1OMRA

Non-myristoylated wild-type bovine recoverin with calcium bound to ef-hand 3
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
201
structure length
201
Chain Sequence
GNSKSGALSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKLKEKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords recoverin
publication title Impact of N-terminal myristoylation on the Ca2+-dependent conformational transition in recoverin
pubmed doi rcsb
source organism Bos taurus
total genus 75
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2003-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1omrA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1omrA01
2K7OA 2ISDA 1EG4A 1ZMZA 1W7JB 1G4YR 1OOJA 1TRFA 4YRUA 2H2KA 4Q04A 4FQOA 3EKJA 1OMVA 2LV7A 2K2FA 2KGRA 5TNCA 1M46A 2H61A 4MSPA 3CS1A 3KPXA 2M29A 1DF0B 3CTNA 1XK4A 1Y0VH 3JVTB 1SYMA 1KK7Z 1QIVA 3EVRA 1UWOA 1XA5A 1B9AA 1QV0A 3PLFB 1X02A 2ZFDA 4PHJA 4GFTA 2I94A 1HT9A 1FF1A 2M8UA 2JOJA 2LCPA 1GQMA 1BODA 3VGOA 5AANA 4A4BA 1U5IB 3SG3A 2PASA 4ORCB 2MAZA 2BKHB 3K21A 1KWOB 4PE7A 2CXJA 1NWDA 1G8IA 3M0WA 2KAVA 2L0PA 2P6BB 1CB1A 3DVEA 4IL1A 2GGMA 1W7IB 1L2OC 1J7QA 1AK8A 1KK7Y 1IRJA 2OPOA 4ZCUA 1FBVA 1K9PA 2M0RA 4I5LB 1BMOA 2LUCA 1MF8B 1YUTA 1UP5A 4USLA 2M97A 1KFUS 1V1GA 1CLLA 1HQVA 3BXKA 3VRPA 1TNXA 4TNCA 1TNQA 1EL4A 4JPZB 2B1UA 1IJ5A 3I5FB 1OMRA 2K7CA 4ORAB 2JWWA 1KSOA 2GV5A 3EVVA 3JVTC 1BU3A 4M2QA 1R2UA 1SL7A 3BOWA 1QASA 2WOSA 1MWNA 3GOFA 2AAOA 3F45A 2LLUA 2BBMA 3PN7C 1AUIB 1Y6WA 3AAJA 1Q80A 2JU0A 2JPTA 1NCZA 2OS8B 1K94A 5AERA 3WHTB 1AVSA 1OZOA 1XFVO 1YX8A 2JQ6A 1E8AA 1IKUA 3JTDB 1WY9A 4PE1A 2LANA 3PM8A 1EG3A 1L7ZA 2PMYA 3CR5X 4BY5A 1J7RA 4QJ4B 4AOMA 1BT6A 1K9UA 1WDCB 1EH2A 3FS7A 1XFZO 2F2PA 2BE4A 2V53A 1NCYA 3D0YA 2OTGB 4NDDA 5CSIA 1H4BA 1B4CA 2MHHA 3TDUA 1QIWA 1F55A 2L5XB 2K0JA 2Y4QA 2BE6A 4WRIA 3LL8B 2PRUA 1QLKA 4JQ0D 2Y1NA 1RTP1 2LVJA 3A8RA 4YI9A 1DTLA 1BF5A 1S26D 1B8CA 1PULA 1K95A 1TN4A 3TZ1A 5G08A 3I5FC 1MQ1A 1DT7B 3I5IC 4L9MA 1MXLC 1K9KA 1NX0A 3VRRA 1SK6D 3FWBA 1SY9A 2LLTA 5PALA 3HX4A 2LE9B 1AJ4A 1BR4B 3PALA 2QACA 3KEVA 3PFVA 4MN0A 2OS8C 1YVLA 1SMGA 2NCOA 4GGFC 1OQPA 5ER4X 3E3RA 3KHEA 1NCXA 1A4PA 1NSHA 4YGCB 4ICBA 3JTDC 2LLSA 2FCEA 4I5KA 1QVIZ 2JRFA 1C7WA 1DGUA 1TCFA 4XJKA 3DVJA 5I8NA 1QJTA 2ZNDA 3DF0A 4YGEB 1CTRA 1WDCC 3SG4A 1PK0D 2SASA 1K93D 3WXAA 1CNPA 2TN4A 1F54A 2BCAA 1OE9B 1ZFSA 2K7DA 5D7FA 1JWDA 1S6CA 1UHNA 3BQ3A 2I7AA 1JSAA 3LK0A 3O4YA 4MZJA 4NQGA 3SG5A 3FIAA 1KCYA 1QATA 5HKWA 1SR6C 3OB1B 2K7BA 4DIRA 5K89A 2KGBC 2M7LA 1FI6A 1DGVA 1CKKA 1QVIY 2HF5A 2GGZA 1M31A 2E30A 5KSZA 1XFYO 3BUXB 1F4OA 3CGAA 1GGZA 1MXEA 3GK1A 2LVIA 4OVNF 2MLEC 4E68A 1XYDA 3BYAA 1IJ6A 2G9BA 4OKHA 2LC5A 2RGIA 2ZRTA 3VRQA 1SL9A 3CR4X 1TTXA 3RM1A 1JFJA 1OSAA 3TDIA 2AMIA 3PN7B 5BPJA 2I18A 1KFUL 1AHRA 2Q4UA 2FJUB 1XFWO 3A4UB 4A4CA 1XO5A 4GPLB 1UHIA 3O2PA 2KHNA 2KAXA 1Y1UA 2L4HA 3I5GB 1WRKA 2NCPA 2Y1MA 4C0KA 4CPVA 1DJHA 4N1FA 1QXPA 1QX7A 4XYNA 3LLEA 3LCPC 1S5GZ 1U5IA 3EK8A 1DJGA 1ALWA 3OX6A 4P5OE 5B8IB 1DJIA 1UHJA 2KOTA 3NSLA 2F2OA 5KU1A 4WQ2A 4PALA 4PHNA 2KQYA 1BJFA 1S1EA 2JZIA 1F4QA 1MUXA 3DVKA 1RWYA 3I5IB 2WORA 1QV1A 5DKQA 1CDNA 2A4JA 2JT3A 3BUOB 3KO0A 2JT8A 2KI6C 1CFDA 5AXIA 1J1EA 2PSRA 4OR9B 1MHOA 1DJZA 1YURA 2WC8A 5CSJA 2SCPA 2LMUA 3DVMA 1GJYA 3EKHA 2M7NA 4JWQA 2FCDA 1WLZA 2L50A 1S5GY 2KBIA 2KFFA 3AKBA 1GGWA 2HPSA 4DUQA 1S36A 3DD4A 2F3ZA 1BR1B 3I5GC 2EC6B 3IF7A 2Q91A 2LP3A 3WHUB 1K2HA 1AJ5A 1IGVA 3IQQA 4MRXA 1SRAA 5GQQC 1TNWA 1TIZA 2O60A 2ZKMX 3LK1A 1JUOA 1C07A 5DKRA 2FOTA 1NYAA 1BOCA 1LVCD 5ER5A 2K61A 1ZACA 4MRYA 1ZOTB 3TDZA 1A75B 1QTXA 1N65A 1SR6B 4MLWA 2JXLA 3BUWB 1B1GA 3SG7A 1CFCA 2M49B 2L4IA 5HKZA 5I2OA 4ORBB 3RLZA 2JT0A 4HRGA 2QPTA 2CNPA 2LAPA 3TUYB 2CT9A 1F8HA 1S6IA 2KYCA 1QLSA 2WCFA 2LVVA 1R6PA 2KFHA 2KFGA 2KDHA 2CTNA 2O5GA 3EK7A 3NSIA 4PHKA 1CMGA 2M9GA 3NSOA 2KI6D 5JOLA 1IH0A 4C0JA 4HREE 2DOQA 3OHMB 1UURA 1SCMB 2EC6C 3I5HB 1TNPA 3MSEB 1EXRA 1LKJA 4FTGA 5FYXA 5CSFA 1RJVA 4AQJA 1M39A 4XJKB 3AAKA 2VRGA 1PALA 2AUCA 2MJWB 2WCEA 4I5JA 1PSRA 1K8UA 1YRTB 1TCOB 1Y1AA 1DVIA 3SG2A 2BCBA 3NXAA 5HYDA 4M2OA 3PATA 1KFXS 3CLNA 1IQ3A 1F70A 2Y5IA 2L2EA 1A2XA 2PALA 1LXFC 1NP8A 3IQOA 1A03A 2ZN8A 1JFKA 1BLQA 1PRWA 4YGAA 3TUYC 2PVBA 2NZ0A 1KK8C 3GK4X 2ZNEA 3O6BA 1JF0A 1FPWA 1NX1A 3SJSA 1QX5B 3SG6A 2LNKA 3VROA 2LVKA 1SW8A 5D69A 2MRDA 3OP0A 4PHMA 2COLB 5CPVA 3SIAA 1CM4A 1SCMC 1CDMA 3I5HC 2KI4B 1J1DA 3NSKA 1NX3A 4N1GA 1B8RA 3O78A 1QX2A 1NIWA 1KQMB 3QRXA 1SBJA 1DF0A 4MZLA 2L51A 2LP2A 1QS7A 2BECA 4GAOA 5AEQA 1OZSA 4NDBA 1YUSA 1NX2A 2LMTA 3KF9A 4AQIA 1AP4A 1CFPA 1CLBA 5DKNA 4DRWA 2CCMA 3GK2A 1IQ5A 2M1KB 2WNDA 1ZUZA 4PCWA 4CLNA 2KAYA 2CBLA 3EVUA 2M1UA 3HCMA 4CFQA 1PSBA 1ALVA 3ZNIA 4HRHA 1CM1A 1SL8A 1CMFA 2MLFC 3SIBA 4MEWA 4MVFA 1FW4A 5I2LA 1CFFA 1SNLA 1J55A 2BL0B 1OMDA 2JTZA 1YX7A 1DJWA 1DJXA 1TOPA 1RFJA 4OCIA 1D1OA 2JULA 2EGDA 1J7PA 1B7TZ 1B47A 1B8LA 5JJGA 1JBAA 5I2QA 3AKAA 1A29A 2BKIB 3PSRA 2H61C 4M2PA 4F0ZB 2KI4C 5HKYA 1C7VA 4HSZA 1KQVA 1XK4C 4ZCVA 2E6WA 1KQMC 1CLMA 1SPYA 1YRUB 2G2BA 2EHBA 3BOWB 4GNKB 1F71A 1XFXO 1EJ3A 1K90D 2LMVA 1IG5A 4YGDB 4P2YB 1SKTA 2F3YA 1NPQA 2R2IA 4BY4A 2HQ8A 3EK4A 1ODBA 4DS7A 1J7OA 2LHIA 1RROA 4GGFA 1G33A 4YI8A 1PVAA 1YVHA 1B7TY 2MBXA 1V1FA 1BG1A 4CFRA 1WRZA 1WRLA 2KSPA 4ETOA 1XFUO 1CDLA 2L98A 3BUNB 3TS5B 2JXCA 4D1EA 1DJYA 4YGBB 3CWGA 3D0YB 1KSMA 2BL0C 4U8DA 1M63B 3BUMB 1VRKA 3VRNA 5J3XA 4CIDA 5IBWA 1YTZC 1KWOC 2NXQA 3H4SE 2HETA 2BBNA 2KQ6A 4QJ5B 1LA3A 4NDCA 2ZN9A 5CSNA 3CR2A 1MR8A 1SCVA 1RECA 2K8MB 1KK8B 1UUSA 1KFXL 1A75A 1CDPA 1XVJA 2LUXA 4OV2A 2JNFA 4UPGA 2M3WA 1JF2A 2KNEA 5HLVA 1FI5A 2F33A 3FWCA 1M45A 4MBEA 3ZWHA 4MZKA 1S3PA 1Y1XA 1UHKA 1WLMA 4YBHB 2HQWA 1JC2A 3C1VA 2F8PA 1LA0A 1LINA 1YUUA 4PDZA 5KTYA 2IS9A 4I5NB 2LM5A 2ZRSA 3CZTX 2JC2A 4R1EA 3DF0B 1UHHA 1NUBA 4N5XA 2KBMA 3TS5C 3OB2B 4DCKA 1DMOA 2LHLA 2WCBA 2MA2A 5HLOA 1K96A 5F6TA 3D10A 4PE0A 2I2RE 1YR5A 5AFPA 2JNXA 1RK9A 2KYFA 2JTTA 4PE4A 1H8BA 4QJ3B 4GGNA 4GUKA 2OTGC 1PVBA 2BCXA 4WQ3A 3OX5A 4GBAA 2NLNA 3ICBA 4C0LA 2D8NA 1S6JA 2K2AA 3WNXB 1N2DA 1IWQA 1L2OB 1N0YA
chains in the Genus database with same CATH superfamily
2K7OA 3L4AA 2ISDA 1EG4A 1ZMZA 1W7JB 1G4YR 3UNWA 1OOJA 1TRFA 4YRUA 2H2KA 4Q04A 4FQOA 3EKJA 1OMVA 2LV7A 2K2FA 2KGRA 5TNCA 1M46A 3OGNA 3CZ0A 2H61A 4MSPA 5FI6A 3CYZA 3CS1A 3KPXA 3S0DA 2M29A 1DF0B 3CTNA 1XK4A 1Y0VH 3JVTB 1SYMA 1KK7Z 1QIVA 3EVRA 1UWOA 1XA5A 2WC6A 1B9AA 1QV0A 3D76A 1X02A 2KPHA 2WC5A 3IVTA 3PLFB 2ZFDA 4PHJA 4GFTA 2I94A 1HT9A 1FF1A 2M8UA 2JOJA 2LCPA 1GQMA 1BODA 3VGOA 5AANA 4A4BA 1U5IB 3SG3A 2PASA 4ORCB 2MAZA 2BKHB 3K21A 1KWOB 4PE7A 2CXJA 1NWDA 1G8IA 3M0WA 2KAVA 2L0PA 2P6BB 1CB1A 3DVEA 4IL1A 2GGMA 1W7IB 1L2OC 1J7QA 1AK8A 1KK7Y 3S0BA 1IRJA 2OPOA 4ZCUA 1FBVA 3D78A 1K9PA 2M0RA 3BFBA 4I5LB 5FI2A 1BMOA 2LUCA 1MF8B 1YUTA 3SS5A 1UP5A 4USLA 2M97A 1KFUS 1V1GA 1CLLA 1HQVA 3BXKA 3VRPA 1TNXA 4TNCA 1TNQA 1EL4A 4JPZB 2B1UA 1IJ5A 3I5FB 1OMRA 2K7CA 4ORAB 2JWWA 1KSOA 2GV5A 3EVVA 3JVTC 1BU3A 4M2QA 1R2UA 1SL7A 3BOWA 1QASA 2H8VA 1MWNA 2WOSA 2AAOA 3F45A 3GOFA 3S0AA 2LLUA 2QDIA 2BBMA 3PN7C 1AUIB 1Y6WA 3AAJA 1Q80A 2JU0A 4ZCVA 2JPTA 1NCZA 2OS8B 1K94A 5AERA 1DEKA 3SS3A 3WHTB 1AVSA 1OZOA 1XFVO 1YX8A 2JQ6A 1E8AA 1IKUA 3JTDB 1WY9A 4PE1A 2WCJA 2LANA 3PM8A 1EG3A 1L7ZA 2PMYA 3CR5X 4BY5A 1J7RA 4QJ4B 4AOMA 1BT6A 1K9UA 1WDCB 1EH2A 3FS7A 1XFZO 2F2PA 2BE4A 2V53A 1NCYA 3D0YA 2OTGB 4NDDA 5CSIA 1H4BA 1B4CA 2MHHA 3TDUA 1QIWA 1F55A 2L5XB 2K0JA 2Y4QA 2BE6A 4WRIA 3LL8B 2PRUA 1QLKA 4JQ0D 2BNXA 2Y1NA 1RTP1 2LVJA 3A8RA 4YI9A 1XFRA 1DTLA 3VB1A 1S26D 1B8CA 1PULA 1TUZA 1K95A 2ERBA 2L2CA 1BF5A 1TN4A 3DY9A 3TZ1A 5G08A 3I5FC 3S0GA 1TWOA 1MQ1A 1DT7B 3I5IC 4L9MA 1MXLC 1K9KA 1NX0A 3VRRA 4INXA 1SK6D 3FWBA 1SY9A 2LLTA 5PALA 3HX4A 2LE9B 1AJ4A 1BR4B 3FE6A 3PALA 2QACA 3KEVA 3PFVA 4MN0A 3R1PA 2QEOA 2OS8C 1YVLA 1SMGA 2NCOA 4GGFC 1OQPA 5ER4X 3E3RA 3KHEA 1NCXA 1A4PA 1NSHA 4YGCB 4ICBA 3JTDC 2LLSA 2FCEA 4I5KA 2QEHA 1QVIZ 2JRFA 1C7WA 1DGUA 3D74A 1TCFA 4XJKA 3DVJA 5I8NA 1QJTA 2ZNDA 3DF0A 4YGEB 1CTRA 1WDCC 3SG4A 1PK0D 2SASA 1K93D 1DELA 3WXAA 1CNPA 2TN4A 1F54A 2BCAA 1OE9B 1ZFSA 2K7DA 1P28A 5D7FA 1OOIX 1JWDA 3FE8A 1S6CA 3D75A 1UHNA 5D3OA 3BQ3A 2I7AA 1JSAA 3LK0A 3O4YA 4MZJA 4NQGA 3SG5A 3BJHA 3FIAA 1KCYA 1QATA 5HKWA 1SR6C 3OB1B 2K7BA 4DIRA 5K89A 2KGBC 2M7LA 1FI6A 1DGVA 1CKKA 1QVIY 3O4XA 2HF5A 2GGZA 1M31A 2E30A 5KSZA 1XFYO 1IIOA 3BUXB 1F4OA 3CGAA 1GGZA 1C3ZA 1MXEA 3GK1A 3CABA 2PYQA 2LVIA 4OVNF 2MLEC 4E68A 1XYDA 3BYAA 2WCHA 1IJ6A 2G9BA 4JD9A 4OKHA 2LC5A 2RGIA 1OOHA 2ZRTA 3VRQA 1DQEA 1SL9A 3CR4X 1TTXA 3RM1A 1JFJA 1OSAA 3TDIA 2AMIA 3PN7B 5BPJA 2I18A 1KFUL 5EL2A 1AHRA 2Q4UA 2FJUB 1XFWO 3A4UB 4A4CA 1XO5A 1GM0A 4GPLB 3BFHA 1UHIA 3O2PA 2KHNA 2KAXA 1Y1UA 2L4HA 3I5GB 1WRKA 2NCPA 2Y1MA 3V2LA 4C0KA 3UO9A 4CPVA 1DJHA 4N1FA 1QXPA 1QX7A 4XYNA 3LLEA 3LCPC 1S5GZ 1U5IA 3EK8A 1DJGA 1ALWA 3OX6A 4P5OE 2WCLA 5B8IB 1DJIA 3FE9A 1UHJA 1DC1A 2KOTA 3NSLA 2F2OA 3BFAA 5KU1A 3SS4A 4WQ2A 4PALA 4PHNA 2KQYA 1BJFA 1S1EA 2JZIA 1F4QA 1MUXA 3DVKA 3S0EA 1RWYA 3EG5B 3I5IB 2WORA 1QV1A 2YGUA 5DKQA 2A4JA 1CDNA 2JT3A 1SSEB 3BUOB 3KO0A 1ORGA 2JT8A 2KI6C 1CFDA 5AXIA 1J1EA 2P71A 2PSRA 1MHOA 1DJZA 1YURA 2WC8A 4OR9B 5CSJA 2SCPA 2LMUA 3DVMA 1GJYA 3EKHA 2M7NA 4JWQA 2FCDA 1WLZA 1OOFA 2WCMA 2L50A 1S5GY 2QEBA 2KBIA 2KFFA 3AKBA 1GGWA 2HPSA 4DUQA 1S36A 3DD4A 2F3ZA 1BR1B 3I5GC 2EC6B 3IF7A 2Q91A 2LP3A 3WHUB 1K2HA 1AJ5A 1IGVA 3IQQA 4MRXA 1SRAA 5GQQC 1TNWA 1TIZA 2O60A 2ZKMX 3LK1A 1JUOA 1C07A 3N7HA 2FOTA 5DKRA 4F7FA 3B87A 3CDNA 3CZ1A 1NYAA 1BOCA 1LVCD 5ER5A 2K61A 1ZACA 4MRYA 1ZOTB 3TDZA 1A75B 1QTXA 1N65A 1SR6B 4MLWA 2JXLA 3BUWB 3DYEA 3SG7A 1B1GA 2FJYA 3D77A 2M49B 1CFCA 2L4IA 5HKZA 3Q8IA 5I2OA 4ORBB 3RLZA 2JT0A 3OBVA 4HRGA 2QPTA 2CNPA 2LAPA 3TUYB 2CT9A 1F8HA 1S6IA 2KYCA 1QLSA 2KLDA 2WCFA 2LVVA 1R6PA 2KFHA 2KFGA 2KDHA 2CTNA 2O5GA 3EK7A 3NSIA 4PHKA 1CMGA 2M9GA 3NSOA 2KI6D 5JOLA 1IH0A 4C0JA 4HREE 2DOQA 3OHMB 1UURA 1SCMB 2EC6C 3I5HB 1TNPA 3MSEB 1EXRA 1LKJA 4FTGA 5FYXA 5CSFA 1RJVA 4AQJA 1M39A 1C3YA 4XJKB 3AAKA 2VRGA 1PALA 2AUCA 2MJWB 2WCEA 4I5JA 1PSRA 1K8UA 1YRTB 1TCOB 1Y1AA 1DVIA 3NGVA 3SG2A 2BCBA 3NXAA 5HYDA 4M2OA 3PATA 1KFXS 3CLNA 1IQ3A 1F70A 2Y5IA 3B88A 2L2EA 1A2XA 2PALA 3B86A 1LXFC 1NP8A 3IQOA 1A03A 2ZN8A 1JFKA 1BLQA 1PRWA 4YGAA 3TUYC 2PVBA 2NZ0A 1KK8C 3GK4X 2ZNEA 3D73A 1JF0A 3O6BA 1FPWA 1NX1A 3SJSA 1QX5B 3NHIA 2LNKA 3SG6A 4KYNA 3VROA 2LVKA 1SW8A 5D69A 1W9ZA 2MRDA 3OP0A 4PHMA 2COLB 5CPVA 3SIAA 1T14A 1CM4A 1SCMC 1CDMA 3I5HC 2KI4B 1J1DA 3NSKA 1NX3A 4N1GA 5DICA 1B8RA 3O78A 1QX2A 1NIWA 1KQMB 3QRXA 1SBJA 1DF0A 4MZLA 2L51A 2LP2A 1QS7A 2BECA 4GAOA 3PM2A 5AEQA 1OZSA 4NDBA 1YUSA 1NX2A 2LMTA 3KF9A 4AQIA 1AP4A 1CFPA 1CLBA 5DKNA 4DRWA 2CCMA 3S0FA 3GK2A 1IQ5A 3DZTA 3R1VA 2M1KB 2WNDA 1ZUZA 4PCWA 5HL1A 3CZ2A 2KAYA 4CLNA 2CBLA 2BAPA 3EVUA 2M1UA 3HCMA 4CFQA 1PSBA 1ALVA 3ZNIA 4HRHA 1CM1A 1SL8A 1CMFA 2MLFC 2P70A 4JKTA 3SIBA 4MEWA 4MVFA 1FW4A 5I2LA 1CFFA 1SNLA 1J55A 2BL0B 1OMDA 2JTZA 1YX7A 1DJWA 1DJXA 1TOPA 1RFJA 2K60A 4OCIA 2JULA 2EGDA 1D1OA 1J7PA 1B7TZ 1B47A 1B8LA 5JJGA 1JBAA 5I2QA 5I94A 3AKAA 1A29A 2BKIB 3PSRA 2H61C 4M2PA 4F0ZB 3B7AA 3L4LA 2KI4C 5HKYA 1C7VA 4HSZA 1KQVA 1XK4C 4PT1A 2E6WA 1KQMC 1CLMA 1SPYA 1YRUB 2G2BA 2EHBA 2QEVA 3BOWB 4GNKB 1F71A 1QWVA 1XFXO 1EJ3A 1K90D 2LMVA 1IG5A 4YGDB 4P2YB 1SKTA 2F3YA 1NPQA 2R2IA 4BY4A 2HQ8A 1Z4HA 3EK4A 1ODBA 4DS7A 1OOGA 2KLEA 2LHIA 1J7OA 3NHTA 1RROA 4GGFA 1G33A 4YI8A 1PVAA 1YVHA 1B7TY 2MBXA 1V1FA 4FQTA 4CFRA 1BG1A 1WRZA 1WRLA 2KSPA 4ETOA 1XFUO 1CDLA 2L98A 3BUNB 4OZDA 2JXCA 3TS5B 4D1EA 1DJYA 3DXLA 3CWGA 4YGBB 3D0YB 1KSMA 2BL0C 3R1OA 4U8DA 1M63B 3BUMB 1VRKA 3VRNA 5J3XA 4CIDA 5IBWA 1YTZC 1KWOC 2NXQA 3H4SE 2HETA 2BBNA 2KQ6A 4QJ5B 1LA3A 4NDCA 2WCKA 2ZN9A 5CSNA 3CR2A 1MR8A 1SCVA 1RECA 2K8MB 1KK8B 1UUSA 3R72A 1KFXL 1A75A 1CDPA 1XVJA 2LUXA 4OV2A 2JNFA 4UPGA 2M3WA 1JF2A 3PJIA 2KNEA 1TUJA 5HLVA 1FI5A 2F33A 3FWCA 3RZSA 1M45A 4MBEA 3ZWHA 3L47A 4MZKA 1S3PA 1Y1XA 1Z2CB 4IJ7A 1UHKA 1WLMA 4YBHB 2HQWA 1JC2A 3C1VA 2PQLA 2F8PA 1LA0A 1LINA 1YUUA 4PDZA 5KTYA 2IS9A 4I5NB 2LM5A 2ZRSA 1OW4A 3CZTX 2JC2A 4R1EA 3DF0B 1UHHA 1NUBA 4N5XA 2KBMA 3TS5C 3OB2B 4DCKA 1DMOA 2LHLA 3QMEA 2WCBA 2MA2A 5HLOA 1K96A 5F6TA 3D10A 4PE0A 2I2RE 1YR5A 5AFPA 2JNXA 3B6XA 1RK9A 2KYFA 2JTTA 4PE4A 1H8BA 4QJ3B 4GGNA 4GUKA 2OTGC 1LS8A 1PVBA 2BCXA 3K1EA 4WQ3A 5FI7A 3OX5A 4GBAA 2GTEA 2JPOA 2L5YA 2NLNA 3ICBA 4INWA 4C0LA 2D8NA 1S6JA 2K2AA 3WNXB 1N2DA 1IWQA 1L2OB 1N0YA
chains in the Genus database with same CATH topology
2K7OA 2ISDA 1EG4A 1ZMZA 1W7JB 1G4YR 1OOJA 1TRFA 4YRUA 2H2KA 4Q04A 4FQOA 3EKJA 1OMVA 2LV7A 2K2FA 2KGRA 5TNCA 1M46A 2H61A 4MSPA 3CS1A 3KPXA 2M29A 1DF0B 3CTNA 1XK4A 1Y0VH 3JVTB 1SYMA 1KK7Z 1QIVA 3EVRA 1UWOA 1XA5A 1B9AA 1QV0A 3PLFB 1X02A 2ZFDA 4PHJA 4GFTA 2I94A 1HT9A 1FF1A 2M8UA 2JOJA 2LCPA 1GQMA 1BODA 3VGOA 5AANA 4A4BA 1U5IB 3SG3A 2PASA 4ORCB 2MAZA 2BKHB 3K21A 1KWOB 4PE7A 2CXJA 1NWDA 1G8IA 3M0WA 2KAVA 2L0PA 2P6BB 1CB1A 3DVEA 4IL1A 2GGMA 1W7IB 1L2OC 1J7QA 1AK8A 1KK7Y 1IRJA 2OPOA 4ZCUA 1FBVA 1K9PA 2M0RA 4I5LB 1BMOA 2LUCA 1MF8B 1YUTA 1UP5A 4USLA 2M97A 1KFUS 1V1GA 1CLLA 1HQVA 3BXKA 3VRPA 1TNXA 4TNCA 1TNQA 1EL4A 4JPZB 2B1UA 1IJ5A 3I5FB 1OMRA 2K7CA 4ORAB 2JWWA 1KSOA 2GV5A 3EVVA 3JVTC 1BU3A 4M2QA 1R2UA 1SL7A 3BOWA 1QASA 2WOSA 1MWNA 3GOFA 2AAOA 3F45A 2LLUA 2BBMA 3PN7C 1AUIB 1Y6WA 3AAJA 1Q80A 2JU0A 2JPTA 1NCZA 2OS8B 1K94A 5AERA 3WHTB 1AVSA 1OZOA 1XFVO 1YX8A 2JQ6A 1E8AA 1IKUA 3JTDB 1WY9A 4PE1A 2LANA 3PM8A 1EG3A 1L7ZA 2PMYA 3CR5X 4BY5A 1J7RA 4QJ4B 4AOMA 1BT6A 1K9UA 1WDCB 1EH2A 3FS7A 1XFZO 2F2PA 2BE4A 2V53A 1NCYA 3D0YA 2OTGB 4NDDA 5CSIA 1H4BA 1B4CA 2MHHA 3TDUA 1QIWA 1F55A 2L5XB 2K0JA 2Y4QA 2BE6A 4WRIA 3LL8B 2PRUA 1QLKA 4JQ0D 2Y1NA 1RTP1 2LVJA 3A8RA 4YI9A 1DTLA 1BF5A 1S26D 1B8CA 1PULA 1K95A 1TN4A 3TZ1A 5G08A 3I5FC 1MQ1A 1DT7B 3I5IC 4L9MA 1MXLC 1K9KA 1NX0A 3VRRA 1SK6D 3FWBA 1SY9A 2LLTA 5PALA 3HX4A 2LE9B 1AJ4A 1BR4B 3PALA 2QACA 3KEVA 3PFVA 4MN0A 2OS8C 1YVLA 1SMGA 2NCOA 4GGFC 1OQPA 5ER4X 3E3RA 3KHEA 1NCXA 1A4PA 1NSHA 4YGCB 4ICBA 3JTDC 2LLSA 2FCEA 4I5KA 1QVIZ 2JRFA 1C7WA 1DGUA 1TCFA 4XJKA 3DVJA 5I8NA 1QJTA 2ZNDA 3DF0A 4YGEB 1CTRA 1WDCC 3SG4A 1PK0D 2SASA 1K93D 3WXAA 1CNPA 2TN4A 1F54A 2BCAA 1OE9B 1ZFSA 2K7DA 5D7FA 1JWDA 1S6CA 1UHNA 3BQ3A 2I7AA 1JSAA 3LK0A 3O4YA 4MZJA 4NQGA 3SG5A 3FIAA 1KCYA 1QATA 5HKWA 1SR6C 3OB1B 2K7BA 4DIRA 5K89A 2KGBC 2M7LA 1FI6A 1DGVA 1CKKA 1QVIY 2HF5A 2GGZA 1M31A 2E30A 5KSZA 1XFYO 3BUXB 1F4OA 3CGAA 1GGZA 1MXEA 3GK1A 2LVIA 4OVNF 2MLEC 4E68A 1XYDA 3BYAA 1IJ6A 2G9BA 4OKHA 2LC5A 2RGIA 2ZRTA 3VRQA 1SL9A 3CR4X 1TTXA 3RM1A 1JFJA 1OSAA 3TDIA 2AMIA 3PN7B 5BPJA 2I18A 1KFUL 1AHRA 2Q4UA 2FJUB 1XFWO 3A4UB 4A4CA 1XO5A 4GPLB 1UHIA 3O2PA 2KHNA 2KAXA 1Y1UA 2L4HA 3I5GB 1WRKA 2NCPA 2Y1MA 4C0KA 4CPVA 1DJHA 4N1FA 1QXPA 1QX7A 4XYNA 3LLEA 3LCPC 1S5GZ 1U5IA 3EK8A 1DJGA 1ALWA 3OX6A 4P5OE 5B8IB 1DJIA 1UHJA 2KOTA 3NSLA 2F2OA 5KU1A 4WQ2A 4PALA 4PHNA 2KQYA 1BJFA 1S1EA 2JZIA 1F4QA 1MUXA 3DVKA 1RWYA 3I5IB 2WORA 1QV1A 5DKQA 1CDNA 2A4JA 2JT3A 3BUOB 3KO0A 2JT8A 2KI6C 1CFDA 5AXIA 1J1EA 2PSRA 4OR9B 1MHOA 1DJZA 1YURA 2WC8A 5CSJA 2SCPA 2LMUA 3DVMA 1GJYA 3EKHA 2M7NA 4JWQA 2FCDA 1WLZA 2L50A 1S5GY 2KBIA 2KFFA 3AKBA 1GGWA 2HPSA 4DUQA 1S36A 3DD4A 2F3ZA 1BR1B 3I5GC 2EC6B 3IF7A 2Q91A 2LP3A 3WHUB 1K2HA 1AJ5A 1IGVA 3IQQA 4MRXA 1SRAA 5GQQC 1TNWA 1TIZA 2O60A 2ZKMX 3LK1A 1JUOA 1C07A 5DKRA 2FOTA 1NYAA 1BOCA 1LVCD 5ER5A 2K61A 1ZACA 4MRYA 1ZOTB 3TDZA 1A75B 1QTXA 1N65A 1SR6B 4MLWA 2JXLA 3BUWB 1B1GA 3SG7A 1CFCA 2M49B 2L4IA 5HKZA 5I2OA 4ORBB 3RLZA 2JT0A 4HRGA 2QPTA 2CNPA 2LAPA 3TUYB 2CT9A 1F8HA 1S6IA 2KYCA 1QLSA 2WCFA 2LVVA 1R6PA 2KFHA 2KFGA 2KDHA 2CTNA 2O5GA 3EK7A 3NSIA 4PHKA 1CMGA 2M9GA 3NSOA 2KI6D 5JOLA 1IH0A 4C0JA 4HREE 2DOQA 3OHMB 1UURA 1SCMB 2EC6C 3I5HB 1TNPA 3MSEB 1EXRA 1LKJA 4FTGA 5FYXA 5CSFA 1RJVA 4AQJA 1M39A 4XJKB 3AAKA 2VRGA 1PALA 2AUCA 2MJWB 2WCEA 4I5JA 1PSRA 1K8UA 1YRTB 1TCOB 1Y1AA 1DVIA 3SG2A 2BCBA 3NXAA 5HYDA 4M2OA 3PATA 1KFXS 3CLNA 1IQ3A 1F70A 2Y5IA 2L2EA 1A2XA 2PALA 1LXFC 1NP8A 3IQOA 1A03A 2ZN8A 1JFKA 1BLQA 1PRWA 4YGAA 3TUYC 2PVBA 2NZ0A 1KK8C 3GK4X 2ZNEA 3O6BA 1JF0A 1FPWA 1NX1A 3SJSA 1QX5B 3SG6A 2LNKA 3VROA 2LVKA 1SW8A 5D69A 2MRDA 3OP0A 4PHMA 2COLB 5CPVA 3SIAA 1CM4A 1SCMC 1CDMA 3I5HC 2KI4B 1J1DA 3NSKA 1NX3A 4N1GA 1B8RA 3O78A 1QX2A 1NIWA 1KQMB 3QRXA 1SBJA 1DF0A 4MZLA 2L51A 2LP2A 1QS7A 2BECA 4GAOA 5AEQA 1OZSA 4NDBA 1YUSA 1NX2A 2LMTA 3KF9A 4AQIA 1AP4A 1CFPA 1CLBA 5DKNA 4DRWA 2CCMA 3GK2A 1IQ5A 2M1KB 2WNDA 1ZUZA 4PCWA 4CLNA 2KAYA 2CBLA 3EVUA 2M1UA 3HCMA 4CFQA 1PSBA 1ALVA 3ZNIA 4HRHA 1CM1A 1SL8A 1CMFA 2MLFC 3SIBA 4MEWA 4MVFA 1FW4A 5I2LA 1CFFA 1SNLA 1J55A 2BL0B 1OMDA 2JTZA 1YX7A 1DJWA 1DJXA 1TOPA 1RFJA 4OCIA 1D1OA 2JULA 2EGDA 1J7PA 1B7TZ 1B47A 1B8LA 5JJGA 1JBAA 5I2QA 3AKAA 1A29A 2BKIB 3PSRA 2H61C 4M2PA 4F0ZB 2KI4C 5HKYA 1C7VA 4HSZA 1KQVA 1XK4C 4ZCVA 2E6WA 1KQMC 1CLMA 1SPYA 1YRUB 2G2BA 2EHBA 3BOWB 4GNKB 1F71A 1XFXO 1EJ3A 1K90D 2LMVA 1IG5A 4YGDB 4P2YB 1SKTA 2F3YA 1NPQA 2R2IA 4BY4A 2HQ8A 3EK4A 1ODBA 4DS7A 1J7OA 2LHIA 1RROA 4GGFA 1G33A 4YI8A 1PVAA 1YVHA 1B7TY 2MBXA 1V1FA 1BG1A 4CFRA 1WRZA 1WRLA 2KSPA 4ETOA 1XFUO 1CDLA 2L98A 3BUNB 3TS5B 2JXCA 4D1EA 1DJYA 4YGBB 3CWGA 3D0YB 1KSMA 2BL0C 4U8DA 1M63B 3BUMB 1VRKA 3VRNA 5J3XA 4CIDA 5IBWA 1YTZC 1KWOC 2NXQA 3H4SE 2HETA 2BBNA 2KQ6A 4QJ5B 1LA3A 4NDCA 2ZN9A 5CSNA 3CR2A 1MR8A 1SCVA 1RECA 2K8MB 1KK8B 1UUSA 1KFXL 1A75A 1CDPA 1XVJA 2LUXA 4OV2A 2JNFA 4UPGA 2M3WA 1JF2A 2KNEA 5HLVA 1FI5A 2F33A 3FWCA 1M45A 4MBEA 3ZWHA 4MZKA 1S3PA 1Y1XA 1UHKA 1WLMA 4YBHB 2HQWA 1JC2A 3C1VA 2F8PA 1LA0A 1LINA 1YUUA 4PDZA 5KTYA 2IS9A 4I5NB 2LM5A 2ZRSA 3CZTX 2JC2A 4R1EA 3DF0B 1UHHA 1NUBA 4N5XA 2KBMA 3TS5C 3OB2B 4DCKA 1DMOA 2LHLA 2WCBA 2MA2A 5HLOA 1K96A 5F6TA 3D10A 4PE0A 2I2RE 1YR5A 5AFPA 2JNXA 1RK9A 2KYFA 2JTTA 4PE4A 1H8BA 4QJ3B 4GGNA 4GUKA 2OTGC 1PVBA 2BCXA 4WQ3A 3OX5A 4GBAA 2NLNA 3ICBA 4C0LA 2D8NA 1S6JA 2K2AA 3WNXB 1N2DA 1IWQA 1L2OB 1N0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K7O A;  2ISD A;  1EG4 A;  1ZMZ A;  1W7J B;  1G4Y R;  1OOJ A;  1TRF A;  4YRU A;  2H2K A;  4Q04 A;  4FQO A;  3EKJ A;  1OMV A;  2LV7 A;  2K2F A;  2KGR A;  5TNC A;  1M46 A;  2H61 A;  4MSP A;  3CS1 A;  3KPX A;  2M29 A;  1DF0 B;  3CTN A;  1XK4 A;  1Y0V H;  3JVT B;  1SYM A;  1KK7 Z;  1QIV A;  3EVR A;  1UWO A;  1XA5 A;  1B9A A;  1QV0 A;  3PLF B;  1X02 A;  2ZFD A;  4PHJ A;  4GFT A;  2I94 A;  1HT9 A;  1FF1 A;  2M8U A;  2JOJ A;  2LCP A;  1GQM A;  1BOD A;  3VGO A;  5AAN A;  4A4B A;  1U5I B;  3SG3 A;  2PAS A;  4ORC B;  2MAZ A;  2BKH B;  3K21 A;  1KWO B;  4PE7 A;  2CXJ A;  1NWD A;  1G8I A;  3M0W A;  2KAV A;  2L0P A;  2P6B B;  1CB1 A;  3DVE A;  4IL1 A;  2GGM A;  1W7I B;  1L2O C;  1J7Q A;  1AK8 A;  1KK7 Y;  1IRJ A;  2OPO A;  4ZCU A;  1FBV A;  1K9P A;  2M0R A;  4I5L B;  1BMO A;  2LUC A;  1MF8 B;  1YUT A;  1UP5 A;  4USL A;  2M97 A;  1KFU S;  1V1G A;  1CLL A;  1HQV A;  3BXK A;  3VRP A;  1TNX A;  4TNC A;  1TNQ A;  1EL4 A;  4JPZ B;  2B1U A;  1IJ5 A;  3I5F B;  1OMR A;  2K7C A;  4ORA B;  2JWW A;  1KSO A;  2GV5 A;  3EVV A;  3JVT C;  1BU3 A;  4M2Q A;  1R2U A;  1SL7 A;  3BOW A;  1QAS A;  2WOS A;  1MWN A;  3GOF A;  2AAO A;  3F45 A;  2LLU A;  2BBM A;  3PN7 C;  1AUI B;  1Y6W A;  3AAJ A;  1Q80 A;  2JU0 A;  2JPT A;  1NCZ A;  2OS8 B;  1K94 A;  5AER A;  3WHT B;  1AVS A;  1OZO A;  1XFV O;  1YX8 A;  2JQ6 A;  1E8A A;  1IKU A;  3JTD B;  1WY9 A;  4PE1 A;  2LAN A;  3PM8 A;  1EG3 A;  1L7Z A;  2PMY A;  3CR5 X;  4BY5 A;  1J7R A;  4QJ4 B;  4AOM A;  1BT6 A;  1K9U A;  1WDC B;  1EH2 A;  3FS7 A;  1XFZ O;  2F2P A;  2BE4 A;  2V53 A;  1NCY A;  3D0Y A;  2OTG B;  4NDD A;  5CSI A;  1H4B A;  1B4C A;  2MHH A;  3TDU A;  1QIW A;  1F55 A;  2L5X B;  2K0J A;  2Y4Q A;  2BE6 A;  4WRI A;  3LL8 B;  2PRU A;  1QLK A;  4JQ0 D;  2Y1N A;  1RTP 1;  2LVJ A;  3A8R A;  4YI9 A;  1DTL A;  1BF5 A;  1S26 D;  1B8C A;  1PUL A;  1K95 A;  1TN4 A;  3TZ1 A;  5G08 A;  3I5F C;  1MQ1 A;  1DT7 B;  3I5I C;  4L9M A;  1MXL C;  1K9K A;  1NX0 A;  3VRR A;  1SK6 D;  3FWB A;  1SY9 A;  2LLT A;  5PAL A;  3HX4 A;  2LE9 B;  1AJ4 A;  1BR4 B;  3PAL A;  2QAC A;  3KEV A;  3PFV A;  4MN0 A;  2OS8 C;  1YVL A;  1SMG A;  2NCO A;  4GGF C;  1OQP A;  5ER4 X;  3E3R A;  3KHE A;  1NCX A;  1A4P A;  1NSH A;  4YGC B;  4ICB A;  3JTD C;  2LLS A;  2FCE A;  4I5K A;  1QVI Z;  2JRF A;  1C7W A;  1DGU A;  1TCF A;  4XJK A;  3DVJ A;  5I8N A;  1QJT A;  2ZND A;  3DF0 A;  4YGE B;  1CTR A;  1WDC C;  3SG4 A;  1PK0 D;  2SAS A;  1K93 D;  3WXA A;  1CNP A;  2TN4 A;  1F54 A;  2BCA A;  1OE9 B;  1ZFS A;  2K7D A;  5D7F A;  1JWD A;  1S6C A;  1UHN A;  3BQ3 A;  2I7A A;  1JSA A;  3LK0 A;  3O4Y A;  4MZJ A;  4NQG A;  3SG5 A;  3FIA A;  1KCY A;  1QAT A;  5HKW A;  1SR6 C;  3OB1 B;  2K7B A;  4DIR A;  5K89 A;  2KGB C;  2M7L A;  1FI6 A;  1DGV A;  1CKK A;  1QVI Y;  2HF5 A;  2GGZ A;  1M31 A;  2E30 A;  5KSZ A;  1XFY O;  3BUX B;  1F4O A;  3CGA A;  1GGZ A;  1MXE A;  3GK1 A;  2LVI A;  4OVN F;  2MLE C;  4E68 A;  1XYD A;  3BYA A;  1IJ6 A;  2G9B A;  4OKH A;  2LC5 A;  2RGI A;  2ZRT A;  3VRQ A;  1SL9 A;  3CR4 X;  1TTX A;  3RM1 A;  1JFJ A;  1OSA A;  3TDI A;  2AMI A;  3PN7 B;  5BPJ A;  2I18 A;  1KFU L;  1AHR A;  2Q4U A;  2FJU B;  1XFW O;  3A4U B;  4A4C A;  1XO5 A;  4GPL B;  1UHI A;  3O2P A;  2KHN A;  2KAX A;  1Y1U A;  2L4H A;  3I5G B;  1WRK A;  2NCP A;  2Y1M A;  4C0K A;  4CPV A;  1DJH A;  4N1F A;  1QXP A;  1QX7 A;  4XYN A;  3LLE A;  3LCP C;  1S5G Z;  1U5I A;  3EK8 A;  1DJG A;  1ALW A;  3OX6 A;  4P5O E;  5B8I B;  1DJI A;  1UHJ A;  2KOT A;  3NSL A;  2F2O A;  5KU1 A;  4WQ2 A;  4PAL A;  4PHN A;  2KQY A;  1BJF A;  1S1E A;  2JZI A;  1F4Q A;  1MUX A;  3DVK A;  1RWY A;  3I5I B;  2WOR A;  1QV1 A;  5DKQ A;  1CDN A;  2A4J A;  2JT3 A;  3BUO B;  3KO0 A;  2JT8 A;  2KI6 C;  1CFD A;  5AXI A;  1J1E A;  2PSR A;  4OR9 B;  1MHO A;  1DJZ A;  1YUR A;  2WC8 A;  5CSJ A;  2SCP A;  2LMU A;  3DVM A;  1GJY A;  3EKH A;  2M7N A;  4JWQ A;  2FCD A;  1WLZ A;  2L50 A;  1S5G Y;  2KBI A;  2KFF A;  3AKB A;  1GGW A;  2HPS A;  4DUQ A;  1S36 A;  3DD4 A;  2F3Z A;  1BR1 B;  3I5G C;  2EC6 B;  3IF7 A;  2Q91 A;  2LP3 A;  3WHU B;  1K2H A;  1AJ5 A;  1IGV A;  3IQQ A;  4MRX A;  1SRA A;  5GQQ C;  1TNW A;  1TIZ A;  2O60 A;  2ZKM X;  3LK1 A;  1JUO A;  1C07 A;  5DKR A;  2FOT A;  1NYA A;  1BOC A;  1LVC D;  5ER5 A;  2K61 A;  1ZAC A;  4MRY A;  1ZOT B;  3TDZ A;  1A75 B;  1QTX A;  1N65 A;  1SR6 B;  4MLW A;  2JXL A;  3BUW B;  1B1G A;  3SG7 A;  1CFC A;  2M49 B;  2L4I A;  5HKZ A;  5I2O A;  4ORB B;  3RLZ A;  2JT0 A;  4HRG A;  2QPT A;  2CNP A;  2LAP A;  3TUY B;  2CT9 A;  1F8H A;  1S6I A;  2KYC A;  1QLS A;  2WCF A;  2LVV A;  1R6P A;  2KFH A;  2KFG A;  2KDH A;  2CTN A;  2O5G A;  3EK7 A;  3NSI A;  4PHK A;  1CMG A;  2M9G A;  3NSO A;  2KI6 D;  5JOL A;  1IH0 A;  4C0J A;  4HRE E;  2DOQ A;  3OHM B;  1UUR A;  1SCM B;  2EC6 C;  3I5H B;  1TNP A;  3MSE B;  1EXR A;  1LKJ A;  4FTG A;  5FYX A;  5CSF A;  1RJV A;  4AQJ A;  1M39 A;  4XJK B;  3AAK A;  2VRG A;  1PAL A;  2AUC A;  2MJW B;  2WCE A;  4I5J A;  1PSR A;  1K8U A;  1YRT B;  1TCO B;  1Y1A A;  1DVI A;  3SG2 A;  2BCB A;  3NXA A;  5HYD A;  4M2O A;  3PAT A;  1KFX S;  3CLN A;  1IQ3 A;  1F70 A;  2Y5I A;  2L2E A;  1A2X A;  2PAL A;  1LXF C;  1NP8 A;  3IQO A;  1A03 A;  2ZN8 A;  1JFK A;  1BLQ A;  1PRW A;  4YGA A;  3TUY C;  2PVB A;  2NZ0 A;  1KK8 C;  3GK4 X;  2ZNE A;  3O6B A;  1JF0 A;  1FPW A;  1NX1 A;  3SJS A;  1QX5 B;  3SG6 A;  2LNK A;  3VRO A;  2LVK A;  1SW8 A;  5D69 A;  2MRD A;  3OP0 A;  4PHM A;  2COL B;  5CPV A;  3SIA A;  1CM4 A;  1SCM C;  1CDM A;  3I5H C;  2KI4 B;  1J1D A;  3NSK A;  1NX3 A;  4N1G A;  1B8R A;  3O78 A;  1QX2 A;  1NIW A;  1KQM B;  3QRX A;  1SBJ A;  1DF0 A;  4MZL A;  2L51 A;  2LP2 A;  1QS7 A;  2BEC A;  4GAO A;  5AEQ A;  1OZS A;  4NDB A;  1YUS A;  1NX2 A;  2LMT A;  3KF9 A;  4AQI A;  1AP4 A;  1CFP A;  1CLB A;  5DKN A;  4DRW A;  2CCM A;  3GK2 A;  1IQ5 A;  2M1K B;  2WND A;  1ZUZ A;  4PCW A;  4CLN A;  2KAY A;  2CBL A;  3EVU A;  2M1U A;  3HCM A;  4CFQ A;  1PSB A;  1ALV A;  3ZNI A;  4HRH A;  1CM1 A;  1SL8 A;  1CMF A;  2MLF C;  3SIB A;  4MEW A;  4MVF A;  1FW4 A;  5I2L A;  1CFF A;  1SNL A;  1J55 A;  2BL0 B;  1OMD A;  2JTZ A;  1YX7 A;  1DJW A;  1DJX A;  1TOP A;  1RFJ A;  4OCI A;  1D1O A;  2JUL A;  2EGD A;  1J7P A;  1B7T Z;  1B47 A;  1B8L A;  5JJG A;  1JBA A;  5I2Q A;  3AKA A;  1A29 A;  2BKI B;  3PSR A;  2H61 C;  4M2P A;  4F0Z B;  2KI4 C;  5HKY A;  1C7V A;  4HSZ A;  1KQV A;  1XK4 C;  4ZCV A;  2E6W A;  1KQM C;  1CLM A;  1SPY A;  1YRU B;  2G2B A;  2EHB A;  3BOW B;  4GNK B;  1F71 A;  1XFX O;  1EJ3 A;  1K90 D;  2LMV A;  1IG5 A;  4YGD B;  4P2Y B;  1SKT A;  2F3Y A;  1NPQ A;  2R2I A;  4BY4 A;  2HQ8 A;  3EK4 A;  1ODB A;  4DS7 A;  1J7O A;  2LHI A;  1RRO A;  4GGF A;  1G33 A;  4YI8 A;  1PVA A;  1YVH A;  1B7T Y;  2MBX A;  1V1F A;  1BG1 A;  4CFR A;  1WRZ A;  1WRL A;  2KSP A;  4ETO A;  1XFU O;  1CDL A;  2L98 A;  3BUN B;  3TS5 B;  2JXC A;  4D1E A;  1DJY A;  4YGB B;  3CWG A;  3D0Y B;  1KSM A;  2BL0 C;  4U8D A;  1M63 B;  3BUM B;  1VRK A;  3VRN A;  5J3X A;  4CID A;  5IBW A;  1YTZ C;  1KWO C;  2NXQ A;  3H4S E;  2HET A;  2BBN A;  2KQ6 A;  4QJ5 B;  1LA3 A;  4NDC A;  2ZN9 A;  5CSN A;  3CR2 A;  1MR8 A;  1SCV A;  1REC A;  2K8M B;  1KK8 B;  1UUS A;  1KFX L;  1A75 A;  1CDP A;  1XVJ A;  2LUX A;  4OV2 A;  2JNF A;  4UPG A;  2M3W A;  1JF2 A;  2KNE A;  5HLV A;  1FI5 A;  2F33 A;  3FWC A;  1M45 A;  4MBE A;  3ZWH A;  4MZK A;  1S3P A;  1Y1X A;  1UHK A;  1WLM A;  4YBH B;  2HQW A;  1JC2 A;  3C1V A;  2F8P A;  1LA0 A;  1LIN A;  1YUU A;  4PDZ A;  5KTY A;  2IS9 A;  4I5N B;  2LM5 A;  2ZRS A;  3CZT X;  2JC2 A;  4R1E A;  3DF0 B;  1UHH A;  1NUB A;  4N5X A;  2KBM A;  3TS5 C;  3OB2 B;  4DCK A;  1DMO A;  2LHL A;  2WCB A;  2MA2 A;  5HLO A;  1K96 A;  5F6T A;  3D10 A;  4PE0 A;  2I2R E;  1YR5 A;  5AFP A;  2JNX A;  1RK9 A;  2KYF A;  2JTT A;  4PE4 A;  1H8B A;  4QJ3 B;  4GGN A;  4GUK A;  2OTG C;  1PVB A;  2BCX A;  4WQ3 A;  3OX5 A;  4GBA A;  2NLN A;  3ICB A;  4C0L A;  2D8N A;  1S6J A;  2K2A A;  3WNX B;  1N2D A;  1IWQ A;  1L2O B;  1N0Y A; 
#chains in the Genus database with same CATH topology
 2K7O A;  3L4A A;  2ISD A;  1EG4 A;  1ZMZ A;  1W7J B;  1G4Y R;  3UNW A;  1OOJ A;  1TRF A;  4YRU A;  2H2K A;  4Q04 A;  4FQO A;  3EKJ A;  1OMV A;  2LV7 A;  2K2F A;  2KGR A;  5TNC A;  1M46 A;  3OGN A;  3CZ0 A;  2H61 A;  4MSP A;  5FI6 A;  3CYZ A;  3CS1 A;  3KPX A;  3S0D A;  2M29 A;  1DF0 B;  3CTN A;  1XK4 A;  1Y0V H;  3JVT B;  1SYM A;  1KK7 Z;  1QIV A;  3EVR A;  1UWO A;  1XA5 A;  2WC6 A;  1B9A A;  1QV0 A;  3D76 A;  1X02 A;  2KPH A;  2WC5 A;  3IVT A;  3PLF B;  2ZFD A;  4PHJ A;  4GFT A;  2I94 A;  1HT9 A;  1FF1 A;  2M8U A;  2JOJ A;  2LCP A;  1GQM A;  1BOD A;  3VGO A;  5AAN A;  4A4B A;  1U5I B;  3SG3 A;  2PAS A;  4ORC B;  2MAZ A;  2BKH B;  3K21 A;  1KWO B;  4PE7 A;  2CXJ A;  1NWD A;  1G8I A;  3M0W A;  2KAV A;  2L0P A;  2P6B B;  1CB1 A;  3DVE A;  4IL1 A;  2GGM A;  1W7I B;  1L2O C;  1J7Q A;  1AK8 A;  1KK7 Y;  3S0B A;  1IRJ A;  2OPO A;  4ZCU A;  1FBV A;  3D78 A;  1K9P A;  2M0R A;  3BFB A;  4I5L B;  5FI2 A;  1BMO A;  2LUC A;  1MF8 B;  1YUT A;  3SS5 A;  1UP5 A;  4USL A;  2M97 A;  1KFU S;  1V1G A;  1CLL A;  1HQV A;  3BXK A;  3VRP A;  1TNX A;  4TNC A;  1TNQ A;  1EL4 A;  4JPZ B;  2B1U A;  1IJ5 A;  3I5F B;  1OMR A;  2K7C A;  4ORA B;  2JWW A;  1KSO A;  2GV5 A;  3EVV A;  3JVT C;  1BU3 A;  4M2Q A;  1R2U A;  1SL7 A;  3BOW A;  1QAS A;  2H8V A;  1MWN A;  2WOS A;  2AAO A;  3F45 A;  3GOF A;  3S0A A;  2LLU A;  2QDI A;  2BBM A;  3PN7 C;  1AUI B;  1Y6W A;  3AAJ A;  1Q80 A;  2JU0 A;  4ZCV A;  2JPT A;  1NCZ A;  2OS8 B;  1K94 A;  5AER A;  1DEK A;  3SS3 A;  3WHT B;  1AVS A;  1OZO A;  1XFV O;  1YX8 A;  2JQ6 A;  1E8A A;  1IKU A;  3JTD B;  1WY9 A;  4PE1 A;  2WCJ A;  2LAN A;  3PM8 A;  1EG3 A;  1L7Z A;  2PMY A;  3CR5 X;  4BY5 A;  1J7R A;  4QJ4 B;  4AOM A;  1BT6 A;  1K9U A;  1WDC B;  1EH2 A;  3FS7 A;  1XFZ O;  2F2P A;  2BE4 A;  2V53 A;  1NCY A;  3D0Y A;  2OTG B;  4NDD A;  5CSI A;  1H4B A;  1B4C A;  2MHH A;  3TDU A;  1QIW A;  1F55 A;  2L5X B;  2K0J A;  2Y4Q A;  2BE6 A;  4WRI A;  3LL8 B;  2PRU A;  1QLK A;  4JQ0 D;  2BNX A;  2Y1N A;  1RTP 1;  2LVJ A;  3A8R A;  4YI9 A;  1XFR A;  1DTL A;  3VB1 A;  1S26 D;  1B8C A;  1PUL A;  1TUZ A;  1K95 A;  2ERB A;  2L2C A;  1BF5 A;  1TN4 A;  3DY9 A;  3TZ1 A;  5G08 A;  3I5F C;  3S0G A;  1TWO A;  1MQ1 A;  1DT7 B;  3I5I C;  4L9M A;  1MXL C;  1K9K A;  1NX0 A;  3VRR A;  4INX A;  1SK6 D;  3FWB A;  1SY9 A;  2LLT A;  5PAL A;  3HX4 A;  2LE9 B;  1AJ4 A;  1BR4 B;  3FE6 A;  3PAL A;  2QAC A;  3KEV A;  3PFV A;  4MN0 A;  3R1P A;  2QEO A;  2OS8 C;  1YVL A;  1SMG A;  2NCO A;  4GGF C;  1OQP A;  5ER4 X;  3E3R A;  3KHE A;  1NCX A;  1A4P A;  1NSH A;  4YGC B;  4ICB A;  3JTD C;  2LLS A;  2FCE A;  4I5K A;  2QEH A;  1QVI Z;  2JRF A;  1C7W A;  1DGU A;  3D74 A;  1TCF A;  4XJK A;  3DVJ A;  5I8N A;  1QJT A;  2ZND A;  3DF0 A;  4YGE B;  1CTR A;  1WDC C;  3SG4 A;  1PK0 D;  2SAS A;  1K93 D;  1DEL A;  3WXA A;  1CNP A;  2TN4 A;  1F54 A;  2BCA A;  1OE9 B;  1ZFS A;  2K7D A;  1P28 A;  5D7F A;  1OOI X;  1JWD A;  3FE8 A;  1S6C A;  3D75 A;  1UHN A;  5D3O A;  3BQ3 A;  2I7A A;  1JSA A;  3LK0 A;  3O4Y A;  4MZJ A;  4NQG A;  3SG5 A;  3BJH A;  3FIA A;  1KCY A;  1QAT A;  5HKW A;  1SR6 C;  3OB1 B;  2K7B A;  4DIR A;  5K89 A;  2KGB C;  2M7L A;  1FI6 A;  1DGV A;  1CKK A;  1QVI Y;  3O4X A;  2HF5 A;  2GGZ A;  1M31 A;  2E30 A;  5KSZ A;  1XFY O;  1IIO A;  3BUX B;  1F4O A;  3CGA A;  1GGZ A;  1C3Z A;  1MXE A;  3GK1 A;  3CAB A;  2PYQ A;  2LVI A;  4OVN F;  2MLE C;  4E68 A;  1XYD A;  3BYA A;  2WCH A;  1IJ6 A;  2G9B A;  4JD9 A;  4OKH A;  2LC5 A;  2RGI A;  1OOH A;  2ZRT A;  3VRQ A;  1DQE A;  1SL9 A;  3CR4 X;  1TTX A;  3RM1 A;  1JFJ A;  1OSA A;  3TDI A;  2AMI A;  3PN7 B;  5BPJ A;  2I18 A;  1KFU L;  5EL2 A;  1AHR A;  2Q4U A;  2FJU B;  1XFW O;  3A4U B;  4A4C A;  1XO5 A;  1GM0 A;  4GPL B;  3BFH A;  1UHI A;  3O2P A;  2KHN A;  2KAX A;  1Y1U A;  2L4H A;  3I5G B;  1WRK A;  2NCP A;  2Y1M A;  3V2L A;  4C0K A;  3UO9 A;  4CPV A;  1DJH A;  4N1F A;  1QXP A;  1QX7 A;  4XYN A;  3LLE A;  3LCP C;  1S5G Z;  1U5I A;  3EK8 A;  1DJG A;  1ALW A;  3OX6 A;  4P5O E;  2WCL A;  5B8I B;  1DJI A;  3FE9 A;  1UHJ A;  1DC1 A;  2KOT A;  3NSL A;  2F2O A;  3BFA A;  5KU1 A;  3SS4 A;  4WQ2 A;  4PAL A;  4PHN A;  2KQY A;  1BJF A;  1S1E A;  2JZI A;  1F4Q A;  1MUX A;  3DVK A;  3S0E A;  1RWY A;  3EG5 B;  3I5I B;  2WOR A;  1QV1 A;  2YGU A;  5DKQ A;  2A4J A;  1CDN A;  2JT3 A;  1SSE B;  3BUO B;  3KO0 A;  1ORG A;  2JT8 A;  2KI6 C;  1CFD A;  5AXI A;  1J1E A;  2P71 A;  2PSR A;  1MHO A;  1DJZ A;  1YUR A;  2WC8 A;  4OR9 B;  5CSJ A;  2SCP A;  2LMU A;  3DVM A;  1GJY A;  3EKH A;  2M7N A;  4JWQ A;  2FCD A;  1WLZ A;  1OOF A;  2WCM A;  2L50 A;  1S5G Y;  2QEB A;  2KBI A;  2KFF A;  3AKB A;  1GGW A;  2HPS A;  4DUQ A;  1S36 A;  3DD4 A;  2F3Z A;  1BR1 B;  3I5G C;  2EC6 B;  3IF7 A;  2Q91 A;  2LP3 A;  3WHU B;  1K2H A;  1AJ5 A;  1IGV A;  3IQQ A;  4MRX A;  1SRA A;  5GQQ C;  1TNW A;  1TIZ A;  2O60 A;  2ZKM X;  3LK1 A;  1JUO A;  1C07 A;  3N7H A;  2FOT A;  5DKR A;  4F7F A;  3B87 A;  3CDN A;  3CZ1 A;  1NYA A;  1BOC A;  1LVC D;  5ER5 A;  2K61 A;  1ZAC A;  4MRY A;  1ZOT B;  3TDZ A;  1A75 B;  1QTX A;  1N65 A;  1SR6 B;  4MLW A;  2JXL A;  3BUW B;  3DYE A;  3SG7 A;  1B1G A;  2FJY A;  3D77 A;  2M49 B;  1CFC A;  2L4I A;  5HKZ A;  3Q8I A;  5I2O A;  4ORB B;  3RLZ A;  2JT0 A;  3OBV A;  4HRG A;  2QPT A;  2CNP A;  2LAP A;  3TUY B;  2CT9 A;  1F8H A;  1S6I A;  2KYC A;  1QLS A;  2KLD A;  2WCF A;  2LVV A;  1R6P A;  2KFH A;  2KFG A;  2KDH A;  2CTN A;  2O5G A;  3EK7 A;  3NSI A;  4PHK A;  1CMG A;  2M9G A;  3NSO A;  2KI6 D;  5JOL A;  1IH0 A;  4C0J A;  4HRE E;  2DOQ A;  3OHM B;  1UUR A;  1SCM B;  2EC6 C;  3I5H B;  1TNP A;  3MSE B;  1EXR A;  1LKJ A;  4FTG A;  5FYX A;  5CSF A;  1RJV A;  4AQJ A;  1M39 A;  1C3Y A;  4XJK B;  3AAK A;  2VRG A;  1PAL A;  2AUC A;  2MJW B;  2WCE A;  4I5J A;  1PSR A;  1K8U A;  1YRT B;  1TCO B;  1Y1A A;  1DVI A;  3NGV A;  3SG2 A;  2BCB A;  3NXA A;  5HYD A;  4M2O A;  3PAT A;  1KFX S;  3CLN A;  1IQ3 A;  1F70 A;  2Y5I A;  3B88 A;  2L2E A;  1A2X A;  2PAL A;  3B86 A;  1LXF C;  1NP8 A;  3IQO A;  1A03 A;  2ZN8 A;  1JFK A;  1BLQ A;  1PRW A;  4YGA A;  3TUY C;  2PVB A;  2NZ0 A;  1KK8 C;  3GK4 X;  2ZNE A;  3D73 A;  1JF0 A;  3O6B A;  1FPW A;  1NX1 A;  3SJS A;  1QX5 B;  3NHI A;  2LNK A;  3SG6 A;  4KYN A;  3VRO A;  2LVK A;  1SW8 A;  5D69 A;  1W9Z A;  2MRD A;  3OP0 A;  4PHM A;  2COL B;  5CPV A;  3SIA A;  1T14 A;  1CM4 A;  1SCM C;  1CDM A;  3I5H C;  2KI4 B;  1J1D A;  3NSK A;  1NX3 A;  4N1G A;  5DIC A;  1B8R A;  3O78 A;  1QX2 A;  1NIW A;  1KQM B;  3QRX A;  1SBJ A;  1DF0 A;  4MZL A;  2L51 A;  2LP2 A;  1QS7 A;  2BEC A;  4GAO A;  3PM2 A;  5AEQ A;  1OZS A;  4NDB A;  1YUS A;  1NX2 A;  2LMT A;  3KF9 A;  4AQI A;  1AP4 A;  1CFP A;  1CLB A;  5DKN A;  4DRW A;  2CCM A;  3S0F A;  3GK2 A;  1IQ5 A;  3DZT A;  3R1V A;  2M1K B;  2WND A;  1ZUZ A;  4PCW A;  5HL1 A;  3CZ2 A;  2KAY A;  4CLN A;  2CBL A;  2BAP A;  3EVU A;  2M1U A;  3HCM A;  4CFQ A;  1PSB A;  1ALV A;  3ZNI A;  4HRH A;  1CM1 A;  1SL8 A;  1CMF A;  2MLF C;  2P70 A;  4JKT A;  3SIB A;  4MEW A;  4MVF A;  1FW4 A;  5I2L A;  1CFF A;  1SNL A;  1J55 A;  2BL0 B;  1OMD A;  2JTZ A;  1YX7 A;  1DJW A;  1DJX A;  1TOP A;  1RFJ A;  2K60 A;  4OCI A;  2JUL A;  2EGD A;  1D1O A;  1J7P A;  1B7T Z;  1B47 A;  1B8L A;  5JJG A;  1JBA A;  5I2Q A;  5I94 A;  3AKA A;  1A29 A;  2BKI B;  3PSR A;  2H61 C;  4M2P A;  4F0Z B;  3B7A A;  3L4L A;  2KI4 C;  5HKY A;  1C7V A;  4HSZ A;  1KQV A;  1XK4 C;  4PT1 A;  2E6W A;  1KQM C;  1CLM A;  1SPY A;  1YRU B;  2G2B A;  2EHB A;  2QEV A;  3BOW B;  4GNK B;  1F71 A;  1QWV A;  1XFX O;  1EJ3 A;  1K90 D;  2LMV A;  1IG5 A;  4YGD B;  4P2Y B;  1SKT A;  2F3Y A;  1NPQ A;  2R2I A;  4BY4 A;  2HQ8 A;  1Z4H A;  3EK4 A;  1ODB A;  4DS7 A;  1OOG A;  2KLE A;  2LHI A;  1J7O A;  3NHT A;  1RRO A;  4GGF A;  1G33 A;  4YI8 A;  1PVA A;  1YVH A;  1B7T Y;  2MBX A;  1V1F A;  4FQT A;  4CFR A;  1BG1 A;  1WRZ A;  1WRL A;  2KSP A;  4ETO A;  1XFU O;  1CDL A;  2L98 A;  3BUN B;  4OZD A;  2JXC A;  3TS5 B;  4D1E A;  1DJY A;  3DXL A;  3CWG A;  4YGB B;  3D0Y B;  1KSM A;  2BL0 C;  3R1O A;  4U8D A;  1M63 B;  3BUM B;  1VRK A;  3VRN A;  5J3X A;  4CID A;  5IBW A;  1YTZ C;  1KWO C;  2NXQ A;  3H4S E;  2HET A;  2BBN A;  2KQ6 A;  4QJ5 B;  1LA3 A;  4NDC A;  2WCK A;  2ZN9 A;  5CSN A;  3CR2 A;  1MR8 A;  1SCV A;  1REC A;  2K8M B;  1KK8 B;  1UUS A;  3R72 A;  1KFX L;  1A75 A;  1CDP A;  1XVJ A;  2LUX A;  4OV2 A;  2JNF A;  4UPG A;  2M3W A;  1JF2 A;  3PJI A;  2KNE A;  1TUJ A;  5HLV A;  1FI5 A;  2F33 A;  3FWC A;  3RZS A;  1M45 A;  4MBE A;  3ZWH A;  3L47 A;  4MZK A;  1S3P A;  1Y1X A;  1Z2C B;  4IJ7 A;  1UHK A;  1WLM A;  4YBH B;  2HQW A;  1JC2 A;  3C1V A;  2PQL A;  2F8P A;  1LA0 A;  1LIN A;  1YUU A;  4PDZ A;  5KTY A;  2IS9 A;  4I5N B;  2LM5 A;  2ZRS A;  1OW4 A;  3CZT X;  2JC2 A;  4R1E A;  3DF0 B;  1UHH A;  1NUB A;  4N5X A;  2KBM A;  3TS5 C;  3OB2 B;  4DCK A;  1DMO A;  2LHL A;  3QME A;  2WCB A;  2MA2 A;  5HLO A;  1K96 A;  5F6T A;  3D10 A;  4PE0 A;  2I2R E;  1YR5 A;  5AFP A;  2JNX A;  3B6X A;  1RK9 A;  2KYF A;  2JTT A;  4PE4 A;  1H8B A;  4QJ3 B;  4GGN A;  4GUK A;  2OTG C;  1LS8 A;  1PVB A;  2BCX A;  3K1E A;  4WQ3 A;  5FI7 A;  3OX5 A;  4GBA A;  2GTE A;  2JPO A;  2L5Y A;  2NLN A;  3ICB A;  4INW A;  4C0L A;  2D8N A;  1S6J A;  2K2A A;  3WNX B;  1N2D A;  1IWQ A;  1L2O B;  1N0Y A; 
#chains in the Genus database with same CATH homology
 2K7O A;  2ISD A;  1EG4 A;  1ZMZ A;  1W7J B;  1G4Y R;  1OOJ A;  1TRF A;  4YRU A;  2H2K A;  4Q04 A;  4FQO A;  3EKJ A;  1OMV A;  2LV7 A;  2K2F A;  2KGR A;  5TNC A;  1M46 A;  2H61 A;  4MSP A;  3CS1 A;  3KPX A;  2M29 A;  1DF0 B;  3CTN A;  1XK4 A;  1Y0V H;  3JVT B;  1SYM A;  1KK7 Z;  1QIV A;  3EVR A;  1UWO A;  1XA5 A;  1B9A A;  1QV0 A;  3PLF B;  1X02 A;  2ZFD A;  4PHJ A;  4GFT A;  2I94 A;  1HT9 A;  1FF1 A;  2M8U A;  2JOJ A;  2LCP A;  1GQM A;  1BOD A;  3VGO A;  5AAN A;  4A4B A;  1U5I B;  3SG3 A;  2PAS A;  4ORC B;  2MAZ A;  2BKH B;  3K21 A;  1KWO B;  4PE7 A;  2CXJ A;  1NWD A;  1G8I A;  3M0W A;  2KAV A;  2L0P A;  2P6B B;  1CB1 A;  3DVE A;  4IL1 A;  2GGM A;  1W7I B;  1L2O C;  1J7Q A;  1AK8 A;  1KK7 Y;  1IRJ A;  2OPO A;  4ZCU A;  1FBV A;  1K9P A;  2M0R A;  4I5L B;  1BMO A;  2LUC A;  1MF8 B;  1YUT A;  1UP5 A;  4USL A;  2M97 A;  1KFU S;  1V1G A;  1CLL A;  1HQV A;  3BXK A;  3VRP A;  1TNX A;  4TNC A;  1TNQ A;  1EL4 A;  4JPZ B;  2B1U A;  1IJ5 A;  3I5F B;  1OMR A;  2K7C A;  4ORA B;  2JWW A;  1KSO A;  2GV5 A;  3EVV A;  3JVT C;  1BU3 A;  4M2Q A;  1R2U A;  1SL7 A;  3BOW A;  1QAS A;  2WOS A;  1MWN A;  3GOF A;  2AAO A;  3F45 A;  2LLU A;  2BBM A;  3PN7 C;  1AUI B;  1Y6W A;  3AAJ A;  1Q80 A;  2JU0 A;  2JPT A;  1NCZ A;  2OS8 B;  1K94 A;  5AER A;  3WHT B;  1AVS A;  1OZO A;  1XFV O;  1YX8 A;  2JQ6 A;  1E8A A;  1IKU A;  3JTD B;  1WY9 A;  4PE1 A;  2LAN A;  3PM8 A;  1EG3 A;  1L7Z A;  2PMY A;  3CR5 X;  4BY5 A;  1J7R A;  4QJ4 B;  4AOM A;  1BT6 A;  1K9U A;  1WDC B;  1EH2 A;  3FS7 A;  1XFZ O;  2F2P A;  2BE4 A;  2V53 A;  1NCY A;  3D0Y A;  2OTG B;  4NDD A;  5CSI A;  1H4B A;  1B4C A;  2MHH A;  3TDU A;  1QIW A;  1F55 A;  2L5X B;  2K0J A;  2Y4Q A;  2BE6 A;  4WRI A;  3LL8 B;  2PRU A;  1QLK A;  4JQ0 D;  2Y1N A;  1RTP 1;  2LVJ A;  3A8R A;  4YI9 A;  1DTL A;  1BF5 A;  1S26 D;  1B8C A;  1PUL A;  1K95 A;  1TN4 A;  3TZ1 A;  5G08 A;  3I5F C;  1MQ1 A;  1DT7 B;  3I5I C;  4L9M A;  1MXL C;  1K9K A;  1NX0 A;  3VRR A;  1SK6 D;  3FWB A;  1SY9 A;  2LLT A;  5PAL A;  3HX4 A;  2LE9 B;  1AJ4 A;  1BR4 B;  3PAL A;  2QAC A;  3KEV A;  3PFV A;  4MN0 A;  2OS8 C;  1YVL A;  1SMG A;  2NCO A;  4GGF C;  1OQP A;  5ER4 X;  3E3R A;  3KHE A;  1NCX A;  1A4P A;  1NSH A;  4YGC B;  4ICB A;  3JTD C;  2LLS A;  2FCE A;  4I5K A;  1QVI Z;  2JRF A;  1C7W A;  1DGU A;  1TCF A;  4XJK A;  3DVJ A;  5I8N A;  1QJT A;  2ZND A;  3DF0 A;  4YGE B;  1CTR A;  1WDC C;  3SG4 A;  1PK0 D;  2SAS A;  1K93 D;  3WXA A;  1CNP A;  2TN4 A;  1F54 A;  2BCA A;  1OE9 B;  1ZFS A;  2K7D A;  5D7F A;  1JWD A;  1S6C A;  1UHN A;  3BQ3 A;  2I7A A;  1JSA A;  3LK0 A;  3O4Y A;  4MZJ A;  4NQG A;  3SG5 A;  3FIA A;  1KCY A;  1QAT A;  5HKW A;  1SR6 C;  3OB1 B;  2K7B A;  4DIR A;  5K89 A;  2KGB C;  2M7L A;  1FI6 A;  1DGV A;  1CKK A;  1QVI Y;  2HF5 A;  2GGZ A;  1M31 A;  2E30 A;  5KSZ A;  1XFY O;  3BUX B;  1F4O A;  3CGA A;  1GGZ A;  1MXE A;  3GK1 A;  2LVI A;  4OVN F;  2MLE C;  4E68 A;  1XYD A;  3BYA A;  1IJ6 A;  2G9B A;  4OKH A;  2LC5 A;  2RGI A;  2ZRT A;  3VRQ A;  1SL9 A;  3CR4 X;  1TTX A;  3RM1 A;  1JFJ A;  1OSA A;  3TDI A;  2AMI A;  3PN7 B;  5BPJ A;  2I18 A;  1KFU L;  1AHR A;  2Q4U A;  2FJU B;  1XFW O;  3A4U B;  4A4C A;  1XO5 A;  4GPL B;  1UHI A;  3O2P A;  2KHN A;  2KAX A;  1Y1U A;  2L4H A;  3I5G B;  1WRK A;  2NCP A;  2Y1M A;  4C0K A;  4CPV A;  1DJH A;  4N1F A;  1QXP A;  1QX7 A;  4XYN A;  3LLE A;  3LCP C;  1S5G Z;  1U5I A;  3EK8 A;  1DJG A;  1ALW A;  3OX6 A;  4P5O E;  5B8I B;  1DJI A;  1UHJ A;  2KOT A;  3NSL A;  2F2O A;  5KU1 A;  4WQ2 A;  4PAL A;  4PHN A;  2KQY A;  1BJF A;  1S1E A;  2JZI A;  1F4Q A;  1MUX A;  3DVK A;  1RWY A;  3I5I B;  2WOR A;  1QV1 A;  5DKQ A;  1CDN A;  2A4J A;  2JT3 A;  3BUO B;  3KO0 A;  2JT8 A;  2KI6 C;  1CFD A;  5AXI A;  1J1E A;  2PSR A;  4OR9 B;  1MHO A;  1DJZ A;  1YUR A;  2WC8 A;  5CSJ A;  2SCP A;  2LMU A;  3DVM A;  1GJY A;  3EKH A;  2M7N A;  4JWQ A;  2FCD A;  1WLZ A;  2L50 A;  1S5G Y;  2KBI A;  2KFF A;  3AKB A;  1GGW A;  2HPS A;  4DUQ A;  1S36 A;  3DD4 A;  2F3Z A;  1BR1 B;  3I5G C;  2EC6 B;  3IF7 A;  2Q91 A;  2LP3 A;  3WHU B;  1K2H A;  1AJ5 A;  1IGV A;  3IQQ A;  4MRX A;  1SRA A;  5GQQ C;  1TNW A;  1TIZ A;  2O60 A;  2ZKM X;  3LK1 A;  1JUO A;  1C07 A;  5DKR A;  2FOT A;  1NYA A;  1BOC A;  1LVC D;  5ER5 A;  2K61 A;  1ZAC A;  4MRY A;  1ZOT B;  3TDZ A;  1A75 B;  1QTX A;  1N65 A;  1SR6 B;  4MLW A;  2JXL A;  3BUW B;  1B1G A;  3SG7 A;  1CFC A;  2M49 B;  2L4I A;  5HKZ A;  5I2O A;  4ORB B;  3RLZ A;  2JT0 A;  4HRG A;  2QPT A;  2CNP A;  2LAP A;  3TUY B;  2CT9 A;  1F8H A;  1S6I A;  2KYC A;  1QLS A;  2WCF A;  2LVV A;  1R6P A;  2KFH A;  2KFG A;  2KDH A;  2CTN A;  2O5G A;  3EK7 A;  3NSI A;  4PHK A;  1CMG A;  2M9G A;  3NSO A;  2KI6 D;  5JOL A;  1IH0 A;  4C0J A;  4HRE E;  2DOQ A;  3OHM B;  1UUR A;  1SCM B;  2EC6 C;  3I5H B;  1TNP A;  3MSE B;  1EXR A;  1LKJ A;  4FTG A;  5FYX A;  5CSF A;  1RJV A;  4AQJ A;  1M39 A;  4XJK B;  3AAK A;  2VRG A;  1PAL A;  2AUC A;  2MJW B;  2WCE A;  4I5J A;  1PSR A;  1K8U A;  1YRT B;  1TCO B;  1Y1A A;  1DVI A;  3SG2 A;  2BCB A;  3NXA A;  5HYD A;  4M2O A;  3PAT A;  1KFX S;  3CLN A;  1IQ3 A;  1F70 A;  2Y5I A;  2L2E A;  1A2X A;  2PAL A;  1LXF C;  1NP8 A;  3IQO A;  1A03 A;  2ZN8 A;  1JFK A;  1BLQ A;  1PRW A;  4YGA A;  3TUY C;  2PVB A;  2NZ0 A;  1KK8 C;  3GK4 X;  2ZNE A;  3O6B A;  1JF0 A;  1FPW A;  1NX1 A;  3SJS A;  1QX5 B;  3SG6 A;  2LNK A;  3VRO A;  2LVK A;  1SW8 A;  5D69 A;  2MRD A;  3OP0 A;  4PHM A;  2COL B;  5CPV A;  3SIA A;  1CM4 A;  1SCM C;  1CDM A;  3I5H C;  2KI4 B;  1J1D A;  3NSK A;  1NX3 A;  4N1G A;  1B8R A;  3O78 A;  1QX2 A;  1NIW A;  1KQM B;  3QRX A;  1SBJ A;  1DF0 A;  4MZL A;  2L51 A;  2LP2 A;  1QS7 A;  2BEC A;  4GAO A;  5AEQ A;  1OZS A;  4NDB A;  1YUS A;  1NX2 A;  2LMT A;  3KF9 A;  4AQI A;  1AP4 A;  1CFP A;  1CLB A;  5DKN A;  4DRW A;  2CCM A;  3GK2 A;  1IQ5 A;  2M1K B;  2WND A;  1ZUZ A;  4PCW A;  4CLN A;  2KAY A;  2CBL A;  3EVU A;  2M1U A;  3HCM A;  4CFQ A;  1PSB A;  1ALV A;  3ZNI A;  4HRH A;  1CM1 A;  1SL8 A;  1CMF A;  2MLF C;  3SIB A;  4MEW A;  4MVF A;  1FW4 A;  5I2L A;  1CFF A;  1SNL A;  1J55 A;  2BL0 B;  1OMD A;  2JTZ A;  1YX7 A;  1DJW A;  1DJX A;  1TOP A;  1RFJ A;  4OCI A;  1D1O A;  2JUL A;  2EGD A;  1J7P A;  1B7T Z;  1B47 A;  1B8L A;  5JJG A;  1JBA A;  5I2Q A;  3AKA A;  1A29 A;  2BKI B;  3PSR A;  2H61 C;  4M2P A;  4F0Z B;  2KI4 C;  5HKY A;  1C7V A;  4HSZ A;  1KQV A;  1XK4 C;  4ZCV A;  2E6W A;  1KQM C;  1CLM A;  1SPY A;  1YRU B;  2G2B A;  2EHB A;  3BOW B;  4GNK B;  1F71 A;  1XFX O;  1EJ3 A;  1K90 D;  2LMV A;  1IG5 A;  4YGD B;  4P2Y B;  1SKT A;  2F3Y A;  1NPQ A;  2R2I A;  4BY4 A;  2HQ8 A;  3EK4 A;  1ODB A;  4DS7 A;  1J7O A;  2LHI A;  1RRO A;  4GGF A;  1G33 A;  4YI8 A;  1PVA A;  1YVH A;  1B7T Y;  2MBX A;  1V1F A;  1BG1 A;  4CFR A;  1WRZ A;  1WRL A;  2KSP A;  4ETO A;  1XFU O;  1CDL A;  2L98 A;  3BUN B;  3TS5 B;  2JXC A;  4D1E A;  1DJY A;  4YGB B;  3CWG A;  3D0Y B;  1KSM A;  2BL0 C;  4U8D A;  1M63 B;  3BUM B;  1VRK A;  3VRN A;  5J3X A;  4CID A;  5IBW A;  1YTZ C;  1KWO C;  2NXQ A;  3H4S E;  2HET A;  2BBN A;  2KQ6 A;  4QJ5 B;  1LA3 A;  4NDC A;  2ZN9 A;  5CSN A;  3CR2 A;  1MR8 A;  1SCV A;  1REC A;  2K8M B;  1KK8 B;  1UUS A;  1KFX L;  1A75 A;  1CDP A;  1XVJ A;  2LUX A;  4OV2 A;  2JNF A;  4UPG A;  2M3W A;  1JF2 A;  2KNE A;  5HLV A;  1FI5 A;  2F33 A;  3FWC A;  1M45 A;  4MBE A;  3ZWH A;  4MZK A;  1S3P A;  1Y1X A;  1UHK A;  1WLM A;  4YBH B;  2HQW A;  1JC2 A;  3C1V A;  2F8P A;  1LA0 A;  1LIN A;  1YUU A;  4PDZ A;  5KTY A;  2IS9 A;  4I5N B;  2LM5 A;  2ZRS A;  3CZT X;  2JC2 A;  4R1E A;  3DF0 B;  1UHH A;  1NUB A;  4N5X A;  2KBM A;  3TS5 C;  3OB2 B;  4DCK A;  1DMO A;  2LHL A;  2WCB A;  2MA2 A;  5HLO A;  1K96 A;  5F6T A;  3D10 A;  4PE0 A;  2I2R E;  1YR5 A;  5AFP A;  2JNX A;  1RK9 A;  2KYF A;  2JTT A;  4PE4 A;  1H8B A;  4QJ3 B;  4GGN A;  4GUK A;  2OTG C;  1PVB A;  2BCX A;  4WQ3 A;  3OX5 A;  4GBA A;  2NLN A;  3ICB A;  4C0L A;  2D8N A;  1S6J A;  2K2A A;  3WNX B;  1N2D A;  1IWQ A;  1L2O B;  1N0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...