1B8CA

Parvalbumin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
108
structure length
108
Chain Sequence
b'AFAGVLNDADIAAALEACKAADSFNHKAFFAKVGLTSKSADDVKKAFAIIAQDKSGFIEEDELKLFLQNFKADARALTDGETKTFLKAGDSDGDGKIGVDDWTALVKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PARVALBUMIN)
publication title Metal-ion affinity and specificity in EF-hand proteins: coordination geometry and domain plasticity in parvalbumin.
pubmed doi rcsb
source organism Cyprinus carpio
molecule tags Calcium binding protein
total genus 34
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1b8cA00
2KFHA 2M1KB 3EKJA 3BOWB 1CKKA 2LUXA 3OHMB 2BKIB 1SKTA 5DKRA 3D0YB 5HKWA 3TS5B 1UHJA 1AVSA 3CS1A 4JPZB 4PE4A 3FIAA 1M46A 1XFUO 2LAPA 1A75B 1L7ZA 5I2LA 1Y1UA 1DVIA 4MRYA 1MXEA 5D7FA 1J7RA 3JVTB 1TNXA 1DGUA 3CR5X 2JNFA 2WCBA 2KYCA 2K2AA 1J55A 2JU0A 1UURA 3FS7A 1KSOA 1CFCA 1NYAA 1XK4A 1B8CA 2JNXA 1NUBA 2KNEA 3KO0A 1F71A 1BU3A 3AKBA 1QS7A 1EG4A 1RFJA 2B1UA 2OTGC 3JTDC 1G4YR 1FI6A 1QLKA 2V53A 2JT3A 1G8IA 2AAOA 1EH2A 4AOMA 1DT7B 2BCXA 1WLMA 2FCDA 1SR6B 1RJVA 2NCOA 1B1GA 1XFWO 1A4PA 2L4IA 1PK0D 3TDUA 2JTZA 2CTNA 3TUYC 4C0KA 2QACA 2MRDA 3EVRA 1MF8B 1BMOA 4YGBB 1S36A 1S5GZ 1MXLC 3CWGA 3OB2B 3PN7C 4N1FA 3LLEA 1L2OC 1J7PA 3WHTB 2ZRTA 1UHNA 3NSLA 1EJ3A 1WRLA 5KTYA 1CDLA 2QPTA 4C0LA 1HT9A 1CLMA 4GGFC 1X02A 4MLWA 4PDZA 3WXAA 3HX4A 2KI4B 1GQMA 1QX7A 5HKYA 5HKZA 4R1EA 2KAXA 1BG1A 3BUXB 1BT6A 2FCEA 2Q91A 2MJWB 1KK8C 3IQQA 1DF0B 4NQGA 1QIVA 1SBJA 1TOPA 1IRJA 2LHIA 1KK7Y 1OZSA 2BKHB 3KPXA 1PRWA 3BUNB 3BUWB 5ER4X 1RWYA 1R6PA 1K94A 2HQWA 1RECA 2KSPA 1LXFC 3AKAA 2E6WA 2H2KA 1YX8A 4A4BA 1OSAA 1SK6D 1WRKA 1XA5A 1TCFA 5F6TA 2Y1NA 3BYAA 2JULA 2NZ0A 1DGVA 4MZLA 3GK4X 5ER5A 1OZOA 3CTNA 1F55A 1J1DA 4QJ4B 1IQ3A 2WORA 2EC6C 1G33A 3SG2A 5AERA 2LMUA 3IF7A 1SL8A 1Y1AA 3BOWA 3VGOA 3DVEA 1NPQA 2JWWA 4GAOA 4HRHA 3EVUA 5K89A 2IS9A 3PSRA 3D0YA 4PHMA 1SY9A 1PVBA 3O2PA 2PVBA 2ZFDA 4NDDA 4GGFA 3I5HC 1MUXA 2D8NA 2LLSA 1A75A 4QJ3B 1KFUS 1RK9A 3NXAA 1TIZA 1MR8A 2P6BB 2WOSA 1LINA 1QX5B 4DIRA 4WQ3A 2KI6D 4U8DA 4YGEB 5IBWA 2KI6C 5B8IB 4ZCUA 2ZRSA 4MZKA 3CGAA 2KAVA 2JC2A 2G2BA 2GGMA 3JTDB 1AK8A 2OTGB 3GK2A 1UHKA 3H4SE 1QATA 4PE1A 3EKHA 2M8UA 2CNPA 1YVHA 1EL4A 2BBNA 2LC5A 2RGIA 2NCPA 3K21A 5JJGA 2KBMA 2WNDA 1SW8A 1S6IA 1ALVA 2JPTA 4DS7A 1SMGA 2O5GA 3VRQA 3PN7B 1JUOA 1L2OB 1A29A 5FYXA 1ODBA 1JBAA 1J1EA 1RTP1 1W7JB 2M29A 1N65A 3M0WA 1IJ5A 2K7CA 3DVJA 4XYNA 4ZCVA 3WHUB 2TN4A 5GQQC 1SCVA 2LVIA 1CLLA 4D1EA 2JXLA 5CSFA 5DKNA 5AXIA 3VROA 5CSIA 1OMDA 1KK8B 2JOJA 1MWNA 2NXQA 2MBXA 4P2YB 1GGZA 4MBEA 1S6JA 1DF0A 1EXRA 2LE9B 2NLNA 1CLBA 2CCMA 2HPSA 4QJ5B 3I5GC 3AAKA 1PULA 4YRUA 4UPGA 1IGVA 1PSBA 2JXCA 4PALA 2M0RA 1JFJA 1K95A 1K9UA 1YURA 2ZN8A 1S5GY 2F8PA 5AANA 2GGZA 3A4UB 1FW4A 3PLFB 1SL9A 1NCZA 1XFXO 1B9AA 1B7TY 1ZACA 2M7LA 2EC6B 1W7IB 4HRGA 1B8LA 3AAJA 1ZOTB 5CSJA 4M2OA 1VRKA 1KQMB 1IG5A 1YX7A 4OCIA 1JF2A 1N0YA 2L50A 2JZIA 1WLZA 2A4JA 2O60A 1B7TZ 3TDIA 2E30A 2K7BA 5AFPA 2MAZA 2G9BA 1NX1A 2LLUA 3OX6A 1F54A 3I5HB 2SCPA 4MEWA 1YUTA 2KYFA 2Y5IA 1LA0A 3KHEA 2KGRA 2JT0A 4YGCB 1S26D 5I8NA 5KU1A 2F2PA 2LHLA 1B8RA 2OPOA 1F4QA 1R2UA 1V1FA 2H61C 1NX2A 4WRIA 2ZKMX 1XYDA 3LK1A 4OVNF 3DF0B 2LVVA 2BCBA 3BUMB 4A4CA 1IH0A 1S6CA 1TNQA 1QV1A 1YUUA 2LVKA 1XVJA 3O78A 3GK1A 4TNCA 1QVIZ 3I5FC 3QRXA 1DJXA 3FWCA 3HCMA 1C7VA 2LCPA 3SG6A 1DJIA 2KDHA 1MHOA 1FPWA 3OP0A 4ETOA 4E68A 2BBMA 1K9PA 5TNCA 1OMVA 2BCAA 2I94A 1KFUL 1XFYO 2LMTA 3O6BA 2BL0B 4ICBA 1NX3A 2KHNA 2F33A 2F3YA 1KQMC 3LK0A 4PCWA 4Q04A 1JF0A 1CDMA 1CM1A 2CBLA 1YTZC 2PALA 3KF9A 1Y6WA 2PASA 2LP2A 4ORCB 3EK4A 1CDNA 1UWOA 4MRXA 3BUOB 4GNKB 1C07A 3EVVA 3CR4X 1H8BA 2OS8C 4N1GA 4AQJA 3PFVA 1M45A 3KEVA 4PE7A 1DJGA 2K2FA 1OMRA 1QJTA 2AMIA 4I5JA 2L5XB 4GGNA 2F2OA 4OKHA 1JFKA 1NCYA 2LVJA 4WQ2A 4PHKA 2LV7A 3NSIA 1DJWA 2CT9A 1BJFA 1E8AA 3I5GB 1K9KA 3LCPC 1XFVO 2MA2A 4XJKB 3VRRA 1FF1A 3ICBA 1CTRA 4M2PA 1NSHA 5JOLA 3E3RA 3MSEB 5DKQA 4CPVA 1CMGA 1CMFA 2BE6A 2KBIA 3A8RA 5CPVA 1S3PA 4MZJA 1SL7A 2JRFA 2ZNDA 3SJSA 3TZ1A 3SIAA 5J3XA 3F45A 5CSNA 1SCMB 2KQ6A 1HQVA 2M9GA 1TNWA 1DJHA 4GBAA 1IJ6A 4F0ZB 1UHHA 1NWDA 1WDCB 2BL0C 2K7DA 2KFFA 2KFGA 1CB1A 4ORBB 1XK4C 1B47A 2K8MB 3CZTX 1AP4A 2Y4QA 2R2IA 1TTXA 2WCFA 3ZWHA 3EK8A 1JSAA 2LANA 4PHJA 2BECA 2HETA 1GGWA 1LKJA 1XO5A 4PHNA 4YI8A 1KFXS 3OB1B 2CXJA 2Y1MA 2ISDA 4OR9B 3CR2A 1YVLA 1ALWA 1LA3A 1SPYA 1CFPA 4CIDA 2LNKA 1M31A 2L0PA 4I5KA 3WNXB 4YGAA 5HYDA 1FI5A 2FOTA 3O4YA 2KQYA 3SIBA 1AUIB 1YR5A 3DF0A 3LL8B 1JWDA 1K8UA 3I5FB 4GFTA 1KWOC 2L2EA 1LVCD 1SNLA 2FJUB 1PSRA 2HF5A 1AJ5A 2AUCA 3DVKA 1CFDA 1M63B 2BE4A 2DOQA 1A2XA 4HSZA 1IQ5A 2LM5A 2KOTA 3OX5A 1QLSA 3IQOA 2K0JA 3ZNIA 1D1OA 1NX0A 2COLB 1DTLA 4JWQA 4I5LB 1SCMC 2EHBA 5BPJA 1V1GA 4MSPA 1WDCC 1ZFSA 2SASA 4CLNA 1QXPA 1TRFA 1CM4A 1H4BA 3SG4A 4DCKA 2EGDA 3PM8A 2ZNEA 2WC8A 3RM1A 1AJ4A 2WCEA 1F70A 1K96A 2OS8B 1TCOB 4HREE 2JQ6A 5HLVA 1XFZO 1N2DA 1U5IB 1ZMZA 3D10A 5KSZA 1BODA 1DJYA 4M2QA 1B4CA 1OE9B 2M1UA 2MLFC 2M3WA 1QVIY 4IL1A 2VRGA 1AHRA 3PATA 5HLOA 3VRNA 1YRTB 1ZUZA 4BY5A 3TS5C 1MQ1A 3SG5A 4XJKA 2K61A 3DVMA 2L51A 1RROA 3CLNA 2L98A 1C7WA 1BOCA 5D69A 1JC2A 1IWQA 2I2RE 1NIWA 4GPLB 2L4HA 4OV2A 2I7AA 1TNPA 3JVTC 1QIWA 1QV0A 4YBHB 1J7QA 1NCXA 2JT8A 1F4OA 5G08A 4NDCA 1M39A 1DJZA 1YUSA 4USLA 1OOJA 4DUQA 2GV5A 2PMYA 5AEQA 1GJYA 1SYMA 3SG7A 3FWBA 4L9MA 4YGDB 3PALA 1BR4B 4C0JA 1BR1B 1KK7Z 1EG3A 1Y0VH 2KAYA 3I5IB 1Y1XA 4MVFA 4NDBA 4AQIA 1J7OA 2M97A 1CDPA 5I2OA 2LUCA 4GUKA 1SR6C 4ORAB 1SRAA 2LP3A 2Q4UA 2H61A 2PSRA 4FQOA 1K93D 1QTXA 2I18A 1KQVA 1IKUA 3GOFA 4FTGA 1UP5A 1KWOB 1BLQA 1FBVA 3BXKA 1WRZA 2HQ8A 4I5NB 2MLEC 3NSKA 2LLTA 2M49B 1BF5A 4P5OE 2K7OA 4DRWA 1NP8A 2KI4C 3DD4A 4MN0A 1A03A 1KFXL 1UHIA 2KGBC 1QX2A 2M7NA 1CNPA 2MHHA 4N5XA 4CFQA 2ZN9A 4CFRA 1YRUB 1UUSA 3NSOA 4PE0A 2F3ZA 3C1VA 1Q80A 1KCYA 5I2QA 1KSMA 4YI9A 3TDZA 1DMOA 3BQ3A 1K2HA 1K90D 4BY4A 3SG3A 4JQ0D 3RLZA 1F8HA 2PRUA 3I5IC 1PVAA 3EK7A 2LMVA 1CFFA 2JTTA 3TUYB 3VRPA 1U5IA 1TN4A 5PALA 1S1EA 1QASA 1OQPA 1PALA 1WY9A
chains in the Genus database with same CATH superfamily
2KFHA 2M1KB 3EKJA 3BOWB 3QMEA 1CKKA 2LUXA 3OHMB 2BKIB 1SKTA 5DKRA 3D0YB 5HKWA 3TS5B 1UHJA 1AVSA 3CS1A 1OW4A 4JPZB 4PE4A 3FIAA 1M46A 1XFUO 2LAPA 1A75B 1L7ZA 3BFHA 5I2LA 1Y1UA 3N7HA 1DVIA 4MRYA 1MXEA 5D7FA 1J7RA 3JVTB 3D78A 2KLDA 1TNXA 1DGUA 3CR5X 3O4XA 2JNFA 1OOHA 2WCKA 2WCBA 3PJIA 2KYCA 2K2AA 1J55A 2JU0A 1UURA 3FS7A 1KSOA 1CFCA 1NYAA 1XK4A 1B8CA 2JNXA 1NUBA 2KNEA 3FE6A 3KO0A 1F71A 1BU3A 3AKBA 1QS7A 1EG4A 1RFJA 2B1UA 2OTGC 3JTDC 1G4YR 1FI6A 1QLKA 2V53A 2JT3A 1G8IA 2AAOA 5DICA 1EH2A 2QDIA 2QEVA 4AOMA 4OZDA 1DT7B 2BCXA 1WLMA 2FCDA 1SR6B 1RJVA 2NCOA 1B1GA 1XFWO 1A4PA 2L4IA 1PK0D 3TDUA 2JTZA 2CTNA 3TUYC 4C0KA 2QACA 2MRDA 3EVRA 1MF8B 1BMOA 4YGBB 1S36A 1S5GZ 1LS8A 1MXLC 3CWGA 3OB2B 3PN7C 3L47A 4N1FA 3LLEA 1L2OC 3CZ0A 1J7PA 3WHTB 2ZRTA 1UHNA 3NSLA 1EJ3A 1WRLA 5KTYA 1CDLA 2QPTA 4C0LA 1HT9A 1CLMA 4GGFC 1X02A 4MLWA 4PDZA 3WXAA 3HX4A 2KI4B 1GQMA 1QX7A 5HKYA 5HKZA 4R1EA 3V2LA 2KAXA 1BG1A 3BUXB 3IVTA 2WCMA 1BT6A 3DZTA 2FCEA 2Q91A 2MJWB 1KK8C 3IQQA 2QEOA 1DF0B 2L5YA 4NQGA 1QIVA 1SBJA 1TOPA 2GTEA 1IRJA 2LHIA 1KK7Y 1OZSA 2BKHB 3KPXA 1PRWA 3BUNB 3BUWB 5ER4X 1RWYA 1R6PA 3OGNA 1K94A 2HQWA 1XFRA 1RECA 3R1OA 2KSPA 1LXFC 3AKAA 1DQEA 2E6WA 2H2KA 1YX8A 4A4BA 1OSAA 1SK6D 1WRKA 1XA5A 1TCFA 5F6TA 3SS5A 2Y1NA 3BYAA 2JULA 2NZ0A 1DGVA 4MZLA 1P28A 3GK4X 5ER5A 1OZOA 3CTNA 4INXA 1F55A 1J1DA 4QJ4B 1IQ3A 2WORA 2EC6C 1G33A 3SG2A 5AERA 2LMUA 3IF7A 1SL8A 1Y1AA 3BOWA 3VGOA 3DVEA 1NPQA 2JWWA 4GAOA 4HRHA 3EVUA 5K89A 3RZSA 2IS9A 3PSRA 3D0YA 3Q8IA 4PHMA 1SY9A 1PVBA 3O2PA 2PVBA 3R72A 2ZFDA 4NDDA 4GGFA 5I94A 1DELA 3I5HC 1MUXA 2D8NA 3NHIA 2LLSA 1A75A 4QJ3B 1KFUS 1RK9A 3NXAA 1TIZA 1MR8A 1SSEB 2P6BB 3NGVA 2WOSA 1LINA 1QX5B 4DIRA 4WQ3A 2KI6D 4U8DA 4YGEB 5IBWA 2KI6C 5B8IB 1OOIX 4ZCUA 2ZRSA 4MZKA 3CGAA 2KAVA 2JC2A 2G2BA 2GGMA 3JTDB 1AK8A 2OTGB 3GK2A 1UHKA 3H4SE 3D77A 3DXLA 1QATA 4PE1A 2YGUA 3EKHA 2M8UA 1GM0A 2CNPA 1YVHA 1EL4A 2BBNA 2LC5A 2RGIA 2NCPA 3K21A 3D73A 2KBMA 2WNDA 5JJGA 1SW8A 1S6IA 1ALVA 2JPTA 3EG5B 5FI2A 1SMGA 4DS7A 4F7FA 2O5GA 3VRQA 3PN7B 1JUOA 1L2OB 1A29A 5FYXA 1ODBA 1JBAA 3VB1A 1J1EA 1RTP1 1W7JB 2M29A 1N65A 3M0WA 1IJ5A 2BNXA 2K7CA 3DVJA 4XYNA 4ZCVA 3WHUB 4FQTA 2TN4A 5GQQC 1SCVA 2KPHA 1CLLA 2LVIA 4D1EA 2JXLA 5CSFA 4KYNA 5DKNA 5AXIA 3VROA 5CSIA 1OMDA 1KK8B 2JOJA 1MWNA 2NXQA 2MBXA 4P2YB 1GGZA 4MBEA 2P71A 1S6JA 1DF0A 1EXRA 2LE9B 2NLNA 1CLBA 2CCMA 2HPSA 4QJ5B 3I5GC 3AAKA 1PULA 4YRUA 4UPGA 1IGVA 1PSBA 2JXCA 3L4LA 4PALA 2L2CA 2M0RA 1JFJA 1K95A 1K9UA 1YURA 2ZN8A 1S5GY 2F8PA 5AANA 2P70A 2GGZA 3A4UB 1FW4A 3PLFB 1SL9A 1NCZA 1XFXO 1B9AA 1B7TY 1ZACA 2M7LA 2EC6B 1W7IB 4HRGA 1B8LA 3AAJA 1ZOTB 5CSJA 4M2OA 1VRKA 1KQMB 1IG5A 1YX7A 4OCIA 1JF2A 1N0YA 2L50A 2JZIA 1WLZA 2A4JA 2O60A 1B7TZ 3TDIA 2E30A 2K7BA 5AFPA 2MAZA 1QWVA 1NX1A 2G9BA 2LLUA 3OX6A 1F54A 3I5HB 2SCPA 4MEWA 1YUTA 2KYFA 2Y5IA 1LA0A 3D75A 3KHEA 2KGRA 2JT0A 4YGCB 1S26D 5I8NA 5KU1A 2F2PA 2LHLA 3B6XA 1B8RA 2OPOA 1F4QA 1R2UA 1V1FA 2H61C 1NX2A 4WRIA 2ZKMX 1XYDA 3LK1A 4OVNF 3DF0B 2LVVA 2BCBA 3BUMB 4A4CA 1IH0A 2JPOA 1S6CA 1TNQA 1QV1A 1YUUA 2LVKA 1XVJA 3O78A 3GK1A 4TNCA 1QVIZ 3I5FC 3QRXA 1DJXA 3FWCA 3HCMA 1C7VA 2LCPA 3SG6A 3BFBA 3R1VA 1DJIA 2KDHA 1MHOA 1TUZA 1FPWA 3OP0A 4ETOA 4E68A 2BBMA 1K9PA 5TNCA 1OMVA 2BCAA 2K60A 3BFAA 2ERBA 2I94A 1KFUL 1XFYO 2LMTA 3O6BA 2BL0B 4ICBA 1NX3A 2KHNA 2F33A 2F3YA 1KQMC 3LK0A 4PCWA 4Q04A 1JF0A 1CDMA 1CM1A 2CBLA 1YTZC 2PALA 3KF9A 1Y6WA 2PASA 2LP2A 4ORCB 3EK4A 1CDNA 1UWOA 4MRXA 3BUOB 4GNKB 3S0FA 1C07A 3EVVA 3FE9A 3CR4X 1H8BA 2OS8C 1DC1A 2BAPA 4N1GA 4AQJA 3PFVA 1M45A 3KEVA 4PE7A 1DJGA 2K2FA 1OMRA 1QJTA 2AMIA 4I5JA 4PT1A 2L5XB 4GGNA 2F2OA 4OKHA 1JFKA 1NCYA 2LVJA 4WQ2A 3S0BA 4PHKA 2LV7A 3DY9A 3NSIA 1DJWA 2CT9A 1BJFA 1E8AA 3I5GB 1K9KA 3LCPC 1XFVO 2MA2A 3FE8A 2WC6A 4XJKB 3VRRA 1FF1A 3ICBA 1CTRA 4M2PA 1NSHA 5JOLA 3R1PA 3E3RA 3MSEB 5DKQA 4CPVA 1CMGA 1TUJA 1CMFA 2BE6A 2KBIA 3A8RA 5CPVA 1S3PA 4MZJA 1SL7A 2JRFA 2ZNDA 3SJSA 3TZ1A 3SIAA 5J3XA 3F45A 3B88A 5CSNA 1SCMB 2KQ6A 1HQVA 2M9GA 1TNWA 1DJHA 4GBAA 1IJ6A 4F0ZB 1UHHA 1NWDA 1WDCB 2BL0C 2K7DA 2KFFA 2KFGA 2QEHA 3OBVA 1CB1A 4ORBB 1XK4C 1B47A 2K8MB 3CZTX 1AP4A 2PQLA 2Y4QA 2R2IA 1ORGA 1TTXA 2WCFA 3ZWHA 3EK8A 1JSAA 2LANA 4PHJA 4INWA 3CZ1A 2BECA 2HETA 3S0AA 1LKJA 1GGWA 1XO5A 4PHNA 4YI8A 1KFXS 3OB1B 2CXJA 2Y1MA 2ISDA 4OR9B 3CR2A 1YVLA 3S0GA 1ALWA 1LA3A 1SPYA 1CFPA 4CIDA 2LNKA 1M31A 2L0PA 1Z2CB 4I5KA 4YGAA 3WNXB 5HYDA 2FOTA 3O4YA 1TWOA 2KQYA 3SIBA 1AUIB 1YR5A 3DF0A 3LL8B 3BJHA 1K8UA 1JWDA 3I5FB 4GFTA 1KWOC 3SS3A 2L2EA 1LVCD 3L4AA 3B87A 1SNLA 2FJUB 1PSRA 2HF5A 1AJ5A 2AUCA 3DVKA 1CFDA 1M63B 2BE4A 2DOQA 1A2XA 4HSZA 1IQ5A 2LM5A 1T14A 2KOTA 1QLSA 2WCJA 3OX5A 3IQOA 2K0JA 3ZNIA 1D1OA 1NX0A 2COLB 1DTLA 3CDNA 4JWQA 4I5LB 1SCMC 2EHBA 4JD9A 5BPJA 1V1GA 1DEKA 4MSPA 1WDCC 1ZFSA 2SASA 1W9ZA 4CLNA 1QXPA 1TRFA 1CM4A 1H4BA 3SG4A 4DCKA 2EGDA 3PM8A 2ZNEA 2WC8A 3RM1A 1AJ4A 2WCEA 1F70A 1K96A 2OS8B 1TCOB 4HREE 2JQ6A 5HLVA 1XFZO 1N2DA 1U5IB 1ZMZA 3D10A 5KSZA 1BODA 3NHTA 1DJYA 4M2QA 1B4CA 2H8VA 1OE9B 2M1UA 2MLFC 1C3YA 2M3WA 1QVIY 4IL1A 3K1EA 2VRGA 3UO9A 1AHRA 2PYQA 3SS4A 2QEBA 3PATA 5HLOA 1YRTB 1ZUZA 3VRNA 3TS5C 4BY5A 1MQ1A 3SG5A 4XJKA 2K61A 3DVMA 2L51A 5FI7A 1RROA 5FI6A 3CLNA 2L98A 1C7WA 1BOCA 3CYZA 5D69A 1JC2A 1C3ZA 1IWQA 2I2RE 1NIWA 4GPLB 2L4HA 4OV2A 2I7AA 1TNPA 3JVTC 3S0DA 1QIWA 1QV0A 4YBHB 1J7QA 1NCXA 2JT8A 1F4OA 3CABA 5G08A 4NDCA 1M39A 1DJZA 1YUSA 4USLA 1OOJA 2WC5A 4DUQA 2GV5A 2PMYA 3D74A 3D76A 5AEQA 1GJYA 1SYMA 3SG7A 3FWBA 2FJYA 4L9MA 4YGDB 5D3OA 3PALA 1BR4B 4C0JA 1BR1B 1KK7Z 1EG3A 1Y0VH 2KAYA 3I5IB 1Y1XA 3B86A 4MVFA 4NDBA 4AQIA 1J7OA 2M97A 1CDPA 5I2OA 2LUCA 5HL1A 4GUKA 1SR6C 4ORAB 1SRAA 2LP3A 2Q4UA 2H61A 2PSRA 4FQOA 3DYEA 1K93D 5EL2A 1QTXA 2I18A 1KQVA 1IKUA 3GOFA 4FTGA 1UP5A 1KWOB 1BLQA 1FBVA 3B7AA 3BXKA 1WRZA 2HQ8A 4I5NB 2MLEC 3PM2A 3NSKA 2LLTA 2M49B 1BF5A 4P5OE 2K7OA 1Z4HA 2WCHA 1NP8A 4DRWA 4JKTA 2KI4C 3DD4A 4MN0A 1A03A 1KFXL 1UHIA 2KGBC 1QX2A 2M7NA 2WCLA 1CNPA 2MHHA 4N5XA 4CFQA 2ZN9A 4CFRA 1YRUB 1FI5A 1UUSA 3S0EA 3NSOA 4PE0A 2F3ZA 3C1VA 1Q80A 1KCYA 5I2QA 1KSMA 4YI9A 3TDZA 1DMOA 2KLEA 3BQ3A 1K90D 4BY4A 1K2HA 4IJ7A 3SG3A 4JQ0D 3RLZA 1IIOA 3CZ2A 1F8HA 2PRUA 3I5IC 1PVAA 3EK7A 2LMVA 3UNWA 1CFFA 2JTTA 3TUYB 3VRPA 1U5IA 1TN4A 5PALA 1S1EA 1QASA 1OOGA 1OQPA 1PALA 1WY9A 1OOFA
chains in the Genus database with same CATH topology
2KFHA 2M1KB 3EKJA 3BOWB 1CKKA 2LUXA 3OHMB 2BKIB 1SKTA 5DKRA 3D0YB 5HKWA 3TS5B 1UHJA 1AVSA 3CS1A 4JPZB 4PE4A 3FIAA 1M46A 1XFUO 2LAPA 1A75B 1L7ZA 5I2LA 1Y1UA 1DVIA 4MRYA 1MXEA 5D7FA 1J7RA 3JVTB 1TNXA 1DGUA 3CR5X 2JNFA 2WCBA 2KYCA 2K2AA 1J55A 2JU0A 1UURA 3FS7A 1KSOA 1CFCA 1NYAA 1XK4A 1B8CA 2JNXA 1NUBA 2KNEA 3KO0A 1F71A 1BU3A 3AKBA 1QS7A 1EG4A 1RFJA 2B1UA 2OTGC 3JTDC 1G4YR 1FI6A 1QLKA 2V53A 2JT3A 1G8IA 2AAOA 1EH2A 4AOMA 1DT7B 2BCXA 1WLMA 2FCDA 1SR6B 1RJVA 2NCOA 1B1GA 1XFWO 1A4PA 2L4IA 1PK0D 3TDUA 2JTZA 2CTNA 3TUYC 4C0KA 2QACA 2MRDA 3EVRA 1MF8B 1BMOA 4YGBB 1S36A 1S5GZ 1MXLC 3CWGA 3OB2B 3PN7C 4N1FA 3LLEA 1L2OC 1J7PA 3WHTB 2ZRTA 1UHNA 3NSLA 1EJ3A 1WRLA 5KTYA 1CDLA 2QPTA 4C0LA 1HT9A 1CLMA 4GGFC 1X02A 4MLWA 4PDZA 3WXAA 3HX4A 2KI4B 1GQMA 1QX7A 5HKYA 5HKZA 4R1EA 2KAXA 1BG1A 3BUXB 1BT6A 2FCEA 2Q91A 2MJWB 1KK8C 3IQQA 1DF0B 4NQGA 1QIVA 1SBJA 1TOPA 1IRJA 2LHIA 1KK7Y 1OZSA 2BKHB 3KPXA 1PRWA 3BUNB 3BUWB 5ER4X 1RWYA 1R6PA 1K94A 2HQWA 1RECA 2KSPA 1LXFC 3AKAA 2E6WA 2H2KA 1YX8A 4A4BA 1OSAA 1SK6D 1WRKA 1XA5A 1TCFA 5F6TA 2Y1NA 3BYAA 2JULA 2NZ0A 1DGVA 4MZLA 3GK4X 5ER5A 1OZOA 3CTNA 1F55A 1J1DA 4QJ4B 1IQ3A 2WORA 2EC6C 1G33A 3SG2A 5AERA 2LMUA 3IF7A 1SL8A 1Y1AA 3BOWA 3VGOA 3DVEA 1NPQA 2JWWA 4GAOA 4HRHA 3EVUA 5K89A 2IS9A 3PSRA 3D0YA 4PHMA 1SY9A 1PVBA 3O2PA 2PVBA 2ZFDA 4NDDA 4GGFA 3I5HC 1MUXA 2D8NA 2LLSA 1A75A 4QJ3B 1KFUS 1RK9A 3NXAA 1TIZA 1MR8A 2P6BB 2WOSA 1LINA 1QX5B 4DIRA 4WQ3A 2KI6D 4U8DA 4YGEB 5IBWA 2KI6C 5B8IB 4ZCUA 2ZRSA 4MZKA 3CGAA 2KAVA 2JC2A 2G2BA 2GGMA 3JTDB 1AK8A 2OTGB 3GK2A 1UHKA 3H4SE 1QATA 4PE1A 3EKHA 2M8UA 2CNPA 1YVHA 1EL4A 2BBNA 2LC5A 2RGIA 2NCPA 3K21A 5JJGA 2KBMA 2WNDA 1SW8A 1S6IA 1ALVA 2JPTA 4DS7A 1SMGA 2O5GA 3VRQA 3PN7B 1JUOA 1L2OB 1A29A 5FYXA 1ODBA 1JBAA 1J1EA 1RTP1 1W7JB 2M29A 1N65A 3M0WA 1IJ5A 2K7CA 3DVJA 4XYNA 4ZCVA 3WHUB 2TN4A 5GQQC 1SCVA 2LVIA 1CLLA 4D1EA 2JXLA 5CSFA 5DKNA 5AXIA 3VROA 5CSIA 1OMDA 1KK8B 2JOJA 1MWNA 2NXQA 2MBXA 4P2YB 1GGZA 4MBEA 1S6JA 1DF0A 1EXRA 2LE9B 2NLNA 1CLBA 2CCMA 2HPSA 4QJ5B 3I5GC 3AAKA 1PULA 4YRUA 4UPGA 1IGVA 1PSBA 2JXCA 4PALA 2M0RA 1JFJA 1K95A 1K9UA 1YURA 2ZN8A 1S5GY 2F8PA 5AANA 2GGZA 3A4UB 1FW4A 3PLFB 1SL9A 1NCZA 1XFXO 1B9AA 1B7TY 1ZACA 2M7LA 2EC6B 1W7IB 4HRGA 1B8LA 3AAJA 1ZOTB 5CSJA 4M2OA 1VRKA 1KQMB 1IG5A 1YX7A 4OCIA 1JF2A 1N0YA 2L50A 2JZIA 1WLZA 2A4JA 2O60A 1B7TZ 3TDIA 2E30A 2K7BA 5AFPA 2MAZA 2G9BA 1NX1A 2LLUA 3OX6A 1F54A 3I5HB 2SCPA 4MEWA 1YUTA 2KYFA 2Y5IA 1LA0A 3KHEA 2KGRA 2JT0A 4YGCB 1S26D 5I8NA 5KU1A 2F2PA 2LHLA 1B8RA 2OPOA 1F4QA 1R2UA 1V1FA 2H61C 1NX2A 4WRIA 2ZKMX 1XYDA 3LK1A 4OVNF 3DF0B 2LVVA 2BCBA 3BUMB 4A4CA 1IH0A 1S6CA 1TNQA 1QV1A 1YUUA 2LVKA 1XVJA 3O78A 3GK1A 4TNCA 1QVIZ 3I5FC 3QRXA 1DJXA 3FWCA 3HCMA 1C7VA 2LCPA 3SG6A 1DJIA 2KDHA 1MHOA 1FPWA 3OP0A 4ETOA 4E68A 2BBMA 1K9PA 5TNCA 1OMVA 2BCAA 2I94A 1KFUL 1XFYO 2LMTA 3O6BA 2BL0B 4ICBA 1NX3A 2KHNA 2F33A 2F3YA 1KQMC 3LK0A 4PCWA 4Q04A 1JF0A 1CDMA 1CM1A 2CBLA 1YTZC 2PALA 3KF9A 1Y6WA 2PASA 2LP2A 4ORCB 3EK4A 1CDNA 1UWOA 4MRXA 3BUOB 4GNKB 1C07A 3EVVA 3CR4X 1H8BA 2OS8C 4N1GA 4AQJA 3PFVA 1M45A 3KEVA 4PE7A 1DJGA 2K2FA 1OMRA 1QJTA 2AMIA 4I5JA 2L5XB 4GGNA 2F2OA 4OKHA 1JFKA 1NCYA 2LVJA 4WQ2A 4PHKA 2LV7A 3NSIA 1DJWA 2CT9A 1BJFA 1E8AA 3I5GB 1K9KA 3LCPC 1XFVO 2MA2A 4XJKB 3VRRA 1FF1A 3ICBA 1CTRA 4M2PA 1NSHA 5JOLA 3E3RA 3MSEB 5DKQA 4CPVA 1CMGA 1CMFA 2BE6A 2KBIA 3A8RA 5CPVA 1S3PA 4MZJA 1SL7A 2JRFA 2ZNDA 3SJSA 3TZ1A 3SIAA 5J3XA 3F45A 5CSNA 1SCMB 2KQ6A 1HQVA 2M9GA 1TNWA 1DJHA 4GBAA 1IJ6A 4F0ZB 1UHHA 1NWDA 1WDCB 2BL0C 2K7DA 2KFFA 2KFGA 1CB1A 4ORBB 1XK4C 1B47A 2K8MB 3CZTX 1AP4A 2Y4QA 2R2IA 1TTXA 2WCFA 3ZWHA 3EK8A 1JSAA 2LANA 4PHJA 2BECA 2HETA 1GGWA 1LKJA 1XO5A 4PHNA 4YI8A 1KFXS 3OB1B 2CXJA 2Y1MA 2ISDA 4OR9B 3CR2A 1YVLA 1ALWA 1LA3A 1SPYA 1CFPA 4CIDA 2LNKA 1M31A 2L0PA 4I5KA 3WNXB 4YGAA 5HYDA 1FI5A 2FOTA 3O4YA 2KQYA 3SIBA 1AUIB 1YR5A 3DF0A 3LL8B 1JWDA 1K8UA 3I5FB 4GFTA 1KWOC 2L2EA 1LVCD 1SNLA 2FJUB 1PSRA 2HF5A 1AJ5A 2AUCA 3DVKA 1CFDA 1M63B 2BE4A 2DOQA 1A2XA 4HSZA 1IQ5A 2LM5A 2KOTA 3OX5A 1QLSA 3IQOA 2K0JA 3ZNIA 1D1OA 1NX0A 2COLB 1DTLA 4JWQA 4I5LB 1SCMC 2EHBA 5BPJA 1V1GA 4MSPA 1WDCC 1ZFSA 2SASA 4CLNA 1QXPA 1TRFA 1CM4A 1H4BA 3SG4A 4DCKA 2EGDA 3PM8A 2ZNEA 2WC8A 3RM1A 1AJ4A 2WCEA 1F70A 1K96A 2OS8B 1TCOB 4HREE 2JQ6A 5HLVA 1XFZO 1N2DA 1U5IB 1ZMZA 3D10A 5KSZA 1BODA 1DJYA 4M2QA 1B4CA 1OE9B 2M1UA 2MLFC 2M3WA 1QVIY 4IL1A 2VRGA 1AHRA 3PATA 5HLOA 3VRNA 1YRTB 1ZUZA 4BY5A 3TS5C 1MQ1A 3SG5A 4XJKA 2K61A 3DVMA 2L51A 1RROA 3CLNA 2L98A 1C7WA 1BOCA 5D69A 1JC2A 1IWQA 2I2RE 1NIWA 4GPLB 2L4HA 4OV2A 2I7AA 1TNPA 3JVTC 1QIWA 1QV0A 4YBHB 1J7QA 1NCXA 2JT8A 1F4OA 5G08A 4NDCA 1M39A 1DJZA 1YUSA 4USLA 1OOJA 4DUQA 2GV5A 2PMYA 5AEQA 1GJYA 1SYMA 3SG7A 3FWBA 4L9MA 4YGDB 3PALA 1BR4B 4C0JA 1BR1B 1KK7Z 1EG3A 1Y0VH 2KAYA 3I5IB 1Y1XA 4MVFA 4NDBA 4AQIA 1J7OA 2M97A 1CDPA 5I2OA 2LUCA 4GUKA 1SR6C 4ORAB 1SRAA 2LP3A 2Q4UA 2H61A 2PSRA 4FQOA 1K93D 1QTXA 2I18A 1KQVA 1IKUA 3GOFA 4FTGA 1UP5A 1KWOB 1BLQA 1FBVA 3BXKA 1WRZA 2HQ8A 4I5NB 2MLEC 3NSKA 2LLTA 2M49B 1BF5A 4P5OE 2K7OA 4DRWA 1NP8A 2KI4C 3DD4A 4MN0A 1A03A 1KFXL 1UHIA 2KGBC 1QX2A 2M7NA 1CNPA 2MHHA 4N5XA 4CFQA 2ZN9A 4CFRA 1YRUB 1UUSA 3NSOA 4PE0A 2F3ZA 3C1VA 1Q80A 1KCYA 5I2QA 1KSMA 4YI9A 3TDZA 1DMOA 3BQ3A 1K2HA 1K90D 4BY4A 3SG3A 4JQ0D 3RLZA 1F8HA 2PRUA 3I5IC 1PVAA 3EK7A 2LMVA 1CFFA 2JTTA 3TUYB 3VRPA 1U5IA 1TN4A 5PALA 1S1EA 1QASA 1OQPA 1PALA 1WY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KFH A;  2M1K B;  3EKJ A;  3BOW B;  1CKK A;  2LUX A;  3OHM B;  2BKI B;  1SKT A;  5DKR A;  3D0Y B;  5HKW A;  3TS5 B;  1UHJ A;  1AVS A;  3CS1 A;  4JPZ B;  4PE4 A;  3FIA A;  1M46 A;  1XFU O;  2LAP A;  1A75 B;  1L7Z A;  5I2L A;  1Y1U A;  1DVI A;  4MRY A;  1MXE A;  5D7F A;  1J7R A;  3JVT B;  1TNX A;  1DGU A;  3CR5 X;  2JNF A;  2WCB A;  2KYC A;  2K2A A;  1J55 A;  2JU0 A;  1UUR A;  3FS7 A;  1KSO A;  1CFC A;  1NYA A;  1XK4 A;  1B8C A;  2JNX A;  1NUB A;  2KNE A;  3KO0 A;  1F71 A;  1BU3 A;  3AKB A;  1QS7 A;  1EG4 A;  1RFJ A;  2B1U A;  2OTG C;  3JTD C;  1G4Y R;  1FI6 A;  1QLK A;  2V53 A;  2JT3 A;  1G8I A;  2AAO A;  1EH2 A;  4AOM A;  1DT7 B;  2BCX A;  1WLM A;  2FCD A;  1SR6 B;  1RJV A;  2NCO A;  1B1G A;  1XFW O;  1A4P A;  2L4I A;  1PK0 D;  3TDU A;  2JTZ A;  2CTN A;  3TUY C;  4C0K A;  2QAC A;  2MRD A;  3EVR A;  1MF8 B;  1BMO A;  4YGB B;  1S36 A;  1S5G Z;  1MXL C;  3CWG A;  3OB2 B;  3PN7 C;  4N1F A;  3LLE A;  1L2O C;  1J7P A;  3WHT B;  2ZRT A;  1UHN A;  3NSL A;  1EJ3 A;  1WRL A;  5KTY A;  1CDL A;  2QPT A;  4C0L A;  1HT9 A;  1CLM A;  4GGF C;  1X02 A;  4MLW A;  4PDZ A;  3WXA A;  3HX4 A;  2KI4 B;  1GQM A;  1QX7 A;  5HKY A;  5HKZ A;  4R1E A;  2KAX A;  1BG1 A;  3BUX B;  1BT6 A;  2FCE A;  2Q91 A;  2MJW B;  1KK8 C;  3IQQ A;  1DF0 B;  4NQG A;  1QIV A;  1SBJ A;  1TOP A;  1IRJ A;  2LHI A;  1KK7 Y;  1OZS A;  2BKH B;  3KPX A;  1PRW A;  3BUN B;  3BUW B;  5ER4 X;  1RWY A;  1R6P A;  1K94 A;  2HQW A;  1REC A;  2KSP A;  1LXF C;  3AKA A;  2E6W A;  2H2K A;  1YX8 A;  4A4B A;  1OSA A;  1SK6 D;  1WRK A;  1XA5 A;  1TCF A;  5F6T A;  2Y1N A;  3BYA A;  2JUL A;  2NZ0 A;  1DGV A;  4MZL A;  3GK4 X;  5ER5 A;  1OZO A;  3CTN A;  1F55 A;  1J1D A;  4QJ4 B;  1IQ3 A;  2WOR A;  2EC6 C;  1G33 A;  3SG2 A;  5AER A;  2LMU A;  3IF7 A;  1SL8 A;  1Y1A A;  3BOW A;  3VGO A;  3DVE A;  1NPQ A;  2JWW A;  4GAO A;  4HRH A;  3EVU A;  5K89 A;  2IS9 A;  3PSR A;  3D0Y A;  4PHM A;  1SY9 A;  1PVB A;  3O2P A;  2PVB A;  2ZFD A;  4NDD A;  4GGF A;  3I5H C;  1MUX A;  2D8N A;  2LLS A;  1A75 A;  4QJ3 B;  1KFU S;  1RK9 A;  3NXA A;  1TIZ A;  1MR8 A;  2P6B B;  2WOS A;  1LIN A;  1QX5 B;  4DIR A;  4WQ3 A;  2KI6 D;  4U8D A;  4YGE B;  5IBW A;  2KI6 C;  5B8I B;  4ZCU A;  2ZRS A;  4MZK A;  3CGA A;  2KAV A;  2JC2 A;  2G2B A;  2GGM A;  3JTD B;  1AK8 A;  2OTG B;  3GK2 A;  1UHK A;  3H4S E;  1QAT A;  4PE1 A;  3EKH A;  2M8U A;  2CNP A;  1YVH A;  1EL4 A;  2BBN A;  2LC5 A;  2RGI A;  2NCP A;  3K21 A;  5JJG A;  2KBM A;  2WND A;  1SW8 A;  1S6I A;  1ALV A;  2JPT A;  4DS7 A;  1SMG A;  2O5G A;  3VRQ A;  3PN7 B;  1JUO A;  1L2O B;  1A29 A;  5FYX A;  1ODB A;  1JBA A;  1J1E A;  1RTP 1;  1W7J B;  2M29 A;  1N65 A;  3M0W A;  1IJ5 A;  2K7C A;  3DVJ A;  4XYN A;  4ZCV A;  3WHU B;  2TN4 A;  5GQQ C;  1SCV A;  2LVI A;  1CLL A;  4D1E A;  2JXL A;  5CSF A;  5DKN A;  5AXI A;  3VRO A;  5CSI A;  1OMD A;  1KK8 B;  2JOJ A;  1MWN A;  2NXQ A;  2MBX A;  4P2Y B;  1GGZ A;  4MBE A;  1S6J A;  1DF0 A;  1EXR A;  2LE9 B;  2NLN A;  1CLB A;  2CCM A;  2HPS A;  4QJ5 B;  3I5G C;  3AAK A;  1PUL A;  4YRU A;  4UPG A;  1IGV A;  1PSB A;  2JXC A;  4PAL A;  2M0R A;  1JFJ A;  1K95 A;  1K9U A;  1YUR A;  2ZN8 A;  1S5G Y;  2F8P A;  5AAN A;  2GGZ A;  3A4U B;  1FW4 A;  3PLF B;  1SL9 A;  1NCZ A;  1XFX O;  1B9A A;  1B7T Y;  1ZAC A;  2M7L A;  2EC6 B;  1W7I B;  4HRG A;  1B8L A;  3AAJ A;  1ZOT B;  5CSJ A;  4M2O A;  1VRK A;  1KQM B;  1IG5 A;  1YX7 A;  4OCI A;  1JF2 A;  1N0Y A;  2L50 A;  2JZI A;  1WLZ A;  2A4J A;  2O60 A;  1B7T Z;  3TDI A;  2E30 A;  2K7B A;  5AFP A;  2MAZ A;  2G9B A;  1NX1 A;  2LLU A;  3OX6 A;  1F54 A;  3I5H B;  2SCP A;  4MEW A;  1YUT A;  2KYF A;  2Y5I A;  1LA0 A;  3KHE A;  2KGR A;  2JT0 A;  4YGC B;  1S26 D;  5I8N A;  5KU1 A;  2F2P A;  2LHL A;  1B8R A;  2OPO A;  1F4Q A;  1R2U A;  1V1F A;  2H61 C;  1NX2 A;  4WRI A;  2ZKM X;  1XYD A;  3LK1 A;  4OVN F;  3DF0 B;  2LVV A;  2BCB A;  3BUM B;  4A4C A;  1IH0 A;  1S6C A;  1TNQ A;  1QV1 A;  1YUU A;  2LVK A;  1XVJ A;  3O78 A;  3GK1 A;  4TNC A;  1QVI Z;  3I5F C;  3QRX A;  1DJX A;  3FWC A;  3HCM A;  1C7V A;  2LCP A;  3SG6 A;  1DJI A;  2KDH A;  1MHO A;  1FPW A;  3OP0 A;  4ETO A;  4E68 A;  2BBM A;  1K9P A;  5TNC A;  1OMV A;  2BCA A;  2I94 A;  1KFU L;  1XFY O;  2LMT A;  3O6B A;  2BL0 B;  4ICB A;  1NX3 A;  2KHN A;  2F33 A;  2F3Y A;  1KQM C;  3LK0 A;  4PCW A;  4Q04 A;  1JF0 A;  1CDM A;  1CM1 A;  2CBL A;  1YTZ C;  2PAL A;  3KF9 A;  1Y6W A;  2PAS A;  2LP2 A;  4ORC B;  3EK4 A;  1CDN A;  1UWO A;  4MRX A;  3BUO B;  4GNK B;  1C07 A;  3EVV A;  3CR4 X;  1H8B A;  2OS8 C;  4N1G A;  4AQJ A;  3PFV A;  1M45 A;  3KEV A;  4PE7 A;  1DJG A;  2K2F A;  1OMR A;  1QJT A;  2AMI A;  4I5J A;  2L5X B;  4GGN A;  2F2O A;  4OKH A;  1JFK A;  1NCY A;  2LVJ A;  4WQ2 A;  4PHK A;  2LV7 A;  3NSI A;  1DJW A;  2CT9 A;  1BJF A;  1E8A A;  3I5G B;  1K9K A;  3LCP C;  1XFV O;  2MA2 A;  4XJK B;  3VRR A;  1FF1 A;  3ICB A;  1CTR A;  4M2P A;  1NSH A;  5JOL A;  3E3R A;  3MSE B;  5DKQ A;  4CPV A;  1CMG A;  1CMF A;  2BE6 A;  2KBI A;  3A8R A;  5CPV A;  1S3P A;  4MZJ A;  1SL7 A;  2JRF A;  2ZND A;  3SJS A;  3TZ1 A;  3SIA A;  5J3X A;  3F45 A;  5CSN A;  1SCM B;  2KQ6 A;  1HQV A;  2M9G A;  1TNW A;  1DJH A;  4GBA A;  1IJ6 A;  4F0Z B;  1UHH A;  1NWD A;  1WDC B;  2BL0 C;  2K7D A;  2KFF A;  2KFG A;  1CB1 A;  4ORB B;  1XK4 C;  1B47 A;  2K8M B;  3CZT X;  1AP4 A;  2Y4Q A;  2R2I A;  1TTX A;  2WCF A;  3ZWH A;  3EK8 A;  1JSA A;  2LAN A;  4PHJ A;  2BEC A;  2HET A;  1GGW A;  1LKJ A;  1XO5 A;  4PHN A;  4YI8 A;  1KFX S;  3OB1 B;  2CXJ A;  2Y1M A;  2ISD A;  4OR9 B;  3CR2 A;  1YVL A;  1ALW A;  1LA3 A;  1SPY A;  1CFP A;  4CID A;  2LNK A;  1M31 A;  2L0P A;  4I5K A;  3WNX B;  4YGA A;  5HYD A;  1FI5 A;  2FOT A;  3O4Y A;  2KQY A;  3SIB A;  1AUI B;  1YR5 A;  3DF0 A;  3LL8 B;  1JWD A;  1K8U A;  3I5F B;  4GFT A;  1KWO C;  2L2E A;  1LVC D;  1SNL A;  2FJU B;  1PSR A;  2HF5 A;  1AJ5 A;  2AUC A;  3DVK A;  1CFD A;  1M63 B;  2BE4 A;  2DOQ A;  1A2X A;  4HSZ A;  1IQ5 A;  2LM5 A;  2KOT A;  3OX5 A;  1QLS A;  3IQO A;  2K0J A;  3ZNI A;  1D1O A;  1NX0 A;  2COL B;  1DTL A;  4JWQ A;  4I5L B;  1SCM C;  2EHB A;  5BPJ A;  1V1G A;  4MSP A;  1WDC C;  1ZFS A;  2SAS A;  4CLN A;  1QXP A;  1TRF A;  1CM4 A;  1H4B A;  3SG4 A;  4DCK A;  2EGD A;  3PM8 A;  2ZNE A;  2WC8 A;  3RM1 A;  1AJ4 A;  2WCE A;  1F70 A;  1K96 A;  2OS8 B;  1TCO B;  4HRE E;  2JQ6 A;  5HLV A;  1XFZ O;  1N2D A;  1U5I B;  1ZMZ A;  3D10 A;  5KSZ A;  1BOD A;  1DJY A;  4M2Q A;  1B4C A;  1OE9 B;  2M1U A;  2MLF C;  2M3W A;  1QVI Y;  4IL1 A;  2VRG A;  1AHR A;  3PAT A;  5HLO A;  3VRN A;  1YRT B;  1ZUZ A;  4BY5 A;  3TS5 C;  1MQ1 A;  3SG5 A;  4XJK A;  2K61 A;  3DVM A;  2L51 A;  1RRO A;  3CLN A;  2L98 A;  1C7W A;  1BOC A;  5D69 A;  1JC2 A;  1IWQ A;  2I2R E;  1NIW A;  4GPL B;  2L4H A;  4OV2 A;  2I7A A;  1TNP A;  3JVT C;  1QIW A;  1QV0 A;  4YBH B;  1J7Q A;  1NCX A;  2JT8 A;  1F4O A;  5G08 A;  4NDC A;  1M39 A;  1DJZ A;  1YUS A;  4USL A;  1OOJ A;  4DUQ A;  2GV5 A;  2PMY A;  5AEQ A;  1GJY A;  1SYM A;  3SG7 A;  3FWB A;  4L9M A;  4YGD B;  3PAL A;  1BR4 B;  4C0J A;  1BR1 B;  1KK7 Z;  1EG3 A;  1Y0V H;  2KAY A;  3I5I B;  1Y1X A;  4MVF A;  4NDB A;  4AQI A;  1J7O A;  2M97 A;  1CDP A;  5I2O A;  2LUC A;  4GUK A;  1SR6 C;  4ORA B;  1SRA A;  2LP3 A;  2Q4U A;  2H61 A;  2PSR A;  4FQO A;  1K93 D;  1QTX A;  2I18 A;  1KQV A;  1IKU A;  3GOF A;  4FTG A;  1UP5 A;  1KWO B;  1BLQ A;  1FBV A;  3BXK A;  1WRZ A;  2HQ8 A;  4I5N B;  2MLE C;  3NSK A;  2LLT A;  2M49 B;  1BF5 A;  4P5O E;  2K7O A;  4DRW A;  1NP8 A;  2KI4 C;  3DD4 A;  4MN0 A;  1A03 A;  1KFX L;  1UHI A;  2KGB C;  1QX2 A;  2M7N A;  1CNP A;  2MHH A;  4N5X A;  4CFQ A;  2ZN9 A;  4CFR A;  1YRU B;  1UUS A;  3NSO A;  4PE0 A;  2F3Z A;  3C1V A;  1Q80 A;  1KCY A;  5I2Q A;  1KSM A;  4YI9 A;  3TDZ A;  1DMO A;  3BQ3 A;  1K2H A;  1K90 D;  4BY4 A;  3SG3 A;  4JQ0 D;  3RLZ A;  1F8H A;  2PRU A;  3I5I C;  1PVA A;  3EK7 A;  2LMV A;  1CFF A;  2JTT A;  3TUY B;  3VRP A;  1U5I A;  1TN4 A;  5PAL A;  1S1E A;  1QAS A;  1OQP A;  1PAL A;  1WY9 A; 
#chains in the Genus database with same CATH topology
 2KFH A;  2M1K B;  3EKJ A;  3BOW B;  3QME A;  1CKK A;  2LUX A;  3OHM B;  2BKI B;  1SKT A;  5DKR A;  3D0Y B;  5HKW A;  3TS5 B;  1UHJ A;  1AVS A;  3CS1 A;  1OW4 A;  4JPZ B;  4PE4 A;  3FIA A;  1M46 A;  1XFU O;  2LAP A;  1A75 B;  1L7Z A;  3BFH A;  5I2L A;  1Y1U A;  3N7H A;  1DVI A;  4MRY A;  1MXE A;  5D7F A;  1J7R A;  3JVT B;  3D78 A;  2KLD A;  1TNX A;  1DGU A;  3CR5 X;  3O4X A;  2JNF A;  1OOH A;  2WCK A;  2WCB A;  3PJI A;  2KYC A;  2K2A A;  1J55 A;  2JU0 A;  1UUR A;  3FS7 A;  1KSO A;  1CFC A;  1NYA A;  1XK4 A;  1B8C A;  2JNX A;  1NUB A;  2KNE A;  3FE6 A;  3KO0 A;  1F71 A;  1BU3 A;  3AKB A;  1QS7 A;  1EG4 A;  1RFJ A;  2B1U A;  2OTG C;  3JTD C;  1G4Y R;  1FI6 A;  1QLK A;  2V53 A;  2JT3 A;  1G8I A;  2AAO A;  5DIC A;  1EH2 A;  2QDI A;  2QEV A;  4AOM A;  4OZD A;  1DT7 B;  2BCX A;  1WLM A;  2FCD A;  1SR6 B;  1RJV A;  2NCO A;  1B1G A;  1XFW O;  1A4P A;  2L4I A;  1PK0 D;  3TDU A;  2JTZ A;  2CTN A;  3TUY C;  4C0K A;  2QAC A;  2MRD A;  3EVR A;  1MF8 B;  1BMO A;  4YGB B;  1S36 A;  1S5G Z;  1LS8 A;  1MXL C;  3CWG A;  3OB2 B;  3PN7 C;  3L47 A;  4N1F A;  3LLE A;  1L2O C;  3CZ0 A;  1J7P A;  3WHT B;  2ZRT A;  1UHN A;  3NSL A;  1EJ3 A;  1WRL A;  5KTY A;  1CDL A;  2QPT A;  4C0L A;  1HT9 A;  1CLM A;  4GGF C;  1X02 A;  4MLW A;  4PDZ A;  3WXA A;  3HX4 A;  2KI4 B;  1GQM A;  1QX7 A;  5HKY A;  5HKZ A;  4R1E A;  3V2L A;  2KAX A;  1BG1 A;  3BUX B;  3IVT A;  2WCM A;  1BT6 A;  3DZT A;  2FCE A;  2Q91 A;  2MJW B;  1KK8 C;  3IQQ A;  2QEO A;  1DF0 B;  2L5Y A;  4NQG A;  1QIV A;  1SBJ A;  1TOP A;  2GTE A;  1IRJ A;  2LHI A;  1KK7 Y;  1OZS A;  2BKH B;  3KPX A;  1PRW A;  3BUN B;  3BUW B;  5ER4 X;  1RWY A;  1R6P A;  3OGN A;  1K94 A;  2HQW A;  1XFR A;  1REC A;  3R1O A;  2KSP A;  1LXF C;  3AKA A;  1DQE A;  2E6W A;  2H2K A;  1YX8 A;  4A4B A;  1OSA A;  1SK6 D;  1WRK A;  1XA5 A;  1TCF A;  5F6T A;  3SS5 A;  2Y1N A;  3BYA A;  2JUL A;  2NZ0 A;  1DGV A;  4MZL A;  1P28 A;  3GK4 X;  5ER5 A;  1OZO A;  3CTN A;  4INX A;  1F55 A;  1J1D A;  4QJ4 B;  1IQ3 A;  2WOR A;  2EC6 C;  1G33 A;  3SG2 A;  5AER A;  2LMU A;  3IF7 A;  1SL8 A;  1Y1A A;  3BOW A;  3VGO A;  3DVE A;  1NPQ A;  2JWW A;  4GAO A;  4HRH A;  3EVU A;  5K89 A;  3RZS A;  2IS9 A;  3PSR A;  3D0Y A;  3Q8I A;  4PHM A;  1SY9 A;  1PVB A;  3O2P A;  2PVB A;  3R72 A;  2ZFD A;  4NDD A;  4GGF A;  5I94 A;  1DEL A;  3I5H C;  1MUX A;  2D8N A;  3NHI A;  2LLS A;  1A75 A;  4QJ3 B;  1KFU S;  1RK9 A;  3NXA A;  1TIZ A;  1MR8 A;  1SSE B;  2P6B B;  3NGV A;  2WOS A;  1LIN A;  1QX5 B;  4DIR A;  4WQ3 A;  2KI6 D;  4U8D A;  4YGE B;  5IBW A;  2KI6 C;  5B8I B;  1OOI X;  4ZCU A;  2ZRS A;  4MZK A;  3CGA A;  2KAV A;  2JC2 A;  2G2B A;  2GGM A;  3JTD B;  1AK8 A;  2OTG B;  3GK2 A;  1UHK A;  3H4S E;  3D77 A;  3DXL A;  1QAT A;  4PE1 A;  2YGU A;  3EKH A;  2M8U A;  1GM0 A;  2CNP A;  1YVH A;  1EL4 A;  2BBN A;  2LC5 A;  2RGI A;  2NCP A;  3K21 A;  3D73 A;  2KBM A;  2WND A;  5JJG A;  1SW8 A;  1S6I A;  1ALV A;  2JPT A;  3EG5 B;  5FI2 A;  1SMG A;  4DS7 A;  4F7F A;  2O5G A;  3VRQ A;  3PN7 B;  1JUO A;  1L2O B;  1A29 A;  5FYX A;  1ODB A;  1JBA A;  3VB1 A;  1J1E A;  1RTP 1;  1W7J B;  2M29 A;  1N65 A;  3M0W A;  1IJ5 A;  2BNX A;  2K7C A;  3DVJ A;  4XYN A;  4ZCV A;  3WHU B;  4FQT A;  2TN4 A;  5GQQ C;  1SCV A;  2KPH A;  1CLL A;  2LVI A;  4D1E A;  2JXL A;  5CSF A;  4KYN A;  5DKN A;  5AXI A;  3VRO A;  5CSI A;  1OMD A;  1KK8 B;  2JOJ A;  1MWN A;  2NXQ A;  2MBX A;  4P2Y B;  1GGZ A;  4MBE A;  2P71 A;  1S6J A;  1DF0 A;  1EXR A;  2LE9 B;  2NLN A;  1CLB A;  2CCM A;  2HPS A;  4QJ5 B;  3I5G C;  3AAK A;  1PUL A;  4YRU A;  4UPG A;  1IGV A;  1PSB A;  2JXC A;  3L4L A;  4PAL A;  2L2C A;  2M0R A;  1JFJ A;  1K95 A;  1K9U A;  1YUR A;  2ZN8 A;  1S5G Y;  2F8P A;  5AAN A;  2P70 A;  2GGZ A;  3A4U B;  1FW4 A;  3PLF B;  1SL9 A;  1NCZ A;  1XFX O;  1B9A A;  1B7T Y;  1ZAC A;  2M7L A;  2EC6 B;  1W7I B;  4HRG A;  1B8L A;  3AAJ A;  1ZOT B;  5CSJ A;  4M2O A;  1VRK A;  1KQM B;  1IG5 A;  1YX7 A;  4OCI A;  1JF2 A;  1N0Y A;  2L50 A;  2JZI A;  1WLZ A;  2A4J A;  2O60 A;  1B7T Z;  3TDI A;  2E30 A;  2K7B A;  5AFP A;  2MAZ A;  1QWV A;  1NX1 A;  2G9B A;  2LLU A;  3OX6 A;  1F54 A;  3I5H B;  2SCP A;  4MEW A;  1YUT A;  2KYF A;  2Y5I A;  1LA0 A;  3D75 A;  3KHE A;  2KGR A;  2JT0 A;  4YGC B;  1S26 D;  5I8N A;  5KU1 A;  2F2P A;  2LHL A;  3B6X A;  1B8R A;  2OPO A;  1F4Q A;  1R2U A;  1V1F A;  2H61 C;  1NX2 A;  4WRI A;  2ZKM X;  1XYD A;  3LK1 A;  4OVN F;  3DF0 B;  2LVV A;  2BCB A;  3BUM B;  4A4C A;  1IH0 A;  2JPO A;  1S6C A;  1TNQ A;  1QV1 A;  1YUU A;  2LVK A;  1XVJ A;  3O78 A;  3GK1 A;  4TNC A;  1QVI Z;  3I5F C;  3QRX A;  1DJX A;  3FWC A;  3HCM A;  1C7V A;  2LCP A;  3SG6 A;  3BFB A;  3R1V A;  1DJI A;  2KDH A;  1MHO A;  1TUZ A;  1FPW A;  3OP0 A;  4ETO A;  4E68 A;  2BBM A;  1K9P A;  5TNC A;  1OMV A;  2BCA A;  2K60 A;  3BFA A;  2ERB A;  2I94 A;  1KFU L;  1XFY O;  2LMT A;  3O6B A;  2BL0 B;  4ICB A;  1NX3 A;  2KHN A;  2F33 A;  2F3Y A;  1KQM C;  3LK0 A;  4PCW A;  4Q04 A;  1JF0 A;  1CDM A;  1CM1 A;  2CBL A;  1YTZ C;  2PAL A;  3KF9 A;  1Y6W A;  2PAS A;  2LP2 A;  4ORC B;  3EK4 A;  1CDN A;  1UWO A;  4MRX A;  3BUO B;  4GNK B;  3S0F A;  1C07 A;  3EVV A;  3FE9 A;  3CR4 X;  1H8B A;  2OS8 C;  1DC1 A;  2BAP A;  4N1G A;  4AQJ A;  3PFV A;  1M45 A;  3KEV A;  4PE7 A;  1DJG A;  2K2F A;  1OMR A;  1QJT A;  2AMI A;  4I5J A;  4PT1 A;  2L5X B;  4GGN A;  2F2O A;  4OKH A;  1JFK A;  1NCY A;  2LVJ A;  4WQ2 A;  3S0B A;  4PHK A;  2LV7 A;  3DY9 A;  3NSI A;  1DJW A;  2CT9 A;  1BJF A;  1E8A A;  3I5G B;  1K9K A;  3LCP C;  1XFV O;  2MA2 A;  3FE8 A;  2WC6 A;  4XJK B;  3VRR A;  1FF1 A;  3ICB A;  1CTR A;  4M2P A;  1NSH A;  5JOL A;  3R1P A;  3E3R A;  3MSE B;  5DKQ A;  4CPV A;  1CMG A;  1TUJ A;  1CMF A;  2BE6 A;  2KBI A;  3A8R A;  5CPV A;  1S3P A;  4MZJ A;  1SL7 A;  2JRF A;  2ZND A;  3SJS A;  3TZ1 A;  3SIA A;  5J3X A;  3F45 A;  3B88 A;  5CSN A;  1SCM B;  2KQ6 A;  1HQV A;  2M9G A;  1TNW A;  1DJH A;  4GBA A;  1IJ6 A;  4F0Z B;  1UHH A;  1NWD A;  1WDC B;  2BL0 C;  2K7D A;  2KFF A;  2KFG A;  2QEH A;  3OBV A;  1CB1 A;  4ORB B;  1XK4 C;  1B47 A;  2K8M B;  3CZT X;  1AP4 A;  2PQL A;  2Y4Q A;  2R2I A;  1ORG A;  1TTX A;  2WCF A;  3ZWH A;  3EK8 A;  1JSA A;  2LAN A;  4PHJ A;  4INW A;  3CZ1 A;  2BEC A;  2HET A;  3S0A A;  1LKJ A;  1GGW A;  1XO5 A;  4PHN A;  4YI8 A;  1KFX S;  3OB1 B;  2CXJ A;  2Y1M A;  2ISD A;  4OR9 B;  3CR2 A;  1YVL A;  3S0G A;  1ALW A;  1LA3 A;  1SPY A;  1CFP A;  4CID A;  2LNK A;  1M31 A;  2L0P A;  1Z2C B;  4I5K A;  4YGA A;  3WNX B;  5HYD A;  2FOT A;  3O4Y A;  1TWO A;  2KQY A;  3SIB A;  1AUI B;  1YR5 A;  3DF0 A;  3LL8 B;  3BJH A;  1K8U A;  1JWD A;  3I5F B;  4GFT A;  1KWO C;  3SS3 A;  2L2E A;  1LVC D;  3L4A A;  3B87 A;  1SNL A;  2FJU B;  1PSR A;  2HF5 A;  1AJ5 A;  2AUC A;  3DVK A;  1CFD A;  1M63 B;  2BE4 A;  2DOQ A;  1A2X A;  4HSZ A;  1IQ5 A;  2LM5 A;  1T14 A;  2KOT A;  1QLS A;  2WCJ A;  3OX5 A;  3IQO A;  2K0J A;  3ZNI A;  1D1O A;  1NX0 A;  2COL B;  1DTL A;  3CDN A;  4JWQ A;  4I5L B;  1SCM C;  2EHB A;  4JD9 A;  5BPJ A;  1V1G A;  1DEK A;  4MSP A;  1WDC C;  1ZFS A;  2SAS A;  1W9Z A;  4CLN A;  1QXP A;  1TRF A;  1CM4 A;  1H4B A;  3SG4 A;  4DCK A;  2EGD A;  3PM8 A;  2ZNE A;  2WC8 A;  3RM1 A;  1AJ4 A;  2WCE A;  1F70 A;  1K96 A;  2OS8 B;  1TCO B;  4HRE E;  2JQ6 A;  5HLV A;  1XFZ O;  1N2D A;  1U5I B;  1ZMZ A;  3D10 A;  5KSZ A;  1BOD A;  3NHT A;  1DJY A;  4M2Q A;  1B4C A;  2H8V A;  1OE9 B;  2M1U A;  2MLF C;  1C3Y A;  2M3W A;  1QVI Y;  4IL1 A;  3K1E A;  2VRG A;  3UO9 A;  1AHR A;  2PYQ A;  3SS4 A;  2QEB A;  3PAT A;  5HLO A;  1YRT B;  1ZUZ A;  3VRN A;  3TS5 C;  4BY5 A;  1MQ1 A;  3SG5 A;  4XJK A;  2K61 A;  3DVM A;  2L51 A;  5FI7 A;  1RRO A;  5FI6 A;  3CLN A;  2L98 A;  1C7W A;  1BOC A;  3CYZ A;  5D69 A;  1JC2 A;  1C3Z A;  1IWQ A;  2I2R E;  1NIW A;  4GPL B;  2L4H A;  4OV2 A;  2I7A A;  1TNP A;  3JVT C;  3S0D A;  1QIW A;  1QV0 A;  4YBH B;  1J7Q A;  1NCX A;  2JT8 A;  1F4O A;  3CAB A;  5G08 A;  4NDC A;  1M39 A;  1DJZ A;  1YUS A;  4USL A;  1OOJ A;  2WC5 A;  4DUQ A;  2GV5 A;  2PMY A;  3D74 A;  3D76 A;  5AEQ A;  1GJY A;  1SYM A;  3SG7 A;  3FWB A;  2FJY A;  4L9M A;  4YGD B;  5D3O A;  3PAL A;  1BR4 B;  4C0J A;  1BR1 B;  1KK7 Z;  1EG3 A;  1Y0V H;  2KAY A;  3I5I B;  1Y1X A;  3B86 A;  4MVF A;  4NDB A;  4AQI A;  1J7O A;  2M97 A;  1CDP A;  5I2O A;  2LUC A;  5HL1 A;  4GUK A;  1SR6 C;  4ORA B;  1SRA A;  2LP3 A;  2Q4U A;  2H61 A;  2PSR A;  4FQO A;  3DYE A;  1K93 D;  5EL2 A;  1QTX A;  2I18 A;  1KQV A;  1IKU A;  3GOF A;  4FTG A;  1UP5 A;  1KWO B;  1BLQ A;  1FBV A;  3B7A A;  3BXK A;  1WRZ A;  2HQ8 A;  4I5N B;  2MLE C;  3PM2 A;  3NSK A;  2LLT A;  2M49 B;  1BF5 A;  4P5O E;  2K7O A;  1Z4H A;  2WCH A;  1NP8 A;  4DRW A;  4JKT A;  2KI4 C;  3DD4 A;  4MN0 A;  1A03 A;  1KFX L;  1UHI A;  2KGB C;  1QX2 A;  2M7N A;  2WCL A;  1CNP A;  2MHH A;  4N5X A;  4CFQ A;  2ZN9 A;  4CFR A;  1YRU B;  1FI5 A;  1UUS A;  3S0E A;  3NSO A;  4PE0 A;  2F3Z A;  3C1V A;  1Q80 A;  1KCY A;  5I2Q A;  1KSM A;  4YI9 A;  3TDZ A;  1DMO A;  2KLE A;  3BQ3 A;  1K90 D;  4BY4 A;  1K2H A;  4IJ7 A;  3SG3 A;  4JQ0 D;  3RLZ A;  1IIO A;  3CZ2 A;  1F8H A;  2PRU A;  3I5I C;  1PVA A;  3EK7 A;  2LMV A;  3UNW A;  1CFF A;  2JTT A;  3TUY B;  3VRP A;  1U5I A;  1TN4 A;  5PAL A;  1S1E A;  1QAS A;  1OOG A;  1OQP A;  1PAL A;  1WY9 A;  1OOF A; 
#chains in the Genus database with same CATH homology
 2KFH A;  2M1K B;  3EKJ A;  3BOW B;  1CKK A;  2LUX A;  3OHM B;  2BKI B;  1SKT A;  5DKR A;  3D0Y B;  5HKW A;  3TS5 B;  1UHJ A;  1AVS A;  3CS1 A;  4JPZ B;  4PE4 A;  3FIA A;  1M46 A;  1XFU O;  2LAP A;  1A75 B;  1L7Z A;  5I2L A;  1Y1U A;  1DVI A;  4MRY A;  1MXE A;  5D7F A;  1J7R A;  3JVT B;  1TNX A;  1DGU A;  3CR5 X;  2JNF A;  2WCB A;  2KYC A;  2K2A A;  1J55 A;  2JU0 A;  1UUR A;  3FS7 A;  1KSO A;  1CFC A;  1NYA A;  1XK4 A;  1B8C A;  2JNX A;  1NUB A;  2KNE A;  3KO0 A;  1F71 A;  1BU3 A;  3AKB A;  1QS7 A;  1EG4 A;  1RFJ A;  2B1U A;  2OTG C;  3JTD C;  1G4Y R;  1FI6 A;  1QLK A;  2V53 A;  2JT3 A;  1G8I A;  2AAO A;  1EH2 A;  4AOM A;  1DT7 B;  2BCX A;  1WLM A;  2FCD A;  1SR6 B;  1RJV A;  2NCO A;  1B1G A;  1XFW O;  1A4P A;  2L4I A;  1PK0 D;  3TDU A;  2JTZ A;  2CTN A;  3TUY C;  4C0K A;  2QAC A;  2MRD A;  3EVR A;  1MF8 B;  1BMO A;  4YGB B;  1S36 A;  1S5G Z;  1MXL C;  3CWG A;  3OB2 B;  3PN7 C;  4N1F A;  3LLE A;  1L2O C;  1J7P A;  3WHT B;  2ZRT A;  1UHN A;  3NSL A;  1EJ3 A;  1WRL A;  5KTY A;  1CDL A;  2QPT A;  4C0L A;  1HT9 A;  1CLM A;  4GGF C;  1X02 A;  4MLW A;  4PDZ A;  3WXA A;  3HX4 A;  2KI4 B;  1GQM A;  1QX7 A;  5HKY A;  5HKZ A;  4R1E A;  2KAX A;  1BG1 A;  3BUX B;  1BT6 A;  2FCE A;  2Q91 A;  2MJW B;  1KK8 C;  3IQQ A;  1DF0 B;  4NQG A;  1QIV A;  1SBJ A;  1TOP A;  1IRJ A;  2LHI A;  1KK7 Y;  1OZS A;  2BKH B;  3KPX A;  1PRW A;  3BUN B;  3BUW B;  5ER4 X;  1RWY A;  1R6P A;  1K94 A;  2HQW A;  1REC A;  2KSP A;  1LXF C;  3AKA A;  2E6W A;  2H2K A;  1YX8 A;  4A4B A;  1OSA A;  1SK6 D;  1WRK A;  1XA5 A;  1TCF A;  5F6T A;  2Y1N A;  3BYA A;  2JUL A;  2NZ0 A;  1DGV A;  4MZL A;  3GK4 X;  5ER5 A;  1OZO A;  3CTN A;  1F55 A;  1J1D A;  4QJ4 B;  1IQ3 A;  2WOR A;  2EC6 C;  1G33 A;  3SG2 A;  5AER A;  2LMU A;  3IF7 A;  1SL8 A;  1Y1A A;  3BOW A;  3VGO A;  3DVE A;  1NPQ A;  2JWW A;  4GAO A;  4HRH A;  3EVU A;  5K89 A;  2IS9 A;  3PSR A;  3D0Y A;  4PHM A;  1SY9 A;  1PVB A;  3O2P A;  2PVB A;  2ZFD A;  4NDD A;  4GGF A;  3I5H C;  1MUX A;  2D8N A;  2LLS A;  1A75 A;  4QJ3 B;  1KFU S;  1RK9 A;  3NXA A;  1TIZ A;  1MR8 A;  2P6B B;  2WOS A;  1LIN A;  1QX5 B;  4DIR A;  4WQ3 A;  2KI6 D;  4U8D A;  4YGE B;  5IBW A;  2KI6 C;  5B8I B;  4ZCU A;  2ZRS A;  4MZK A;  3CGA A;  2KAV A;  2JC2 A;  2G2B A;  2GGM A;  3JTD B;  1AK8 A;  2OTG B;  3GK2 A;  1UHK A;  3H4S E;  1QAT A;  4PE1 A;  3EKH A;  2M8U A;  2CNP A;  1YVH A;  1EL4 A;  2BBN A;  2LC5 A;  2RGI A;  2NCP A;  3K21 A;  5JJG A;  2KBM A;  2WND A;  1SW8 A;  1S6I A;  1ALV A;  2JPT A;  4DS7 A;  1SMG A;  2O5G A;  3VRQ A;  3PN7 B;  1JUO A;  1L2O B;  1A29 A;  5FYX A;  1ODB A;  1JBA A;  1J1E A;  1RTP 1;  1W7J B;  2M29 A;  1N65 A;  3M0W A;  1IJ5 A;  2K7C A;  3DVJ A;  4XYN A;  4ZCV A;  3WHU B;  2TN4 A;  5GQQ C;  1SCV A;  2LVI A;  1CLL A;  4D1E A;  2JXL A;  5CSF A;  5DKN A;  5AXI A;  3VRO A;  5CSI A;  1OMD A;  1KK8 B;  2JOJ A;  1MWN A;  2NXQ A;  2MBX A;  4P2Y B;  1GGZ A;  4MBE A;  1S6J A;  1DF0 A;  1EXR A;  2LE9 B;  2NLN A;  1CLB A;  2CCM A;  2HPS A;  4QJ5 B;  3I5G C;  3AAK A;  1PUL A;  4YRU A;  4UPG A;  1IGV A;  1PSB A;  2JXC A;  4PAL A;  2M0R A;  1JFJ A;  1K95 A;  1K9U A;  1YUR A;  2ZN8 A;  1S5G Y;  2F8P A;  5AAN A;  2GGZ A;  3A4U B;  1FW4 A;  3PLF B;  1SL9 A;  1NCZ A;  1XFX O;  1B9A A;  1B7T Y;  1ZAC A;  2M7L A;  2EC6 B;  1W7I B;  4HRG A;  1B8L A;  3AAJ A;  1ZOT B;  5CSJ A;  4M2O A;  1VRK A;  1KQM B;  1IG5 A;  1YX7 A;  4OCI A;  1JF2 A;  1N0Y A;  2L50 A;  2JZI A;  1WLZ A;  2A4J A;  2O60 A;  1B7T Z;  3TDI A;  2E30 A;  2K7B A;  5AFP A;  2MAZ A;  2G9B A;  1NX1 A;  2LLU A;  3OX6 A;  1F54 A;  3I5H B;  2SCP A;  4MEW A;  1YUT A;  2KYF A;  2Y5I A;  1LA0 A;  3KHE A;  2KGR A;  2JT0 A;  4YGC B;  1S26 D;  5I8N A;  5KU1 A;  2F2P A;  2LHL A;  1B8R A;  2OPO A;  1F4Q A;  1R2U A;  1V1F A;  2H61 C;  1NX2 A;  4WRI A;  2ZKM X;  1XYD A;  3LK1 A;  4OVN F;  3DF0 B;  2LVV A;  2BCB A;  3BUM B;  4A4C A;  1IH0 A;  1S6C A;  1TNQ A;  1QV1 A;  1YUU A;  2LVK A;  1XVJ A;  3O78 A;  3GK1 A;  4TNC A;  1QVI Z;  3I5F C;  3QRX A;  1DJX A;  3FWC A;  3HCM A;  1C7V A;  2LCP A;  3SG6 A;  1DJI A;  2KDH A;  1MHO A;  1FPW A;  3OP0 A;  4ETO A;  4E68 A;  2BBM A;  1K9P A;  5TNC A;  1OMV A;  2BCA A;  2I94 A;  1KFU L;  1XFY O;  2LMT A;  3O6B A;  2BL0 B;  4ICB A;  1NX3 A;  2KHN A;  2F33 A;  2F3Y A;  1KQM C;  3LK0 A;  4PCW A;  4Q04 A;  1JF0 A;  1CDM A;  1CM1 A;  2CBL A;  1YTZ C;  2PAL A;  3KF9 A;  1Y6W A;  2PAS A;  2LP2 A;  4ORC B;  3EK4 A;  1CDN A;  1UWO A;  4MRX A;  3BUO B;  4GNK B;  1C07 A;  3EVV A;  3CR4 X;  1H8B A;  2OS8 C;  4N1G A;  4AQJ A;  3PFV A;  1M45 A;  3KEV A;  4PE7 A;  1DJG A;  2K2F A;  1OMR A;  1QJT A;  2AMI A;  4I5J A;  2L5X B;  4GGN A;  2F2O A;  4OKH A;  1JFK A;  1NCY A;  2LVJ A;  4WQ2 A;  4PHK A;  2LV7 A;  3NSI A;  1DJW A;  2CT9 A;  1BJF A;  1E8A A;  3I5G B;  1K9K A;  3LCP C;  1XFV O;  2MA2 A;  4XJK B;  3VRR A;  1FF1 A;  3ICB A;  1CTR A;  4M2P A;  1NSH A;  5JOL A;  3E3R A;  3MSE B;  5DKQ A;  4CPV A;  1CMG A;  1CMF A;  2BE6 A;  2KBI A;  3A8R A;  5CPV A;  1S3P A;  4MZJ A;  1SL7 A;  2JRF A;  2ZND A;  3SJS A;  3TZ1 A;  3SIA A;  5J3X A;  3F45 A;  5CSN A;  1SCM B;  2KQ6 A;  1HQV A;  2M9G A;  1TNW A;  1DJH A;  4GBA A;  1IJ6 A;  4F0Z B;  1UHH A;  1NWD A;  1WDC B;  2BL0 C;  2K7D A;  2KFF A;  2KFG A;  1CB1 A;  4ORB B;  1XK4 C;  1B47 A;  2K8M B;  3CZT X;  1AP4 A;  2Y4Q A;  2R2I A;  1TTX A;  2WCF A;  3ZWH A;  3EK8 A;  1JSA A;  2LAN A;  4PHJ A;  2BEC A;  2HET A;  1GGW A;  1LKJ A;  1XO5 A;  4PHN A;  4YI8 A;  1KFX S;  3OB1 B;  2CXJ A;  2Y1M A;  2ISD A;  4OR9 B;  3CR2 A;  1YVL A;  1ALW A;  1LA3 A;  1SPY A;  1CFP A;  4CID A;  2LNK A;  1M31 A;  2L0P A;  4I5K A;  3WNX B;  4YGA A;  5HYD A;  1FI5 A;  2FOT A;  3O4Y A;  2KQY A;  3SIB A;  1AUI B;  1YR5 A;  3DF0 A;  3LL8 B;  1JWD A;  1K8U A;  3I5F B;  4GFT A;  1KWO C;  2L2E A;  1LVC D;  1SNL A;  2FJU B;  1PSR A;  2HF5 A;  1AJ5 A;  2AUC A;  3DVK A;  1CFD A;  1M63 B;  2BE4 A;  2DOQ A;  1A2X A;  4HSZ A;  1IQ5 A;  2LM5 A;  2KOT A;  3OX5 A;  1QLS A;  3IQO A;  2K0J A;  3ZNI A;  1D1O A;  1NX0 A;  2COL B;  1DTL A;  4JWQ A;  4I5L B;  1SCM C;  2EHB A;  5BPJ A;  1V1G A;  4MSP A;  1WDC C;  1ZFS A;  2SAS A;  4CLN A;  1QXP A;  1TRF A;  1CM4 A;  1H4B A;  3SG4 A;  4DCK A;  2EGD A;  3PM8 A;  2ZNE A;  2WC8 A;  3RM1 A;  1AJ4 A;  2WCE A;  1F70 A;  1K96 A;  2OS8 B;  1TCO B;  4HRE E;  2JQ6 A;  5HLV A;  1XFZ O;  1N2D A;  1U5I B;  1ZMZ A;  3D10 A;  5KSZ A;  1BOD A;  1DJY A;  4M2Q A;  1B4C A;  1OE9 B;  2M1U A;  2MLF C;  2M3W A;  1QVI Y;  4IL1 A;  2VRG A;  1AHR A;  3PAT A;  5HLO A;  3VRN A;  1YRT B;  1ZUZ A;  4BY5 A;  3TS5 C;  1MQ1 A;  3SG5 A;  4XJK A;  2K61 A;  3DVM A;  2L51 A;  1RRO A;  3CLN A;  2L98 A;  1C7W A;  1BOC A;  5D69 A;  1JC2 A;  1IWQ A;  2I2R E;  1NIW A;  4GPL B;  2L4H A;  4OV2 A;  2I7A A;  1TNP A;  3JVT C;  1QIW A;  1QV0 A;  4YBH B;  1J7Q A;  1NCX A;  2JT8 A;  1F4O A;  5G08 A;  4NDC A;  1M39 A;  1DJZ A;  1YUS A;  4USL A;  1OOJ A;  4DUQ A;  2GV5 A;  2PMY A;  5AEQ A;  1GJY A;  1SYM A;  3SG7 A;  3FWB A;  4L9M A;  4YGD B;  3PAL A;  1BR4 B;  4C0J A;  1BR1 B;  1KK7 Z;  1EG3 A;  1Y0V H;  2KAY A;  3I5I B;  1Y1X A;  4MVF A;  4NDB A;  4AQI A;  1J7O A;  2M97 A;  1CDP A;  5I2O A;  2LUC A;  4GUK A;  1SR6 C;  4ORA B;  1SRA A;  2LP3 A;  2Q4U A;  2H61 A;  2PSR A;  4FQO A;  1K93 D;  1QTX A;  2I18 A;  1KQV A;  1IKU A;  3GOF A;  4FTG A;  1UP5 A;  1KWO B;  1BLQ A;  1FBV A;  3BXK A;  1WRZ A;  2HQ8 A;  4I5N B;  2MLE C;  3NSK A;  2LLT A;  2M49 B;  1BF5 A;  4P5O E;  2K7O A;  4DRW A;  1NP8 A;  2KI4 C;  3DD4 A;  4MN0 A;  1A03 A;  1KFX L;  1UHI A;  2KGB C;  1QX2 A;  2M7N A;  1CNP A;  2MHH A;  4N5X A;  4CFQ A;  2ZN9 A;  4CFR A;  1YRU B;  1UUS A;  3NSO A;  4PE0 A;  2F3Z A;  3C1V A;  1Q80 A;  1KCY A;  5I2Q A;  1KSM A;  4YI9 A;  3TDZ A;  1DMO A;  3BQ3 A;  1K2H A;  1K90 D;  4BY4 A;  3SG3 A;  4JQ0 D;  3RLZ A;  1F8H A;  2PRU A;  3I5I C;  1PVA A;  3EK7 A;  2LMV A;  1CFF A;  2JTT A;  3TUY B;  3VRP A;  1U5I A;  1TN4 A;  5PAL A;  1S1E A;  1QAS A;  1OQP A;  1PAL A;  1WY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...