVMA 3I5GC 2KI6C 1TRFA 2LHLA 2HQWA 1YRUB 3E3RA 1QLSA 2KQYA 1KCYA 2JC2A 2O5GA 1XA5A 2I7AA 4HRHA 1SW8A 4CPVA 5CSIA 1SCVA 1QX2A 1YUSA 1GQMA 2A4JA 1TIZA 2BE4A 3CLNA 4YI9A 1CFPA 1NCYA 3BUXB 3I5IB 3PALA 1BJFA 4AQJA 1U5IB 1WRLA 1M39A 1S5GZ 1F70A 1K96A 1TNQA 1RECA 1W7JB 2M0RA 4PHMA 2ZNDA 1B47A 3IQOA 1RROA 3BYAA 3OB2B 4CIDA 1BF5A 2I2RE 1Y1UA 2K0JA 4XYNA 1DGUA 1MWNA 3SG5A 4OVNF 2JXCA 1XFZO 1AJ4A 2BECA 3C1VA 1SBJA 3HX4A 2BCBA 2M97A 1DMOA 1NWDA 1QATA 2LUXA 3CZTX 1IG5A 3TUYC 2JTZA 3AAKA 4GNKB 1OSAA 2MAZA 2HPSA 3CR4X 4MN0A 1GJYA 1NYAA 2HQ8A 2O60A 2WOSA 1KSOA 1JF0A 2NXQA 3BQ3A 1KWOB 2BL0C 1F4QA 4Q04A 1C07A 4YBHB 2JT3A 1OQPA 2JXLA 2LM5A 2ZN9A 1QJTA 1K90D 5DKNA 3NSOA 1YR5A 1JF2A 1M31A 1XFUO 1YRTB 4WQ2A 2ZRTA 4YGEB 4OKHA 1DJIA 1AHRA 3SIBA 1MUXA 4MLWA 4QJ5B 1V1GA 1L2OC 4GPLB 1Y6WA 2L4HA 3PATA 1KFUS 1PVAA 1L7ZA 1IJ5A 1XFYO 1RK9A 1SMGA 1E8AA 2LLTA 4ORCB 3SG2A 1KQMB 5JOLA 3BUWB 3RLZA 2M7NA 2M1UA 1N65A 3BUMB 1PSRA 3F45A 2B1UA 1BMOA 2LV7A 1WLZA 1A4PA 3ZWHA 4GGFC 2HF5A 5G08A 1CDPA 1NSHA 2BBMA 2KHNA 2IS9A 5KSZA 2KI4B 1LA3A 2JZIA 4GFTA 1EL4A 5KU1A 2CT9A 4YRUA 2I18A 4R1EA 1LXFC 5B8IB 2K2AA 1S1EA 4MRYA 4AOMA 1NP8A 2JOJA 4DCKA 1CMFA 1CM4A 3VRPA 4P2YB 4YGAA 3EVUA 2PMYA 3D0YA 3BXKA 2LMTA 2H2KA 3SG6A 2F2PA 3PSRA 2QACA 4P5OE 4YGDB 4MZLA 1CDLA 1IJ6A 2GGZA 3BUNB 4ETOA 3DF0A 3JTDC 4FTGA 1DF0A 3I5FB 4U8DA 5K89A 2KBMA 5HLVA 3I5HC 4MSPA 1WRZA 1MF8B 1NCXA 1EG4A 1PSBA 1WDCC 1V1FA 3I5GB 3FS7A 3SG7A 2KFFA 3D0YB 1CLLA 1MHOA 4D1EA 4DRWA 1IRJA 2KAVA 1A03A 1SCMC 2WORA 1F8HA 2OPOA 2KQ6A 4MVFA 1BU3A 3DF0B 1J55A 5IBWA 1K9UA 2LLSA 3KEVA 4XJKA 4DUQA 2NLNA 1D1OA 1SYMA 2LVJA 1A2XA 2FJUB 1PK0D 2MA2A 1KK7Y 1UHKA 2JWWA 2F2OA 1JSAA 1R6PA 3WXAA 1NUBA 3DD4A 2BBNA 1J1EA 1B8CA 2AAOA 1M63B 3NSKA 1ZUZA 2MJWB 1C7VA 4E68A 1DTLA 1IQ3A 1XK4C 4OV2A 2ZFDA 4XJKB 1AP4A 3MSEB 1CDNA 2JULA 1BR1B 1IGVA 2K7CA 1QS7A 3TDZA 3AAJA 1ZOTB 2KOTA
chains in the Genus database with same CATH superfamily
2E30A 1K8UA 1DJGA 3D75A 1LVCD 1BR4B 1M46A 2CBLA 3OX6A 4INWA 1UUSA 5D3OA 1KFXL 1Y1AA 2KBIA 1XFVO 2HETA 3CZ2A 3LK1A 4ZCVA 3TUYB 1XYDA 3KF9A 4PE1A 2YGUA 1TUJA 3KHEA 1OE9B 2COLB 3S0GA 1K2HA 2PASA 1UURA 2CCMA 2KI6D 2L5XB 4OCIA 5DKRA 2M49B 1FI5A 1UHNA 1SY9A 4PE7A 1Y1XA 2BL0B 1XFRA 1QTXA 4MBEA 1S6CA 2G2BA 1LS8A 1PRWA 4GAOA 3D76A 1CTRA 2SCPA 3NHTA 5HKWA 2QEOA 1EH2A 2Y1MA 3SS4A 3VRQA 2KLDA 1S36A 3GK2A 2JQ6A 3L4AA 3R72A 3S0DA 2LVKA 1QIWA 4DS7A 2Y1NA 1K94A 1IKUA 2L98A 1CMGA 2M9GA 4GGFA 3PLFB 2LLUA 3VRNA 2KYCA 1QVIZ 2JPTA 1L2OB 2F8PA 2VRGA 3ZNIA 3EK7A 3CWGA 1J7QA 2PALA 2KGRA 2L51A 1XFXO 3LK0A 4JQ0D 2K2FA 4NDDA 1TCOB 5GQQC 4QJ4B 2PVBA 2EC6C 3LCPC 1QV1A 1G8IA 3PFVA 1OMRA 3AKAA 2KFHA 2PQLA 2LHIA 2WC8A 2Q91A 3CDNA 3K1EA 3LLEA 2BAPA 2F3ZA 5FI2A 2G9BA 5D69A 2BKHB 1LKJA 2NCOA 3O78A 3O6BA 4I5LB 2EHBA 4FQOA 2WCEA 2K7DA 5JJGA 4GUKA 1CM1A 1CB1A 2BCXA 1OOJA 4C0LA 1C7WA 3DVEA 3A4UB 1ZMZA 1N2DA 2WCBA 3BOWA 3GK4X 2LAPA 2AUCA 1KK8B 3D77A 1OZOA 2LCPA 2CTNA 2WCMA 4PT1A 3OP0A 3CR5X 3JTDB 3CS1A 1B7TZ 3I5HB 3FWCA 2ZKMX 2ZN8A 3TDIA 5HYDA 2MRDA 1BODA 1CKKA 2R2IA 5ER4X 4M2QA 2K7BA 3DY9A 2F33A 3WHTB 4ZCUA 5CPVA 4F0ZB 1KSMA 3SG3A 1TNXA 1UP5A 2P6BB 3CZ0A 2WC6A 1SCMB 1T14A 3RM1A 4CLNA 2BE6A 1B4CA 3OHMB 2OS8B 3OBVA 1KQVA 3VROA 1K9PA 1XK4A 4I5NB 3D74A 1ALWA 1TWOA 3CGAA 4MRXA 1ZFSA 1JC2A 1K93D 1NX1A 4WRIA 3DVKA 5CSNA 1RWYA 1IWQA 5CSFA 3WNXB 1TOPA 2WCHA 1S26D 2EGDA 5HKZA 3EG5B 4M2OA 1B1GA 2OTGB 1YUUA 1PALA 4HRGA 4TNCA 1UHJA 3NXAA 4NQGA 1K95A 1EG3A 2ISDA 2BNXA 2KDHA 3AKBA 2JT8A 4PE0A 2GTEA 1SRAA 5BPJA 1UHHA 2M3WA 3D78A 1A75A 4M2PA 1YURA 5KTYA 1DF0B 2FOTA 1HT9A 1SR6C 1TN4A 2MLEC 2PSRA 3DYEA 1K9KA 3B87A 1B9AA 1JFJA 3S0AA 4OR9B 1EJ3A 2MBXA 2JT0A 3UNWA 5EL2A 3D73A 1AK8A 1XVJA 2LVIA 1WRKA 2M8UA 5ER5A 3OB1B 5I2QA 3NSLA 1A75B 4BY4A 4CFQA 1AUIB 5FYXA 3VGOA 3S0BA 2L2EA 1PVBA 5AERA 4JD9A 5AFPA 3CABA 3DVJA 1DJYA 5AEQA 2Y4QA 1SSEB 3I5FC 1HQVA 1ORGA 1DJXA 2KAXA 4MZKA 3CTNA 4HSZA 4PDZA 1FW4A 3CR2A 3R1VA 4YI8A 3PN7C 1DVIA 1J1DA 1EXRA 4YGBB 1G4YR 1JUOA 1NPQA 2H61C 5D7FA 1A29A 1C3YA 1AVSA 1JWDA 5HL1A 1NX3A 1XFWO 2L0PA 1DJHA 4ICBA 1J7PA 4C0KA 4MZJA 1LINA 3LL8B 2WCJA 1FPWA 1RTP1 2LUCA 4N1FA 1KFUL 1YVHA 2EC6B 1TUZA 2L50A 2WCFA 2KLEA 4NDCA 2FCEA 5I2LA 1OOGA 4BY5A 1Q80A 4IL1A 2TN4A 2JNXA 4F7FA 4FQTA 5CSJA 2CNPA 1SL9A 1B8RA 3GOFA 2JPOA 1MXLC 3TS5C 2M1KB 1YUTA 3EKJA 4PCWA 1QX7A 2M7LA 1ALVA 3JVTC 4I5JA 2Y5IA 2LE9B 3HCMA 4JKTA 3EVVA 1H4BA 3S0FA 1NX0A 2BKIB 5I8NA 1NCZA 4MEWA 2JNFA 1TNWA 3A8RA 1F4OA 3L4LA 1UHIA 5FI7A 1M45A 1F55A 1BT6A 4A4BA 2WNDA 2FCDA 2LC5A 5J3XA 3FIAA 3I5IC 3EVRA 2AMIA 1C3ZA 2NZ0A 2WCKA 1NX2A 1MQ1A 1DJWA 4USLA 1XO5A 1N0YA 3H4SE 2GV5A 1YVLA 2NCPA 3FE6A 3TDUA 1G33A 3OGNA 1DT7B 3O2PA 1CFDA 1WLMA 1KFXS 3PJIA 4CFRA 2D8NA 2KNEA 2H8VA 1QLKA 3B6XA 3BFAA 3Q8IA 3R1OA 4GGNA 5I2OA 3VRRA 3FE9A 5DKQA 3EKHA 1KK7Z 4ORBB 1FBVA 3BFBA 1S6IA 2KYFA 2LANA 3R1PA 1LA0A 5F6TA 1UWOA 1OOHA 1CLMA 1R2UA 1YX7A 4L9MA 2L4IA 1X02A 2QDIA 4PALA 5AANA 1OMVA 1W7IB 3NSIA 1WDCB 4PHJA 4I5KA 1S5GY 2GGMA 2JTTA 3BOWB 1Y0VH 3SJSA 1J7OA 2DOQA 1KWOC 1RJVA 1WY9A 5HLOA 1CFCA 2LP2A 4GBAA 2KSPA 2V53A 4N1GA 4WQ3A 3IQQA 2MHHA 2Q4UA 4N5XA 3RZSA 1SKTA 2QEBA 5AXIA 1SL8A 1QX5B 1RFJA 1PULA 3QRXA 2LNKA 1SL7A 1SR6B 2I94A 5TNCA 3V2LA 1TCFA 2ZRSA 1JBAA 1BOCA 1F71A 1SK6D 1BG1A 4HREE 3TZ1A 2LMUA 3M0WA 4AQIA 3EK4A 4NDBA 1QIVA 1QVIY 3DXLA 4PE4A 3O4YA 3KPXA 3PM8A 5PALA 1GM0A 1MR8A 2H61A 1S3PA 1FF1A 1F54A 3B7AA 3SS5A 1AJ5A 1JFKA 4UPGA 1BLQA 3IF7A 1KQMC 4A4CA 2WC5A 1FI6A 1J7RA 1GGZA 1KK8C 1NIWA 2K8MB 1OMDA 2ZNEA 1CLBA 3DZTA 3SIAA 4DIRA 1YTZC 2SASA 2BCAA 2KI4C 3WHUB 1CFFA 4JPZB 1SPYA 3OX5A 1ZACA 1DGVA 2LP3A 3D10A 3PN7B 4JWQA 1TTXA 1QXPA 3GK1A 1B8LA 2M29A 2JU0A 2MLFC 3EK8A 3KO0A 1DJZA 1QASA 2K7OA 3FWBA 4ORAB 2KGBC 2QPTA 2QEVA 3BUOB 1IQ5A 2CXJA 1SNLA 2KAYA 1MXEA 2RGIA 1S6JA 2JRFA 4YGCB 1QV0A 2OS8C 1OZSA 3K21A 1H8BA 3ICBA 2F3YA 2E6WA 2PRUA 3SG4A 1GGWA 2P71A 4PHKA 1VRKA 2LMVA 2K61A 4QJ3B 4PHNA 1ODBA 1B7TY 3TS5B 1IH0A 2KFGA 5HKYA 2LVVA 1YX8A 2OTGC 1CNPA 1IIOA 1TNPA 1U5IA 3JVTB 1CDMA 3DVMA 3I5GC 2KI6C 1TRFA 5FI6A 2LHLA 2HQWA 3QMEA 1YRUB 3E3RA 1QLSA 2KQYA 5DICA 2JC2A 2O5GA 1KCYA 1XA5A 2FJYA 2I7AA 4HRHA 1SW8A 3VB1A 3B86A 4CPVA 5CSIA 1SCVA 1QX2A 1YUSA 1GQMA 2A4JA 1TIZA 2BE4A 1DEKA 3CLNA 4YI9A 1CFPA 1NCYA 4OZDA 3BUXB 3I5IB 3PALA 1BJFA 4AQJA 1U5IB 1WRLA 3IVTA 1M39A 4INXA 1S5GZ 1F70A 1K96A 1TNQA 1RECA 1W7JB 2M0RA 4PHMA 2ZNDA 1B47A 3FE8A 3IQOA 1RROA 2PYQA 3BYAA 3OB2B 4CIDA 1BF5A 2I2RE 2KPHA 2L2CA 1Y1UA 2K0JA 4XYNA 1OOFA 1DGUA 1MWNA 3SG5A 4OVNF 1W9ZA 2JXCA 1XFZO 1AJ4A 2BECA 3CZ1A 3C1VA 4IJ7A 1SBJA 3HX4A 2BCBA 2M97A 1DMOA 1NWDA 1QATA 2LUXA 3CZTX 1IG5A 3TUYC 2JTZA 3AAKA 4GNKB 1DELA 1OSAA 2MAZA 2HPSA 3CR4X 1DQEA 1GJYA 1NYAA 4MN0A 2HQ8A 2O60A 2WOSA 1KSOA 1JF0A 2NXQA 3BQ3A 1KWOB 2BL0C 1F4QA 4Q04A 1C07A 4YBHB 2JT3A 1OQPA 1Z2CB 2JXLA 2LM5A 2ZN9A 3S0EA 1QJTA 1K90D 5DKNA 3NSOA 3CYZA 1YR5A 1JF2A 1M31A 1XFUO 1YRTB 3BFHA 4WQ2A 2ZRTA 4C0JA 4YGEB 4OKHA 1DJIA 1AHRA 3SIBA 1MUXA 4MLWA 4QJ5B 1V1GA 1L2OC 4GPLB 1Y6WA 2L4HA 3UO9A 3PATA 1KFUS 1PVAA 1L7ZA 1IJ5A 1XFYO 2P70A 1RK9A 1OOIX 1SMGA 1E8AA 2LLTA 4ORCB 3SG2A 1KQMB 5JOLA 3BUWB 3RLZA 2M7NA 3NGVA 2M1UA 1N65A 3BUMB 1PSRA 3F45A 2B1UA 1BMOA 2LV7A 1WLZA 3BJHA 1A4PA 2QEHA 4GGFC 3ZWHA 2HF5A 5G08A 2WCLA 1CDPA 1NSHA 2BBMA 2KHNA 2IS9A 5KSZA 2KI4B 1LA3A 2JZIA 4GFTA 1EL4A 5KU1A 4KYNA 2CT9A 4YRUA 2I18A 3B88A 4R1EA 1LXFC 5B8IB 2K2AA 1S1EA 4MRYA 4AOMA 1NP8A 2JOJA 4DCKA 1CMFA 1CM4A 3VRPA 4P2YB 4YGAA 3EVUA 2K60A 2PMYA 3D0YA 3BXKA 2LMTA 2H2KA 3SG6A 2F2PA 3PSRA 2QACA 4P5OE 4YGDB 4MZLA 1CDLA 1IJ6A 2GGZA 3BUNB 4ETOA 3L47A 3DF0A 3JTDC 4FTGA 1DF0A 3I5FB 4U8DA 5K89A 2KBMA 3SS3A 5HLVA 3I5HC 4MSPA 1WRZA 1MF8B 1NCXA 1EG4A 1PSBA 1WDCC 1V1FA 3I5GB 3FS7A 3SG7A 2KFFA 2L5YA 3D0YB 1CLLA 1MHOA 4D1EA 4DRWA 1IRJA 2KAVA 1A03A 1SCMC 2WORA 1F8HA 1P28A 2OPOA 2KQ6A 4MVFA 1BU3A 3DF0B 1J55A 5IBWA 1K9UA 2LLSA 3KEVA 4XJKA 4DUQA 2NLNA 1D1OA 1SYMA 2LVJA 2ERBA 1A2XA 2FJUB 1PK0D 2MA2A 1KK7Y 1UHKA 2JWWA 2F2OA 1JSAA 1R6PA 3WXAA 1NUBA 1OW4A 3DD4A 2BBNA 1J1EA 1B8CA 1QWVA 2AAOA 1M63B 3NSKA 1ZUZA 3NHIA 2MJWB 1C7VA 4E68A 1DTLA 3N7HA 1IQ3A 3PM2A 1XK4C 3O4XA 4OV2A 1Z4HA 2ZFDA 1DC1A 4XJKB 1AP4A 3MSEB 1CDNA 2JULA 1BR1B 5I94A 1IGVA 2K7CA 1QS7A 3TDZA 3AAJA 1ZOTB 2KOTA
chains in the Genus database with same CATH topology
2E30A 1K8UA 1DJGA 1LVCD 1BR4B 1M46A 2CBLA 3OX6A 1UUSA 1KFXL 1Y1AA 2KBIA 1XFVO 2HETA 3LK1A 4ZCVA 3TUYB 1XYDA 3KF9A 4PE1A 3KHEA 1OE9B 2COLB 1K2HA 2PASA 1UURA 2CCMA 2KI6D 2L5XB 4OCIA 5DKRA 2M49B 1FI5A 1UHNA 1SY9A 4PE7A 1Y1XA 2BL0B 1QTXA 4MBEA 1S6CA 2G2BA 1PRWA 4GAOA 5HKWA 1CTRA 2SCPA 1EH2A 2Y1MA 3VRQA 1S36A 3GK2A 2JQ6A 4DS7A 2LVKA 1QIWA 2Y1NA 1K94A 1IKUA 2L98A 1CMGA 2M9GA 4GGFA 3PLFB 2LLUA 3VRNA 2KYCA 1QVIZ 2JPTA 1L2OB 2F8PA 2VRGA 3ZNIA 3EK7A 3CWGA 1J7QA 2PALA 2KGRA 2L51A 1XFXO 3LK0A 4JQ0D 2K2FA 4NDDA 1TCOB 5GQQC 4QJ4B 2PVBA 2EC6C 3LCPC 1QV1A 1G8IA 3PFVA 1OMRA 3AKAA 2KFHA 2WC8A 2LHIA 2Q91A 3LLEA 2F3ZA 2G9BA 5D69A 2BKHB 1LKJA 2NCOA 3O78A 3O6BA 4I5LB 2EHBA 4FQOA 2WCEA 2K7DA 5JJGA 4GUKA 1CM1A 1CB1A 2BCXA 1OOJA 4C0LA 1C7WA 3DVEA 3A4UB 1ZMZA 1N2DA 2WCBA 3BOWA 3GK4X 2LAPA 2AUCA 1KK8B 1OZOA 2LCPA 2CTNA 3OP0A 3CR5X 3JTDB 3CS1A 1B7TZ 3I5HB 3FWCA 2ZKMX 2ZN8A 3TDIA 5HYDA 2MRDA 1BODA 1CKKA 2R2IA 5ER4X 4M2QA 2K7BA 2F33A 3WHTB 4ZCUA 5CPVA 4F0ZB 1KSMA 3SG3A 1TNXA 1UP5A 2P6BB 1SCMB 3RM1A 4CLNA 2BE6A 1B4CA 3OHMB 2OS8B 1KQVA 3VROA 1K9PA 1XK4A 4I5NB 1ALWA 3CGAA 4MRXA 1ZFSA 1JC2A 1K93D 1NX1A 4WRIA 3DVKA 5CSNA 1RWYA 1IWQA 5CSFA 3WNXB 1TOPA 1S26D 2EGDA 5HKZA 1B1GA 4M2OA 2OTGB 1YUUA 1PALA 4HRGA 4TNCA 1UHJA 3NXAA 4NQGA 1K95A 1EG3A 2ISDA 2KDHA 3AKBA 2JT8A 4PE0A 1SRAA 5BPJA 1UHHA 2M3WA 1A75A 4M2PA 1YURA 5KTYA 1DF0B 2FOTA 1HT9A 1SR6C 1TN4A 2MLEC 2PSRA 1K9KA 1B9AA 1JFJA 4OR9B 1EJ3A 2MBXA 2JT0A 1AK8A 1XVJA 2LVIA 1WRKA 2M8UA 5ER5A 3OB1B 5I2QA 3NSLA 1A75B 4BY4A 4CFQA 1AUIB 5FYXA 3VGOA 2L2EA 1PVBA 5AERA 5AFPA 3DVJA 1DJYA 5AEQA 2Y4QA 3I5FC 1HQVA 4C0JA 1DJXA 2KAXA 4MZKA 3CTNA 4HSZA 4PDZA 1FW4A 3CR2A 4YI8A 3PN7C 1DVIA 1J1DA 1EXRA 4YGBB 1G4YR 1JUOA 1NPQA 2H61C 5D7FA 1A29A 1AVSA 1JWDA 1NX3A 1XFWO 2L0PA 1DJHA 4ICBA 1J7PA 4C0KA 4MZJA 1LINA 3LL8B 1FPWA 1RTP1 2LUCA 4N1FA 1KFUL 1YVHA 2EC6B 2L50A 2WCFA 4NDCA 2FCEA 5I2LA 4BY5A 1Q80A 4IL1A 2TN4A 2JNXA 5CSJA 2CNPA 1SL9A 1B8RA 3GOFA 1MXLC 3TS5C 2M1KB 1YUTA 3EKJA 4PCWA 1QX7A 2M7LA 1ALVA 3JVTC 4I5JA 2Y5IA 2LE9B 3HCMA 3EVVA 1H4BA 1NX0A 2BKIB 5I8NA 1NCZA 4MEWA 2JNFA 1TNWA 3A8RA 1F4OA 1UHIA 1M45A 1F55A 1BT6A 4A4BA 2WNDA 2FCDA 2LC5A 5J3XA 3FIAA 3I5IC 3EVRA 2AMIA 2NZ0A 1NX2A 1MQ1A 1DJWA 4USLA 1XO5A 1N0YA 3H4SE 2GV5A 1YVLA 2NCPA 3TDUA 1DT7B 1G33A 3O2PA 1CFDA 1WLMA 1KFXS 4CFRA 2D8NA 2KNEA 5I2OA 1QLKA 4GGNA 3VRRA 5DKQA 3EKHA 1KK7Z 4ORBB 1FBVA 1S6IA 2KYFA 2LANA 5F6TA 1LA0A 1UWOA 1R2UA 1CLMA 1YX7A 5AANA 4L9MA 2L4IA 1X02A 4PALA 1OMVA 1W7IB 3NSIA 1WDCB 4PHJA 4I5KA 1S5GY 2GGMA 2JTTA 3BOWB 1Y0VH 3SJSA 1J7OA 2DOQA 1KWOC 1RJVA 1WY9A 5HLOA 1CFCA 2LP2A 4GBAA 2KSPA 2V53A 4N1GA 4WQ3A 3IQQA 2MHHA 2Q4UA 4N5XA 1SKTA 5AXIA 1SL8A 1QX5B 1RFJA 1PULA 3QRXA 2LNKA 1SL7A 1SR6B 2I94A 5TNCA 1TCFA 2ZRSA 1JBAA 1BOCA 1F71A 1SK6D 1BG1A 4HREE 3TZ1A 2LMUA 3M0WA 4AQIA 3EK4A 4NDBA 1QIVA 1QVIY 4PE4A 3O4YA 3KPXA 3PM8A 5PALA 1MR8A 2H61A 1S3PA 1FF1A 1F54A 1AJ5A 1JFKA 4UPGA 1BLQA 3IF7A 1KQMC 4A4CA 1FI6A 1J7RA 1GGZA 1KK8C 1NIWA 2K8MB 1OMDA 2ZNEA 1CLBA 3SIAA 4DIRA 1YTZC 2SASA 2BCAA 2KI4C 3WHUB 1CFFA 4JPZB 1SPYA 3OX5A 1ZACA 1DGVA 2LP3A 3D10A 3PN7B 4JWQA 1TTXA 1QXPA 3GK1A 1B8LA 2M29A 2JU0A 2MLFC 3EK8A 3KO0A 1DJZA 1QASA 2K7OA 3FWBA 4ORAB 2KGBC 2QPTA 3BUOB 1IQ5A 2CXJA 1SNLA 2KAYA 1MXEA 2RGIA 1S6JA 2JRFA 4YGCB 1QV0A 2OS8C 1OZSA 3K21A 1H8BA 3ICBA 2F3YA 2E6WA 2PRUA 3SG4A 1GGWA 4PHKA 1VRKA 2LMVA 2K61A 4QJ3B 4PHNA 1ODBA 1B7TY 3TS5B 1IH0A 2KFGA 5HKYA 2LVVA 1YX8A 2OTGC 1CNPA 1TNPA 1U5IA 3JVTB 1CDMA 3DVMA 3I5GC 2KI6C 1TRFA 2LHLA 2HQWA 1YRUB 3E3RA 1QLSA 2KQYA 1KCYA 2JC2A 2O5GA 1XA5A 2I7AA 4HRHA 1SW8A 4CPVA 5CSIA 1SCVA 1QX2A 1YUSA 1GQMA 2A4JA 1TIZA 2BE4A 3CLNA 4YI9A 1CFPA 1NCYA 3BUXB 3I5IB 3PALA 1BJFA 4AQJA 1U5IB 1WRLA 1M39A 1S5GZ 1F70A 1K96A 1TNQA 1RECA 1W7JB 2M0RA 4PHMA 2ZNDA 1B47A 3IQOA 1RROA 3BYAA 3OB2B 4CIDA 1BF5A 2I2RE 1Y1UA 2K0JA 4XYNA 1DGUA 1MWNA 3SG5A 4OVNF 2JXCA 1XFZO 1AJ4A 2BECA 3C1VA 1SBJA 3HX4A 2BCBA 2M97A 1DMOA 1NWDA 1QATA 2LUXA 3CZTX 1IG5A 3TUYC 2JTZA 3AAKA 4GNKB 1OSAA 2MAZA 2HPSA 3CR4X 4MN0A 1GJYA 1NYAA 2HQ8A 2O60A 2WOSA 1KSOA 1JF0A 2NXQA 3BQ3A 1KWOB 2BL0C 1F4QA 4Q04A 1C07A 4YBHB 2JT3A 1OQPA 2JXLA 2LM5A 2ZN9A 1QJTA 1K90D 5DKNA 3NSOA 1YR5A 1JF2A 1M31A 1XFUO 1YRTB 4WQ2A 2ZRTA 4YGEB 4OKHA 1DJIA 1AHRA 3SIBA 1MUXA 4MLWA 4QJ5B 1V1GA 1L2OC 4GPLB 1Y6WA 2L4HA 3PATA 1KFUS 1PVAA 1L7ZA 1IJ5A 1XFYO 1RK9A 1SMGA 1E8AA 2LLTA 4ORCB 3SG2A 1KQMB 5JOLA 3BUWB 3RLZA 2M7NA 2M1UA 1N65A 3BUMB 1PSRA 3F45A 2B1UA 1BMOA 2LV7A 1WLZA 1A4PA 3ZWHA 4GGFC 2HF5A 5G08A 1CDPA 1NSHA 2BBMA 2KHNA 2IS9A 5KSZA 2KI4B 1LA3A 2JZIA 4GFTA 1EL4A 5KU1A 2CT9A 4YRUA 2I18A 4R1EA 1LXFC 5B8IB 2K2AA 1S1EA 4MRYA 4AOMA 1NP8A 2JOJA 4DCKA 1CMFA 1CM4A 3VRPA 4P2YB 4YGAA 3EVUA 2PMYA 3D0YA 3BXKA 2LMTA 2H2KA 3SG6A 2F2PA 3PSRA 2QACA 4P5OE 4YGDB 4MZLA 1CDLA 1IJ6A 2GGZA 3BUNB 4ETOA 3DF0A 3JTDC 4FTGA 1DF0A 3I5FB 4U8DA 5K89A 2KBMA 5HLVA 3I5HC 4MSPA 1WRZA 1MF8B 1NCXA 1EG4A 1PSBA 1WDCC 1V1FA 3I5GB 3FS7A 3SG7A 2KFFA 3D0YB 1CLLA 1MHOA 4D1EA 4DRWA 1IRJA 2KAVA 1A03A 1SCMC 2WORA 1F8HA 2OPOA 2KQ6A 4MVFA 1BU3A 3DF0B 1J55A 5IBWA 1K9UA 2LLSA 3KEVA 4XJKA 4DUQA 2NLNA 1D1OA 1SYMA 2LVJA 1A2XA 2FJUB 1PK0D 2MA2A 1KK7Y 1UHKA 2JWWA 2F2OA 1JSAA 1R6PA 3WXAA 1NUBA 3DD4A 2BBNA 1J1EA 1B8CA 2AAOA 1M63B 3NSKA 1ZUZA 2MJWB 1C7VA 4E68A 1DTLA 1IQ3A 1XK4C 4OV2A 2ZFDA 4XJKB 1AP4A 3MSEB 1CDNA 2JULA 1BR1B 1IGVA 2K7CA 1QS7A 3TDZA 3AAJA 1ZOTB 2KOTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E30 A;  1K8U A;  1DJG A;  1LVC D;  1BR4 B;  1M46 A;  2CBL A;  3OX6 A;  1UUS A;  1KFX L;  1Y1A A;  2KBI A;  1XFV O;  2HET A;  3LK1 A;  4ZCV A;  3TUY B;  1XYD A;  3KF9 A;  4PE1 A;  3KHE A;  1OE9 B;  2COL B;  1K2H A;  2PAS A;  1UUR A;  2CCM A;  2KI6 D;  2L5X B;  4OCI A;  5DKR A;  2M49 B;  1FI5 A;  1UHN A;  1SY9 A;  4PE7 A;  1Y1X A;  2BL0 B;  1QTX A;  4MBE A;  1S6C A;  2G2B A;  1PRW A;  4GAO A;  5HKW A;  1CTR A;  2SCP A;  1EH2 A;  2Y1M A;  3VRQ A;  1S36 A;  3GK2 A;  2JQ6 A;  4DS7 A;  2LVK A;  1QIW A;  2Y1N A;  1K94 A;  1IKU A;  2L98 A;  1CMG A;  2M9G A;  4GGF A;  3PLF B;  2LLU A;  3VRN A;  2KYC A;  1QVI Z;  2JPT A;  1L2O B;  2F8P A;  2VRG A;  3ZNI A;  3EK7 A;  3CWG A;  1J7Q A;  2PAL A;  2KGR A;  2L51 A;  1XFX O;  3LK0 A;  4JQ0 D;  2K2F A;  4NDD A;  1TCO B;  5GQQ C;  4QJ4 B;  2PVB A;  2EC6 C;  3LCP C;  1QV1 A;  1G8I A;  3PFV A;  1OMR A;  3AKA A;  2KFH A;  2WC8 A;  2LHI A;  2Q91 A;  3LLE A;  2F3Z A;  2G9B A;  5D69 A;  2BKH B;  1LKJ A;  2NCO A;  3O78 A;  3O6B A;  4I5L B;  2EHB A;  4FQO A;  2WCE A;  2K7D A;  5JJG A;  4GUK A;  1CM1 A;  1CB1 A;  2BCX A;  1OOJ A;  4C0L A;  1C7W A;  3DVE A;  3A4U B;  1ZMZ A;  1N2D A;  2WCB A;  3BOW A;  3GK4 X;  2LAP A;  2AUC A;  1KK8 B;  1OZO A;  2LCP A;  2CTN A;  3OP0 A;  3CR5 X;  3JTD B;  3CS1 A;  1B7T Z;  3I5H B;  3FWC A;  2ZKM X;  2ZN8 A;  3TDI A;  5HYD A;  2MRD A;  1BOD A;  1CKK A;  2R2I A;  5ER4 X;  4M2Q A;  2K7B A;  2F33 A;  3WHT B;  4ZCU A;  5CPV A;  4F0Z B;  1KSM A;  3SG3 A;  1TNX A;  1UP5 A;  2P6B B;  1SCM B;  3RM1 A;  4CLN A;  2BE6 A;  1B4C A;  3OHM B;  2OS8 B;  1KQV A;  3VRO A;  1K9P A;  1XK4 A;  4I5N B;  1ALW A;  3CGA A;  4MRX A;  1ZFS A;  1JC2 A;  1K93 D;  1NX1 A;  4WRI A;  3DVK A;  5CSN A;  1RWY A;  1IWQ A;  5CSF A;  3WNX B;  1TOP A;  1S26 D;  2EGD A;  5HKZ A;  1B1G A;  4M2O A;  2OTG B;  1YUU A;  1PAL A;  4HRG A;  4TNC A;  1UHJ A;  3NXA A;  4NQG A;  1K95 A;  1EG3 A;  2ISD A;  2KDH A;  3AKB A;  2JT8 A;  4PE0 A;  1SRA A;  5BPJ A;  1UHH A;  2M3W A;  1A75 A;  4M2P A;  1YUR A;  5KTY A;  1DF0 B;  2FOT A;  1HT9 A;  1SR6 C;  1TN4 A;  2MLE C;  2PSR A;  1K9K A;  1B9A A;  1JFJ A;  4OR9 B;  1EJ3 A;  2MBX A;  2JT0 A;  1AK8 A;  1XVJ A;  2LVI A;  1WRK A;  2M8U A;  5ER5 A;  3OB1 B;  5I2Q A;  3NSL A;  1A75 B;  4BY4 A;  4CFQ A;  1AUI B;  5FYX A;  3VGO A;  2L2E A;  1PVB A;  5AER A;  5AFP A;  3DVJ A;  1DJY A;  5AEQ A;  2Y4Q A;  3I5F C;  1HQV A;  4C0J A;  1DJX A;  2KAX A;  4MZK A;  3CTN A;  4HSZ A;  4PDZ A;  1FW4 A;  3CR2 A;  4YI8 A;  3PN7 C;  1DVI A;  1J1D A;  1EXR A;  4YGB B;  1G4Y R;  1JUO A;  1NPQ A;  2H61 C;  5D7F A;  1A29 A;  1AVS A;  1JWD A;  1NX3 A;  1XFW O;  2L0P A;  1DJH A;  4ICB A;  1J7P A;  4C0K A;  4MZJ A;  1LIN A;  3LL8 B;  1FPW A;  1RTP 1;  2LUC A;  4N1F A;  1KFU L;  1YVH A;  2EC6 B;  2L50 A;  2WCF A;  4NDC A;  2FCE A;  5I2L A;  4BY5 A;  1Q80 A;  4IL1 A;  2TN4 A;  2JNX A;  5CSJ A;  2CNP A;  1SL9 A;  1B8R A;  3GOF A;  1MXL C;  3TS5 C;  2M1K B;  1YUT A;  3EKJ A;  4PCW A;  1QX7 A;  2M7L A;  1ALV A;  3JVT C;  4I5J A;  2Y5I A;  2LE9 B;  3HCM A;  3EVV A;  1H4B A;  1NX0 A;  2BKI B;  5I8N A;  1NCZ A;  4MEW A;  2JNF A;  1TNW A;  3A8R A;  1F4O A;  1UHI A;  1M45 A;  1F55 A;  1BT6 A;  4A4B A;  2WND A;  2FCD A;  2LC5 A;  5J3X A;  3FIA A;  3I5I C;  3EVR A;  2AMI A;  2NZ0 A;  1NX2 A;  1MQ1 A;  1DJW A;  4USL A;  1XO5 A;  1N0Y A;  3H4S E;  2GV5 A;  1YVL A;  2NCP A;  3TDU A;  1DT7 B;  1G33 A;  3O2P A;  1CFD A;  1WLM A;  1KFX S;  4CFR A;  2D8N A;  2KNE A;  5I2O A;  1QLK A;  4GGN A;  3VRR A;  5DKQ A;  3EKH A;  1KK7 Z;  4ORB B;  1FBV A;  1S6I A;  2KYF A;  2LAN A;  5F6T A;  1LA0 A;  1UWO A;  1R2U A;  1CLM A;  1YX7 A;  5AAN A;  4L9M A;  2L4I A;  1X02 A;  4PAL A;  1OMV A;  1W7I B;  3NSI A;  1WDC B;  4PHJ A;  4I5K A;  1S5G Y;  2GGM A;  2JTT A;  3BOW B;  1Y0V H;  3SJS A;  1J7O A;  2DOQ A;  1KWO C;  1RJV A;  1WY9 A;  5HLO A;  1CFC A;  2LP2 A;  4GBA A;  2KSP A;  2V53 A;  4N1G A;  4WQ3 A;  3IQQ A;  2MHH A;  2Q4U A;  4N5X A;  1SKT A;  5AXI A;  1SL8 A;  1QX5 B;  1RFJ A;  1PUL A;  3QRX A;  2LNK A;  1SL7 A;  1SR6 B;  2I94 A;  5TNC A;  1TCF A;  2ZRS A;  1JBA A;  1BOC A;  1F71 A;  1SK6 D;  1BG1 A;  4HRE E;  3TZ1 A;  2LMU A;  3M0W A;  4AQI A;  3EK4 A;  4NDB A;  1QIV A;  1QVI Y;  4PE4 A;  3O4Y A;  3KPX A;  3PM8 A;  5PAL A;  1MR8 A;  2H61 A;  1S3P A;  1FF1 A;  1F54 A;  1AJ5 A;  1JFK A;  4UPG A;  1BLQ A;  3IF7 A;  1KQM C;  4A4C A;  1FI6 A;  1J7R A;  1GGZ A;  1KK8 C;  1NIW A;  2K8M B;  1OMD A;  2ZNE A;  1CLB A;  3SIA A;  4DIR A;  1YTZ C;  2SAS A;  2BCA A;  2KI4 C;  3WHU B;  1CFF A;  4JPZ B;  1SPY A;  3OX5 A;  1ZAC A;  1DGV A;  2LP3 A;  3D10 A;  3PN7 B;  4JWQ A;  1TTX A;  1QXP A;  3GK1 A;  1B8L A;  2M29 A;  2JU0 A;  2MLF C;  3EK8 A;  3KO0 A;  1DJZ A;  1QAS A;  2K7O A;  3FWB A;  4ORA B;  2KGB C;  2QPT A;  3BUO B;  1IQ5 A;  2CXJ A;  1SNL A;  2KAY A;  1MXE A;  2RGI A;  1S6J A;  2JRF A;  4YGC B;  1QV0 A;  2OS8 C;  1OZS A;  3K21 A;  1H8B A;  3ICB A;  2F3Y A;  2E6W A;  2PRU A;  3SG4 A;  1GGW A;  4PHK A;  1VRK A;  2LMV A;  2K61 A;  4QJ3 B;  4PHN A;  1ODB A;  1B7T Y;  3TS5 B;  1IH0 A;  2KFG A;  5HKY A;  2LVV A;  1YX8 A;  2OTG C;  1CNP A;  1TNP A;  1U5I A;  3JVT B;  1CDM A;  3DVM A;  3I5G C;  2KI6 C;  1TRF A;  2LHL A;  2HQW A;  1YRU B;  3E3R A;  1QLS A;  2KQY A;  1KCY A;  2JC2 A;  2O5G A;  1XA5 A;  2I7A A;  4HRH A;  1SW8 A;  4CPV A;  5CSI A;  1SCV A;  1QX2 A;  1YUS A;  1GQM A;  2A4J A;  1TIZ A;  2BE4 A;  3CLN A;  4YI9 A;  1CFP A;  1NCY A;  3BUX B;  3I5I B;  3PAL A;  1BJF A;  4AQJ A;  1U5I B;  1WRL A;  1M39 A;  1S5G Z;  1F70 A;  1K96 A;  1TNQ A;  1REC A;  1W7J B;  2M0R A;  4PHM A;  2ZND A;  1B47 A;  3IQO A;  1RRO A;  3BYA A;  3OB2 B;  4CID A;  1BF5 A;  2I2R E;  1Y1U A;  2K0J A;  4XYN A;  1DGU A;  1MWN A;  3SG5 A;  4OVN F;  2JXC A;  1XFZ O;  1AJ4 A;  2BEC A;  3C1V A;  1SBJ A;  3HX4 A;  2BCB A;  2M97 A;  1DMO A;  1NWD A;  1QAT A;  2LUX A;  3CZT X;  1IG5 A;  3TUY C;  2JTZ A;  3AAK A;  4GNK B;  1OSA A;  2MAZ A;  2HPS A;  3CR4 X;  4MN0 A;  1GJY A;  1NYA A;  2HQ8 A;  2O60 A;  2WOS A;  1KSO A;  1JF0 A;  2NXQ A;  3BQ3 A;  1KWO B;  2BL0 C;  1F4Q A;  4Q04 A;  1C07 A;  4YBH B;  2JT3 A;  1OQP A;  2JXL A;  2LM5 A;  2ZN9 A;  1QJT A;  1K90 D;  5DKN A;  3NSO A;  1YR5 A;  1JF2 A;  1M31 A;  1XFU O;  1YRT B;  4WQ2 A;  2ZRT A;  4YGE B;  4OKH A;  1DJI A;  1AHR A;  3SIB A;  1MUX A;  4MLW A;  4QJ5 B;  1V1G A;  1L2O C;  4GPL B;  1Y6W A;  2L4H A;  3PAT A;  1KFU S;  1PVA A;  1L7Z A;  1IJ5 A;  1XFY O;  1RK9 A;  1SMG A;  1E8A A;  2LLT A;  4ORC B;  3SG2 A;  1KQM B;  5JOL A;  3BUW B;  3RLZ A;  2M7N A;  2M1U A;  1N65 A;  3BUM B;  1PSR A;  3F45 A;  2B1U A;  1BMO A;  2LV7 A;  1WLZ A;  1A4P A;  3ZWH A;  4GGF C;  2HF5 A;  5G08 A;  1CDP A;  1NSH A;  2BBM A;  2KHN A;  2IS9 A;  5KSZ A;  2KI4 B;  1LA3 A;  2JZI A;  4GFT A;  1EL4 A;  5KU1 A;  2CT9 A;  4YRU A;  2I18 A;  4R1E A;  1LXF C;  5B8I B;  2K2A A;  1S1E A;  4MRY A;  4AOM A;  1NP8 A;  2JOJ A;  4DCK A;  1CMF A;  1CM4 A;  3VRP A;  4P2Y B;  4YGA A;  3EVU A;  2PMY A;  3D0Y A;  3BXK A;  2LMT A;  2H2K A;  3SG6 A;  2F2P A;  3PSR A;  2QAC A;  4P5O E;  4YGD B;  4MZL A;  1CDL A;  1IJ6 A;  2GGZ A;  3BUN B;  4ETO A;  3DF0 A;  3JTD C;  4FTG A;  1DF0 A;  3I5F B;  4U8D A;  5K89 A;  2KBM A;  5HLV A;  3I5H C;  4MSP A;  1WRZ A;  1MF8 B;  1NCX A;  1EG4 A;  1PSB A;  1WDC C;  1V1F A;  3I5G B;  3FS7 A;  3SG7 A;  2KFF A;  3D0Y B;  1CLL A;  1MHO A;  4D1E A;  4DRW A;  1IRJ A;  2KAV A;  1A03 A;  1SCM C;  2WOR A;  1F8H A;  2OPO A;  2KQ6 A;  4MVF A;  1BU3 A;  3DF0 B;  1J55 A;  5IBW A;  1K9U A;  2LLS A;  3KEV A;  4XJK A;  4DUQ A;  2NLN A;  1D1O A;  1SYM A;  2LVJ A;  1A2X A;  2FJU B;  1PK0 D;  2MA2 A;  1KK7 Y;  1UHK A;  2JWW A;  2F2O A;  1JSA A;  1R6P A;  3WXA A;  1NUB A;  3DD4 A;  2BBN A;  1J1E A;  1B8C A;  2AAO A;  1M63 B;  3NSK A;  1ZUZ A;  2MJW B;  1C7V A;  4E68 A;  1DTL A;  1IQ3 A;  1XK4 C;  4OV2 A;  2ZFD A;  4XJK B;  1AP4 A;  3MSE B;  1CDN A;  2JUL A;  1BR1 B;  1IGV A;  2K7C A;  1QS7 A;  3TDZ A;  3AAJ A;  1ZOT B;  2KOT A; 
#chains in the Genus database with same CATH topology
 2E30 A;  1K8U A;  1DJG A;  3D75 A;  1LVC D;  1BR4 B;  1M46 A;  2CBL A;  3OX6 A;  4INW A;  1UUS A;  5D3O A;  1KFX L;  1Y1A A;  2KBI A;  1XFV O;  2HET A;  3CZ2 A;  3LK1 A;  4ZCV A;  3TUY B;  1XYD A;  3KF9 A;  4PE1 A;  2YGU A;  1TUJ A;  3KHE A;  1OE9 B;  2COL B;  3S0G A;  1K2H A;  2PAS A;  1UUR A;  2CCM A;  2KI6 D;  2L5X B;  4OCI A;  5DKR A;  2M49 B;  1FI5 A;  1UHN A;  1SY9 A;  4PE7 A;  1Y1X A;  2BL0 B;  1XFR A;  1QTX A;  4MBE A;  1S6C A;  2G2B A;  1LS8 A;  1PRW A;  4GAO A;  3D76 A;  1CTR A;  2SCP A;  3NHT A;  5HKW A;  2QEO A;  1EH2 A;  2Y1M A;  3SS4 A;  3VRQ A;  2KLD A;  1S36 A;  3GK2 A;  2JQ6 A;  3L4A A;  3R72 A;  3S0D A;  2LVK A;  1QIW A;  4DS7 A;  2Y1N A;  1K94 A;  1IKU A;  2L98 A;  1CMG A;  2M9G A;  4GGF A;  3PLF B;  2LLU A;  3VRN A;  2KYC A;  1QVI Z;  2JPT A;  1L2O B;  2F8P A;  2VRG A;  3ZNI A;  3EK7 A;  3CWG A;  1J7Q A;  2PAL A;  2KGR A;  2L51 A;  1XFX O;  3LK0 A;  4JQ0 D;  2K2F A;  4NDD A;  1TCO B;  5GQQ C;  4QJ4 B;  2PVB A;  2EC6 C;  3LCP C;  1QV1 A;  1G8I A;  3PFV A;  1OMR A;  3AKA A;  2KFH A;  2PQL A;  2LHI A;  2WC8 A;  2Q91 A;  3CDN A;  3K1E A;  3LLE A;  2BAP A;  2F3Z A;  5FI2 A;  2G9B A;  5D69 A;  2BKH B;  1LKJ A;  2NCO A;  3O78 A;  3O6B A;  4I5L B;  2EHB A;  4FQO A;  2WCE A;  2K7D A;  5JJG A;  4GUK A;  1CM1 A;  1CB1 A;  2BCX A;  1OOJ A;  4C0L A;  1C7W A;  3DVE A;  3A4U B;  1ZMZ A;  1N2D A;  2WCB A;  3BOW A;  3GK4 X;  2LAP A;  2AUC A;  1KK8 B;  3D77 A;  1OZO A;  2LCP A;  2CTN A;  2WCM A;  4PT1 A;  3OP0 A;  3CR5 X;  3JTD B;  3CS1 A;  1B7T Z;  3I5H B;  3FWC A;  2ZKM X;  2ZN8 A;  3TDI A;  5HYD A;  2MRD A;  1BOD A;  1CKK A;  2R2I A;  5ER4 X;  4M2Q A;  2K7B A;  3DY9 A;  2F33 A;  3WHT B;  4ZCU A;  5CPV A;  4F0Z B;  1KSM A;  3SG3 A;  1TNX A;  1UP5 A;  2P6B B;  3CZ0 A;  2WC6 A;  1SCM B;  1T14 A;  3RM1 A;  4CLN A;  2BE6 A;  1B4C A;  3OHM B;  2OS8 B;  3OBV A;  1KQV A;  3VRO A;  1K9P A;  1XK4 A;  4I5N B;  3D74 A;  1ALW A;  1TWO A;  3CGA A;  4MRX A;  1ZFS A;  1JC2 A;  1K93 D;  1NX1 A;  4WRI A;  3DVK A;  5CSN A;  1RWY A;  1IWQ A;  5CSF A;  3WNX B;  1TOP A;  2WCH A;  1S26 D;  2EGD A;  5HKZ A;  3EG5 B;  4M2O A;  1B1G A;  2OTG B;  1YUU A;  1PAL A;  4HRG A;  4TNC A;  1UHJ A;  3NXA A;  4NQG A;  1K95 A;  1EG3 A;  2ISD A;  2BNX A;  2KDH A;  3AKB A;  2JT8 A;  4PE0 A;  2GTE A;  1SRA A;  5BPJ A;  1UHH A;  2M3W A;  3D78 A;  1A75 A;  4M2P A;  1YUR A;  5KTY A;  1DF0 B;  2FOT A;  1HT9 A;  1SR6 C;  1TN4 A;  2MLE C;  2PSR A;  3DYE A;  1K9K A;  3B87 A;  1B9A A;  1JFJ A;  3S0A A;  4OR9 B;  1EJ3 A;  2MBX A;  2JT0 A;  3UNW A;  5EL2 A;  3D73 A;  1AK8 A;  1XVJ A;  2LVI A;  1WRK A;  2M8U A;  5ER5 A;  3OB1 B;  5I2Q A;  3NSL A;  1A75 B;  4BY4 A;  4CFQ A;  1AUI B;  5FYX A;  3VGO A;  3S0B A;  2L2E A;  1PVB A;  5AER A;  4JD9 A;  5AFP A;  3CAB A;  3DVJ A;  1DJY A;  5AEQ A;  2Y4Q A;  1SSE B;  3I5F C;  1HQV A;  1ORG A;  1DJX A;  2KAX A;  4MZK A;  3CTN A;  4HSZ A;  4PDZ A;  1FW4 A;  3CR2 A;  3R1V A;  4YI8 A;  3PN7 C;  1DVI A;  1J1D A;  1EXR A;  4YGB B;  1G4Y R;  1JUO A;  1NPQ A;  2H61 C;  5D7F A;  1A29 A;  1C3Y A;  1AVS A;  1JWD A;  5HL1 A;  1NX3 A;  1XFW O;  2L0P A;  1DJH A;  4ICB A;  1J7P A;  4C0K A;  4MZJ A;  1LIN A;  3LL8 B;  2WCJ A;  1FPW A;  1RTP 1;  2LUC A;  4N1F A;  1KFU L;  1YVH A;  2EC6 B;  1TUZ A;  2L50 A;  2WCF A;  2KLE A;  4NDC A;  2FCE A;  5I2L A;  1OOG A;  4BY5 A;  1Q80 A;  4IL1 A;  2TN4 A;  2JNX A;  4F7F A;  4FQT A;  5CSJ A;  2CNP A;  1SL9 A;  1B8R A;  3GOF A;  2JPO A;  1MXL C;  3TS5 C;  2M1K B;  1YUT A;  3EKJ A;  4PCW A;  1QX7 A;  2M7L A;  1ALV A;  3JVT C;  4I5J A;  2Y5I A;  2LE9 B;  3HCM A;  4JKT A;  3EVV A;  1H4B A;  3S0F A;  1NX0 A;  2BKI B;  5I8N A;  1NCZ A;  4MEW A;  2JNF A;  1TNW A;  3A8R A;  1F4O A;  3L4L A;  1UHI A;  5FI7 A;  1M45 A;  1F55 A;  1BT6 A;  4A4B A;  2WND A;  2FCD A;  2LC5 A;  5J3X A;  3FIA A;  3I5I C;  3EVR A;  2AMI A;  1C3Z A;  2NZ0 A;  2WCK A;  1NX2 A;  1MQ1 A;  1DJW A;  4USL A;  1XO5 A;  1N0Y A;  3H4S E;  2GV5 A;  1YVL A;  2NCP A;  3FE6 A;  3TDU A;  1G33 A;  3OGN A;  1DT7 B;  3O2P A;  1CFD A;  1WLM A;  1KFX S;  3PJI A;  4CFR A;  2D8N A;  2KNE A;  2H8V A;  1QLK A;  3B6X A;  3BFA A;  3Q8I A;  3R1O A;  4GGN A;  5I2O A;  3VRR A;  3FE9 A;  5DKQ A;  3EKH A;  1KK7 Z;  4ORB B;  1FBV A;  3BFB A;  1S6I A;  2KYF A;  2LAN A;  3R1P A;  1LA0 A;  5F6T A;  1UWO A;  1OOH A;  1CLM A;  1R2U A;  1YX7 A;  4L9M A;  2L4I A;  1X02 A;  2QDI A;  4PAL A;  5AAN A;  1OMV A;  1W7I B;  3NSI A;  1WDC B;  4PHJ A;  4I5K A;  1S5G Y;  2GGM A;  2JTT A;  3BOW B;  1Y0V H;  3SJS A;  1J7O A;  2DOQ A;  1KWO C;  1RJV A;  1WY9 A;  5HLO A;  1CFC A;  2LP2 A;  4GBA A;  2KSP A;  2V53 A;  4N1G A;  4WQ3 A;  3IQQ A;  2MHH A;  2Q4U A;  4N5X A;  3RZS A;  1SKT A;  2QEB A;  5AXI A;  1SL8 A;  1QX5 B;  1RFJ A;  1PUL A;  3QRX A;  2LNK A;  1SL7 A;  1SR6 B;  2I94 A;  5TNC A;  3V2L A;  1TCF A;  2ZRS A;  1JBA A;  1BOC A;  1F71 A;  1SK6 D;  1BG1 A;  4HRE E;  3TZ1 A;  2LMU A;  3M0W A;  4AQI A;  3EK4 A;  4NDB A;  1QIV A;  1QVI Y;  3DXL A;  4PE4 A;  3O4Y A;  3KPX A;  3PM8 A;  5PAL A;  1GM0 A;  1MR8 A;  2H61 A;  1S3P A;  1FF1 A;  1F54 A;  3B7A A;  3SS5 A;  1AJ5 A;  1JFK A;  4UPG A;  1BLQ A;  3IF7 A;  1KQM C;  4A4C A;  2WC5 A;  1FI6 A;  1J7R A;  1GGZ A;  1KK8 C;  1NIW A;  2K8M B;  1OMD A;  2ZNE A;  1CLB A;  3DZT A;  3SIA A;  4DIR A;  1YTZ C;  2SAS A;  2BCA A;  2KI4 C;  3WHU B;  1CFF A;  4JPZ B;  1SPY A;  3OX5 A;  1ZAC A;  1DGV A;  2LP3 A;  3D10 A;  3PN7 B;  4JWQ A;  1TTX A;  1QXP A;  3GK1 A;  1B8L A;  2M29 A;  2JU0 A;  2MLF C;  3EK8 A;  3KO0 A;  1DJZ A;  1QAS A;  2K7O A;  3FWB A;  4ORA B;  2KGB C;  2QPT A;  2QEV A;  3BUO B;  1IQ5 A;  2CXJ A;  1SNL A;  2KAY A;  1MXE A;  2RGI A;  1S6J A;  2JRF A;  4YGC B;  1QV0 A;  2OS8 C;  1OZS A;  3K21 A;  1H8B A;  3ICB A;  2F3Y A;  2E6W A;  2PRU A;  3SG4 A;  1GGW A;  2P71 A;  4PHK A;  1VRK A;  2LMV A;  2K61 A;  4QJ3 B;  4PHN A;  1ODB A;  1B7T Y;  3TS5 B;  1IH0 A;  2KFG A;  5HKY A;  2LVV A;  1YX8 A;  2OTG C;  1CNP A;  1IIO A;  1TNP A;  1U5I A;  3JVT B;  1CDM A;  3DVM A;  3I5G C;  2KI6 C;  1TRF A;  5FI6 A;  2LHL A;  2HQW A;  3QME A;  1YRU B;  3E3R A;  1QLS A;  2KQY A;  5DIC A;  2JC2 A;  2O5G A;  1KCY A;  1XA5 A;  2FJY A;  2I7A A;  4HRH A;  1SW8 A;  3VB1 A;  3B86 A;  4CPV A;  5CSI A;  1SCV A;  1QX2 A;  1YUS A;  1GQM A;  2A4J A;  1TIZ A;  2BE4 A;  1DEK A;  3CLN A;  4YI9 A;  1CFP A;  1NCY A;  4OZD A;  3BUX B;  3I5I B;  3PAL A;  1BJF A;  4AQJ A;  1U5I B;  1WRL A;  3IVT A;  1M39 A;  4INX A;  1S5G Z;  1F70 A;  1K96 A;  1TNQ A;  1REC A;  1W7J B;  2M0R A;  4PHM A;  2ZND A;  1B47 A;  3FE8 A;  3IQO A;  1RRO A;  2PYQ A;  3BYA A;  3OB2 B;  4CID A;  1BF5 A;  2I2R E;  2KPH A;  2L2C A;  1Y1U A;  2K0J A;  4XYN A;  1OOF A;  1DGU A;  1MWN A;  3SG5 A;  4OVN F;  1W9Z A;  2JXC A;  1XFZ O;  1AJ4 A;  2BEC A;  3CZ1 A;  3C1V A;  4IJ7 A;  1SBJ A;  3HX4 A;  2BCB A;  2M97 A;  1DMO A;  1NWD A;  1QAT A;  2LUX A;  3CZT X;  1IG5 A;  3TUY C;  2JTZ A;  3AAK A;  4GNK B;  1DEL A;  1OSA A;  2MAZ A;  2HPS A;  3CR4 X;  1DQE A;  1GJY A;  1NYA A;  4MN0 A;  2HQ8 A;  2O60 A;  2WOS A;  1KSO A;  1JF0 A;  2NXQ A;  3BQ3 A;  1KWO B;  2BL0 C;  1F4Q A;  4Q04 A;  1C07 A;  4YBH B;  2JT3 A;  1OQP A;  1Z2C B;  2JXL A;  2LM5 A;  2ZN9 A;  3S0E A;  1QJT A;  1K90 D;  5DKN A;  3NSO A;  3CYZ A;  1YR5 A;  1JF2 A;  1M31 A;  1XFU O;  1YRT B;  3BFH A;  4WQ2 A;  2ZRT A;  4C0J A;  4YGE B;  4OKH A;  1DJI A;  1AHR A;  3SIB A;  1MUX A;  4MLW A;  4QJ5 B;  1V1G A;  1L2O C;  4GPL B;  1Y6W A;  2L4H A;  3UO9 A;  3PAT A;  1KFU S;  1PVA A;  1L7Z A;  1IJ5 A;  1XFY O;  2P70 A;  1RK9 A;  1OOI X;  1SMG A;  1E8A A;  2LLT A;  4ORC B;  3SG2 A;  1KQM B;  5JOL A;  3BUW B;  3RLZ A;  2M7N A;  3NGV A;  2M1U A;  1N65 A;  3BUM B;  1PSR A;  3F45 A;  2B1U A;  1BMO A;  2LV7 A;  1WLZ A;  3BJH A;  1A4P A;  2QEH A;  4GGF C;  3ZWH A;  2HF5 A;  5G08 A;  2WCL A;  1CDP A;  1NSH A;  2BBM A;  2KHN A;  2IS9 A;  5KSZ A;  2KI4 B;  1LA3 A;  2JZI A;  4GFT A;  1EL4 A;  5KU1 A;  4KYN A;  2CT9 A;  4YRU A;  2I18 A;  3B88 A;  4R1E A;  1LXF C;  5B8I B;  2K2A A;  1S1E A;  4MRY A;  4AOM A;  1NP8 A;  2JOJ A;  4DCK A;  1CMF A;  1CM4 A;  3VRP A;  4P2Y B;  4YGA A;  3EVU A;  2K60 A;  2PMY A;  3D0Y A;  3BXK A;  2LMT A;  2H2K A;  3SG6 A;  2F2P A;  3PSR A;  2QAC A;  4P5O E;  4YGD B;  4MZL A;  1CDL A;  1IJ6 A;  2GGZ A;  3BUN B;  4ETO A;  3L47 A;  3DF0 A;  3JTD C;  4FTG A;  1DF0 A;  3I5F B;  4U8D A;  5K89 A;  2KBM A;  3SS3 A;  5HLV A;  3I5H C;  4MSP A;  1WRZ A;  1MF8 B;  1NCX A;  1EG4 A;  1PSB A;  1WDC C;  1V1F A;  3I5G B;  3FS7 A;  3SG7 A;  2KFF A;  2L5Y A;  3D0Y B;  1CLL A;  1MHO A;  4D1E A;  4DRW A;  1IRJ A;  2KAV A;  1A03 A;  1SCM C;  2WOR A;  1F8H A;  1P28 A;  2OPO A;  2KQ6 A;  4MVF A;  1BU3 A;  3DF0 B;  1J55 A;  5IBW A;  1K9U A;  2LLS A;  3KEV A;  4XJK A;  4DUQ A;  2NLN A;  1D1O A;  1SYM A;  2LVJ A;  2ERB A;  1A2X A;  2FJU B;  1PK0 D;  2MA2 A;  1KK7 Y;  1UHK A;  2JWW A;  2F2O A;  1JSA A;  1R6P A;  3WXA A;  1NUB A;  1OW4 A;  3DD4 A;  2BBN A;  1J1E A;  1B8C A;  1QWV A;  2AAO A;  1M63 B;  3NSK A;  1ZUZ A;  3NHI A;  2MJW B;  1C7V A;  4E68 A;  1DTL A;  3N7H A;  1IQ3 A;  3PM2 A;  1XK4 C;  3O4X A;  4OV2 A;  1Z4H A;  2ZFD A;  1DC1 A;  4XJK B;  1AP4 A;  3MSE B;  1CDN A;  2JUL A;  1BR1 B;  5I94 A;  1IGV A;  2K7C A;  1QS7 A;  3TDZ A;  3AAJ A;  1ZOT B;  2KOT A; 
#chains in the Genus database with same CATH homology
 2E30 A;  1K8U A;  1DJG A;  1LVC D;  1BR4 B;  1M46 A;  2CBL A;  3OX6 A;  1UUS A;  1KFX L;  1Y1A A;  2KBI A;  1XFV O;  2HET A;  3LK1 A;  4ZCV A;  3TUY B;  1XYD A;  3KF9 A;  4PE1 A;  3KHE A;  1OE9 B;  2COL B;  1K2H A;  2PAS A;  1UUR A;  2CCM A;  2KI6 D;  2L5X B;  4OCI A;  5DKR A;  2M49 B;  1FI5 A;  1UHN A;  1SY9 A;  4PE7 A;  1Y1X A;  2BL0 B;  1QTX A;  4MBE A;  1S6C A;  2G2B A;  1PRW A;  4GAO A;  5HKW A;  1CTR A;  2SCP A;  1EH2 A;  2Y1M A;  3VRQ A;  1S36 A;  3GK2 A;  2JQ6 A;  4DS7 A;  2LVK A;  1QIW A;  2Y1N A;  1K94 A;  1IKU A;  2L98 A;  1CMG A;  2M9G A;  4GGF A;  3PLF B;  2LLU A;  3VRN A;  2KYC A;  1QVI Z;  2JPT A;  1L2O B;  2F8P A;  2VRG A;  3ZNI A;  3EK7 A;  3CWG A;  1J7Q A;  2PAL A;  2KGR A;  2L51 A;  1XFX O;  3LK0 A;  4JQ0 D;  2K2F A;  4NDD A;  1TCO B;  5GQQ C;  4QJ4 B;  2PVB A;  2EC6 C;  3LCP C;  1QV1 A;  1G8I A;  3PFV A;  1OMR A;  3AKA A;  2KFH A;  2WC8 A;  2LHI A;  2Q91 A;  3LLE A;  2F3Z A;  2G9B A;  5D69 A;  2BKH B;  1LKJ A;  2NCO A;  3O78 A;  3O6B A;  4I5L B;  2EHB A;  4FQO A;  2WCE A;  2K7D A;  5JJG A;  4GUK A;  1CM1 A;  1CB1 A;  2BCX A;  1OOJ A;  4C0L A;  1C7W A;  3DVE A;  3A4U B;  1ZMZ A;  1N2D A;  2WCB A;  3BOW A;  3GK4 X;  2LAP A;  2AUC A;  1KK8 B;  1OZO A;  2LCP A;  2CTN A;  3OP0 A;  3CR5 X;  3JTD B;  3CS1 A;  1B7T Z;  3I5H B;  3FWC A;  2ZKM X;  2ZN8 A;  3TDI A;  5HYD A;  2MRD A;  1BOD A;  1CKK A;  2R2I A;  5ER4 X;  4M2Q A;  2K7B A;  2F33 A;  3WHT B;  4ZCU A;  5CPV A;  4F0Z B;  1KSM A;  3SG3 A;  1TNX A;  1UP5 A;  2P6B B;  1SCM B;  3RM1 A;  4CLN A;  2BE6 A;  1B4C A;  3OHM B;  2OS8 B;  1KQV A;  3VRO A;  1K9P A;  1XK4 A;  4I5N B;  1ALW A;  3CGA A;  4MRX A;  1ZFS A;  1JC2 A;  1K93 D;  1NX1 A;  4WRI A;  3DVK A;  5CSN A;  1RWY A;  1IWQ A;  5CSF A;  3WNX B;  1TOP A;  1S26 D;  2EGD A;  5HKZ A;  1B1G A;  4M2O A;  2OTG B;  1YUU A;  1PAL A;  4HRG A;  4TNC A;  1UHJ A;  3NXA A;  4NQG A;  1K95 A;  1EG3 A;  2ISD A;  2KDH A;  3AKB A;  2JT8 A;  4PE0 A;  1SRA A;  5BPJ A;  1UHH A;  2M3W A;  1A75 A;  4M2P A;  1YUR A;  5KTY A;  1DF0 B;  2FOT A;  1HT9 A;  1SR6 C;  1TN4 A;  2MLE C;  2PSR A;  1K9K A;  1B9A A;  1JFJ A;  4OR9 B;  1EJ3 A;  2MBX A;  2JT0 A;  1AK8 A;  1XVJ A;  2LVI A;  1WRK A;  2M8U A;  5ER5 A;  3OB1 B;  5I2Q A;  3NSL A;  1A75 B;  4BY4 A;  4CFQ A;  1AUI B;  5FYX A;  3VGO A;  2L2E A;  1PVB A;  5AER A;  5AFP A;  3DVJ A;  1DJY A;  5AEQ A;  2Y4Q A;  3I5F C;  1HQV A;  4C0J A;  1DJX A;  2KAX A;  4MZK A;  3CTN A;  4HSZ A;  4PDZ A;  1FW4 A;  3CR2 A;  4YI8 A;  3PN7 C;  1DVI A;  1J1D A;  1EXR A;  4YGB B;  1G4Y R;  1JUO A;  1NPQ A;  2H61 C;  5D7F A;  1A29 A;  1AVS A;  1JWD A;  1NX3 A;  1XFW O;  2L0P A;  1DJH A;  4ICB A;  1J7P A;  4C0K A;  4MZJ A;  1LIN A;  3LL8 B;  1FPW A;  1RTP 1;  2LUC A;  4N1F A;  1KFU L;  1YVH A;  2EC6 B;  2L50 A;  2WCF A;  4NDC A;  2FCE A;  5I2L A;  4BY5 A;  1Q80 A;  4IL1 A;  2TN4 A;  2JNX A;  5CSJ A;  2CNP A;  1SL9 A;  1B8R A;  3GOF A;  1MXL C;  3TS5 C;  2M1K B;  1YUT A;  3EKJ A;  4PCW A;  1QX7 A;  2M7L A;  1ALV A;  3JVT C;  4I5J A;  2Y5I A;  2LE9 B;  3HCM A;  3EVV A;  1H4B A;  1NX0 A;  2BKI B;  5I8N A;  1NCZ A;  4MEW A;  2JNF A;  1TNW A;  3A8R A;  1F4O A;  1UHI A;  1M45 A;  1F55 A;  1BT6 A;  4A4B A;  2WND A;  2FCD A;  2LC5 A;  5J3X A;  3FIA A;  3I5I C;  3EVR A;  2AMI A;  2NZ0 A;  1NX2 A;  1MQ1 A;  1DJW A;  4USL A;  1XO5 A;  1N0Y A;  3H4S E;  2GV5 A;  1YVL A;  2NCP A;  3TDU A;  1DT7 B;  1G33 A;  3O2P A;  1CFD A;  1WLM A;  1KFX S;  4CFR A;  2D8N A;  2KNE A;  5I2O A;  1QLK A;  4GGN A;  3VRR A;  5DKQ A;  3EKH A;  1KK7 Z;  4ORB B;  1FBV A;  1S6I A;  2KYF A;  2LAN A;  5F6T A;  1LA0 A;  1UWO A;  1R2U A;  1CLM A;  1YX7 A;  5AAN A;  4L9M A;  2L4I A;  1X02 A;  4PAL A;  1OMV A;  1W7I B;  3NSI A;  1WDC B;  4PHJ A;  4I5K A;  1S5G Y;  2GGM A;  2JTT A;  3BOW B;  1Y0V H;  3SJS A;  1J7O A;  2DOQ A;  1KWO C;  1RJV A;  1WY9 A;  5HLO A;  1CFC A;  2LP2 A;  4GBA A;  2KSP A;  2V53 A;  4N1G A;  4WQ3 A;  3IQQ A;  2MHH A;  2Q4U A;  4N5X A;  1SKT A;  5AXI A;  1SL8 A;  1QX5 B;  1RFJ A;  1PUL A;  3QRX A;  2LNK A;  1SL7 A;  1SR6 B;  2I94 A;  5TNC A;  1TCF A;  2ZRS A;  1JBA A;  1BOC A;  1F71 A;  1SK6 D;  1BG1 A;  4HRE E;  3TZ1 A;  2LMU A;  3M0W A;  4AQI A;  3EK4 A;  4NDB A;  1QIV A;  1QVI Y;  4PE4 A;  3O4Y A;  3KPX A;  3PM8 A;  5PAL A;  1MR8 A;  2H61 A;  1S3P A;  1FF1 A;  1F54 A;  1AJ5 A;  1JFK A;  4UPG A;  1BLQ A;  3IF7 A;  1KQM C;  4A4C A;  1FI6 A;  1J7R A;  1GGZ A;  1KK8 C;  1NIW A;  2K8M B;  1OMD A;  2ZNE A;  1CLB A;  3SIA A;  4DIR A;  1YTZ C;  2SAS A;  2BCA A;  2KI4 C;  3WHU B;  1CFF A;  4JPZ B;  1SPY A;  3OX5 A;  1ZAC A;  1DGV A;  2LP3 A;  3D10 A;  3PN7 B;  4JWQ A;  1TTX A;  1QXP A;  3GK1 A;  1B8L A;  2M29 A;  2JU0 A;  2MLF C;  3EK8 A;  3KO0 A;  1DJZ A;  1QAS A;  2K7O A;  3FWB A;  4ORA B;  2KGB C;  2QPT A;  3BUO B;  1IQ5 A;  2CXJ A;  1SNL A;  2KAY A;  1MXE A;  2RGI A;  1S6J A;  2JRF A;  4YGC B;  1QV0 A;  2OS8 C;  1OZS A;  3K21 A;  1H8B A;  3ICB A;  2F3Y A;  2E6W A;  2PRU A;  3SG4 A;  1GGW A;  4PHK A;  1VRK A;  2LMV A;  2K61 A;  4QJ3 B;  4PHN A;  1ODB A;  1B7T Y;  3TS5 B;  1IH0 A;  2KFG A;  5HKY A;  2LVV A;  1YX8 A;  2OTG C;  1CNP A;  1TNP A;  1U5I A;  3JVT B;  1CDM A;  3DVM A;  3I5G C;  2KI6 C;  1TRF A;  2LHL A;  2HQW A;  1YRU B;  3E3R A;  1QLS A;  2KQY A;  1KCY A;  2JC2 A;  2O5G A;  1XA5 A;  2I7A A;  4HRH A;  1SW8 A;  4CPV A;  5CSI A;  1SCV A;  1QX2 A;  1YUS A;  1GQM A;  2A4J A;  1TIZ A;  2BE4 A;  3CLN A;  4YI9 A;  1CFP A;  1NCY A;  3BUX B;  3I5I B;  3PAL A;  1BJF A;  4AQJ A;  1U5I B;  1WRL A;  1M39 A;  1S5G Z;  1F70 A;  1K96 A;  1TNQ A;  1REC A;  1W7J B;  2M0R A;  4PHM A;  2ZND A;  1B47 A;  3IQO A;  1RRO A;  3BYA A;  3OB2 B;  4CID A;  1BF5 A;  2I2R E;  1Y1U A;  2K0J A;  4XYN A;  1DGU A;  1MWN A;  3SG5 A;  4OVN F;  2JXC A;  1XFZ O;  1AJ4 A;  2BEC A;  3C1V A;  1SBJ A;  3HX4 A;  2BCB A;  2M97 A;  1DMO A;  1NWD A;  1QAT A;  2LUX A;  3CZT X;  1IG5 A;  3TUY C;  2JTZ A;  3AAK A;  4GNK B;  1OSA A;  2MAZ A;  2HPS A;  3CR4 X;  4MN0 A;  1GJY A;  1NYA A;  2HQ8 A;  2O60 A;  2WOS A;  1KSO A;  1JF0 A;  2NXQ A;  3BQ3 A;  1KWO B;  2BL0 C;  1F4Q A;  4Q04 A;  1C07 A;  4YBH B;  2JT3 A;  1OQP A;  2JXL A;  2LM5 A;  2ZN9 A;  1QJT A;  1K90 D;  5DKN A;  3NSO A;  1YR5 A;  1JF2 A;  1M31 A;  1XFU O;  1YRT B;  4WQ2 A;  2ZRT A;  4YGE B;  4OKH A;  1DJI A;  1AHR A;  3SIB A;  1MUX A;  4MLW A;  4QJ5 B;  1V1G A;  1L2O C;  4GPL B;  1Y6W A;  2L4H A;  3PAT A;  1KFU S;  1PVA A;  1L7Z A;  1IJ5 A;  1XFY O;  1RK9 A;  1SMG A;  1E8A A;  2LLT A;  4ORC B;  3SG2 A;  1KQM B;  5JOL A;  3BUW B;  3RLZ A;  2M7N A;  2M1U A;  1N65 A;  3BUM B;  1PSR A;  3F45 A;  2B1U A;  1BMO A;  2LV7 A;  1WLZ A;  1A4P A;  3ZWH A;  4GGF C;  2HF5 A;  5G08 A;  1CDP A;  1NSH A;  2BBM A;  2KHN A;  2IS9 A;  5KSZ A;  2KI4 B;  1LA3 A;  2JZI A;  4GFT A;  1EL4 A;  5KU1 A;  2CT9 A;  4YRU A;  2I18 A;  4R1E A;  1LXF C;  5B8I B;  2K2A A;  1S1E A;  4MRY A;  4AOM A;  1NP8 A;  2JOJ A;  4DCK A;  1CMF A;  1CM4 A;  3VRP A;  4P2Y B;  4YGA A;  3EVU A;  2PMY A;  3D0Y A;  3BXK A;  2LMT A;  2H2K A;  3SG6 A;  2F2P A;  3PSR A;  2QAC A;  4P5O E;  4YGD B;  4MZL A;  1CDL A;  1IJ6 A;  2GGZ A;  3BUN B;  4ETO A;  3DF0 A;  3JTD C;  4FTG A;  1DF0 A;  3I5F B;  4U8D A;  5K89 A;  2KBM A;  5HLV A;  3I5H C;  4MSP A;  1WRZ A;  1MF8 B;  1NCX A;  1EG4 A;  1PSB A;  1WDC C;  1V1F A;  3I5G B;  3FS7 A;  3SG7 A;  2KFF A;  3D0Y B;  1CLL A;  1MHO A;  4D1E A;  4DRW A;  1IRJ A;  2KAV A;  1A03 A;  1SCM C;  2WOR A;  1F8H A;  2OPO A;  2KQ6 A;  4MVF A;  1BU3 A;  3DF0 B;  1J55 A;  5IBW A;  1K9U A;  2LLS A;  3KEV A;  4XJK A;  4DUQ A;  2NLN A;  1D1O A;  1SYM A;  2LVJ A;  1A2X A;  2FJU B;  1PK0 D;  2MA2 A;  1KK7 Y;  1UHK A;  2JWW A;  2F2O A;  1JSA A;  1R6P A;  3WXA A;  1NUB A;  3DD4 A;  2BBN A;  1J1E A;  1B8C A;  2AAO A;  1M63 B;  3NSK A;  1ZUZ A;  2MJW B;  1C7V A;  4E68 A;  1DTL A;  1IQ3 A;  1XK4 C;  4OV2 A;  2ZFD A;  4XJK B;  1AP4 A;  3MSE B;  1CDN A;  2JUL A;  1BR1 B;  1IGV A;  2K7C A;  1QS7 A;  3TDZ A;  3AAJ A;  1ZOT B;  2KOT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...