1OMRA

Non-myristoylated wild-type bovine recoverin with calcium bound to ef-hand 3
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
201
structure length
201
Chain Sequence
GNSKSGALSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKLKEKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Impact of N-terminal myristoylation on the Ca2+-dependent conformational transition in recoverin
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
molecule keywords recoverin
total genus 75
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2003-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1omrA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1omrA01
1PULA 1MXEA 1G4YR 1KQMB 1KSMA 4E68A 3TS5B 3BOWA 2MA2A 2JPTA 1QJTA 1QTXA 2KI4C 1TCFA 1A2XA 1OMVA 1YR5A 2L98A 2Y1NA 1BG1A 1EL4A 1B8CA 2GGZA 1NUBA 1X02A 1YX8A 2L0PA 2B1UA 1W7IB 3BYAA 2JULA 3I5GC 2LMVA 1GGZA 1BJFA 1TNWA 5CPVA 1AP4A 4YGDB 4DIRA 1S5GY 3KHEA 1SL7A 1QVIY 2MBXA 1L2OC 1CLLA 1ZFSA 2HQ8A 1J55A 2A4JA 1DMOA 1CDLA 1XO5A 1B8LA 1U5IB 1NCYA 4M2QA 3PN7C 3VRPA 1CDPA 3EK4A 4MVFA 1CFPA 3CTNA 1AVSA 5G08A 1XK4A 3EKHA 2LCPA 5HKWA 4P5OE 2E30A 5HKZA 1R6PA 5D7FA 2KI6C 5HYDA 3BXKA 3EKJA 1IKUA 2EC6C 1PALA 4A4BA 1KK7Z 4GAOA 2KNEA 4C0JA 1WRLA 3OX5A 2G9BA 2H61A 2KYCA 1UHNA 3CR5X 4GGNA 1DJGA 4PHNA 3SG4A 4GFTA 2JTZA 1UURA 1XFXO 2P6BB 2NCOA 1CMGA 1ODBA 1UWOA 2JT0A 2F3ZA 5GQQC 3RLZA 1SCVA 3VROA 1LINA 1QVIZ 2FJUB 3BUOB 1SY9A 1FI5A 2MHHA 4CFQA 1DF0B 1Y0VH 2PSRA 1NX0A 1WLZA 2PMYA 2Y5IA 3SG6A 2TN4A 1OQPA 3LLEA 1ZMZA 2BKHB 2HPSA 1J7PA 4N1GA 1J1DA 3SJSA 1JWDA 5DKRA 1XVJA 4WQ2A 3JTDC 1F55A 2ZRTA 4OKHA 3D0YB 2KFGA 2LANA 2K7OA 3PSRA 3KEVA 2KI4B 2LLSA 1KWOC 1S36A 2BCXA 2EC6B 3GK2A 2AAOA 3NSKA 1JF2A 2KYFA 3NSOA 2PRUA 1CLMA 3BOWB 2LHIA 2KSPA 4OR9B 1IQ5A 1MHOA 3I5HB 2HQWA 2LHLA 3CS1A 4R1EA 1TNQA 1VRKA 2ZRSA 1C7VA 1S6CA 2L50A 1TNXA 4PE4A 1A29A 2VRGA 3PM8A 4QJ5B 2ZN8A 3FS7A 1JBAA 3TUYB 1UHIA 4M2OA 5KSZA 2NLNA 1FF1A 1DJXA 1PVBA 4GUKA 3E3RA 3LK1A 4PCWA 2WC8A 4Q04A 3SG5A 3JVTC 2Q91A 2H61C 2LLTA 2IS9A 4I5NB 2FCDA 4A4CA 1FW4A 2NCPA 2WCEA 1B7TY 3I5FC 2MJWB 4XYNA 1M31A 5J3XA 1NX3A 1UUSA 2KOTA 4MSPA 3AAKA 2F8PA 1QLKA 2O5GA 2WCBA 2ZNEA 3BQ3A 4GPLB 1IGVA 1AJ4A 1N2DA 5KTYA 1JC2A 1F71A 1WDCB 1S26D 2WORA 2M1UA 5ER5A 2LVKA 1K93D 4ZCVA 1YUUA 3O6BA 5HLOA 1OZOA 4AQIA 1MQ1A 1B8RA 3K21A 1CB1A 1EG3A 2BCAA 3PALA 1LA0A 3D0YA 2BKIB 1KFXS 2F2OA 2CNPA 1AJ5A 1MWNA 2L4IA 3SIAA 1B9AA 3FIAA 4USLA 3ZWHA 2PALA 2SCPA 3EVRA 2QACA 1NPQA 2HF5A 2LE9B 2BE4A 2OTGC 1JUOA 2MLFC 4YGEB 1L7ZA 1GGWA 1B47A 1SRAA 2SASA 2BL0C 2GV5A 2KFFA 1IQ3A 5AFPA 2QPTA 3FWCA 2CTNA 4MEWA 1YUSA 4MZLA 2V53A 4YI9A 1LA3A 1CFDA 1TCOB 1YRTB 1YVLA 3LK0A 1S5GZ 2M9GA 5AERA 1CLBA 1HQVA 2G2BA 1F8HA 5CSIA 3A8RA 1N65A 2M0RA 1RECA 1BODA 1IRJA 5ER4X 2L5XB 2COLB 2LVIA 1DT7B 1AUIB 1QS7A 2LC5A 1CFCA 4M2PA 3CLNA 1YUTA 2ZFDA 3OB2B 1AK8A 2LLUA 4NQGA 3C1VA 3AAJA 1J1EA 1XFWO 3WHUB 4CPVA 4HRHA 3DVJA 2R2IA 2ISDA 1E8AA 1Y6WA 3EK7A 2E6WA 2F33A 2LAPA 2LNKA 2MRDA 3BUNB 3F45A 1KFUL 4QJ4B 3M0WA 3O4YA 3CR2A 1JF0A 5PALA 3GK4X 1DVIA 2M29A 1QLSA 4PE7A 1SCMC 1W7JB 4UPGA 4ETOA 1F70A 1AHRA 4JWQA 2WCFA 3SIBA 5CSJA 3KF9A 4C0KA 1KWOB 3CZTX 2WNDA 3NSIA 5KU1A 4MBEA 1MUXA 1XK4C 4AQJA 4MRYA 1F54A 1A75A 1BOCA 1KQVA 2JWWA 3HCMA 4MRXA 1YX7A 4HREE 4YGBB 1SR6B 5TNCA 4I5KA 1KK8B 1M46A 2ZN9A 3CR4X 1J7OA 3KPXA 1CFFA 1SYMA 2KAYA 2I2RE 1WDCC 4CIDA 2JQ6A 1OSAA 1XA5A 1LXFC 1LKJA 1WRKA 2LMTA 3KO0A 2I18A 4PE0A 1CKKA 2LVVA 3TS5C 2JXCA 3I5IC 4PHKA 1NIWA 1G33A 3JVTB 4ORBB 5I8NA 2BECA 5CSNA 1B7TZ 1ZUZA 3EK8A 3BUXB 2M7LA 1K90D 3H4SE 2JNXA 3GK1A 1YVHA 2KHNA 1EXRA 1K8UA 1XFUO 1C07A 1BR4B 1ALWA 1M63B 3WHTB 2JXLA 3TZ1A 4BY5A 5JOLA 2I94A 1NYAA 1SW8A 3DF0B 1RK9A 4DCKA 2KQ6A 4PHJA 2BBMA 1TIZA 5AEQA 1RTP1 1SL8A 1KFXL 3GOFA 4HSZA 2WOSA 1N0YA 4PDZA 1QIVA 2K7DA 1G8IA 1DGVA 3VRRA 1DTLA 5BPJA 4ZCUA 5B8IB 5AANA 4XJKA 1JFKA 1K96A 2I7AA 5IBWA 1QIWA 1BMOA 2K2AA 3BUMB 2PASA 1GJYA 3BUWB 1IG5A 3EVUA 4D1EA 3CWGA 2BL0B 3EVVA 1OE9B 4YI8A 1Y1AA 2MAZA 4L9MA 4PE1A 2LV7A 3DD4A 5CSFA 1F4QA 3NXAA 4BY4A 2K8MB 4GGFA 3I5HC 1DJYA 1PSRA 3OHMB 3SG7A 4GBAA 1K95A 3LL8B 2JZIA 3JTDB 1DGUA 1KSOA 1MR8A 1XFZO 5F6TA 5I2LA 4PHMA 4FQOA 1JSAA 1IJ5A 1PSBA 1F4OA 1L2OB 2L51A 1KQMC 2GGMA 4F0ZB 2K0JA 1UHJA 1RWYA 3IQQA 2LM5A 5FYXA 2BBNA 2BE6A 1DF0A 3HX4A 1RFJA 1RROA 2CXJA 2OS8B 1S3PA 1OOJA 2LP3A 2CBLA 2M97A 2HETA 2LP2A 3DF0A 1TRFA 2CT9A 1LVCD 4MZKA 3I5GB 1EG4A 2K7CA 2MLEC 2M7NA 2OTGB 4WRIA 1WY9A 3VRQA 1DJHA 3A4UB 4TNCA 2FOTA 1EJ3A 2ZKMX 3SG2A 1CTRA 4NDDA 4OVNF 1MF8B 1UHHA 4AOMA 1TN4A 2OPOA 4CLNA 5DKQA 1GQMA 1M45A 2JOJA 3OX6A 2JRFA 1MXLC 2Y4QA 2LVJA 1BR1B 4P2YB 1FI6A 1SK6D 1CNPA 1CDNA 1J7RA 1FBVA 1K9KA 1KK8C 2KBIA 1SNLA 4NDBA 4OCIA 3PFVA 3TDUA 1BF5A 1IWQA 2KAXA 2M1KB 1YTZC 1B4CA 1NX2A 1NSHA 1M39A 3ICBA 5HLVA 1IH0A 1QX7A 2L2EA 3VGOA 1CM1A 2L4HA 3AKBA 4U8DA 2PVBA 4OV2A 3SG3A 1A4PA 4YRUA 2D8NA 1V1FA 1C7WA 1XFVO 1YURA 1JFJA 2BCBA 4ORCB 2F2PA 1K2HA 1QXPA 4DUQA 5JJGA 1OMDA 1QATA 2JU0A 3DVMA 4NDCA 4MLWA 1WLMA 2KAVA 1BU3A 2FCEA 1SCMB 4YGAA 2JNFA 3LCPC 2KGBC 1RJVA 4YBHB 1K94A 1H8BA 4PALA 1V1GA 2M3WA 3MSEB 3IF7A 4HRGA 1SKTA 2AMIA 2JT3A 2K7BA 2DOQA 1S1EA 2O60A 4MZJA 1B1GA 2KGRA 3O78A 1PVAA 2K61A 1R2UA 3WXAA 4ICBA 4ORAB 3PLFB 1QV1A 4GNKB 1ALVA 3DVEA 3I5FB 5AXIA 1NWDA 4YGCB 4I5JA 3IQOA 1PK0D 1TOPA 5I2OA 3TUYC 1Q80A 1OMRA 1A75B 3NSLA 4JPZB 1EH2A 1OZSA 1CDMA 2LUCA 1NCXA 1DJZA 1U5IA 2H2KA 3I5IB 1XFYO 2ZNDA 4GGFC 1J7QA 2RGIA 2AUCA 1SBJA 1CM4A 1KFUS 2NXQA 3WNXB 1K9PA 1QV0A 1S6IA 2KQYA 1BLQA 3AKAA 3CGAA 4XJKB 2EGDA 5D69A 1A03A 1QX5B 4WQ3A 4DRWA 1DJIA 3TDIA 1ZOTB 1QX2A 2EHBA 2KFHA 1YRUB 3D10A 3ZNIA 4JQ0D 4N5XA 2K2FA 3OP0A 2LUXA 2Q4UA 3DVKA 3RM1A 1H4BA 2JT8A 2LMUA 1Y1XA 2M8UA 5HKYA 5DKNA 1KK7Y 4MN0A 4C0LA 1BT6A 1K9UA 1NP8A 2Y1MA 4N1FA 1SR6C 1UP5A 2OS8C 4FTGA 3O2PA 3OB1B 1XYDA 4DS7A 5I2QA 1WRZA 5K89A 1CMFA 1Y1UA 2F3YA 4CFRA 1D1OA 3TDZA 1TNPA 1KCYA 1ZACA 4QJ3B 1HT9A 1NX1A 1PRWA 1TTXA 3FWBA 3PATA 2KI6D 1SPYA 2JC2A 1SMGA 1IJ6A 4IL1A 1SL9A 2M49B 1S6JA 1UHKA 2CCMA 2KBMA 2KDHA 3PN7B 1QASA 2JTTA 2NZ0A 1FPWA 3QRXA 4I5LB 1NCZA 1DJWA 3VRNA
chains in the Genus database with same CATH superfamily
1PULA 1MXEA 1G4YR 1KQMB 1KSMA 4E68A 3TS5B 3BOWA 2MA2A 2JPTA 1QJTA 1QTXA 2KI4C 1TCFA 1A2XA 1OMVA 1YR5A 2L98A 2Y1NA 1BG1A 1EL4A 1B8CA 2GGZA 1NUBA 1X02A 1YX8A 2L0PA 2B1UA 1W7IB 3BYAA 2JULA 3CABA 3I5GC 2LMVA 1GGZA 1BJFA 1TNWA 5CPVA 1AP4A 3OBVA 4YGDB 4DIRA 1S5GY 3KHEA 4PT1A 2P71A 1SL7A 1QVIY 2MBXA 1L2OC 1CLLA 1SSEB 1ZFSA 2HQ8A 1J55A 2A4JA 1DMOA 1CDLA 1XO5A 1B8LA 1U5IB 1NCYA 4M2QA 3PN7C 3VRPA 1CDPA 3EK4A 4MVFA 3CZ0A 3SS3A 1CFPA 3CTNA 1AVSA 4JD9A 1XK4A 3EKHA 5G08A 2LCPA 4INXA 3UNWA 5HKWA 4P5OE 2E30A 5HKZA 1R6PA 5D7FA 2KI6C 5HYDA 2H8VA 3BXKA 3B88A 3EKJA 2WCJA 2EC6C 1IKUA 1PALA 3D77A 4A4BA 1KK7Z 4GAOA 2KNEA 4C0JA 1WRLA 3OX5A 2G9BA 2H61A 2KYCA 1UHNA 3CR5X 4GGNA 1DJGA 4PHNA 3SG4A 4GFTA 2JTZA 1UURA 1XFXO 2P6BB 2NCOA 1CMGA 1ODBA 1UWOA 2JT0A 2F3ZA 5GQQC 3RLZA 1SCVA 3VROA 1LINA 1QVIZ 2FJUB 3BUOB 1SY9A 1FI5A 2MHHA 4CFQA 1DF0B 3Q8IA 1Y0VH 2PSRA 1NX0A 1WLZA 2PMYA 2Y5IA 3BFAA 3SG6A 2TN4A 1OQPA 3LLEA 1ZMZA 1P28A 3OGNA 2BKHB 2HPSA 1J7PA 1ORGA 4N1GA 1J1DA 3D73A 4OZDA 3SJSA 1JWDA 5DKRA 1XVJA 3BFBA 4WQ2A 3JTDC 1F55A 2ZRTA 4OKHA 3D0YB 2BAPA 2KFGA 2LANA 2K7OA 3PSRA 3KEVA 2KI4B 2LLSA 1KWOC 2BCXA 1S36A 2EC6B 3GK2A 1C3ZA 2AAOA 3NSKA 1JF2A 2KYFA 2PYQA 1XFRA 3NSOA 2PRUA 1CLMA 3BOWB 3FE6A 2LHIA 2KSPA 4OR9B 1IQ5A 1MHOA 3I5HB 2HQWA 3S0GA 1T14A 2LHLA 3CS1A 3NGVA 4R1EA 1TNQA 1VRKA 2ZRSA 1C7VA 1S6CA 2L50A 1TNXA 4PE4A 1A29A 2WCLA 2VRGA 3PM8A 4QJ5B 2ZN8A 3FS7A 1JBAA 1OOHA 1UHIA 4M2OA 3TUYB 2NLNA 2BNXA 1DJXA 1PVBA 5KSZA 1FF1A 4GUKA 3E3RA 3LK1A 2PQLA 2WC8A 4PCWA 1Z4HA 4Q04A 3SG5A 3JVTC 2Q91A 2H61C 2LLTA 2IS9A 5I94A 4I5NB 2FCDA 4A4CA 1FW4A 2NCPA 2WCEA 1B7TY 3DY9A 3I5FC 2MJWB 4XYNA 3EG5B 1M31A 1W9ZA 5J3XA 3BFHA 3N7HA 1NX3A 1UUSA 2KOTA 4MSPA 3AAKA 2F8PA 1QLKA 2O5GA 2WCBA 2ZNEA 3BQ3A 3K1EA 1IGVA 1AJ4A 1N2DA 4GPLB 5KTYA 3S0EA 1JC2A 1F71A 1WDCB 1S26D 2WORA 2M1UA 2QEHA 5ER5A 2LVKA 1K93D 4ZCVA 1YUUA 3O6BA 5HLOA 1OZOA 4AQIA 1MQ1A 4KYNA 1B8RA 3K21A 1CB1A 1EG3A 2BCAA 3PALA 1LA0A 3D0YA 2BKIB 1KFXS 2F2OA 2CNPA 1AJ5A 1MWNA 2L4IA 3SIAA 1B9AA 3FIAA 4USLA 3ZWHA 2PALA 2SCPA 3DZTA 3EVRA 2QACA 1NPQA 2HF5A 3CDNA 2LE9B 2BE4A 2OTGC 1JUOA 2MLFC 1OW4A 4YGEB 1L7ZA 1GGWA 3S0FA 1B47A 1SRAA 2SASA 2BL0C 2GV5A 2KFFA 1IQ3A 5AFPA 2QPTA 3FWCA 2CTNA 4MEWA 2QEOA 1YUSA 4MZLA 2V53A 4YI9A 1LA3A 1CFDA 1TCOB 1YRTB 1YVLA 3LK0A 1S5GZ 2M9GA 5AERA 1CLBA 1HQVA 2G2BA 1F8HA 5CSIA 3A8RA 1N65A 2M0RA 1RECA 5FI7A 3PJIA 1BODA 1IRJA 5ER4X 2L5XB 2COLB 3R1OA 2LVIA 1DT7B 1AUIB 1QS7A 2LC5A 1CFCA 4M2PA 3CLNA 1YUTA 2ZFDA 3OB2B 1AK8A 2LLUA 4NQGA 1LS8A 3C1VA 3AAJA 1J1EA 1XFWO 3WHUB 4CPVA 4HRHA 3DVJA 2R2IA 2ISDA 1E8AA 1Y6WA 3EK7A 2E6WA 2F33A 2LAPA 2LNKA 2MRDA 3BUNB 3F45A 1KFUL 4QJ4B 3M0WA 2QEVA 2L5YA 3O4YA 3RZSA 3CR2A 1JF0A 5PALA 3GK4X 1DVIA 2M29A 1QLSA 4PE7A 1SCMC 1W7JB 4FQTA 4UPGA 1TUJA 4ETOA 1F70A 1AHRA 4JWQA 5HL1A 2WCFA 3SIBA 5CSJA 3KF9A 4C0KA 1KWOB 3CZTX 2WNDA 1GM0A 5D3OA 3NSIA 5KU1A 4MBEA 1MUXA 1XK4C 4AQJA 4MRYA 1F54A 1A75A 1BOCA 1KQVA 2JWWA 3HCMA 4MRXA 1YX7A 4HREE 4YGBB 1SR6B 5TNCA 4I5KA 1KK8B 3DYEA 1M46A 2ZN9A 3CR4X 1J7OA 3KPXA 1CFFA 1SYMA 2KAYA 2I2RE 1WDCC 4CIDA 2JQ6A 1OSAA 1XA5A 1LXFC 1LKJA 1WRKA 2LMTA 3KO0A 3L4LA 2I18A 3PM2A 4PE0A 1CKKA 2LVVA 3TS5C 2JXCA 3I5IC 1QWVA 4PHKA 1NIWA 1G33A 3JVTB 4ORBB 1OOIX 5I8NA 2K60A 2BECA 5CSNA 1B7TZ 1ZUZA 3EK8A 3BUXB 1OOGA 2QEBA 2M7LA 3B6XA 3D78A 1K90D 3H4SE 2JNXA 3GK1A 1IIOA 1YVHA 2KHNA 1EXRA 1K8UA 1XFUO 2ERBA 3R1PA 1C07A 1BR4B 1ALWA 1M63B 3WHTB 2JXLA 3TZ1A 4BY5A 3L47A 2I94A 2P70A 2YGUA 1NYAA 1SW8A 3DF0B 1RK9A 5JOLA 2KLDA 2KQ6A 2BBMA 1TIZA 4PHJA 5AEQA 1RTP1 1SL8A 1KFXL 3GOFA 4HSZA 2WOSA 1N0YA 4PDZA 2QDIA 1QIVA 2K7DA 1G8IA 1DGVA 4IJ7A 3VRRA 1DTLA 5BPJA 4ZCUA 5B8IB 5AANA 4XJKA 1JFKA 1K96A 2I7AA 5IBWA 1QIWA 1BMOA 2K2AA 2KPHA 3BUMB 3S0BA 2PASA 1GJYA 3BUWB 3UO9A 1IG5A 3EVUA 4D1EA 3CWGA 2BL0B 3EVVA 1OE9B 4YI8A 1C3YA 3B87A 1DEKA 1Y1AA 2MAZA 4L9MA 4PE1A 2LV7A 3DD4A 5CSFA 1F4QA 2WC6A 3NXAA 4BY4A 2K8MB 4GGFA 3SS5A 3I5HC 1DJYA 1PSRA 3OHMB 3SG7A 4GBAA 1K95A 3LL8B 2JZIA 3JTDB 1DGUA 1KSOA 1MR8A 1XFZO 5F6TA 5I2LA 4PHMA 4FQOA 1JSAA 1IJ5A 1PSBA 1F4OA 1L2OB 2L51A 2KLEA 1KQMC 2GGMA 4F0ZB 3D76A 2K0JA 1UHJA 1RWYA 3IQQA 2LM5A 5FYXA 2BBNA 2BE6A 1DF0A 3HX4A 1RFJA 1RROA 2CXJA 2OS8B 1S3PA 1OOJA 3FE9A 2LP3A 2CBLA 2M97A 2HETA 2LP2A 3DF0A 1TRFA 2CT9A 1LVCD 3DXLA 4MZKA 3I5GB 1EG4A 2K7CA 2MLEC 2M7NA 2OTGB 2L2CA 1WY9A 4JKTA 3D74A 4WRIA 1DJHA 1TWOA 3A4UB 4TNCA 2FOTA 1EJ3A 2ZKMX 3SG2A 3L4AA 1CTRA 4NDDA 1OOFA 1MF8B 4OVNF 1UHHA 4AOMA 1TN4A 2OPOA 4CLNA 5DKQA 3CZ2A 1GQMA 1M45A 2JOJA 3OX6A 2JRFA 3VRQA 1MXLC 2Y4QA 2LVJA 5FI2A 1BR1B 4P2YB 1FI6A 1SK6D 1CNPA 1CDNA 1J7RA 1FBVA 1K9KA 1KK8C 2KBIA 1SNLA 4NDBA 4OCIA 3PFVA 3TDUA 1BF5A 1IWQA 2KAXA 2M1KB 1YTZC 1B4CA 3D75A 3B7AA 1NX2A 1NSHA 1M39A 3ICBA 5HLVA 1IH0A 1QX7A 2JPOA 2L2EA 3VGOA 1CM1A 2L4HA 3AKBA 4U8DA 2PVBA 4OV2A 3SG3A 1A4PA 4YRUA 2D8NA 1DC1A 1V1FA 1C7WA 1XFVO 1YURA 1JFJA 2BCBA 4ORCB 2F2PA 1K2HA 1QXPA 3R72A 4DUQA 5JJGA 1OMDA 1QATA 2JU0A 3DVMA 4NDCA 4MLWA 1WLMA 2KAVA 1BU3A 2GTEA 2FCEA 1SCMB 4YGAA 2JNFA 3LCPC 2KGBC 3BJHA 1RJVA 4YBHB 1K94A 4DCKA 1H8BA 4PALA 1V1GA 2M3WA 3MSEB 3IF7A 3O4XA 4HRGA 1SKTA 3V2LA 2AMIA 2JT3A 2K7BA 2DOQA 1S1EA 2O60A 4MZJA 1Z2CB 1B1GA 2KGRA 3O78A 1PVAA 2K61A 1R2UA 5DICA 3WXAA 3S0AA 4ICBA 4ORAB 3PLFB 1QV1A 3IVTA 4GNKB 1ALVA 3DVEA 3I5FB 5AXIA 1NWDA 4YGCB 4I5JA 3IQOA 3NHIA 1PK0D 1TOPA 5I2OA 2WCHA 3TUYC 1Q80A 2WC5A 3NHTA 1OMRA 1A75B 3NSLA 4JPZB 4F7FA 1EH2A 1OZSA 1CDMA 2LUCA 1NCXA 1DJZA 1U5IA 2H2KA 3I5IB 1XFYO 2ZNDA 4GGFC 1J7QA 2RGIA 2AUCA 1TUZA 1SBJA 1CM4A 1KFUS 2NXQA 3WNXB 1K9PA 1QV0A 1S6IA 2KQYA 1BLQA 3AKAA 3CGAA 4XJKB 2EGDA 5D69A 1DQEA 1QX5B 4WQ3A 1A03A 3B86A 4DRWA 1DJIA 3S0DA 3TDIA 1ZOTB 1QX2A 2EHBA 3FE8A 4INWA 2KFHA 1YRUB 3D10A 3ZNIA 4JQ0D 4N5XA 2K2FA 3OP0A 2LUXA 2Q4UA 3DVKA 3RM1A 1H4BA 2JT8A 2LMUA 1Y1XA 2M8UA 5HKYA 5DKNA 1KK7Y 4MN0A 4C0LA 1BT6A 1K9UA 1NP8A 3R1VA 2Y1MA 4N1FA 1SR6C 1UP5A 2FJYA 2OS8C 4FTGA 3O2PA 3OB1B 1XYDA 4DS7A 5I2QA 1WRZA 5K89A 1CMFA 1Y1UA 2F3YA 3QMEA 3SS4A 4CFRA 1D1OA 3TDZA 3CZ1A 1TNPA 2WCMA 1KCYA 1ZACA 4QJ3B 1HT9A 1NX1A 1PRWA 1TTXA 3FWBA 3PATA 5EL2A 2KI6D 1SPYA 2JC2A 3VB1A 1SMGA 1IJ6A 4IL1A 1SL9A 2M49B 1S6JA 1UHKA 2CCMA 2KBMA 2KDHA 5FI6A 1DELA 3PN7B 1QASA 2JTTA 2NZ0A 1FPWA 3QRXA 4I5LB 1NCZA 3CYZA 2WCKA 1DJWA 3VRNA
chains in the Genus database with same CATH topology
1PULA 1MXEA 1G4YR 1KQMB 1KSMA 4E68A 3TS5B 3BOWA 2MA2A 2JPTA 1QJTA 1QTXA 2KI4C 1TCFA 1A2XA 1OMVA 1YR5A 2L98A 2Y1NA 1BG1A 1EL4A 1B8CA 2GGZA 1NUBA 1X02A 1YX8A 2L0PA 2B1UA 1W7IB 3BYAA 2JULA 3I5GC 2LMVA 1GGZA 1BJFA 1TNWA 5CPVA 1AP4A 4YGDB 4DIRA 1S5GY 3KHEA 1SL7A 1QVIY 2MBXA 1L2OC 1CLLA 1ZFSA 2HQ8A 1J55A 2A4JA 1DMOA 1CDLA 1XO5A 1B8LA 1U5IB 1NCYA 4M2QA 3PN7C 3VRPA 1CDPA 3EK4A 4MVFA 1CFPA 3CTNA 1AVSA 5G08A 1XK4A 3EKHA 2LCPA 5HKWA 4P5OE 2E30A 5HKZA 1R6PA 5D7FA 2KI6C 5HYDA 3BXKA 3EKJA 1IKUA 2EC6C 1PALA 4A4BA 1KK7Z 4GAOA 2KNEA 4C0JA 1WRLA 3OX5A 2G9BA 2H61A 2KYCA 1UHNA 3CR5X 4GGNA 1DJGA 4PHNA 3SG4A 4GFTA 2JTZA 1UURA 1XFXO 2P6BB 2NCOA 1CMGA 1ODBA 1UWOA 2JT0A 2F3ZA 5GQQC 3RLZA 1SCVA 3VROA 1LINA 1QVIZ 2FJUB 3BUOB 1SY9A 1FI5A 2MHHA 4CFQA 1DF0B 1Y0VH 2PSRA 1NX0A 1WLZA 2PMYA 2Y5IA 3SG6A 2TN4A 1OQPA 3LLEA 1ZMZA 2BKHB 2HPSA 1J7PA 4N1GA 1J1DA 3SJSA 1JWDA 5DKRA 1XVJA 4WQ2A 3JTDC 1F55A 2ZRTA 4OKHA 3D0YB 2KFGA 2LANA 2K7OA 3PSRA 3KEVA 2KI4B 2LLSA 1KWOC 1S36A 2BCXA 2EC6B 3GK2A 2AAOA 3NSKA 1JF2A 2KYFA 3NSOA 2PRUA 1CLMA 3BOWB 2LHIA 2KSPA 4OR9B 1IQ5A 1MHOA 3I5HB 2HQWA 2LHLA 3CS1A 4R1EA 1TNQA 1VRKA 2ZRSA 1C7VA 1S6CA 2L50A 1TNXA 4PE4A 1A29A 2VRGA 3PM8A 4QJ5B 2ZN8A 3FS7A 1JBAA 3TUYB 1UHIA 4M2OA 5KSZA 2NLNA 1FF1A 1DJXA 1PVBA 4GUKA 3E3RA 3LK1A 4PCWA 2WC8A 4Q04A 3SG5A 3JVTC 2Q91A 2H61C 2LLTA 2IS9A 4I5NB 2FCDA 4A4CA 1FW4A 2NCPA 2WCEA 1B7TY 3I5FC 2MJWB 4XYNA 1M31A 5J3XA 1NX3A 1UUSA 2KOTA 4MSPA 3AAKA 2F8PA 1QLKA 2O5GA 2WCBA 2ZNEA 3BQ3A 4GPLB 1IGVA 1AJ4A 1N2DA 5KTYA 1JC2A 1F71A 1WDCB 1S26D 2WORA 2M1UA 5ER5A 2LVKA 1K93D 4ZCVA 1YUUA 3O6BA 5HLOA 1OZOA 4AQIA 1MQ1A 1B8RA 3K21A 1CB1A 1EG3A 2BCAA 3PALA 1LA0A 3D0YA 2BKIB 1KFXS 2F2OA 2CNPA 1AJ5A 1MWNA 2L4IA 3SIAA 1B9AA 3FIAA 4USLA 3ZWHA 2PALA 2SCPA 3EVRA 2QACA 1NPQA 2HF5A 2LE9B 2BE4A 2OTGC 1JUOA 2MLFC 4YGEB 1L7ZA 1GGWA 1B47A 1SRAA 2SASA 2BL0C 2GV5A 2KFFA 1IQ3A 5AFPA 2QPTA 3FWCA 2CTNA 4MEWA 1YUSA 4MZLA 2V53A 4YI9A 1LA3A 1CFDA 1TCOB 1YRTB 1YVLA 3LK0A 1S5GZ 2M9GA 5AERA 1CLBA 1HQVA 2G2BA 1F8HA 5CSIA 3A8RA 1N65A 2M0RA 1RECA 1BODA 1IRJA 5ER4X 2L5XB 2COLB 2LVIA 1DT7B 1AUIB 1QS7A 2LC5A 1CFCA 4M2PA 3CLNA 1YUTA 2ZFDA 3OB2B 1AK8A 2LLUA 4NQGA 3C1VA 3AAJA 1J1EA 1XFWO 3WHUB 4CPVA 4HRHA 3DVJA 2R2IA 2ISDA 1E8AA 1Y6WA 3EK7A 2E6WA 2F33A 2LAPA 2LNKA 2MRDA 3BUNB 3F45A 1KFUL 4QJ4B 3M0WA 3O4YA 3CR2A 1JF0A 5PALA 3GK4X 1DVIA 2M29A 1QLSA 4PE7A 1SCMC 1W7JB 4UPGA 4ETOA 1F70A 1AHRA 4JWQA 2WCFA 3SIBA 5CSJA 3KF9A 4C0KA 1KWOB 3CZTX 2WNDA 3NSIA 5KU1A 4MBEA 1MUXA 1XK4C 4AQJA 4MRYA 1F54A 1A75A 1BOCA 1KQVA 2JWWA 3HCMA 4MRXA 1YX7A 4HREE 4YGBB 1SR6B 5TNCA 4I5KA 1KK8B 1M46A 2ZN9A 3CR4X 1J7OA 3KPXA 1CFFA 1SYMA 2KAYA 2I2RE 1WDCC 4CIDA 2JQ6A 1OSAA 1XA5A 1LXFC 1LKJA 1WRKA 2LMTA 3KO0A 2I18A 4PE0A 1CKKA 2LVVA 3TS5C 2JXCA 3I5IC 4PHKA 1NIWA 1G33A 3JVTB 4ORBB 5I8NA 2BECA 5CSNA 1B7TZ 1ZUZA 3EK8A 3BUXB 2M7LA 1K90D 3H4SE 2JNXA 3GK1A 1YVHA 2KHNA 1EXRA 1K8UA 1XFUO 1C07A 1BR4B 1ALWA 1M63B 3WHTB 2JXLA 3TZ1A 4BY5A 5JOLA 2I94A 1NYAA 1SW8A 3DF0B 1RK9A 4DCKA 2KQ6A 4PHJA 2BBMA 1TIZA 5AEQA 1RTP1 1SL8A 1KFXL 3GOFA 4HSZA 2WOSA 1N0YA 4PDZA 1QIVA 2K7DA 1G8IA 1DGVA 3VRRA 1DTLA 5BPJA 4ZCUA 5B8IB 5AANA 4XJKA 1JFKA 1K96A 2I7AA 5IBWA 1QIWA 1BMOA 2K2AA 3BUMB 2PASA 1GJYA 3BUWB 1IG5A 3EVUA 4D1EA 3CWGA 2BL0B 3EVVA 1OE9B 4YI8A 1Y1AA 2MAZA 4L9MA 4PE1A 2LV7A 3DD4A 5CSFA 1F4QA 3NXAA 4BY4A 2K8MB 4GGFA 3I5HC 1DJYA 1PSRA 3OHMB 3SG7A 4GBAA 1K95A 3LL8B 2JZIA 3JTDB 1DGUA 1KSOA 1MR8A 1XFZO 5F6TA 5I2LA 4PHMA 4FQOA 1JSAA 1IJ5A 1PSBA 1F4OA 1L2OB 2L51A 1KQMC 2GGMA 4F0ZB 2K0JA 1UHJA 1RWYA 3IQQA 2LM5A 5FYXA 2BBNA 2BE6A 1DF0A 3HX4A 1RFJA 1RROA 2CXJA 2OS8B 1S3PA 1OOJA 2LP3A 2CBLA 2M97A 2HETA 2LP2A 3DF0A 1TRFA 2CT9A 1LVCD 4MZKA 3I5GB 1EG4A 2K7CA 2MLEC 2M7NA 2OTGB 4WRIA 1WY9A 3VRQA 1DJHA 3A4UB 4TNCA 2FOTA 1EJ3A 2ZKMX 3SG2A 1CTRA 4NDDA 4OVNF 1MF8B 1UHHA 4AOMA 1TN4A 2OPOA 4CLNA 5DKQA 1GQMA 1M45A 2JOJA 3OX6A 2JRFA 1MXLC 2Y4QA 2LVJA 1BR1B 4P2YB 1FI6A 1SK6D 1CNPA 1CDNA 1J7RA 1FBVA 1K9KA 1KK8C 2KBIA 1SNLA 4NDBA 4OCIA 3PFVA 3TDUA 1BF5A 1IWQA 2KAXA 2M1KB 1YTZC 1B4CA 1NX2A 1NSHA 1M39A 3ICBA 5HLVA 1IH0A 1QX7A 2L2EA 3VGOA 1CM1A 2L4HA 3AKBA 4U8DA 2PVBA 4OV2A 3SG3A 1A4PA 4YRUA 2D8NA 1V1FA 1C7WA 1XFVO 1YURA 1JFJA 2BCBA 4ORCB 2F2PA 1K2HA 1QXPA 4DUQA 5JJGA 1OMDA 1QATA 2JU0A 3DVMA 4NDCA 4MLWA 1WLMA 2KAVA 1BU3A 2FCEA 1SCMB 4YGAA 2JNFA 3LCPC 2KGBC 1RJVA 4YBHB 1K94A 1H8BA 4PALA 1V1GA 2M3WA 3MSEB 3IF7A 4HRGA 1SKTA 2AMIA 2JT3A 2K7BA 2DOQA 1S1EA 2O60A 4MZJA 1B1GA 2KGRA 3O78A 1PVAA 2K61A 1R2UA 3WXAA 4ICBA 4ORAB 3PLFB 1QV1A 4GNKB 1ALVA 3DVEA 3I5FB 5AXIA 1NWDA 4YGCB 4I5JA 3IQOA 1PK0D 1TOPA 5I2OA 3TUYC 1Q80A 1OMRA 1A75B 3NSLA 4JPZB 1EH2A 1OZSA 1CDMA 2LUCA 1NCXA 1DJZA 1U5IA 2H2KA 3I5IB 1XFYO 2ZNDA 4GGFC 1J7QA 2RGIA 2AUCA 1SBJA 1CM4A 1KFUS 2NXQA 3WNXB 1K9PA 1QV0A 1S6IA 2KQYA 1BLQA 3AKAA 3CGAA 4XJKB 2EGDA 5D69A 1A03A 1QX5B 4WQ3A 4DRWA 1DJIA 3TDIA 1ZOTB 1QX2A 2EHBA 2KFHA 1YRUB 3D10A 3ZNIA 4JQ0D 4N5XA 2K2FA 3OP0A 2LUXA 2Q4UA 3DVKA 3RM1A 1H4BA 2JT8A 2LMUA 1Y1XA 2M8UA 5HKYA 5DKNA 1KK7Y 4MN0A 4C0LA 1BT6A 1K9UA 1NP8A 2Y1MA 4N1FA 1SR6C 1UP5A 2OS8C 4FTGA 3O2PA 3OB1B 1XYDA 4DS7A 5I2QA 1WRZA 5K89A 1CMFA 1Y1UA 2F3YA 4CFRA 1D1OA 3TDZA 1TNPA 1KCYA 1ZACA 4QJ3B 1HT9A 1NX1A 1PRWA 1TTXA 3FWBA 3PATA 2KI6D 1SPYA 2JC2A 1SMGA 1IJ6A 4IL1A 1SL9A 2M49B 1S6JA 1UHKA 2CCMA 2KBMA 2KDHA 3PN7B 1QASA 2JTTA 2NZ0A 1FPWA 3QRXA 4I5LB 1NCZA 1DJWA 3VRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PUL A;  1MXE A;  1G4Y R;  1KQM B;  1KSM A;  4E68 A;  3TS5 B;  3BOW A;  2MA2 A;  2JPT A;  1QJT A;  1QTX A;  2KI4 C;  1TCF A;  1A2X A;  1OMV A;  1YR5 A;  2L98 A;  2Y1N A;  1BG1 A;  1EL4 A;  1B8C A;  2GGZ A;  1NUB A;  1X02 A;  1YX8 A;  2L0P A;  2B1U A;  1W7I B;  3BYA A;  2JUL A;  3I5G C;  2LMV A;  1GGZ A;  1BJF A;  1TNW A;  5CPV A;  1AP4 A;  4YGD B;  4DIR A;  1S5G Y;  3KHE A;  1SL7 A;  1QVI Y;  2MBX A;  1L2O C;  1CLL A;  1ZFS A;  2HQ8 A;  1J55 A;  2A4J A;  1DMO A;  1CDL A;  1XO5 A;  1B8L A;  1U5I B;  1NCY A;  4M2Q A;  3PN7 C;  3VRP A;  1CDP A;  3EK4 A;  4MVF A;  1CFP A;  3CTN A;  1AVS A;  5G08 A;  1XK4 A;  3EKH A;  2LCP A;  5HKW A;  4P5O E;  2E30 A;  5HKZ A;  1R6P A;  5D7F A;  2KI6 C;  5HYD A;  3BXK A;  3EKJ A;  1IKU A;  2EC6 C;  1PAL A;  4A4B A;  1KK7 Z;  4GAO A;  2KNE A;  4C0J A;  1WRL A;  3OX5 A;  2G9B A;  2H61 A;  2KYC A;  1UHN A;  3CR5 X;  4GGN A;  1DJG A;  4PHN A;  3SG4 A;  4GFT A;  2JTZ A;  1UUR A;  1XFX O;  2P6B B;  2NCO A;  1CMG A;  1ODB A;  1UWO A;  2JT0 A;  2F3Z A;  5GQQ C;  3RLZ A;  1SCV A;  3VRO A;  1LIN A;  1QVI Z;  2FJU B;  3BUO B;  1SY9 A;  1FI5 A;  2MHH A;  4CFQ A;  1DF0 B;  1Y0V H;  2PSR A;  1NX0 A;  1WLZ A;  2PMY A;  2Y5I A;  3SG6 A;  2TN4 A;  1OQP A;  3LLE A;  1ZMZ A;  2BKH B;  2HPS A;  1J7P A;  4N1G A;  1J1D A;  3SJS A;  1JWD A;  5DKR A;  1XVJ A;  4WQ2 A;  3JTD C;  1F55 A;  2ZRT A;  4OKH A;  3D0Y B;  2KFG A;  2LAN A;  2K7O A;  3PSR A;  3KEV A;  2KI4 B;  2LLS A;  1KWO C;  1S36 A;  2BCX A;  2EC6 B;  3GK2 A;  2AAO A;  3NSK A;  1JF2 A;  2KYF A;  3NSO A;  2PRU A;  1CLM A;  3BOW B;  2LHI A;  2KSP A;  4OR9 B;  1IQ5 A;  1MHO A;  3I5H B;  2HQW A;  2LHL A;  3CS1 A;  4R1E A;  1TNQ A;  1VRK A;  2ZRS A;  1C7V A;  1S6C A;  2L50 A;  1TNX A;  4PE4 A;  1A29 A;  2VRG A;  3PM8 A;  4QJ5 B;  2ZN8 A;  3FS7 A;  1JBA A;  3TUY B;  1UHI A;  4M2O A;  5KSZ A;  2NLN A;  1FF1 A;  1DJX A;  1PVB A;  4GUK A;  3E3R A;  3LK1 A;  4PCW A;  2WC8 A;  4Q04 A;  3SG5 A;  3JVT C;  2Q91 A;  2H61 C;  2LLT A;  2IS9 A;  4I5N B;  2FCD A;  4A4C A;  1FW4 A;  2NCP A;  2WCE A;  1B7T Y;  3I5F C;  2MJW B;  4XYN A;  1M31 A;  5J3X A;  1NX3 A;  1UUS A;  2KOT A;  4MSP A;  3AAK A;  2F8P A;  1QLK A;  2O5G A;  2WCB A;  2ZNE A;  3BQ3 A;  4GPL B;  1IGV A;  1AJ4 A;  1N2D A;  5KTY A;  1JC2 A;  1F71 A;  1WDC B;  1S26 D;  2WOR A;  2M1U A;  5ER5 A;  2LVK A;  1K93 D;  4ZCV A;  1YUU A;  3O6B A;  5HLO A;  1OZO A;  4AQI A;  1MQ1 A;  1B8R A;  3K21 A;  1CB1 A;  1EG3 A;  2BCA A;  3PAL A;  1LA0 A;  3D0Y A;  2BKI B;  1KFX S;  2F2O A;  2CNP A;  1AJ5 A;  1MWN A;  2L4I A;  3SIA A;  1B9A A;  3FIA A;  4USL A;  3ZWH A;  2PAL A;  2SCP A;  3EVR A;  2QAC A;  1NPQ A;  2HF5 A;  2LE9 B;  2BE4 A;  2OTG C;  1JUO A;  2MLF C;  4YGE B;  1L7Z A;  1GGW A;  1B47 A;  1SRA A;  2SAS A;  2BL0 C;  2GV5 A;  2KFF A;  1IQ3 A;  5AFP A;  2QPT A;  3FWC A;  2CTN A;  4MEW A;  1YUS A;  4MZL A;  2V53 A;  4YI9 A;  1LA3 A;  1CFD A;  1TCO B;  1YRT B;  1YVL A;  3LK0 A;  1S5G Z;  2M9G A;  5AER A;  1CLB A;  1HQV A;  2G2B A;  1F8H A;  5CSI A;  3A8R A;  1N65 A;  2M0R A;  1REC A;  1BOD A;  1IRJ A;  5ER4 X;  2L5X B;  2COL B;  2LVI A;  1DT7 B;  1AUI B;  1QS7 A;  2LC5 A;  1CFC A;  4M2P A;  3CLN A;  1YUT A;  2ZFD A;  3OB2 B;  1AK8 A;  2LLU A;  4NQG A;  3C1V A;  3AAJ A;  1J1E A;  1XFW O;  3WHU B;  4CPV A;  4HRH A;  3DVJ A;  2R2I A;  2ISD A;  1E8A A;  1Y6W A;  3EK7 A;  2E6W A;  2F33 A;  2LAP A;  2LNK A;  2MRD A;  3BUN B;  3F45 A;  1KFU L;  4QJ4 B;  3M0W A;  3O4Y A;  3CR2 A;  1JF0 A;  5PAL A;  3GK4 X;  1DVI A;  2M29 A;  1QLS A;  4PE7 A;  1SCM C;  1W7J B;  4UPG A;  4ETO A;  1F70 A;  1AHR A;  4JWQ A;  2WCF A;  3SIB A;  5CSJ A;  3KF9 A;  4C0K A;  1KWO B;  3CZT X;  2WND A;  3NSI A;  5KU1 A;  4MBE A;  1MUX A;  1XK4 C;  4AQJ A;  4MRY A;  1F54 A;  1A75 A;  1BOC A;  1KQV A;  2JWW A;  3HCM A;  4MRX A;  1YX7 A;  4HRE E;  4YGB B;  1SR6 B;  5TNC A;  4I5K A;  1KK8 B;  1M46 A;  2ZN9 A;  3CR4 X;  1J7O A;  3KPX A;  1CFF A;  1SYM A;  2KAY A;  2I2R E;  1WDC C;  4CID A;  2JQ6 A;  1OSA A;  1XA5 A;  1LXF C;  1LKJ A;  1WRK A;  2LMT A;  3KO0 A;  2I18 A;  4PE0 A;  1CKK A;  2LVV A;  3TS5 C;  2JXC A;  3I5I C;  4PHK A;  1NIW A;  1G33 A;  3JVT B;  4ORB B;  5I8N A;  2BEC A;  5CSN A;  1B7T Z;  1ZUZ A;  3EK8 A;  3BUX B;  2M7L A;  1K90 D;  3H4S E;  2JNX A;  3GK1 A;  1YVH A;  2KHN A;  1EXR A;  1K8U A;  1XFU O;  1C07 A;  1BR4 B;  1ALW A;  1M63 B;  3WHT B;  2JXL A;  3TZ1 A;  4BY5 A;  5JOL A;  2I94 A;  1NYA A;  1SW8 A;  3DF0 B;  1RK9 A;  4DCK A;  2KQ6 A;  4PHJ A;  2BBM A;  1TIZ A;  5AEQ A;  1RTP 1;  1SL8 A;  1KFX L;  3GOF A;  4HSZ A;  2WOS A;  1N0Y A;  4PDZ A;  1QIV A;  2K7D A;  1G8I A;  1DGV A;  3VRR A;  1DTL A;  5BPJ A;  4ZCU A;  5B8I B;  5AAN A;  4XJK A;  1JFK A;  1K96 A;  2I7A A;  5IBW A;  1QIW A;  1BMO A;  2K2A A;  3BUM B;  2PAS A;  1GJY A;  3BUW B;  1IG5 A;  3EVU A;  4D1E A;  3CWG A;  2BL0 B;  3EVV A;  1OE9 B;  4YI8 A;  1Y1A A;  2MAZ A;  4L9M A;  4PE1 A;  2LV7 A;  3DD4 A;  5CSF A;  1F4Q A;  3NXA A;  4BY4 A;  2K8M B;  4GGF A;  3I5H C;  1DJY A;  1PSR A;  3OHM B;  3SG7 A;  4GBA A;  1K95 A;  3LL8 B;  2JZI A;  3JTD B;  1DGU A;  1KSO A;  1MR8 A;  1XFZ O;  5F6T A;  5I2L A;  4PHM A;  4FQO A;  1JSA A;  1IJ5 A;  1PSB A;  1F4O A;  1L2O B;  2L51 A;  1KQM C;  2GGM A;  4F0Z B;  2K0J A;  1UHJ A;  1RWY A;  3IQQ A;  2LM5 A;  5FYX A;  2BBN A;  2BE6 A;  1DF0 A;  3HX4 A;  1RFJ A;  1RRO A;  2CXJ A;  2OS8 B;  1S3P A;  1OOJ A;  2LP3 A;  2CBL A;  2M97 A;  2HET A;  2LP2 A;  3DF0 A;  1TRF A;  2CT9 A;  1LVC D;  4MZK A;  3I5G B;  1EG4 A;  2K7C A;  2MLE C;  2M7N A;  2OTG B;  4WRI A;  1WY9 A;  3VRQ A;  1DJH A;  3A4U B;  4TNC A;  2FOT A;  1EJ3 A;  2ZKM X;  3SG2 A;  1CTR A;  4NDD A;  4OVN F;  1MF8 B;  1UHH A;  4AOM A;  1TN4 A;  2OPO A;  4CLN A;  5DKQ A;  1GQM A;  1M45 A;  2JOJ A;  3OX6 A;  2JRF A;  1MXL C;  2Y4Q A;  2LVJ A;  1BR1 B;  4P2Y B;  1FI6 A;  1SK6 D;  1CNP A;  1CDN A;  1J7R A;  1FBV A;  1K9K A;  1KK8 C;  2KBI A;  1SNL A;  4NDB A;  4OCI A;  3PFV A;  3TDU A;  1BF5 A;  1IWQ A;  2KAX A;  2M1K B;  1YTZ C;  1B4C A;  1NX2 A;  1NSH A;  1M39 A;  3ICB A;  5HLV A;  1IH0 A;  1QX7 A;  2L2E A;  3VGO A;  1CM1 A;  2L4H A;  3AKB A;  4U8D A;  2PVB A;  4OV2 A;  3SG3 A;  1A4P A;  4YRU A;  2D8N A;  1V1F A;  1C7W A;  1XFV O;  1YUR A;  1JFJ A;  2BCB A;  4ORC B;  2F2P A;  1K2H A;  1QXP A;  4DUQ A;  5JJG A;  1OMD A;  1QAT A;  2JU0 A;  3DVM A;  4NDC A;  4MLW A;  1WLM A;  2KAV A;  1BU3 A;  2FCE A;  1SCM B;  4YGA A;  2JNF A;  3LCP C;  2KGB C;  1RJV A;  4YBH B;  1K94 A;  1H8B A;  4PAL A;  1V1G A;  2M3W A;  3MSE B;  3IF7 A;  4HRG A;  1SKT A;  2AMI A;  2JT3 A;  2K7B A;  2DOQ A;  1S1E A;  2O60 A;  4MZJ A;  1B1G A;  2KGR A;  3O78 A;  1PVA A;  2K61 A;  1R2U A;  3WXA A;  4ICB A;  4ORA B;  3PLF B;  1QV1 A;  4GNK B;  1ALV A;  3DVE A;  3I5F B;  5AXI A;  1NWD A;  4YGC B;  4I5J A;  3IQO A;  1PK0 D;  1TOP A;  5I2O A;  3TUY C;  1Q80 A;  1OMR A;  1A75 B;  3NSL A;  4JPZ B;  1EH2 A;  1OZS A;  1CDM A;  2LUC A;  1NCX A;  1DJZ A;  1U5I A;  2H2K A;  3I5I B;  1XFY O;  2ZND A;  4GGF C;  1J7Q A;  2RGI A;  2AUC A;  1SBJ A;  1CM4 A;  1KFU S;  2NXQ A;  3WNX B;  1K9P A;  1QV0 A;  1S6I A;  2KQY A;  1BLQ A;  3AKA A;  3CGA A;  4XJK B;  2EGD A;  5D69 A;  1A03 A;  1QX5 B;  4WQ3 A;  4DRW A;  1DJI A;  3TDI A;  1ZOT B;  1QX2 A;  2EHB A;  2KFH A;  1YRU B;  3D10 A;  3ZNI A;  4JQ0 D;  4N5X A;  2K2F A;  3OP0 A;  2LUX A;  2Q4U A;  3DVK A;  3RM1 A;  1H4B A;  2JT8 A;  2LMU A;  1Y1X A;  2M8U A;  5HKY A;  5DKN A;  1KK7 Y;  4MN0 A;  4C0L A;  1BT6 A;  1K9U A;  1NP8 A;  2Y1M A;  4N1F A;  1SR6 C;  1UP5 A;  2OS8 C;  4FTG A;  3O2P A;  3OB1 B;  1XYD A;  4DS7 A;  5I2Q A;  1WRZ A;  5K89 A;  1CMF A;  1Y1U A;  2F3Y A;  4CFR A;  1D1O A;  3TDZ A;  1TNP A;  1KCY A;  1ZAC A;  4QJ3 B;  1HT9 A;  1NX1 A;  1PRW A;  1TTX A;  3FWB A;  3PAT A;  2KI6 D;  1SPY A;  2JC2 A;  1SMG A;  1IJ6 A;  4IL1 A;  1SL9 A;  2M49 B;  1S6J A;  1UHK A;  2CCM A;  2KBM A;  2KDH A;  3PN7 B;  1QAS A;  2JTT A;  2NZ0 A;  1FPW A;  3QRX A;  4I5L B;  1NCZ A;  1DJW A;  3VRN A; 
#chains in the Genus database with same CATH topology
 1PUL A;  1MXE A;  1G4Y R;  1KQM B;  1KSM A;  4E68 A;  3TS5 B;  3BOW A;  2MA2 A;  2JPT A;  1QJT A;  1QTX A;  2KI4 C;  1TCF A;  1A2X A;  1OMV A;  1YR5 A;  2L98 A;  2Y1N A;  1BG1 A;  1EL4 A;  1B8C A;  2GGZ A;  1NUB A;  1X02 A;  1YX8 A;  2L0P A;  2B1U A;  1W7I B;  3BYA A;  2JUL A;  3CAB A;  3I5G C;  2LMV A;  1GGZ A;  1BJF A;  1TNW A;  5CPV A;  1AP4 A;  3OBV A;  4YGD B;  4DIR A;  1S5G Y;  3KHE A;  4PT1 A;  2P71 A;  1SL7 A;  1QVI Y;  2MBX A;  1L2O C;  1CLL A;  1SSE B;  1ZFS A;  2HQ8 A;  1J55 A;  2A4J A;  1DMO A;  1CDL A;  1XO5 A;  1B8L A;  1U5I B;  1NCY A;  4M2Q A;  3PN7 C;  3VRP A;  1CDP A;  3EK4 A;  4MVF A;  3CZ0 A;  3SS3 A;  1CFP A;  3CTN A;  1AVS A;  4JD9 A;  1XK4 A;  3EKH A;  5G08 A;  2LCP A;  4INX A;  3UNW A;  5HKW A;  4P5O E;  2E30 A;  5HKZ A;  1R6P A;  5D7F A;  2KI6 C;  5HYD A;  2H8V A;  3BXK A;  3B88 A;  3EKJ A;  2WCJ A;  2EC6 C;  1IKU A;  1PAL A;  3D77 A;  4A4B A;  1KK7 Z;  4GAO A;  2KNE A;  4C0J A;  1WRL A;  3OX5 A;  2G9B A;  2H61 A;  2KYC A;  1UHN A;  3CR5 X;  4GGN A;  1DJG A;  4PHN A;  3SG4 A;  4GFT A;  2JTZ A;  1UUR A;  1XFX O;  2P6B B;  2NCO A;  1CMG A;  1ODB A;  1UWO A;  2JT0 A;  2F3Z A;  5GQQ C;  3RLZ A;  1SCV A;  3VRO A;  1LIN A;  1QVI Z;  2FJU B;  3BUO B;  1SY9 A;  1FI5 A;  2MHH A;  4CFQ A;  1DF0 B;  3Q8I A;  1Y0V H;  2PSR A;  1NX0 A;  1WLZ A;  2PMY A;  2Y5I A;  3BFA A;  3SG6 A;  2TN4 A;  1OQP A;  3LLE A;  1ZMZ A;  1P28 A;  3OGN A;  2BKH B;  2HPS A;  1J7P A;  1ORG A;  4N1G A;  1J1D A;  3D73 A;  4OZD A;  3SJS A;  1JWD A;  5DKR A;  1XVJ A;  3BFB A;  4WQ2 A;  3JTD C;  1F55 A;  2ZRT A;  4OKH A;  3D0Y B;  2BAP A;  2KFG A;  2LAN A;  2K7O A;  3PSR A;  3KEV A;  2KI4 B;  2LLS A;  1KWO C;  2BCX A;  1S36 A;  2EC6 B;  3GK2 A;  1C3Z A;  2AAO A;  3NSK A;  1JF2 A;  2KYF A;  2PYQ A;  1XFR A;  3NSO A;  2PRU A;  1CLM A;  3BOW B;  3FE6 A;  2LHI A;  2KSP A;  4OR9 B;  1IQ5 A;  1MHO A;  3I5H B;  2HQW A;  3S0G A;  1T14 A;  2LHL A;  3CS1 A;  3NGV A;  4R1E A;  1TNQ A;  1VRK A;  2ZRS A;  1C7V A;  1S6C A;  2L50 A;  1TNX A;  4PE4 A;  1A29 A;  2WCL A;  2VRG A;  3PM8 A;  4QJ5 B;  2ZN8 A;  3FS7 A;  1JBA A;  1OOH A;  1UHI A;  4M2O A;  3TUY B;  2NLN A;  2BNX A;  1DJX A;  1PVB A;  5KSZ A;  1FF1 A;  4GUK A;  3E3R A;  3LK1 A;  2PQL A;  2WC8 A;  4PCW A;  1Z4H A;  4Q04 A;  3SG5 A;  3JVT C;  2Q91 A;  2H61 C;  2LLT A;  2IS9 A;  5I94 A;  4I5N B;  2FCD A;  4A4C A;  1FW4 A;  2NCP A;  2WCE A;  1B7T Y;  3DY9 A;  3I5F C;  2MJW B;  4XYN A;  3EG5 B;  1M31 A;  1W9Z A;  5J3X A;  3BFH A;  3N7H A;  1NX3 A;  1UUS A;  2KOT A;  4MSP A;  3AAK A;  2F8P A;  1QLK A;  2O5G A;  2WCB A;  2ZNE A;  3BQ3 A;  3K1E A;  1IGV A;  1AJ4 A;  1N2D A;  4GPL B;  5KTY A;  3S0E A;  1JC2 A;  1F71 A;  1WDC B;  1S26 D;  2WOR A;  2M1U A;  2QEH A;  5ER5 A;  2LVK A;  1K93 D;  4ZCV A;  1YUU A;  3O6B A;  5HLO A;  1OZO A;  4AQI A;  1MQ1 A;  4KYN A;  1B8R A;  3K21 A;  1CB1 A;  1EG3 A;  2BCA A;  3PAL A;  1LA0 A;  3D0Y A;  2BKI B;  1KFX S;  2F2O A;  2CNP A;  1AJ5 A;  1MWN A;  2L4I A;  3SIA A;  1B9A A;  3FIA A;  4USL A;  3ZWH A;  2PAL A;  2SCP A;  3DZT A;  3EVR A;  2QAC A;  1NPQ A;  2HF5 A;  3CDN A;  2LE9 B;  2BE4 A;  2OTG C;  1JUO A;  2MLF C;  1OW4 A;  4YGE B;  1L7Z A;  1GGW A;  3S0F A;  1B47 A;  1SRA A;  2SAS A;  2BL0 C;  2GV5 A;  2KFF A;  1IQ3 A;  5AFP A;  2QPT A;  3FWC A;  2CTN A;  4MEW A;  2QEO A;  1YUS A;  4MZL A;  2V53 A;  4YI9 A;  1LA3 A;  1CFD A;  1TCO B;  1YRT B;  1YVL A;  3LK0 A;  1S5G Z;  2M9G A;  5AER A;  1CLB A;  1HQV A;  2G2B A;  1F8H A;  5CSI A;  3A8R A;  1N65 A;  2M0R A;  1REC A;  5FI7 A;  3PJI A;  1BOD A;  1IRJ A;  5ER4 X;  2L5X B;  2COL B;  3R1O A;  2LVI A;  1DT7 B;  1AUI B;  1QS7 A;  2LC5 A;  1CFC A;  4M2P A;  3CLN A;  1YUT A;  2ZFD A;  3OB2 B;  1AK8 A;  2LLU A;  4NQG A;  1LS8 A;  3C1V A;  3AAJ A;  1J1E A;  1XFW O;  3WHU B;  4CPV A;  4HRH A;  3DVJ A;  2R2I A;  2ISD A;  1E8A A;  1Y6W A;  3EK7 A;  2E6W A;  2F33 A;  2LAP A;  2LNK A;  2MRD A;  3BUN B;  3F45 A;  1KFU L;  4QJ4 B;  3M0W A;  2QEV A;  2L5Y A;  3O4Y A;  3RZS A;  3CR2 A;  1JF0 A;  5PAL A;  3GK4 X;  1DVI A;  2M29 A;  1QLS A;  4PE7 A;  1SCM C;  1W7J B;  4FQT A;  4UPG A;  1TUJ A;  4ETO A;  1F70 A;  1AHR A;  4JWQ A;  5HL1 A;  2WCF A;  3SIB A;  5CSJ A;  3KF9 A;  4C0K A;  1KWO B;  3CZT X;  2WND A;  1GM0 A;  5D3O A;  3NSI A;  5KU1 A;  4MBE A;  1MUX A;  1XK4 C;  4AQJ A;  4MRY A;  1F54 A;  1A75 A;  1BOC A;  1KQV A;  2JWW A;  3HCM A;  4MRX A;  1YX7 A;  4HRE E;  4YGB B;  1SR6 B;  5TNC A;  4I5K A;  1KK8 B;  3DYE A;  1M46 A;  2ZN9 A;  3CR4 X;  1J7O A;  3KPX A;  1CFF A;  1SYM A;  2KAY A;  2I2R E;  1WDC C;  4CID A;  2JQ6 A;  1OSA A;  1XA5 A;  1LXF C;  1LKJ A;  1WRK A;  2LMT A;  3KO0 A;  3L4L A;  2I18 A;  3PM2 A;  4PE0 A;  1CKK A;  2LVV A;  3TS5 C;  2JXC A;  3I5I C;  1QWV A;  4PHK A;  1NIW A;  1G33 A;  3JVT B;  4ORB B;  1OOI X;  5I8N A;  2K60 A;  2BEC A;  5CSN A;  1B7T Z;  1ZUZ A;  3EK8 A;  3BUX B;  1OOG A;  2QEB A;  2M7L A;  3B6X A;  3D78 A;  1K90 D;  3H4S E;  2JNX A;  3GK1 A;  1IIO A;  1YVH A;  2KHN A;  1EXR A;  1K8U A;  1XFU O;  2ERB A;  3R1P A;  1C07 A;  1BR4 B;  1ALW A;  1M63 B;  3WHT B;  2JXL A;  3TZ1 A;  4BY5 A;  3L47 A;  2I94 A;  2P70 A;  2YGU A;  1NYA A;  1SW8 A;  3DF0 B;  1RK9 A;  5JOL A;  2KLD A;  2KQ6 A;  2BBM A;  1TIZ A;  4PHJ A;  5AEQ A;  1RTP 1;  1SL8 A;  1KFX L;  3GOF A;  4HSZ A;  2WOS A;  1N0Y A;  4PDZ A;  2QDI A;  1QIV A;  2K7D A;  1G8I A;  1DGV A;  4IJ7 A;  3VRR A;  1DTL A;  5BPJ A;  4ZCU A;  5B8I B;  5AAN A;  4XJK A;  1JFK A;  1K96 A;  2I7A A;  5IBW A;  1QIW A;  1BMO A;  2K2A A;  2KPH A;  3BUM B;  3S0B A;  2PAS A;  1GJY A;  3BUW B;  3UO9 A;  1IG5 A;  3EVU A;  4D1E A;  3CWG A;  2BL0 B;  3EVV A;  1OE9 B;  4YI8 A;  1C3Y A;  3B87 A;  1DEK A;  1Y1A A;  2MAZ A;  4L9M A;  4PE1 A;  2LV7 A;  3DD4 A;  5CSF A;  1F4Q A;  2WC6 A;  3NXA A;  4BY4 A;  2K8M B;  4GGF A;  3SS5 A;  3I5H C;  1DJY A;  1PSR A;  3OHM B;  3SG7 A;  4GBA A;  1K95 A;  3LL8 B;  2JZI A;  3JTD B;  1DGU A;  1KSO A;  1MR8 A;  1XFZ O;  5F6T A;  5I2L A;  4PHM A;  4FQO A;  1JSA A;  1IJ5 A;  1PSB A;  1F4O A;  1L2O B;  2L51 A;  2KLE A;  1KQM C;  2GGM A;  4F0Z B;  3D76 A;  2K0J A;  1UHJ A;  1RWY A;  3IQQ A;  2LM5 A;  5FYX A;  2BBN A;  2BE6 A;  1DF0 A;  3HX4 A;  1RFJ A;  1RRO A;  2CXJ A;  2OS8 B;  1S3P A;  1OOJ A;  3FE9 A;  2LP3 A;  2CBL A;  2M97 A;  2HET A;  2LP2 A;  3DF0 A;  1TRF A;  2CT9 A;  1LVC D;  3DXL A;  4MZK A;  3I5G B;  1EG4 A;  2K7C A;  2MLE C;  2M7N A;  2OTG B;  2L2C A;  1WY9 A;  4JKT A;  3D74 A;  4WRI A;  1DJH A;  1TWO A;  3A4U B;  4TNC A;  2FOT A;  1EJ3 A;  2ZKM X;  3SG2 A;  3L4A A;  1CTR A;  4NDD A;  1OOF A;  1MF8 B;  4OVN F;  1UHH A;  4AOM A;  1TN4 A;  2OPO A;  4CLN A;  5DKQ A;  3CZ2 A;  1GQM A;  1M45 A;  2JOJ A;  3OX6 A;  2JRF A;  3VRQ A;  1MXL C;  2Y4Q A;  2LVJ A;  5FI2 A;  1BR1 B;  4P2Y B;  1FI6 A;  1SK6 D;  1CNP A;  1CDN A;  1J7R A;  1FBV A;  1K9K A;  1KK8 C;  2KBI A;  1SNL A;  4NDB A;  4OCI A;  3PFV A;  3TDU A;  1BF5 A;  1IWQ A;  2KAX A;  2M1K B;  1YTZ C;  1B4C A;  3D75 A;  3B7A A;  1NX2 A;  1NSH A;  1M39 A;  3ICB A;  5HLV A;  1IH0 A;  1QX7 A;  2JPO A;  2L2E A;  3VGO A;  1CM1 A;  2L4H A;  3AKB A;  4U8D A;  2PVB A;  4OV2 A;  3SG3 A;  1A4P A;  4YRU A;  2D8N A;  1DC1 A;  1V1F A;  1C7W A;  1XFV O;  1YUR A;  1JFJ A;  2BCB A;  4ORC B;  2F2P A;  1K2H A;  1QXP A;  3R72 A;  4DUQ A;  5JJG A;  1OMD A;  1QAT A;  2JU0 A;  3DVM A;  4NDC A;  4MLW A;  1WLM A;  2KAV A;  1BU3 A;  2GTE A;  2FCE A;  1SCM B;  4YGA A;  2JNF A;  3LCP C;  2KGB C;  3BJH A;  1RJV A;  4YBH B;  1K94 A;  4DCK A;  1H8B A;  4PAL A;  1V1G A;  2M3W A;  3MSE B;  3IF7 A;  3O4X A;  4HRG A;  1SKT A;  3V2L A;  2AMI A;  2JT3 A;  2K7B A;  2DOQ A;  1S1E A;  2O60 A;  4MZJ A;  1Z2C B;  1B1G A;  2KGR A;  3O78 A;  1PVA A;  2K61 A;  1R2U A;  5DIC A;  3WXA A;  3S0A A;  4ICB A;  4ORA B;  3PLF B;  1QV1 A;  3IVT A;  4GNK B;  1ALV A;  3DVE A;  3I5F B;  5AXI A;  1NWD A;  4YGC B;  4I5J A;  3IQO A;  3NHI A;  1PK0 D;  1TOP A;  5I2O A;  2WCH A;  3TUY C;  1Q80 A;  2WC5 A;  3NHT A;  1OMR A;  1A75 B;  3NSL A;  4JPZ B;  4F7F A;  1EH2 A;  1OZS A;  1CDM A;  2LUC A;  1NCX A;  1DJZ A;  1U5I A;  2H2K A;  3I5I B;  1XFY O;  2ZND A;  4GGF C;  1J7Q A;  2RGI A;  2AUC A;  1TUZ A;  1SBJ A;  1CM4 A;  1KFU S;  2NXQ A;  3WNX B;  1K9P A;  1QV0 A;  1S6I A;  2KQY A;  1BLQ A;  3AKA A;  3CGA A;  4XJK B;  2EGD A;  5D69 A;  1DQE A;  1QX5 B;  4WQ3 A;  1A03 A;  3B86 A;  4DRW A;  1DJI A;  3S0D A;  3TDI A;  1ZOT B;  1QX2 A;  2EHB A;  3FE8 A;  4INW A;  2KFH A;  1YRU B;  3D10 A;  3ZNI A;  4JQ0 D;  4N5X A;  2K2F A;  3OP0 A;  2LUX A;  2Q4U A;  3DVK A;  3RM1 A;  1H4B A;  2JT8 A;  2LMU A;  1Y1X A;  2M8U A;  5HKY A;  5DKN A;  1KK7 Y;  4MN0 A;  4C0L A;  1BT6 A;  1K9U A;  1NP8 A;  3R1V A;  2Y1M A;  4N1F A;  1SR6 C;  1UP5 A;  2FJY A;  2OS8 C;  4FTG A;  3O2P A;  3OB1 B;  1XYD A;  4DS7 A;  5I2Q A;  1WRZ A;  5K89 A;  1CMF A;  1Y1U A;  2F3Y A;  3QME A;  3SS4 A;  4CFR A;  1D1O A;  3TDZ A;  3CZ1 A;  1TNP A;  2WCM A;  1KCY A;  1ZAC A;  4QJ3 B;  1HT9 A;  1NX1 A;  1PRW A;  1TTX A;  3FWB A;  3PAT A;  5EL2 A;  2KI6 D;  1SPY A;  2JC2 A;  3VB1 A;  1SMG A;  1IJ6 A;  4IL1 A;  1SL9 A;  2M49 B;  1S6J A;  1UHK A;  2CCM A;  2KBM A;  2KDH A;  5FI6 A;  1DEL A;  3PN7 B;  1QAS A;  2JTT A;  2NZ0 A;  1FPW A;  3QRX A;  4I5L B;  1NCZ A;  3CYZ A;  2WCK A;  1DJW A;  3VRN A; 
#chains in the Genus database with same CATH homology
 1PUL A;  1MXE A;  1G4Y R;  1KQM B;  1KSM A;  4E68 A;  3TS5 B;  3BOW A;  2MA2 A;  2JPT A;  1QJT A;  1QTX A;  2KI4 C;  1TCF A;  1A2X A;  1OMV A;  1YR5 A;  2L98 A;  2Y1N A;  1BG1 A;  1EL4 A;  1B8C A;  2GGZ A;  1NUB A;  1X02 A;  1YX8 A;  2L0P A;  2B1U A;  1W7I B;  3BYA A;  2JUL A;  3I5G C;  2LMV A;  1GGZ A;  1BJF A;  1TNW A;  5CPV A;  1AP4 A;  4YGD B;  4DIR A;  1S5G Y;  3KHE A;  1SL7 A;  1QVI Y;  2MBX A;  1L2O C;  1CLL A;  1ZFS A;  2HQ8 A;  1J55 A;  2A4J A;  1DMO A;  1CDL A;  1XO5 A;  1B8L A;  1U5I B;  1NCY A;  4M2Q A;  3PN7 C;  3VRP A;  1CDP A;  3EK4 A;  4MVF A;  1CFP A;  3CTN A;  1AVS A;  5G08 A;  1XK4 A;  3EKH A;  2LCP A;  5HKW A;  4P5O E;  2E30 A;  5HKZ A;  1R6P A;  5D7F A;  2KI6 C;  5HYD A;  3BXK A;  3EKJ A;  1IKU A;  2EC6 C;  1PAL A;  4A4B A;  1KK7 Z;  4GAO A;  2KNE A;  4C0J A;  1WRL A;  3OX5 A;  2G9B A;  2H61 A;  2KYC A;  1UHN A;  3CR5 X;  4GGN A;  1DJG A;  4PHN A;  3SG4 A;  4GFT A;  2JTZ A;  1UUR A;  1XFX O;  2P6B B;  2NCO A;  1CMG A;  1ODB A;  1UWO A;  2JT0 A;  2F3Z A;  5GQQ C;  3RLZ A;  1SCV A;  3VRO A;  1LIN A;  1QVI Z;  2FJU B;  3BUO B;  1SY9 A;  1FI5 A;  2MHH A;  4CFQ A;  1DF0 B;  1Y0V H;  2PSR A;  1NX0 A;  1WLZ A;  2PMY A;  2Y5I A;  3SG6 A;  2TN4 A;  1OQP A;  3LLE A;  1ZMZ A;  2BKH B;  2HPS A;  1J7P A;  4N1G A;  1J1D A;  3SJS A;  1JWD A;  5DKR A;  1XVJ A;  4WQ2 A;  3JTD C;  1F55 A;  2ZRT A;  4OKH A;  3D0Y B;  2KFG A;  2LAN A;  2K7O A;  3PSR A;  3KEV A;  2KI4 B;  2LLS A;  1KWO C;  1S36 A;  2BCX A;  2EC6 B;  3GK2 A;  2AAO A;  3NSK A;  1JF2 A;  2KYF A;  3NSO A;  2PRU A;  1CLM A;  3BOW B;  2LHI A;  2KSP A;  4OR9 B;  1IQ5 A;  1MHO A;  3I5H B;  2HQW A;  2LHL A;  3CS1 A;  4R1E A;  1TNQ A;  1VRK A;  2ZRS A;  1C7V A;  1S6C A;  2L50 A;  1TNX A;  4PE4 A;  1A29 A;  2VRG A;  3PM8 A;  4QJ5 B;  2ZN8 A;  3FS7 A;  1JBA A;  3TUY B;  1UHI A;  4M2O A;  5KSZ A;  2NLN A;  1FF1 A;  1DJX A;  1PVB A;  4GUK A;  3E3R A;  3LK1 A;  4PCW A;  2WC8 A;  4Q04 A;  3SG5 A;  3JVT C;  2Q91 A;  2H61 C;  2LLT A;  2IS9 A;  4I5N B;  2FCD A;  4A4C A;  1FW4 A;  2NCP A;  2WCE A;  1B7T Y;  3I5F C;  2MJW B;  4XYN A;  1M31 A;  5J3X A;  1NX3 A;  1UUS A;  2KOT A;  4MSP A;  3AAK A;  2F8P A;  1QLK A;  2O5G A;  2WCB A;  2ZNE A;  3BQ3 A;  4GPL B;  1IGV A;  1AJ4 A;  1N2D A;  5KTY A;  1JC2 A;  1F71 A;  1WDC B;  1S26 D;  2WOR A;  2M1U A;  5ER5 A;  2LVK A;  1K93 D;  4ZCV A;  1YUU A;  3O6B A;  5HLO A;  1OZO A;  4AQI A;  1MQ1 A;  1B8R A;  3K21 A;  1CB1 A;  1EG3 A;  2BCA A;  3PAL A;  1LA0 A;  3D0Y A;  2BKI B;  1KFX S;  2F2O A;  2CNP A;  1AJ5 A;  1MWN A;  2L4I A;  3SIA A;  1B9A A;  3FIA A;  4USL A;  3ZWH A;  2PAL A;  2SCP A;  3EVR A;  2QAC A;  1NPQ A;  2HF5 A;  2LE9 B;  2BE4 A;  2OTG C;  1JUO A;  2MLF C;  4YGE B;  1L7Z A;  1GGW A;  1B47 A;  1SRA A;  2SAS A;  2BL0 C;  2GV5 A;  2KFF A;  1IQ3 A;  5AFP A;  2QPT A;  3FWC A;  2CTN A;  4MEW A;  1YUS A;  4MZL A;  2V53 A;  4YI9 A;  1LA3 A;  1CFD A;  1TCO B;  1YRT B;  1YVL A;  3LK0 A;  1S5G Z;  2M9G A;  5AER A;  1CLB A;  1HQV A;  2G2B A;  1F8H A;  5CSI A;  3A8R A;  1N65 A;  2M0R A;  1REC A;  1BOD A;  1IRJ A;  5ER4 X;  2L5X B;  2COL B;  2LVI A;  1DT7 B;  1AUI B;  1QS7 A;  2LC5 A;  1CFC A;  4M2P A;  3CLN A;  1YUT A;  2ZFD A;  3OB2 B;  1AK8 A;  2LLU A;  4NQG A;  3C1V A;  3AAJ A;  1J1E A;  1XFW O;  3WHU B;  4CPV A;  4HRH A;  3DVJ A;  2R2I A;  2ISD A;  1E8A A;  1Y6W A;  3EK7 A;  2E6W A;  2F33 A;  2LAP A;  2LNK A;  2MRD A;  3BUN B;  3F45 A;  1KFU L;  4QJ4 B;  3M0W A;  3O4Y A;  3CR2 A;  1JF0 A;  5PAL A;  3GK4 X;  1DVI A;  2M29 A;  1QLS A;  4PE7 A;  1SCM C;  1W7J B;  4UPG A;  4ETO A;  1F70 A;  1AHR A;  4JWQ A;  2WCF A;  3SIB A;  5CSJ A;  3KF9 A;  4C0K A;  1KWO B;  3CZT X;  2WND A;  3NSI A;  5KU1 A;  4MBE A;  1MUX A;  1XK4 C;  4AQJ A;  4MRY A;  1F54 A;  1A75 A;  1BOC A;  1KQV A;  2JWW A;  3HCM A;  4MRX A;  1YX7 A;  4HRE E;  4YGB B;  1SR6 B;  5TNC A;  4I5K A;  1KK8 B;  1M46 A;  2ZN9 A;  3CR4 X;  1J7O A;  3KPX A;  1CFF A;  1SYM A;  2KAY A;  2I2R E;  1WDC C;  4CID A;  2JQ6 A;  1OSA A;  1XA5 A;  1LXF C;  1LKJ A;  1WRK A;  2LMT A;  3KO0 A;  2I18 A;  4PE0 A;  1CKK A;  2LVV A;  3TS5 C;  2JXC A;  3I5I C;  4PHK A;  1NIW A;  1G33 A;  3JVT B;  4ORB B;  5I8N A;  2BEC A;  5CSN A;  1B7T Z;  1ZUZ A;  3EK8 A;  3BUX B;  2M7L A;  1K90 D;  3H4S E;  2JNX A;  3GK1 A;  1YVH A;  2KHN A;  1EXR A;  1K8U A;  1XFU O;  1C07 A;  1BR4 B;  1ALW A;  1M63 B;  3WHT B;  2JXL A;  3TZ1 A;  4BY5 A;  5JOL A;  2I94 A;  1NYA A;  1SW8 A;  3DF0 B;  1RK9 A;  4DCK A;  2KQ6 A;  4PHJ A;  2BBM A;  1TIZ A;  5AEQ A;  1RTP 1;  1SL8 A;  1KFX L;  3GOF A;  4HSZ A;  2WOS A;  1N0Y A;  4PDZ A;  1QIV A;  2K7D A;  1G8I A;  1DGV A;  3VRR A;  1DTL A;  5BPJ A;  4ZCU A;  5B8I B;  5AAN A;  4XJK A;  1JFK A;  1K96 A;  2I7A A;  5IBW A;  1QIW A;  1BMO A;  2K2A A;  3BUM B;  2PAS A;  1GJY A;  3BUW B;  1IG5 A;  3EVU A;  4D1E A;  3CWG A;  2BL0 B;  3EVV A;  1OE9 B;  4YI8 A;  1Y1A A;  2MAZ A;  4L9M A;  4PE1 A;  2LV7 A;  3DD4 A;  5CSF A;  1F4Q A;  3NXA A;  4BY4 A;  2K8M B;  4GGF A;  3I5H C;  1DJY A;  1PSR A;  3OHM B;  3SG7 A;  4GBA A;  1K95 A;  3LL8 B;  2JZI A;  3JTD B;  1DGU A;  1KSO A;  1MR8 A;  1XFZ O;  5F6T A;  5I2L A;  4PHM A;  4FQO A;  1JSA A;  1IJ5 A;  1PSB A;  1F4O A;  1L2O B;  2L51 A;  1KQM C;  2GGM A;  4F0Z B;  2K0J A;  1UHJ A;  1RWY A;  3IQQ A;  2LM5 A;  5FYX A;  2BBN A;  2BE6 A;  1DF0 A;  3HX4 A;  1RFJ A;  1RRO A;  2CXJ A;  2OS8 B;  1S3P A;  1OOJ A;  2LP3 A;  2CBL A;  2M97 A;  2HET A;  2LP2 A;  3DF0 A;  1TRF A;  2CT9 A;  1LVC D;  4MZK A;  3I5G B;  1EG4 A;  2K7C A;  2MLE C;  2M7N A;  2OTG B;  4WRI A;  1WY9 A;  3VRQ A;  1DJH A;  3A4U B;  4TNC A;  2FOT A;  1EJ3 A;  2ZKM X;  3SG2 A;  1CTR A;  4NDD A;  4OVN F;  1MF8 B;  1UHH A;  4AOM A;  1TN4 A;  2OPO A;  4CLN A;  5DKQ A;  1GQM A;  1M45 A;  2JOJ A;  3OX6 A;  2JRF A;  1MXL C;  2Y4Q A;  2LVJ A;  1BR1 B;  4P2Y B;  1FI6 A;  1SK6 D;  1CNP A;  1CDN A;  1J7R A;  1FBV A;  1K9K A;  1KK8 C;  2KBI A;  1SNL A;  4NDB A;  4OCI A;  3PFV A;  3TDU A;  1BF5 A;  1IWQ A;  2KAX A;  2M1K B;  1YTZ C;  1B4C A;  1NX2 A;  1NSH A;  1M39 A;  3ICB A;  5HLV A;  1IH0 A;  1QX7 A;  2L2E A;  3VGO A;  1CM1 A;  2L4H A;  3AKB A;  4U8D A;  2PVB A;  4OV2 A;  3SG3 A;  1A4P A;  4YRU A;  2D8N A;  1V1F A;  1C7W A;  1XFV O;  1YUR A;  1JFJ A;  2BCB A;  4ORC B;  2F2P A;  1K2H A;  1QXP A;  4DUQ A;  5JJG A;  1OMD A;  1QAT A;  2JU0 A;  3DVM A;  4NDC A;  4MLW A;  1WLM A;  2KAV A;  1BU3 A;  2FCE A;  1SCM B;  4YGA A;  2JNF A;  3LCP C;  2KGB C;  1RJV A;  4YBH B;  1K94 A;  1H8B A;  4PAL A;  1V1G A;  2M3W A;  3MSE B;  3IF7 A;  4HRG A;  1SKT A;  2AMI A;  2JT3 A;  2K7B A;  2DOQ A;  1S1E A;  2O60 A;  4MZJ A;  1B1G A;  2KGR A;  3O78 A;  1PVA A;  2K61 A;  1R2U A;  3WXA A;  4ICB A;  4ORA B;  3PLF B;  1QV1 A;  4GNK B;  1ALV A;  3DVE A;  3I5F B;  5AXI A;  1NWD A;  4YGC B;  4I5J A;  3IQO A;  1PK0 D;  1TOP A;  5I2O A;  3TUY C;  1Q80 A;  1OMR A;  1A75 B;  3NSL A;  4JPZ B;  1EH2 A;  1OZS A;  1CDM A;  2LUC A;  1NCX A;  1DJZ A;  1U5I A;  2H2K A;  3I5I B;  1XFY O;  2ZND A;  4GGF C;  1J7Q A;  2RGI A;  2AUC A;  1SBJ A;  1CM4 A;  1KFU S;  2NXQ A;  3WNX B;  1K9P A;  1QV0 A;  1S6I A;  2KQY A;  1BLQ A;  3AKA A;  3CGA A;  4XJK B;  2EGD A;  5D69 A;  1A03 A;  1QX5 B;  4WQ3 A;  4DRW A;  1DJI A;  3TDI A;  1ZOT B;  1QX2 A;  2EHB A;  2KFH A;  1YRU B;  3D10 A;  3ZNI A;  4JQ0 D;  4N5X A;  2K2F A;  3OP0 A;  2LUX A;  2Q4U A;  3DVK A;  3RM1 A;  1H4B A;  2JT8 A;  2LMU A;  1Y1X A;  2M8U A;  5HKY A;  5DKN A;  1KK7 Y;  4MN0 A;  4C0L A;  1BT6 A;  1K9U A;  1NP8 A;  2Y1M A;  4N1F A;  1SR6 C;  1UP5 A;  2OS8 C;  4FTG A;  3O2P A;  3OB1 B;  1XYD A;  4DS7 A;  5I2Q A;  1WRZ A;  5K89 A;  1CMF A;  1Y1U A;  2F3Y A;  4CFR A;  1D1O A;  3TDZ A;  1TNP A;  1KCY A;  1ZAC A;  4QJ3 B;  1HT9 A;  1NX1 A;  1PRW A;  1TTX A;  3FWB A;  3PAT A;  2KI6 D;  1SPY A;  2JC2 A;  1SMG A;  1IJ6 A;  4IL1 A;  1SL9 A;  2M49 B;  1S6J A;  1UHK A;  2CCM A;  2KBM A;  2KDH A;  3PN7 B;  1QAS A;  2JTT A;  2NZ0 A;  1FPW A;  3QRX A;  4I5L B;  1NCZ A;  1DJW A;  3VRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...