1OMRA

Non-myristoylated wild-type bovine recoverin with calcium bound to ef-hand 3
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
201
structure length
201
Chain Sequence
GNSKSGALSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKLKEKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords recoverin
publication title Impact of N-terminal myristoylation on the Ca2+-dependent conformational transition in recoverin
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 75
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2003-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1omrA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1omrA01
5KSZA 4MZJA 1GGWA 2Y1NA 5JJGA 3RLZA 1K95A 1KFXS 4ICBA 1TNPA 1BODA 4HREE 4XJKA 2I2RE 4WRIA 1BLQA 4OVNF 2AUCA 1LXFC 5AANA 2LVVA 3LLEA 2KOTA 1LA3A 1IRJA 1WRKA 2I94A 1YRTB 1F4QA 5DKNA 1QVIZ 2SASA 5CSIA 1XFYO 2F33A 4AQJA 3OX6A 1AHRA 1K9UA 2K7BA 1WRZA 1J1DA 1J7OA 1QX5B 4WQ2A 1N0YA 1QIVA 4MBEA 4N1FA 1AJ4A 1Y0VH 1C7VA 2LLUA 5BPJA 2JULA 3TDUA 1DMOA 1RFJA 4OV2A 4BY5A 1L2OC 1NPQA 3PFVA 2MBXA 2K7DA 5TNCA 3WHTB 3KO0A 2ZKMX 2KNEA 1BMOA 1IQ5A 2M29A 2M49B 2KGRA 1QJTA 2F3YA 2BKHB 1ALWA 3JTDC 1DJYA 4ORBB 3JTDB 5CSNA 1PALA 1TCOB 3FWCA 1S1EA 1V1FA 3H4SE 1YUUA 2SCPA 1CDMA 1Q80A 1FW4A 4I5KA 1XYDA 4PHMA 1TTXA 3SG4A 1NCXA 1KWOC 1EG3A 2LMUA 2OPOA 3DVJA 1S5GY 3VRPA 1UHIA 3AAJA 1EXRA 1DJHA 2H61A 2A4JA 4A4BA 1NX3A 1JF0A 1FF1A 1FBVA 4AQIA 1CTRA 1AUIB 4I5JA 1MUXA 3TDIA 5FYXA 3TS5C 1PK0D 1A4PA 3CR4X 4GFTA 4QJ5B 2HF5A 2BECA 1L7ZA 1TN4A 1AK8A 1XFUO 2MA2A 1B7TZ 4PCWA 4YGBB 1A03A 2L4HA 3SG5A 1SCMC 1R2UA 4NDDA 1OQPA 4P5OE 2GGZA 4MRXA 2BCBA 1DT7B 3I5GC 5HLVA 3I5GB 3ZWHA 1ZOTB 1RJVA 2JXCA 1UHJA 1KFUS 4MRYA 1K96A 4DUQA 1NP8A 1S26D 1CFDA 1RK9A 2Y4QA 1M63B 1CMGA 1S5GZ 3PM8A 1KCYA 1NUBA 1NIWA 4I5LB 1QV1A 1U5IA 1K93D 1FI6A 5G08A 3EVVA 1RROA 2KGBC 2JQ6A 1S6CA 3I5HC 4C0KA 3I5HB 2E30A 2AMIA 2ZRSA 3NSIA 1SBJA 1DJWA 2OTGC 1CFCA 1F70A 3O4YA 2LAPA 5ER4X 1IQ3A 1IWQA 5D69A 4N1GA 3C1VA 2PSRA 3WHUB 2JPTA 1SCVA 1J7PA 3RM1A 2LUXA 4PDZA 5KTYA 2IS9A 1JSAA 1DJIA 2JXLA 3OB2B 1PSBA 3DF0B 1HQVA 3QRXA 2GV5A 1M45A 1OMDA 3GK2A 2NCPA 1C7WA 1B47A 2M7NA 1QLKA 3JVTC 1M39A 1K2HA 1KSOA 2LCPA 1J55A 3CWGA 1WLZA 1W7JB 2KI4C 1UP5A 5D7FA 2KI4B 2PMYA 3AKBA 2ZFDA 1LA0A 1TRFA 3I5FC 3I5FB 1XO5A 2LE9B 3WNXB 1EH2A 4BY4A 3PN7C 1BJFA 3PN7B 1DTLA 1CFPA 3NXAA 4M2QA 5I2OA 3BUXB 1LINA 4FTGA 4OKHA 3BOWB 2EHBA 2EGDA 2F2OA 4PHJA 4ETOA 1YVLA 2BBMA 2L2EA 1PVAA 5IBWA 1JBAA 2M97A 1QTXA 3CR5X 3PLFB 1U5IB 1SRAA 1XK4C 3MSEB 2K0JA 1SL8A 2K2AA 4R1EA 3VGOA 5HKZA 1S6IA 1K8UA 2JTZA 1X02A 3BUMB 2HETA 2L0PA 2BE6A 1ZMZA 2L98A 4YBHB 4YGAA 3TDZA 1S36A 1TNQA 1PULA 2M9GA 3EVRA 5AERA 1LKJA 1MQ1A 2JOJA 3A4UB 1UWOA 3IQQA 1BF5A 2BCXA 3BUNB 2VRGA 4FQOA 2RGIA 3SG2A 4MSPA 1NCYA 2KFHA 2LANA 2WCFA 2LV7A 4PALA 2BKIB 5CPVA 1B1GA 2Q4UA 1A2XA 4NDBA 3SIAA 1IKUA 5HKWA 1GJYA 2M3WA 3DVKA 4PHKA 2JT8A 2LMTA 1L2OB 1B7TY 2OS8C 1CLMA 4DRWA 2PVBA 1NX0A 2L50A 2F3ZA 1A75A 1B8LA 2Y5IA 4GBAA 4NDCA 1A29A 2PRUA 3O6BA 3DVMA 3EVUA 1JFKA 2MLEC 2Q91A 2JU0A 1SL9A 4ZCUA 1OZOA 2BE4A 1BT6A 1PVBA 1HT9A 4ORCB 2JT0A 2EC6C 1BR1B 1KWOB 2EC6B 1SR6C 3SIBA 1E8AA 1SR6B 1NCZA 1KK7Y 1WDCC 2JNXA 2M1UA 5F6TA 1WDCB 1J7RA 3LCPC 1YRUB 1UHHA 1N2DA 3LK0A 4DIRA 4OR9B 1BOCA 2JC2A 1UHNA 3TS5B 1XFZO 3DF0A 1CKKA 1IG5A 2LM5A 4YI9A 2FCEA 3D10A 2CTNA 2E6WA 1Y6WA 4P2YB 2HQ8A 1SCMB 1F4OA 4IL1A 4CLNA 2CT9A 1MXLC 2LP2A 3NSKA 4CPVA 3SG3A 3OP0A 2GGMA 2Y1MA 2ZN9A 1SPYA 4GNKB 3GOFA 2I18A 1XA5A 3BUWB 3EK8A 4F0ZB 1CNPA 4I5NB 1WLMA 3BOWA 3LL8B 3VRQA 1ZFSA 1IJ6A 1A75B 5K89A 1RWYA 2WC8A 3KHEA 1Y1AA 1YUTA 2KAYA 1KK7Z 1JWDA 4CFQA 1XK4A 1KQVA 2FOTA 2NLNA 4MZLA 2NXQA 3O78A 1AVSA 2OTGB 2HPSA 1BG1A 2F2PA 4QJ4B 3ICBA 3DVEA 1MXEA 3CZTX 3BUOB 3PATA 4GGNA 2LMVA 1UHKA 3EK4A 1B8RA 1GGZA 1K9KA 1WRLA 1YR5A 3NSLA 4JWQA 3VRRA 1PSRA 3HX4A 5I2LA 4TNCA 4PHNA 1ALVA 1KK8C 1M46A 2COLB 4ZCVA 1KK8B 4MVFA 1TOPA 1G33A 2H2KA 3JVTB 3SJSA 1QXPA 1SL7A 2JRFA 4ORAB 1JF2A 2K61A 3M0WA 4MEWA 2HQWA 3HCMA 2LVJA 5DKRA 1F71A 1DGVA 5B8IB 1CLLA 1XFVO 1RTP1 3K21A 1OSAA 4Q04A 5GQQC 1SKTA 2LHLA 5HKYA 1J7QA 2M8UA 1YTZC 2F8PA 1B4CA 1F54A 4HRGA 1TIZA 3F45A 2NZ0A 3WXAA 2AAOA 3OX5A 4XYNA 4U8DA 4A4CA 4MN0A 1Y1XA 1SW8A 3O2PA 1EG4A 1UUSA 4HRHA 2WCBA 2FJUB 4YGEB 1J1EA 3CTNA 4PE4A 1IJ5A 1FI5A 1YVHA 2KAVA 2BL0C 1F55A 2BL0B 1DF0B 2KI6C 2M1KB 4GAOA 1UURA 1EL4A 1VRKA 4DCKA 1M31A 1IH0A 2LVKA 3D0YB 1KFXL 1JFJA 4GPLB 2P6BB 4UPGA 2KYCA 2WORA 3CR2A 4N5XA 1RECA 4GGFC 4PE0A 1SYMA 1JC2A 4D1EA 5KU1A 1W7IB 1QV0A 1FPWA 1OE9B 2K7CA 3OB1B 1JUOA 2KQ6A 2K8MB 2B1UA 2JWWA 2JZIA 2KBIA 2ZRTA 5DKQA 2OS8B 1QS7A 2CCMA 2WOSA 4QJ3B 3CGAA 4WQ3A 2PALA 4E68A 3TZ1A 3I5IC 2LVIA 3NSOA 1CDLA 3I5IB 2DOQA 4MZKA 1XVJA 2G2BA 1K90D 3OHMB 1SK6D 1K94A 1CMFA 1B9AA 1QX7A 5CSJA 2ZN8A 4L9MA 2LP3A 1OMRA 2TN4A 1CM4A 4NQGA 3A8RA 1XFXO 2PASA 4JPZB 1QATA 1D1OA 1QIWA 1SNLA 2R2IA 1CM1A 1NWDA 4OCIA 1AJ5A 3SG6A 1TNWA 2KHNA 3KPXA 3AAKA 3EKHA 1K9PA 1YURA 1ZACA 2CNPA 2M7LA 3E3RA 1V1GA 3KEVA 1BR4B 5HYDA 3GK4X 4XJKB 1BU3A 2M0RA 2O60A 1NX2A 2LNKA 2LC5A 3DD4A 1F8HA 2G9BA 5AEQA 1B8CA 1G4YR 1ZUZA 2V53A 2JT3A 5PALA 1CDPA 2KFGA 1C07A 1S6JA 1CB1A 1XFWO 1DGUA 1CDNA 1G8IA 2QACA 1AP4A 2FCDA 5HLOA 2JNFA 2KYFA 2LHIA 1NX1A 1ODBA 3FIAA 3BQ3A 3IQOA 4M2OA 1DJXA 1KQMC 2D8NA 1MWNA 2KBMA 1KQMB 2ZNDA 1KSMA 2KI6D 2L4IA 1GQMA 1KFUL 1MHOA 2L5XB 4HSZA 1LVCD 1H8BA 4DS7A 2BCAA 2MRDA 1DF0A 3FWBA 5CSFA 4YRUA 1DJZA 2KFFA 3D0YA 5ER5A 3IF7A 3TUYC 2CXJA 3TUYB 4GUKA 2BBNA 2I7AA 2LUCA 1Y1UA 4GGFA 1QX2A 2ZNEA 3PALA 1YUSA 1OZSA 2KQYA 1PRWA 1DJGA 1N65A 2LLTA 3GK1A 1EJ3A 4CIDA 2KSPA 4CFRA 2KDHA 2NCOA 2H61C 1CFFA 5I2QA 4MLWA 4AOMA 4JQ0D 2ISDA 1NSHA 3AKAA 3CLNA 1CLBA 1YX8A 2KAXA 2MJWB 3ZNIA 3KF9A 5J3XA 3VRNA 5I8NA 1MR8A 4PE7A 2WNDA 1H4BA 5AFPA 3FS7A 5AXIA 2MAZA 2K2FA 5JOLA 3CS1A 2K7OA 3EK7A 3EKJA 1MF8B 4YI8A 3PSRA 1S3PA 1TCFA 3BXKA 1NYAA 1WY9A 1SMGA 2L51A 2O5GA 4PE1A 1OOJA 3VROA 4C0JA 2MHHA 1QLSA 4M2PA 1QVIY 1R6PA 1DVIA 1TNXA 2QPTA 4USLA 1QASA 1SY9A 1OMVA 4C0LA 3LK1A 1IGVA 4YGDB 4YGCB 2WCEA 1YX7A 2CBLA 2MLFC 2LLSA 2JTTA 3SG7A 3BYAA
chains in the Genus database with same CATH superfamily
3N7HA 4MZJA 5KSZA 1GGWA 2Y1NA 5JJGA 3RLZA 1K95A 1KFXS 4ICBA 1TNPA 1BODA 4HREE 1SSEB 4XJKA 2I2RE 4WRIA 3D76A 2H8VA 3DY9A 3D75A 1BLQA 5DICA 4OVNF 3CYZA 2AUCA 1LXFC 5AANA 2LVVA 3LLEA 2KOTA 1LA3A 2KLDA 1IRJA 1WRKA 2I94A 2JPOA 1YRTB 3R1OA 3B88A 1F4QA 5DKNA 1QVIZ 2SASA 5CSIA 2QEHA 3OBVA 1XFYO 2F33A 4AQJA 3OX6A 1AHRA 1K9UA 2K7BA 1WRZA 1OOFA 1J1DA 1J7OA 1QX5B 4WQ2A 1N0YA 1QIVA 4MBEA 4N1FA 1AJ4A 1Y0VH 1C7VA 2LLUA 5BPJA 2JULA 3TDUA 1DMOA 1RFJA 4OV2A 4BY5A 1L2OC 5HL1A 1NPQA 3PFVA 2MBXA 2K7DA 5TNCA 3WHTB 3KO0A 2ZKMX 2KNEA 1BMOA 3PJIA 2GTEA 1LS8A 1IQ5A 2M29A 3CDNA 2M49B 2KGRA 1QJTA 2F3YA 2BKHB 1ALWA 3JTDC 1DJYA 4ORBB 3JTDB 5CSNA 1PALA 1TCOB 3D77A 1S1EA 3FWCA 1V1FA 3H4SE 1YUUA 2SCPA 1CDMA 1Q80A 1FW4A 4I5KA 1XYDA 4PHMA 1TTXA 3SG4A 1NCXA 1KWOC 1EG3A 2LMUA 2OPOA 3DVJA 1S5GY 3VRPA 1UHIA 3AAJA 1EXRA 1DJHA 2H61A 2A4JA 3NHTA 4INXA 4A4BA 1NX3A 1JF0A 1FF1A 1FBVA 4AQIA 1CTRA 1AUIB 4I5JA 1MUXA 3TDIA 5FYXA 3TS5C 1PK0D 1A4PA 3CR4X 4GFTA 3OGNA 4QJ5B 2HF5A 2BECA 1L7ZA 1TN4A 3S0FA 1XFUO 2MA2A 1B7TZ 4PCWA 4YGBB 1A03A 1AK8A 2L4HA 3SG5A 1SCMC 1R2UA 4NDDA 1OQPA 4P5OE 2GGZA 3CZ1A 4MRXA 2BCBA 3DZTA 1DT7B 3I5GC 5HLVA 3DYEA 3I5GB 3ZWHA 3VB1A 1ZOTB 1RJVA 2JXCA 1UHJA 1KFUS 4MRYA 1K96A 4DUQA 1NP8A 1S26D 1CFDA 1RK9A 2Y4QA 1M63B 1CMGA 1S5GZ 3PM8A 1KCYA 1NUBA 1NIWA 3EG5B 4I5LB 1QV1A 1U5IA 1OOGA 1K93D 1FI6A 5G08A 3EVVA 1RROA 2KGBC 2JQ6A 1S6CA 1DC1A 3I5HC 4C0KA 3I5HB 2E30A 2AMIA 2ZRSA 3NSIA 1SBJA 1DJWA 2OTGC 3BJHA 3D73A 3UO9A 1CFCA 1F70A 3O4YA 2LAPA 5ER4X 1TUZA 1IWQA 1IQ3A 5D69A 4N1GA 3C1VA 2PSRA 3WHUB 2JPTA 1SCVA 1J7PA 3RM1A 4DIRA 2LUXA 4PDZA 5KTYA 2IS9A 1JSAA 1DJIA 2JXLA 3OB2B 1PSBA 3DF0B 1HQVA 1QWVA 2GV5A 3QRXA 5FI2A 1M45A 1OMDA 3GK2A 2NCPA 1C7WA 1B47A 2M7NA 1QLKA 2WCMA 3JVTC 1M39A 1K2HA 1KSOA 2LCPA 1J55A 3CWGA 1WLZA 1W7JB 2KI4C 1UP5A 5D7FA 2KI4B 2PMYA 3AKBA 3S0EA 2ZFDA 1LA0A 1TRFA 3I5FC 3I5FB 1XO5A 2LE9B 3WNXB 1EH2A 4BY4A 3PN7C 1BJFA 3PN7B 1DTLA 1CFPA 3NXAA 4M2QA 3UNWA 5I2OA 3BUXB 1LINA 4FTGA 4OKHA 3BOWB 2EHBA 2EGDA 2F2OA 4PHJA 4ETOA 1YVLA 2BBMA 2L2EA 1PVAA 5IBWA 1JBAA 2M97A 3CZ2A 1QTXA 3CR5X 3PLFB 1U5IB 3IVTA 1SRAA 1XK4C 3MSEB 2K0JA 1SL8A 2K2AA 4R1EA 3VGOA 5HKZA 1S6IA 1K8UA 2JTZA 1X02A 1OOHA 3BUMB 2HETA 2L0PA 2BE6A 1ZMZA 2L98A 4YBHB 4YGAA 3TDZA 1S36A 1TNQA 3SS3A 1PULA 2ERBA 2M9GA 3EVRA 5AERA 1LKJA 1MQ1A 2JOJA 3A4UB 2QEBA 1UWOA 3IQQA 1BF5A 2BCXA 3BUNB 2VRGA 4FQOA 2RGIA 3SG2A 4MSPA 1NCYA 2KFHA 2LANA 2WCFA 2LV7A 4PALA 2BKIB 5CPVA 1B1GA 2Q4UA 1A2XA 4NDBA 4INWA 3SIAA 1IKUA 5HKWA 1GJYA 2M3WA 3DVKA 4PHKA 2JT8A 1XFRA 2LMTA 1L2OB 1B7TY 5EL2A 2OS8C 1CLMA 4DRWA 2PVBA 1NX0A 2L50A 2F3ZA 1A75A 1B8LA 2Y5IA 3BFHA 4GBAA 4NDCA 1A29A 2PRUA 2K60A 3O6BA 3DVMA 1ORGA 3EVUA 3D74A 1JFKA 2MLEC 3B87A 2Q91A 2JU0A 1SL9A 3BFAA 4ZCUA 1OZOA 2BE4A 1BT6A 1PVBA 2L2CA 1HT9A 4JD9A 5FI6A 4ORCB 2JT0A 3B86A 4IJ7A 2EC6C 3S0BA 1BR1B 1KWOB 2EC6B 4PT1A 1SR6C 3DXLA 3SIBA 1E8AA 1SR6B 1NCZA 5D3OA 1KK7Y 1WDCC 2JNXA 2M1UA 5F6TA 1WDCB 1J7RA 3LCPC 1YRUB 1UHHA 1N2DA 3LK0A 4JKTA 3L4AA 4OR9B 1BOCA 2JC2A 1UHNA 3TS5B 1XFZO 3DF0A 3S0DA 1CKKA 1IG5A 1Z4HA 2LM5A 4YI9A 2FCEA 3D10A 2CTNA 2E6WA 1Y6WA 4P2YB 2HQ8A 1SCMB 1C3ZA 2QDIA 1F4OA 4IL1A 2P71A 4CLNA 2CT9A 1MXLC 3B6XA 2LP2A 3NSKA 4CPVA 3SG3A 3OP0A 2GGMA 2Y1MA 2ZN9A 1SPYA 4GNKB 3GOFA 2I18A 1XA5A 2YGUA 3BUWB 3EK8A 4F0ZB 1CNPA 4I5NB 1WLMA 3R1PA 1Z2CB 3BOWA 3LL8B 3VRQA 1ZFSA 1IJ6A 3L4LA 1A75B 5K89A 1RWYA 2L5YA 2WC8A 3KHEA 1Y1AA 1YUTA 2KAYA 1KK7Z 1JWDA 4CFQA 1GM0A 1XK4A 1KQVA 2FOTA 2NLNA 1OW4A 4MZLA 2NXQA 3O78A 1C3YA 1AVSA 2OTGB 1T14A 2HPSA 1BG1A 2F2PA 4QJ4B 3ICBA 3DVEA 1MXEA 3CZTX 3BUOB 3PATA 4GGNA 5I94A 3L47A 2LMVA 1UHKA 3EK4A 1B8RA 1GGZA 1K9KA 1WRLA 1YR5A 3NSLA 4JWQA 3VRRA 1IIOA 1PSRA 3HX4A 2PYQA 5I2LA 4TNCA 4PHNA 1ALVA 1KK8C 1M46A 2COLB 4ZCVA 1KK8B 4MVFA 1TOPA 1G33A 2H2KA 3SS4A 3JVTB 3SJSA 1QXPA 1SL7A 2JRFA 4ORAB 1JF2A 2K61A 3O4XA 3M0WA 1P28A 2WCHA 4MEWA 2HQWA 3HCMA 2LVJA 5DKRA 1F71A 4KYNA 1DGVA 5B8IB 1CLLA 1XFVO 1RTP1 3K21A 3R1VA 1OSAA 4Q04A 5GQQC 1SKTA 2LHLA 5HKYA 1J7QA 2M8UA 1YTZC 2F8PA 1B4CA 1F54A 4HRGA 1TIZA 3F45A 2NZ0A 3WXAA 2AAOA 3OX5A 2QEVA 4U8DA 4XYNA 4A4CA 4MN0A 1Y1XA 1SW8A 3O2PA 1EG4A 1UUSA 4HRHA 2WCBA 2FJUB 4YGEB 1J1EA 3CTNA 4PE4A 1IJ5A 1FI5A 1YVHA 2P70A 2KAVA 2BL0C 1F55A 2BL0B 1DF0B 2KI6C 2M1KB 2WCLA 4GAOA 1UURA 1EL4A 1VRKA 3FE8A 1OOIX 4DCKA 1M31A 2FJYA 1IH0A 2LVKA 3D0YB 1KFXL 1JFJA 4GPLB 2P6BB 4UPGA 2KYCA 2WORA 3CR2A 4N5XA 1RECA 4GGFC 4PE0A 1SYMA 3S0AA 1JC2A 4D1EA 3Q8IA 5KU1A 1W7IB 1DELA 1QV0A 1FPWA 1OE9B 2K7CA 3OB1B 3S0GA 1JUOA 2KQ6A 2K8MB 2B1UA 2JWWA 2JZIA 2KBIA 2ZRTA 5DKQA 2OS8B 1QS7A 2CCMA 4OZDA 2WOSA 4QJ3B 3CGAA 4WQ3A 2PALA 4E68A 2KPHA 3TZ1A 3I5IC 2LVIA 3NSOA 1CDLA 3I5IB 2DOQA 4MZKA 1XVJA 2G2BA 1K90D 1W9ZA 1SK6D 1K94A 1DQEA 3OHMB 1B9AA 1QX7A 5FI7A 1CMFA 5CSJA 2ZN8A 4L9MA 2LP3A 1TWOA 3CABA 1OMRA 2QEOA 2TN4A 1CM4A 4NQGA 3A8RA 1XFXO 2PASA 4JPZB 1QATA 1D1OA 2WC5A 1QIWA 1SNLA 2R2IA 1CM1A 1NWDA 2WCJA 4OCIA 1AJ5A 3SG6A 1TNWA 2KHNA 3BFBA 3KPXA 3AAKA 3EKHA 1K9PA 1YURA 1ZACA 2CNPA 2M7LA 3E3RA 1V1GA 3KEVA 1BR4B 5HYDA 3GK4X 4XJKB 3NHIA 1BU3A 2M0RA 2O60A 1NX2A 2LNKA 2LC5A 3DD4A 1F8HA 2G9BA 5AEQA 1B8CA 1G4YR 1ZUZA 2V53A 2JT3A 5PALA 1CDPA 2KFGA 1C07A 1S6JA 1CB1A 1XFWO 4FQTA 1DGUA 1CDNA 1G8IA 2QACA 1AP4A 2FCDA 5HLOA 2WCKA 2JNFA 2KYFA 2LHIA 1NX1A 1ODBA 2BNXA 3SS5A 3FIAA 3BQ3A 3IQOA 4M2OA 1DJXA 1KQMC 2D8NA 1MWNA 2KBMA 1KQMB 2ZNDA 1TUJA 1KSMA 2KI6D 2L4IA 3QMEA 1GQMA 1KFUL 1MHOA 2L5XB 4HSZA 1LVCD 1H8BA 4DS7A 2BCAA 2MRDA 1DF0A 3FWBA 3R72A 5CSFA 4YRUA 1DJZA 4F7FA 2KFFA 3D0YA 5ER5A 3IF7A 3TUYC 2CXJA 3TUYB 4GUKA 2BBNA 2I7AA 2LUCA 1Y1UA 4GGFA 1QX2A 2ZNEA 3FE6A 3PALA 1YUSA 1OZSA 2KQYA 1PRWA 3CZ0A 1DJGA 1N65A 2LLTA 3GK1A 1EJ3A 3NGVA 4CIDA 2BAPA 2KSPA 4CFRA 2KDHA 2NCOA 2H61C 1CFFA 5I2QA 1DEKA 4MLWA 4AOMA 4JQ0D 2ISDA 1NSHA 3AKAA 3CLNA 3RZSA 3PM2A 1CLBA 1YX8A 2KAXA 2MJWB 3ZNIA 2PQLA 3KF9A 5J3XA 3VRNA 5I8NA 1MR8A 4PE7A 2WNDA 1H4BA 5AFPA 3FS7A 5AXIA 2MAZA 2K2FA 5JOLA 3CS1A 2K7OA 3EK7A 3EKJA 1MF8B 4YI8A 3PSRA 1S3PA 1TCFA 3BXKA 1NYAA 1WY9A 1SMGA 2L51A 2O5GA 3B7AA 1OOJA 2KLEA 3K1EA 4PE1A 2MHHA 3VROA 4C0JA 1QLSA 4M2PA 1QVIY 3V2LA 1R6PA 1DVIA 1TNXA 2QPTA 4USLA 1QASA 1SY9A 1OMVA 4C0LA 3D78A 3LK1A 3FE9A 1IGVA 4YGDB 4YGCB 2WCEA 1YX7A 2CBLA 2MLFC 2LLSA 2WC6A 2JTTA 3SG7A 3BYAA
chains in the Genus database with same CATH topology
5KSZA 4MZJA 1GGWA 2Y1NA 5JJGA 3RLZA 1K95A 1KFXS 4ICBA 1TNPA 1BODA 4HREE 4XJKA 2I2RE 4WRIA 1BLQA 4OVNF 2AUCA 1LXFC 5AANA 2LVVA 3LLEA 2KOTA 1LA3A 1IRJA 1WRKA 2I94A 1YRTB 1F4QA 5DKNA 1QVIZ 2SASA 5CSIA 1XFYO 2F33A 4AQJA 3OX6A 1AHRA 1K9UA 2K7BA 1WRZA 1J1DA 1J7OA 1QX5B 4WQ2A 1N0YA 1QIVA 4MBEA 4N1FA 1AJ4A 1Y0VH 1C7VA 2LLUA 5BPJA 2JULA 3TDUA 1DMOA 1RFJA 4OV2A 4BY5A 1L2OC 1NPQA 3PFVA 2MBXA 2K7DA 5TNCA 3WHTB 3KO0A 2ZKMX 2KNEA 1BMOA 1IQ5A 2M29A 2M49B 2KGRA 1QJTA 2F3YA 2BKHB 1ALWA 3JTDC 1DJYA 4ORBB 3JTDB 5CSNA 1PALA 1TCOB 3FWCA 1S1EA 1V1FA 3H4SE 1YUUA 2SCPA 1CDMA 1Q80A 1FW4A 4I5KA 1XYDA 4PHMA 1TTXA 3SG4A 1NCXA 1KWOC 1EG3A 2LMUA 2OPOA 3DVJA 1S5GY 3VRPA 1UHIA 3AAJA 1EXRA 1DJHA 2H61A 2A4JA 4A4BA 1NX3A 1JF0A 1FF1A 1FBVA 4AQIA 1CTRA 1AUIB 4I5JA 1MUXA 3TDIA 5FYXA 3TS5C 1PK0D 1A4PA 3CR4X 4GFTA 4QJ5B 2HF5A 2BECA 1L7ZA 1TN4A 1AK8A 1XFUO 2MA2A 1B7TZ 4PCWA 4YGBB 1A03A 2L4HA 3SG5A 1SCMC 1R2UA 4NDDA 1OQPA 4P5OE 2GGZA 4MRXA 2BCBA 1DT7B 3I5GC 5HLVA 3I5GB 3ZWHA 1ZOTB 1RJVA 2JXCA 1UHJA 1KFUS 4MRYA 1K96A 4DUQA 1NP8A 1S26D 1CFDA 1RK9A 2Y4QA 1M63B 1CMGA 1S5GZ 3PM8A 1KCYA 1NUBA 1NIWA 4I5LB 1QV1A 1U5IA 1K93D 1FI6A 5G08A 3EVVA 1RROA 2KGBC 2JQ6A 1S6CA 3I5HC 4C0KA 3I5HB 2E30A 2AMIA 2ZRSA 3NSIA 1SBJA 1DJWA 2OTGC 1CFCA 1F70A 3O4YA 2LAPA 5ER4X 1IQ3A 1IWQA 5D69A 4N1GA 3C1VA 2PSRA 3WHUB 2JPTA 1SCVA 1J7PA 3RM1A 2LUXA 4PDZA 5KTYA 2IS9A 1JSAA 1DJIA 2JXLA 3OB2B 1PSBA 3DF0B 1HQVA 3QRXA 2GV5A 1M45A 1OMDA 3GK2A 2NCPA 1C7WA 1B47A 2M7NA 1QLKA 3JVTC 1M39A 1K2HA 1KSOA 2LCPA 1J55A 3CWGA 1WLZA 1W7JB 2KI4C 1UP5A 5D7FA 2KI4B 2PMYA 3AKBA 2ZFDA 1LA0A 1TRFA 3I5FC 3I5FB 1XO5A 2LE9B 3WNXB 1EH2A 4BY4A 3PN7C 1BJFA 3PN7B 1DTLA 1CFPA 3NXAA 4M2QA 5I2OA 3BUXB 1LINA 4FTGA 4OKHA 3BOWB 2EHBA 2EGDA 2F2OA 4PHJA 4ETOA 1YVLA 2BBMA 2L2EA 1PVAA 5IBWA 1JBAA 2M97A 1QTXA 3CR5X 3PLFB 1U5IB 1SRAA 1XK4C 3MSEB 2K0JA 1SL8A 2K2AA 4R1EA 3VGOA 5HKZA 1S6IA 1K8UA 2JTZA 1X02A 3BUMB 2HETA 2L0PA 2BE6A 1ZMZA 2L98A 4YBHB 4YGAA 3TDZA 1S36A 1TNQA 1PULA 2M9GA 3EVRA 5AERA 1LKJA 1MQ1A 2JOJA 3A4UB 1UWOA 3IQQA 1BF5A 2BCXA 3BUNB 2VRGA 4FQOA 2RGIA 3SG2A 4MSPA 1NCYA 2KFHA 2LANA 2WCFA 2LV7A 4PALA 2BKIB 5CPVA 1B1GA 2Q4UA 1A2XA 4NDBA 3SIAA 1IKUA 5HKWA 1GJYA 2M3WA 3DVKA 4PHKA 2JT8A 2LMTA 1L2OB 1B7TY 2OS8C 1CLMA 4DRWA 2PVBA 1NX0A 2L50A 2F3ZA 1A75A 1B8LA 2Y5IA 4GBAA 4NDCA 1A29A 2PRUA 3O6BA 3DVMA 3EVUA 1JFKA 2MLEC 2Q91A 2JU0A 1SL9A 4ZCUA 1OZOA 2BE4A 1BT6A 1PVBA 1HT9A 4ORCB 2JT0A 2EC6C 1BR1B 1KWOB 2EC6B 1SR6C 3SIBA 1E8AA 1SR6B 1NCZA 1KK7Y 1WDCC 2JNXA 2M1UA 5F6TA 1WDCB 1J7RA 3LCPC 1YRUB 1UHHA 1N2DA 3LK0A 4DIRA 4OR9B 1BOCA 2JC2A 1UHNA 3TS5B 1XFZO 3DF0A 1CKKA 1IG5A 2LM5A 4YI9A 2FCEA 3D10A 2CTNA 2E6WA 1Y6WA 4P2YB 2HQ8A 1SCMB 1F4OA 4IL1A 4CLNA 2CT9A 1MXLC 2LP2A 3NSKA 4CPVA 3SG3A 3OP0A 2GGMA 2Y1MA 2ZN9A 1SPYA 4GNKB 3GOFA 2I18A 1XA5A 3BUWB 3EK8A 4F0ZB 1CNPA 4I5NB 1WLMA 3BOWA 3LL8B 3VRQA 1ZFSA 1IJ6A 1A75B 5K89A 1RWYA 2WC8A 3KHEA 1Y1AA 1YUTA 2KAYA 1KK7Z 1JWDA 4CFQA 1XK4A 1KQVA 2FOTA 2NLNA 4MZLA 2NXQA 3O78A 1AVSA 2OTGB 2HPSA 1BG1A 2F2PA 4QJ4B 3ICBA 3DVEA 1MXEA 3CZTX 3BUOB 3PATA 4GGNA 2LMVA 1UHKA 3EK4A 1B8RA 1GGZA 1K9KA 1WRLA 1YR5A 3NSLA 4JWQA 3VRRA 1PSRA 3HX4A 5I2LA 4TNCA 4PHNA 1ALVA 1KK8C 1M46A 2COLB 4ZCVA 1KK8B 4MVFA 1TOPA 1G33A 2H2KA 3JVTB 3SJSA 1QXPA 1SL7A 2JRFA 4ORAB 1JF2A 2K61A 3M0WA 4MEWA 2HQWA 3HCMA 2LVJA 5DKRA 1F71A 1DGVA 5B8IB 1CLLA 1XFVO 1RTP1 3K21A 1OSAA 4Q04A 5GQQC 1SKTA 2LHLA 5HKYA 1J7QA 2M8UA 1YTZC 2F8PA 1B4CA 1F54A 4HRGA 1TIZA 3F45A 2NZ0A 3WXAA 2AAOA 3OX5A 4XYNA 4U8DA 4A4CA 4MN0A 1Y1XA 1SW8A 3O2PA 1EG4A 1UUSA 4HRHA 2WCBA 2FJUB 4YGEB 1J1EA 3CTNA 4PE4A 1IJ5A 1FI5A 1YVHA 2KAVA 2BL0C 1F55A 2BL0B 1DF0B 2KI6C 2M1KB 4GAOA 1UURA 1EL4A 1VRKA 4DCKA 1M31A 1IH0A 2LVKA 3D0YB 1KFXL 1JFJA 4GPLB 2P6BB 4UPGA 2KYCA 2WORA 3CR2A 4N5XA 1RECA 4GGFC 4PE0A 1SYMA 1JC2A 4D1EA 5KU1A 1W7IB 1QV0A 1FPWA 1OE9B 2K7CA 3OB1B 1JUOA 2KQ6A 2K8MB 2B1UA 2JWWA 2JZIA 2KBIA 2ZRTA 5DKQA 2OS8B 1QS7A 2CCMA 2WOSA 4QJ3B 3CGAA 4WQ3A 2PALA 4E68A 3TZ1A 3I5IC 2LVIA 3NSOA 1CDLA 3I5IB 2DOQA 4MZKA 1XVJA 2G2BA 1K90D 3OHMB 1SK6D 1K94A 1CMFA 1B9AA 1QX7A 5CSJA 2ZN8A 4L9MA 2LP3A 1OMRA 2TN4A 1CM4A 4NQGA 3A8RA 1XFXO 2PASA 4JPZB 1QATA 1D1OA 1QIWA 1SNLA 2R2IA 1CM1A 1NWDA 4OCIA 1AJ5A 3SG6A 1TNWA 2KHNA 3KPXA 3AAKA 3EKHA 1K9PA 1YURA 1ZACA 2CNPA 2M7LA 3E3RA 1V1GA 3KEVA 1BR4B 5HYDA 3GK4X 4XJKB 1BU3A 2M0RA 2O60A 1NX2A 2LNKA 2LC5A 3DD4A 1F8HA 2G9BA 5AEQA 1B8CA 1G4YR 1ZUZA 2V53A 2JT3A 5PALA 1CDPA 2KFGA 1C07A 1S6JA 1CB1A 1XFWO 1DGUA 1CDNA 1G8IA 2QACA 1AP4A 2FCDA 5HLOA 2JNFA 2KYFA 2LHIA 1NX1A 1ODBA 3FIAA 3BQ3A 3IQOA 4M2OA 1DJXA 1KQMC 2D8NA 1MWNA 2KBMA 1KQMB 2ZNDA 1KSMA 2KI6D 2L4IA 1GQMA 1KFUL 1MHOA 2L5XB 4HSZA 1LVCD 1H8BA 4DS7A 2BCAA 2MRDA 1DF0A 3FWBA 5CSFA 4YRUA 1DJZA 2KFFA 3D0YA 5ER5A 3IF7A 3TUYC 2CXJA 3TUYB 4GUKA 2BBNA 2I7AA 2LUCA 1Y1UA 4GGFA 1QX2A 2ZNEA 3PALA 1YUSA 1OZSA 2KQYA 1PRWA 1DJGA 1N65A 2LLTA 3GK1A 1EJ3A 4CIDA 2KSPA 4CFRA 2KDHA 2NCOA 2H61C 1CFFA 5I2QA 4MLWA 4AOMA 4JQ0D 2ISDA 1NSHA 3AKAA 3CLNA 1CLBA 1YX8A 2KAXA 2MJWB 3ZNIA 3KF9A 5J3XA 3VRNA 5I8NA 1MR8A 4PE7A 2WNDA 1H4BA 5AFPA 3FS7A 5AXIA 2MAZA 2K2FA 5JOLA 3CS1A 2K7OA 3EK7A 3EKJA 1MF8B 4YI8A 3PSRA 1S3PA 1TCFA 3BXKA 1NYAA 1WY9A 1SMGA 2L51A 2O5GA 4PE1A 1OOJA 3VROA 4C0JA 2MHHA 1QLSA 4M2PA 1QVIY 1R6PA 1DVIA 1TNXA 2QPTA 4USLA 1QASA 1SY9A 1OMVA 4C0LA 3LK1A 1IGVA 4YGDB 4YGCB 2WCEA 1YX7A 2CBLA 2MLFC 2LLSA 2JTTA 3SG7A 3BYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KSZ A;  4MZJ A;  1GGW A;  2Y1N A;  5JJG A;  3RLZ A;  1K95 A;  1KFX S;  4ICB A;  1TNP A;  1BOD A;  4HRE E;  4XJK A;  2I2R E;  4WRI A;  1BLQ A;  4OVN F;  2AUC A;  1LXF C;  5AAN A;  2LVV A;  3LLE A;  2KOT A;  1LA3 A;  1IRJ A;  1WRK A;  2I94 A;  1YRT B;  1F4Q A;  5DKN A;  1QVI Z;  2SAS A;  5CSI A;  1XFY O;  2F33 A;  4AQJ A;  3OX6 A;  1AHR A;  1K9U A;  2K7B A;  1WRZ A;  1J1D A;  1J7O A;  1QX5 B;  4WQ2 A;  1N0Y A;  1QIV A;  4MBE A;  4N1F A;  1AJ4 A;  1Y0V H;  1C7V A;  2LLU A;  5BPJ A;  2JUL A;  3TDU A;  1DMO A;  1RFJ A;  4OV2 A;  4BY5 A;  1L2O C;  1NPQ A;  3PFV A;  2MBX A;  2K7D A;  5TNC A;  3WHT B;  3KO0 A;  2ZKM X;  2KNE A;  1BMO A;  1IQ5 A;  2M29 A;  2M49 B;  2KGR A;  1QJT A;  2F3Y A;  2BKH B;  1ALW A;  3JTD C;  1DJY A;  4ORB B;  3JTD B;  5CSN A;  1PAL A;  1TCO B;  3FWC A;  1S1E A;  1V1F A;  3H4S E;  1YUU A;  2SCP A;  1CDM A;  1Q80 A;  1FW4 A;  4I5K A;  1XYD A;  4PHM A;  1TTX A;  3SG4 A;  1NCX A;  1KWO C;  1EG3 A;  2LMU A;  2OPO A;  3DVJ A;  1S5G Y;  3VRP A;  1UHI A;  3AAJ A;  1EXR A;  1DJH A;  2H61 A;  2A4J A;  4A4B A;  1NX3 A;  1JF0 A;  1FF1 A;  1FBV A;  4AQI A;  1CTR A;  1AUI B;  4I5J A;  1MUX A;  3TDI A;  5FYX A;  3TS5 C;  1PK0 D;  1A4P A;  3CR4 X;  4GFT A;  4QJ5 B;  2HF5 A;  2BEC A;  1L7Z A;  1TN4 A;  1AK8 A;  1XFU O;  2MA2 A;  1B7T Z;  4PCW A;  4YGB B;  1A03 A;  2L4H A;  3SG5 A;  1SCM C;  1R2U A;  4NDD A;  1OQP A;  4P5O E;  2GGZ A;  4MRX A;  2BCB A;  1DT7 B;  3I5G C;  5HLV A;  3I5G B;  3ZWH A;  1ZOT B;  1RJV A;  2JXC A;  1UHJ A;  1KFU S;  4MRY A;  1K96 A;  4DUQ A;  1NP8 A;  1S26 D;  1CFD A;  1RK9 A;  2Y4Q A;  1M63 B;  1CMG A;  1S5G Z;  3PM8 A;  1KCY A;  1NUB A;  1NIW A;  4I5L B;  1QV1 A;  1U5I A;  1K93 D;  1FI6 A;  5G08 A;  3EVV A;  1RRO A;  2KGB C;  2JQ6 A;  1S6C A;  3I5H C;  4C0K A;  3I5H B;  2E30 A;  2AMI A;  2ZRS A;  3NSI A;  1SBJ A;  1DJW A;  2OTG C;  1CFC A;  1F70 A;  3O4Y A;  2LAP A;  5ER4 X;  1IQ3 A;  1IWQ A;  5D69 A;  4N1G A;  3C1V A;  2PSR A;  3WHU B;  2JPT A;  1SCV A;  1J7P A;  3RM1 A;  2LUX A;  4PDZ A;  5KTY A;  2IS9 A;  1JSA A;  1DJI A;  2JXL A;  3OB2 B;  1PSB A;  3DF0 B;  1HQV A;  3QRX A;  2GV5 A;  1M45 A;  1OMD A;  3GK2 A;  2NCP A;  1C7W A;  1B47 A;  2M7N A;  1QLK A;  3JVT C;  1M39 A;  1K2H A;  1KSO A;  2LCP A;  1J55 A;  3CWG A;  1WLZ A;  1W7J B;  2KI4 C;  1UP5 A;  5D7F A;  2KI4 B;  2PMY A;  3AKB A;  2ZFD A;  1LA0 A;  1TRF A;  3I5F C;  3I5F B;  1XO5 A;  2LE9 B;  3WNX B;  1EH2 A;  4BY4 A;  3PN7 C;  1BJF A;  3PN7 B;  1DTL A;  1CFP A;  3NXA A;  4M2Q A;  5I2O A;  3BUX B;  1LIN A;  4FTG A;  4OKH A;  3BOW B;  2EHB A;  2EGD A;  2F2O A;  4PHJ A;  4ETO A;  1YVL A;  2BBM A;  2L2E A;  1PVA A;  5IBW A;  1JBA A;  2M97 A;  1QTX A;  3CR5 X;  3PLF B;  1U5I B;  1SRA A;  1XK4 C;  3MSE B;  2K0J A;  1SL8 A;  2K2A A;  4R1E A;  3VGO A;  5HKZ A;  1S6I A;  1K8U A;  2JTZ A;  1X02 A;  3BUM B;  2HET A;  2L0P A;  2BE6 A;  1ZMZ A;  2L98 A;  4YBH B;  4YGA A;  3TDZ A;  1S36 A;  1TNQ A;  1PUL A;  2M9G A;  3EVR A;  5AER A;  1LKJ A;  1MQ1 A;  2JOJ A;  3A4U B;  1UWO A;  3IQQ A;  1BF5 A;  2BCX A;  3BUN B;  2VRG A;  4FQO A;  2RGI A;  3SG2 A;  4MSP A;  1NCY A;  2KFH A;  2LAN A;  2WCF A;  2LV7 A;  4PAL A;  2BKI B;  5CPV A;  1B1G A;  2Q4U A;  1A2X A;  4NDB A;  3SIA A;  1IKU A;  5HKW A;  1GJY A;  2M3W A;  3DVK A;  4PHK A;  2JT8 A;  2LMT A;  1L2O B;  1B7T Y;  2OS8 C;  1CLM A;  4DRW A;  2PVB A;  1NX0 A;  2L50 A;  2F3Z A;  1A75 A;  1B8L A;  2Y5I A;  4GBA A;  4NDC A;  1A29 A;  2PRU A;  3O6B A;  3DVM A;  3EVU A;  1JFK A;  2MLE C;  2Q91 A;  2JU0 A;  1SL9 A;  4ZCU A;  1OZO A;  2BE4 A;  1BT6 A;  1PVB A;  1HT9 A;  4ORC B;  2JT0 A;  2EC6 C;  1BR1 B;  1KWO B;  2EC6 B;  1SR6 C;  3SIB A;  1E8A A;  1SR6 B;  1NCZ A;  1KK7 Y;  1WDC C;  2JNX A;  2M1U A;  5F6T A;  1WDC B;  1J7R A;  3LCP C;  1YRU B;  1UHH A;  1N2D A;  3LK0 A;  4DIR A;  4OR9 B;  1BOC A;  2JC2 A;  1UHN A;  3TS5 B;  1XFZ O;  3DF0 A;  1CKK A;  1IG5 A;  2LM5 A;  4YI9 A;  2FCE A;  3D10 A;  2CTN A;  2E6W A;  1Y6W A;  4P2Y B;  2HQ8 A;  1SCM B;  1F4O A;  4IL1 A;  4CLN A;  2CT9 A;  1MXL C;  2LP2 A;  3NSK A;  4CPV A;  3SG3 A;  3OP0 A;  2GGM A;  2Y1M A;  2ZN9 A;  1SPY A;  4GNK B;  3GOF A;  2I18 A;  1XA5 A;  3BUW B;  3EK8 A;  4F0Z B;  1CNP A;  4I5N B;  1WLM A;  3BOW A;  3LL8 B;  3VRQ A;  1ZFS A;  1IJ6 A;  1A75 B;  5K89 A;  1RWY A;  2WC8 A;  3KHE A;  1Y1A A;  1YUT A;  2KAY A;  1KK7 Z;  1JWD A;  4CFQ A;  1XK4 A;  1KQV A;  2FOT A;  2NLN A;  4MZL A;  2NXQ A;  3O78 A;  1AVS A;  2OTG B;  2HPS A;  1BG1 A;  2F2P A;  4QJ4 B;  3ICB A;  3DVE A;  1MXE A;  3CZT X;  3BUO B;  3PAT A;  4GGN A;  2LMV A;  1UHK A;  3EK4 A;  1B8R A;  1GGZ A;  1K9K A;  1WRL A;  1YR5 A;  3NSL A;  4JWQ A;  3VRR A;  1PSR A;  3HX4 A;  5I2L A;  4TNC A;  4PHN A;  1ALV A;  1KK8 C;  1M46 A;  2COL B;  4ZCV A;  1KK8 B;  4MVF A;  1TOP A;  1G33 A;  2H2K A;  3JVT B;  3SJS A;  1QXP A;  1SL7 A;  2JRF A;  4ORA B;  1JF2 A;  2K61 A;  3M0W A;  4MEW A;  2HQW A;  3HCM A;  2LVJ A;  5DKR A;  1F71 A;  1DGV A;  5B8I B;  1CLL A;  1XFV O;  1RTP 1;  3K21 A;  1OSA A;  4Q04 A;  5GQQ C;  1SKT A;  2LHL A;  5HKY A;  1J7Q A;  2M8U A;  1YTZ C;  2F8P A;  1B4C A;  1F54 A;  4HRG A;  1TIZ A;  3F45 A;  2NZ0 A;  3WXA A;  2AAO A;  3OX5 A;  4XYN A;  4U8D A;  4A4C A;  4MN0 A;  1Y1X A;  1SW8 A;  3O2P A;  1EG4 A;  1UUS A;  4HRH A;  2WCB A;  2FJU B;  4YGE B;  1J1E A;  3CTN A;  4PE4 A;  1IJ5 A;  1FI5 A;  1YVH A;  2KAV A;  2BL0 C;  1F55 A;  2BL0 B;  1DF0 B;  2KI6 C;  2M1K B;  4GAO A;  1UUR A;  1EL4 A;  1VRK A;  4DCK A;  1M31 A;  1IH0 A;  2LVK A;  3D0Y B;  1KFX L;  1JFJ A;  4GPL B;  2P6B B;  4UPG A;  2KYC A;  2WOR A;  3CR2 A;  4N5X A;  1REC A;  4GGF C;  4PE0 A;  1SYM A;  1JC2 A;  4D1E A;  5KU1 A;  1W7I B;  1QV0 A;  1FPW A;  1OE9 B;  2K7C A;  3OB1 B;  1JUO A;  2KQ6 A;  2K8M B;  2B1U A;  2JWW A;  2JZI A;  2KBI A;  2ZRT A;  5DKQ A;  2OS8 B;  1QS7 A;  2CCM A;  2WOS A;  4QJ3 B;  3CGA A;  4WQ3 A;  2PAL A;  4E68 A;  3TZ1 A;  3I5I C;  2LVI A;  3NSO A;  1CDL A;  3I5I B;  2DOQ A;  4MZK A;  1XVJ A;  2G2B A;  1K90 D;  3OHM B;  1SK6 D;  1K94 A;  1CMF A;  1B9A A;  1QX7 A;  5CSJ A;  2ZN8 A;  4L9M A;  2LP3 A;  1OMR A;  2TN4 A;  1CM4 A;  4NQG A;  3A8R A;  1XFX O;  2PAS A;  4JPZ B;  1QAT A;  1D1O A;  1QIW A;  1SNL A;  2R2I A;  1CM1 A;  1NWD A;  4OCI A;  1AJ5 A;  3SG6 A;  1TNW A;  2KHN A;  3KPX A;  3AAK A;  3EKH A;  1K9P A;  1YUR A;  1ZAC A;  2CNP A;  2M7L A;  3E3R A;  1V1G A;  3KEV A;  1BR4 B;  5HYD A;  3GK4 X;  4XJK B;  1BU3 A;  2M0R A;  2O60 A;  1NX2 A;  2LNK A;  2LC5 A;  3DD4 A;  1F8H A;  2G9B A;  5AEQ A;  1B8C A;  1G4Y R;  1ZUZ A;  2V53 A;  2JT3 A;  5PAL A;  1CDP A;  2KFG A;  1C07 A;  1S6J A;  1CB1 A;  1XFW O;  1DGU A;  1CDN A;  1G8I A;  2QAC A;  1AP4 A;  2FCD A;  5HLO A;  2JNF A;  2KYF A;  2LHI A;  1NX1 A;  1ODB A;  3FIA A;  3BQ3 A;  3IQO A;  4M2O A;  1DJX A;  1KQM C;  2D8N A;  1MWN A;  2KBM A;  1KQM B;  2ZND A;  1KSM A;  2KI6 D;  2L4I A;  1GQM A;  1KFU L;  1MHO A;  2L5X B;  4HSZ A;  1LVC D;  1H8B A;  4DS7 A;  2BCA A;  2MRD A;  1DF0 A;  3FWB A;  5CSF A;  4YRU A;  1DJZ A;  2KFF A;  3D0Y A;  5ER5 A;  3IF7 A;  3TUY C;  2CXJ A;  3TUY B;  4GUK A;  2BBN A;  2I7A A;  2LUC A;  1Y1U A;  4GGF A;  1QX2 A;  2ZNE A;  3PAL A;  1YUS A;  1OZS A;  2KQY A;  1PRW A;  1DJG A;  1N65 A;  2LLT A;  3GK1 A;  1EJ3 A;  4CID A;  2KSP A;  4CFR A;  2KDH A;  2NCO A;  2H61 C;  1CFF A;  5I2Q A;  4MLW A;  4AOM A;  4JQ0 D;  2ISD A;  1NSH A;  3AKA A;  3CLN A;  1CLB A;  1YX8 A;  2KAX A;  2MJW B;  3ZNI A;  3KF9 A;  5J3X A;  3VRN A;  5I8N A;  1MR8 A;  4PE7 A;  2WND A;  1H4B A;  5AFP A;  3FS7 A;  5AXI A;  2MAZ A;  2K2F A;  5JOL A;  3CS1 A;  2K7O A;  3EK7 A;  3EKJ A;  1MF8 B;  4YI8 A;  3PSR A;  1S3P A;  1TCF A;  3BXK A;  1NYA A;  1WY9 A;  1SMG A;  2L51 A;  2O5G A;  4PE1 A;  1OOJ A;  3VRO A;  4C0J A;  2MHH A;  1QLS A;  4M2P A;  1QVI Y;  1R6P A;  1DVI A;  1TNX A;  2QPT A;  4USL A;  1QAS A;  1SY9 A;  1OMV A;  4C0L A;  3LK1 A;  1IGV A;  4YGD B;  4YGC B;  2WCE A;  1YX7 A;  2CBL A;  2MLF C;  2LLS A;  2JTT A;  3SG7 A;  3BYA A; 
#chains in the Genus database with same CATH topology
 3N7H A;  4MZJ A;  5KSZ A;  1GGW A;  2Y1N A;  5JJG A;  3RLZ A;  1K95 A;  1KFX S;  4ICB A;  1TNP A;  1BOD A;  4HRE E;  1SSE B;  4XJK A;  2I2R E;  4WRI A;  3D76 A;  2H8V A;  3DY9 A;  3D75 A;  1BLQ A;  5DIC A;  4OVN F;  3CYZ A;  2AUC A;  1LXF C;  5AAN A;  2LVV A;  3LLE A;  2KOT A;  1LA3 A;  2KLD A;  1IRJ A;  1WRK A;  2I94 A;  2JPO A;  1YRT B;  3R1O A;  3B88 A;  1F4Q A;  5DKN A;  1QVI Z;  2SAS A;  5CSI A;  2QEH A;  3OBV A;  1XFY O;  2F33 A;  4AQJ A;  3OX6 A;  1AHR A;  1K9U A;  2K7B A;  1WRZ A;  1OOF A;  1J1D A;  1J7O A;  1QX5 B;  4WQ2 A;  1N0Y A;  1QIV A;  4MBE A;  4N1F A;  1AJ4 A;  1Y0V H;  1C7V A;  2LLU A;  5BPJ A;  2JUL A;  3TDU A;  1DMO A;  1RFJ A;  4OV2 A;  4BY5 A;  1L2O C;  5HL1 A;  1NPQ A;  3PFV A;  2MBX A;  2K7D A;  5TNC A;  3WHT B;  3KO0 A;  2ZKM X;  2KNE A;  1BMO A;  3PJI A;  2GTE A;  1LS8 A;  1IQ5 A;  2M29 A;  3CDN A;  2M49 B;  2KGR A;  1QJT A;  2F3Y A;  2BKH B;  1ALW A;  3JTD C;  1DJY A;  4ORB B;  3JTD B;  5CSN A;  1PAL A;  1TCO B;  3D77 A;  1S1E A;  3FWC A;  1V1F A;  3H4S E;  1YUU A;  2SCP A;  1CDM A;  1Q80 A;  1FW4 A;  4I5K A;  1XYD A;  4PHM A;  1TTX A;  3SG4 A;  1NCX A;  1KWO C;  1EG3 A;  2LMU A;  2OPO A;  3DVJ A;  1S5G Y;  3VRP A;  1UHI A;  3AAJ A;  1EXR A;  1DJH A;  2H61 A;  2A4J A;  3NHT A;  4INX A;  4A4B A;  1NX3 A;  1JF0 A;  1FF1 A;  1FBV A;  4AQI A;  1CTR A;  1AUI B;  4I5J A;  1MUX A;  3TDI A;  5FYX A;  3TS5 C;  1PK0 D;  1A4P A;  3CR4 X;  4GFT A;  3OGN A;  4QJ5 B;  2HF5 A;  2BEC A;  1L7Z A;  1TN4 A;  3S0F A;  1XFU O;  2MA2 A;  1B7T Z;  4PCW A;  4YGB B;  1A03 A;  1AK8 A;  2L4H A;  3SG5 A;  1SCM C;  1R2U A;  4NDD A;  1OQP A;  4P5O E;  2GGZ A;  3CZ1 A;  4MRX A;  2BCB A;  3DZT A;  1DT7 B;  3I5G C;  5HLV A;  3DYE A;  3I5G B;  3ZWH A;  3VB1 A;  1ZOT B;  1RJV A;  2JXC A;  1UHJ A;  1KFU S;  4MRY A;  1K96 A;  4DUQ A;  1NP8 A;  1S26 D;  1CFD A;  1RK9 A;  2Y4Q A;  1M63 B;  1CMG A;  1S5G Z;  3PM8 A;  1KCY A;  1NUB A;  1NIW A;  3EG5 B;  4I5L B;  1QV1 A;  1U5I A;  1OOG A;  1K93 D;  1FI6 A;  5G08 A;  3EVV A;  1RRO A;  2KGB C;  2JQ6 A;  1S6C A;  1DC1 A;  3I5H C;  4C0K A;  3I5H B;  2E30 A;  2AMI A;  2ZRS A;  3NSI A;  1SBJ A;  1DJW A;  2OTG C;  3BJH A;  3D73 A;  3UO9 A;  1CFC A;  1F70 A;  3O4Y A;  2LAP A;  5ER4 X;  1TUZ A;  1IWQ A;  1IQ3 A;  5D69 A;  4N1G A;  3C1V A;  2PSR A;  3WHU B;  2JPT A;  1SCV A;  1J7P A;  3RM1 A;  4DIR A;  2LUX A;  4PDZ A;  5KTY A;  2IS9 A;  1JSA A;  1DJI A;  2JXL A;  3OB2 B;  1PSB A;  3DF0 B;  1HQV A;  1QWV A;  2GV5 A;  3QRX A;  5FI2 A;  1M45 A;  1OMD A;  3GK2 A;  2NCP A;  1C7W A;  1B47 A;  2M7N A;  1QLK A;  2WCM A;  3JVT C;  1M39 A;  1K2H A;  1KSO A;  2LCP A;  1J55 A;  3CWG A;  1WLZ A;  1W7J B;  2KI4 C;  1UP5 A;  5D7F A;  2KI4 B;  2PMY A;  3AKB A;  3S0E A;  2ZFD A;  1LA0 A;  1TRF A;  3I5F C;  3I5F B;  1XO5 A;  2LE9 B;  3WNX B;  1EH2 A;  4BY4 A;  3PN7 C;  1BJF A;  3PN7 B;  1DTL A;  1CFP A;  3NXA A;  4M2Q A;  3UNW A;  5I2O A;  3BUX B;  1LIN A;  4FTG A;  4OKH A;  3BOW B;  2EHB A;  2EGD A;  2F2O A;  4PHJ A;  4ETO A;  1YVL A;  2BBM A;  2L2E A;  1PVA A;  5IBW A;  1JBA A;  2M97 A;  3CZ2 A;  1QTX A;  3CR5 X;  3PLF B;  1U5I B;  3IVT A;  1SRA A;  1XK4 C;  3MSE B;  2K0J A;  1SL8 A;  2K2A A;  4R1E A;  3VGO A;  5HKZ A;  1S6I A;  1K8U A;  2JTZ A;  1X02 A;  1OOH A;  3BUM B;  2HET A;  2L0P A;  2BE6 A;  1ZMZ A;  2L98 A;  4YBH B;  4YGA A;  3TDZ A;  1S36 A;  1TNQ A;  3SS3 A;  1PUL A;  2ERB A;  2M9G A;  3EVR A;  5AER A;  1LKJ A;  1MQ1 A;  2JOJ A;  3A4U B;  2QEB A;  1UWO A;  3IQQ A;  1BF5 A;  2BCX A;  3BUN B;  2VRG A;  4FQO A;  2RGI A;  3SG2 A;  4MSP A;  1NCY A;  2KFH A;  2LAN A;  2WCF A;  2LV7 A;  4PAL A;  2BKI B;  5CPV A;  1B1G A;  2Q4U A;  1A2X A;  4NDB A;  4INW A;  3SIA A;  1IKU A;  5HKW A;  1GJY A;  2M3W A;  3DVK A;  4PHK A;  2JT8 A;  1XFR A;  2LMT A;  1L2O B;  1B7T Y;  5EL2 A;  2OS8 C;  1CLM A;  4DRW A;  2PVB A;  1NX0 A;  2L50 A;  2F3Z A;  1A75 A;  1B8L A;  2Y5I A;  3BFH A;  4GBA A;  4NDC A;  1A29 A;  2PRU A;  2K60 A;  3O6B A;  3DVM A;  1ORG A;  3EVU A;  3D74 A;  1JFK A;  2MLE C;  3B87 A;  2Q91 A;  2JU0 A;  1SL9 A;  3BFA A;  4ZCU A;  1OZO A;  2BE4 A;  1BT6 A;  1PVB A;  2L2C A;  1HT9 A;  4JD9 A;  5FI6 A;  4ORC B;  2JT0 A;  3B86 A;  4IJ7 A;  2EC6 C;  3S0B A;  1BR1 B;  1KWO B;  2EC6 B;  4PT1 A;  1SR6 C;  3DXL A;  3SIB A;  1E8A A;  1SR6 B;  1NCZ A;  5D3O A;  1KK7 Y;  1WDC C;  2JNX A;  2M1U A;  5F6T A;  1WDC B;  1J7R A;  3LCP C;  1YRU B;  1UHH A;  1N2D A;  3LK0 A;  4JKT A;  3L4A A;  4OR9 B;  1BOC A;  2JC2 A;  1UHN A;  3TS5 B;  1XFZ O;  3DF0 A;  3S0D A;  1CKK A;  1IG5 A;  1Z4H A;  2LM5 A;  4YI9 A;  2FCE A;  3D10 A;  2CTN A;  2E6W A;  1Y6W A;  4P2Y B;  2HQ8 A;  1SCM B;  1C3Z A;  2QDI A;  1F4O A;  4IL1 A;  2P71 A;  4CLN A;  2CT9 A;  1MXL C;  3B6X A;  2LP2 A;  3NSK A;  4CPV A;  3SG3 A;  3OP0 A;  2GGM A;  2Y1M A;  2ZN9 A;  1SPY A;  4GNK B;  3GOF A;  2I18 A;  1XA5 A;  2YGU A;  3BUW B;  3EK8 A;  4F0Z B;  1CNP A;  4I5N B;  1WLM A;  3R1P A;  1Z2C B;  3BOW A;  3LL8 B;  3VRQ A;  1ZFS A;  1IJ6 A;  3L4L A;  1A75 B;  5K89 A;  1RWY A;  2L5Y A;  2WC8 A;  3KHE A;  1Y1A A;  1YUT A;  2KAY A;  1KK7 Z;  1JWD A;  4CFQ A;  1GM0 A;  1XK4 A;  1KQV A;  2FOT A;  2NLN A;  1OW4 A;  4MZL A;  2NXQ A;  3O78 A;  1C3Y A;  1AVS A;  2OTG B;  1T14 A;  2HPS A;  1BG1 A;  2F2P A;  4QJ4 B;  3ICB A;  3DVE A;  1MXE A;  3CZT X;  3BUO B;  3PAT A;  4GGN A;  5I94 A;  3L47 A;  2LMV A;  1UHK A;  3EK4 A;  1B8R A;  1GGZ A;  1K9K A;  1WRL A;  1YR5 A;  3NSL A;  4JWQ A;  3VRR A;  1IIO A;  1PSR A;  3HX4 A;  2PYQ A;  5I2L A;  4TNC A;  4PHN A;  1ALV A;  1KK8 C;  1M46 A;  2COL B;  4ZCV A;  1KK8 B;  4MVF A;  1TOP A;  1G33 A;  2H2K A;  3SS4 A;  3JVT B;  3SJS A;  1QXP A;  1SL7 A;  2JRF A;  4ORA B;  1JF2 A;  2K61 A;  3O4X A;  3M0W A;  1P28 A;  2WCH A;  4MEW A;  2HQW A;  3HCM A;  2LVJ A;  5DKR A;  1F71 A;  4KYN A;  1DGV A;  5B8I B;  1CLL A;  1XFV O;  1RTP 1;  3K21 A;  3R1V A;  1OSA A;  4Q04 A;  5GQQ C;  1SKT A;  2LHL A;  5HKY A;  1J7Q A;  2M8U A;  1YTZ C;  2F8P A;  1B4C A;  1F54 A;  4HRG A;  1TIZ A;  3F45 A;  2NZ0 A;  3WXA A;  2AAO A;  3OX5 A;  2QEV A;  4U8D A;  4XYN A;  4A4C A;  4MN0 A;  1Y1X A;  1SW8 A;  3O2P A;  1EG4 A;  1UUS A;  4HRH A;  2WCB A;  2FJU B;  4YGE B;  1J1E A;  3CTN A;  4PE4 A;  1IJ5 A;  1FI5 A;  1YVH A;  2P70 A;  2KAV A;  2BL0 C;  1F55 A;  2BL0 B;  1DF0 B;  2KI6 C;  2M1K B;  2WCL A;  4GAO A;  1UUR A;  1EL4 A;  1VRK A;  3FE8 A;  1OOI X;  4DCK A;  1M31 A;  2FJY A;  1IH0 A;  2LVK A;  3D0Y B;  1KFX L;  1JFJ A;  4GPL B;  2P6B B;  4UPG A;  2KYC A;  2WOR A;  3CR2 A;  4N5X A;  1REC A;  4GGF C;  4PE0 A;  1SYM A;  3S0A A;  1JC2 A;  4D1E A;  3Q8I A;  5KU1 A;  1W7I B;  1DEL A;  1QV0 A;  1FPW A;  1OE9 B;  2K7C A;  3OB1 B;  3S0G A;  1JUO A;  2KQ6 A;  2K8M B;  2B1U A;  2JWW A;  2JZI A;  2KBI A;  2ZRT A;  5DKQ A;  2OS8 B;  1QS7 A;  2CCM A;  4OZD A;  2WOS A;  4QJ3 B;  3CGA A;  4WQ3 A;  2PAL A;  4E68 A;  2KPH A;  3TZ1 A;  3I5I C;  2LVI A;  3NSO A;  1CDL A;  3I5I B;  2DOQ A;  4MZK A;  1XVJ A;  2G2B A;  1K90 D;  1W9Z A;  1SK6 D;  1K94 A;  1DQE A;  3OHM B;  1B9A A;  1QX7 A;  5FI7 A;  1CMF A;  5CSJ A;  2ZN8 A;  4L9M A;  2LP3 A;  1TWO A;  3CAB A;  1OMR A;  2QEO A;  2TN4 A;  1CM4 A;  4NQG A;  3A8R A;  1XFX O;  2PAS A;  4JPZ B;  1QAT A;  1D1O A;  2WC5 A;  1QIW A;  1SNL A;  2R2I A;  1CM1 A;  1NWD A;  2WCJ A;  4OCI A;  1AJ5 A;  3SG6 A;  1TNW A;  2KHN A;  3BFB A;  3KPX A;  3AAK A;  3EKH A;  1K9P A;  1YUR A;  1ZAC A;  2CNP A;  2M7L A;  3E3R A;  1V1G A;  3KEV A;  1BR4 B;  5HYD A;  3GK4 X;  4XJK B;  3NHI A;  1BU3 A;  2M0R A;  2O60 A;  1NX2 A;  2LNK A;  2LC5 A;  3DD4 A;  1F8H A;  2G9B A;  5AEQ A;  1B8C A;  1G4Y R;  1ZUZ A;  2V53 A;  2JT3 A;  5PAL A;  1CDP A;  2KFG A;  1C07 A;  1S6J A;  1CB1 A;  1XFW O;  4FQT A;  1DGU A;  1CDN A;  1G8I A;  2QAC A;  1AP4 A;  2FCD A;  5HLO A;  2WCK A;  2JNF A;  2KYF A;  2LHI A;  1NX1 A;  1ODB A;  2BNX A;  3SS5 A;  3FIA A;  3BQ3 A;  3IQO A;  4M2O A;  1DJX A;  1KQM C;  2D8N A;  1MWN A;  2KBM A;  1KQM B;  2ZND A;  1TUJ A;  1KSM A;  2KI6 D;  2L4I A;  3QME A;  1GQM A;  1KFU L;  1MHO A;  2L5X B;  4HSZ A;  1LVC D;  1H8B A;  4DS7 A;  2BCA A;  2MRD A;  1DF0 A;  3FWB A;  3R72 A;  5CSF A;  4YRU A;  1DJZ A;  4F7F A;  2KFF A;  3D0Y A;  5ER5 A;  3IF7 A;  3TUY C;  2CXJ A;  3TUY B;  4GUK A;  2BBN A;  2I7A A;  2LUC A;  1Y1U A;  4GGF A;  1QX2 A;  2ZNE A;  3FE6 A;  3PAL A;  1YUS A;  1OZS A;  2KQY A;  1PRW A;  3CZ0 A;  1DJG A;  1N65 A;  2LLT A;  3GK1 A;  1EJ3 A;  3NGV A;  4CID A;  2BAP A;  2KSP A;  4CFR A;  2KDH A;  2NCO A;  2H61 C;  1CFF A;  5I2Q A;  1DEK A;  4MLW A;  4AOM A;  4JQ0 D;  2ISD A;  1NSH A;  3AKA A;  3CLN A;  3RZS A;  3PM2 A;  1CLB A;  1YX8 A;  2KAX A;  2MJW B;  3ZNI A;  2PQL A;  3KF9 A;  5J3X A;  3VRN A;  5I8N A;  1MR8 A;  4PE7 A;  2WND A;  1H4B A;  5AFP A;  3FS7 A;  5AXI A;  2MAZ A;  2K2F A;  5JOL A;  3CS1 A;  2K7O A;  3EK7 A;  3EKJ A;  1MF8 B;  4YI8 A;  3PSR A;  1S3P A;  1TCF A;  3BXK A;  1NYA A;  1WY9 A;  1SMG A;  2L51 A;  2O5G A;  3B7A A;  1OOJ A;  2KLE A;  3K1E A;  4PE1 A;  2MHH A;  3VRO A;  4C0J A;  1QLS A;  4M2P A;  1QVI Y;  3V2L A;  1R6P A;  1DVI A;  1TNX A;  2QPT A;  4USL A;  1QAS A;  1SY9 A;  1OMV A;  4C0L A;  3D78 A;  3LK1 A;  3FE9 A;  1IGV A;  4YGD B;  4YGC B;  2WCE A;  1YX7 A;  2CBL A;  2MLF C;  2LLS A;  2WC6 A;  2JTT A;  3SG7 A;  3BYA A; 
#chains in the Genus database with same CATH homology
 5KSZ A;  4MZJ A;  1GGW A;  2Y1N A;  5JJG A;  3RLZ A;  1K95 A;  1KFX S;  4ICB A;  1TNP A;  1BOD A;  4HRE E;  4XJK A;  2I2R E;  4WRI A;  1BLQ A;  4OVN F;  2AUC A;  1LXF C;  5AAN A;  2LVV A;  3LLE A;  2KOT A;  1LA3 A;  1IRJ A;  1WRK A;  2I94 A;  1YRT B;  1F4Q A;  5DKN A;  1QVI Z;  2SAS A;  5CSI A;  1XFY O;  2F33 A;  4AQJ A;  3OX6 A;  1AHR A;  1K9U A;  2K7B A;  1WRZ A;  1J1D A;  1J7O A;  1QX5 B;  4WQ2 A;  1N0Y A;  1QIV A;  4MBE A;  4N1F A;  1AJ4 A;  1Y0V H;  1C7V A;  2LLU A;  5BPJ A;  2JUL A;  3TDU A;  1DMO A;  1RFJ A;  4OV2 A;  4BY5 A;  1L2O C;  1NPQ A;  3PFV A;  2MBX A;  2K7D A;  5TNC A;  3WHT B;  3KO0 A;  2ZKM X;  2KNE A;  1BMO A;  1IQ5 A;  2M29 A;  2M49 B;  2KGR A;  1QJT A;  2F3Y A;  2BKH B;  1ALW A;  3JTD C;  1DJY A;  4ORB B;  3JTD B;  5CSN A;  1PAL A;  1TCO B;  3FWC A;  1S1E A;  1V1F A;  3H4S E;  1YUU A;  2SCP A;  1CDM A;  1Q80 A;  1FW4 A;  4I5K A;  1XYD A;  4PHM A;  1TTX A;  3SG4 A;  1NCX A;  1KWO C;  1EG3 A;  2LMU A;  2OPO A;  3DVJ A;  1S5G Y;  3VRP A;  1UHI A;  3AAJ A;  1EXR A;  1DJH A;  2H61 A;  2A4J A;  4A4B A;  1NX3 A;  1JF0 A;  1FF1 A;  1FBV A;  4AQI A;  1CTR A;  1AUI B;  4I5J A;  1MUX A;  3TDI A;  5FYX A;  3TS5 C;  1PK0 D;  1A4P A;  3CR4 X;  4GFT A;  4QJ5 B;  2HF5 A;  2BEC A;  1L7Z A;  1TN4 A;  1AK8 A;  1XFU O;  2MA2 A;  1B7T Z;  4PCW A;  4YGB B;  1A03 A;  2L4H A;  3SG5 A;  1SCM C;  1R2U A;  4NDD A;  1OQP A;  4P5O E;  2GGZ A;  4MRX A;  2BCB A;  1DT7 B;  3I5G C;  5HLV A;  3I5G B;  3ZWH A;  1ZOT B;  1RJV A;  2JXC A;  1UHJ A;  1KFU S;  4MRY A;  1K96 A;  4DUQ A;  1NP8 A;  1S26 D;  1CFD A;  1RK9 A;  2Y4Q A;  1M63 B;  1CMG A;  1S5G Z;  3PM8 A;  1KCY A;  1NUB A;  1NIW A;  4I5L B;  1QV1 A;  1U5I A;  1K93 D;  1FI6 A;  5G08 A;  3EVV A;  1RRO A;  2KGB C;  2JQ6 A;  1S6C A;  3I5H C;  4C0K A;  3I5H B;  2E30 A;  2AMI A;  2ZRS A;  3NSI A;  1SBJ A;  1DJW A;  2OTG C;  1CFC A;  1F70 A;  3O4Y A;  2LAP A;  5ER4 X;  1IQ3 A;  1IWQ A;  5D69 A;  4N1G A;  3C1V A;  2PSR A;  3WHU B;  2JPT A;  1SCV A;  1J7P A;  3RM1 A;  2LUX A;  4PDZ A;  5KTY A;  2IS9 A;  1JSA A;  1DJI A;  2JXL A;  3OB2 B;  1PSB A;  3DF0 B;  1HQV A;  3QRX A;  2GV5 A;  1M45 A;  1OMD A;  3GK2 A;  2NCP A;  1C7W A;  1B47 A;  2M7N A;  1QLK A;  3JVT C;  1M39 A;  1K2H A;  1KSO A;  2LCP A;  1J55 A;  3CWG A;  1WLZ A;  1W7J B;  2KI4 C;  1UP5 A;  5D7F A;  2KI4 B;  2PMY A;  3AKB A;  2ZFD A;  1LA0 A;  1TRF A;  3I5F C;  3I5F B;  1XO5 A;  2LE9 B;  3WNX B;  1EH2 A;  4BY4 A;  3PN7 C;  1BJF A;  3PN7 B;  1DTL A;  1CFP A;  3NXA A;  4M2Q A;  5I2O A;  3BUX B;  1LIN A;  4FTG A;  4OKH A;  3BOW B;  2EHB A;  2EGD A;  2F2O A;  4PHJ A;  4ETO A;  1YVL A;  2BBM A;  2L2E A;  1PVA A;  5IBW A;  1JBA A;  2M97 A;  1QTX A;  3CR5 X;  3PLF B;  1U5I B;  1SRA A;  1XK4 C;  3MSE B;  2K0J A;  1SL8 A;  2K2A A;  4R1E A;  3VGO A;  5HKZ A;  1S6I A;  1K8U A;  2JTZ A;  1X02 A;  3BUM B;  2HET A;  2L0P A;  2BE6 A;  1ZMZ A;  2L98 A;  4YBH B;  4YGA A;  3TDZ A;  1S36 A;  1TNQ A;  1PUL A;  2M9G A;  3EVR A;  5AER A;  1LKJ A;  1MQ1 A;  2JOJ A;  3A4U B;  1UWO A;  3IQQ A;  1BF5 A;  2BCX A;  3BUN B;  2VRG A;  4FQO A;  2RGI A;  3SG2 A;  4MSP A;  1NCY A;  2KFH A;  2LAN A;  2WCF A;  2LV7 A;  4PAL A;  2BKI B;  5CPV A;  1B1G A;  2Q4U A;  1A2X A;  4NDB A;  3SIA A;  1IKU A;  5HKW A;  1GJY A;  2M3W A;  3DVK A;  4PHK A;  2JT8 A;  2LMT A;  1L2O B;  1B7T Y;  2OS8 C;  1CLM A;  4DRW A;  2PVB A;  1NX0 A;  2L50 A;  2F3Z A;  1A75 A;  1B8L A;  2Y5I A;  4GBA A;  4NDC A;  1A29 A;  2PRU A;  3O6B A;  3DVM A;  3EVU A;  1JFK A;  2MLE C;  2Q91 A;  2JU0 A;  1SL9 A;  4ZCU A;  1OZO A;  2BE4 A;  1BT6 A;  1PVB A;  1HT9 A;  4ORC B;  2JT0 A;  2EC6 C;  1BR1 B;  1KWO B;  2EC6 B;  1SR6 C;  3SIB A;  1E8A A;  1SR6 B;  1NCZ A;  1KK7 Y;  1WDC C;  2JNX A;  2M1U A;  5F6T A;  1WDC B;  1J7R A;  3LCP C;  1YRU B;  1UHH A;  1N2D A;  3LK0 A;  4DIR A;  4OR9 B;  1BOC A;  2JC2 A;  1UHN A;  3TS5 B;  1XFZ O;  3DF0 A;  1CKK A;  1IG5 A;  2LM5 A;  4YI9 A;  2FCE A;  3D10 A;  2CTN A;  2E6W A;  1Y6W A;  4P2Y B;  2HQ8 A;  1SCM B;  1F4O A;  4IL1 A;  4CLN A;  2CT9 A;  1MXL C;  2LP2 A;  3NSK A;  4CPV A;  3SG3 A;  3OP0 A;  2GGM A;  2Y1M A;  2ZN9 A;  1SPY A;  4GNK B;  3GOF A;  2I18 A;  1XA5 A;  3BUW B;  3EK8 A;  4F0Z B;  1CNP A;  4I5N B;  1WLM A;  3BOW A;  3LL8 B;  3VRQ A;  1ZFS A;  1IJ6 A;  1A75 B;  5K89 A;  1RWY A;  2WC8 A;  3KHE A;  1Y1A A;  1YUT A;  2KAY A;  1KK7 Z;  1JWD A;  4CFQ A;  1XK4 A;  1KQV A;  2FOT A;  2NLN A;  4MZL A;  2NXQ A;  3O78 A;  1AVS A;  2OTG B;  2HPS A;  1BG1 A;  2F2P A;  4QJ4 B;  3ICB A;  3DVE A;  1MXE A;  3CZT X;  3BUO B;  3PAT A;  4GGN A;  2LMV A;  1UHK A;  3EK4 A;  1B8R A;  1GGZ A;  1K9K A;  1WRL A;  1YR5 A;  3NSL A;  4JWQ A;  3VRR A;  1PSR A;  3HX4 A;  5I2L A;  4TNC A;  4PHN A;  1ALV A;  1KK8 C;  1M46 A;  2COL B;  4ZCV A;  1KK8 B;  4MVF A;  1TOP A;  1G33 A;  2H2K A;  3JVT B;  3SJS A;  1QXP A;  1SL7 A;  2JRF A;  4ORA B;  1JF2 A;  2K61 A;  3M0W A;  4MEW A;  2HQW A;  3HCM A;  2LVJ A;  5DKR A;  1F71 A;  1DGV A;  5B8I B;  1CLL A;  1XFV O;  1RTP 1;  3K21 A;  1OSA A;  4Q04 A;  5GQQ C;  1SKT A;  2LHL A;  5HKY A;  1J7Q A;  2M8U A;  1YTZ C;  2F8P A;  1B4C A;  1F54 A;  4HRG A;  1TIZ A;  3F45 A;  2NZ0 A;  3WXA A;  2AAO A;  3OX5 A;  4XYN A;  4U8D A;  4A4C A;  4MN0 A;  1Y1X A;  1SW8 A;  3O2P A;  1EG4 A;  1UUS A;  4HRH A;  2WCB A;  2FJU B;  4YGE B;  1J1E A;  3CTN A;  4PE4 A;  1IJ5 A;  1FI5 A;  1YVH A;  2KAV A;  2BL0 C;  1F55 A;  2BL0 B;  1DF0 B;  2KI6 C;  2M1K B;  4GAO A;  1UUR A;  1EL4 A;  1VRK A;  4DCK A;  1M31 A;  1IH0 A;  2LVK A;  3D0Y B;  1KFX L;  1JFJ A;  4GPL B;  2P6B B;  4UPG A;  2KYC A;  2WOR A;  3CR2 A;  4N5X A;  1REC A;  4GGF C;  4PE0 A;  1SYM A;  1JC2 A;  4D1E A;  5KU1 A;  1W7I B;  1QV0 A;  1FPW A;  1OE9 B;  2K7C A;  3OB1 B;  1JUO A;  2KQ6 A;  2K8M B;  2B1U A;  2JWW A;  2JZI A;  2KBI A;  2ZRT A;  5DKQ A;  2OS8 B;  1QS7 A;  2CCM A;  2WOS A;  4QJ3 B;  3CGA A;  4WQ3 A;  2PAL A;  4E68 A;  3TZ1 A;  3I5I C;  2LVI A;  3NSO A;  1CDL A;  3I5I B;  2DOQ A;  4MZK A;  1XVJ A;  2G2B A;  1K90 D;  3OHM B;  1SK6 D;  1K94 A;  1CMF A;  1B9A A;  1QX7 A;  5CSJ A;  2ZN8 A;  4L9M A;  2LP3 A;  1OMR A;  2TN4 A;  1CM4 A;  4NQG A;  3A8R A;  1XFX O;  2PAS A;  4JPZ B;  1QAT A;  1D1O A;  1QIW A;  1SNL A;  2R2I A;  1CM1 A;  1NWD A;  4OCI A;  1AJ5 A;  3SG6 A;  1TNW A;  2KHN A;  3KPX A;  3AAK A;  3EKH A;  1K9P A;  1YUR A;  1ZAC A;  2CNP A;  2M7L A;  3E3R A;  1V1G A;  3KEV A;  1BR4 B;  5HYD A;  3GK4 X;  4XJK B;  1BU3 A;  2M0R A;  2O60 A;  1NX2 A;  2LNK A;  2LC5 A;  3DD4 A;  1F8H A;  2G9B A;  5AEQ A;  1B8C A;  1G4Y R;  1ZUZ A;  2V53 A;  2JT3 A;  5PAL A;  1CDP A;  2KFG A;  1C07 A;  1S6J A;  1CB1 A;  1XFW O;  1DGU A;  1CDN A;  1G8I A;  2QAC A;  1AP4 A;  2FCD A;  5HLO A;  2JNF A;  2KYF A;  2LHI A;  1NX1 A;  1ODB A;  3FIA A;  3BQ3 A;  3IQO A;  4M2O A;  1DJX A;  1KQM C;  2D8N A;  1MWN A;  2KBM A;  1KQM B;  2ZND A;  1KSM A;  2KI6 D;  2L4I A;  1GQM A;  1KFU L;  1MHO A;  2L5X B;  4HSZ A;  1LVC D;  1H8B A;  4DS7 A;  2BCA A;  2MRD A;  1DF0 A;  3FWB A;  5CSF A;  4YRU A;  1DJZ A;  2KFF A;  3D0Y A;  5ER5 A;  3IF7 A;  3TUY C;  2CXJ A;  3TUY B;  4GUK A;  2BBN A;  2I7A A;  2LUC A;  1Y1U A;  4GGF A;  1QX2 A;  2ZNE A;  3PAL A;  1YUS A;  1OZS A;  2KQY A;  1PRW A;  1DJG A;  1N65 A;  2LLT A;  3GK1 A;  1EJ3 A;  4CID A;  2KSP A;  4CFR A;  2KDH A;  2NCO A;  2H61 C;  1CFF A;  5I2Q A;  4MLW A;  4AOM A;  4JQ0 D;  2ISD A;  1NSH A;  3AKA A;  3CLN A;  1CLB A;  1YX8 A;  2KAX A;  2MJW B;  3ZNI A;  3KF9 A;  5J3X A;  3VRN A;  5I8N A;  1MR8 A;  4PE7 A;  2WND A;  1H4B A;  5AFP A;  3FS7 A;  5AXI A;  2MAZ A;  2K2F A;  5JOL A;  3CS1 A;  2K7O A;  3EK7 A;  3EKJ A;  1MF8 B;  4YI8 A;  3PSR A;  1S3P A;  1TCF A;  3BXK A;  1NYA A;  1WY9 A;  1SMG A;  2L51 A;  2O5G A;  4PE1 A;  1OOJ A;  3VRO A;  4C0J A;  2MHH A;  1QLS A;  4M2P A;  1QVI Y;  1R6P A;  1DVI A;  1TNX A;  2QPT A;  4USL A;  1QAS A;  1SY9 A;  1OMV A;  4C0L A;  3LK1 A;  1IGV A;  4YGD B;  4YGC B;  2WCE A;  1YX7 A;  2CBL A;  2MLF C;  2LLS A;  2JTT A;  3SG7 A;  3BYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...