3DXLA

Crystal structure of aed7 from aedes aegypti
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
303
structure length
299
Chain Sequence
MGPFDPEEMLFIFTRCMEDNLEDGANRLPMLAKWKEWINEPVDSPATQCFGKCVLVRTGLYDPVAQKFDASVIQEQFKAYPSLGEKSKVEAYANAVKQLPSTNNDCAAVFKAYDPVHKAHKDTSKNLFHGNKELTKGLYEKLGKDIRQKKQSYFEFCENKYYPAGSDKRQQLCQIRQYTVLDDALFKEHTDCVMKGIRYITKDNQLDVEEVKRDFKLVNKDTKALEEVLNDCKSKEPSNAKEKSWHYYKCLVESSVKDDFKEAFDYREVRSQIYAFNLPKNQAYSKPAVMEIDGKQCPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Allergen Aed a 2
publication title Multifunctionality and mechanism of ligand binding in a mosquito antiinflammatory protein
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Odorant-binding protein
total genus 117
structure length 299
sequence length 303
ec nomenclature
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3dxlA01
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3dxlA02
3S0DA 3S0EA 2QEHA 3V2LA 2WCHA 3CABA 3CYZA 3NGVA 5DICA 3OGNA 2P71A 2QEBA 3BFBA 3N7HA 2P70A 2JPOA 1TUJA 1DQEA 3B87A 3FE8A 2H8VA 3CZ2A 2QEOA 1OOGA 1C3ZA 1ORGA 3B88A 2KPHA 2WCLA 3NHIA 3FE9A 3S0GA 2ERBA 1P28A 3DYEA 2PQLA 4PT1A 4INWA 3NHTA 3B6XA 2GTEA 3S0AA 1XFRA 3FE6A 3DZTA 2L2CA 1GM0A 3K1EA 3L4LA 3BFHA 2WC6A 3VB1A 3R1VA 3DY9A 3Q8IA 3D78A 2WCJA 3CDNA 3S0BA 1LS8A 3D76A 3R72A 3BFAA 4INXA 4FQTA 2FJYA 4JD9A 3B86A 3B7AA 3RZSA 1QWVA 2QEVA 3D75A 3L4AA 3L47A 1T14A 2QDIA 3CZ1A 2WCKA 1OW4A 1OOIX 3BJHA 3PJIA 3D77A 3QMEA 3R1PA 5EL2A 1C3YA 2WC5A 3R1OA 3CZ0A 3D73A 4F7FA 1OOHA 2WCMA 1OOFA 3D74A 3S0FA 1TWOA 4OZDA 3DXLA
chains in the Genus database with same CATH superfamily
1RFJA 1UHHA 3EK8A 4JPZB 1Y1XA 2QEHA 1J55A 1DC1A 1KK7Y 5F6TA 4NDDA 3E3RA 3EKHA 3OGNA 2FCEA 1CMFA 2H2KA 4PALA 5FI7A 1NCXA 2KBMA 4CIDA 1NWDA 1KSOA 2LMTA 1QVIY 2Q4UA 1DQEA 3BOWA 2JC2A 3PM2A 4DIRA 5I2QA 2H8VA 1GJYA 2JTTA 1M31A 1UP5A 2NCPA 2PASA 4PCWA 1G33A 5HLVA 1BJFA 4CPVA 1KFXS 1YX8A 3WNXB 4AQJA 3DVMA 3EK7A 4YGEB 1CLBA 1CMGA 5HKYA 3SG3A 5KU1A 3O78A 2ERBA 2M9GA 3DYEA 2Y5IA 1MHOA 1LA3A 1SL9A 3TS5C 4BY4A 1KK8B 1NX3A 3IF7A 5GQQC 2AMIA 1DF0B 2EHBA 2BAPA 4M2OA 2KLEA 2BL0C 1BOCA 1F54A 4N1FA 1V1FA 1UUSA 3S0AA 1XFRA 1CM4A 1R2UA 2MAZA 4N1GA 3DZTA 3A4UB 3AAKA 1RWYA 1X02A 2M1UA 3K1EA 1YRTB 1XO5A 2H61C 2K0JA 2CTNA 1U5IA 1UWOA 4PHNA 1JWDA 1PULA 2L0PA 3JVTB 3O4XA 3CR5X 1SCMB 1CKKA 3SG4A 3TDZA 3R1VA 3KO0A 1NCYA 1S26D 1IKUA 1C7WA 1PK0D 4MVFA 1XFUO 2MRDA 3NSLA 3I5FC 1TCFA 1L2OC 1A29A 3NSIA 1CFFA 1A75B 2BBNA 2LHLA 4YBHB 1IQ3A 1OZSA 2K7DA 2L4HA 5HKZA 3PLFB 4F0ZB 1NSHA 3OHMB 1DEKA 1B8RA 1LXFC 4GGNA 2JT0A 1JC2A 4MBEA 2LMUA 2ZNEA 4CFQA 2JQ6A 3D10A 1TUZA 2JWWA 1QV1A 2JZIA 4MZJA 1BG1A 1ODBA 2K61A 3UO9A 2E6WA 1KFUS 1QJTA 2L5XB 3RLZA 3GK1A 2P6BB 4GFTA 4JQ0D 1QWVA 4DS7A 2B1UA 2QEVA 1DJIA 4WQ3A 1CFPA 3UNWA 1TTXA 1ZFSA 4Q04A 2QDIA 3DF0B 1H4BA 4MEWA 1OE9B 2WCFA 3OX5A 2F33A 2PVBA 1WRLA 1WLMA 3BUWB 1UHJA 1KK8C 3GOFA 4MZKA 2HPSA 3IQOA 4PDZA 2Y1MA 3BYAA 2WC5A 3R1OA 5G08A 2WORA 1SMGA 1S5GZ 3D73A 3BUMB 2I2RE 1QIVA 5CPVA 1Q80A 2JPTA 4OV2A 1TWOA 1YUTA 5CSIA 4A4CA 2Y4QA 1MXLC 1V1GA 1JUOA 2JNFA 1YVLA 5AANA 1SCMC 2L5YA 4HRHA 2KAVA 1XK4C 3NGVA 2L51A 2PRUA 3CZTX 2KLDA 5AEQA 2H61A 2K7CA 1GGZA 3VROA 1OMDA 1GQMA 1DJYA 2LVVA 1TUJA 4MLWA 3FE8A 2ZRSA 3F45A 2I18A 4ZCUA 1SPYA 1J7OA 4YRUA 3D0YB 5ER4X 3I5GC 1ORGA 2ZNDA 1CM1A 1M63B 3TZ1A 5D69A 4PHJA 2WCLA 5TNCA 4OR9B 2AUCA 1L2OB 3FE9A 5JJGA 4NQGA 1K9PA 3EG5B 5ER5A 5HKWA 3EKJA 3SIAA 1QX5B 2JRFA 3SG5A 1CLLA 2LANA 2JT8A 2BBMA 1F70A 4YI9A 2IS9A 2HETA 1KCYA 5HLOA 4WQ2A 1Y6WA 1Z2CB 2PSRA 3B6XA 1WY9A 3JTDB 4UPGA 5J3XA 2LVKA 3FE6A 3OX6A 4GPLB 4ORAB 3SG2A 4YGBB 2KBIA 4KYNA 4C0LA 2COLB 5KSZA 2MBXA 2I94A 3HCMA 3KEVA 2L4IA 2WCEA 1RECA 2GV5A 3AAJA 3L4LA 3PATA 2WC8A 5PALA 4PE4A 2JULA 1E8AA 2WC6A 4IL1A 2LP3A 5JOLA 1J7QA 1FW4A 2M8UA 3DY9A 5K89A 2CNPA 4MSPA 4HREE 1DF0A 1XFZO 3D78A 4D1EA 2BCBA 3EVUA 4YGCB 2KQYA 1KQVA 1M46A 1QX7A 2YGUA 1S36A 1B4CA 3EVRA 2CXJA 4DUQA 1YRUB 1RJVA 3OB1B 3FS7A 1IRJA 1L7ZA 3I5IC 4PHMA 3BFAA 2WCBA 1YTZC 4IJ7A 1DTLA 4ORCB 1QASA 1SR6B 4FQTA 3TDUA 2HF5A 1GGWA 1KK7Z 2F3ZA 1PVAA 2KAXA 3KHEA 2JTZA 3QRXA 4ICBA 4NDCA 3H4SE 1SL7A 1OOJA 1W7JB 1J7RA 1QATA 1TNQA 1XK4A 2K2FA 3FWCA 1QVIZ 1H8BA 3SS4A 1JBAA 4GNKB 5FI2A 2LVJA 2LP2A 4M2QA 2PYQA 1A75A 3D75A 5CSJA 3KPXA 3LK1A 3LK0A 5HL1A 1CDLA 2F8PA 2SCPA 3GK4X 1OW4A 4FQOA 1LKJA 2MA2A 4E68A 3PJIA 4USLA 1DJZA 4XJKB 3D77A 3QMEA 5I8NA 5EL2A 1XFVO 3O4YA 2BCAA 1WDCB 2CBLA 1ZOTB 4ZCVA 3DVJA 1BR1B 1CFCA 1CFDA 3I5GB 4ETOA 3JTDC 2V53A 4F7FA 1OOHA 3D74A 1Y0VH 4N5XA 5AXIA 1KWOB 1SY9A 3CGAA 3S0FA 2JT3A 1YUSA 2K8MB 1WRZA 1XFXO 3NSOA 4M2PA 4YGDB 1MUXA 4OZDA 1CDMA 1K95A 2R2IA 3BQ3A 3DF0A 4PE1A 1IH0A 1W9ZA 2FOTA 3C1VA 5D7FA 1UHIA 2BE6A 3DD4A 1DGVA 2FJUB 1EG4A 2WCHA 3CYZA 3SIBA 1AP4A 1DMOA 4P5OE 2QEBA 2OS8B 2BKHB 3BFBA 2HQ8A 2JOJA 1RROA 2JPOA 3N7HA 4GUKA 1JFJA 1RTP1 3B87A 1FPWA 1A4PA 1K2HA 3CZ2A 4MZLA 3OBVA 1F4QA 1F8HA 1N65A 1HT9A 1IJ5A 2O5GA 4DCKA 1BF5A 1BMOA 1OOGA 1AJ5A 3IQQA 4OVNF 1PSBA 1SR6C 2RGIA 3B88A 3SS3A 1OMRA 4QJ5B 1F4OA 1AHRA 4YGAA 2OTGB 1SCVA 3NHIA 2LE9B 3LCPC 1DJXA 2E30A 3TUYC 3VRPA 2K7OA 2PQLA 1NYAA 1QX2A 1XYDA 2NCOA 1M45A 3SG7A 4PT1A 1OQPA 3IVTA 2QACA 5DKQA 5KTYA 3I5IB 1JFKA 3HX4A 2PMYA 1OZOA 2BNXA 1IIOA 1D1OA 2GTEA 4GGFC 3EK4A 1ALVA 1NP8A 2JXCA 4FTGA 2BCXA 1XFYO 1J1EA 5I2OA 4I5LB 4CLNA 1GM0A 1K90D 1XFWO 3D0YA 1Y1AA 2JU0A 3PM8A 1UURA 1TCOB 2D8NA 5CSFA 2BKIB 2LC5A 1WDCC 2BE4A 4YI8A 1SK6D 1B1GA 2CCMA 3ZWHA 1CNPA 1PVBA 3BFHA 4HRGA 1CDPA 1ZMZA 3VB1A 4DRWA 4CFRA 1F71A 2AAOA 1KWOC 2MLEC 3CTNA 2OPOA 3NXAA 3Q8IA 3SS5A 1ALWA 1BU3A 3NSKA 5DKRA 1NCZA 3VRRA 1IG5A 1C07A 2I7AA 3PN7C 1EL4A 2ZRTA 2LV7A 3CDNA 5I94A 1JSAA 3S0BA 1B7TZ 4JKTA 4AOMA 2MHHA 1FBVA 2LHIA 1DVIA 1SBJA 2EC6C 3CR2A 4QJ4B 2KI6C 1EG3A 3D76A 3R72A 1B8CA 3I5HB 1N0YA 4INXA 1PRWA 1MR8A 2M3WA 2OS8C 1TNPA 1SYMA 1NIWA 1B9AA 2KAYA 2L2EA 1QTXA 2KNEA 4C0JA 4JD9A 4MRYA 3B86A 1YR5A 4OCIA 2Y1NA 2KFGA 1K93D 1BODA 2KI4B 1TOPA 1FI5A 2OTGC 2GGZA 2ZFDA 4R1EA 2KI6D 2KOTA 1OOIX 3BJHA 3FIAA 2MLFC 4PHKA 2Q91A 1DELA 1CTRA 3ICBA 1IWQA 1NPQA 3WXAA 4A4BA 2LAPA 1A03A 2F2PA 3DVKA 3K21A 3BOWB 4I5NB 1S6IA 2KFHA 2WCMA 2ISDA 1PSRA 2L98A 1BT6A 2LLSA 3ZNIA 3BUNB 3TUYB 1LINA 2KYCA 1MXEA 3DXLA 1CB1A 3S0DA 4GGFA 3S0EA 2LVIA 2WOSA 2G9BA 3V2LA 4XJKA 3EVVA 3WHUB 1EXRA 3CABA 1TIZA 2WNDA 5DICA 1AK8A 2SASA 2P71A 1S6CA 2M97A 4OKHA 4I5JA 1DT7B 5I2LA 4PE7A 1IQ5A 3CS1A 1MWNA 1G4YR 2EGDA 1B47A 1OSAA 2M29A 3TDIA 5FYXA 3BUXB 2MJWB 1IJ6A 2ZKMX 1KQMB 2BECA 2QEOA 5B8IB 3I5HC 1WLZA 1QLSA 4QJ3B 1TN4A 2PALA 1C3ZA 1XVJA 2KPHA 1U5IB 1Y1UA 1QV0A 1S6JA 3CLNA 2NXQA 1YUUA 2K7BA 2FCDA 2LMVA 3S0GA 1P28A 3PN7B 2DOQA 3CR4X 3RM1A 3WHTB 3BXKA 1S5GY 2M7NA 1SSEB 1IGVA 2EC6B 2NLNA 4WRIA 2L50A 4INWA 2KI4C 2M1KB 3OB2B 3PALA 3NHTA 1KFXL 3MSEB 1K94A 2KDHA 1YVHA 4I5KA 1A2XA 1BR4B 1K9UA 3CWGA 1QS7A 1WRKA 2QPTA 2L2CA 2LUXA 1TNXA 4JWQA 1G8IA 4GBAA 3M0WA 3OP0A 1TNWA 2K2AA 1AUIB 5CSNA 1K96A 2A4JA 3VRQA 4PE0A 2TN4A 1SL8A 2ZN9A 3AKBA 1SKTA 4BY5A 2KGRA 2HQWA 2K60A 5D3OA 5FI6A 1QLKA 4GAOA 5AERA 3AKAA 1BLQA 1ZUZA 1NX1A 1NX2A 3PSRA 2WCJA 2M0RA 2M7LA 1LA0A 1N2DA 4P2YB 1S1EA 1OMVA 3O6BA 2ZN8A 4TNCA 2KYFA 4U8DA 1CLMA 1M39A 2O60A 3GK2A 2LNKA 1LS8A 1AVSA 2JNXA 4NDBA 3VGOA 1F55A 4XYNA 1K9KA 2KHNA 1C7VA 1PALA 1J7PA 1QXPA 4MRXA 4ORBB 5DKNA 4L9MA 1S3PA 2FJYA 3FWBA 2KSPA 2LLTA 3PFVA 1B7TY 1NX0A 3VRNA 3B7AA 1KQMC 3TS5B 1MQ1A 3RZSA 1VRKA 1UHKA 1QIWA 4AQIA 3A8RA 1UHNA 3JVTC 1LVCD 2VRGA 1DJWA 2BL0B 1KSMA 1SRAA 1YURA 3L4AA 3L47A 1T14A 1HQVA 3CZ1A 4MN0A 5HYDA 2WCKA 1AJ4A 1EH2A 2LUCA 2F3YA 3LLEA 1KFUL 3O2PA 5AFPA 3DVEA 4HSZA 1FI6A 5BPJA 1SW8A 1J1DA 3R1PA 1SNLA 2G2BA 1NUBA 1Z4HA 1C3YA 1DJGA 1R6PA 2M49B 2LCPA 1JF0A 1DJHA 1JF2A 2LLUA 1W7IB 2KQ6A 2F2OA 1B8LA 2KGBC 1MF8B 3CZ0A 2CT9A 2JXLA 2LM5A 3LL8B 2GGMA 2NZ0A 1TRFA 1EJ3A 1XA5A 1OOFA 3BUOB 3SG6A 1CDNA 1DGUA 1K8UA 4C0KA 1RK9A 2KFFA 3I5FB 5IBWA 1ZACA 3KF9A 3SJSA 1FF1A 2P70A 1YX7A
chains in the Genus database with same CATH topology
3S0DA 3S0EA 2QEHA 3V2LA 2WCHA 3CABA 3CYZA 3NGVA 5DICA 3OGNA 2P71A 2QEBA 3BFBA 3N7HA 2P70A 2JPOA 1TUJA 1DQEA 3B87A 3FE8A 2H8VA 3CZ2A 2QEOA 1OOGA 1C3ZA 1ORGA 3B88A 2KPHA 2WCLA 3NHIA 3FE9A 3S0GA 2ERBA 1P28A 3DYEA 2PQLA 4PT1A 4INWA 3NHTA 3B6XA 2GTEA 3S0AA 1XFRA 3FE6A 3DZTA 2L2CA 1GM0A 3K1EA 3L4LA 3BFHA 2WC6A 3VB1A 3R1VA 3DY9A 3Q8IA 3D78A 2WCJA 3CDNA 3S0BA 1LS8A 3D76A 3R72A 3BFAA 4INXA 4FQTA 2FJYA 4JD9A 3B86A 3B7AA 3RZSA 1QWVA 2QEVA 3D75A 3L4AA 3L47A 1T14A 2QDIA 3CZ1A 2WCKA 1OW4A 1OOIX 3BJHA 3PJIA 3D77A 3QMEA 3R1PA 5EL2A 1C3YA 2WC5A 3R1OA 3CZ0A 3D73A 4F7FA 1OOHA 2WCMA 1OOFA 3D74A 3S0FA 1TWOA 4OZDA 3DXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S0D A;  3S0E A;  2QEH A;  3V2L A;  2WCH A;  3CAB A;  3CYZ A;  3NGV A;  5DIC A;  3OGN A;  2P71 A;  2QEB A;  3BFB A;  3N7H A;  2P70 A;  2JPO A;  1TUJ A;  1DQE A;  3B87 A;  3FE8 A;  2H8V A;  3CZ2 A;  2QEO A;  1OOG A;  1C3Z A;  1ORG A;  3B88 A;  2KPH A;  2WCL A;  3NHI A;  3FE9 A;  3S0G A;  2ERB A;  1P28 A;  3DYE A;  2PQL A;  4PT1 A;  4INW A;  3NHT A;  3B6X A;  2GTE A;  3S0A A;  1XFR A;  3FE6 A;  3DZT A;  2L2C A;  1GM0 A;  3K1E A;  3L4L A;  3BFH A;  2WC6 A;  3VB1 A;  3R1V A;  3DY9 A;  3Q8I A;  3D78 A;  2WCJ A;  3CDN A;  3S0B A;  1LS8 A;  3D76 A;  3R72 A;  3BFA A;  4INX A;  4FQT A;  2FJY A;  4JD9 A;  3B86 A;  3B7A A;  3RZS A;  1QWV A;  2QEV A;  3D75 A;  3L4A A;  3L47 A;  1T14 A;  2QDI A;  3CZ1 A;  2WCK A;  1OW4 A;  1OOI X;  3BJH A;  3PJI A;  3D77 A;  3QME A;  3R1P A;  5EL2 A;  1C3Y A;  2WC5 A;  3R1O A;  3CZ0 A;  3D73 A;  4F7F A;  1OOH A;  2WCM A;  1OOF A;  3D74 A;  3S0F A;  1TWO A;  4OZD A;  3DXL A; 
#chains in the Genus database with same CATH topology
 1RFJ A;  1UHH A;  3EK8 A;  4JPZ B;  1Y1X A;  2QEH A;  1J55 A;  1DC1 A;  1KK7 Y;  5F6T A;  4NDD A;  3E3R A;  3EKH A;  3OGN A;  2FCE A;  1CMF A;  2H2K A;  4PAL A;  5FI7 A;  1NCX A;  2KBM A;  4CID A;  1NWD A;  1KSO A;  2LMT A;  1QVI Y;  2Q4U A;  1DQE A;  3BOW A;  2JC2 A;  3PM2 A;  4DIR A;  5I2Q A;  2H8V A;  1GJY A;  2JTT A;  1M31 A;  1UP5 A;  2NCP A;  2PAS A;  4PCW A;  1G33 A;  5HLV A;  1BJF A;  4CPV A;  1KFX S;  1YX8 A;  3WNX B;  4AQJ A;  3DVM A;  3EK7 A;  4YGE B;  1CLB A;  1CMG A;  5HKY A;  3SG3 A;  5KU1 A;  3O78 A;  2ERB A;  2M9G A;  3DYE A;  2Y5I A;  1MHO A;  1LA3 A;  1SL9 A;  3TS5 C;  4BY4 A;  1KK8 B;  1NX3 A;  3IF7 A;  5GQQ C;  2AMI A;  1DF0 B;  2EHB A;  2BAP A;  4M2O A;  2KLE A;  2BL0 C;  1BOC A;  1F54 A;  4N1F A;  1V1F A;  1UUS A;  3S0A A;  1XFR A;  1CM4 A;  1R2U A;  2MAZ A;  4N1G A;  3DZT A;  3A4U B;  3AAK A;  1RWY A;  1X02 A;  2M1U A;  3K1E A;  1YRT B;  1XO5 A;  2H61 C;  2K0J A;  2CTN A;  1U5I A;  1UWO A;  4PHN A;  1JWD A;  1PUL A;  2L0P A;  3JVT B;  3O4X A;  3CR5 X;  1SCM B;  1CKK A;  3SG4 A;  3TDZ A;  3R1V A;  3KO0 A;  1NCY A;  1S26 D;  1IKU A;  1C7W A;  1PK0 D;  4MVF A;  1XFU O;  2MRD A;  3NSL A;  3I5F C;  1TCF A;  1L2O C;  1A29 A;  3NSI A;  1CFF A;  1A75 B;  2BBN A;  2LHL A;  4YBH B;  1IQ3 A;  1OZS A;  2K7D A;  2L4H A;  5HKZ A;  3PLF B;  4F0Z B;  1NSH A;  3OHM B;  1DEK A;  1B8R A;  1LXF C;  4GGN A;  2JT0 A;  1JC2 A;  4MBE A;  2LMU A;  2ZNE A;  4CFQ A;  2JQ6 A;  3D10 A;  1TUZ A;  2JWW A;  1QV1 A;  2JZI A;  4MZJ A;  1BG1 A;  1ODB A;  2K61 A;  3UO9 A;  2E6W A;  1KFU S;  1QJT A;  2L5X B;  3RLZ A;  3GK1 A;  2P6B B;  4GFT A;  4JQ0 D;  1QWV A;  4DS7 A;  2B1U A;  2QEV A;  1DJI A;  4WQ3 A;  1CFP A;  3UNW A;  1TTX A;  1ZFS A;  4Q04 A;  2QDI A;  3DF0 B;  1H4B A;  4MEW A;  1OE9 B;  2WCF A;  3OX5 A;  2F33 A;  2PVB A;  1WRL A;  1WLM A;  3BUW B;  1UHJ A;  1KK8 C;  3GOF A;  4MZK A;  2HPS A;  3IQO A;  4PDZ A;  2Y1M A;  3BYA A;  2WC5 A;  3R1O A;  5G08 A;  2WOR A;  1SMG A;  1S5G Z;  3D73 A;  3BUM B;  2I2R E;  1QIV A;  5CPV A;  1Q80 A;  2JPT A;  4OV2 A;  1TWO A;  1YUT A;  5CSI A;  4A4C A;  2Y4Q A;  1MXL C;  1V1G A;  1JUO A;  2JNF A;  1YVL A;  5AAN A;  1SCM C;  2L5Y A;  4HRH A;  2KAV A;  1XK4 C;  3NGV A;  2L51 A;  2PRU A;  3CZT X;  2KLD A;  5AEQ A;  2H61 A;  2K7C A;  1GGZ A;  3VRO A;  1OMD A;  1GQM A;  1DJY A;  2LVV A;  1TUJ A;  4MLW A;  3FE8 A;  2ZRS A;  3F45 A;  2I18 A;  4ZCU A;  1SPY A;  1J7O A;  4YRU A;  3D0Y B;  5ER4 X;  3I5G C;  1ORG A;  2ZND A;  1CM1 A;  1M63 B;  3TZ1 A;  5D69 A;  4PHJ A;  2WCL A;  5TNC A;  4OR9 B;  2AUC A;  1L2O B;  3FE9 A;  5JJG A;  4NQG A;  1K9P A;  3EG5 B;  5ER5 A;  5HKW A;  3EKJ A;  3SIA A;  1QX5 B;  2JRF A;  3SG5 A;  1CLL A;  2LAN A;  2JT8 A;  2BBM A;  1F70 A;  4YI9 A;  2IS9 A;  2HET A;  1KCY A;  5HLO A;  4WQ2 A;  1Y6W A;  1Z2C B;  2PSR A;  3B6X A;  1WY9 A;  3JTD B;  4UPG A;  5J3X A;  2LVK A;  3FE6 A;  3OX6 A;  4GPL B;  4ORA B;  3SG2 A;  4YGB B;  2KBI A;  4KYN A;  4C0L A;  2COL B;  5KSZ A;  2MBX A;  2I94 A;  3HCM A;  3KEV A;  2L4I A;  2WCE A;  1REC A;  2GV5 A;  3AAJ A;  3L4L A;  3PAT A;  2WC8 A;  5PAL A;  4PE4 A;  2JUL A;  1E8A A;  2WC6 A;  4IL1 A;  2LP3 A;  5JOL A;  1J7Q A;  1FW4 A;  2M8U A;  3DY9 A;  5K89 A;  2CNP A;  4MSP A;  4HRE E;  1DF0 A;  1XFZ O;  3D78 A;  4D1E A;  2BCB A;  3EVU A;  4YGC B;  2KQY A;  1KQV A;  1M46 A;  1QX7 A;  2YGU A;  1S36 A;  1B4C A;  3EVR A;  2CXJ A;  4DUQ A;  1YRU B;  1RJV A;  3OB1 B;  3FS7 A;  1IRJ A;  1L7Z A;  3I5I C;  4PHM A;  3BFA A;  2WCB A;  1YTZ C;  4IJ7 A;  1DTL A;  4ORC B;  1QAS A;  1SR6 B;  4FQT A;  3TDU A;  2HF5 A;  1GGW A;  1KK7 Z;  2F3Z A;  1PVA A;  2KAX A;  3KHE A;  2JTZ A;  3QRX A;  4ICB A;  4NDC A;  3H4S E;  1SL7 A;  1OOJ A;  1W7J B;  1J7R A;  1QAT A;  1TNQ A;  1XK4 A;  2K2F A;  3FWC A;  1QVI Z;  1H8B A;  3SS4 A;  1JBA A;  4GNK B;  5FI2 A;  2LVJ A;  2LP2 A;  4M2Q A;  2PYQ A;  1A75 A;  3D75 A;  5CSJ A;  3KPX A;  3LK1 A;  3LK0 A;  5HL1 A;  1CDL A;  2F8P A;  2SCP A;  3GK4 X;  1OW4 A;  4FQO A;  1LKJ A;  2MA2 A;  4E68 A;  3PJI A;  4USL A;  1DJZ A;  4XJK B;  3D77 A;  3QME A;  5I8N A;  5EL2 A;  1XFV O;  3O4Y A;  2BCA A;  1WDC B;  2CBL A;  1ZOT B;  4ZCV A;  3DVJ A;  1BR1 B;  1CFC A;  1CFD A;  3I5G B;  4ETO A;  3JTD C;  2V53 A;  4F7F A;  1OOH A;  3D74 A;  1Y0V H;  4N5X A;  5AXI A;  1KWO B;  1SY9 A;  3CGA A;  3S0F A;  2JT3 A;  1YUS A;  2K8M B;  1WRZ A;  1XFX O;  3NSO A;  4M2P A;  4YGD B;  1MUX A;  4OZD A;  1CDM A;  1K95 A;  2R2I A;  3BQ3 A;  3DF0 A;  4PE1 A;  1IH0 A;  1W9Z A;  2FOT A;  3C1V A;  5D7F A;  1UHI A;  2BE6 A;  3DD4 A;  1DGV A;  2FJU B;  1EG4 A;  2WCH A;  3CYZ A;  3SIB A;  1AP4 A;  1DMO A;  4P5O E;  2QEB A;  2OS8 B;  2BKH B;  3BFB A;  2HQ8 A;  2JOJ A;  1RRO A;  2JPO A;  3N7H A;  4GUK A;  1JFJ A;  1RTP 1;  3B87 A;  1FPW A;  1A4P A;  1K2H A;  3CZ2 A;  4MZL A;  3OBV A;  1F4Q A;  1F8H A;  1N65 A;  1HT9 A;  1IJ5 A;  2O5G A;  4DCK A;  1BF5 A;  1BMO A;  1OOG A;  1AJ5 A;  3IQQ A;  4OVN F;  1PSB A;  1SR6 C;  2RGI A;  3B88 A;  3SS3 A;  1OMR A;  4QJ5 B;  1F4O A;  1AHR A;  4YGA A;  2OTG B;  1SCV A;  3NHI A;  2LE9 B;  3LCP C;  1DJX A;  2E30 A;  3TUY C;  3VRP A;  2K7O A;  2PQL A;  1NYA A;  1QX2 A;  1XYD A;  2NCO A;  1M45 A;  3SG7 A;  4PT1 A;  1OQP A;  3IVT A;  2QAC A;  5DKQ A;  5KTY A;  3I5I B;  1JFK A;  3HX4 A;  2PMY A;  1OZO A;  2BNX A;  1IIO A;  1D1O A;  2GTE A;  4GGF C;  3EK4 A;  1ALV A;  1NP8 A;  2JXC A;  4FTG A;  2BCX A;  1XFY O;  1J1E A;  5I2O A;  4I5L B;  4CLN A;  1GM0 A;  1K90 D;  1XFW O;  3D0Y A;  1Y1A A;  2JU0 A;  3PM8 A;  1UUR A;  1TCO B;  2D8N A;  5CSF A;  2BKI B;  2LC5 A;  1WDC C;  2BE4 A;  4YI8 A;  1SK6 D;  1B1G A;  2CCM A;  3ZWH A;  1CNP A;  1PVB A;  3BFH A;  4HRG A;  1CDP A;  1ZMZ A;  3VB1 A;  4DRW A;  4CFR A;  1F71 A;  2AAO A;  1KWO C;  2MLE C;  3CTN A;  2OPO A;  3NXA A;  3Q8I A;  3SS5 A;  1ALW A;  1BU3 A;  3NSK A;  5DKR A;  1NCZ A;  3VRR A;  1IG5 A;  1C07 A;  2I7A A;  3PN7 C;  1EL4 A;  2ZRT A;  2LV7 A;  3CDN A;  5I94 A;  1JSA A;  3S0B A;  1B7T Z;  4JKT A;  4AOM A;  2MHH A;  1FBV A;  2LHI A;  1DVI A;  1SBJ A;  2EC6 C;  3CR2 A;  4QJ4 B;  2KI6 C;  1EG3 A;  3D76 A;  3R72 A;  1B8C A;  3I5H B;  1N0Y A;  4INX A;  1PRW A;  1MR8 A;  2M3W A;  2OS8 C;  1TNP A;  1SYM A;  1NIW A;  1B9A A;  2KAY A;  2L2E A;  1QTX A;  2KNE A;  4C0J A;  4JD9 A;  4MRY A;  3B86 A;  1YR5 A;  4OCI A;  2Y1N A;  2KFG A;  1K93 D;  1BOD A;  2KI4 B;  1TOP A;  1FI5 A;  2OTG C;  2GGZ A;  2ZFD A;  4R1E A;  2KI6 D;  2KOT A;  1OOI X;  3BJH A;  3FIA A;  2MLF C;  4PHK A;  2Q91 A;  1DEL A;  1CTR A;  3ICB A;  1IWQ A;  1NPQ A;  3WXA A;  4A4B A;  2LAP A;  1A03 A;  2F2P A;  3DVK A;  3K21 A;  3BOW B;  4I5N B;  1S6I A;  2KFH A;  2WCM A;  2ISD A;  1PSR A;  2L98 A;  1BT6 A;  2LLS A;  3ZNI A;  3BUN B;  3TUY B;  1LIN A;  2KYC A;  1MXE A;  3DXL A;  1CB1 A;  3S0D A;  4GGF A;  3S0E A;  2LVI A;  2WOS A;  2G9B A;  3V2L A;  4XJK A;  3EVV A;  3WHU B;  1EXR A;  3CAB A;  1TIZ A;  2WND A;  5DIC A;  1AK8 A;  2SAS A;  2P71 A;  1S6C A;  2M97 A;  4OKH A;  4I5J A;  1DT7 B;  5I2L A;  4PE7 A;  1IQ5 A;  3CS1 A;  1MWN A;  1G4Y R;  2EGD A;  1B47 A;  1OSA A;  2M29 A;  3TDI A;  5FYX A;  3BUX B;  2MJW B;  1IJ6 A;  2ZKM X;  1KQM B;  2BEC A;  2QEO A;  5B8I B;  3I5H C;  1WLZ A;  1QLS A;  4QJ3 B;  1TN4 A;  2PAL A;  1C3Z A;  1XVJ A;  2KPH A;  1U5I B;  1Y1U A;  1QV0 A;  1S6J A;  3CLN A;  2NXQ A;  1YUU A;  2K7B A;  2FCD A;  2LMV A;  3S0G A;  1P28 A;  3PN7 B;  2DOQ A;  3CR4 X;  3RM1 A;  3WHT B;  3BXK A;  1S5G Y;  2M7N A;  1SSE B;  1IGV A;  2EC6 B;  2NLN A;  4WRI A;  2L50 A;  4INW A;  2KI4 C;  2M1K B;  3OB2 B;  3PAL A;  3NHT A;  1KFX L;  3MSE B;  1K94 A;  2KDH A;  1YVH A;  4I5K A;  1A2X A;  1BR4 B;  1K9U A;  3CWG A;  1QS7 A;  1WRK A;  2QPT A;  2L2C A;  2LUX A;  1TNX A;  4JWQ A;  1G8I A;  4GBA A;  3M0W A;  3OP0 A;  1TNW A;  2K2A A;  1AUI B;  5CSN A;  1K96 A;  2A4J A;  3VRQ A;  4PE0 A;  2TN4 A;  1SL8 A;  2ZN9 A;  3AKB A;  1SKT A;  4BY5 A;  2KGR A;  2HQW A;  2K60 A;  5D3O A;  5FI6 A;  1QLK A;  4GAO A;  5AER A;  3AKA A;  1BLQ A;  1ZUZ A;  1NX1 A;  1NX2 A;  3PSR A;  2WCJ A;  2M0R A;  2M7L A;  1LA0 A;  1N2D A;  4P2Y B;  1S1E A;  1OMV A;  3O6B A;  2ZN8 A;  4TNC A;  2KYF A;  4U8D A;  1CLM A;  1M39 A;  2O60 A;  3GK2 A;  2LNK A;  1LS8 A;  1AVS A;  2JNX A;  4NDB A;  3VGO A;  1F55 A;  4XYN A;  1K9K A;  2KHN A;  1C7V A;  1PAL A;  1J7P A;  1QXP A;  4MRX A;  4ORB B;  5DKN A;  4L9M A;  1S3P A;  2FJY A;  3FWB A;  2KSP A;  2LLT A;  3PFV A;  1B7T Y;  1NX0 A;  3VRN A;  3B7A A;  1KQM C;  3TS5 B;  1MQ1 A;  3RZS A;  1VRK A;  1UHK A;  1QIW A;  4AQI A;  3A8R A;  1UHN A;  3JVT C;  1LVC D;  2VRG A;  1DJW A;  2BL0 B;  1KSM A;  1SRA A;  1YUR A;  3L4A A;  3L47 A;  1T14 A;  1HQV A;  3CZ1 A;  4MN0 A;  5HYD A;  2WCK A;  1AJ4 A;  1EH2 A;  2LUC A;  2F3Y A;  3LLE A;  1KFU L;  3O2P A;  5AFP A;  3DVE A;  4HSZ A;  1FI6 A;  5BPJ A;  1SW8 A;  1J1D A;  3R1P A;  1SNL A;  2G2B A;  1NUB A;  1Z4H A;  1C3Y A;  1DJG A;  1R6P A;  2M49 B;  2LCP A;  1JF0 A;  1DJH A;  1JF2 A;  2LLU A;  1W7I B;  2KQ6 A;  2F2O A;  1B8L A;  2KGB C;  1MF8 B;  3CZ0 A;  2CT9 A;  2JXL A;  2LM5 A;  3LL8 B;  2GGM A;  2NZ0 A;  1TRF A;  1EJ3 A;  1XA5 A;  1OOF A;  3BUO B;  3SG6 A;  1CDN A;  1DGU A;  1K8U A;  4C0K A;  1RK9 A;  2KFF A;  3I5F B;  5IBW A;  1ZAC A;  3KF9 A;  3SJS A;  1FF1 A;  2P70 A;  1YX7 A; 
#chains in the Genus database with same CATH homology
 3S0D A;  3S0E A;  2QEH A;  3V2L A;  2WCH A;  3CAB A;  3CYZ A;  3NGV A;  5DIC A;  3OGN A;  2P71 A;  2QEB A;  3BFB A;  3N7H A;  2P70 A;  2JPO A;  1TUJ A;  1DQE A;  3B87 A;  3FE8 A;  2H8V A;  3CZ2 A;  2QEO A;  1OOG A;  1C3Z A;  1ORG A;  3B88 A;  2KPH A;  2WCL A;  3NHI A;  3FE9 A;  3S0G A;  2ERB A;  1P28 A;  3DYE A;  2PQL A;  4PT1 A;  4INW A;  3NHT A;  3B6X A;  2GTE A;  3S0A A;  1XFR A;  3FE6 A;  3DZT A;  2L2C A;  1GM0 A;  3K1E A;  3L4L A;  3BFH A;  2WC6 A;  3VB1 A;  3R1V A;  3DY9 A;  3Q8I A;  3D78 A;  2WCJ A;  3CDN A;  3S0B A;  1LS8 A;  3D76 A;  3R72 A;  3BFA A;  4INX A;  4FQT A;  2FJY A;  4JD9 A;  3B86 A;  3B7A A;  3RZS A;  1QWV A;  2QEV A;  3D75 A;  3L4A A;  3L47 A;  1T14 A;  2QDI A;  3CZ1 A;  2WCK A;  1OW4 A;  1OOI X;  3BJH A;  3PJI A;  3D77 A;  3QME A;  3R1P A;  5EL2 A;  1C3Y A;  2WC5 A;  3R1O A;  3CZ0 A;  3D73 A;  4F7F A;  1OOH A;  2WCM A;  1OOF A;  3D74 A;  3S0F A;  1TWO A;  4OZD A;  3DXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...