1OMRA

Non-myristoylated wild-type bovine recoverin with calcium bound to ef-hand 3
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
201
structure length
201
Chain Sequence
GNSKSGALSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKLKEKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Impact of N-terminal myristoylation on the Ca2+-dependent conformational transition in recoverin
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
molecule keywords recoverin
total genus 75
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2003-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1omrA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1omrA01
1YR5A 1LKJA 1NCZA 2LP3A 1BF5A 1SCMB 4HRGA 1EH2A 1BU3A 1JFKA 1JC2A 2PALA 1ALVA 2DOQA 2JT8A 3LL8B 2BKIB 1B8CA 1K94A 5DKRA 4HREE 2BECA 5D7FA 2HPSA 1BLQA 2KNEA 1JFJA 1HQVA 3O2PA 4GAOA 1SRAA 2BCXA 2LM5A 1AVSA 2HF5A 2L2EA 2L51A 2H2KA 4JQ0D 1S26D 3KPXA 3I5IB 1TOPA 1PULA 1L2OC 1WRZA 2ZN8A 2ZN9A 1BG1A 2LE9B 1A2XA 1XO5A 2JXCA 1QATA 3DF0B 2PSRA 3GK1A 1D1OA 3O78A 1S36A 4PE7A 2LAPA 2LLTA 4QJ4B 1E8AA 2OS8B 2LVVA 2JULA 1PSBA 1F8HA 4PHNA 1N65A 3NXAA 2KBMA 1TRFA 1WRKA 1CM4A 3CLNA 2H61A 3DD4A 2JWWA 1ALWA 1IJ5A 2LMVA 5HKZA 3CZTX 1B9AA 1QS7A 1MR8A 1MF8B 3A4UB 2MAZA 1PALA 1UHNA 2O5GA 3EK4A 4PCWA 1C7WA 1OMRA 4NQGA 2RGIA 4BY5A 1KFXS 2FOTA 3I5HB 4XYNA 2K7DA 1SKTA 3BOWA 3D0YB 4OV2A 3NSLA 1B8LA 1XYDA 1JSAA 1XFZO 1SK6D 3OB1B 2R2IA 5ER5A 2OS8C 3VRQA 3EKJA 1UHJA 3CS1A 5J3XA 4CPVA 1J7OA 3LCPC 4NDBA 1CDPA 1K93D 2Q4UA 4AOMA 1XFYO 1KCYA 1X02A 2SASA 4R1EA 1TCFA 3AKBA 5JJGA 3KHEA 2M7LA 2CT9A 1BMOA 4GNKB 4GUKA 2KGRA 4PE1A 1SR6C 1UWOA 1K9UA 1SL8A 2NCOA 1IGVA 1YX8A 4MRXA 4DS7A 2M97A 3DVMA 1WLMA 5CSNA 5KSZA 1YUSA 1PSRA 1WRLA 1FF1A 2PVBA 1LVCD 3PALA 3CR4X 1IKUA 2I94A 4GFTA 5AANA 1CFPA 1TIZA 3DVJA 2HETA 1M46A 4C0KA 4PE4A 1A75B 3GK2A 3EK7A 2ZNEA 4XJKA 1KQVA 3FIAA 1WLZA 2HQWA 1NUBA 1VRKA 1PK0D 5B8IB 3VRPA 1Y1AA 1TNWA 4GBAA 4XJKB 2ZFDA 4YGDB 4DCKA 2K8MB 2JNFA 2BL0B 4MRYA 2WCEA 1C07A 1W7IB 1S6IA 4D1EA 1J7PA 1CLMA 1QV1A 2F3YA 2LNKA 5I2LA 1ODBA 1NWDA 1ZUZA 1CMGA 1YTZC 4ETOA 1SYMA 2BE6A 1OSAA 1QXPA 3I5FB 1SNLA 3PLFB 1K9KA 1BR1B 4YGBB 3ZWHA 4MSPA 2JPTA 4MZKA 1KSOA 2MHHA 2LP2A 4GPLB 4MLWA 1F55A 2KI4B 1DJIA 3SIBA 2K7OA 1LINA 3CR2A 2BKHB 4YRUA 1XFWO 1NSHA 1KSMA 1OZOA 2FCEA 1CLLA 1MHOA 1K9PA 2AUCA 3BUXB 3ICBA 1MWNA 5CSIA 3EVUA 2K0JA 5HYDA 1J1EA 2FCDA 1B47A 1M63B 2SCPA 1Y6WA 2KFGA 3E3RA 1B1GA 3FS7A 5I2OA 2KAVA 1CLBA 1UHHA 1KK8C 1ZFSA 1QLSA 2NCPA 1F71A 1SPYA 3BYAA 4HRHA 2IS9A 2F2PA 2E6WA 3PSRA 2K2FA 4TNCA 3KF9A 3BUNB 5AEQA 2LLSA 1IH0A 1RJVA 4PHKA 3I5HC 4CLNA 4A4BA 4CFRA 1V1FA 3BOWB 1RWYA 2KYCA 2L4HA 2LVIA 2NLNA 5CSFA 2I2RE 4PDZA 1EJ3A 1A4PA 1KK7Y 2KDHA 4OCIA 3GOFA 3JTDC 2KSPA 1XK4A 2L5XB 1AP4A 2Q91A 1NCYA 1BOCA 1DVIA 3NSOA 1KK7Z 1DJXA 1NPQA 5HLOA 3CWGA 1K2HA 4MBEA 3VRRA 1CM1A 2L0PA 3KEVA 3PN7C 4JWQA 2CNPA 3OX5A 1YUTA 4CFQA 1FI6A 2JT3A 5DKNA 1KWOC 2LUCA 2BCAA 4MVFA 2L4IA 2PASA 4E68A 1FW4A 1N2DA 2D8NA 3TS5C 2LV7A 5KU1A 1CKKA 1JBAA 2K2AA 3QRXA 2M0RA 4I5JA 3VROA 1QX2A 1DF0B 1KFUL 3I5FC 4ICBA 2LLUA 1SW8A 3BUWB 1WY9A 4I5LB 1B8RA 3RM1A 2AAOA 1DJGA 2LVJA 4C0JA 2KI6D 3PFVA 1S6CA 1A75A 1DJWA 4U8DA 2LCPA 3I5GC 5F6TA 2MLEC 2M8UA 4MN0A 1KQMB 1RROA 2KGBC 1TN4A 3EKHA 2PMYA 1DJHA 1XFVO 2LMTA 1SY9A 3JTDB 4F0ZB 1QIVA 1S5GY 2L50A 1KFXL 2AMIA 4MZJA 1M45A 3EVRA 3FWBA 4AQIA 2I7AA 2LC5A 4M2OA 3SG7A 3WHTB 4AQJA 1S5GZ 5AERA 1ZMZA 2CCMA 1C7VA 2VRGA 3JVTB 3NSKA 1QV0A 2OTGB 2OPOA 3O4YA 4YGEB 2JQ6A 1UHIA 1KWOB 1J7QA 3DF0A 1K90D 4P5OE 3EK8A 1Q80A 1QTXA 2G2BA 2Y1MA 3BXKA 4M2PA 1RECA 4ORBB 2F8PA 1L2OB 1QX5B 2MRDA 4C0LA 1K8UA 2LHLA 2JTZA 3NSIA 1GGWA 1XFXO 1CFFA 1WDCB 2KHNA 4YBHB 5AFPA 1M31A 4DRWA 1XK4C 3O6BA 3OP0A 1UURA 2BCBA 3FWCA 4A4CA 2OTGC 1FPWA 4ZCVA 1CTRA 4PALA 4ZCUA 1YVHA 1WDCC 3TDUA 2Y4QA 1IQ5A 1BT6A 2QPTA 5TNCA 1K96A 3HCMA 3IF7A 4YI8A 1GGZA 1PVAA 4DIRA 1FBVA 3I5IC 5CSJA 1NX2A 3LK1A 5DKQA 3TDIA 1HT9A 2F33A 1NX0A 2COLB 1YURA 2JRFA 4NDDA 2KAYA 1AHRA 3SG3A 1MXLC 4QJ3B 1TCOB 1DGVA 2M3WA 1OOJA 5ER4X 3OX6A 1RK9A 1G33A 1JUOA 2JNXA 1NIWA 2KBIA 2ZKMX 3SG2A 2KOTA 2LANA 3IQOA 4I5KA 1IQ3A 1SR6B 3RLZA 1CDNA 1M39A 1UUSA 2I18A 5BPJA 3AAJA 1G4YR 3CTNA 1UHKA 2F3ZA 2BE4A 2KI6C 1PVBA 1L7ZA 3IQQA 3TZ1A 4GGFC 1FI5A 4WQ3A 3HX4A 1AUIB 3SG5A 1OZSA 2ZRTA 1EG3A 3LK0A 5JOLA 2CTNA 2M1KB 2K61A 1SBJA 1NP8A 2WOSA 3TDZA 1DJZA 3OHMB 1XVJA 1S1EA 2KQYA 4N1FA 5HKWA 1QVIY 1QASA 3M0WA 2WNDA 3PATA 4DUQA 2EC6B 1B4CA 1DF0A 1AJ4A 3BQ3A 1TNQA 2LUXA 3A8RA 1R2UA 1KQMC 1RFJA 1S6JA 3SG4A 1DMOA 1NCXA 1SMGA 2GGMA 5PALA 1IJ6A 2F2OA 2O60A 1IRJA 1DGUA 1GQMA 2TN4A 1J1DA 2ZRSA 1JF0A 5CPVA 1F4OA 2GV5A 1CFCA 2JTTA 2NZ0A 1DTLA 2JOJA 3LLEA 1EL4A 1OMDA 4FQOA 5FYXA 4I5NB 1TNXA 2M1UA 3TUYC 4M2QA 2CBLA 1KFUS 1LA0A 4JPZB 1A29A 1QLKA 4GGNA 1RTP1 1J7RA 1TNPA 2KQ6A 2M49B 1LXFC 1BODA 1NX1A 1YX7A 5I8NA 5I2QA 1AJ5A 3PM8A 4L9MA 1A03A 2WORA 4ORAB 4PHJA 1JF2A 2NXQA 3D10A 4P2YB 1AK8A 5AXIA 1J55A 5D69A 1OQPA 1OMVA 2M29A 3AKAA 4FTGA 2BBMA 1YVLA 1SL7A 1DT7B 1LA3A 1Y1UA 2LVKA 2MJWB 2MBXA 1Y0VH 2K7CA 3SIAA 1N0YA 2MLFC 2EC6C 1CB1A 1F70A 1JWDA 3AAKA 3PN7B 2JC2A 2LHIA 2ISDA 1H8BA 2E30A 2QACA 4CIDA 2KYFA 4N1GA 4WQ2A 1CDMA 4WRIA 1KK8B 1XFUO 3MSEB 1CMFA 1MUXA 2KAXA 1CFDA 1OE9B 5IBWA 3CGAA 4GGFA 1CNPA 1ZOTB 4OR9B 3VRNA 1MQ1A 1CDLA 1TTXA 3F45A 4YGAA 5HLVA 2BL0C 5HKYA 2EGDA 1QVIZ 3GK4X 1H4BA 2WCFA 3VGOA 3ZNIA 3K21A 2WC8A 4YGCB 3WXAA 1Y1XA 2FJUB 2K7BA 4IL1A 2JXLA 2GGZA 1XA5A 2Y5IA 4UPGA 2KFFA 1DJYA 2KI4C 5K89A 1NX3A 1YRUB 4N5XA 2B1UA 3BUMB 4NDCA 1NYAA 2HQ8A 1BR4B 1F4QA 2G9BA 3WHUB 4PHMA 3TUYB 2JU0A 1G8IA 1PRWA 1S3PA 2M9GA 2ZNDA 1B7TZ 2P6BB 3D0YA 1K95A 2A4JA 2M7NA 1F54A 1YRTB 3CR5X 2Y1NA 4Q04A 3H4SE 1B7TY 1IG5A 3KO0A 2EHBA 3BUOB 3JVTC 4MEWA 1U5IA 5KTYA 4QJ5B 1EG4A 1YUUA 3WNXB 1GJYA 5G08A 4OKHA 1ZACA 3TS5B 1QIWA 1IWQA 1UP5A 4PE0A 4MZLA 3EVVA 3DVKA 1U5IB 3OB2B 2L98A 2PRUA 4BY4A 4HSZA 3SJSA 2JZIA 1SL9A 2KFHA 3SG6A 5GQQC 4OVNF 1V1GA 1R6PA 1MXEA 1QX7A 1QJTA 2JT0A 2MA2A 2V53A 1SCVA 2BBNA 4YI9A 3I5GB 3DVEA 1BJFA 1W7JB 4ORCB 2H61C 3C1VA 1SCMC 4USLA 2CXJA 2LMUA 1EXRA 2WCBA
chains in the Genus database with same CATH superfamily
1YR5A 1LKJA 1NCZA 2LP3A 1BF5A 1SCMB 4HRGA 1EH2A 1BU3A 1JFKA 1JC2A 2PALA 3UNWA 1ALVA 2DOQA 2JT8A 3LL8B 2BKIB 1B8CA 1K94A 5DKRA 4HREE 2BECA 5D7FA 2HPSA 1BLQA 2KNEA 1JFJA 1HQVA 2ERBA 3O2PA 4GAOA 1SRAA 3NGVA 2BCXA 2LM5A 1AVSA 2HF5A 3FE6A 2L2EA 2L51A 2H2KA 4JQ0D 1S26D 1DC1A 3S0EA 3KPXA 3I5IB 1TOPA 1PULA 1L2OC 1OOFA 1WRZA 2ZN8A 2ZN9A 1BG1A 2LE9B 1A2XA 1XO5A 2JXCA 4OZDA 1QATA 3DF0B 2PSRA 3GK1A 1D1OA 3O78A 1S36A 4PE7A 2LAPA 2LLTA 2QEHA 3CYZA 4QJ4B 1E8AA 2OS8B 2LVVA 2JULA 1PSBA 1F8HA 3B86A 4PHNA 1N65A 3NXAA 2KBMA 1TRFA 1WRKA 3BFBA 1CM4A 3CLNA 2H61A 3DD4A 2JWWA 1ALWA 3O4XA 1IJ5A 2LMVA 5HKZA 3CZTX 1B9AA 1QS7A 1MR8A 1MF8B 3A4UB 2MAZA 1PALA 1UHNA 1ORGA 2O5GA 3EK4A 4PCWA 1C7WA 1OMRA 4NQGA 2RGIA 3D78A 4BY5A 1KFXS 2FOTA 3I5HB 4XYNA 2K7DA 1SKTA 3BOWA 3D0YB 4OV2A 3NSLA 1OOIX 1B8LA 1XYDA 1JSAA 1XFZO 1SK6D 3OB1B 2R2IA 5ER5A 3RZSA 2OS8C 3VRQA 3EKJA 1UHJA 3R1VA 3CS1A 5J3XA 4CPVA 1J7OA 3LCPC 3B88A 4NDBA 1CDPA 1K93D 2Q4UA 4AOMA 1XFYO 1KCYA 1X02A 2SASA 4R1EA 1TCFA 3AKBA 5JJGA 3KHEA 2M7LA 2CT9A 3BFAA 1BMOA 4GNKB 4GUKA 2KGRA 4PE1A 1SR6C 1UWOA 1K9UA 1SL8A 2NCOA 1IGVA 1YX8A 4MRXA 4DS7A 2M97A 3DVMA 1WLMA 5CSNA 5KSZA 1YUSA 3B87A 3FE8A 1PSRA 1WRLA 4INXA 1FF1A 3B7AA 2PVBA 1DQEA 1LVCD 2PYQA 3PALA 2QEBA 3CR4X 1IKUA 1SSEB 2I94A 4GFTA 5AANA 1CFPA 1TIZA 3DVJA 2HETA 1M46A 4C0KA 4PE4A 1A75B 3GK2A 3EK7A 2ZNEA 4XJKA 1KQVA 3FIAA 1WLZA 2HQWA 1NUBA 1VRKA 1PK0D 1TWOA 3VB1A 5B8IB 3NHTA 3VRPA 1Y1AA 3Q8IA 1TNWA 4GBAA 4XJKB 2ZFDA 4YGDB 4DCKA 2K8MB 2JNFA 2BL0B 3CZ1A 2WCEA 4MRYA 1C07A 1W7IB 1S6IA 4D1EA 1J7PA 1CLMA 1QV1A 2F3YA 2LNKA 5I2LA 1ODBA 1NWDA 3D77A 1ZUZA 1CMGA 1YTZC 4ETOA 4JKTA 1SYMA 2BE6A 1OSAA 1QXPA 3I5FB 1SNLA 3PLFB 1K9KA 1BR1B 4YGBB 3ZWHA 5I94A 4MSPA 2JPTA 4MZKA 1KSOA 4IJ7A 2MHHA 2LP2A 4GPLB 4MLWA 3R72A 1F55A 2KI4B 1DJIA 3SIBA 2K7OA 1LINA 3CR2A 2BKHB 4YRUA 1XFWO 1NSHA 1KSMA 5HL1A 4INWA 1OZOA 2FCEA 1CLLA 1MHOA 1K9PA 1XFRA 2AUCA 3BUXB 3ICBA 4PT1A 1MWNA 5CSIA 3EVUA 2K0JA 5HYDA 1J1EA 2FCDA 4KYNA 1B47A 1M63B 2K60A 2SCPA 1Y6WA 2BNXA 2KFGA 3E3RA 1B1GA 3FS7A 5I2OA 2KAVA 1CLBA 1UHHA 1KK8C 1ZFSA 1QLSA 2NCPA 1F71A 3S0AA 1Z4HA 1SPYA 2P70A 3BYAA 4HRHA 3S0DA 2IS9A 5EL2A 2F2PA 2E6WA 3PSRA 2K2FA 4TNCA 3KF9A 3BUNB 5AEQA 2LLSA 3DZTA 1RJVA 1GM0A 4PHKA 1IH0A 3I5HC 4CLNA 4A4BA 4CFRA 1V1FA 3BOWB 1RWYA 2KYCA 2L2CA 2L4HA 2LVIA 2NLNA 3D74A 5CSFA 2I2RE 4PDZA 1EJ3A 1A4PA 1KK7Y 2KDHA 4OCIA 3GOFA 3JTDC 2KSPA 1XK4A 2L5XB 1AP4A 2Q91A 1NCYA 1BOCA 1DVIA 3OGNA 3NSOA 3R1PA 1KK7Z 1IIOA 1DJXA 1NPQA 5HLOA 3OBVA 3CWGA 3SS3A 1K2HA 4MBEA 3VRRA 1CM1A 2L0PA 3S0GA 3BFHA 3CZ0A 3KEVA 3PN7C 4JWQA 5FI7A 2CNPA 3OX5A 1YUTA 4CFQA 1FI6A 2JT3A 2JPOA 5DKNA 1KWOC 2LUCA 2BCAA 1TUJA 4MVFA 2L4IA 2PASA 4E68A 1FW4A 2QEVA 1N2DA 2D8NA 3TS5C 2LV7A 5KU1A 1CKKA 1JBAA 2K2AA 3QRXA 2M0RA 4I5JA 3VROA 1QX2A 1DF0B 1KFUL 3I5FC 4ICBA 2LLUA 1SW8A 2KPHA 3BUWB 1WY9A 4I5LB 1B8RA 3RM1A 2AAOA 1DJGA 2LVJA 4C0JA 2KI6D 3PFVA 1S6CA 1A75A 1DJWA 4U8DA 2LCPA 3I5GC 2WC5A 5F6TA 2MLEC 2M8UA 4MN0A 1KQMB 1RROA 2KGBC 3FE9A 1TN4A 3EKHA 2PMYA 1DJHA 1XFVO 2LMTA 1TUZA 1SY9A 3JTDB 4F0ZB 1QIVA 1S5GY 5DICA 2L50A 1KFXL 2AMIA 4MZJA 4FQTA 1M45A 3EVRA 3FWBA 3UO9A 4AQIA 2I7AA 2LC5A 4M2OA 3SG7A 3WHTB 4AQJA 1S5GZ 1OW4A 5AERA 1ZMZA 2CCMA 1C7VA 2H8VA 2VRGA 3JVTB 3NSKA 1QV0A 2OTGB 2OPOA 3O4YA 4YGEB 1C3YA 2JQ6A 1UHIA 1KWOB 1J7QA 3DF0A 1K90D 3PJIA 4P5OE 3EK8A 2L5YA 2WCHA 1Q80A 1QTXA 2G2BA 2Y1MA 2FJYA 3BXKA 1RECA 4M2PA 4ORBB 2F8PA 1L2OB 2KLDA 1QX5B 2MRDA 4C0LA 1K8UA 2LHLA 2JTZA 3NSIA 1GGWA 1XFXO 1CFFA 3QMEA 1WDCB 2KHNA 4YBHB 5AFPA 1M31A 4DRWA 1XK4C 3O6BA 3OP0A 1UURA 2BCBA 3FWCA 3L4LA 4A4CA 3K1EA 2OTGC 1FPWA 1DEKA 4ZCVA 1CTRA 4PALA 2QEOA 1YVHA 1WDCC 4ZCUA 3TDUA 2Y4QA 1IQ5A 1BT6A 2QPTA 5TNCA 1K96A 3HCMA 3IF7A 4YI8A 1GGZA 1PVAA 4DIRA 1FBVA 3I5IC 5CSJA 1NX2A 3LK1A 5DKQA 2WCLA 3TDIA 1HT9A 2F33A 1NX0A 3CABA 2COLB 1YURA 2JRFA 4NDDA 2KAYA 5FI6A 1AHRA 3D76A 3SG3A 1MXLC 4QJ3B 1TCOB 1DGVA 2M3WA 1OOJA 5ER4X 3CZ2A 3OX6A 1RK9A 1G33A 1JUOA 2JNXA 1NIWA 2KBIA 3D73A 2ZKMX 3SG2A 2KOTA 2LANA 3IQOA 4I5KA 1IQ3A 1SR6B 3RLZA 1CDNA 1M39A 1UUSA 2I18A 5BPJA 3AAJA 1G4YR 3CTNA 1UHKA 1P28A 2BE4A 2F3ZA 1PVBA 1L7ZA 2KI6C 3IQQA 4GGFC 3TZ1A 1FI5A 4WQ3A 3HX4A 1AUIB 2KLEA 3SG5A 1OZSA 2ZRTA 1EG3A 3LK0A 4JD9A 2CTNA 5JOLA 2M1KB 3N7HA 2K61A 1SBJA 1NP8A 3DY9A 2WOSA 3TDZA 1DJZA 3OHMB 1XVJA 1S1EA 2KQYA 4N1FA 5HKWA 1QVIY 1QASA 3M0WA 2WNDA 3PATA 4DUQA 2EC6B 1B4CA 1DF0A 1AJ4A 3BQ3A 1TNQA 2LUXA 3A8RA 1R2UA 1KQMC 1RFJA 1S6JA 3SG4A 1DMOA 1NCXA 1SMGA 2GGMA 3L4AA 2P71A 5PALA 1IJ6A 2F2OA 2O60A 1IRJA 1DGUA 1GQMA 2TN4A 1J1DA 2ZRSA 1JF0A 5CPVA 1F4OA 2GV5A 1CFCA 2JTTA 2NZ0A 2WCMA 1DTLA 2JOJA 3LLEA 1EL4A 1OMDA 3PM2A 4FQOA 5FYXA 4I5NB 1DELA 1TNXA 2M1UA 3TUYC 4M2QA 2CBLA 1KFUS 1LA0A 4JPZB 1A29A 1QLKA 4GGNA 1RTP1 4F7FA 1J7RA 1QWVA 1TNPA 2KQ6A 2M49B 1LXFC 1BODA 1NX1A 1YX7A 2BAPA 5I8NA 5I2QA 1AJ5A 3PM8A 4L9MA 1A03A 2WORA 4ORAB 2YGUA 1JF2A 2NXQA 3D10A 4P2YB 4PHJA 1AK8A 5AXIA 1J55A 5D69A 1OQPA 1OMVA 2M29A 3AKAA 4FTGA 2BBMA 1YVLA 1SL7A 1DT7B 2WCJA 1LA3A 1Y1UA 2LVKA 2MJWB 2MBXA 3R1OA 1Y0VH 2K7CA 3SIAA 1N0YA 2MLFC 2EC6C 1CB1A 1F70A 1JWDA 3AAKA 3PN7B 2JC2A 2LHIA 2ISDA 1H8BA 3DXLA 2E30A 5FI2A 2QACA 4CIDA 2KYFA 4N1GA 4WQ2A 3S0FA 1CDMA 1T14A 2GTEA 3BJHA 4WRIA 1KK8B 1XFUO 3MSEB 1CMFA 1MUXA 2KAXA 1CFDA 1OE9B 5IBWA 3CGAA 4GGFA 1CNPA 1ZOTB 4OR9B 3VRNA 1MQ1A 1CDLA 1TTXA 1OOGA 3F45A 4YGAA 5HLVA 2BL0C 5HKYA 5D3OA 1C3ZA 2EGDA 1QVIZ 3GK4X 1H4BA 2WCFA 3VGOA 3ZNIA 1W9ZA 3K21A 3V2LA 2WC8A 4YGCB 3WXAA 1Y1XA 2FJUB 2K7BA 4IL1A 3CDNA 2JXLA 2GGZA 1XA5A 2Y5IA 4UPGA 3S0BA 2KFFA 1DJYA 2KI4C 5K89A 1NX3A 1YRUB 4N5XA 2B1UA 3BUMB 4NDCA 1NYAA 2HQ8A 3SS5A 1BR4B 1F4QA 2G9BA 3WHUB 4PHMA 3D75A 3NHIA 3TUYB 2JU0A 1G8IA 1PRWA 1OOHA 1S3PA 2M9GA 2ZNDA 1B7TZ 2P6BB 3D0YA 1K95A 2A4JA 2M7NA 1Z2CB 1F54A 1YRTB 3CR5X 2Y1NA 4Q04A 3H4SE 2QDIA 1B7TY 1IG5A 3KO0A 2EHBA 3BUOB 3JVTC 4MEWA 1LS8A 1U5IA 2WC6A 3SS4A 4QJ5B 5KTYA 1EG4A 1YUUA 3WNXB 1GJYA 5G08A 4OKHA 1ZACA 3TS5B 1QIWA 1IWQA 1UP5A 3L47A 4MZLA 4PE0A 2PQLA 3EVVA 3DVKA 1U5IB 3OB2B 2L98A 2PRUA 4BY4A 4HSZA 3SJSA 2JZIA 1SL9A 2KFHA 3SG6A 5GQQC 4OVNF 1V1GA 1R6PA 1MXEA 3DYEA 1QX7A 1QJTA 2JT0A 2MA2A 2V53A 2WCKA 1SCVA 2BBNA 3IVTA 4YI9A 3I5GB 3DVEA 3B6XA 1BJFA 1W7JB 4ORCB 3EG5B 2H61C 3C1VA 1SCMC 4USLA 2CXJA 2LMUA 1EXRA 2WCBA
chains in the Genus database with same CATH topology
1YR5A 1LKJA 1NCZA 2LP3A 1BF5A 1SCMB 4HRGA 1EH2A 1BU3A 1JFKA 1JC2A 2PALA 1ALVA 2DOQA 2JT8A 3LL8B 2BKIB 1B8CA 1K94A 5DKRA 4HREE 2BECA 5D7FA 2HPSA 1BLQA 2KNEA 1JFJA 1HQVA 3O2PA 4GAOA 1SRAA 2BCXA 2LM5A 1AVSA 2HF5A 2L2EA 2L51A 2H2KA 4JQ0D 1S26D 3KPXA 3I5IB 1TOPA 1PULA 1L2OC 1WRZA 2ZN8A 2ZN9A 1BG1A 2LE9B 1A2XA 1XO5A 2JXCA 1QATA 3DF0B 2PSRA 3GK1A 1D1OA 3O78A 1S36A 4PE7A 2LAPA 2LLTA 4QJ4B 1E8AA 2OS8B 2LVVA 2JULA 1PSBA 1F8HA 4PHNA 1N65A 3NXAA 2KBMA 1TRFA 1WRKA 1CM4A 3CLNA 2H61A 3DD4A 2JWWA 1ALWA 1IJ5A 2LMVA 5HKZA 3CZTX 1B9AA 1QS7A 1MR8A 1MF8B 3A4UB 2MAZA 1PALA 1UHNA 2O5GA 3EK4A 4PCWA 1C7WA 1OMRA 4NQGA 2RGIA 4BY5A 1KFXS 2FOTA 3I5HB 4XYNA 2K7DA 1SKTA 3BOWA 3D0YB 4OV2A 3NSLA 1B8LA 1XYDA 1JSAA 1XFZO 1SK6D 3OB1B 2R2IA 5ER5A 2OS8C 3VRQA 3EKJA 1UHJA 3CS1A 5J3XA 4CPVA 1J7OA 3LCPC 4NDBA 1CDPA 1K93D 2Q4UA 4AOMA 1XFYO 1KCYA 1X02A 2SASA 4R1EA 1TCFA 3AKBA 5JJGA 3KHEA 2M7LA 2CT9A 1BMOA 4GNKB 4GUKA 2KGRA 4PE1A 1SR6C 1UWOA 1K9UA 1SL8A 2NCOA 1IGVA 1YX8A 4MRXA 4DS7A 2M97A 3DVMA 1WLMA 5CSNA 5KSZA 1YUSA 1PSRA 1WRLA 1FF1A 2PVBA 1LVCD 3PALA 3CR4X 1IKUA 2I94A 4GFTA 5AANA 1CFPA 1TIZA 3DVJA 2HETA 1M46A 4C0KA 4PE4A 1A75B 3GK2A 3EK7A 2ZNEA 4XJKA 1KQVA 3FIAA 1WLZA 2HQWA 1NUBA 1VRKA 1PK0D 5B8IB 3VRPA 1Y1AA 1TNWA 4GBAA 4XJKB 2ZFDA 4YGDB 4DCKA 2K8MB 2JNFA 2BL0B 4MRYA 2WCEA 1C07A 1W7IB 1S6IA 4D1EA 1J7PA 1CLMA 1QV1A 2F3YA 2LNKA 5I2LA 1ODBA 1NWDA 1ZUZA 1CMGA 1YTZC 4ETOA 1SYMA 2BE6A 1OSAA 1QXPA 3I5FB 1SNLA 3PLFB 1K9KA 1BR1B 4YGBB 3ZWHA 4MSPA 2JPTA 4MZKA 1KSOA 2MHHA 2LP2A 4GPLB 4MLWA 1F55A 2KI4B 1DJIA 3SIBA 2K7OA 1LINA 3CR2A 2BKHB 4YRUA 1XFWO 1NSHA 1KSMA 1OZOA 2FCEA 1CLLA 1MHOA 1K9PA 2AUCA 3BUXB 3ICBA 1MWNA 5CSIA 3EVUA 2K0JA 5HYDA 1J1EA 2FCDA 1B47A 1M63B 2SCPA 1Y6WA 2KFGA 3E3RA 1B1GA 3FS7A 5I2OA 2KAVA 1CLBA 1UHHA 1KK8C 1ZFSA 1QLSA 2NCPA 1F71A 1SPYA 3BYAA 4HRHA 2IS9A 2F2PA 2E6WA 3PSRA 2K2FA 4TNCA 3KF9A 3BUNB 5AEQA 2LLSA 1IH0A 1RJVA 4PHKA 3I5HC 4CLNA 4A4BA 4CFRA 1V1FA 3BOWB 1RWYA 2KYCA 2L4HA 2LVIA 2NLNA 5CSFA 2I2RE 4PDZA 1EJ3A 1A4PA 1KK7Y 2KDHA 4OCIA 3GOFA 3JTDC 2KSPA 1XK4A 2L5XB 1AP4A 2Q91A 1NCYA 1BOCA 1DVIA 3NSOA 1KK7Z 1DJXA 1NPQA 5HLOA 3CWGA 1K2HA 4MBEA 3VRRA 1CM1A 2L0PA 3KEVA 3PN7C 4JWQA 2CNPA 3OX5A 1YUTA 4CFQA 1FI6A 2JT3A 5DKNA 1KWOC 2LUCA 2BCAA 4MVFA 2L4IA 2PASA 4E68A 1FW4A 1N2DA 2D8NA 3TS5C 2LV7A 5KU1A 1CKKA 1JBAA 2K2AA 3QRXA 2M0RA 4I5JA 3VROA 1QX2A 1DF0B 1KFUL 3I5FC 4ICBA 2LLUA 1SW8A 3BUWB 1WY9A 4I5LB 1B8RA 3RM1A 2AAOA 1DJGA 2LVJA 4C0JA 2KI6D 3PFVA 1S6CA 1A75A 1DJWA 4U8DA 2LCPA 3I5GC 5F6TA 2MLEC 2M8UA 4MN0A 1KQMB 1RROA 2KGBC 1TN4A 3EKHA 2PMYA 1DJHA 1XFVO 2LMTA 1SY9A 3JTDB 4F0ZB 1QIVA 1S5GY 2L50A 1KFXL 2AMIA 4MZJA 1M45A 3EVRA 3FWBA 4AQIA 2I7AA 2LC5A 4M2OA 3SG7A 3WHTB 4AQJA 1S5GZ 5AERA 1ZMZA 2CCMA 1C7VA 2VRGA 3JVTB 3NSKA 1QV0A 2OTGB 2OPOA 3O4YA 4YGEB 2JQ6A 1UHIA 1KWOB 1J7QA 3DF0A 1K90D 4P5OE 3EK8A 1Q80A 1QTXA 2G2BA 2Y1MA 3BXKA 4M2PA 1RECA 4ORBB 2F8PA 1L2OB 1QX5B 2MRDA 4C0LA 1K8UA 2LHLA 2JTZA 3NSIA 1GGWA 1XFXO 1CFFA 1WDCB 2KHNA 4YBHB 5AFPA 1M31A 4DRWA 1XK4C 3O6BA 3OP0A 1UURA 2BCBA 3FWCA 4A4CA 2OTGC 1FPWA 4ZCVA 1CTRA 4PALA 4ZCUA 1YVHA 1WDCC 3TDUA 2Y4QA 1IQ5A 1BT6A 2QPTA 5TNCA 1K96A 3HCMA 3IF7A 4YI8A 1GGZA 1PVAA 4DIRA 1FBVA 3I5IC 5CSJA 1NX2A 3LK1A 5DKQA 3TDIA 1HT9A 2F33A 1NX0A 2COLB 1YURA 2JRFA 4NDDA 2KAYA 1AHRA 3SG3A 1MXLC 4QJ3B 1TCOB 1DGVA 2M3WA 1OOJA 5ER4X 3OX6A 1RK9A 1G33A 1JUOA 2JNXA 1NIWA 2KBIA 2ZKMX 3SG2A 2KOTA 2LANA 3IQOA 4I5KA 1IQ3A 1SR6B 3RLZA 1CDNA 1M39A 1UUSA 2I18A 5BPJA 3AAJA 1G4YR 3CTNA 1UHKA 2F3ZA 2BE4A 2KI6C 1PVBA 1L7ZA 3IQQA 3TZ1A 4GGFC 1FI5A 4WQ3A 3HX4A 1AUIB 3SG5A 1OZSA 2ZRTA 1EG3A 3LK0A 5JOLA 2CTNA 2M1KB 2K61A 1SBJA 1NP8A 2WOSA 3TDZA 1DJZA 3OHMB 1XVJA 1S1EA 2KQYA 4N1FA 5HKWA 1QVIY 1QASA 3M0WA 2WNDA 3PATA 4DUQA 2EC6B 1B4CA 1DF0A 1AJ4A 3BQ3A 1TNQA 2LUXA 3A8RA 1R2UA 1KQMC 1RFJA 1S6JA 3SG4A 1DMOA 1NCXA 1SMGA 2GGMA 5PALA 1IJ6A 2F2OA 2O60A 1IRJA 1DGUA 1GQMA 2TN4A 1J1DA 2ZRSA 1JF0A 5CPVA 1F4OA 2GV5A 1CFCA 2JTTA 2NZ0A 1DTLA 2JOJA 3LLEA 1EL4A 1OMDA 4FQOA 5FYXA 4I5NB 1TNXA 2M1UA 3TUYC 4M2QA 2CBLA 1KFUS 1LA0A 4JPZB 1A29A 1QLKA 4GGNA 1RTP1 1J7RA 1TNPA 2KQ6A 2M49B 1LXFC 1BODA 1NX1A 1YX7A 5I8NA 5I2QA 1AJ5A 3PM8A 4L9MA 1A03A 2WORA 4ORAB 4PHJA 1JF2A 2NXQA 3D10A 4P2YB 1AK8A 5AXIA 1J55A 5D69A 1OQPA 1OMVA 2M29A 3AKAA 4FTGA 2BBMA 1YVLA 1SL7A 1DT7B 1LA3A 1Y1UA 2LVKA 2MJWB 2MBXA 1Y0VH 2K7CA 3SIAA 1N0YA 2MLFC 2EC6C 1CB1A 1F70A 1JWDA 3AAKA 3PN7B 2JC2A 2LHIA 2ISDA 1H8BA 2E30A 2QACA 4CIDA 2KYFA 4N1GA 4WQ2A 1CDMA 4WRIA 1KK8B 1XFUO 3MSEB 1CMFA 1MUXA 2KAXA 1CFDA 1OE9B 5IBWA 3CGAA 4GGFA 1CNPA 1ZOTB 4OR9B 3VRNA 1MQ1A 1CDLA 1TTXA 3F45A 4YGAA 5HLVA 2BL0C 5HKYA 2EGDA 1QVIZ 3GK4X 1H4BA 2WCFA 3VGOA 3ZNIA 3K21A 2WC8A 4YGCB 3WXAA 1Y1XA 2FJUB 2K7BA 4IL1A 2JXLA 2GGZA 1XA5A 2Y5IA 4UPGA 2KFFA 1DJYA 2KI4C 5K89A 1NX3A 1YRUB 4N5XA 2B1UA 3BUMB 4NDCA 1NYAA 2HQ8A 1BR4B 1F4QA 2G9BA 3WHUB 4PHMA 3TUYB 2JU0A 1G8IA 1PRWA 1S3PA 2M9GA 2ZNDA 1B7TZ 2P6BB 3D0YA 1K95A 2A4JA 2M7NA 1F54A 1YRTB 3CR5X 2Y1NA 4Q04A 3H4SE 1B7TY 1IG5A 3KO0A 2EHBA 3BUOB 3JVTC 4MEWA 1U5IA 5KTYA 4QJ5B 1EG4A 1YUUA 3WNXB 1GJYA 5G08A 4OKHA 1ZACA 3TS5B 1QIWA 1IWQA 1UP5A 4PE0A 4MZLA 3EVVA 3DVKA 1U5IB 3OB2B 2L98A 2PRUA 4BY4A 4HSZA 3SJSA 2JZIA 1SL9A 2KFHA 3SG6A 5GQQC 4OVNF 1V1GA 1R6PA 1MXEA 1QX7A 1QJTA 2JT0A 2MA2A 2V53A 1SCVA 2BBNA 4YI9A 3I5GB 3DVEA 1BJFA 1W7JB 4ORCB 2H61C 3C1VA 1SCMC 4USLA 2CXJA 2LMUA 1EXRA 2WCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YR5 A;  1LKJ A;  1NCZ A;  2LP3 A;  1BF5 A;  1SCM B;  4HRG A;  1EH2 A;  1BU3 A;  1JFK A;  1JC2 A;  2PAL A;  1ALV A;  2DOQ A;  2JT8 A;  3LL8 B;  2BKI B;  1B8C A;  1K94 A;  5DKR A;  4HRE E;  2BEC A;  5D7F A;  2HPS A;  1BLQ A;  2KNE A;  1JFJ A;  1HQV A;  3O2P A;  4GAO A;  1SRA A;  2BCX A;  2LM5 A;  1AVS A;  2HF5 A;  2L2E A;  2L51 A;  2H2K A;  4JQ0 D;  1S26 D;  3KPX A;  3I5I B;  1TOP A;  1PUL A;  1L2O C;  1WRZ A;  2ZN8 A;  2ZN9 A;  1BG1 A;  2LE9 B;  1A2X A;  1XO5 A;  2JXC A;  1QAT A;  3DF0 B;  2PSR A;  3GK1 A;  1D1O A;  3O78 A;  1S36 A;  4PE7 A;  2LAP A;  2LLT A;  4QJ4 B;  1E8A A;  2OS8 B;  2LVV A;  2JUL A;  1PSB A;  1F8H A;  4PHN A;  1N65 A;  3NXA A;  2KBM A;  1TRF A;  1WRK A;  1CM4 A;  3CLN A;  2H61 A;  3DD4 A;  2JWW A;  1ALW A;  1IJ5 A;  2LMV A;  5HKZ A;  3CZT X;  1B9A A;  1QS7 A;  1MR8 A;  1MF8 B;  3A4U B;  2MAZ A;  1PAL A;  1UHN A;  2O5G A;  3EK4 A;  4PCW A;  1C7W A;  1OMR A;  4NQG A;  2RGI A;  4BY5 A;  1KFX S;  2FOT A;  3I5H B;  4XYN A;  2K7D A;  1SKT A;  3BOW A;  3D0Y B;  4OV2 A;  3NSL A;  1B8L A;  1XYD A;  1JSA A;  1XFZ O;  1SK6 D;  3OB1 B;  2R2I A;  5ER5 A;  2OS8 C;  3VRQ A;  3EKJ A;  1UHJ A;  3CS1 A;  5J3X A;  4CPV A;  1J7O A;  3LCP C;  4NDB A;  1CDP A;  1K93 D;  2Q4U A;  4AOM A;  1XFY O;  1KCY A;  1X02 A;  2SAS A;  4R1E A;  1TCF A;  3AKB A;  5JJG A;  3KHE A;  2M7L A;  2CT9 A;  1BMO A;  4GNK B;  4GUK A;  2KGR A;  4PE1 A;  1SR6 C;  1UWO A;  1K9U A;  1SL8 A;  2NCO A;  1IGV A;  1YX8 A;  4MRX A;  4DS7 A;  2M97 A;  3DVM A;  1WLM A;  5CSN A;  5KSZ A;  1YUS A;  1PSR A;  1WRL A;  1FF1 A;  2PVB A;  1LVC D;  3PAL A;  3CR4 X;  1IKU A;  2I94 A;  4GFT A;  5AAN A;  1CFP A;  1TIZ A;  3DVJ A;  2HET A;  1M46 A;  4C0K A;  4PE4 A;  1A75 B;  3GK2 A;  3EK7 A;  2ZNE A;  4XJK A;  1KQV A;  3FIA A;  1WLZ A;  2HQW A;  1NUB A;  1VRK A;  1PK0 D;  5B8I B;  3VRP A;  1Y1A A;  1TNW A;  4GBA A;  4XJK B;  2ZFD A;  4YGD B;  4DCK A;  2K8M B;  2JNF A;  2BL0 B;  4MRY A;  2WCE A;  1C07 A;  1W7I B;  1S6I A;  4D1E A;  1J7P A;  1CLM A;  1QV1 A;  2F3Y A;  2LNK A;  5I2L A;  1ODB A;  1NWD A;  1ZUZ A;  1CMG A;  1YTZ C;  4ETO A;  1SYM A;  2BE6 A;  1OSA A;  1QXP A;  3I5F B;  1SNL A;  3PLF B;  1K9K A;  1BR1 B;  4YGB B;  3ZWH A;  4MSP A;  2JPT A;  4MZK A;  1KSO A;  2MHH A;  2LP2 A;  4GPL B;  4MLW A;  1F55 A;  2KI4 B;  1DJI A;  3SIB A;  2K7O A;  1LIN A;  3CR2 A;  2BKH B;  4YRU A;  1XFW O;  1NSH A;  1KSM A;  1OZO A;  2FCE A;  1CLL A;  1MHO A;  1K9P A;  2AUC A;  3BUX B;  3ICB A;  1MWN A;  5CSI A;  3EVU A;  2K0J A;  5HYD A;  1J1E A;  2FCD A;  1B47 A;  1M63 B;  2SCP A;  1Y6W A;  2KFG A;  3E3R A;  1B1G A;  3FS7 A;  5I2O A;  2KAV A;  1CLB A;  1UHH A;  1KK8 C;  1ZFS A;  1QLS A;  2NCP A;  1F71 A;  1SPY A;  3BYA A;  4HRH A;  2IS9 A;  2F2P A;  2E6W A;  3PSR A;  2K2F A;  4TNC A;  3KF9 A;  3BUN B;  5AEQ A;  2LLS A;  1IH0 A;  1RJV A;  4PHK A;  3I5H C;  4CLN A;  4A4B A;  4CFR A;  1V1F A;  3BOW B;  1RWY A;  2KYC A;  2L4H A;  2LVI A;  2NLN A;  5CSF A;  2I2R E;  4PDZ A;  1EJ3 A;  1A4P A;  1KK7 Y;  2KDH A;  4OCI A;  3GOF A;  3JTD C;  2KSP A;  1XK4 A;  2L5X B;  1AP4 A;  2Q91 A;  1NCY A;  1BOC A;  1DVI A;  3NSO A;  1KK7 Z;  1DJX A;  1NPQ A;  5HLO A;  3CWG A;  1K2H A;  4MBE A;  3VRR A;  1CM1 A;  2L0P A;  3KEV A;  3PN7 C;  4JWQ A;  2CNP A;  3OX5 A;  1YUT A;  4CFQ A;  1FI6 A;  2JT3 A;  5DKN A;  1KWO C;  2LUC A;  2BCA A;  4MVF A;  2L4I A;  2PAS A;  4E68 A;  1FW4 A;  1N2D A;  2D8N A;  3TS5 C;  2LV7 A;  5KU1 A;  1CKK A;  1JBA A;  2K2A A;  3QRX A;  2M0R A;  4I5J A;  3VRO A;  1QX2 A;  1DF0 B;  1KFU L;  3I5F C;  4ICB A;  2LLU A;  1SW8 A;  3BUW B;  1WY9 A;  4I5L B;  1B8R A;  3RM1 A;  2AAO A;  1DJG A;  2LVJ A;  4C0J A;  2KI6 D;  3PFV A;  1S6C A;  1A75 A;  1DJW A;  4U8D A;  2LCP A;  3I5G C;  5F6T A;  2MLE C;  2M8U A;  4MN0 A;  1KQM B;  1RRO A;  2KGB C;  1TN4 A;  3EKH A;  2PMY A;  1DJH A;  1XFV O;  2LMT A;  1SY9 A;  3JTD B;  4F0Z B;  1QIV A;  1S5G Y;  2L50 A;  1KFX L;  2AMI A;  4MZJ A;  1M45 A;  3EVR A;  3FWB A;  4AQI A;  2I7A A;  2LC5 A;  4M2O A;  3SG7 A;  3WHT B;  4AQJ A;  1S5G Z;  5AER A;  1ZMZ A;  2CCM A;  1C7V A;  2VRG A;  3JVT B;  3NSK A;  1QV0 A;  2OTG B;  2OPO A;  3O4Y A;  4YGE B;  2JQ6 A;  1UHI A;  1KWO B;  1J7Q A;  3DF0 A;  1K90 D;  4P5O E;  3EK8 A;  1Q80 A;  1QTX A;  2G2B A;  2Y1M A;  3BXK A;  4M2P A;  1REC A;  4ORB B;  2F8P A;  1L2O B;  1QX5 B;  2MRD A;  4C0L A;  1K8U A;  2LHL A;  2JTZ A;  3NSI A;  1GGW A;  1XFX O;  1CFF A;  1WDC B;  2KHN A;  4YBH B;  5AFP A;  1M31 A;  4DRW A;  1XK4 C;  3O6B A;  3OP0 A;  1UUR A;  2BCB A;  3FWC A;  4A4C A;  2OTG C;  1FPW A;  4ZCV A;  1CTR A;  4PAL A;  4ZCU A;  1YVH A;  1WDC C;  3TDU A;  2Y4Q A;  1IQ5 A;  1BT6 A;  2QPT A;  5TNC A;  1K96 A;  3HCM A;  3IF7 A;  4YI8 A;  1GGZ A;  1PVA A;  4DIR A;  1FBV A;  3I5I C;  5CSJ A;  1NX2 A;  3LK1 A;  5DKQ A;  3TDI A;  1HT9 A;  2F33 A;  1NX0 A;  2COL B;  1YUR A;  2JRF A;  4NDD A;  2KAY A;  1AHR A;  3SG3 A;  1MXL C;  4QJ3 B;  1TCO B;  1DGV A;  2M3W A;  1OOJ A;  5ER4 X;  3OX6 A;  1RK9 A;  1G33 A;  1JUO A;  2JNX A;  1NIW A;  2KBI A;  2ZKM X;  3SG2 A;  2KOT A;  2LAN A;  3IQO A;  4I5K A;  1IQ3 A;  1SR6 B;  3RLZ A;  1CDN A;  1M39 A;  1UUS A;  2I18 A;  5BPJ A;  3AAJ A;  1G4Y R;  3CTN A;  1UHK A;  2F3Z A;  2BE4 A;  2KI6 C;  1PVB A;  1L7Z A;  3IQQ A;  3TZ1 A;  4GGF C;  1FI5 A;  4WQ3 A;  3HX4 A;  1AUI B;  3SG5 A;  1OZS A;  2ZRT A;  1EG3 A;  3LK0 A;  5JOL A;  2CTN A;  2M1K B;  2K61 A;  1SBJ A;  1NP8 A;  2WOS A;  3TDZ A;  1DJZ A;  3OHM B;  1XVJ A;  1S1E A;  2KQY A;  4N1F A;  5HKW A;  1QVI Y;  1QAS A;  3M0W A;  2WND A;  3PAT A;  4DUQ A;  2EC6 B;  1B4C A;  1DF0 A;  1AJ4 A;  3BQ3 A;  1TNQ A;  2LUX A;  3A8R A;  1R2U A;  1KQM C;  1RFJ A;  1S6J A;  3SG4 A;  1DMO A;  1NCX A;  1SMG A;  2GGM A;  5PAL A;  1IJ6 A;  2F2O A;  2O60 A;  1IRJ A;  1DGU A;  1GQM A;  2TN4 A;  1J1D A;  2ZRS A;  1JF0 A;  5CPV A;  1F4O A;  2GV5 A;  1CFC A;  2JTT A;  2NZ0 A;  1DTL A;  2JOJ A;  3LLE A;  1EL4 A;  1OMD A;  4FQO A;  5FYX A;  4I5N B;  1TNX A;  2M1U A;  3TUY C;  4M2Q A;  2CBL A;  1KFU S;  1LA0 A;  4JPZ B;  1A29 A;  1QLK A;  4GGN A;  1RTP 1;  1J7R A;  1TNP A;  2KQ6 A;  2M49 B;  1LXF C;  1BOD A;  1NX1 A;  1YX7 A;  5I8N A;  5I2Q A;  1AJ5 A;  3PM8 A;  4L9M A;  1A03 A;  2WOR A;  4ORA B;  4PHJ A;  1JF2 A;  2NXQ A;  3D10 A;  4P2Y B;  1AK8 A;  5AXI A;  1J55 A;  5D69 A;  1OQP A;  1OMV A;  2M29 A;  3AKA A;  4FTG A;  2BBM A;  1YVL A;  1SL7 A;  1DT7 B;  1LA3 A;  1Y1U A;  2LVK A;  2MJW B;  2MBX A;  1Y0V H;  2K7C A;  3SIA A;  1N0Y A;  2MLF C;  2EC6 C;  1CB1 A;  1F70 A;  1JWD A;  3AAK A;  3PN7 B;  2JC2 A;  2LHI A;  2ISD A;  1H8B A;  2E30 A;  2QAC A;  4CID A;  2KYF A;  4N1G A;  4WQ2 A;  1CDM A;  4WRI A;  1KK8 B;  1XFU O;  3MSE B;  1CMF A;  1MUX A;  2KAX A;  1CFD A;  1OE9 B;  5IBW A;  3CGA A;  4GGF A;  1CNP A;  1ZOT B;  4OR9 B;  3VRN A;  1MQ1 A;  1CDL A;  1TTX A;  3F45 A;  4YGA A;  5HLV A;  2BL0 C;  5HKY A;  2EGD A;  1QVI Z;  3GK4 X;  1H4B A;  2WCF A;  3VGO A;  3ZNI A;  3K21 A;  2WC8 A;  4YGC B;  3WXA A;  1Y1X A;  2FJU B;  2K7B A;  4IL1 A;  2JXL A;  2GGZ A;  1XA5 A;  2Y5I A;  4UPG A;  2KFF A;  1DJY A;  2KI4 C;  5K89 A;  1NX3 A;  1YRU B;  4N5X A;  2B1U A;  3BUM B;  4NDC A;  1NYA A;  2HQ8 A;  1BR4 B;  1F4Q A;  2G9B A;  3WHU B;  4PHM A;  3TUY B;  2JU0 A;  1G8I A;  1PRW A;  1S3P A;  2M9G A;  2ZND A;  1B7T Z;  2P6B B;  3D0Y A;  1K95 A;  2A4J A;  2M7N A;  1F54 A;  1YRT B;  3CR5 X;  2Y1N A;  4Q04 A;  3H4S E;  1B7T Y;  1IG5 A;  3KO0 A;  2EHB A;  3BUO B;  3JVT C;  4MEW A;  1U5I A;  5KTY A;  4QJ5 B;  1EG4 A;  1YUU A;  3WNX B;  1GJY A;  5G08 A;  4OKH A;  1ZAC A;  3TS5 B;  1QIW A;  1IWQ A;  1UP5 A;  4PE0 A;  4MZL A;  3EVV A;  3DVK A;  1U5I B;  3OB2 B;  2L98 A;  2PRU A;  4BY4 A;  4HSZ A;  3SJS A;  2JZI A;  1SL9 A;  2KFH A;  3SG6 A;  5GQQ C;  4OVN F;  1V1G A;  1R6P A;  1MXE A;  1QX7 A;  1QJT A;  2JT0 A;  2MA2 A;  2V53 A;  1SCV A;  2BBN A;  4YI9 A;  3I5G B;  3DVE A;  1BJF A;  1W7J B;  4ORC B;  2H61 C;  3C1V A;  1SCM C;  4USL A;  2CXJ A;  2LMU A;  1EXR A;  2WCB A; 
#chains in the Genus database with same CATH topology
 1YR5 A;  1LKJ A;  1NCZ A;  2LP3 A;  1BF5 A;  1SCM B;  4HRG A;  1EH2 A;  1BU3 A;  1JFK A;  1JC2 A;  2PAL A;  3UNW A;  1ALV A;  2DOQ A;  2JT8 A;  3LL8 B;  2BKI B;  1B8C A;  1K94 A;  5DKR A;  4HRE E;  2BEC A;  5D7F A;  2HPS A;  1BLQ A;  2KNE A;  1JFJ A;  1HQV A;  2ERB A;  3O2P A;  4GAO A;  1SRA A;  3NGV A;  2BCX A;  2LM5 A;  1AVS A;  2HF5 A;  3FE6 A;  2L2E A;  2L51 A;  2H2K A;  4JQ0 D;  1S26 D;  1DC1 A;  3S0E A;  3KPX A;  3I5I B;  1TOP A;  1PUL A;  1L2O C;  1OOF A;  1WRZ A;  2ZN8 A;  2ZN9 A;  1BG1 A;  2LE9 B;  1A2X A;  1XO5 A;  2JXC A;  4OZD A;  1QAT A;  3DF0 B;  2PSR A;  3GK1 A;  1D1O A;  3O78 A;  1S36 A;  4PE7 A;  2LAP A;  2LLT A;  2QEH A;  3CYZ A;  4QJ4 B;  1E8A A;  2OS8 B;  2LVV A;  2JUL A;  1PSB A;  1F8H A;  3B86 A;  4PHN A;  1N65 A;  3NXA A;  2KBM A;  1TRF A;  1WRK A;  3BFB A;  1CM4 A;  3CLN A;  2H61 A;  3DD4 A;  2JWW A;  1ALW A;  3O4X A;  1IJ5 A;  2LMV A;  5HKZ A;  3CZT X;  1B9A A;  1QS7 A;  1MR8 A;  1MF8 B;  3A4U B;  2MAZ A;  1PAL A;  1UHN A;  1ORG A;  2O5G A;  3EK4 A;  4PCW A;  1C7W A;  1OMR A;  4NQG A;  2RGI A;  3D78 A;  4BY5 A;  1KFX S;  2FOT A;  3I5H B;  4XYN A;  2K7D A;  1SKT A;  3BOW A;  3D0Y B;  4OV2 A;  3NSL A;  1OOI X;  1B8L A;  1XYD A;  1JSA A;  1XFZ O;  1SK6 D;  3OB1 B;  2R2I A;  5ER5 A;  3RZS A;  2OS8 C;  3VRQ A;  3EKJ A;  1UHJ A;  3R1V A;  3CS1 A;  5J3X A;  4CPV A;  1J7O A;  3LCP C;  3B88 A;  4NDB A;  1CDP A;  1K93 D;  2Q4U A;  4AOM A;  1XFY O;  1KCY A;  1X02 A;  2SAS A;  4R1E A;  1TCF A;  3AKB A;  5JJG A;  3KHE A;  2M7L A;  2CT9 A;  3BFA A;  1BMO A;  4GNK B;  4GUK A;  2KGR A;  4PE1 A;  1SR6 C;  1UWO A;  1K9U A;  1SL8 A;  2NCO A;  1IGV A;  1YX8 A;  4MRX A;  4DS7 A;  2M97 A;  3DVM A;  1WLM A;  5CSN A;  5KSZ A;  1YUS A;  3B87 A;  3FE8 A;  1PSR A;  1WRL A;  4INX A;  1FF1 A;  3B7A A;  2PVB A;  1DQE A;  1LVC D;  2PYQ A;  3PAL A;  2QEB A;  3CR4 X;  1IKU A;  1SSE B;  2I94 A;  4GFT A;  5AAN A;  1CFP A;  1TIZ A;  3DVJ A;  2HET A;  1M46 A;  4C0K A;  4PE4 A;  1A75 B;  3GK2 A;  3EK7 A;  2ZNE A;  4XJK A;  1KQV A;  3FIA A;  1WLZ A;  2HQW A;  1NUB A;  1VRK A;  1PK0 D;  1TWO A;  3VB1 A;  5B8I B;  3NHT A;  3VRP A;  1Y1A A;  3Q8I A;  1TNW A;  4GBA A;  4XJK B;  2ZFD A;  4YGD B;  4DCK A;  2K8M B;  2JNF A;  2BL0 B;  3CZ1 A;  2WCE A;  4MRY A;  1C07 A;  1W7I B;  1S6I A;  4D1E A;  1J7P A;  1CLM A;  1QV1 A;  2F3Y A;  2LNK A;  5I2L A;  1ODB A;  1NWD A;  3D77 A;  1ZUZ A;  1CMG A;  1YTZ C;  4ETO A;  4JKT A;  1SYM A;  2BE6 A;  1OSA A;  1QXP A;  3I5F B;  1SNL A;  3PLF B;  1K9K A;  1BR1 B;  4YGB B;  3ZWH A;  5I94 A;  4MSP A;  2JPT A;  4MZK A;  1KSO A;  4IJ7 A;  2MHH A;  2LP2 A;  4GPL B;  4MLW A;  3R72 A;  1F55 A;  2KI4 B;  1DJI A;  3SIB A;  2K7O A;  1LIN A;  3CR2 A;  2BKH B;  4YRU A;  1XFW O;  1NSH A;  1KSM A;  5HL1 A;  4INW A;  1OZO A;  2FCE A;  1CLL A;  1MHO A;  1K9P A;  1XFR A;  2AUC A;  3BUX B;  3ICB A;  4PT1 A;  1MWN A;  5CSI A;  3EVU A;  2K0J A;  5HYD A;  1J1E A;  2FCD A;  4KYN A;  1B47 A;  1M63 B;  2K60 A;  2SCP A;  1Y6W A;  2BNX A;  2KFG A;  3E3R A;  1B1G A;  3FS7 A;  5I2O A;  2KAV A;  1CLB A;  1UHH A;  1KK8 C;  1ZFS A;  1QLS A;  2NCP A;  1F71 A;  3S0A A;  1Z4H A;  1SPY A;  2P70 A;  3BYA A;  4HRH A;  3S0D A;  2IS9 A;  5EL2 A;  2F2P A;  2E6W A;  3PSR A;  2K2F A;  4TNC A;  3KF9 A;  3BUN B;  5AEQ A;  2LLS A;  3DZT A;  1RJV A;  1GM0 A;  4PHK A;  1IH0 A;  3I5H C;  4CLN A;  4A4B A;  4CFR A;  1V1F A;  3BOW B;  1RWY A;  2KYC A;  2L2C A;  2L4H A;  2LVI A;  2NLN A;  3D74 A;  5CSF A;  2I2R E;  4PDZ A;  1EJ3 A;  1A4P A;  1KK7 Y;  2KDH A;  4OCI A;  3GOF A;  3JTD C;  2KSP A;  1XK4 A;  2L5X B;  1AP4 A;  2Q91 A;  1NCY A;  1BOC A;  1DVI A;  3OGN A;  3NSO A;  3R1P A;  1KK7 Z;  1IIO A;  1DJX A;  1NPQ A;  5HLO A;  3OBV A;  3CWG A;  3SS3 A;  1K2H A;  4MBE A;  3VRR A;  1CM1 A;  2L0P A;  3S0G A;  3BFH A;  3CZ0 A;  3KEV A;  3PN7 C;  4JWQ A;  5FI7 A;  2CNP A;  3OX5 A;  1YUT A;  4CFQ A;  1FI6 A;  2JT3 A;  2JPO A;  5DKN A;  1KWO C;  2LUC A;  2BCA A;  1TUJ A;  4MVF A;  2L4I A;  2PAS A;  4E68 A;  1FW4 A;  2QEV A;  1N2D A;  2D8N A;  3TS5 C;  2LV7 A;  5KU1 A;  1CKK A;  1JBA A;  2K2A A;  3QRX A;  2M0R A;  4I5J A;  3VRO A;  1QX2 A;  1DF0 B;  1KFU L;  3I5F C;  4ICB A;  2LLU A;  1SW8 A;  2KPH A;  3BUW B;  1WY9 A;  4I5L B;  1B8R A;  3RM1 A;  2AAO A;  1DJG A;  2LVJ A;  4C0J A;  2KI6 D;  3PFV A;  1S6C A;  1A75 A;  1DJW A;  4U8D A;  2LCP A;  3I5G C;  2WC5 A;  5F6T A;  2MLE C;  2M8U A;  4MN0 A;  1KQM B;  1RRO A;  2KGB C;  3FE9 A;  1TN4 A;  3EKH A;  2PMY A;  1DJH A;  1XFV O;  2LMT A;  1TUZ A;  1SY9 A;  3JTD B;  4F0Z B;  1QIV A;  1S5G Y;  5DIC A;  2L50 A;  1KFX L;  2AMI A;  4MZJ A;  4FQT A;  1M45 A;  3EVR A;  3FWB A;  3UO9 A;  4AQI A;  2I7A A;  2LC5 A;  4M2O A;  3SG7 A;  3WHT B;  4AQJ A;  1S5G Z;  1OW4 A;  5AER A;  1ZMZ A;  2CCM A;  1C7V A;  2H8V A;  2VRG A;  3JVT B;  3NSK A;  1QV0 A;  2OTG B;  2OPO A;  3O4Y A;  4YGE B;  1C3Y A;  2JQ6 A;  1UHI A;  1KWO B;  1J7Q A;  3DF0 A;  1K90 D;  3PJI A;  4P5O E;  3EK8 A;  2L5Y A;  2WCH A;  1Q80 A;  1QTX A;  2G2B A;  2Y1M A;  2FJY A;  3BXK A;  1REC A;  4M2P A;  4ORB B;  2F8P A;  1L2O B;  2KLD A;  1QX5 B;  2MRD A;  4C0L A;  1K8U A;  2LHL A;  2JTZ A;  3NSI A;  1GGW A;  1XFX O;  1CFF A;  3QME A;  1WDC B;  2KHN A;  4YBH B;  5AFP A;  1M31 A;  4DRW A;  1XK4 C;  3O6B A;  3OP0 A;  1UUR A;  2BCB A;  3FWC A;  3L4L A;  4A4C A;  3K1E A;  2OTG C;  1FPW A;  1DEK A;  4ZCV A;  1CTR A;  4PAL A;  2QEO A;  1YVH A;  1WDC C;  4ZCU A;  3TDU A;  2Y4Q A;  1IQ5 A;  1BT6 A;  2QPT A;  5TNC A;  1K96 A;  3HCM A;  3IF7 A;  4YI8 A;  1GGZ A;  1PVA A;  4DIR A;  1FBV A;  3I5I C;  5CSJ A;  1NX2 A;  3LK1 A;  5DKQ A;  2WCL A;  3TDI A;  1HT9 A;  2F33 A;  1NX0 A;  3CAB A;  2COL B;  1YUR A;  2JRF A;  4NDD A;  2KAY A;  5FI6 A;  1AHR A;  3D76 A;  3SG3 A;  1MXL C;  4QJ3 B;  1TCO B;  1DGV A;  2M3W A;  1OOJ A;  5ER4 X;  3CZ2 A;  3OX6 A;  1RK9 A;  1G33 A;  1JUO A;  2JNX A;  1NIW A;  2KBI A;  3D73 A;  2ZKM X;  3SG2 A;  2KOT A;  2LAN A;  3IQO A;  4I5K A;  1IQ3 A;  1SR6 B;  3RLZ A;  1CDN A;  1M39 A;  1UUS A;  2I18 A;  5BPJ A;  3AAJ A;  1G4Y R;  3CTN A;  1UHK A;  1P28 A;  2BE4 A;  2F3Z A;  1PVB A;  1L7Z A;  2KI6 C;  3IQQ A;  4GGF C;  3TZ1 A;  1FI5 A;  4WQ3 A;  3HX4 A;  1AUI B;  2KLE A;  3SG5 A;  1OZS A;  2ZRT A;  1EG3 A;  3LK0 A;  4JD9 A;  2CTN A;  5JOL A;  2M1K B;  3N7H A;  2K61 A;  1SBJ A;  1NP8 A;  3DY9 A;  2WOS A;  3TDZ A;  1DJZ A;  3OHM B;  1XVJ A;  1S1E A;  2KQY A;  4N1F A;  5HKW A;  1QVI Y;  1QAS A;  3M0W A;  2WND A;  3PAT A;  4DUQ A;  2EC6 B;  1B4C A;  1DF0 A;  1AJ4 A;  3BQ3 A;  1TNQ A;  2LUX A;  3A8R A;  1R2U A;  1KQM C;  1RFJ A;  1S6J A;  3SG4 A;  1DMO A;  1NCX A;  1SMG A;  2GGM A;  3L4A A;  2P71 A;  5PAL A;  1IJ6 A;  2F2O A;  2O60 A;  1IRJ A;  1DGU A;  1GQM A;  2TN4 A;  1J1D A;  2ZRS A;  1JF0 A;  5CPV A;  1F4O A;  2GV5 A;  1CFC A;  2JTT A;  2NZ0 A;  2WCM A;  1DTL A;  2JOJ A;  3LLE A;  1EL4 A;  1OMD A;  3PM2 A;  4FQO A;  5FYX A;  4I5N B;  1DEL A;  1TNX A;  2M1U A;  3TUY C;  4M2Q A;  2CBL A;  1KFU S;  1LA0 A;  4JPZ B;  1A29 A;  1QLK A;  4GGN A;  1RTP 1;  4F7F A;  1J7R A;  1QWV A;  1TNP A;  2KQ6 A;  2M49 B;  1LXF C;  1BOD A;  1NX1 A;  1YX7 A;  2BAP A;  5I8N A;  5I2Q A;  1AJ5 A;  3PM8 A;  4L9M A;  1A03 A;  2WOR A;  4ORA B;  2YGU A;  1JF2 A;  2NXQ A;  3D10 A;  4P2Y B;  4PHJ A;  1AK8 A;  5AXI A;  1J55 A;  5D69 A;  1OQP A;  1OMV A;  2M29 A;  3AKA A;  4FTG A;  2BBM A;  1YVL A;  1SL7 A;  1DT7 B;  2WCJ A;  1LA3 A;  1Y1U A;  2LVK A;  2MJW B;  2MBX A;  3R1O A;  1Y0V H;  2K7C A;  3SIA A;  1N0Y A;  2MLF C;  2EC6 C;  1CB1 A;  1F70 A;  1JWD A;  3AAK A;  3PN7 B;  2JC2 A;  2LHI A;  2ISD A;  1H8B A;  3DXL A;  2E30 A;  5FI2 A;  2QAC A;  4CID A;  2KYF A;  4N1G A;  4WQ2 A;  3S0F A;  1CDM A;  1T14 A;  2GTE A;  3BJH A;  4WRI A;  1KK8 B;  1XFU O;  3MSE B;  1CMF A;  1MUX A;  2KAX A;  1CFD A;  1OE9 B;  5IBW A;  3CGA A;  4GGF A;  1CNP A;  1ZOT B;  4OR9 B;  3VRN A;  1MQ1 A;  1CDL A;  1TTX A;  1OOG A;  3F45 A;  4YGA A;  5HLV A;  2BL0 C;  5HKY A;  5D3O A;  1C3Z A;  2EGD A;  1QVI Z;  3GK4 X;  1H4B A;  2WCF A;  3VGO A;  3ZNI A;  1W9Z A;  3K21 A;  3V2L A;  2WC8 A;  4YGC B;  3WXA A;  1Y1X A;  2FJU B;  2K7B A;  4IL1 A;  3CDN A;  2JXL A;  2GGZ A;  1XA5 A;  2Y5I A;  4UPG A;  3S0B A;  2KFF A;  1DJY A;  2KI4 C;  5K89 A;  1NX3 A;  1YRU B;  4N5X A;  2B1U A;  3BUM B;  4NDC A;  1NYA A;  2HQ8 A;  3SS5 A;  1BR4 B;  1F4Q A;  2G9B A;  3WHU B;  4PHM A;  3D75 A;  3NHI A;  3TUY B;  2JU0 A;  1G8I A;  1PRW A;  1OOH A;  1S3P A;  2M9G A;  2ZND A;  1B7T Z;  2P6B B;  3D0Y A;  1K95 A;  2A4J A;  2M7N A;  1Z2C B;  1F54 A;  1YRT B;  3CR5 X;  2Y1N A;  4Q04 A;  3H4S E;  2QDI A;  1B7T Y;  1IG5 A;  3KO0 A;  2EHB A;  3BUO B;  3JVT C;  4MEW A;  1LS8 A;  1U5I A;  2WC6 A;  3SS4 A;  4QJ5 B;  5KTY A;  1EG4 A;  1YUU A;  3WNX B;  1GJY A;  5G08 A;  4OKH A;  1ZAC A;  3TS5 B;  1QIW A;  1IWQ A;  1UP5 A;  3L47 A;  4MZL A;  4PE0 A;  2PQL A;  3EVV A;  3DVK A;  1U5I B;  3OB2 B;  2L98 A;  2PRU A;  4BY4 A;  4HSZ A;  3SJS A;  2JZI A;  1SL9 A;  2KFH A;  3SG6 A;  5GQQ C;  4OVN F;  1V1G A;  1R6P A;  1MXE A;  3DYE A;  1QX7 A;  1QJT A;  2JT0 A;  2MA2 A;  2V53 A;  2WCK A;  1SCV A;  2BBN A;  3IVT A;  4YI9 A;  3I5G B;  3DVE A;  3B6X A;  1BJF A;  1W7J B;  4ORC B;  3EG5 B;  2H61 C;  3C1V A;  1SCM C;  4USL A;  2CXJ A;  2LMU A;  1EXR A;  2WCB A; 
#chains in the Genus database with same CATH homology
 1YR5 A;  1LKJ A;  1NCZ A;  2LP3 A;  1BF5 A;  1SCM B;  4HRG A;  1EH2 A;  1BU3 A;  1JFK A;  1JC2 A;  2PAL A;  1ALV A;  2DOQ A;  2JT8 A;  3LL8 B;  2BKI B;  1B8C A;  1K94 A;  5DKR A;  4HRE E;  2BEC A;  5D7F A;  2HPS A;  1BLQ A;  2KNE A;  1JFJ A;  1HQV A;  3O2P A;  4GAO A;  1SRA A;  2BCX A;  2LM5 A;  1AVS A;  2HF5 A;  2L2E A;  2L51 A;  2H2K A;  4JQ0 D;  1S26 D;  3KPX A;  3I5I B;  1TOP A;  1PUL A;  1L2O C;  1WRZ A;  2ZN8 A;  2ZN9 A;  1BG1 A;  2LE9 B;  1A2X A;  1XO5 A;  2JXC A;  1QAT A;  3DF0 B;  2PSR A;  3GK1 A;  1D1O A;  3O78 A;  1S36 A;  4PE7 A;  2LAP A;  2LLT A;  4QJ4 B;  1E8A A;  2OS8 B;  2LVV A;  2JUL A;  1PSB A;  1F8H A;  4PHN A;  1N65 A;  3NXA A;  2KBM A;  1TRF A;  1WRK A;  1CM4 A;  3CLN A;  2H61 A;  3DD4 A;  2JWW A;  1ALW A;  1IJ5 A;  2LMV A;  5HKZ A;  3CZT X;  1B9A A;  1QS7 A;  1MR8 A;  1MF8 B;  3A4U B;  2MAZ A;  1PAL A;  1UHN A;  2O5G A;  3EK4 A;  4PCW A;  1C7W A;  1OMR A;  4NQG A;  2RGI A;  4BY5 A;  1KFX S;  2FOT A;  3I5H B;  4XYN A;  2K7D A;  1SKT A;  3BOW A;  3D0Y B;  4OV2 A;  3NSL A;  1B8L A;  1XYD A;  1JSA A;  1XFZ O;  1SK6 D;  3OB1 B;  2R2I A;  5ER5 A;  2OS8 C;  3VRQ A;  3EKJ A;  1UHJ A;  3CS1 A;  5J3X A;  4CPV A;  1J7O A;  3LCP C;  4NDB A;  1CDP A;  1K93 D;  2Q4U A;  4AOM A;  1XFY O;  1KCY A;  1X02 A;  2SAS A;  4R1E A;  1TCF A;  3AKB A;  5JJG A;  3KHE A;  2M7L A;  2CT9 A;  1BMO A;  4GNK B;  4GUK A;  2KGR A;  4PE1 A;  1SR6 C;  1UWO A;  1K9U A;  1SL8 A;  2NCO A;  1IGV A;  1YX8 A;  4MRX A;  4DS7 A;  2M97 A;  3DVM A;  1WLM A;  5CSN A;  5KSZ A;  1YUS A;  1PSR A;  1WRL A;  1FF1 A;  2PVB A;  1LVC D;  3PAL A;  3CR4 X;  1IKU A;  2I94 A;  4GFT A;  5AAN A;  1CFP A;  1TIZ A;  3DVJ A;  2HET A;  1M46 A;  4C0K A;  4PE4 A;  1A75 B;  3GK2 A;  3EK7 A;  2ZNE A;  4XJK A;  1KQV A;  3FIA A;  1WLZ A;  2HQW A;  1NUB A;  1VRK A;  1PK0 D;  5B8I B;  3VRP A;  1Y1A A;  1TNW A;  4GBA A;  4XJK B;  2ZFD A;  4YGD B;  4DCK A;  2K8M B;  2JNF A;  2BL0 B;  4MRY A;  2WCE A;  1C07 A;  1W7I B;  1S6I A;  4D1E A;  1J7P A;  1CLM A;  1QV1 A;  2F3Y A;  2LNK A;  5I2L A;  1ODB A;  1NWD A;  1ZUZ A;  1CMG A;  1YTZ C;  4ETO A;  1SYM A;  2BE6 A;  1OSA A;  1QXP A;  3I5F B;  1SNL A;  3PLF B;  1K9K A;  1BR1 B;  4YGB B;  3ZWH A;  4MSP A;  2JPT A;  4MZK A;  1KSO A;  2MHH A;  2LP2 A;  4GPL B;  4MLW A;  1F55 A;  2KI4 B;  1DJI A;  3SIB A;  2K7O A;  1LIN A;  3CR2 A;  2BKH B;  4YRU A;  1XFW O;  1NSH A;  1KSM A;  1OZO A;  2FCE A;  1CLL A;  1MHO A;  1K9P A;  2AUC A;  3BUX B;  3ICB A;  1MWN A;  5CSI A;  3EVU A;  2K0J A;  5HYD A;  1J1E A;  2FCD A;  1B47 A;  1M63 B;  2SCP A;  1Y6W A;  2KFG A;  3E3R A;  1B1G A;  3FS7 A;  5I2O A;  2KAV A;  1CLB A;  1UHH A;  1KK8 C;  1ZFS A;  1QLS A;  2NCP A;  1F71 A;  1SPY A;  3BYA A;  4HRH A;  2IS9 A;  2F2P A;  2E6W A;  3PSR A;  2K2F A;  4TNC A;  3KF9 A;  3BUN B;  5AEQ A;  2LLS A;  1IH0 A;  1RJV A;  4PHK A;  3I5H C;  4CLN A;  4A4B A;  4CFR A;  1V1F A;  3BOW B;  1RWY A;  2KYC A;  2L4H A;  2LVI A;  2NLN A;  5CSF A;  2I2R E;  4PDZ A;  1EJ3 A;  1A4P A;  1KK7 Y;  2KDH A;  4OCI A;  3GOF A;  3JTD C;  2KSP A;  1XK4 A;  2L5X B;  1AP4 A;  2Q91 A;  1NCY A;  1BOC A;  1DVI A;  3NSO A;  1KK7 Z;  1DJX A;  1NPQ A;  5HLO A;  3CWG A;  1K2H A;  4MBE A;  3VRR A;  1CM1 A;  2L0P A;  3KEV A;  3PN7 C;  4JWQ A;  2CNP A;  3OX5 A;  1YUT A;  4CFQ A;  1FI6 A;  2JT3 A;  5DKN A;  1KWO C;  2LUC A;  2BCA A;  4MVF A;  2L4I A;  2PAS A;  4E68 A;  1FW4 A;  1N2D A;  2D8N A;  3TS5 C;  2LV7 A;  5KU1 A;  1CKK A;  1JBA A;  2K2A A;  3QRX A;  2M0R A;  4I5J A;  3VRO A;  1QX2 A;  1DF0 B;  1KFU L;  3I5F C;  4ICB A;  2LLU A;  1SW8 A;  3BUW B;  1WY9 A;  4I5L B;  1B8R A;  3RM1 A;  2AAO A;  1DJG A;  2LVJ A;  4C0J A;  2KI6 D;  3PFV A;  1S6C A;  1A75 A;  1DJW A;  4U8D A;  2LCP A;  3I5G C;  5F6T A;  2MLE C;  2M8U A;  4MN0 A;  1KQM B;  1RRO A;  2KGB C;  1TN4 A;  3EKH A;  2PMY A;  1DJH A;  1XFV O;  2LMT A;  1SY9 A;  3JTD B;  4F0Z B;  1QIV A;  1S5G Y;  2L50 A;  1KFX L;  2AMI A;  4MZJ A;  1M45 A;  3EVR A;  3FWB A;  4AQI A;  2I7A A;  2LC5 A;  4M2O A;  3SG7 A;  3WHT B;  4AQJ A;  1S5G Z;  5AER A;  1ZMZ A;  2CCM A;  1C7V A;  2VRG A;  3JVT B;  3NSK A;  1QV0 A;  2OTG B;  2OPO A;  3O4Y A;  4YGE B;  2JQ6 A;  1UHI A;  1KWO B;  1J7Q A;  3DF0 A;  1K90 D;  4P5O E;  3EK8 A;  1Q80 A;  1QTX A;  2G2B A;  2Y1M A;  3BXK A;  4M2P A;  1REC A;  4ORB B;  2F8P A;  1L2O B;  1QX5 B;  2MRD A;  4C0L A;  1K8U A;  2LHL A;  2JTZ A;  3NSI A;  1GGW A;  1XFX O;  1CFF A;  1WDC B;  2KHN A;  4YBH B;  5AFP A;  1M31 A;  4DRW A;  1XK4 C;  3O6B A;  3OP0 A;  1UUR A;  2BCB A;  3FWC A;  4A4C A;  2OTG C;  1FPW A;  4ZCV A;  1CTR A;  4PAL A;  4ZCU A;  1YVH A;  1WDC C;  3TDU A;  2Y4Q A;  1IQ5 A;  1BT6 A;  2QPT A;  5TNC A;  1K96 A;  3HCM A;  3IF7 A;  4YI8 A;  1GGZ A;  1PVA A;  4DIR A;  1FBV A;  3I5I C;  5CSJ A;  1NX2 A;  3LK1 A;  5DKQ A;  3TDI A;  1HT9 A;  2F33 A;  1NX0 A;  2COL B;  1YUR A;  2JRF A;  4NDD A;  2KAY A;  1AHR A;  3SG3 A;  1MXL C;  4QJ3 B;  1TCO B;  1DGV A;  2M3W A;  1OOJ A;  5ER4 X;  3OX6 A;  1RK9 A;  1G33 A;  1JUO A;  2JNX A;  1NIW A;  2KBI A;  2ZKM X;  3SG2 A;  2KOT A;  2LAN A;  3IQO A;  4I5K A;  1IQ3 A;  1SR6 B;  3RLZ A;  1CDN A;  1M39 A;  1UUS A;  2I18 A;  5BPJ A;  3AAJ A;  1G4Y R;  3CTN A;  1UHK A;  2F3Z A;  2BE4 A;  2KI6 C;  1PVB A;  1L7Z A;  3IQQ A;  3TZ1 A;  4GGF C;  1FI5 A;  4WQ3 A;  3HX4 A;  1AUI B;  3SG5 A;  1OZS A;  2ZRT A;  1EG3 A;  3LK0 A;  5JOL A;  2CTN A;  2M1K B;  2K61 A;  1SBJ A;  1NP8 A;  2WOS A;  3TDZ A;  1DJZ A;  3OHM B;  1XVJ A;  1S1E A;  2KQY A;  4N1F A;  5HKW A;  1QVI Y;  1QAS A;  3M0W A;  2WND A;  3PAT A;  4DUQ A;  2EC6 B;  1B4C A;  1DF0 A;  1AJ4 A;  3BQ3 A;  1TNQ A;  2LUX A;  3A8R A;  1R2U A;  1KQM C;  1RFJ A;  1S6J A;  3SG4 A;  1DMO A;  1NCX A;  1SMG A;  2GGM A;  5PAL A;  1IJ6 A;  2F2O A;  2O60 A;  1IRJ A;  1DGU A;  1GQM A;  2TN4 A;  1J1D A;  2ZRS A;  1JF0 A;  5CPV A;  1F4O A;  2GV5 A;  1CFC A;  2JTT A;  2NZ0 A;  1DTL A;  2JOJ A;  3LLE A;  1EL4 A;  1OMD A;  4FQO A;  5FYX A;  4I5N B;  1TNX A;  2M1U A;  3TUY C;  4M2Q A;  2CBL A;  1KFU S;  1LA0 A;  4JPZ B;  1A29 A;  1QLK A;  4GGN A;  1RTP 1;  1J7R A;  1TNP A;  2KQ6 A;  2M49 B;  1LXF C;  1BOD A;  1NX1 A;  1YX7 A;  5I8N A;  5I2Q A;  1AJ5 A;  3PM8 A;  4L9M A;  1A03 A;  2WOR A;  4ORA B;  4PHJ A;  1JF2 A;  2NXQ A;  3D10 A;  4P2Y B;  1AK8 A;  5AXI A;  1J55 A;  5D69 A;  1OQP A;  1OMV A;  2M29 A;  3AKA A;  4FTG A;  2BBM A;  1YVL A;  1SL7 A;  1DT7 B;  1LA3 A;  1Y1U A;  2LVK A;  2MJW B;  2MBX A;  1Y0V H;  2K7C A;  3SIA A;  1N0Y A;  2MLF C;  2EC6 C;  1CB1 A;  1F70 A;  1JWD A;  3AAK A;  3PN7 B;  2JC2 A;  2LHI A;  2ISD A;  1H8B A;  2E30 A;  2QAC A;  4CID A;  2KYF A;  4N1G A;  4WQ2 A;  1CDM A;  4WRI A;  1KK8 B;  1XFU O;  3MSE B;  1CMF A;  1MUX A;  2KAX A;  1CFD A;  1OE9 B;  5IBW A;  3CGA A;  4GGF A;  1CNP A;  1ZOT B;  4OR9 B;  3VRN A;  1MQ1 A;  1CDL A;  1TTX A;  3F45 A;  4YGA A;  5HLV A;  2BL0 C;  5HKY A;  2EGD A;  1QVI Z;  3GK4 X;  1H4B A;  2WCF A;  3VGO A;  3ZNI A;  3K21 A;  2WC8 A;  4YGC B;  3WXA A;  1Y1X A;  2FJU B;  2K7B A;  4IL1 A;  2JXL A;  2GGZ A;  1XA5 A;  2Y5I A;  4UPG A;  2KFF A;  1DJY A;  2KI4 C;  5K89 A;  1NX3 A;  1YRU B;  4N5X A;  2B1U A;  3BUM B;  4NDC A;  1NYA A;  2HQ8 A;  1BR4 B;  1F4Q A;  2G9B A;  3WHU B;  4PHM A;  3TUY B;  2JU0 A;  1G8I A;  1PRW A;  1S3P A;  2M9G A;  2ZND A;  1B7T Z;  2P6B B;  3D0Y A;  1K95 A;  2A4J A;  2M7N A;  1F54 A;  1YRT B;  3CR5 X;  2Y1N A;  4Q04 A;  3H4S E;  1B7T Y;  1IG5 A;  3KO0 A;  2EHB A;  3BUO B;  3JVT C;  4MEW A;  1U5I A;  5KTY A;  4QJ5 B;  1EG4 A;  1YUU A;  3WNX B;  1GJY A;  5G08 A;  4OKH A;  1ZAC A;  3TS5 B;  1QIW A;  1IWQ A;  1UP5 A;  4PE0 A;  4MZL A;  3EVV A;  3DVK A;  1U5I B;  3OB2 B;  2L98 A;  2PRU A;  4BY4 A;  4HSZ A;  3SJS A;  2JZI A;  1SL9 A;  2KFH A;  3SG6 A;  5GQQ C;  4OVN F;  1V1G A;  1R6P A;  1MXE A;  1QX7 A;  1QJT A;  2JT0 A;  2MA2 A;  2V53 A;  1SCV A;  2BBN A;  4YI9 A;  3I5G B;  3DVE A;  1BJF A;  1W7J B;  4ORC B;  2H61 C;  3C1V A;  1SCM C;  4USL A;  2CXJ A;  2LMU A;  1EXR A;  2WCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...