1OMRA

Non-myristoylated wild-type bovine recoverin with calcium bound to ef-hand 3
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
201
structure length
201
Chain Sequence
b'GNSKSGALSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKLKEKKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords recoverin
molecule tags Metal binding protein
source organism Bos taurus
publication title Impact of N-terminal myristoylation on the Ca2+-dependent conformational transition in recoverin
pubmed doi rcsb
total genus 75
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2003-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1omrA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1omrA01
3KPXA 4CFRA 1A29A 1ALWA 2KFFA 1FW4A 1TTXA 3BOWB 1DJGA 1XFXO 3NXAA 2EC6C 1QVIY 3VRRA 2NCOA 4QJ5B 2WCFA 3KF9A 1DJZA 5JOLA 4MN0A 1RJVA 2CTNA 1Q80A 1KFUL 1OOJA 3SG4A 2K2AA 1SY9A 1UUSA 4YBHB 5D7FA 5BPJA 1IH0A 1F71A 1CMFA 1OMVA 1KWOB 2ZRSA 5DKNA 1XFYO 2L0PA 4DUQA 2L5XB 4I5LB 4CIDA 2LMTA 5FYXA 4P2YB 3VGOA 1IKUA 1SNLA 3SG7A 1Y0VH 1B1GA 2A4JA 2LC5A 3CGAA 4U8DA 3JTDC 4F0ZB 1X02A 1BU3A 5DKRA 4HRHA 3DVEA 1GGWA 2V53A 1PK0D 2EHBA 4XJKB 3M0WA 2LLSA 1FBVA 1IWQA 1KFUS 3KO0A 5CSFA 2BL0B 1S6CA 1B8CA 1S3PA 1M39A 1S6IA 2M97A 3BUWB 3I5IC 3TS5C 3TDZA 1SYMA 1TN4A 2AMIA 1SCMC 1SCMB 1BT6A 1DF0A 3O4YA 4ORAB 2M7LA 2MAZA 2BBMA 2WCBA 2GV5A 3OP0A 2OS8C 2HPSA 2JXCA 4OV2A 1NX2A 3DVMA 1S26D 2WOSA 1WRZA 1CDPA 1MWNA 1NSHA 1FF1A 1J1DA 1F70A 2M1KB 1OZOA 2M29A 3CR5X 1J55A 5AEQA 2MA2A 3JTDB 3ZWHA 1N2DA 2KQYA 2OTGB 4AOMA 1J1EA 2LMVA 4MLWA 4QJ3B 1QIVA 4BY5A 1N65A 2JNFA 2PRUA 3I5FC 2KI6D 3I5FB 2E30A 5KU1A 1K2HA 2LMUA 2TN4A 3NSIA 4N1FA 1U5IA 1AHRA 4UPGA 2Q91A 1KK8B 1DJYA 1N0YA 2BCBA 3PN7C 1YURA 4ORBB 2L4IA 2K7DA 1F8HA 1TCOB 1V1FA 2M3WA 2PALA 3GK1A 1ZUZA 1DMOA 2KGBC 1KSOA 5AFPA 5ER4X 1TCFA 1YX7A 2D8NA 1R2UA 3TDIA 2LLUA 4ORCB 5ER5A 1KQMC 2LUCA 2LE9B 3PSRA 2BKHB 2LHIA 1IG5A 4MZJA 1K90D 1L2OB 1MXLC 3D10A 1L2OC 1B7TZ 1S36A 1Y1XA 3EKJA 1SL9A 3NSLA 1DVIA 1QXPA 1SK6D 1QX2A 3FS7A 1DJIA 1V1GA 2ZNDA 4I5KA 1YVLA 1WRLA 1XFUO 1OMRA 1UHNA 4OKHA 1B8RA 1SR6C 2AAOA 1UHJA 1DGVA 2JPTA 2KSPA 1KWOC 4I5NB 4R1EA 1AK8A 1CFPA 1KQVA 2KI6C 1JFJA 1H4BA 4OR9B 1B9AA 2R2IA 1QIWA 4MSPA 1MR8A 3EK7A 1PSBA 3TUYB 2JQ6A 1A4PA 4GAOA 2CNPA 2O5GA 3EK4A 2K7OA 3LK1A 1TNQA 1MHOA 2HQ8A 1FPWA 2M9GA 3BXKA 4YGDB 1K93D 1IRJA 1LINA 3IQQA 1A75A 2RGIA 2F2OA 3AKAA 4QJ4B 4E68A 1VRKA 4CPVA 2JOJA 1UHIA 2CT9A 2ZFDA 1MF8B 3O6BA 2Q4UA 4AQJA 1UWOA 1XFVO 2K7BA 3I5HC 1OE9B 1QX7A 1UURA 4PHNA 4MVFA 2O60A 1QASA 1A03A 1C07A 1OSAA 1NCZA 2ISDA 1JF2A 2MBXA 2OS8B 2KOTA 2ZN9A 3BUMB 2JU0A 4USLA 2CCMA 1JWDA 2KYCA 3OX5A 1M46A 4IL1A 1LA0A 1OMDA 2KBMA 1F4OA 2I7AA 2FCDA 2LHLA 4P5OE 5HKWA 1JC2A 2HETA 3PLFB 3CR2A 4BY4A 2OTGC 1YRTB 1G8IA 3KEVA 3BYAA 2OPOA 1NCXA 4ZCVA 1FI6A 1B8LA 3CS1A 5F6TA 1SL8A 1NIWA 2GGMA 2KQ6A 1EH2A 2KFHA 1IQ3A 4PE7A 4HREE 1EXRA 4WRIA 1DJHA 2SCPA 1F4QA 2MRDA 2M0RA 1JSAA 2LVJA 5AXIA 1SRAA 1A2XA 1QS7A 5GQQC 3JVTC 4ETOA 4GBAA 3GK4X 4DRWA 1IJ6A 5CSIA 1NPQA 2PMYA 1W7IB 2WNDA 2FCEA 3SG5A 2EC6B 2KI4B 3O2PA 4M2OA 1K9KA 3KHEA 2LVVA 3AAKA 1AP4A 2GGZA 3DVJA 4D1EA 1PRWA 1GJYA 2LCPA 1MUXA 1PVAA 1ZACA 3OB2B 3FIAA 2HQWA 2G2BA 1IGVA 4HSZA 1BMOA 1XO5A 4I5JA 4YRUA 4FQOA 5CSNA 4YGEB 1SL7A 1TNPA 1CNPA 2Y1MA 1D1OA 4GGNA 3TS5B 1TRFA 2CBLA 1RECA 2F8PA 1RFJA 1UP5A 4JWQA 1K8UA 1UHKA 2KNEA 1CTRA 4PCWA 4ICBA 1JFKA 1OQPA 1AJ4A 4MEWA 2LAPA 2LVIA 2KFGA 4NDCA 1CFFA 3D0YB 1K9UA 4PALA 1NX3A 2JT3A 3I5IB 2LUXA 4MBEA 1M31A 1EJ3A 2NXQA 3OB1B 3LLEA 1B4CA 2F33A 1K9PA 1QJTA 2K0JA 3I5HB 1XA5A 2L4HA 3VROA 3TUYC 1GGZA 1E8AA 1CB1A 2BE6A 3CTNA 4JPZB 3OX6A 2KAYA 2ZNEA 1K94A 4M2QA 1XVJA 1QX5B 1K96A 3EKHA 3CZTX 2BCXA 3TDUA 1BOCA 5B8IB 4FTGA 1M63B 1SKTA 1YR5A 2F2PA 2IS9A 2L50A 3I5GB 1SW8A 2NZ0A 1G4YR 1PVBA 1SBJA 2K61A 2LP2A 3F45A 4YGAA 5TNCA 1LKJA 3MSEB 1TNWA 1YX8A 3DF0A 1WDCB 2HF5A 1WDCC 4GPLB 5CPVA 1S5GY 1B7TY 1BJFA 2COLB 4NDBA 2JRFA 3PALA 2JT0A 4HRGA 5I2QA 3DD4A 4MRYA 5DKQA 4C0LA 1BLQA 1QV0A 1J7QA 1ZFSA 3ICBA 4JQ0D 4MZKA 2BECA 1CDLA 2LP3A 1RWYA 1KFXL 1LA3A 2M7NA 5AERA 1YTZC 3A4UB 1KCYA 3EVUA 4GFTA 2FJUB 4YI9A 2K7CA 3GK2A 2VRGA 2I94A 2E6WA 2KAXA 3RM1A 3EVVA 3NSOA 3A8RA 3SIBA 1SR6B 1NX0A 4AQIA 1TOPA 5HKYA 2I2RE 1RTP1 1S6JA 4WQ2A 2NLNA 1CFDA 1KFXS 3SG3A 2ZN8A 1WLMA 4C0JA 1EG4A 1W7JB 2LVKA 4GNKB 1SPYA 3RLZA 3VRPA 2KBIA 1A75B 1RROA 3PFVA 4N1GA 1DJXA 5HYDA 1Y1AA 1FI5A 1CDMA 2BKIB 2LLTA 1IJ5A 2BCAA 3FWCA 4PE4A 1XFZO 4PHMA 2M1UA 1B47A 2F3ZA 4YGBB 2L2EA 1TIZA 4GUKA 3BUOB 3WNXB 3SG2A 3DVKA 4C0KA 2NCPA 3CR4X 4GGFA 5JJGA 2H2KA 4GGFC 4PHJA 5HLVA 2K2FA 1NP8A 1YUSA 2ZKMX 1PSRA 1SMGA 2F3YA 2BL0C 4CLNA 1XK4A 2JTZA 5AANA 5I8NA 1BF5A 2MLFC 4YI8A 4YGCB 4MZLA 4DS7A 3I5GC 5HLOA 2KDHA 1NWDA 4A4BA 2QACA 2LV7A 3CWGA 2P6BB 2WCEA 1CMGA 1CLBA 2H61C 1XYDA 2JULA 2KHNA 2KGRA 2M8UA 2H61A 1C7VA 1CLMA 1QVIZ 4N5XA 1UHHA 1CFCA 1BODA 5PALA 1AVSA 2PASA 2LM5A 5I2LA 1LVCD 2WORA 3BOWA 2LANA 2DOQA 1BR1B 2K8MB 2L51A 2I18A 1R6PA 1WRKA 3WHUB 3K21A 5IBWA 1H8BA 3LCPC 1JBAA 3CLNA 1LXFC 1Y1UA 4A4CA 3BQ3A 3D0YA 3PN7B 4TNCA 1J7OA 5HKZA 1QTXA 1XK4C 4ZCUA 5CSJA 1KK7Y 2KI4C 3TZ1A 1DT7B 2QPTA 2M49B 1EG3A 1BR4B 1IQ5A 1QLKA 1WLZA 1J7PA 1NYAA 3NSKA 1RK9A 3AKBA 4Q04A 1KQMB 2Y5IA 5D69A 1YUTA 3WHTB 1F55A 5I2OA 2MLEC 3PATA 3QRXA 3PM8A 1PALA 1PULA 3SG6A 1MXEA 3H4SE 3BUNB 3DF0B 4XJKA 1MQ1A 3HCMA 5KSZA 2SASA 2Y1NA 1F54A 2JT8A 2KYFA 1ZOTB 2BE4A 3LK0A 1HT9A 1L7ZA 1CLLA 3C1VA 4DCKA 2WC8A 1OZSA 2BBNA 2Y4QA 4PHKA 5K89A 1NX1A 1BG1A 1NUBA 4PE1A 2ZRTA 1JUOA 5G08A 1JF0A 1S1EA 3IF7A 1J7RA 4NDDA 2CXJA 1AJ5A 3IQOA 1TNXA 1HQVA 4M2PA 2MHHA 1DJWA 2JNXA 4L9MA 1G33A 4CFQA 2B1UA 2PVBA 4DIRA 1YVHA 1KK7Z 2MJWB 1K95A 1QV1A 2L98A 4PDZA 3SJSA 1U5IB 3OHMB 2JWWA 2JXLA 3AAJA 2G9BA 1Y6WA 1C7WA 1DTLA 3SIAA 1YRUB 1ZMZA 3E3RA 3VRNA 2JC2A 3BUXB 1SCVA 2EGDA 3JVTB 4WQ3A 1DF0B 1KSMA 3GOFA 2JZIA 2AUCA 1ALVA 3EK8A 3VRQA 1CM4A 2JTTA 3O78A 3HX4A 1CDNA 3WXAA 3FWBA 1AUIB 1M45A 4MRXA 1NCYA 2PSRA 1S5GZ 1KK8C 5KTYA 2LNKA 5J3XA 4NQGA 1ODBA 3EVRA 1QLSA 4PE0A 1EL4A 2KAVA 4XYNA 1GQMA 3ZNIA 1XFWO 4OCIA 2FOTA 1QATA 1CM1A 3LL8B 4OVNF 1DGUA 1WY9A 1CKKA 1YUUA
chains in the Genus database with same CATH superfamily
3KPXA 3L4AA 4CFRA 3B87A 1A29A 1ALWA 2KFFA 1FW4A 1TTXA 3BOWB 1DJGA 1XFXO 2PYQA 3NXAA 2EC6C 1QVIY 3VRRA 2NCOA 4QJ5B 2WCFA 3KF9A 1DJZA 5JOLA 4MN0A 3CDNA 4JD9A 1RJVA 2QDIA 3S0BA 3R72A 2CTNA 1Q80A 3SS4A 1KFUL 1OOJA 3SG4A 2K2AA 1SY9A 1UUSA 4YBHB 5D7FA 5BPJA 1IH0A 3EG5B 3R1OA 1F71A 1CMFA 1OMVA 1KWOB 2ZRSA 5DKNA 1XFYO 2L0PA 4DUQA 2L5XB 4I5LB 4CIDA 2LMTA 5FYXA 4P2YB 3VGOA 1IKUA 1SNLA 3SG7A 1Y0VH 1B1GA 2A4JA 2LC5A 3CGAA 4U8DA 3JTDC 4F0ZB 1X02A 1BU3A 5DKRA 4HRHA 3DVEA 1GGWA 2V53A 1PK0D 2EHBA 4XJKB 3M0WA 2LLSA 1FBVA 1IWQA 1KFUS 3KO0A 5CSFA 2BL0B 1S6CA 1B8CA 1S3PA 1M39A 1S6IA 2M97A 3BUWB 3I5IC 3TS5C 3TDZA 1SYMA 1TN4A 2AMIA 1SCMC 1SCMB 1BT6A 1DF0A 3O4YA 4ORAB 2M7LA 2MAZA 2BBMA 2WCBA 2GV5A 2WC6A 3OP0A 2OS8C 2HPSA 2JXCA 4OV2A 1NX2A 3B6XA 3DVMA 2P70A 1S26D 1OOGA 2WOSA 1WRZA 1CDPA 1MWNA 1NSHA 2P71A 4FQTA 1FF1A 1J1DA 4JKTA 2M1KB 1OZOA 2M29A 1F70A 3CR5X 1J55A 5AEQA 2MA2A 3JTDB 3ZWHA 1N2DA 2KQYA 3VB1A 2OTGB 3OGNA 4AOMA 1J1EA 2LMVA 4MLWA 4QJ3B 1QIVA 4BY5A 1N65A 2JNFA 2PRUA 3I5FC 2KI6D 3I5FB 2E30A 3DYEA 5KU1A 3BFBA 1K2HA 2LMUA 2TN4A 3NSIA 4N1FA 1U5IA 1AHRA 4UPGA 2Q91A 1KK8B 1DJYA 1N0YA 2BCBA 3PN7C 1YURA 3QMEA 4ORBB 2L4IA 2K7DA 2PQLA 1F8HA 1TCOB 1V1FA 2M3WA 2PALA 3GK1A 3UO9A 1ZUZA 1DMOA 2KGBC 1KSOA 5AFPA 5ER4X 1TCFA 1YX7A 2D8NA 2GTEA 1R2UA 3TDIA 2LLUA 4ORCB 5ER5A 1KQMC 2LUCA 2LE9B 3PSRA 2BKHB 2LHIA 1IG5A 4MZJA 1K90D 1L2OB 1MXLC 3D10A 1L2OC 1B7TZ 1S36A 1Y1XA 3EKJA 1SL9A 1LS8A 3NSLA 1DVIA 1QXPA 1SK6D 1QX2A 3BFHA 3FS7A 1DJIA 1V1GA 2ZNDA 4I5KA 1YVLA 1WRLA 1XFUO 3S0EA 3UNWA 3L4LA 1OMRA 1UHNA 4OKHA 1B8RA 1SR6C 2AAOA 1UHJA 1DGVA 2JPTA 2KSPA 1KWOC 4I5NB 4R1EA 1AK8A 1C3YA 1CFPA 2KI6C 1JFJA 1H4BA 4OR9B 1B9AA 2R2IA 1QIWA 4MSPA 1MR8A 3EK7A 1PSBA 4PT1A 3TUYB 2JQ6A 2WCJA 1A4PA 4GAOA 2CNPA 3NHIA 2O5GA 3EK4A 2K7OA 3LK1A 1TNQA 1MHOA 2HQ8A 1FPWA 2M9GA 3BXKA 4YGDB 1K93D 1IRJA 1LINA 3IQQA 1A75A 2RGIA 2F2OA 3AKAA 5EL2A 4QJ4B 4E68A 1VRKA 4CPVA 2JOJA 1UHIA 2CT9A 2ZFDA 1MF8B 3O6BA 2Q4UA 4AQJA 1UWOA 1XFVO 2K7BA 3I5HC 1OE9B 1QX7A 1UURA 3CABA 4PHNA 2L2CA 1C3ZA 4MVFA 1KQVA 3CZ0A 2O60A 1QASA 1A03A 1C07A 1OSAA 1NCZA 2ISDA 1JF2A 2MBXA 2OS8B 2KOTA 2ZN9A 3BUMB 2JU0A 4USLA 2CCMA 1JWDA 1OOHA 2KYCA 3OX5A 1M46A 4IL1A 1LA0A 1OMDA 2KBMA 1F4OA 2I7AA 2FCDA 2LHLA 4P5OE 2KLEA 5HKWA 1JC2A 3OBVA 1GM0A 2HETA 3PLFB 3CR2A 3IVTA 4BY4A 2OTGC 1YRTB 5FI7A 1G8IA 3KEVA 4INWA 3BYAA 2OPOA 1NCXA 4ZCVA 1FI6A 1B8LA 3CS1A 2BAPA 5F6TA 1SL8A 1NIWA 2GGMA 2KQ6A 1EH2A 2KFHA 1IQ3A 4PE7A 4HREE 1EXRA 4WRIA 1DJHA 2SCPA 1F4QA 2MRDA 2M0RA 1JSAA 2LVJA 5AXIA 1SRAA 1A2XA 1QS7A 5GQQC 3JVTC 4ETOA 2KPHA 4GBAA 3GK4X 4DRWA 2KLDA 1IJ6A 5CSIA 1NPQA 2PMYA 1W7IB 1SSEB 2WNDA 2FCEA 3SG5A 2EC6B 3D74A 2KI4B 3O2PA 4M2OA 1K9KA 1DC1A 3KHEA 2LVVA 3AAKA 1AP4A 2GGZA 3DVJA 5D3OA 1PRWA 1GJYA 2LCPA 4D1EA 1MUXA 1PVAA 3Q8IA 1ZACA 3OB2B 3FIAA 2HQWA 2G2BA 1IGVA 4HSZA 1BMOA 1XO5A 4I5JA 4YRUA 4FQOA 5CSNA 4YGEB 1SL7A 1TNPA 1CNPA 1P28A 2Y1MA 1D1OA 4GGNA 3TS5B 1TRFA 2CBLA 1RECA 1UP5A 1RFJA 2F8PA 3CYZA 4JWQA 1K8UA 1UHKA 2KNEA 1CTRA 2WCLA 4PCWA 4ICBA 1JFKA 1OQPA 3PM2A 1AJ4A 4MEWA 2LAPA 3PJIA 2LVIA 2KFGA 4NDCA 1CFFA 3D0YB 1K9UA 4PALA 1NX3A 2JT3A 3I5IB 2LUXA 4MBEA 3S0DA 1M31A 1EJ3A 2NXQA 5HL1A 3OB1B 3LLEA 1B4CA 2F33A 1K9PA 1QJTA 2K0JA 3DXLA 4IJ7A 3I5HB 1XA5A 2L4HA 3VROA 3TUYC 1GGZA 1E8AA 1CB1A 1DELA 2BE6A 3CTNA 4JPZB 3OX6A 2KAYA 2ZNEA 1K94A 1QWVA 1XVJA 1QX5B 4M2QA 1K96A 3EKHA 3CZTX 2BCXA 3TDUA 3RZSA 1BOCA 5B8IB 4FTGA 1M63B 1SKTA 1YR5A 2F2PA 2IS9A 2L50A 3CZ1A 3I5GB 1Z2CB 3S0AA 1SW8A 2NZ0A 1G4YR 1PVBA 1SBJA 2K61A 2LP2A 3F45A 4YGAA 1TUZA 5TNCA 1LKJA 3MSEB 1TNWA 1YX8A 3DF0A 1WDCB 2HF5A 1WDCC 4GPLB 5CPVA 1S5GY 1B7TY 1BJFA 2COLB 4NDBA 2JRFA 3PALA 3R1VA 2JT0A 4HRGA 5I2QA 3DD4A 4MRYA 5DKQA 4C0LA 1BLQA 1QV0A 1J7QA 1ZFSA 3D73A 3ICBA 4JQ0D 4MZKA 2BECA 1CDLA 2LP3A 1RWYA 1KFXL 1LA3A 2M7NA 5AERA 1YTZC 3A4UB 1KCYA 2QEBA 3EVUA 4GFTA 2FJUB 3NGVA 4YI9A 2K7CA 3GK2A 2VRGA 2I94A 2E6WA 2KAXA 3RM1A 3EVVA 3NSOA 3A8RA 3SIBA 1SR6B 1NX0A 4AQIA 1TUJA 1TOPA 3SS5A 5HKYA 2I2RE 1RTP1 1S6JA 4WQ2A 2NLNA 1CFDA 1KFXS 3SG3A 1OW4A 5DICA 2ZN8A 1WLMA 4C0JA 1EG4A 1W7JB 2LVKA 4GNKB 1SPYA 3RLZA 3VRPA 2KBIA 3FE8A 1A75B 1RROA 3PFVA 4N1GA 1DJXA 5I94A 3FE6A 5HYDA 1Y1AA 1FI5A 1CDMA 2BKIB 2LLTA 1IJ5A 2BCAA 2ERBA 3FWCA 4PE4A 1XFZO 4PHMA 2M1UA 3D77A 1B47A 1OOIX 2F3ZA 4YGBB 2L2EA 1TIZA 4GUKA 2WCHA 3BUOB 3WNXB 3SG2A 2K60A 3DVKA 4C0KA 2NCPA 3CR4X 4GGFA 5JJGA 2H2KA 4GGFC 4PHJA 5HLVA 2K2FA 1NP8A 1YUSA 2ZKMX 1PSRA 1SMGA 1Z4HA 2F3YA 2BL0C 4CLNA 1XK4A 1IIOA 2JTZA 5AANA 5I8NA 1BF5A 2MLFC 4YI8A 4YGCB 4MZLA 4DS7A 3I5GC 5HLOA 2KDHA 3B88A 1NWDA 4KYNA 4A4BA 2QACA 2LV7A 3CWGA 2P6BB 2WCEA 3DZTA 1CMGA 3D75A 1CLBA 2H61C 1XYDA 2JULA 2KHNA 2KGRA 2M8UA 2H61A 2YGUA 1C7VA 3BJHA 3SS3A 1CLMA 1QVIZ 4N5XA 1UHHA 1CFCA 1BODA 5PALA 1AVSA 1T14A 2PASA 2LM5A 3N7HA 5I2LA 5FI2A 1LVCD 2WORA 3BOWA 2LANA 2DOQA 1BR1B 2JPOA 2K8MB 2L51A 2I18A 1R6PA 1WRKA 2BNXA 2WCKA 3K21A 3WHUB 5IBWA 1H8BA 3LCPC 1JBAA 3CLNA 1LXFC 1Y1UA 4A4CA 3BQ3A 5FI6A 3D0YA 3PN7B 4TNCA 1J7OA 5HKZA 2QEVA 1QTXA 1XK4C 4ZCUA 5CSJA 1KK7Y 2KI4C 3TZ1A 1DT7B 2QPTA 2M49B 1EG3A 1BR4B 1IQ5A 1QLKA 1WLZA 1J7PA 1NYAA 3NSKA 1RK9A 3AKBA 4Q04A 1KQMB 2QEOA 2WC5A 2Y5IA 1XFRA 5D69A 1YUTA 3WHTB 1F55A 5I2OA 2MLEC 3D76A 3PATA 3QRXA 3PM8A 1PALA 1PULA 3SG6A 1MXEA 3S0GA 3H4SE 3BUNB 3DF0B 3D78A 1MQ1A 3HCMA 4XJKA 5KSZA 2SASA 2Y1NA 1F54A 2JT8A 2KYFA 1ZOTB 2BE4A 3LK0A 1HT9A 1L7ZA 1CLLA 3C1VA 4DCKA 2WC8A 1ORGA 1OZSA 2BBNA 2Y4QA 3K1EA 1NX1A 4PHKA 5K89A 1BG1A 1NUBA 4PE1A 2ZRTA 2QEHA 1JUOA 5G08A 1JF0A 1S1EA 3IF7A 3O4XA 1J7RA 4NDDA 2CXJA 1AJ5A 3IQOA 3S0FA 1TNXA 1HQVA 4M2PA 2L5YA 4OZDA 2MHHA 1OOFA 1DJWA 2JNXA 3B86A 4L9MA 1G33A 3B7AA 4CFQA 2B1UA 2PVBA 4DIRA 3L47A 1DQEA 1KK7Z 1YVHA 2MJWB 1K95A 1QV1A 2L98A 4PDZA 3SJSA 1TWOA 4F7FA 1U5IB 3OHMB 2JWWA 2JXLA 3AAJA 2G9BA 1Y6WA 1C7WA 1DTLA 3BFAA 1YRUB 1ZMZA 3E3RA 3SIAA 3NHTA 2WCMA 3VRNA 2JC2A 3BUXB 1SCVA 2EGDA 3JVTB 4WQ3A 1DF0B 3FE9A 1KSMA 3GOFA 1W9ZA 2AUCA 1ALVA 2JZIA 3EK8A 3VRQA 1CM4A 2JTTA 3O78A 3HX4A 4INXA 1CDNA 1DEKA 3WXAA 3FWBA 1AUIB 1M45A 4MRXA 1NCYA 2PSRA 1S5GZ 1KK8C 5KTYA 2LNKA 5J3XA 4NQGA 1ODBA 3EVRA 3DY9A 1QLSA 3R1PA 4PE0A 1EL4A 2KAVA 4XYNA 1GQMA 3ZNIA 1XFWO 4OCIA 2FOTA 1QATA 2FJYA 1CM1A 2H8VA 3LL8B 3CZ2A 3V2LA 4OVNF 1DGUA 1WY9A 1CKKA 1YUUA
chains in the Genus database with same CATH topology
3KPXA 4CFRA 1A29A 1ALWA 2KFFA 1FW4A 1TTXA 3BOWB 1DJGA 1XFXO 3NXAA 2EC6C 1QVIY 3VRRA 2NCOA 4QJ5B 2WCFA 3KF9A 1DJZA 5JOLA 4MN0A 1RJVA 2CTNA 1Q80A 1KFUL 1OOJA 3SG4A 2K2AA 1SY9A 1UUSA 4YBHB 5D7FA 5BPJA 1IH0A 1F71A 1CMFA 1OMVA 1KWOB 2ZRSA 5DKNA 1XFYO 2L0PA 4DUQA 2L5XB 4I5LB 4CIDA 2LMTA 5FYXA 4P2YB 3VGOA 1IKUA 1SNLA 3SG7A 1Y0VH 1B1GA 2A4JA 2LC5A 3CGAA 4U8DA 3JTDC 4F0ZB 1X02A 1BU3A 5DKRA 4HRHA 3DVEA 1GGWA 2V53A 1PK0D 2EHBA 4XJKB 3M0WA 2LLSA 1FBVA 1IWQA 1KFUS 3KO0A 5CSFA 2BL0B 1S6CA 1B8CA 1S3PA 1M39A 1S6IA 2M97A 3BUWB 3I5IC 3TS5C 3TDZA 1SYMA 1TN4A 2AMIA 1SCMC 1SCMB 1BT6A 1DF0A 3O4YA 4ORAB 2M7LA 2MAZA 2BBMA 2WCBA 2GV5A 3OP0A 2OS8C 2HPSA 2JXCA 4OV2A 1NX2A 3DVMA 1S26D 2WOSA 1WRZA 1CDPA 1MWNA 1NSHA 1FF1A 1J1DA 1F70A 2M1KB 1OZOA 2M29A 3CR5X 1J55A 5AEQA 2MA2A 3JTDB 3ZWHA 1N2DA 2KQYA 2OTGB 4AOMA 1J1EA 2LMVA 4MLWA 4QJ3B 1QIVA 4BY5A 1N65A 2JNFA 2PRUA 3I5FC 2KI6D 3I5FB 2E30A 5KU1A 1K2HA 2LMUA 2TN4A 3NSIA 4N1FA 1U5IA 1AHRA 4UPGA 2Q91A 1KK8B 1DJYA 1N0YA 2BCBA 3PN7C 1YURA 4ORBB 2L4IA 2K7DA 1F8HA 1TCOB 1V1FA 2M3WA 2PALA 3GK1A 1ZUZA 1DMOA 2KGBC 1KSOA 5AFPA 5ER4X 1TCFA 1YX7A 2D8NA 1R2UA 3TDIA 2LLUA 4ORCB 5ER5A 1KQMC 2LUCA 2LE9B 3PSRA 2BKHB 2LHIA 1IG5A 4MZJA 1K90D 1L2OB 1MXLC 3D10A 1L2OC 1B7TZ 1S36A 1Y1XA 3EKJA 1SL9A 3NSLA 1DVIA 1QXPA 1SK6D 1QX2A 3FS7A 1DJIA 1V1GA 2ZNDA 4I5KA 1YVLA 1WRLA 1XFUO 1OMRA 1UHNA 4OKHA 1B8RA 1SR6C 2AAOA 1UHJA 1DGVA 2JPTA 2KSPA 1KWOC 4I5NB 4R1EA 1AK8A 1CFPA 1KQVA 2KI6C 1JFJA 1H4BA 4OR9B 1B9AA 2R2IA 1QIWA 4MSPA 1MR8A 3EK7A 1PSBA 3TUYB 2JQ6A 1A4PA 4GAOA 2CNPA 2O5GA 3EK4A 2K7OA 3LK1A 1TNQA 1MHOA 2HQ8A 1FPWA 2M9GA 3BXKA 4YGDB 1K93D 1IRJA 1LINA 3IQQA 1A75A 2RGIA 2F2OA 3AKAA 4QJ4B 4E68A 1VRKA 4CPVA 2JOJA 1UHIA 2CT9A 2ZFDA 1MF8B 3O6BA 2Q4UA 4AQJA 1UWOA 1XFVO 2K7BA 3I5HC 1OE9B 1QX7A 1UURA 4PHNA 4MVFA 2O60A 1QASA 1A03A 1C07A 1OSAA 1NCZA 2ISDA 1JF2A 2MBXA 2OS8B 2KOTA 2ZN9A 3BUMB 2JU0A 4USLA 2CCMA 1JWDA 2KYCA 3OX5A 1M46A 4IL1A 1LA0A 1OMDA 2KBMA 1F4OA 2I7AA 2FCDA 2LHLA 4P5OE 5HKWA 1JC2A 2HETA 3PLFB 3CR2A 4BY4A 2OTGC 1YRTB 1G8IA 3KEVA 3BYAA 2OPOA 1NCXA 4ZCVA 1FI6A 1B8LA 3CS1A 5F6TA 1SL8A 1NIWA 2GGMA 2KQ6A 1EH2A 2KFHA 1IQ3A 4PE7A 4HREE 1EXRA 4WRIA 1DJHA 2SCPA 1F4QA 2MRDA 2M0RA 1JSAA 2LVJA 5AXIA 1SRAA 1A2XA 1QS7A 5GQQC 3JVTC 4ETOA 4GBAA 3GK4X 4DRWA 1IJ6A 5CSIA 1NPQA 2PMYA 1W7IB 2WNDA 2FCEA 3SG5A 2EC6B 2KI4B 3O2PA 4M2OA 1K9KA 3KHEA 2LVVA 3AAKA 1AP4A 2GGZA 3DVJA 4D1EA 1PRWA 1GJYA 2LCPA 1MUXA 1PVAA 1ZACA 3OB2B 3FIAA 2HQWA 2G2BA 1IGVA 4HSZA 1BMOA 1XO5A 4I5JA 4YRUA 4FQOA 5CSNA 4YGEB 1SL7A 1TNPA 1CNPA 2Y1MA 1D1OA 4GGNA 3TS5B 1TRFA 2CBLA 1RECA 2F8PA 1RFJA 1UP5A 4JWQA 1K8UA 1UHKA 2KNEA 1CTRA 4PCWA 4ICBA 1JFKA 1OQPA 1AJ4A 4MEWA 2LAPA 2LVIA 2KFGA 4NDCA 1CFFA 3D0YB 1K9UA 4PALA 1NX3A 2JT3A 3I5IB 2LUXA 4MBEA 1M31A 1EJ3A 2NXQA 3OB1B 3LLEA 1B4CA 2F33A 1K9PA 1QJTA 2K0JA 3I5HB 1XA5A 2L4HA 3VROA 3TUYC 1GGZA 1E8AA 1CB1A 2BE6A 3CTNA 4JPZB 3OX6A 2KAYA 2ZNEA 1K94A 4M2QA 1XVJA 1QX5B 1K96A 3EKHA 3CZTX 2BCXA 3TDUA 1BOCA 5B8IB 4FTGA 1M63B 1SKTA 1YR5A 2F2PA 2IS9A 2L50A 3I5GB 1SW8A 2NZ0A 1G4YR 1PVBA 1SBJA 2K61A 2LP2A 3F45A 4YGAA 5TNCA 1LKJA 3MSEB 1TNWA 1YX8A 3DF0A 1WDCB 2HF5A 1WDCC 4GPLB 5CPVA 1S5GY 1B7TY 1BJFA 2COLB 4NDBA 2JRFA 3PALA 2JT0A 4HRGA 5I2QA 3DD4A 4MRYA 5DKQA 4C0LA 1BLQA 1QV0A 1J7QA 1ZFSA 3ICBA 4JQ0D 4MZKA 2BECA 1CDLA 2LP3A 1RWYA 1KFXL 1LA3A 2M7NA 5AERA 1YTZC 3A4UB 1KCYA 3EVUA 4GFTA 2FJUB 4YI9A 2K7CA 3GK2A 2VRGA 2I94A 2E6WA 2KAXA 3RM1A 3EVVA 3NSOA 3A8RA 3SIBA 1SR6B 1NX0A 4AQIA 1TOPA 5HKYA 2I2RE 1RTP1 1S6JA 4WQ2A 2NLNA 1CFDA 1KFXS 3SG3A 2ZN8A 1WLMA 4C0JA 1EG4A 1W7JB 2LVKA 4GNKB 1SPYA 3RLZA 3VRPA 2KBIA 1A75B 1RROA 3PFVA 4N1GA 1DJXA 5HYDA 1Y1AA 1FI5A 1CDMA 2BKIB 2LLTA 1IJ5A 2BCAA 3FWCA 4PE4A 1XFZO 4PHMA 2M1UA 1B47A 2F3ZA 4YGBB 2L2EA 1TIZA 4GUKA 3BUOB 3WNXB 3SG2A 3DVKA 4C0KA 2NCPA 3CR4X 4GGFA 5JJGA 2H2KA 4GGFC 4PHJA 5HLVA 2K2FA 1NP8A 1YUSA 2ZKMX 1PSRA 1SMGA 2F3YA 2BL0C 4CLNA 1XK4A 2JTZA 5AANA 5I8NA 1BF5A 2MLFC 4YI8A 4YGCB 4MZLA 4DS7A 3I5GC 5HLOA 2KDHA 1NWDA 4A4BA 2QACA 2LV7A 3CWGA 2P6BB 2WCEA 1CMGA 1CLBA 2H61C 1XYDA 2JULA 2KHNA 2KGRA 2M8UA 2H61A 1C7VA 1CLMA 1QVIZ 4N5XA 1UHHA 1CFCA 1BODA 5PALA 1AVSA 2PASA 2LM5A 5I2LA 1LVCD 2WORA 3BOWA 2LANA 2DOQA 1BR1B 2K8MB 2L51A 2I18A 1R6PA 1WRKA 3WHUB 3K21A 5IBWA 1H8BA 3LCPC 1JBAA 3CLNA 1LXFC 1Y1UA 4A4CA 3BQ3A 3D0YA 3PN7B 4TNCA 1J7OA 5HKZA 1QTXA 1XK4C 4ZCUA 5CSJA 1KK7Y 2KI4C 3TZ1A 1DT7B 2QPTA 2M49B 1EG3A 1BR4B 1IQ5A 1QLKA 1WLZA 1J7PA 1NYAA 3NSKA 1RK9A 3AKBA 4Q04A 1KQMB 2Y5IA 5D69A 1YUTA 3WHTB 1F55A 5I2OA 2MLEC 3PATA 3QRXA 3PM8A 1PALA 1PULA 3SG6A 1MXEA 3H4SE 3BUNB 3DF0B 4XJKA 1MQ1A 3HCMA 5KSZA 2SASA 2Y1NA 1F54A 2JT8A 2KYFA 1ZOTB 2BE4A 3LK0A 1HT9A 1L7ZA 1CLLA 3C1VA 4DCKA 2WC8A 1OZSA 2BBNA 2Y4QA 4PHKA 5K89A 1NX1A 1BG1A 1NUBA 4PE1A 2ZRTA 1JUOA 5G08A 1JF0A 1S1EA 3IF7A 1J7RA 4NDDA 2CXJA 1AJ5A 3IQOA 1TNXA 1HQVA 4M2PA 2MHHA 1DJWA 2JNXA 4L9MA 1G33A 4CFQA 2B1UA 2PVBA 4DIRA 1YVHA 1KK7Z 2MJWB 1K95A 1QV1A 2L98A 4PDZA 3SJSA 1U5IB 3OHMB 2JWWA 2JXLA 3AAJA 2G9BA 1Y6WA 1C7WA 1DTLA 3SIAA 1YRUB 1ZMZA 3E3RA 3VRNA 2JC2A 3BUXB 1SCVA 2EGDA 3JVTB 4WQ3A 1DF0B 1KSMA 3GOFA 2JZIA 2AUCA 1ALVA 3EK8A 3VRQA 1CM4A 2JTTA 3O78A 3HX4A 1CDNA 3WXAA 3FWBA 1AUIB 1M45A 4MRXA 1NCYA 2PSRA 1S5GZ 1KK8C 5KTYA 2LNKA 5J3XA 4NQGA 1ODBA 3EVRA 1QLSA 4PE0A 1EL4A 2KAVA 4XYNA 1GQMA 3ZNIA 1XFWO 4OCIA 2FOTA 1QATA 1CM1A 3LL8B 4OVNF 1DGUA 1WY9A 1CKKA 1YUUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KPX A;  4CFR A;  1A29 A;  1ALW A;  2KFF A;  1FW4 A;  1TTX A;  3BOW B;  1DJG A;  1XFX O;  3NXA A;  2EC6 C;  1QVI Y;  3VRR A;  2NCO A;  4QJ5 B;  2WCF A;  3KF9 A;  1DJZ A;  5JOL A;  4MN0 A;  1RJV A;  2CTN A;  1Q80 A;  1KFU L;  1OOJ A;  3SG4 A;  2K2A A;  1SY9 A;  1UUS A;  4YBH B;  5D7F A;  5BPJ A;  1IH0 A;  1F71 A;  1CMF A;  1OMV A;  1KWO B;  2ZRS A;  5DKN A;  1XFY O;  2L0P A;  4DUQ A;  2L5X B;  4I5L B;  4CID A;  2LMT A;  5FYX A;  4P2Y B;  3VGO A;  1IKU A;  1SNL A;  3SG7 A;  1Y0V H;  1B1G A;  2A4J A;  2LC5 A;  3CGA A;  4U8D A;  3JTD C;  4F0Z B;  1X02 A;  1BU3 A;  5DKR A;  4HRH A;  3DVE A;  1GGW A;  2V53 A;  1PK0 D;  2EHB A;  4XJK B;  3M0W A;  2LLS A;  1FBV A;  1IWQ A;  1KFU S;  3KO0 A;  5CSF A;  2BL0 B;  1S6C A;  1B8C A;  1S3P A;  1M39 A;  1S6I A;  2M97 A;  3BUW B;  3I5I C;  3TS5 C;  3TDZ A;  1SYM A;  1TN4 A;  2AMI A;  1SCM C;  1SCM B;  1BT6 A;  1DF0 A;  3O4Y A;  4ORA B;  2M7L A;  2MAZ A;  2BBM A;  2WCB A;  2GV5 A;  3OP0 A;  2OS8 C;  2HPS A;  2JXC A;  4OV2 A;  1NX2 A;  3DVM A;  1S26 D;  2WOS A;  1WRZ A;  1CDP A;  1MWN A;  1NSH A;  1FF1 A;  1J1D A;  1F70 A;  2M1K B;  1OZO A;  2M29 A;  3CR5 X;  1J55 A;  5AEQ A;  2MA2 A;  3JTD B;  3ZWH A;  1N2D A;  2KQY A;  2OTG B;  4AOM A;  1J1E A;  2LMV A;  4MLW A;  4QJ3 B;  1QIV A;  4BY5 A;  1N65 A;  2JNF A;  2PRU A;  3I5F C;  2KI6 D;  3I5F B;  2E30 A;  5KU1 A;  1K2H A;  2LMU A;  2TN4 A;  3NSI A;  4N1F A;  1U5I A;  1AHR A;  4UPG A;  2Q91 A;  1KK8 B;  1DJY A;  1N0Y A;  2BCB A;  3PN7 C;  1YUR A;  4ORB B;  2L4I A;  2K7D A;  1F8H A;  1TCO B;  1V1F A;  2M3W A;  2PAL A;  3GK1 A;  1ZUZ A;  1DMO A;  2KGB C;  1KSO A;  5AFP A;  5ER4 X;  1TCF A;  1YX7 A;  2D8N A;  1R2U A;  3TDI A;  2LLU A;  4ORC B;  5ER5 A;  1KQM C;  2LUC A;  2LE9 B;  3PSR A;  2BKH B;  2LHI A;  1IG5 A;  4MZJ A;  1K90 D;  1L2O B;  1MXL C;  3D10 A;  1L2O C;  1B7T Z;  1S36 A;  1Y1X A;  3EKJ A;  1SL9 A;  3NSL A;  1DVI A;  1QXP A;  1SK6 D;  1QX2 A;  3FS7 A;  1DJI A;  1V1G A;  2ZND A;  4I5K A;  1YVL A;  1WRL A;  1XFU O;  1OMR A;  1UHN A;  4OKH A;  1B8R A;  1SR6 C;  2AAO A;  1UHJ A;  1DGV A;  2JPT A;  2KSP A;  1KWO C;  4I5N B;  4R1E A;  1AK8 A;  1CFP A;  1KQV A;  2KI6 C;  1JFJ A;  1H4B A;  4OR9 B;  1B9A A;  2R2I A;  1QIW A;  4MSP A;  1MR8 A;  3EK7 A;  1PSB A;  3TUY B;  2JQ6 A;  1A4P A;  4GAO A;  2CNP A;  2O5G A;  3EK4 A;  2K7O A;  3LK1 A;  1TNQ A;  1MHO A;  2HQ8 A;  1FPW A;  2M9G A;  3BXK A;  4YGD B;  1K93 D;  1IRJ A;  1LIN A;  3IQQ A;  1A75 A;  2RGI A;  2F2O A;  3AKA A;  4QJ4 B;  4E68 A;  1VRK A;  4CPV A;  2JOJ A;  1UHI A;  2CT9 A;  2ZFD A;  1MF8 B;  3O6B A;  2Q4U A;  4AQJ A;  1UWO A;  1XFV O;  2K7B A;  3I5H C;  1OE9 B;  1QX7 A;  1UUR A;  4PHN A;  4MVF A;  2O60 A;  1QAS A;  1A03 A;  1C07 A;  1OSA A;  1NCZ A;  2ISD A;  1JF2 A;  2MBX A;  2OS8 B;  2KOT A;  2ZN9 A;  3BUM B;  2JU0 A;  4USL A;  2CCM A;  1JWD A;  2KYC A;  3OX5 A;  1M46 A;  4IL1 A;  1LA0 A;  1OMD A;  2KBM A;  1F4O A;  2I7A A;  2FCD A;  2LHL A;  4P5O E;  5HKW A;  1JC2 A;  2HET A;  3PLF B;  3CR2 A;  4BY4 A;  2OTG C;  1YRT B;  1G8I A;  3KEV A;  3BYA A;  2OPO A;  1NCX A;  4ZCV A;  1FI6 A;  1B8L A;  3CS1 A;  5F6T A;  1SL8 A;  1NIW A;  2GGM A;  2KQ6 A;  1EH2 A;  2KFH A;  1IQ3 A;  4PE7 A;  4HRE E;  1EXR A;  4WRI A;  1DJH A;  2SCP A;  1F4Q A;  2MRD A;  2M0R A;  1JSA A;  2LVJ A;  5AXI A;  1SRA A;  1A2X A;  1QS7 A;  5GQQ C;  3JVT C;  4ETO A;  4GBA A;  3GK4 X;  4DRW A;  1IJ6 A;  5CSI A;  1NPQ A;  2PMY A;  1W7I B;  2WND A;  2FCE A;  3SG5 A;  2EC6 B;  2KI4 B;  3O2P A;  4M2O A;  1K9K A;  3KHE A;  2LVV A;  3AAK A;  1AP4 A;  2GGZ A;  3DVJ A;  4D1E A;  1PRW A;  1GJY A;  2LCP A;  1MUX A;  1PVA A;  1ZAC A;  3OB2 B;  3FIA A;  2HQW A;  2G2B A;  1IGV A;  4HSZ A;  1BMO A;  1XO5 A;  4I5J A;  4YRU A;  4FQO A;  5CSN A;  4YGE B;  1SL7 A;  1TNP A;  1CNP A;  2Y1M A;  1D1O A;  4GGN A;  3TS5 B;  1TRF A;  2CBL A;  1REC A;  2F8P A;  1RFJ A;  1UP5 A;  4JWQ A;  1K8U A;  1UHK A;  2KNE A;  1CTR A;  4PCW A;  4ICB A;  1JFK A;  1OQP A;  1AJ4 A;  4MEW A;  2LAP A;  2LVI A;  2KFG A;  4NDC A;  1CFF A;  3D0Y B;  1K9U A;  4PAL A;  1NX3 A;  2JT3 A;  3I5I B;  2LUX A;  4MBE A;  1M31 A;  1EJ3 A;  2NXQ A;  3OB1 B;  3LLE A;  1B4C A;  2F33 A;  1K9P A;  1QJT A;  2K0J A;  3I5H B;  1XA5 A;  2L4H A;  3VRO A;  3TUY C;  1GGZ A;  1E8A A;  1CB1 A;  2BE6 A;  3CTN A;  4JPZ B;  3OX6 A;  2KAY A;  2ZNE A;  1K94 A;  4M2Q A;  1XVJ A;  1QX5 B;  1K96 A;  3EKH A;  3CZT X;  2BCX A;  3TDU A;  1BOC A;  5B8I B;  4FTG A;  1M63 B;  1SKT A;  1YR5 A;  2F2P A;  2IS9 A;  2L50 A;  3I5G B;  1SW8 A;  2NZ0 A;  1G4Y R;  1PVB A;  1SBJ A;  2K61 A;  2LP2 A;  3F45 A;  4YGA A;  5TNC A;  1LKJ A;  3MSE B;  1TNW A;  1YX8 A;  3DF0 A;  1WDC B;  2HF5 A;  1WDC C;  4GPL B;  5CPV A;  1S5G Y;  1B7T Y;  1BJF A;  2COL B;  4NDB A;  2JRF A;  3PAL A;  2JT0 A;  4HRG A;  5I2Q A;  3DD4 A;  4MRY A;  5DKQ A;  4C0L A;  1BLQ A;  1QV0 A;  1J7Q A;  1ZFS A;  3ICB A;  4JQ0 D;  4MZK A;  2BEC A;  1CDL A;  2LP3 A;  1RWY A;  1KFX L;  1LA3 A;  2M7N A;  5AER A;  1YTZ C;  3A4U B;  1KCY A;  3EVU A;  4GFT A;  2FJU B;  4YI9 A;  2K7C A;  3GK2 A;  2VRG A;  2I94 A;  2E6W A;  2KAX A;  3RM1 A;  3EVV A;  3NSO A;  3A8R A;  3SIB A;  1SR6 B;  1NX0 A;  4AQI A;  1TOP A;  5HKY A;  2I2R E;  1RTP 1;  1S6J A;  4WQ2 A;  2NLN A;  1CFD A;  1KFX S;  3SG3 A;  2ZN8 A;  1WLM A;  4C0J A;  1EG4 A;  1W7J B;  2LVK A;  4GNK B;  1SPY A;  3RLZ A;  3VRP A;  2KBI A;  1A75 B;  1RRO A;  3PFV A;  4N1G A;  1DJX A;  5HYD A;  1Y1A A;  1FI5 A;  1CDM A;  2BKI B;  2LLT A;  1IJ5 A;  2BCA A;  3FWC A;  4PE4 A;  1XFZ O;  4PHM A;  2M1U A;  1B47 A;  2F3Z A;  4YGB B;  2L2E A;  1TIZ A;  4GUK A;  3BUO B;  3WNX B;  3SG2 A;  3DVK A;  4C0K A;  2NCP A;  3CR4 X;  4GGF A;  5JJG A;  2H2K A;  4GGF C;  4PHJ A;  5HLV A;  2K2F A;  1NP8 A;  1YUS A;  2ZKM X;  1PSR A;  1SMG A;  2F3Y A;  2BL0 C;  4CLN A;  1XK4 A;  2JTZ A;  5AAN A;  5I8N A;  1BF5 A;  2MLF C;  4YI8 A;  4YGC B;  4MZL A;  4DS7 A;  3I5G C;  5HLO A;  2KDH A;  1NWD A;  4A4B A;  2QAC A;  2LV7 A;  3CWG A;  2P6B B;  2WCE A;  1CMG A;  1CLB A;  2H61 C;  1XYD A;  2JUL A;  2KHN A;  2KGR A;  2M8U A;  2H61 A;  1C7V A;  1CLM A;  1QVI Z;  4N5X A;  1UHH A;  1CFC A;  1BOD A;  5PAL A;  1AVS A;  2PAS A;  2LM5 A;  5I2L A;  1LVC D;  2WOR A;  3BOW A;  2LAN A;  2DOQ A;  1BR1 B;  2K8M B;  2L51 A;  2I18 A;  1R6P A;  1WRK A;  3WHU B;  3K21 A;  5IBW A;  1H8B A;  3LCP C;  1JBA A;  3CLN A;  1LXF C;  1Y1U A;  4A4C A;  3BQ3 A;  3D0Y A;  3PN7 B;  4TNC A;  1J7O A;  5HKZ A;  1QTX A;  1XK4 C;  4ZCU A;  5CSJ A;  1KK7 Y;  2KI4 C;  3TZ1 A;  1DT7 B;  2QPT A;  2M49 B;  1EG3 A;  1BR4 B;  1IQ5 A;  1QLK A;  1WLZ A;  1J7P A;  1NYA A;  3NSK A;  1RK9 A;  3AKB A;  4Q04 A;  1KQM B;  2Y5I A;  5D69 A;  1YUT A;  3WHT B;  1F55 A;  5I2O A;  2MLE C;  3PAT A;  3QRX A;  3PM8 A;  1PAL A;  1PUL A;  3SG6 A;  1MXE A;  3H4S E;  3BUN B;  3DF0 B;  4XJK A;  1MQ1 A;  3HCM A;  5KSZ A;  2SAS A;  2Y1N A;  1F54 A;  2JT8 A;  2KYF A;  1ZOT B;  2BE4 A;  3LK0 A;  1HT9 A;  1L7Z A;  1CLL A;  3C1V A;  4DCK A;  2WC8 A;  1OZS A;  2BBN A;  2Y4Q A;  4PHK A;  5K89 A;  1NX1 A;  1BG1 A;  1NUB A;  4PE1 A;  2ZRT A;  1JUO A;  5G08 A;  1JF0 A;  1S1E A;  3IF7 A;  1J7R A;  4NDD A;  2CXJ A;  1AJ5 A;  3IQO A;  1TNX A;  1HQV A;  4M2P A;  2MHH A;  1DJW A;  2JNX A;  4L9M A;  1G33 A;  4CFQ A;  2B1U A;  2PVB A;  4DIR A;  1YVH A;  1KK7 Z;  2MJW B;  1K95 A;  1QV1 A;  2L98 A;  4PDZ A;  3SJS A;  1U5I B;  3OHM B;  2JWW A;  2JXL A;  3AAJ A;  2G9B A;  1Y6W A;  1C7W A;  1DTL A;  3SIA A;  1YRU B;  1ZMZ A;  3E3R A;  3VRN A;  2JC2 A;  3BUX B;  1SCV A;  2EGD A;  3JVT B;  4WQ3 A;  1DF0 B;  1KSM A;  3GOF A;  2JZI A;  2AUC A;  1ALV A;  3EK8 A;  3VRQ A;  1CM4 A;  2JTT A;  3O78 A;  3HX4 A;  1CDN A;  3WXA A;  3FWB A;  1AUI B;  1M45 A;  4MRX A;  1NCY A;  2PSR A;  1S5G Z;  1KK8 C;  5KTY A;  2LNK A;  5J3X A;  4NQG A;  1ODB A;  3EVR A;  1QLS A;  4PE0 A;  1EL4 A;  2KAV A;  4XYN A;  1GQM A;  3ZNI A;  1XFW O;  4OCI A;  2FOT A;  1QAT A;  1CM1 A;  3LL8 B;  4OVN F;  1DGU A;  1WY9 A;  1CKK A;  1YUU A; 
#chains in the Genus database with same CATH topology
 3KPX A;  3L4A A;  4CFR A;  3B87 A;  1A29 A;  1ALW A;  2KFF A;  1FW4 A;  1TTX A;  3BOW B;  1DJG A;  1XFX O;  2PYQ A;  3NXA A;  2EC6 C;  1QVI Y;  3VRR A;  2NCO A;  4QJ5 B;  2WCF A;  3KF9 A;  1DJZ A;  5JOL A;  4MN0 A;  3CDN A;  4JD9 A;  1RJV A;  2QDI A;  3S0B A;  3R72 A;  2CTN A;  1Q80 A;  3SS4 A;  1KFU L;  1OOJ A;  3SG4 A;  2K2A A;  1SY9 A;  1UUS A;  4YBH B;  5D7F A;  5BPJ A;  1IH0 A;  3EG5 B;  3R1O A;  1F71 A;  1CMF A;  1OMV A;  1KWO B;  2ZRS A;  5DKN A;  1XFY O;  2L0P A;  4DUQ A;  2L5X B;  4I5L B;  4CID A;  2LMT A;  5FYX A;  4P2Y B;  3VGO A;  1IKU A;  1SNL A;  3SG7 A;  1Y0V H;  1B1G A;  2A4J A;  2LC5 A;  3CGA A;  4U8D A;  3JTD C;  4F0Z B;  1X02 A;  1BU3 A;  5DKR A;  4HRH A;  3DVE A;  1GGW A;  2V53 A;  1PK0 D;  2EHB A;  4XJK B;  3M0W A;  2LLS A;  1FBV A;  1IWQ A;  1KFU S;  3KO0 A;  5CSF A;  2BL0 B;  1S6C A;  1B8C A;  1S3P A;  1M39 A;  1S6I A;  2M97 A;  3BUW B;  3I5I C;  3TS5 C;  3TDZ A;  1SYM A;  1TN4 A;  2AMI A;  1SCM C;  1SCM B;  1BT6 A;  1DF0 A;  3O4Y A;  4ORA B;  2M7L A;  2MAZ A;  2BBM A;  2WCB A;  2GV5 A;  2WC6 A;  3OP0 A;  2OS8 C;  2HPS A;  2JXC A;  4OV2 A;  1NX2 A;  3B6X A;  3DVM A;  2P70 A;  1S26 D;  1OOG A;  2WOS A;  1WRZ A;  1CDP A;  1MWN A;  1NSH A;  2P71 A;  4FQT A;  1FF1 A;  1J1D A;  4JKT A;  2M1K B;  1OZO A;  2M29 A;  1F70 A;  3CR5 X;  1J55 A;  5AEQ A;  2MA2 A;  3JTD B;  3ZWH A;  1N2D A;  2KQY A;  3VB1 A;  2OTG B;  3OGN A;  4AOM A;  1J1E A;  2LMV A;  4MLW A;  4QJ3 B;  1QIV A;  4BY5 A;  1N65 A;  2JNF A;  2PRU A;  3I5F C;  2KI6 D;  3I5F B;  2E30 A;  3DYE A;  5KU1 A;  3BFB A;  1K2H A;  2LMU A;  2TN4 A;  3NSI A;  4N1F A;  1U5I A;  1AHR A;  4UPG A;  2Q91 A;  1KK8 B;  1DJY A;  1N0Y A;  2BCB A;  3PN7 C;  1YUR A;  3QME A;  4ORB B;  2L4I A;  2K7D A;  2PQL A;  1F8H A;  1TCO B;  1V1F A;  2M3W A;  2PAL A;  3GK1 A;  3UO9 A;  1ZUZ A;  1DMO A;  2KGB C;  1KSO A;  5AFP A;  5ER4 X;  1TCF A;  1YX7 A;  2D8N A;  2GTE A;  1R2U A;  3TDI A;  2LLU A;  4ORC B;  5ER5 A;  1KQM C;  2LUC A;  2LE9 B;  3PSR A;  2BKH B;  2LHI A;  1IG5 A;  4MZJ A;  1K90 D;  1L2O B;  1MXL C;  3D10 A;  1L2O C;  1B7T Z;  1S36 A;  1Y1X A;  3EKJ A;  1SL9 A;  1LS8 A;  3NSL A;  1DVI A;  1QXP A;  1SK6 D;  1QX2 A;  3BFH A;  3FS7 A;  1DJI A;  1V1G A;  2ZND A;  4I5K A;  1YVL A;  1WRL A;  1XFU O;  3S0E A;  3UNW A;  3L4L A;  1OMR A;  1UHN A;  4OKH A;  1B8R A;  1SR6 C;  2AAO A;  1UHJ A;  1DGV A;  2JPT A;  2KSP A;  1KWO C;  4I5N B;  4R1E A;  1AK8 A;  1C3Y A;  1CFP A;  2KI6 C;  1JFJ A;  1H4B A;  4OR9 B;  1B9A A;  2R2I A;  1QIW A;  4MSP A;  1MR8 A;  3EK7 A;  1PSB A;  4PT1 A;  3TUY B;  2JQ6 A;  2WCJ A;  1A4P A;  4GAO A;  2CNP A;  3NHI A;  2O5G A;  3EK4 A;  2K7O A;  3LK1 A;  1TNQ A;  1MHO A;  2HQ8 A;  1FPW A;  2M9G A;  3BXK A;  4YGD B;  1K93 D;  1IRJ A;  1LIN A;  3IQQ A;  1A75 A;  2RGI A;  2F2O A;  3AKA A;  5EL2 A;  4QJ4 B;  4E68 A;  1VRK A;  4CPV A;  2JOJ A;  1UHI A;  2CT9 A;  2ZFD A;  1MF8 B;  3O6B A;  2Q4U A;  4AQJ A;  1UWO A;  1XFV O;  2K7B A;  3I5H C;  1OE9 B;  1QX7 A;  1UUR A;  3CAB A;  4PHN A;  2L2C A;  1C3Z A;  4MVF A;  1KQV A;  3CZ0 A;  2O60 A;  1QAS A;  1A03 A;  1C07 A;  1OSA A;  1NCZ A;  2ISD A;  1JF2 A;  2MBX A;  2OS8 B;  2KOT A;  2ZN9 A;  3BUM B;  2JU0 A;  4USL A;  2CCM A;  1JWD A;  1OOH A;  2KYC A;  3OX5 A;  1M46 A;  4IL1 A;  1LA0 A;  1OMD A;  2KBM A;  1F4O A;  2I7A A;  2FCD A;  2LHL A;  4P5O E;  2KLE A;  5HKW A;  1JC2 A;  3OBV A;  1GM0 A;  2HET A;  3PLF B;  3CR2 A;  3IVT A;  4BY4 A;  2OTG C;  1YRT B;  5FI7 A;  1G8I A;  3KEV A;  4INW A;  3BYA A;  2OPO A;  1NCX A;  4ZCV A;  1FI6 A;  1B8L A;  3CS1 A;  2BAP A;  5F6T A;  1SL8 A;  1NIW A;  2GGM A;  2KQ6 A;  1EH2 A;  2KFH A;  1IQ3 A;  4PE7 A;  4HRE E;  1EXR A;  4WRI A;  1DJH A;  2SCP A;  1F4Q A;  2MRD A;  2M0R A;  1JSA A;  2LVJ A;  5AXI A;  1SRA A;  1A2X A;  1QS7 A;  5GQQ C;  3JVT C;  4ETO A;  2KPH A;  4GBA A;  3GK4 X;  4DRW A;  2KLD A;  1IJ6 A;  5CSI A;  1NPQ A;  2PMY A;  1W7I B;  1SSE B;  2WND A;  2FCE A;  3SG5 A;  2EC6 B;  3D74 A;  2KI4 B;  3O2P A;  4M2O A;  1K9K A;  1DC1 A;  3KHE A;  2LVV A;  3AAK A;  1AP4 A;  2GGZ A;  3DVJ A;  5D3O A;  1PRW A;  1GJY A;  2LCP A;  4D1E A;  1MUX A;  1PVA A;  3Q8I A;  1ZAC A;  3OB2 B;  3FIA A;  2HQW A;  2G2B A;  1IGV A;  4HSZ A;  1BMO A;  1XO5 A;  4I5J A;  4YRU A;  4FQO A;  5CSN A;  4YGE B;  1SL7 A;  1TNP A;  1CNP A;  1P28 A;  2Y1M A;  1D1O A;  4GGN A;  3TS5 B;  1TRF A;  2CBL A;  1REC A;  1UP5 A;  1RFJ A;  2F8P A;  3CYZ A;  4JWQ A;  1K8U A;  1UHK A;  2KNE A;  1CTR A;  2WCL A;  4PCW A;  4ICB A;  1JFK A;  1OQP A;  3PM2 A;  1AJ4 A;  4MEW A;  2LAP A;  3PJI A;  2LVI A;  2KFG A;  4NDC A;  1CFF A;  3D0Y B;  1K9U A;  4PAL A;  1NX3 A;  2JT3 A;  3I5I B;  2LUX A;  4MBE A;  3S0D A;  1M31 A;  1EJ3 A;  2NXQ A;  5HL1 A;  3OB1 B;  3LLE A;  1B4C A;  2F33 A;  1K9P A;  1QJT A;  2K0J A;  3DXL A;  4IJ7 A;  3I5H B;  1XA5 A;  2L4H A;  3VRO A;  3TUY C;  1GGZ A;  1E8A A;  1CB1 A;  1DEL A;  2BE6 A;  3CTN A;  4JPZ B;  3OX6 A;  2KAY A;  2ZNE A;  1K94 A;  1QWV A;  1XVJ A;  1QX5 B;  4M2Q A;  1K96 A;  3EKH A;  3CZT X;  2BCX A;  3TDU A;  3RZS A;  1BOC A;  5B8I B;  4FTG A;  1M63 B;  1SKT A;  1YR5 A;  2F2P A;  2IS9 A;  2L50 A;  3CZ1 A;  3I5G B;  1Z2C B;  3S0A A;  1SW8 A;  2NZ0 A;  1G4Y R;  1PVB A;  1SBJ A;  2K61 A;  2LP2 A;  3F45 A;  4YGA A;  1TUZ A;  5TNC A;  1LKJ A;  3MSE B;  1TNW A;  1YX8 A;  3DF0 A;  1WDC B;  2HF5 A;  1WDC C;  4GPL B;  5CPV A;  1S5G Y;  1B7T Y;  1BJF A;  2COL B;  4NDB A;  2JRF A;  3PAL A;  3R1V A;  2JT0 A;  4HRG A;  5I2Q A;  3DD4 A;  4MRY A;  5DKQ A;  4C0L A;  1BLQ A;  1QV0 A;  1J7Q A;  1ZFS A;  3D73 A;  3ICB A;  4JQ0 D;  4MZK A;  2BEC A;  1CDL A;  2LP3 A;  1RWY A;  1KFX L;  1LA3 A;  2M7N A;  5AER A;  1YTZ C;  3A4U B;  1KCY A;  2QEB A;  3EVU A;  4GFT A;  2FJU B;  3NGV A;  4YI9 A;  2K7C A;  3GK2 A;  2VRG A;  2I94 A;  2E6W A;  2KAX A;  3RM1 A;  3EVV A;  3NSO A;  3A8R A;  3SIB A;  1SR6 B;  1NX0 A;  4AQI A;  1TUJ A;  1TOP A;  3SS5 A;  5HKY A;  2I2R E;  1RTP 1;  1S6J A;  4WQ2 A;  2NLN A;  1CFD A;  1KFX S;  3SG3 A;  1OW4 A;  5DIC A;  2ZN8 A;  1WLM A;  4C0J A;  1EG4 A;  1W7J B;  2LVK A;  4GNK B;  1SPY A;  3RLZ A;  3VRP A;  2KBI A;  3FE8 A;  1A75 B;  1RRO A;  3PFV A;  4N1G A;  1DJX A;  5I94 A;  3FE6 A;  5HYD A;  1Y1A A;  1FI5 A;  1CDM A;  2BKI B;  2LLT A;  1IJ5 A;  2BCA A;  2ERB A;  3FWC A;  4PE4 A;  1XFZ O;  4PHM A;  2M1U A;  3D77 A;  1B47 A;  1OOI X;  2F3Z A;  4YGB B;  2L2E A;  1TIZ A;  4GUK A;  2WCH A;  3BUO B;  3WNX B;  3SG2 A;  2K60 A;  3DVK A;  4C0K A;  2NCP A;  3CR4 X;  4GGF A;  5JJG A;  2H2K A;  4GGF C;  4PHJ A;  5HLV A;  2K2F A;  1NP8 A;  1YUS A;  2ZKM X;  1PSR A;  1SMG A;  1Z4H A;  2F3Y A;  2BL0 C;  4CLN A;  1XK4 A;  1IIO A;  2JTZ A;  5AAN A;  5I8N A;  1BF5 A;  2MLF C;  4YI8 A;  4YGC B;  4MZL A;  4DS7 A;  3I5G C;  5HLO A;  2KDH A;  3B88 A;  1NWD A;  4KYN A;  4A4B A;  2QAC A;  2LV7 A;  3CWG A;  2P6B B;  2WCE A;  3DZT A;  1CMG A;  3D75 A;  1CLB A;  2H61 C;  1XYD A;  2JUL A;  2KHN A;  2KGR A;  2M8U A;  2H61 A;  2YGU A;  1C7V A;  3BJH A;  3SS3 A;  1CLM A;  1QVI Z;  4N5X A;  1UHH A;  1CFC A;  1BOD A;  5PAL A;  1AVS A;  1T14 A;  2PAS A;  2LM5 A;  3N7H A;  5I2L A;  5FI2 A;  1LVC D;  2WOR A;  3BOW A;  2LAN A;  2DOQ A;  1BR1 B;  2JPO A;  2K8M B;  2L51 A;  2I18 A;  1R6P A;  1WRK A;  2BNX A;  2WCK A;  3K21 A;  3WHU B;  5IBW A;  1H8B A;  3LCP C;  1JBA A;  3CLN A;  1LXF C;  1Y1U A;  4A4C A;  3BQ3 A;  5FI6 A;  3D0Y A;  3PN7 B;  4TNC A;  1J7O A;  5HKZ A;  2QEV A;  1QTX A;  1XK4 C;  4ZCU A;  5CSJ A;  1KK7 Y;  2KI4 C;  3TZ1 A;  1DT7 B;  2QPT A;  2M49 B;  1EG3 A;  1BR4 B;  1IQ5 A;  1QLK A;  1WLZ A;  1J7P A;  1NYA A;  3NSK A;  1RK9 A;  3AKB A;  4Q04 A;  1KQM B;  2QEO A;  2WC5 A;  2Y5I A;  1XFR A;  5D69 A;  1YUT A;  3WHT B;  1F55 A;  5I2O A;  2MLE C;  3D76 A;  3PAT A;  3QRX A;  3PM8 A;  1PAL A;  1PUL A;  3SG6 A;  1MXE A;  3S0G A;  3H4S E;  3BUN B;  3DF0 B;  3D78 A;  1MQ1 A;  3HCM A;  4XJK A;  5KSZ A;  2SAS A;  2Y1N A;  1F54 A;  2JT8 A;  2KYF A;  1ZOT B;  2BE4 A;  3LK0 A;  1HT9 A;  1L7Z A;  1CLL A;  3C1V A;  4DCK A;  2WC8 A;  1ORG A;  1OZS A;  2BBN A;  2Y4Q A;  3K1E A;  1NX1 A;  4PHK A;  5K89 A;  1BG1 A;  1NUB A;  4PE1 A;  2ZRT A;  2QEH A;  1JUO A;  5G08 A;  1JF0 A;  1S1E A;  3IF7 A;  3O4X A;  1J7R A;  4NDD A;  2CXJ A;  1AJ5 A;  3IQO A;  3S0F A;  1TNX A;  1HQV A;  4M2P A;  2L5Y A;  4OZD A;  2MHH A;  1OOF A;  1DJW A;  2JNX A;  3B86 A;  4L9M A;  1G33 A;  3B7A A;  4CFQ A;  2B1U A;  2PVB A;  4DIR A;  3L47 A;  1DQE A;  1KK7 Z;  1YVH A;  2MJW B;  1K95 A;  1QV1 A;  2L98 A;  4PDZ A;  3SJS A;  1TWO A;  4F7F A;  1U5I B;  3OHM B;  2JWW A;  2JXL A;  3AAJ A;  2G9B A;  1Y6W A;  1C7W A;  1DTL A;  3BFA A;  1YRU B;  1ZMZ A;  3E3R A;  3SIA A;  3NHT A;  2WCM A;  3VRN A;  2JC2 A;  3BUX B;  1SCV A;  2EGD A;  3JVT B;  4WQ3 A;  1DF0 B;  3FE9 A;  1KSM A;  3GOF A;  1W9Z A;  2AUC A;  1ALV A;  2JZI A;  3EK8 A;  3VRQ A;  1CM4 A;  2JTT A;  3O78 A;  3HX4 A;  4INX A;  1CDN A;  1DEK A;  3WXA A;  3FWB A;  1AUI B;  1M45 A;  4MRX A;  1NCY A;  2PSR A;  1S5G Z;  1KK8 C;  5KTY A;  2LNK A;  5J3X A;  4NQG A;  1ODB A;  3EVR A;  3DY9 A;  1QLS A;  3R1P A;  4PE0 A;  1EL4 A;  2KAV A;  4XYN A;  1GQM A;  3ZNI A;  1XFW O;  4OCI A;  2FOT A;  1QAT A;  2FJY A;  1CM1 A;  2H8V A;  3LL8 B;  3CZ2 A;  3V2L A;  4OVN F;  1DGU A;  1WY9 A;  1CKK A;  1YUU A; 
#chains in the Genus database with same CATH homology
 3KPX A;  4CFR A;  1A29 A;  1ALW A;  2KFF A;  1FW4 A;  1TTX A;  3BOW B;  1DJG A;  1XFX O;  3NXA A;  2EC6 C;  1QVI Y;  3VRR A;  2NCO A;  4QJ5 B;  2WCF A;  3KF9 A;  1DJZ A;  5JOL A;  4MN0 A;  1RJV A;  2CTN A;  1Q80 A;  1KFU L;  1OOJ A;  3SG4 A;  2K2A A;  1SY9 A;  1UUS A;  4YBH B;  5D7F A;  5BPJ A;  1IH0 A;  1F71 A;  1CMF A;  1OMV A;  1KWO B;  2ZRS A;  5DKN A;  1XFY O;  2L0P A;  4DUQ A;  2L5X B;  4I5L B;  4CID A;  2LMT A;  5FYX A;  4P2Y B;  3VGO A;  1IKU A;  1SNL A;  3SG7 A;  1Y0V H;  1B1G A;  2A4J A;  2LC5 A;  3CGA A;  4U8D A;  3JTD C;  4F0Z B;  1X02 A;  1BU3 A;  5DKR A;  4HRH A;  3DVE A;  1GGW A;  2V53 A;  1PK0 D;  2EHB A;  4XJK B;  3M0W A;  2LLS A;  1FBV A;  1IWQ A;  1KFU S;  3KO0 A;  5CSF A;  2BL0 B;  1S6C A;  1B8C A;  1S3P A;  1M39 A;  1S6I A;  2M97 A;  3BUW B;  3I5I C;  3TS5 C;  3TDZ A;  1SYM A;  1TN4 A;  2AMI A;  1SCM C;  1SCM B;  1BT6 A;  1DF0 A;  3O4Y A;  4ORA B;  2M7L A;  2MAZ A;  2BBM A;  2WCB A;  2GV5 A;  3OP0 A;  2OS8 C;  2HPS A;  2JXC A;  4OV2 A;  1NX2 A;  3DVM A;  1S26 D;  2WOS A;  1WRZ A;  1CDP A;  1MWN A;  1NSH A;  1FF1 A;  1J1D A;  1F70 A;  2M1K B;  1OZO A;  2M29 A;  3CR5 X;  1J55 A;  5AEQ A;  2MA2 A;  3JTD B;  3ZWH A;  1N2D A;  2KQY A;  2OTG B;  4AOM A;  1J1E A;  2LMV A;  4MLW A;  4QJ3 B;  1QIV A;  4BY5 A;  1N65 A;  2JNF A;  2PRU A;  3I5F C;  2KI6 D;  3I5F B;  2E30 A;  5KU1 A;  1K2H A;  2LMU A;  2TN4 A;  3NSI A;  4N1F A;  1U5I A;  1AHR A;  4UPG A;  2Q91 A;  1KK8 B;  1DJY A;  1N0Y A;  2BCB A;  3PN7 C;  1YUR A;  4ORB B;  2L4I A;  2K7D A;  1F8H A;  1TCO B;  1V1F A;  2M3W A;  2PAL A;  3GK1 A;  1ZUZ A;  1DMO A;  2KGB C;  1KSO A;  5AFP A;  5ER4 X;  1TCF A;  1YX7 A;  2D8N A;  1R2U A;  3TDI A;  2LLU A;  4ORC B;  5ER5 A;  1KQM C;  2LUC A;  2LE9 B;  3PSR A;  2BKH B;  2LHI A;  1IG5 A;  4MZJ A;  1K90 D;  1L2O B;  1MXL C;  3D10 A;  1L2O C;  1B7T Z;  1S36 A;  1Y1X A;  3EKJ A;  1SL9 A;  3NSL A;  1DVI A;  1QXP A;  1SK6 D;  1QX2 A;  3FS7 A;  1DJI A;  1V1G A;  2ZND A;  4I5K A;  1YVL A;  1WRL A;  1XFU O;  1OMR A;  1UHN A;  4OKH A;  1B8R A;  1SR6 C;  2AAO A;  1UHJ A;  1DGV A;  2JPT A;  2KSP A;  1KWO C;  4I5N B;  4R1E A;  1AK8 A;  1CFP A;  1KQV A;  2KI6 C;  1JFJ A;  1H4B A;  4OR9 B;  1B9A A;  2R2I A;  1QIW A;  4MSP A;  1MR8 A;  3EK7 A;  1PSB A;  3TUY B;  2JQ6 A;  1A4P A;  4GAO A;  2CNP A;  2O5G A;  3EK4 A;  2K7O A;  3LK1 A;  1TNQ A;  1MHO A;  2HQ8 A;  1FPW A;  2M9G A;  3BXK A;  4YGD B;  1K93 D;  1IRJ A;  1LIN A;  3IQQ A;  1A75 A;  2RGI A;  2F2O A;  3AKA A;  4QJ4 B;  4E68 A;  1VRK A;  4CPV A;  2JOJ A;  1UHI A;  2CT9 A;  2ZFD A;  1MF8 B;  3O6B A;  2Q4U A;  4AQJ A;  1UWO A;  1XFV O;  2K7B A;  3I5H C;  1OE9 B;  1QX7 A;  1UUR A;  4PHN A;  4MVF A;  2O60 A;  1QAS A;  1A03 A;  1C07 A;  1OSA A;  1NCZ A;  2ISD A;  1JF2 A;  2MBX A;  2OS8 B;  2KOT A;  2ZN9 A;  3BUM B;  2JU0 A;  4USL A;  2CCM A;  1JWD A;  2KYC A;  3OX5 A;  1M46 A;  4IL1 A;  1LA0 A;  1OMD A;  2KBM A;  1F4O A;  2I7A A;  2FCD A;  2LHL A;  4P5O E;  5HKW A;  1JC2 A;  2HET A;  3PLF B;  3CR2 A;  4BY4 A;  2OTG C;  1YRT B;  1G8I A;  3KEV A;  3BYA A;  2OPO A;  1NCX A;  4ZCV A;  1FI6 A;  1B8L A;  3CS1 A;  5F6T A;  1SL8 A;  1NIW A;  2GGM A;  2KQ6 A;  1EH2 A;  2KFH A;  1IQ3 A;  4PE7 A;  4HRE E;  1EXR A;  4WRI A;  1DJH A;  2SCP A;  1F4Q A;  2MRD A;  2M0R A;  1JSA A;  2LVJ A;  5AXI A;  1SRA A;  1A2X A;  1QS7 A;  5GQQ C;  3JVT C;  4ETO A;  4GBA A;  3GK4 X;  4DRW A;  1IJ6 A;  5CSI A;  1NPQ A;  2PMY A;  1W7I B;  2WND A;  2FCE A;  3SG5 A;  2EC6 B;  2KI4 B;  3O2P A;  4M2O A;  1K9K A;  3KHE A;  2LVV A;  3AAK A;  1AP4 A;  2GGZ A;  3DVJ A;  4D1E A;  1PRW A;  1GJY A;  2LCP A;  1MUX A;  1PVA A;  1ZAC A;  3OB2 B;  3FIA A;  2HQW A;  2G2B A;  1IGV A;  4HSZ A;  1BMO A;  1XO5 A;  4I5J A;  4YRU A;  4FQO A;  5CSN A;  4YGE B;  1SL7 A;  1TNP A;  1CNP A;  2Y1M A;  1D1O A;  4GGN A;  3TS5 B;  1TRF A;  2CBL A;  1REC A;  2F8P A;  1RFJ A;  1UP5 A;  4JWQ A;  1K8U A;  1UHK A;  2KNE A;  1CTR A;  4PCW A;  4ICB A;  1JFK A;  1OQP A;  1AJ4 A;  4MEW A;  2LAP A;  2LVI A;  2KFG A;  4NDC A;  1CFF A;  3D0Y B;  1K9U A;  4PAL A;  1NX3 A;  2JT3 A;  3I5I B;  2LUX A;  4MBE A;  1M31 A;  1EJ3 A;  2NXQ A;  3OB1 B;  3LLE A;  1B4C A;  2F33 A;  1K9P A;  1QJT A;  2K0J A;  3I5H B;  1XA5 A;  2L4H A;  3VRO A;  3TUY C;  1GGZ A;  1E8A A;  1CB1 A;  2BE6 A;  3CTN A;  4JPZ B;  3OX6 A;  2KAY A;  2ZNE A;  1K94 A;  4M2Q A;  1XVJ A;  1QX5 B;  1K96 A;  3EKH A;  3CZT X;  2BCX A;  3TDU A;  1BOC A;  5B8I B;  4FTG A;  1M63 B;  1SKT A;  1YR5 A;  2F2P A;  2IS9 A;  2L50 A;  3I5G B;  1SW8 A;  2NZ0 A;  1G4Y R;  1PVB A;  1SBJ A;  2K61 A;  2LP2 A;  3F45 A;  4YGA A;  5TNC A;  1LKJ A;  3MSE B;  1TNW A;  1YX8 A;  3DF0 A;  1WDC B;  2HF5 A;  1WDC C;  4GPL B;  5CPV A;  1S5G Y;  1B7T Y;  1BJF A;  2COL B;  4NDB A;  2JRF A;  3PAL A;  2JT0 A;  4HRG A;  5I2Q A;  3DD4 A;  4MRY A;  5DKQ A;  4C0L A;  1BLQ A;  1QV0 A;  1J7Q A;  1ZFS A;  3ICB A;  4JQ0 D;  4MZK A;  2BEC A;  1CDL A;  2LP3 A;  1RWY A;  1KFX L;  1LA3 A;  2M7N A;  5AER A;  1YTZ C;  3A4U B;  1KCY A;  3EVU A;  4GFT A;  2FJU B;  4YI9 A;  2K7C A;  3GK2 A;  2VRG A;  2I94 A;  2E6W A;  2KAX A;  3RM1 A;  3EVV A;  3NSO A;  3A8R A;  3SIB A;  1SR6 B;  1NX0 A;  4AQI A;  1TOP A;  5HKY A;  2I2R E;  1RTP 1;  1S6J A;  4WQ2 A;  2NLN A;  1CFD A;  1KFX S;  3SG3 A;  2ZN8 A;  1WLM A;  4C0J A;  1EG4 A;  1W7J B;  2LVK A;  4GNK B;  1SPY A;  3RLZ A;  3VRP A;  2KBI A;  1A75 B;  1RRO A;  3PFV A;  4N1G A;  1DJX A;  5HYD A;  1Y1A A;  1FI5 A;  1CDM A;  2BKI B;  2LLT A;  1IJ5 A;  2BCA A;  3FWC A;  4PE4 A;  1XFZ O;  4PHM A;  2M1U A;  1B47 A;  2F3Z A;  4YGB B;  2L2E A;  1TIZ A;  4GUK A;  3BUO B;  3WNX B;  3SG2 A;  3DVK A;  4C0K A;  2NCP A;  3CR4 X;  4GGF A;  5JJG A;  2H2K A;  4GGF C;  4PHJ A;  5HLV A;  2K2F A;  1NP8 A;  1YUS A;  2ZKM X;  1PSR A;  1SMG A;  2F3Y A;  2BL0 C;  4CLN A;  1XK4 A;  2JTZ A;  5AAN A;  5I8N A;  1BF5 A;  2MLF C;  4YI8 A;  4YGC B;  4MZL A;  4DS7 A;  3I5G C;  5HLO A;  2KDH A;  1NWD A;  4A4B A;  2QAC A;  2LV7 A;  3CWG A;  2P6B B;  2WCE A;  1CMG A;  1CLB A;  2H61 C;  1XYD A;  2JUL A;  2KHN A;  2KGR A;  2M8U A;  2H61 A;  1C7V A;  1CLM A;  1QVI Z;  4N5X A;  1UHH A;  1CFC A;  1BOD A;  5PAL A;  1AVS A;  2PAS A;  2LM5 A;  5I2L A;  1LVC D;  2WOR A;  3BOW A;  2LAN A;  2DOQ A;  1BR1 B;  2K8M B;  2L51 A;  2I18 A;  1R6P A;  1WRK A;  3WHU B;  3K21 A;  5IBW A;  1H8B A;  3LCP C;  1JBA A;  3CLN A;  1LXF C;  1Y1U A;  4A4C A;  3BQ3 A;  3D0Y A;  3PN7 B;  4TNC A;  1J7O A;  5HKZ A;  1QTX A;  1XK4 C;  4ZCU A;  5CSJ A;  1KK7 Y;  2KI4 C;  3TZ1 A;  1DT7 B;  2QPT A;  2M49 B;  1EG3 A;  1BR4 B;  1IQ5 A;  1QLK A;  1WLZ A;  1J7P A;  1NYA A;  3NSK A;  1RK9 A;  3AKB A;  4Q04 A;  1KQM B;  2Y5I A;  5D69 A;  1YUT A;  3WHT B;  1F55 A;  5I2O A;  2MLE C;  3PAT A;  3QRX A;  3PM8 A;  1PAL A;  1PUL A;  3SG6 A;  1MXE A;  3H4S E;  3BUN B;  3DF0 B;  4XJK A;  1MQ1 A;  3HCM A;  5KSZ A;  2SAS A;  2Y1N A;  1F54 A;  2JT8 A;  2KYF A;  1ZOT B;  2BE4 A;  3LK0 A;  1HT9 A;  1L7Z A;  1CLL A;  3C1V A;  4DCK A;  2WC8 A;  1OZS A;  2BBN A;  2Y4Q A;  4PHK A;  5K89 A;  1NX1 A;  1BG1 A;  1NUB A;  4PE1 A;  2ZRT A;  1JUO A;  5G08 A;  1JF0 A;  1S1E A;  3IF7 A;  1J7R A;  4NDD A;  2CXJ A;  1AJ5 A;  3IQO A;  1TNX A;  1HQV A;  4M2P A;  2MHH A;  1DJW A;  2JNX A;  4L9M A;  1G33 A;  4CFQ A;  2B1U A;  2PVB A;  4DIR A;  1YVH A;  1KK7 Z;  2MJW B;  1K95 A;  1QV1 A;  2L98 A;  4PDZ A;  3SJS A;  1U5I B;  3OHM B;  2JWW A;  2JXL A;  3AAJ A;  2G9B A;  1Y6W A;  1C7W A;  1DTL A;  3SIA A;  1YRU B;  1ZMZ A;  3E3R A;  3VRN A;  2JC2 A;  3BUX B;  1SCV A;  2EGD A;  3JVT B;  4WQ3 A;  1DF0 B;  1KSM A;  3GOF A;  2JZI A;  2AUC A;  1ALV A;  3EK8 A;  3VRQ A;  1CM4 A;  2JTT A;  3O78 A;  3HX4 A;  1CDN A;  3WXA A;  3FWB A;  1AUI B;  1M45 A;  4MRX A;  1NCY A;  2PSR A;  1S5G Z;  1KK8 C;  5KTY A;  2LNK A;  5J3X A;  4NQG A;  1ODB A;  3EVR A;  1QLS A;  4PE0 A;  1EL4 A;  2KAV A;  4XYN A;  1GQM A;  3ZNI A;  1XFW O;  4OCI A;  2FOT A;  1QAT A;  1CM1 A;  3LL8 B;  4OVN F;  1DGU A;  1WY9 A;  1CKK A;  1YUU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...