1OMRA

Non-myristoylated wild-type bovine recoverin with calcium bound to ef-hand 3
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
201
structure length
201
Chain Sequence
GNSKSGALSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKLKEKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords recoverin
publication title Impact of N-terminal myristoylation on the Ca2+-dependent conformational transition in recoverin
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 75
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2003-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1omrA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1omrA01
1ZACA 3BUNB 3JTDB 1J1EA 4AQJA 2JULA 1R2UA 3SJSA 1QX5B 4AOMA 3GOFA 1E8AA 1WY9A 2JTZA 1YX7A 2V53A 1PK0D 2OPOA 5IBWA 2NCOA 1WDCC 1K2HA 3TDUA 1DJIA 1MHOA 1RFJA 1WRLA 3PATA 4WRIA 4YGBB 1AP4A 1XFXO 1J1DA 1GGWA 2H2KA 1KCYA 1WLMA 1CLLA 3DVKA 4IL1A 1SR6B 5B8IB 1QX7A 1UWOA 2KDHA 1J7QA 2PASA 2F8PA 2Y1NA 1F4OA 2M8UA 4I5NB 2F33A 1BG1A 1H4BA 4E68A 5PALA 2FCDA 3OP0A 2LHIA 2O60A 1XFYO 1JSAA 1KFUS 4C0LA 1EL4A 4MRXA 4ETOA 1LINA 1SRAA 1ALVA 2KAYA 3LCPC 2BKIB 4ZCVA 1IQ3A 4FQOA 1XYDA 2K0JA 3AKBA 3BUMB 3A4UB 1F71A 2LP3A 1MUXA 1RK9A 4PHKA 2I18A 1SY9A 1CDNA 2LVJA 5TNCA 1WRKA 4YGCB 3BUWB 4C0KA 2KHNA 1S3PA 1TNXA 2B1UA 1SKTA 4MVFA 1CDPA 2JT3A 4GPLB 1A29A 1UHKA 2CBLA 1NSHA 2E30A 2KFFA 4QJ4B 4GGNA 2M9GA 4XJKA 4JWQA 1C07A 1SCVA 4PCWA 2QPTA 1L7ZA 2HQ8A 1DJGA 1SMGA 3CGAA 4YGDB 1IQ5A 4BY5A 2LVKA 5AANA 1F70A 1QXPA 5AERA 2OS8C 3MSEB 1JUOA 2K7OA 2HETA 1DF0B 2LM5A 4AQIA 2L4IA 3RLZA 1TTXA 2KNEA 2M0RA 3ZWHA 1PVAA 5HKZA 1QATA 1DT7B 2LVIA 1J7OA 3HX4A 1XA5A 1KFXS 3CTNA 1MWNA 1TRFA 2LLTA 3JVTC 5HLOA 2L4HA 3PSRA 1MF8B 2LVVA 2KSPA 2H61C 4A4CA 4OCIA 5I2QA 1JWDA 1CDMA 1CFDA 2R2IA 5DKNA 1G8IA 3E3RA 3DF0B 1Q80A 5CSNA 4D1EA 4OR9B 1K95A 1CKKA 1GGZA 1RJVA 2HPSA 3I5IB 1K8UA 2KYFA 2Y4QA 3FIAA 1F4QA 4M2QA 1YUTA 3BQ3A 5AFPA 3VGOA 2JU0A 4CFRA 4WQ2A 2QACA 2WNDA 4I5JA 1JF0A 4N1FA 3I5GC 1GQMA 2M29A 2ZFDA 1NX2A 1KQMC 1U5IB 2Q91A 1SCMB 1DF0A 2MAZA 1DTLA 1M39A 2WORA 1QV1A 1JF2A 2M1KB 4ICBA 3TS5C 4WQ3A 1KWOB 1LVCD 1M46A 2I94A 3VRRA 1N2DA 4P5OE 1JFJA 3KO0A 3LL8B 4YGAA 1BF5A 1N65A 1CDLA 3SG5A 4TNCA 4YBHB 3WHTB 3SIAA 2K8MB 1HQVA 1K9UA 1A03A 1ALWA 2WCFA 1SL8A 3CLNA 4MSPA 2BL0C 1S5GY 2KI6C 1IG5A 1SL7A 2LMVA 3O4YA 3SG3A 1K93D 2L2EA 2F2PA 2FJUB 3D0YA 1DJWA 1YX8A 1NCXA 5CPVA 1K90D 1KK8B 3CZTX 4N1GA 2ZNEA 1CB1A 1CFFA 3OX6A 2PVBA 4PE0A 2JOJA 3PN7C 3NXAA 1BODA 2WCBA 1B1GA 3LK1A 3KF9A 4GGFA 3AAJA 1U5IA 3TDIA 1XVJA 3I5FB 3PM8A 3EVRA 1BR1B 2LHLA 4DIRA 1WLZA 3GK2A 2K7CA 2EC6C 3ICBA 1D1OA 1A2XA 1PSBA 2JXLA 2AAOA 4XJKB 2LC5A 1IGVA 2P6BB 1B7TY 4I5KA 4CPVA 1Y1AA 2D8NA 1XFWO 1WRZA 4F0ZB 3FWBA 2KFGA 3EVVA 1LKJA 1XO5A 3FWCA 1QV0A 1BJFA 2LV7A 5J3XA 1NP8A 4CFQA 1PRWA 1UHHA 2PSRA 1L2OB 1PALA 1S6JA 1OQPA 1CNPA 3SG6A 1G33A 1RROA 3BYAA 2LMUA 1TNWA 2BCXA 1YR5A 2RGIA 1RWYA 1M45A 2K2AA 3DVMA 3TDZA 3SG7A 2GGZA 1JBAA 3SIBA 1QIVA 1CMGA 4NDDA 3NSLA 3FS7A 1S5GZ 4YRUA 1JFKA 1DGUA 1S36A 1BMOA 1DJHA 2JNFA 2PALA 1BOCA 1QVIY 2K61A 4YGEB 1NCYA 4ZCUA 3O2PA 1NWDA 2JTTA 3EK8A 2G2BA 3GK1A 5CSFA 1Y1UA 3A8RA 3O78A 2LUXA 2O5GA 1YURA 2KYCA 1XK4A 2ISDA 4A4BA 2CXJA 1DJXA 2M7LA 1UHJA 2GV5A 5JJGA 4N5XA 3EKJA 2M49B 2K7BA 4NDBA 1YUUA 3SG2A 1PVBA 3IF7A 4P2YB 1OSAA 2MJWB 1QS7A 1YRTB 5ER5A 4C0JA 1OMVA 1UHNA 2MRDA 3D10A 3EK4A 3O6BA 2L5XB 2OS8B 2ZN8A 1B47A 2BCAA 3HCMA 1AHRA 2ZRTA 1B7TZ 1IJ6A 1OZOA 4DRWA 4QJ5B 1LXFC 1NUBA 2MHHA 3NSIA 3TUYB 1SW8A 3LK0A 1SNLA 3BUOB 1AVSA 1K96A 1NX0A 2KAVA 2NXQA 3I5HC 4PE1A 1UURA 1QIWA 1W7IB 2KQ6A 2KOTA 2JT0A 1EG4A 2L98A 3D0YB 3PLFB 3WXAA 3KHEA 4OV2A 2KQYA 1ZOTB 2LUCA 4NDCA 1RTP1 1ZFSA 1OE9B 2KI4B 2F2OA 3EK7A 1TN4A 3PFVA 4HRHA 3OX5A 1FBVA 1YRUB 1J7RA 3I5IC 5HKWA 2ZKMX 1QLKA 3OB1B 1B8RA 2JXCA 2SASA 2LE9B 3ZNIA 5FYXA 2KGRA 1TNQA 1MQ1A 1QVIZ 1EJ3A 1OZSA 3I5GB 4JQ0D 4PHMA 1W7JB 5G08A 3RM1A 5KSZA 1NYAA 2Y1MA 4PE7A 3TZ1A 2OTGB 4QJ3B 1OMDA 4DS7A 4MLWA 3PALA 4GGFC 4M2PA 5AEQA 4YI9A 5KTYA 1S6CA 2AUCA 2CNPA 3CR5X 2MBXA 2LAPA 5I2LA 1KFUL 1SCMC 2WC8A 1AUIB 1XFUO 3VRPA 4Q04A 3WHUB 5CSJA 2VRGA 2WCEA 2HQWA 4OVNF 4XYNA 2FOTA 1ZUZA 3C1VA 1Y1XA 2IS9A 1VRKA 5ER4X 1YUSA 1DGVA 1KQVA 1M31A 4PALA 3EVUA 2NCPA 2COLB 4GNKB 3BOWB 5GQQC 1QX2A 1C7VA 1YVHA 1TOPA 2F3ZA 1BR4B 2JNXA 1F8HA 2A4JA 2M1UA 3CS1A 1FPWA 1J55A 5AXIA 2MA2A 3JTDC 1KK8C 3PN7B 1FI5A 1MR8A 5I2OA 1UHIA 1WDCB 3OHMB 5DKRA 3DD4A 4R1EA 1JC2A 2BKHB 3CWGA 4ORAB 1CM1A 1B8LA 3VRQA 1K94A 2PMYA 1KSMA 4HRGA 2EC6B 1IWQA 1B8CA 1S1EA 1G4YR 3AKAA 2LANA 1V1FA 3I5FC 4GFTA 5DKQA 3IQQA 2BECA 1SR6C 2WOSA 3WNXB 2BCBA 4DUQA 1EXRA 1XK4C 2NZ0A 4PE4A 2FCEA 5BPJA 5D69A 2M97A 2HF5A 1KK7Y 2KI6D 1NIWA 1KFXL 1AK8A 1F55A 1OOJA 1PSRA 2AMIA 2LLSA 4MBEA 4PHNA 2K2FA 3BXKA 3BOWA 4L9MA 4USLA 3CR2A 2JWWA 4UPGA 1RECA 2L0PA 3DVJA 1L2OC 1KSOA 1OMRA 2BE4A 4CLNA 1DJZA 1NCZA 2K7DA 3AAKA 3EKHA 5K89A 1CTRA 2Q4UA 1MXLC 2LNKA 3F45A 1FI6A 1PULA 4OKHA 1NX3A 4U8DA 1K9KA 1UP5A 3GK4X 1EH2A 1XFZO 3VROA 2CT9A 1X02A 4MZJA 1IJ5A 1DJYA 1R6PA 4MEWA 2GGMA 1YTZC 1SBJA 5CSIA 5I8NA 1GJYA 1FW4A 2M3WA 2M7NA 1A4PA 1LA3A 4MZLA 4PDZA 5F6TA 2SCPA 4JPZB 2BBMA 2LMTA 2CTNA 4NQGA 3M0WA 1SL9A 2JT8A 1DVIA 1ZMZA 1TIZA 1IKUA 1V1GA 2JC2A 5HLVA 4CIDA 3BUXB 1S6IA 3NSOA 2KBMA 2KFHA 2KBIA 1AJ5A 1Y0VH 1A75B 2TN4A 1K9PA 3JVTB 1SK6D 2JZIA 2E6WA 3SG4A 1CM4A 2KAXA 2LCPA 1CFCA 1LA0A 1KK7Z 4ORBB 3I5HB 4PHJA 1HT9A 1YVLA 2MLFC 3TUYC 5KU1A 1TCFA 2ZNDA 1BT6A 1ODBA 1SPYA 2JQ6A 3H4SE 4ORCB 1J7PA 2ZRSA 1NPQA 2Y5IA 1MXEA 2L50A 4I5LB 1EG3A 2JRFA 4M2OA 3LLEA 2DOQA 2NLNA 2G9BA 3KEVA 2KI4C 4MN0A 5D7FA 2LLUA 2F3YA 4HSZA 3IQOA 3NSKA 1IH0A 2BBNA 3CR4X 2CCMA 2PRUA 1KQMB 1B4CA 1N0YA 4MRYA 2ZN9A 4GAOA 1QJTA 4HREE 1BU3A 1QLSA 1Y6WA 3TS5B 2EHBA 2OTGC 2I2RE 1S26D 1QASA 1CLMA 1A75A 3DVEA 1KWOC 1NX1A 2H61A 4YI8A 5JOLA 1QTXA 5HYDA 1DMOA 3OB2B 3VRNA 1M63B 2BL0B 4GBAA 1B9AA 1CFPA 1UUSA 3QRXA 1CMFA 1AJ4A 1TCOB 1IRJA 3K21A 2MLEC 4MZKA 3KPXA 1H8BA 4BY4A 3DF0A 4GUKA 4FTGA 4DCKA 2KGBC 1F54A 1TNPA 2JPTA 2BE6A 5HKYA 1BLQA 1XFVO 2LP2A 1FF1A 2EGDA 2L51A 1CLBA 2I7AA 1C7WA 1SYMA
chains in the Genus database with same CATH superfamily
1ZACA 3BUNB 3JTDB 1J1EA 4AQJA 2JULA 1R2UA 3SJSA 1QX5B 4AOMA 3GOFA 1E8AA 1WY9A 2JTZA 1YX7A 2V53A 1PK0D 3B87A 2OPOA 5IBWA 2NCOA 1WDCC 3D77A 1K2HA 3TDUA 1DJIA 1MHOA 1RFJA 1WRLA 2K60A 3PATA 4WRIA 4YGBB 1AP4A 1XFXO 1J1DA 1GGWA 2H2KA 1KCYA 1WLMA 1CLLA 3DVKA 4IL1A 1SR6B 5B8IB 1QX7A 1UWOA 2KDHA 2QEVA 1J7QA 2PASA 2F8PA 2Y1NA 1F4OA 2M8UA 4I5NB 2F33A 1BG1A 1H4BA 4E68A 2QDIA 5PALA 2FCDA 3OP0A 2LHIA 2O60A 1XFYO 1JSAA 1KFUS 1DQEA 4C0LA 1EL4A 4MRXA 4ETOA 1LINA 1SRAA 1ALVA 2KAYA 3LCPC 2BKIB 5DICA 4ZCVA 1IQ3A 2L5YA 4FQOA 2WC5A 1XYDA 2K0JA 1Z2CB 3AKBA 3A4UB 3BUMB 2LP3A 1F71A 1MUXA 1RK9A 4PHKA 2I18A 1SY9A 1CDNA 2LVJA 5TNCA 1WRKA 4YGCB 3DY9A 3BUWB 4C0KA 2KHNA 1IIOA 1S3PA 1TNXA 2B1UA 1SKTA 3CDNA 4MVFA 1CDPA 2JT3A 4GPLB 1A29A 1UHKA 2CBLA 1NSHA 2E30A 2KFFA 2WCKA 4QJ4B 4GGNA 2M9GA 5FI2A 4XJKA 4JWQA 1C07A 1SCVA 4PCWA 2QPTA 1L7ZA 3PJIA 2HQ8A 1DJGA 1SMGA 3CGAA 4YGDB 1IQ5A 4BY5A 1OOFA 2LVKA 5AANA 1QXPA 1F70A 5AERA 2OS8C 3MSEB 1JUOA 2K7OA 2HETA 1DF0B 2LM5A 4AQIA 3L47A 2L4IA 3RLZA 1TTXA 2KNEA 4F7FA 2M0RA 3ZWHA 1PVAA 5HKZA 1QATA 1DT7B 2LVIA 1J7OA 3HX4A 3L4AA 1XA5A 1KFXS 3CTNA 1MWNA 4KYNA 1TRFA 2KPHA 2LLTA 3JVTC 5HLOA 2L4HA 3PSRA 1MF8B 2LVVA 2KSPA 2H61C 4A4CA 4OCIA 5I2QA 1JWDA 1CDMA 1CFDA 2R2IA 5DKNA 1G8IA 3E3RA 3DF0B 1Q80A 5CSNA 4D1EA 4OR9B 1K95A 1CKKA 1GGZA 1RJVA 2HPSA 3I5IB 1K8UA 3D73A 2KYFA 2Y4QA 3FIAA 1F4QA 4M2QA 1YUTA 3BQ3A 5AFPA 3VGOA 2JU0A 4CFRA 4WQ2A 2QACA 2WNDA 3N7HA 4I5JA 1JF0A 4N1FA 3I5GC 1GQMA 2M29A 4JD9A 2ZFDA 3NHTA 1NX2A 1KQMC 1U5IB 5D3OA 2Q91A 1SCMB 1DF0A 2MAZA 1DTLA 1LS8A 1M39A 2WORA 1QV1A 1JF2A 2M1KB 4ICBA 3TS5C 4WQ3A 1KWOB 1LVCD 1M46A 2I94A 3VRRA 1N2DA 4P5OE 1JFJA 3S0EA 3KO0A 3LL8B 4YGAA 1BF5A 1N65A 1CDLA 3SG5A 4TNCA 4YBHB 3B7AA 3WHTB 3SIAA 2K8MB 1HQVA 1K9UA 1A03A 1ALWA 1XFRA 2WCFA 1SL8A 3CLNA 4MSPA 2BL0C 1S5GY 2KI6C 1IG5A 1SL7A 2LMVA 3O4YA 3SG3A 3B86A 1K93D 2L2EA 3UO9A 2F2PA 3PM2A 2FJUB 3R1PA 3D0YA 1DJWA 1YX8A 1NCXA 5CPVA 1K90D 3FE9A 2P70A 1KK8B 3CZTX 4N1GA 2ZNEA 2ERBA 3R1VA 1CB1A 1CFFA 3OX6A 2PVBA 4PE0A 2JOJA 3PN7C 3NXAA 1BODA 2WCBA 1B1GA 3LK1A 3KF9A 4GGFA 3AAJA 1U5IA 3TDIA 1XVJA 3I5FB 3PM8A 3EVRA 1BR1B 2LHLA 4DIRA 1WLZA 3GK2A 2K7CA 2EC6C 3ICBA 1D1OA 1A2XA 1PSBA 2JXLA 2AAOA 4XJKB 2LC5A 1IGVA 2P6BB 4PT1A 1B7TY 4I5KA 4CPVA 1Y1AA 2D8NA 1XFWO 1WRZA 4F0ZB 3FWBA 2KFGA 3EVVA 1LKJA 1XO5A 2BAPA 2QEBA 3FWCA 1QV0A 1BJFA 2LV7A 5J3XA 1NP8A 4CFQA 1PRWA 1UHHA 2PSRA 1L2OB 1PALA 1S6JA 1OQPA 1CNPA 3SG6A 1SSEB 1G33A 1RROA 3BYAA 2LMUA 1TNWA 2BCXA 1YR5A 2RGIA 1RWYA 1M45A 2K2AA 3DVMA 3TDZA 3SG7A 2GGZA 1JBAA 3FE6A 3SIBA 1QIVA 1CMGA 1ORGA 4NDDA 4JKTA 3NSLA 3FS7A 3L4LA 1S5GZ 4YRUA 1JFKA 1DGUA 1S36A 3DYEA 1BMOA 1DJHA 2JNFA 2PALA 1BOCA 1QVIY 2K61A 4YGEB 1NCYA 4ZCUA 2PQLA 3O2PA 1NWDA 2JTTA 3EK8A 2G2BA 3GK1A 5CSFA 1Y1UA 3A8RA 3O78A 2LUXA 2O5GA 1YURA 2KYCA 1XK4A 2ISDA 4A4BA 2CXJA 1DJXA 2M7LA 1UHJA 5HL1A 2GV5A 3R1OA 5JJGA 4N5XA 3EKJA 2M49B 2K7BA 4NDBA 1YUUA 3SG2A 3VB1A 1PVBA 3IF7A 4P2YB 1OSAA 2MJWB 1QS7A 1YRTB 5ER5A 4C0JA 1OMVA 1UHNA 2MRDA 3D10A 3EK4A 3O6BA 2L5XB 2OS8B 2ZN8A 1B47A 2BCAA 1P28A 1AHRA 3HCMA 2ZRTA 1B7TZ 3DZTA 1IJ6A 1OZOA 4DRWA 4QJ5B 1LXFC 1NUBA 3B6XA 2MHHA 3NSIA 3TUYB 1SW8A 3LK0A 1SNLA 3BUOB 1AVSA 3S0DA 1K96A 1NX0A 1QWVA 2KAVA 2NXQA 2WC6A 3I5HC 3NHIA 4PE1A 1OOGA 1UURA 1QIWA 1W7IB 2KQ6A 2KOTA 2JT0A 3CYZA 3CABA 1EG4A 2L98A 3D0YB 3PLFB 3WXAA 3FE8A 3KHEA 2KQYA 1ZOTB 4OV2A 2LUCA 4NDCA 1RTP1 1ZFSA 1OE9B 2KI4B 2F2OA 3EK7A 1TN4A 3K1EA 3PFVA 4HRHA 3OX5A 1FBVA 5FI6A 1GM0A 1YRUB 1J7RA 2YGUA 3I5IC 5HKWA 2ZKMX 3D75A 1QLKA 5I94A 3OB1B 1B8RA 2JXCA 2SASA 2LE9B 3ZNIA 3D76A 5FYXA 2KGRA 1TNQA 1MQ1A 1QVIZ 1EJ3A 1OZSA 3I5GB 3IVTA 3R72A 1W7JB 4JQ0D 4PHMA 5G08A 1NYAA 2Y1MA 4PE7A 3TZ1A 2OTGB 4QJ3B 4FQTA 1OMDA 4DS7A 2WCJA 4MLWA 3PALA 4GGFC 4M2PA 5AEQA 4YI9A 5KTYA 1S6CA 2AUCA 2CNPA 3CR5X 2MBXA 2LAPA 5I2LA 1KFUL 1SCMC 2WC8A 1AUIB 1XFUO 3VRPA 4Q04A 5EL2A 3Q8IA 3WHUB 5CSJA 2VRGA 2WCEA 2HQWA 4OVNF 4XYNA 2FOTA 1ZUZA 3C1VA 3BJHA 1Y1XA 2IS9A 1OW4A 1VRKA 5ER4X 1YUSA 1C3ZA 1DGVA 3QMEA 1KQVA 1M31A 2QEHA 3EVUA 4PALA 2NCPA 2COLB 4GNKB 2PYQA 3BOWB 5GQQC 1QX2A 1C7VA 1YVHA 1TOPA 2F3ZA 1BR4B 2JNXA 1F8HA 2A4JA 2M1UA 3CS1A 1FPWA 1J55A 1OOHA 3S0AA 5AXIA 2MA2A 3JTDC 1KK8C 3PN7B 1FI5A 1MR8A 5I2OA 1UHIA 1WDCB 3OHMB 5DKRA 3DD4A 4R1EA 1JC2A 1Z4HA 2BKHB 2P71A 3CWGA 3CZ1A 4ORAB 1CM1A 3S0BA 3S0FA 1B8LA 3BFBA 3VRQA 1K94A 2PMYA 1KSMA 4HRGA 3RZSA 2EC6B 1IWQA 1B8CA 1S1EA 1G4YR 3AKAA 2LANA 1V1FA 3CZ0A 3I5FC 4GFTA 5DKQA 3IQQA 2BECA 1SR6C 2FJYA 2WOSA 3WNXB 2BCBA 4DUQA 1EXRA 1XK4C 2NZ0A 4PE4A 2FCEA 5BPJA 5FI7A 5D69A 2M97A 2HF5A 1KK7Y 2KI6D 1NIWA 3O4XA 1KFXL 1AK8A 1F55A 1OOJA 1PSRA 2AMIA 2LLSA 3D78A 4MBEA 4PHNA 2K2FA 2L2CA 3BXKA 3BOWA 4L9MA 4USLA 3CR2A 2JWWA 3UNWA 4UPGA 1RECA 3DXLA 2L0PA 3EG5B 3OGNA 3DVJA 1L2OC 1KSOA 2KLEA 3CZ2A 1OMRA 1OOIX 2BE4A 3SS4A 4CLNA 1DJZA 1NCZA 2K7DA 3AAKA 3EKHA 5K89A 1CTRA 4OZDA 2Q4UA 1MXLC 2LNKA 3F45A 2GTEA 1DC1A 1PULA 1FI6A 4OKHA 1NX3A 4U8DA 1K9KA 1UP5A 3GK4X 1EH2A 1XFZO 1TUJA 3VROA 2CT9A 1W9ZA 1X02A 1IJ5A 4MZJA 1DJYA 1R6PA 4MEWA 2GGMA 1YTZC 1SBJA 5CSIA 5I8NA 1GJYA 3S0GA 1FW4A 2BNXA 2M3WA 2M7NA 1A4PA 3V2LA 1LA3A 4MZLA 4PDZA 5F6TA 2SCPA 5KSZA 3B88A 4JPZB 3D74A 2BBMA 2LMTA 2CTNA 4NQGA 3M0WA 1SL9A 2JT8A 1DVIA 1ZMZA 1TIZA 1TUZA 1IKUA 1V1GA 2JC2A 5HLVA 4CIDA 3BUXB 1S6IA 1TWOA 2KBMA 2KFHA 3NSOA 2KBIA 3RM1A 1AJ5A 1Y0VH 3SS3A 1A75B 2TN4A 1K9PA 3JVTB 1C3YA 3NGVA 1SK6D 2JZIA 2E6WA 3SG4A 1CM4A 2KAXA 2LCPA 1CFCA 1LA0A 1KK7Z 4ORBB 3I5HB 4PHJA 1HT9A 1YVLA 2MLFC 3TUYC 5KU1A 1TCFA 2ZNDA 3OBVA 1BT6A 1ODBA 1SPYA 2JQ6A 3H4SE 4ORCB 1J7PA 2ZRSA 1NPQA 2Y5IA 1MXEA 2L50A 4I5LB 1EG3A 2JRFA 4M2OA 3LLEA 2DOQA 2NLNA 1T14A 4INWA 2G9BA 1DELA 3KEVA 3SS5A 2KI4C 4INXA 4MN0A 2LLUA 5D7FA 2F3YA 4HSZA 3IQOA 3NSKA 1IH0A 2BBNA 3CR4X 2CCMA 2PRUA 1KQMB 1B4CA 1N0YA 4MRYA 2ZN9A 4GAOA 1QJTA 4HREE 3BFHA 1BU3A 1QLSA 1Y6WA 3BFAA 3TS5B 1DEKA 2EHBA 2JPOA 2OTGC 2I2RE 2KLDA 1S26D 1QASA 2WCHA 1CLMA 1A75A 3DVEA 1KWOC 1NX1A 2H61A 4YI8A 5JOLA 1QTXA 5HYDA 1DMOA 3OB2B 3VRNA 1M63B 2QEOA 2BL0B 4GBAA 1B9AA 1CFPA 1UUSA 3QRXA 1CMFA 1AJ4A 1TCOB 2WCLA 1IRJA 3K21A 2MLEC 4MZKA 3KPXA 1H8BA 4BY4A 3DF0A 4GUKA 4FTGA 2WCMA 2KGBC 4DCKA 1F54A 1TNPA 2JPTA 2BE6A 2H8VA 4IJ7A 5HKYA 1XFVO 1BLQA 2LP2A 1FF1A 2EGDA 2L51A 1CLBA 2I7AA 1C7WA 1SYMA
chains in the Genus database with same CATH topology
1ZACA 3BUNB 3JTDB 1J1EA 4AQJA 2JULA 1R2UA 3SJSA 1QX5B 4AOMA 3GOFA 1E8AA 1WY9A 2JTZA 1YX7A 2V53A 1PK0D 2OPOA 5IBWA 2NCOA 1WDCC 1K2HA 3TDUA 1DJIA 1MHOA 1RFJA 1WRLA 3PATA 4WRIA 4YGBB 1AP4A 1XFXO 1J1DA 1GGWA 2H2KA 1KCYA 1WLMA 1CLLA 3DVKA 4IL1A 1SR6B 5B8IB 1QX7A 1UWOA 2KDHA 1J7QA 2PASA 2F8PA 2Y1NA 1F4OA 2M8UA 4I5NB 2F33A 1BG1A 1H4BA 4E68A 5PALA 2FCDA 3OP0A 2LHIA 2O60A 1XFYO 1JSAA 1KFUS 4C0LA 1EL4A 4MRXA 4ETOA 1LINA 1SRAA 1ALVA 2KAYA 3LCPC 2BKIB 4ZCVA 1IQ3A 4FQOA 1XYDA 2K0JA 3AKBA 3BUMB 3A4UB 1F71A 2LP3A 1MUXA 1RK9A 4PHKA 2I18A 1SY9A 1CDNA 2LVJA 5TNCA 1WRKA 4YGCB 3BUWB 4C0KA 2KHNA 1S3PA 1TNXA 2B1UA 1SKTA 4MVFA 1CDPA 2JT3A 4GPLB 1A29A 1UHKA 2CBLA 1NSHA 2E30A 2KFFA 4QJ4B 4GGNA 2M9GA 4XJKA 4JWQA 1C07A 1SCVA 4PCWA 2QPTA 1L7ZA 2HQ8A 1DJGA 1SMGA 3CGAA 4YGDB 1IQ5A 4BY5A 2LVKA 5AANA 1F70A 1QXPA 5AERA 2OS8C 3MSEB 1JUOA 2K7OA 2HETA 1DF0B 2LM5A 4AQIA 2L4IA 3RLZA 1TTXA 2KNEA 2M0RA 3ZWHA 1PVAA 5HKZA 1QATA 1DT7B 2LVIA 1J7OA 3HX4A 1XA5A 1KFXS 3CTNA 1MWNA 1TRFA 2LLTA 3JVTC 5HLOA 2L4HA 3PSRA 1MF8B 2LVVA 2KSPA 2H61C 4A4CA 4OCIA 5I2QA 1JWDA 1CDMA 1CFDA 2R2IA 5DKNA 1G8IA 3E3RA 3DF0B 1Q80A 5CSNA 4D1EA 4OR9B 1K95A 1CKKA 1GGZA 1RJVA 2HPSA 3I5IB 1K8UA 2KYFA 2Y4QA 3FIAA 1F4QA 4M2QA 1YUTA 3BQ3A 5AFPA 3VGOA 2JU0A 4CFRA 4WQ2A 2QACA 2WNDA 4I5JA 1JF0A 4N1FA 3I5GC 1GQMA 2M29A 2ZFDA 1NX2A 1KQMC 1U5IB 2Q91A 1SCMB 1DF0A 2MAZA 1DTLA 1M39A 2WORA 1QV1A 1JF2A 2M1KB 4ICBA 3TS5C 4WQ3A 1KWOB 1LVCD 1M46A 2I94A 3VRRA 1N2DA 4P5OE 1JFJA 3KO0A 3LL8B 4YGAA 1BF5A 1N65A 1CDLA 3SG5A 4TNCA 4YBHB 3WHTB 3SIAA 2K8MB 1HQVA 1K9UA 1A03A 1ALWA 2WCFA 1SL8A 3CLNA 4MSPA 2BL0C 1S5GY 2KI6C 1IG5A 1SL7A 2LMVA 3O4YA 3SG3A 1K93D 2L2EA 2F2PA 2FJUB 3D0YA 1DJWA 1YX8A 1NCXA 5CPVA 1K90D 1KK8B 3CZTX 4N1GA 2ZNEA 1CB1A 1CFFA 3OX6A 2PVBA 4PE0A 2JOJA 3PN7C 3NXAA 1BODA 2WCBA 1B1GA 3LK1A 3KF9A 4GGFA 3AAJA 1U5IA 3TDIA 1XVJA 3I5FB 3PM8A 3EVRA 1BR1B 2LHLA 4DIRA 1WLZA 3GK2A 2K7CA 2EC6C 3ICBA 1D1OA 1A2XA 1PSBA 2JXLA 2AAOA 4XJKB 2LC5A 1IGVA 2P6BB 1B7TY 4I5KA 4CPVA 1Y1AA 2D8NA 1XFWO 1WRZA 4F0ZB 3FWBA 2KFGA 3EVVA 1LKJA 1XO5A 3FWCA 1QV0A 1BJFA 2LV7A 5J3XA 1NP8A 4CFQA 1PRWA 1UHHA 2PSRA 1L2OB 1PALA 1S6JA 1OQPA 1CNPA 3SG6A 1G33A 1RROA 3BYAA 2LMUA 1TNWA 2BCXA 1YR5A 2RGIA 1RWYA 1M45A 2K2AA 3DVMA 3TDZA 3SG7A 2GGZA 1JBAA 3SIBA 1QIVA 1CMGA 4NDDA 3NSLA 3FS7A 1S5GZ 4YRUA 1JFKA 1DGUA 1S36A 1BMOA 1DJHA 2JNFA 2PALA 1BOCA 1QVIY 2K61A 4YGEB 1NCYA 4ZCUA 3O2PA 1NWDA 2JTTA 3EK8A 2G2BA 3GK1A 5CSFA 1Y1UA 3A8RA 3O78A 2LUXA 2O5GA 1YURA 2KYCA 1XK4A 2ISDA 4A4BA 2CXJA 1DJXA 2M7LA 1UHJA 2GV5A 5JJGA 4N5XA 3EKJA 2M49B 2K7BA 4NDBA 1YUUA 3SG2A 1PVBA 3IF7A 4P2YB 1OSAA 2MJWB 1QS7A 1YRTB 5ER5A 4C0JA 1OMVA 1UHNA 2MRDA 3D10A 3EK4A 3O6BA 2L5XB 2OS8B 2ZN8A 1B47A 2BCAA 3HCMA 1AHRA 2ZRTA 1B7TZ 1IJ6A 1OZOA 4DRWA 4QJ5B 1LXFC 1NUBA 2MHHA 3NSIA 3TUYB 1SW8A 3LK0A 1SNLA 3BUOB 1AVSA 1K96A 1NX0A 2KAVA 2NXQA 3I5HC 4PE1A 1UURA 1QIWA 1W7IB 2KQ6A 2KOTA 2JT0A 1EG4A 2L98A 3D0YB 3PLFB 3WXAA 3KHEA 4OV2A 2KQYA 1ZOTB 2LUCA 4NDCA 1RTP1 1ZFSA 1OE9B 2KI4B 2F2OA 3EK7A 1TN4A 3PFVA 4HRHA 3OX5A 1FBVA 1YRUB 1J7RA 3I5IC 5HKWA 2ZKMX 1QLKA 3OB1B 1B8RA 2JXCA 2SASA 2LE9B 3ZNIA 5FYXA 2KGRA 1TNQA 1MQ1A 1QVIZ 1EJ3A 1OZSA 3I5GB 4JQ0D 4PHMA 1W7JB 5G08A 3RM1A 5KSZA 1NYAA 2Y1MA 4PE7A 3TZ1A 2OTGB 4QJ3B 1OMDA 4DS7A 4MLWA 3PALA 4GGFC 4M2PA 5AEQA 4YI9A 5KTYA 1S6CA 2AUCA 2CNPA 3CR5X 2MBXA 2LAPA 5I2LA 1KFUL 1SCMC 2WC8A 1AUIB 1XFUO 3VRPA 4Q04A 3WHUB 5CSJA 2VRGA 2WCEA 2HQWA 4OVNF 4XYNA 2FOTA 1ZUZA 3C1VA 1Y1XA 2IS9A 1VRKA 5ER4X 1YUSA 1DGVA 1KQVA 1M31A 4PALA 3EVUA 2NCPA 2COLB 4GNKB 3BOWB 5GQQC 1QX2A 1C7VA 1YVHA 1TOPA 2F3ZA 1BR4B 2JNXA 1F8HA 2A4JA 2M1UA 3CS1A 1FPWA 1J55A 5AXIA 2MA2A 3JTDC 1KK8C 3PN7B 1FI5A 1MR8A 5I2OA 1UHIA 1WDCB 3OHMB 5DKRA 3DD4A 4R1EA 1JC2A 2BKHB 3CWGA 4ORAB 1CM1A 1B8LA 3VRQA 1K94A 2PMYA 1KSMA 4HRGA 2EC6B 1IWQA 1B8CA 1S1EA 1G4YR 3AKAA 2LANA 1V1FA 3I5FC 4GFTA 5DKQA 3IQQA 2BECA 1SR6C 2WOSA 3WNXB 2BCBA 4DUQA 1EXRA 1XK4C 2NZ0A 4PE4A 2FCEA 5BPJA 5D69A 2M97A 2HF5A 1KK7Y 2KI6D 1NIWA 1KFXL 1AK8A 1F55A 1OOJA 1PSRA 2AMIA 2LLSA 4MBEA 4PHNA 2K2FA 3BXKA 3BOWA 4L9MA 4USLA 3CR2A 2JWWA 4UPGA 1RECA 2L0PA 3DVJA 1L2OC 1KSOA 1OMRA 2BE4A 4CLNA 1DJZA 1NCZA 2K7DA 3AAKA 3EKHA 5K89A 1CTRA 2Q4UA 1MXLC 2LNKA 3F45A 1FI6A 1PULA 4OKHA 1NX3A 4U8DA 1K9KA 1UP5A 3GK4X 1EH2A 1XFZO 3VROA 2CT9A 1X02A 4MZJA 1IJ5A 1DJYA 1R6PA 4MEWA 2GGMA 1YTZC 1SBJA 5CSIA 5I8NA 1GJYA 1FW4A 2M3WA 2M7NA 1A4PA 1LA3A 4MZLA 4PDZA 5F6TA 2SCPA 4JPZB 2BBMA 2LMTA 2CTNA 4NQGA 3M0WA 1SL9A 2JT8A 1DVIA 1ZMZA 1TIZA 1IKUA 1V1GA 2JC2A 5HLVA 4CIDA 3BUXB 1S6IA 3NSOA 2KBMA 2KFHA 2KBIA 1AJ5A 1Y0VH 1A75B 2TN4A 1K9PA 3JVTB 1SK6D 2JZIA 2E6WA 3SG4A 1CM4A 2KAXA 2LCPA 1CFCA 1LA0A 1KK7Z 4ORBB 3I5HB 4PHJA 1HT9A 1YVLA 2MLFC 3TUYC 5KU1A 1TCFA 2ZNDA 1BT6A 1ODBA 1SPYA 2JQ6A 3H4SE 4ORCB 1J7PA 2ZRSA 1NPQA 2Y5IA 1MXEA 2L50A 4I5LB 1EG3A 2JRFA 4M2OA 3LLEA 2DOQA 2NLNA 2G9BA 3KEVA 2KI4C 4MN0A 5D7FA 2LLUA 2F3YA 4HSZA 3IQOA 3NSKA 1IH0A 2BBNA 3CR4X 2CCMA 2PRUA 1KQMB 1B4CA 1N0YA 4MRYA 2ZN9A 4GAOA 1QJTA 4HREE 1BU3A 1QLSA 1Y6WA 3TS5B 2EHBA 2OTGC 2I2RE 1S26D 1QASA 1CLMA 1A75A 3DVEA 1KWOC 1NX1A 2H61A 4YI8A 5JOLA 1QTXA 5HYDA 1DMOA 3OB2B 3VRNA 1M63B 2BL0B 4GBAA 1B9AA 1CFPA 1UUSA 3QRXA 1CMFA 1AJ4A 1TCOB 1IRJA 3K21A 2MLEC 4MZKA 3KPXA 1H8BA 4BY4A 3DF0A 4GUKA 4FTGA 4DCKA 2KGBC 1F54A 1TNPA 2JPTA 2BE6A 5HKYA 1BLQA 1XFVO 2LP2A 1FF1A 2EGDA 2L51A 1CLBA 2I7AA 1C7WA 1SYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZAC A;  3BUN B;  3JTD B;  1J1E A;  4AQJ A;  2JUL A;  1R2U A;  3SJS A;  1QX5 B;  4AOM A;  3GOF A;  1E8A A;  1WY9 A;  2JTZ A;  1YX7 A;  2V53 A;  1PK0 D;  2OPO A;  5IBW A;  2NCO A;  1WDC C;  1K2H A;  3TDU A;  1DJI A;  1MHO A;  1RFJ A;  1WRL A;  3PAT A;  4WRI A;  4YGB B;  1AP4 A;  1XFX O;  1J1D A;  1GGW A;  2H2K A;  1KCY A;  1WLM A;  1CLL A;  3DVK A;  4IL1 A;  1SR6 B;  5B8I B;  1QX7 A;  1UWO A;  2KDH A;  1J7Q A;  2PAS A;  2F8P A;  2Y1N A;  1F4O A;  2M8U A;  4I5N B;  2F33 A;  1BG1 A;  1H4B A;  4E68 A;  5PAL A;  2FCD A;  3OP0 A;  2LHI A;  2O60 A;  1XFY O;  1JSA A;  1KFU S;  4C0L A;  1EL4 A;  4MRX A;  4ETO A;  1LIN A;  1SRA A;  1ALV A;  2KAY A;  3LCP C;  2BKI B;  4ZCV A;  1IQ3 A;  4FQO A;  1XYD A;  2K0J A;  3AKB A;  3BUM B;  3A4U B;  1F71 A;  2LP3 A;  1MUX A;  1RK9 A;  4PHK A;  2I18 A;  1SY9 A;  1CDN A;  2LVJ A;  5TNC A;  1WRK A;  4YGC B;  3BUW B;  4C0K A;  2KHN A;  1S3P A;  1TNX A;  2B1U A;  1SKT A;  4MVF A;  1CDP A;  2JT3 A;  4GPL B;  1A29 A;  1UHK A;  2CBL A;  1NSH A;  2E30 A;  2KFF A;  4QJ4 B;  4GGN A;  2M9G A;  4XJK A;  4JWQ A;  1C07 A;  1SCV A;  4PCW A;  2QPT A;  1L7Z A;  2HQ8 A;  1DJG A;  1SMG A;  3CGA A;  4YGD B;  1IQ5 A;  4BY5 A;  2LVK A;  5AAN A;  1F70 A;  1QXP A;  5AER A;  2OS8 C;  3MSE B;  1JUO A;  2K7O A;  2HET A;  1DF0 B;  2LM5 A;  4AQI A;  2L4I A;  3RLZ A;  1TTX A;  2KNE A;  2M0R A;  3ZWH A;  1PVA A;  5HKZ A;  1QAT A;  1DT7 B;  2LVI A;  1J7O A;  3HX4 A;  1XA5 A;  1KFX S;  3CTN A;  1MWN A;  1TRF A;  2LLT A;  3JVT C;  5HLO A;  2L4H A;  3PSR A;  1MF8 B;  2LVV A;  2KSP A;  2H61 C;  4A4C A;  4OCI A;  5I2Q A;  1JWD A;  1CDM A;  1CFD A;  2R2I A;  5DKN A;  1G8I A;  3E3R A;  3DF0 B;  1Q80 A;  5CSN A;  4D1E A;  4OR9 B;  1K95 A;  1CKK A;  1GGZ A;  1RJV A;  2HPS A;  3I5I B;  1K8U A;  2KYF A;  2Y4Q A;  3FIA A;  1F4Q A;  4M2Q A;  1YUT A;  3BQ3 A;  5AFP A;  3VGO A;  2JU0 A;  4CFR A;  4WQ2 A;  2QAC A;  2WND A;  4I5J A;  1JF0 A;  4N1F A;  3I5G C;  1GQM A;  2M29 A;  2ZFD A;  1NX2 A;  1KQM C;  1U5I B;  2Q91 A;  1SCM B;  1DF0 A;  2MAZ A;  1DTL A;  1M39 A;  2WOR A;  1QV1 A;  1JF2 A;  2M1K B;  4ICB A;  3TS5 C;  4WQ3 A;  1KWO B;  1LVC D;  1M46 A;  2I94 A;  3VRR A;  1N2D A;  4P5O E;  1JFJ A;  3KO0 A;  3LL8 B;  4YGA A;  1BF5 A;  1N65 A;  1CDL A;  3SG5 A;  4TNC A;  4YBH B;  3WHT B;  3SIA A;  2K8M B;  1HQV A;  1K9U A;  1A03 A;  1ALW A;  2WCF A;  1SL8 A;  3CLN A;  4MSP A;  2BL0 C;  1S5G Y;  2KI6 C;  1IG5 A;  1SL7 A;  2LMV A;  3O4Y A;  3SG3 A;  1K93 D;  2L2E A;  2F2P A;  2FJU B;  3D0Y A;  1DJW A;  1YX8 A;  1NCX A;  5CPV A;  1K90 D;  1KK8 B;  3CZT X;  4N1G A;  2ZNE A;  1CB1 A;  1CFF A;  3OX6 A;  2PVB A;  4PE0 A;  2JOJ A;  3PN7 C;  3NXA A;  1BOD A;  2WCB A;  1B1G A;  3LK1 A;  3KF9 A;  4GGF A;  3AAJ A;  1U5I A;  3TDI A;  1XVJ A;  3I5F B;  3PM8 A;  3EVR A;  1BR1 B;  2LHL A;  4DIR A;  1WLZ A;  3GK2 A;  2K7C A;  2EC6 C;  3ICB A;  1D1O A;  1A2X A;  1PSB A;  2JXL A;  2AAO A;  4XJK B;  2LC5 A;  1IGV A;  2P6B B;  1B7T Y;  4I5K A;  4CPV A;  1Y1A A;  2D8N A;  1XFW O;  1WRZ A;  4F0Z B;  3FWB A;  2KFG A;  3EVV A;  1LKJ A;  1XO5 A;  3FWC A;  1QV0 A;  1BJF A;  2LV7 A;  5J3X A;  1NP8 A;  4CFQ A;  1PRW A;  1UHH A;  2PSR A;  1L2O B;  1PAL A;  1S6J A;  1OQP A;  1CNP A;  3SG6 A;  1G33 A;  1RRO A;  3BYA A;  2LMU A;  1TNW A;  2BCX A;  1YR5 A;  2RGI A;  1RWY A;  1M45 A;  2K2A A;  3DVM A;  3TDZ A;  3SG7 A;  2GGZ A;  1JBA A;  3SIB A;  1QIV A;  1CMG A;  4NDD A;  3NSL A;  3FS7 A;  1S5G Z;  4YRU A;  1JFK A;  1DGU A;  1S36 A;  1BMO A;  1DJH A;  2JNF A;  2PAL A;  1BOC A;  1QVI Y;  2K61 A;  4YGE B;  1NCY A;  4ZCU A;  3O2P A;  1NWD A;  2JTT A;  3EK8 A;  2G2B A;  3GK1 A;  5CSF A;  1Y1U A;  3A8R A;  3O78 A;  2LUX A;  2O5G A;  1YUR A;  2KYC A;  1XK4 A;  2ISD A;  4A4B A;  2CXJ A;  1DJX A;  2M7L A;  1UHJ A;  2GV5 A;  5JJG A;  4N5X A;  3EKJ A;  2M49 B;  2K7B A;  4NDB A;  1YUU A;  3SG2 A;  1PVB A;  3IF7 A;  4P2Y B;  1OSA A;  2MJW B;  1QS7 A;  1YRT B;  5ER5 A;  4C0J A;  1OMV A;  1UHN A;  2MRD A;  3D10 A;  3EK4 A;  3O6B A;  2L5X B;  2OS8 B;  2ZN8 A;  1B47 A;  2BCA A;  3HCM A;  1AHR A;  2ZRT A;  1B7T Z;  1IJ6 A;  1OZO A;  4DRW A;  4QJ5 B;  1LXF C;  1NUB A;  2MHH A;  3NSI A;  3TUY B;  1SW8 A;  3LK0 A;  1SNL A;  3BUO B;  1AVS A;  1K96 A;  1NX0 A;  2KAV A;  2NXQ A;  3I5H C;  4PE1 A;  1UUR A;  1QIW A;  1W7I B;  2KQ6 A;  2KOT A;  2JT0 A;  1EG4 A;  2L98 A;  3D0Y B;  3PLF B;  3WXA A;  3KHE A;  4OV2 A;  2KQY A;  1ZOT B;  2LUC A;  4NDC A;  1RTP 1;  1ZFS A;  1OE9 B;  2KI4 B;  2F2O A;  3EK7 A;  1TN4 A;  3PFV A;  4HRH A;  3OX5 A;  1FBV A;  1YRU B;  1J7R A;  3I5I C;  5HKW A;  2ZKM X;  1QLK A;  3OB1 B;  1B8R A;  2JXC A;  2SAS A;  2LE9 B;  3ZNI A;  5FYX A;  2KGR A;  1TNQ A;  1MQ1 A;  1QVI Z;  1EJ3 A;  1OZS A;  3I5G B;  4JQ0 D;  4PHM A;  1W7J B;  5G08 A;  3RM1 A;  5KSZ A;  1NYA A;  2Y1M A;  4PE7 A;  3TZ1 A;  2OTG B;  4QJ3 B;  1OMD A;  4DS7 A;  4MLW A;  3PAL A;  4GGF C;  4M2P A;  5AEQ A;  4YI9 A;  5KTY A;  1S6C A;  2AUC A;  2CNP A;  3CR5 X;  2MBX A;  2LAP A;  5I2L A;  1KFU L;  1SCM C;  2WC8 A;  1AUI B;  1XFU O;  3VRP A;  4Q04 A;  3WHU B;  5CSJ A;  2VRG A;  2WCE A;  2HQW A;  4OVN F;  4XYN A;  2FOT A;  1ZUZ A;  3C1V A;  1Y1X A;  2IS9 A;  1VRK A;  5ER4 X;  1YUS A;  1DGV A;  1KQV A;  1M31 A;  4PAL A;  3EVU A;  2NCP A;  2COL B;  4GNK B;  3BOW B;  5GQQ C;  1QX2 A;  1C7V A;  1YVH A;  1TOP A;  2F3Z A;  1BR4 B;  2JNX A;  1F8H A;  2A4J A;  2M1U A;  3CS1 A;  1FPW A;  1J55 A;  5AXI A;  2MA2 A;  3JTD C;  1KK8 C;  3PN7 B;  1FI5 A;  1MR8 A;  5I2O A;  1UHI A;  1WDC B;  3OHM B;  5DKR A;  3DD4 A;  4R1E A;  1JC2 A;  2BKH B;  3CWG A;  4ORA B;  1CM1 A;  1B8L A;  3VRQ A;  1K94 A;  2PMY A;  1KSM A;  4HRG A;  2EC6 B;  1IWQ A;  1B8C A;  1S1E A;  1G4Y R;  3AKA A;  2LAN A;  1V1F A;  3I5F C;  4GFT A;  5DKQ A;  3IQQ A;  2BEC A;  1SR6 C;  2WOS A;  3WNX B;  2BCB A;  4DUQ A;  1EXR A;  1XK4 C;  2NZ0 A;  4PE4 A;  2FCE A;  5BPJ A;  5D69 A;  2M97 A;  2HF5 A;  1KK7 Y;  2KI6 D;  1NIW A;  1KFX L;  1AK8 A;  1F55 A;  1OOJ A;  1PSR A;  2AMI A;  2LLS A;  4MBE A;  4PHN A;  2K2F A;  3BXK A;  3BOW A;  4L9M A;  4USL A;  3CR2 A;  2JWW A;  4UPG A;  1REC A;  2L0P A;  3DVJ A;  1L2O C;  1KSO A;  1OMR A;  2BE4 A;  4CLN A;  1DJZ A;  1NCZ A;  2K7D A;  3AAK A;  3EKH A;  5K89 A;  1CTR A;  2Q4U A;  1MXL C;  2LNK A;  3F45 A;  1FI6 A;  1PUL A;  4OKH A;  1NX3 A;  4U8D A;  1K9K A;  1UP5 A;  3GK4 X;  1EH2 A;  1XFZ O;  3VRO A;  2CT9 A;  1X02 A;  4MZJ A;  1IJ5 A;  1DJY A;  1R6P A;  4MEW A;  2GGM A;  1YTZ C;  1SBJ A;  5CSI A;  5I8N A;  1GJY A;  1FW4 A;  2M3W A;  2M7N A;  1A4P A;  1LA3 A;  4MZL A;  4PDZ A;  5F6T A;  2SCP A;  4JPZ B;  2BBM A;  2LMT A;  2CTN A;  4NQG A;  3M0W A;  1SL9 A;  2JT8 A;  1DVI A;  1ZMZ A;  1TIZ A;  1IKU A;  1V1G A;  2JC2 A;  5HLV A;  4CID A;  3BUX B;  1S6I A;  3NSO A;  2KBM A;  2KFH A;  2KBI A;  1AJ5 A;  1Y0V H;  1A75 B;  2TN4 A;  1K9P A;  3JVT B;  1SK6 D;  2JZI A;  2E6W A;  3SG4 A;  1CM4 A;  2KAX A;  2LCP A;  1CFC A;  1LA0 A;  1KK7 Z;  4ORB B;  3I5H B;  4PHJ A;  1HT9 A;  1YVL A;  2MLF C;  3TUY C;  5KU1 A;  1TCF A;  2ZND A;  1BT6 A;  1ODB A;  1SPY A;  2JQ6 A;  3H4S E;  4ORC B;  1J7P A;  2ZRS A;  1NPQ A;  2Y5I A;  1MXE A;  2L50 A;  4I5L B;  1EG3 A;  2JRF A;  4M2O A;  3LLE A;  2DOQ A;  2NLN A;  2G9B A;  3KEV A;  2KI4 C;  4MN0 A;  5D7F A;  2LLU A;  2F3Y A;  4HSZ A;  3IQO A;  3NSK A;  1IH0 A;  2BBN A;  3CR4 X;  2CCM A;  2PRU A;  1KQM B;  1B4C A;  1N0Y A;  4MRY A;  2ZN9 A;  4GAO A;  1QJT A;  4HRE E;  1BU3 A;  1QLS A;  1Y6W A;  3TS5 B;  2EHB A;  2OTG C;  2I2R E;  1S26 D;  1QAS A;  1CLM A;  1A75 A;  3DVE A;  1KWO C;  1NX1 A;  2H61 A;  4YI8 A;  5JOL A;  1QTX A;  5HYD A;  1DMO A;  3OB2 B;  3VRN A;  1M63 B;  2BL0 B;  4GBA A;  1B9A A;  1CFP A;  1UUS A;  3QRX A;  1CMF A;  1AJ4 A;  1TCO B;  1IRJ A;  3K21 A;  2MLE C;  4MZK A;  3KPX A;  1H8B A;  4BY4 A;  3DF0 A;  4GUK A;  4FTG A;  4DCK A;  2KGB C;  1F54 A;  1TNP A;  2JPT A;  2BE6 A;  5HKY A;  1BLQ A;  1XFV O;  2LP2 A;  1FF1 A;  2EGD A;  2L51 A;  1CLB A;  2I7A A;  1C7W A;  1SYM A; 
#chains in the Genus database with same CATH topology
 1ZAC A;  3BUN B;  3JTD B;  1J1E A;  4AQJ A;  2JUL A;  1R2U A;  3SJS A;  1QX5 B;  4AOM A;  3GOF A;  1E8A A;  1WY9 A;  2JTZ A;  1YX7 A;  2V53 A;  1PK0 D;  3B87 A;  2OPO A;  5IBW A;  2NCO A;  1WDC C;  3D77 A;  1K2H A;  3TDU A;  1DJI A;  1MHO A;  1RFJ A;  1WRL A;  2K60 A;  3PAT A;  4WRI A;  4YGB B;  1AP4 A;  1XFX O;  1J1D A;  1GGW A;  2H2K A;  1KCY A;  1WLM A;  1CLL A;  3DVK A;  4IL1 A;  1SR6 B;  5B8I B;  1QX7 A;  1UWO A;  2KDH A;  2QEV A;  1J7Q A;  2PAS A;  2F8P A;  2Y1N A;  1F4O A;  2M8U A;  4I5N B;  2F33 A;  1BG1 A;  1H4B A;  4E68 A;  2QDI A;  5PAL A;  2FCD A;  3OP0 A;  2LHI A;  2O60 A;  1XFY O;  1JSA A;  1KFU S;  1DQE A;  4C0L A;  1EL4 A;  4MRX A;  4ETO A;  1LIN A;  1SRA A;  1ALV A;  2KAY A;  3LCP C;  2BKI B;  5DIC A;  4ZCV A;  1IQ3 A;  2L5Y A;  4FQO A;  2WC5 A;  1XYD A;  2K0J A;  1Z2C B;  3AKB A;  3A4U B;  3BUM B;  2LP3 A;  1F71 A;  1MUX A;  1RK9 A;  4PHK A;  2I18 A;  1SY9 A;  1CDN A;  2LVJ A;  5TNC A;  1WRK A;  4YGC B;  3DY9 A;  3BUW B;  4C0K A;  2KHN A;  1IIO A;  1S3P A;  1TNX A;  2B1U A;  1SKT A;  3CDN A;  4MVF A;  1CDP A;  2JT3 A;  4GPL B;  1A29 A;  1UHK A;  2CBL A;  1NSH A;  2E30 A;  2KFF A;  2WCK A;  4QJ4 B;  4GGN A;  2M9G A;  5FI2 A;  4XJK A;  4JWQ A;  1C07 A;  1SCV A;  4PCW A;  2QPT A;  1L7Z A;  3PJI A;  2HQ8 A;  1DJG A;  1SMG A;  3CGA A;  4YGD B;  1IQ5 A;  4BY5 A;  1OOF A;  2LVK A;  5AAN A;  1QXP A;  1F70 A;  5AER A;  2OS8 C;  3MSE B;  1JUO A;  2K7O A;  2HET A;  1DF0 B;  2LM5 A;  4AQI A;  3L47 A;  2L4I A;  3RLZ A;  1TTX A;  2KNE A;  4F7F A;  2M0R A;  3ZWH A;  1PVA A;  5HKZ A;  1QAT A;  1DT7 B;  2LVI A;  1J7O A;  3HX4 A;  3L4A A;  1XA5 A;  1KFX S;  3CTN A;  1MWN A;  4KYN A;  1TRF A;  2KPH A;  2LLT A;  3JVT C;  5HLO A;  2L4H A;  3PSR A;  1MF8 B;  2LVV A;  2KSP A;  2H61 C;  4A4C A;  4OCI A;  5I2Q A;  1JWD A;  1CDM A;  1CFD A;  2R2I A;  5DKN A;  1G8I A;  3E3R A;  3DF0 B;  1Q80 A;  5CSN A;  4D1E A;  4OR9 B;  1K95 A;  1CKK A;  1GGZ A;  1RJV A;  2HPS A;  3I5I B;  1K8U A;  3D73 A;  2KYF A;  2Y4Q A;  3FIA A;  1F4Q A;  4M2Q A;  1YUT A;  3BQ3 A;  5AFP A;  3VGO A;  2JU0 A;  4CFR A;  4WQ2 A;  2QAC A;  2WND A;  3N7H A;  4I5J A;  1JF0 A;  4N1F A;  3I5G C;  1GQM A;  2M29 A;  4JD9 A;  2ZFD A;  3NHT A;  1NX2 A;  1KQM C;  1U5I B;  5D3O A;  2Q91 A;  1SCM B;  1DF0 A;  2MAZ A;  1DTL A;  1LS8 A;  1M39 A;  2WOR A;  1QV1 A;  1JF2 A;  2M1K B;  4ICB A;  3TS5 C;  4WQ3 A;  1KWO B;  1LVC D;  1M46 A;  2I94 A;  3VRR A;  1N2D A;  4P5O E;  1JFJ A;  3S0E A;  3KO0 A;  3LL8 B;  4YGA A;  1BF5 A;  1N65 A;  1CDL A;  3SG5 A;  4TNC A;  4YBH B;  3B7A A;  3WHT B;  3SIA A;  2K8M B;  1HQV A;  1K9U A;  1A03 A;  1ALW A;  1XFR A;  2WCF A;  1SL8 A;  3CLN A;  4MSP A;  2BL0 C;  1S5G Y;  2KI6 C;  1IG5 A;  1SL7 A;  2LMV A;  3O4Y A;  3SG3 A;  3B86 A;  1K93 D;  2L2E A;  3UO9 A;  2F2P A;  3PM2 A;  2FJU B;  3R1P A;  3D0Y A;  1DJW A;  1YX8 A;  1NCX A;  5CPV A;  1K90 D;  3FE9 A;  2P70 A;  1KK8 B;  3CZT X;  4N1G A;  2ZNE A;  2ERB A;  3R1V A;  1CB1 A;  1CFF A;  3OX6 A;  2PVB A;  4PE0 A;  2JOJ A;  3PN7 C;  3NXA A;  1BOD A;  2WCB A;  1B1G A;  3LK1 A;  3KF9 A;  4GGF A;  3AAJ A;  1U5I A;  3TDI A;  1XVJ A;  3I5F B;  3PM8 A;  3EVR A;  1BR1 B;  2LHL A;  4DIR A;  1WLZ A;  3GK2 A;  2K7C A;  2EC6 C;  3ICB A;  1D1O A;  1A2X A;  1PSB A;  2JXL A;  2AAO A;  4XJK B;  2LC5 A;  1IGV A;  2P6B B;  4PT1 A;  1B7T Y;  4I5K A;  4CPV A;  1Y1A A;  2D8N A;  1XFW O;  1WRZ A;  4F0Z B;  3FWB A;  2KFG A;  3EVV A;  1LKJ A;  1XO5 A;  2BAP A;  2QEB A;  3FWC A;  1QV0 A;  1BJF A;  2LV7 A;  5J3X A;  1NP8 A;  4CFQ A;  1PRW A;  1UHH A;  2PSR A;  1L2O B;  1PAL A;  1S6J A;  1OQP A;  1CNP A;  3SG6 A;  1SSE B;  1G33 A;  1RRO A;  3BYA A;  2LMU A;  1TNW A;  2BCX A;  1YR5 A;  2RGI A;  1RWY A;  1M45 A;  2K2A A;  3DVM A;  3TDZ A;  3SG7 A;  2GGZ A;  1JBA A;  3FE6 A;  3SIB A;  1QIV A;  1CMG A;  1ORG A;  4NDD A;  4JKT A;  3NSL A;  3FS7 A;  3L4L A;  1S5G Z;  4YRU A;  1JFK A;  1DGU A;  1S36 A;  3DYE A;  1BMO A;  1DJH A;  2JNF A;  2PAL A;  1BOC A;  1QVI Y;  2K61 A;  4YGE B;  1NCY A;  4ZCU A;  2PQL A;  3O2P A;  1NWD A;  2JTT A;  3EK8 A;  2G2B A;  3GK1 A;  5CSF A;  1Y1U A;  3A8R A;  3O78 A;  2LUX A;  2O5G A;  1YUR A;  2KYC A;  1XK4 A;  2ISD A;  4A4B A;  2CXJ A;  1DJX A;  2M7L A;  1UHJ A;  5HL1 A;  2GV5 A;  3R1O A;  5JJG A;  4N5X A;  3EKJ A;  2M49 B;  2K7B A;  4NDB A;  1YUU A;  3SG2 A;  3VB1 A;  1PVB A;  3IF7 A;  4P2Y B;  1OSA A;  2MJW B;  1QS7 A;  1YRT B;  5ER5 A;  4C0J A;  1OMV A;  1UHN A;  2MRD A;  3D10 A;  3EK4 A;  3O6B A;  2L5X B;  2OS8 B;  2ZN8 A;  1B47 A;  2BCA A;  1P28 A;  1AHR A;  3HCM A;  2ZRT A;  1B7T Z;  3DZT A;  1IJ6 A;  1OZO A;  4DRW A;  4QJ5 B;  1LXF C;  1NUB A;  3B6X A;  2MHH A;  3NSI A;  3TUY B;  1SW8 A;  3LK0 A;  1SNL A;  3BUO B;  1AVS A;  3S0D A;  1K96 A;  1NX0 A;  1QWV A;  2KAV A;  2NXQ A;  2WC6 A;  3I5H C;  3NHI A;  4PE1 A;  1OOG A;  1UUR A;  1QIW A;  1W7I B;  2KQ6 A;  2KOT A;  2JT0 A;  3CYZ A;  3CAB A;  1EG4 A;  2L98 A;  3D0Y B;  3PLF B;  3WXA A;  3FE8 A;  3KHE A;  2KQY A;  1ZOT B;  4OV2 A;  2LUC A;  4NDC A;  1RTP 1;  1ZFS A;  1OE9 B;  2KI4 B;  2F2O A;  3EK7 A;  1TN4 A;  3K1E A;  3PFV A;  4HRH A;  3OX5 A;  1FBV A;  5FI6 A;  1GM0 A;  1YRU B;  1J7R A;  2YGU A;  3I5I C;  5HKW A;  2ZKM X;  3D75 A;  1QLK A;  5I94 A;  3OB1 B;  1B8R A;  2JXC A;  2SAS A;  2LE9 B;  3ZNI A;  3D76 A;  5FYX A;  2KGR A;  1TNQ A;  1MQ1 A;  1QVI Z;  1EJ3 A;  1OZS A;  3I5G B;  3IVT A;  3R72 A;  1W7J B;  4JQ0 D;  4PHM A;  5G08 A;  1NYA A;  2Y1M A;  4PE7 A;  3TZ1 A;  2OTG B;  4QJ3 B;  4FQT A;  1OMD A;  4DS7 A;  2WCJ A;  4MLW A;  3PAL A;  4GGF C;  4M2P A;  5AEQ A;  4YI9 A;  5KTY A;  1S6C A;  2AUC A;  2CNP A;  3CR5 X;  2MBX A;  2LAP A;  5I2L A;  1KFU L;  1SCM C;  2WC8 A;  1AUI B;  1XFU O;  3VRP A;  4Q04 A;  5EL2 A;  3Q8I A;  3WHU B;  5CSJ A;  2VRG A;  2WCE A;  2HQW A;  4OVN F;  4XYN A;  2FOT A;  1ZUZ A;  3C1V A;  3BJH A;  1Y1X A;  2IS9 A;  1OW4 A;  1VRK A;  5ER4 X;  1YUS A;  1C3Z A;  1DGV A;  3QME A;  1KQV A;  1M31 A;  2QEH A;  3EVU A;  4PAL A;  2NCP A;  2COL B;  4GNK B;  2PYQ A;  3BOW B;  5GQQ C;  1QX2 A;  1C7V A;  1YVH A;  1TOP A;  2F3Z A;  1BR4 B;  2JNX A;  1F8H A;  2A4J A;  2M1U A;  3CS1 A;  1FPW A;  1J55 A;  1OOH A;  3S0A A;  5AXI A;  2MA2 A;  3JTD C;  1KK8 C;  3PN7 B;  1FI5 A;  1MR8 A;  5I2O A;  1UHI A;  1WDC B;  3OHM B;  5DKR A;  3DD4 A;  4R1E A;  1JC2 A;  1Z4H A;  2BKH B;  2P71 A;  3CWG A;  3CZ1 A;  4ORA B;  1CM1 A;  3S0B A;  3S0F A;  1B8L A;  3BFB A;  3VRQ A;  1K94 A;  2PMY A;  1KSM A;  4HRG A;  3RZS A;  2EC6 B;  1IWQ A;  1B8C A;  1S1E A;  1G4Y R;  3AKA A;  2LAN A;  1V1F A;  3CZ0 A;  3I5F C;  4GFT A;  5DKQ A;  3IQQ A;  2BEC A;  1SR6 C;  2FJY A;  2WOS A;  3WNX B;  2BCB A;  4DUQ A;  1EXR A;  1XK4 C;  2NZ0 A;  4PE4 A;  2FCE A;  5BPJ A;  5FI7 A;  5D69 A;  2M97 A;  2HF5 A;  1KK7 Y;  2KI6 D;  1NIW A;  3O4X A;  1KFX L;  1AK8 A;  1F55 A;  1OOJ A;  1PSR A;  2AMI A;  2LLS A;  3D78 A;  4MBE A;  4PHN A;  2K2F A;  2L2C A;  3BXK A;  3BOW A;  4L9M A;  4USL A;  3CR2 A;  2JWW A;  3UNW A;  4UPG A;  1REC A;  3DXL A;  2L0P A;  3EG5 B;  3OGN A;  3DVJ A;  1L2O C;  1KSO A;  2KLE A;  3CZ2 A;  1OMR A;  1OOI X;  2BE4 A;  3SS4 A;  4CLN A;  1DJZ A;  1NCZ A;  2K7D A;  3AAK A;  3EKH A;  5K89 A;  1CTR A;  4OZD A;  2Q4U A;  1MXL C;  2LNK A;  3F45 A;  2GTE A;  1DC1 A;  1PUL A;  1FI6 A;  4OKH A;  1NX3 A;  4U8D A;  1K9K A;  1UP5 A;  3GK4 X;  1EH2 A;  1XFZ O;  1TUJ A;  3VRO A;  2CT9 A;  1W9Z A;  1X02 A;  1IJ5 A;  4MZJ A;  1DJY A;  1R6P A;  4MEW A;  2GGM A;  1YTZ C;  1SBJ A;  5CSI A;  5I8N A;  1GJY A;  3S0G A;  1FW4 A;  2BNX A;  2M3W A;  2M7N A;  1A4P A;  3V2L A;  1LA3 A;  4MZL A;  4PDZ A;  5F6T A;  2SCP A;  5KSZ A;  3B88 A;  4JPZ B;  3D74 A;  2BBM A;  2LMT A;  2CTN A;  4NQG A;  3M0W A;  1SL9 A;  2JT8 A;  1DVI A;  1ZMZ A;  1TIZ A;  1TUZ A;  1IKU A;  1V1G A;  2JC2 A;  5HLV A;  4CID A;  3BUX B;  1S6I A;  1TWO A;  2KBM A;  2KFH A;  3NSO A;  2KBI A;  3RM1 A;  1AJ5 A;  1Y0V H;  3SS3 A;  1A75 B;  2TN4 A;  1K9P A;  3JVT B;  1C3Y A;  3NGV A;  1SK6 D;  2JZI A;  2E6W A;  3SG4 A;  1CM4 A;  2KAX A;  2LCP A;  1CFC A;  1LA0 A;  1KK7 Z;  4ORB B;  3I5H B;  4PHJ A;  1HT9 A;  1YVL A;  2MLF C;  3TUY C;  5KU1 A;  1TCF A;  2ZND A;  3OBV A;  1BT6 A;  1ODB A;  1SPY A;  2JQ6 A;  3H4S E;  4ORC B;  1J7P A;  2ZRS A;  1NPQ A;  2Y5I A;  1MXE A;  2L50 A;  4I5L B;  1EG3 A;  2JRF A;  4M2O A;  3LLE A;  2DOQ A;  2NLN A;  1T14 A;  4INW A;  2G9B A;  1DEL A;  3KEV A;  3SS5 A;  2KI4 C;  4INX A;  4MN0 A;  2LLU A;  5D7F A;  2F3Y A;  4HSZ A;  3IQO A;  3NSK A;  1IH0 A;  2BBN A;  3CR4 X;  2CCM A;  2PRU A;  1KQM B;  1B4C A;  1N0Y A;  4MRY A;  2ZN9 A;  4GAO A;  1QJT A;  4HRE E;  3BFH A;  1BU3 A;  1QLS A;  1Y6W A;  3BFA A;  3TS5 B;  1DEK A;  2EHB A;  2JPO A;  2OTG C;  2I2R E;  2KLD A;  1S26 D;  1QAS A;  2WCH A;  1CLM A;  1A75 A;  3DVE A;  1KWO C;  1NX1 A;  2H61 A;  4YI8 A;  5JOL A;  1QTX A;  5HYD A;  1DMO A;  3OB2 B;  3VRN A;  1M63 B;  2QEO A;  2BL0 B;  4GBA A;  1B9A A;  1CFP A;  1UUS A;  3QRX A;  1CMF A;  1AJ4 A;  1TCO B;  2WCL A;  1IRJ A;  3K21 A;  2MLE C;  4MZK A;  3KPX A;  1H8B A;  4BY4 A;  3DF0 A;  4GUK A;  4FTG A;  2WCM A;  2KGB C;  4DCK A;  1F54 A;  1TNP A;  2JPT A;  2BE6 A;  2H8V A;  4IJ7 A;  5HKY A;  1XFV O;  1BLQ A;  2LP2 A;  1FF1 A;  2EGD A;  2L51 A;  1CLB A;  2I7A A;  1C7W A;  1SYM A; 
#chains in the Genus database with same CATH homology
 1ZAC A;  3BUN B;  3JTD B;  1J1E A;  4AQJ A;  2JUL A;  1R2U A;  3SJS A;  1QX5 B;  4AOM A;  3GOF A;  1E8A A;  1WY9 A;  2JTZ A;  1YX7 A;  2V53 A;  1PK0 D;  2OPO A;  5IBW A;  2NCO A;  1WDC C;  1K2H A;  3TDU A;  1DJI A;  1MHO A;  1RFJ A;  1WRL A;  3PAT A;  4WRI A;  4YGB B;  1AP4 A;  1XFX O;  1J1D A;  1GGW A;  2H2K A;  1KCY A;  1WLM A;  1CLL A;  3DVK A;  4IL1 A;  1SR6 B;  5B8I B;  1QX7 A;  1UWO A;  2KDH A;  1J7Q A;  2PAS A;  2F8P A;  2Y1N A;  1F4O A;  2M8U A;  4I5N B;  2F33 A;  1BG1 A;  1H4B A;  4E68 A;  5PAL A;  2FCD A;  3OP0 A;  2LHI A;  2O60 A;  1XFY O;  1JSA A;  1KFU S;  4C0L A;  1EL4 A;  4MRX A;  4ETO A;  1LIN A;  1SRA A;  1ALV A;  2KAY A;  3LCP C;  2BKI B;  4ZCV A;  1IQ3 A;  4FQO A;  1XYD A;  2K0J A;  3AKB A;  3BUM B;  3A4U B;  1F71 A;  2LP3 A;  1MUX A;  1RK9 A;  4PHK A;  2I18 A;  1SY9 A;  1CDN A;  2LVJ A;  5TNC A;  1WRK A;  4YGC B;  3BUW B;  4C0K A;  2KHN A;  1S3P A;  1TNX A;  2B1U A;  1SKT A;  4MVF A;  1CDP A;  2JT3 A;  4GPL B;  1A29 A;  1UHK A;  2CBL A;  1NSH A;  2E30 A;  2KFF A;  4QJ4 B;  4GGN A;  2M9G A;  4XJK A;  4JWQ A;  1C07 A;  1SCV A;  4PCW A;  2QPT A;  1L7Z A;  2HQ8 A;  1DJG A;  1SMG A;  3CGA A;  4YGD B;  1IQ5 A;  4BY5 A;  2LVK A;  5AAN A;  1F70 A;  1QXP A;  5AER A;  2OS8 C;  3MSE B;  1JUO A;  2K7O A;  2HET A;  1DF0 B;  2LM5 A;  4AQI A;  2L4I A;  3RLZ A;  1TTX A;  2KNE A;  2M0R A;  3ZWH A;  1PVA A;  5HKZ A;  1QAT A;  1DT7 B;  2LVI A;  1J7O A;  3HX4 A;  1XA5 A;  1KFX S;  3CTN A;  1MWN A;  1TRF A;  2LLT A;  3JVT C;  5HLO A;  2L4H A;  3PSR A;  1MF8 B;  2LVV A;  2KSP A;  2H61 C;  4A4C A;  4OCI A;  5I2Q A;  1JWD A;  1CDM A;  1CFD A;  2R2I A;  5DKN A;  1G8I A;  3E3R A;  3DF0 B;  1Q80 A;  5CSN A;  4D1E A;  4OR9 B;  1K95 A;  1CKK A;  1GGZ A;  1RJV A;  2HPS A;  3I5I B;  1K8U A;  2KYF A;  2Y4Q A;  3FIA A;  1F4Q A;  4M2Q A;  1YUT A;  3BQ3 A;  5AFP A;  3VGO A;  2JU0 A;  4CFR A;  4WQ2 A;  2QAC A;  2WND A;  4I5J A;  1JF0 A;  4N1F A;  3I5G C;  1GQM A;  2M29 A;  2ZFD A;  1NX2 A;  1KQM C;  1U5I B;  2Q91 A;  1SCM B;  1DF0 A;  2MAZ A;  1DTL A;  1M39 A;  2WOR A;  1QV1 A;  1JF2 A;  2M1K B;  4ICB A;  3TS5 C;  4WQ3 A;  1KWO B;  1LVC D;  1M46 A;  2I94 A;  3VRR A;  1N2D A;  4P5O E;  1JFJ A;  3KO0 A;  3LL8 B;  4YGA A;  1BF5 A;  1N65 A;  1CDL A;  3SG5 A;  4TNC A;  4YBH B;  3WHT B;  3SIA A;  2K8M B;  1HQV A;  1K9U A;  1A03 A;  1ALW A;  2WCF A;  1SL8 A;  3CLN A;  4MSP A;  2BL0 C;  1S5G Y;  2KI6 C;  1IG5 A;  1SL7 A;  2LMV A;  3O4Y A;  3SG3 A;  1K93 D;  2L2E A;  2F2P A;  2FJU B;  3D0Y A;  1DJW A;  1YX8 A;  1NCX A;  5CPV A;  1K90 D;  1KK8 B;  3CZT X;  4N1G A;  2ZNE A;  1CB1 A;  1CFF A;  3OX6 A;  2PVB A;  4PE0 A;  2JOJ A;  3PN7 C;  3NXA A;  1BOD A;  2WCB A;  1B1G A;  3LK1 A;  3KF9 A;  4GGF A;  3AAJ A;  1U5I A;  3TDI A;  1XVJ A;  3I5F B;  3PM8 A;  3EVR A;  1BR1 B;  2LHL A;  4DIR A;  1WLZ A;  3GK2 A;  2K7C A;  2EC6 C;  3ICB A;  1D1O A;  1A2X A;  1PSB A;  2JXL A;  2AAO A;  4XJK B;  2LC5 A;  1IGV A;  2P6B B;  1B7T Y;  4I5K A;  4CPV A;  1Y1A A;  2D8N A;  1XFW O;  1WRZ A;  4F0Z B;  3FWB A;  2KFG A;  3EVV A;  1LKJ A;  1XO5 A;  3FWC A;  1QV0 A;  1BJF A;  2LV7 A;  5J3X A;  1NP8 A;  4CFQ A;  1PRW A;  1UHH A;  2PSR A;  1L2O B;  1PAL A;  1S6J A;  1OQP A;  1CNP A;  3SG6 A;  1G33 A;  1RRO A;  3BYA A;  2LMU A;  1TNW A;  2BCX A;  1YR5 A;  2RGI A;  1RWY A;  1M45 A;  2K2A A;  3DVM A;  3TDZ A;  3SG7 A;  2GGZ A;  1JBA A;  3SIB A;  1QIV A;  1CMG A;  4NDD A;  3NSL A;  3FS7 A;  1S5G Z;  4YRU A;  1JFK A;  1DGU A;  1S36 A;  1BMO A;  1DJH A;  2JNF A;  2PAL A;  1BOC A;  1QVI Y;  2K61 A;  4YGE B;  1NCY A;  4ZCU A;  3O2P A;  1NWD A;  2JTT A;  3EK8 A;  2G2B A;  3GK1 A;  5CSF A;  1Y1U A;  3A8R A;  3O78 A;  2LUX A;  2O5G A;  1YUR A;  2KYC A;  1XK4 A;  2ISD A;  4A4B A;  2CXJ A;  1DJX A;  2M7L A;  1UHJ A;  2GV5 A;  5JJG A;  4N5X A;  3EKJ A;  2M49 B;  2K7B A;  4NDB A;  1YUU A;  3SG2 A;  1PVB A;  3IF7 A;  4P2Y B;  1OSA A;  2MJW B;  1QS7 A;  1YRT B;  5ER5 A;  4C0J A;  1OMV A;  1UHN A;  2MRD A;  3D10 A;  3EK4 A;  3O6B A;  2L5X B;  2OS8 B;  2ZN8 A;  1B47 A;  2BCA A;  3HCM A;  1AHR A;  2ZRT A;  1B7T Z;  1IJ6 A;  1OZO A;  4DRW A;  4QJ5 B;  1LXF C;  1NUB A;  2MHH A;  3NSI A;  3TUY B;  1SW8 A;  3LK0 A;  1SNL A;  3BUO B;  1AVS A;  1K96 A;  1NX0 A;  2KAV A;  2NXQ A;  3I5H C;  4PE1 A;  1UUR A;  1QIW A;  1W7I B;  2KQ6 A;  2KOT A;  2JT0 A;  1EG4 A;  2L98 A;  3D0Y B;  3PLF B;  3WXA A;  3KHE A;  4OV2 A;  2KQY A;  1ZOT B;  2LUC A;  4NDC A;  1RTP 1;  1ZFS A;  1OE9 B;  2KI4 B;  2F2O A;  3EK7 A;  1TN4 A;  3PFV A;  4HRH A;  3OX5 A;  1FBV A;  1YRU B;  1J7R A;  3I5I C;  5HKW A;  2ZKM X;  1QLK A;  3OB1 B;  1B8R A;  2JXC A;  2SAS A;  2LE9 B;  3ZNI A;  5FYX A;  2KGR A;  1TNQ A;  1MQ1 A;  1QVI Z;  1EJ3 A;  1OZS A;  3I5G B;  4JQ0 D;  4PHM A;  1W7J B;  5G08 A;  3RM1 A;  5KSZ A;  1NYA A;  2Y1M A;  4PE7 A;  3TZ1 A;  2OTG B;  4QJ3 B;  1OMD A;  4DS7 A;  4MLW A;  3PAL A;  4GGF C;  4M2P A;  5AEQ A;  4YI9 A;  5KTY A;  1S6C A;  2AUC A;  2CNP A;  3CR5 X;  2MBX A;  2LAP A;  5I2L A;  1KFU L;  1SCM C;  2WC8 A;  1AUI B;  1XFU O;  3VRP A;  4Q04 A;  3WHU B;  5CSJ A;  2VRG A;  2WCE A;  2HQW A;  4OVN F;  4XYN A;  2FOT A;  1ZUZ A;  3C1V A;  1Y1X A;  2IS9 A;  1VRK A;  5ER4 X;  1YUS A;  1DGV A;  1KQV A;  1M31 A;  4PAL A;  3EVU A;  2NCP A;  2COL B;  4GNK B;  3BOW B;  5GQQ C;  1QX2 A;  1C7V A;  1YVH A;  1TOP A;  2F3Z A;  1BR4 B;  2JNX A;  1F8H A;  2A4J A;  2M1U A;  3CS1 A;  1FPW A;  1J55 A;  5AXI A;  2MA2 A;  3JTD C;  1KK8 C;  3PN7 B;  1FI5 A;  1MR8 A;  5I2O A;  1UHI A;  1WDC B;  3OHM B;  5DKR A;  3DD4 A;  4R1E A;  1JC2 A;  2BKH B;  3CWG A;  4ORA B;  1CM1 A;  1B8L A;  3VRQ A;  1K94 A;  2PMY A;  1KSM A;  4HRG A;  2EC6 B;  1IWQ A;  1B8C A;  1S1E A;  1G4Y R;  3AKA A;  2LAN A;  1V1F A;  3I5F C;  4GFT A;  5DKQ A;  3IQQ A;  2BEC A;  1SR6 C;  2WOS A;  3WNX B;  2BCB A;  4DUQ A;  1EXR A;  1XK4 C;  2NZ0 A;  4PE4 A;  2FCE A;  5BPJ A;  5D69 A;  2M97 A;  2HF5 A;  1KK7 Y;  2KI6 D;  1NIW A;  1KFX L;  1AK8 A;  1F55 A;  1OOJ A;  1PSR A;  2AMI A;  2LLS A;  4MBE A;  4PHN A;  2K2F A;  3BXK A;  3BOW A;  4L9M A;  4USL A;  3CR2 A;  2JWW A;  4UPG A;  1REC A;  2L0P A;  3DVJ A;  1L2O C;  1KSO A;  1OMR A;  2BE4 A;  4CLN A;  1DJZ A;  1NCZ A;  2K7D A;  3AAK A;  3EKH A;  5K89 A;  1CTR A;  2Q4U A;  1MXL C;  2LNK A;  3F45 A;  1FI6 A;  1PUL A;  4OKH A;  1NX3 A;  4U8D A;  1K9K A;  1UP5 A;  3GK4 X;  1EH2 A;  1XFZ O;  3VRO A;  2CT9 A;  1X02 A;  4MZJ A;  1IJ5 A;  1DJY A;  1R6P A;  4MEW A;  2GGM A;  1YTZ C;  1SBJ A;  5CSI A;  5I8N A;  1GJY A;  1FW4 A;  2M3W A;  2M7N A;  1A4P A;  1LA3 A;  4MZL A;  4PDZ A;  5F6T A;  2SCP A;  4JPZ B;  2BBM A;  2LMT A;  2CTN A;  4NQG A;  3M0W A;  1SL9 A;  2JT8 A;  1DVI A;  1ZMZ A;  1TIZ A;  1IKU A;  1V1G A;  2JC2 A;  5HLV A;  4CID A;  3BUX B;  1S6I A;  3NSO A;  2KBM A;  2KFH A;  2KBI A;  1AJ5 A;  1Y0V H;  1A75 B;  2TN4 A;  1K9P A;  3JVT B;  1SK6 D;  2JZI A;  2E6W A;  3SG4 A;  1CM4 A;  2KAX A;  2LCP A;  1CFC A;  1LA0 A;  1KK7 Z;  4ORB B;  3I5H B;  4PHJ A;  1HT9 A;  1YVL A;  2MLF C;  3TUY C;  5KU1 A;  1TCF A;  2ZND A;  1BT6 A;  1ODB A;  1SPY A;  2JQ6 A;  3H4S E;  4ORC B;  1J7P A;  2ZRS A;  1NPQ A;  2Y5I A;  1MXE A;  2L50 A;  4I5L B;  1EG3 A;  2JRF A;  4M2O A;  3LLE A;  2DOQ A;  2NLN A;  2G9B A;  3KEV A;  2KI4 C;  4MN0 A;  5D7F A;  2LLU A;  2F3Y A;  4HSZ A;  3IQO A;  3NSK A;  1IH0 A;  2BBN A;  3CR4 X;  2CCM A;  2PRU A;  1KQM B;  1B4C A;  1N0Y A;  4MRY A;  2ZN9 A;  4GAO A;  1QJT A;  4HRE E;  1BU3 A;  1QLS A;  1Y6W A;  3TS5 B;  2EHB A;  2OTG C;  2I2R E;  1S26 D;  1QAS A;  1CLM A;  1A75 A;  3DVE A;  1KWO C;  1NX1 A;  2H61 A;  4YI8 A;  5JOL A;  1QTX A;  5HYD A;  1DMO A;  3OB2 B;  3VRN A;  1M63 B;  2BL0 B;  4GBA A;  1B9A A;  1CFP A;  1UUS A;  3QRX A;  1CMF A;  1AJ4 A;  1TCO B;  1IRJ A;  3K21 A;  2MLE C;  4MZK A;  3KPX A;  1H8B A;  4BY4 A;  3DF0 A;  4GUK A;  4FTG A;  4DCK A;  2KGB C;  1F54 A;  1TNP A;  2JPT A;  2BE6 A;  5HKY A;  1BLQ A;  1XFV O;  2LP2 A;  1FF1 A;  2EGD A;  2L51 A;  1CLB A;  2I7A A;  1C7W A;  1SYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...