3DXLA

Crystal structure of aed7 from aedes aegypti
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
303
structure length
299
Chain Sequence
MGPFDPEEMLFIFTRCMEDNLEDGANRLPMLAKWKEWINEPVDSPATQCFGKCVLVRTGLYDPVAQKFDASVIQEQFKAYPSLGEKSKVEAYANAVKQLPSTNNDCAAVFKAYDPVHKAHKDTSKNLFHGNKELTKGLYEKLGKDIRQKKQSYFEFCENKYYPAGSDKRQQLCQIRQYTVLDDALFKEHTDCVMKGIRYITKDNQLDVEEVKRDFKLVNKDTKALEEVLNDCKSKEPSNAKEKSWHYYKCLVESSVKDDFKEAFDYREVRSQIYAFNLPKNQAYSKPAVMEIDGKQCPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Odorant-binding protein
molecule keywords Allergen Aed a 2
publication title Multifunctionality and mechanism of ligand binding in a mosquito antiinflammatory protein
pubmed doi rcsb
source organism Aedes aegypti
total genus 117
structure length 299
sequence length 303
ec nomenclature
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3dxlA01
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3dxlA02
3FE6A 3S0BA 1OOFA 2QDIA 3DXLA 4JD9A 1OW4A 3S0FA 2WCKA 3B88A 2H8VA 3NHTA 2P70A 3L47A 4F7FA 3DYEA 3QMEA 3V2LA 3BFBA 3BFHA 1C3YA 4OZDA 3L4LA 3Q8IA 3K1EA 3BJHA 3DZTA 2QEHA 3N7HA 1OOHA 3R1OA 5EL2A 3D78A 3B86A 3R1PA 3NHIA 1QWVA 1TUJA 3FE8A 3R1VA 2KPHA 3R72A 3NGVA 2PQLA 3CZ1A 1T14A 1ORGA 3D74A 5DICA 1OOIX 4INXA 2QEVA 1XFRA 1OOGA 2WCLA 3CYZA 2WC5A 3S0EA 3L4AA 3VB1A 2WCMA 3D75A 3S0DA 2L2CA 2ERBA 2P71A 4INWA 3FE9A 3S0GA 1P28A 1LS8A 2FJYA 2GTEA 3D73A 2JPOA 1TWOA 4FQTA 3D77A 1DQEA 2WCJA 3DY9A 3PJIA 3RZSA 1C3ZA 2QEOA 3B6XA 3CZ0A 3CZ2A 3OGNA 3S0AA 4PT1A 3B7AA 2WCHA 3BFAA 3CDNA 3CABA 1GM0A 3B87A 2QEBA 2WC6A 3D76A
chains in the Genus database with same CATH superfamily
4MRYA 3BOWA 3UO9A 2PRUA 3NSLA 3NSKA 1OOJA 3DXLA 4JD9A 3S0FA 1SY9A 2CTNA 4C0KA 1NWDA 2G2BA 1JF0A 1H8BA 1NP8A 1AJ4A 1XFWO 2F8PA 1IH0A 3VGOA 4F7FA 3BFBA 2L2EA 2LAPA 2K7CA 4HSZA 4OR9B 2K61A 1OMVA 1QX5B 4HRGA 1BR4B 4CFQA 3Q8IA 3EVRA 1FPWA 4MRXA 3AKBA 2HQ8A 1NYAA 2L50A 3BJHA 4ETOA 1CNPA 1J1EA 5ER5A 1F70A 1MWNA 3IQQA 3NSOA 1DELA 1NX1A 1F4QA 1PRWA 1E8AA 2ZNEA 3R1OA 3WNXB 2QPTA 5HKZA 5EL2A 1SCMB 1CM4A 5FI7A 3BOWB 2SASA 1X02A 1ALWA 1HT9A 2VRGA 1KSOA 1CMFA 4N1GA 1TUJA 1B47A 1K9UA 3KHEA 5HLOA 3SG6A 4E68A 5G08A 1Y1AA 1KFUL 2NLNA 2LP2A 4PE4A 2KOTA 1BG1A 1EH2A 2MBXA 1CLLA 2K0JA 1KFXS 1B9AA 1KK7Z 1S6CA 2CNPA 1SNLA 2OTGC 2OS8B 2Y1NA 1JC2A 3CYZA 3SIBA 3IVTA 4GBAA 3CR5X 5KSZA 2A4JA 3BYAA 4PE0A 4CLNA 1K2HA 1LA3A 4YBHB 1XFUO 1SKTA 2KQYA 2LCPA 1A75A 2PYQA 2MAZA 3E3RA 3UNWA 1XO5A 1SK6D 2ERBA 2P71A 1C07A 2KI6D 1DJWA 3DF0B 4N5XA 4INWA 2BBNA 3SG3A 1BR1B 1DJYA 1QV1A 1SRAA 1UURA 2WCBA 3BUWB 1IKUA 1L2OC 1P28A 4AQJA 3EKHA 1MHOA 1F4OA 1PK0D 1C7VA 2HQWA 2V53A 4FQTA 5TNCA 3DVJA 4I5KA 1M39A 3BUXB 4A4CA 4BY4A 3PSRA 2JXLA 4NQGA 2GV5A 1NX3A 4PHMA 2KDHA 3TZ1A 2K7DA 4PE1A 1OMRA 2WORA 3DY9A 4DS7A 2BKHB 5I94A 2JOJA 1DF0B 2CT9A 2K2AA 5BPJA 1BU3A 1SL7A 1MUXA 4DCKA 1AK8A 2L51A 2KBMA 2P6BB 2MLFC 2LLTA 1GGWA 2KFHA 3H4SE 5CSFA 1NCZA 2AAOA 3ZNIA 3D10A 1SR6B 3I5HC 2MA2A 5CSJA 2K7OA 1KK8C 1PSRA 1PULA 2JTZA 4GUKA 3TDIA 2WCHA 1U5IB 4ICBA 3PM2A 2KI6C 1KSMA 2EC6C 1GQMA 1ALVA 2Q4UA 2JPTA 1BT6A 1S5GY 4XJKB 1GM0A 2L4HA 4PE7A 3F45A 1UHIA 3OB1B 2BAPA 1BODA 1J7QA 1WDCC 2JXCA 3B87A 2KQ6A 3O78A 1W7JB 1UUSA 2LHIA 3DD4A 5FI6A 3A4UB 3S0BA 4AOMA 3FE6A 4YGDB 2G9BA 4XYNA 3BUNB 1YVHA 1G33A 1DEKA 1Z2CB 1NUBA 1F71A 4M2OA 3B88A 4MZJA 2JT8A 3CWGA 1KCYA 3O2PA 1AP4A 1YX7A 1QVIY 3PM8A 1TN4A 4KYNA 4WRIA 1SL9A 3SG7A 1K94A 3A8RA 2BBMA 2LM5A 2WOSA 3BFHA 5FI2A 1DGVA 3IF7A 2L98A 1J7PA 2QACA 1UWOA 3WHUB 2PVBA 3L4LA 4IJ7A 2BCBA 1B7TY 2AMIA 3I5GC 2QEHA 4Q04A 1NIWA 4YRUA 1J1DA 2KBIA 3BXKA 5ER4X 1OOHA 2K2FA 2KI4C 2MJWB 2KAYA 3BUOB 3BQ3A 3D78A 1ZOTB 2LANA 2D8NA 5IBWA 1K9PA 1XA5A 2BCAA 4ORBB 1EG4A 4C0LA 2TN4A 2ZKMX 4YI9A 5CSNA 5J3XA 3PATA 1ZFSA 4GPLB 2ZNDA 1B8RA 4DIRA 3GK2A 3ZWHA 3CZ1A 4PHJA 3TS5B 2EGDA 3TS5C 1NSHA 1EG3A 5JJGA 1JWDA 3DVKA 4OVNF 1CLMA 3D74A 1NCXA 1XFRA 1OOGA 4USLA 2WCLA 2BKIB 3FS7A 2LMVA 1XYDA 4MEWA 3S0EA 2JTTA 4U8DA 2K7BA 2BE4A 3L4AA 3VB1A 1AVSA 2KLDA 3I5FB 2M8UA 3I5FC 2IS9A 2JT3A 3O4XA 1YX8A 1KWOB 1RWYA 1S26D 3O4YA 4M2PA 1KQMB 1TNQA 1SCMC 2FOTA 1Y0VH 3CR4X 4JPZB 1M31A 1TUZA 1Y6WA 4PHNA 4YGBB 5AEQA 3DF0A 4WQ3A 1BF5A 1BMOA 1NX0A 2WC6A 2AUCA 2GGZA 2HF5A 2I94A 1TCOB 1OZSA 1B1GA 2FJYA 3OX5A 3LCPC 1K93D 2JNFA 4F0ZB 1WRZA 1IJ6A 1M46A 1B8CA 5HLVA 1VRKA 1RK9A 1YUUA 2COLB 2Y5IA 3D77A 5PALA 5KU1A 4I5NB 1TOPA 2OS8C 1F8HA 1CDNA 1JBAA 1DQEA 1KK7Y 1WLMA 1MXEA 1SBJA 4NDDA 2I18A 1EL4A 5K89A 1TCFA 4MLWA 2KGRA 1QATA 1CLBA 1RECA 4WQ2A 3AAJA 2LUCA 2PALA 1YR5A 1FI5A 1PSBA 4ZCVA 1DF0A 4ZCUA 3I5IB 1XFVO 2H61A 1WRLA 3MSEB 1V1GA 3NXAA 1B8LA 2MRDA 1NX2A 1RTP1 2QEOA 4YGEB 2M97A 5DKRA 2JT0A 2JWWA 3OGNA 1CFFA 1UHKA 1ODBA 4YI8A 4MN0A 1NCYA 5D69A 1J55A 2JQ6A 3BFAA 3KEVA 1IGVA 1U5IA 2JNXA 1OZOA 2PSRA 4XJKA 3O6BA 2JRFA 3EK4A 3VRRA 2KNEA 2QEBA 4P2YB 1M63B 4PALA 4GAOA 4I5JA 2GGMA 1XVJA 2ZN9A 3D76A 2SCPA 2ZFDA 1MR8A 3WHTB 3AAKA 2QDIA 1OW4A 2H61C 2WCKA 3LK1A 1JFJA 1F54A 3TUYB 2F2OA 1SL8A 1IRJA 2FCEA 2H8VA 1DJHA 2KLEA 2P70A 3L47A 1AHRA 1ZACA 5AANA 1C3YA 3QMEA 1J7OA 1XFYO 4CFRA 3PFVA 1SR6C 2KYFA 5D7FA 5JOLA 1WRKA 1LKJA 4OZDA 1DJXA 3PLFB 5HKWA 5CSIA 3HX4A 3CZTX 5CPVA 2CXJA 2L5YA 3DZTA 3K1EA 1B4CA 2KGBC 4GGFA 2B1UA 4JWQA 2Y4QA 3N7HA 4MBEA 3D0YA 1PALA 1QLKA 4IL1A 2NZ0A 3KO0A 1A03A 1PVBA 3B86A 2M1UA 1S36A 1Z4HA 2KSPA 2WCFA 1QWVA 3KPXA 3CR2A 2RGIA 5AERA 1FBVA 3R1VA 2FCDA 2O5GA 1LVCD 4JKTA 3R72A 3JTDB 2F3ZA 1A2XA 1OSAA 2PQLA 1UHNA 3OHMB 1S5GZ 1T14A 1XFZO 5KTYA 1CFCA 5D3OA 2LLSA 2LVJA 1YRUB 3SG2A 1QS7A 2ZRSA 5HYDA 1CFDA 1IQ5A 2LNKA 4MZLA 1QASA 2KFGA 3PN7B 3PN7C 4GGFC 4NDCA 5DKNA 5GQQC 4QJ4B 1FF1A 3BUMB 1BOCA 3D0YB 1XFXO 2WCMA 4FTGA 4P5OE 4MZKA 1KFUS 1QIVA 2ZRTA 4MVFA 1QVIZ 2ISDA 4ORCB 2M1KB 1EXRA 3FE9A 1LS8A 3D73A 1W7IB 3PALA 1TNPA 2JPOA 1TNXA 1W9ZA 1TWOA 4CIDA 4L9MA 1M45A 3LL8B 1J7RA 1SMGA 3VROA 1A4PA 1BLQA 1CFPA 2M29A 1N0YA 1CKKA 2LMTA 2M7LA 3TDZA 1OQPA 1N65A 2PMYA 1YUSA 2M3WA 1N2DA 4DRWA 5I8NA 1KWOC 3RZSA 3SIAA 1DC1A 2LE9B 1S1EA 1KQMC 1C3ZA 4MSPA 3EKJA 3DVMA 1DJIA 2K8MB 2NCOA 3CTNA 1Y1XA 4ORAB 3CZ2A 1MQ1A 3QRXA 2LMUA 4PT1A 3K21A 3B7AA 1RROA 3OB2B 2ZN8A 2E6WA 1YURA 3EVUA 3CDNA 1YVLA 3SS5A 2LVIA 1LXFC 1R6PA 1XK4A 1G4YR 1RFJA 3SG4A 2M0RA 1UHJA 2HETA 2KHNA 4AQIA 1CM1A 1Q80A 2KYCA 1OOFA 2NXQA 3I5IC 1HQVA 1QJTA 3M0WA 4UPGA 1TNWA 2JU0A 4HRHA 1GJYA 3EK8A 1A29A 3NHTA 4CPVA 2LVKA 5HL1A 1UP5A 1DGUA 4C0JA 3DYEA 3V2LA 2CBLA 3FIAA 1RJVA 5I2OA 4GGNA 2FJUB 1IWQA 1GGZA 1QIWA 1SYMA 2OTGB 1ZUZA 4QJ5B 2WC8A 1CTRA 1SSEB 3EG5B 1FI6A 3GK4X 1TRFA 2M9GA 3HCMA 1YTZC 4TNCA 1H4BA 1SPYA 3KF9A 3CGAA 1DVIA 2LLUA 3CS1A 1XK4C 3RM1A 2Y1MA 5B8IB 4FQOA 2KAVA 3IQOA 1UHHA 4YGCB 1AUIB 3ICBA 3R1PA 1K90D 3GK1A 1LINA 3NHIA 2M7NA 2LHLA 4HREE 1L2OB 3FE8A 3JVTB 3JVTC 2Q91A 4DUQA 2BE6A 2EHBA 3TUYC 3TDUA 1DJGA 2KPHA 2JULA 1YUTA 3NGVA 5AXIA 3VRPA 3SS3A 4I5LB 1ORGA 2K60A 1TIZA 2JZIA 2OPOA 3OP0A 4M2QA 5DICA 1DJZA 1K96A 1OOIX 4INXA 2QEVA 1CMGA 1AJ5A 2E30A 1CDPA 1QLSA 2F33A 2I2RE 2WC5A 1TTXA 2MHHA 2YGUA 1IQ3A 1ZMZA 1WLZA 2L5XB 3D75A 1A75B 2L0PA 1WY9A 2BNXA 3S0DA 1DMOA 1S3PA 1PVAA 2L2CA 2O60A 1DT7B 4PHKA 1G8IA 2JC2A 1OMDA 3GOFA 2KFFA 1SW8A 4OKHA 3CLNA 1KFXL 2LUXA 1JF2A 2WCEA 1R2UA 1DTLA 1K8UA 2CCMA 5F6TA 3S0GA 1IG5A 3I5HB 2GTEA 1KK8B 4GNKB 4A4BA 1FW4A 3RLZA 1V1FA 1QTXA 4OV2A 2DOQA 3JTDC 3SJSA 2EC6B 1JUOA 1OE9B 2F2PA 3VRNA 1QXPA 1SCVA 2LV7A 3FWCA 4N1FA 4PCWA 1CB1A 2PASA 5I2QA 1WDCB 2WCJA 3EVVA 4GFTA 1K9KA 4JQ0D 1L7ZA 1QX2A 5FYXA 1S6JA 1IJ5A 1MXLC 1NPQA 3PJIA 2I7AA 5AFPA 1BJFA 2LC5A 4NDBA 5DKQA 1S6IA 2KAXA 3DVEA 1JFKA 1QX7A 1D1OA 4BY5A 2R2IA 1JSAA 4OCIA 2HPSA 2WNDA 3C1VA 3B6XA 1YRTB 5HKYA 3CZ0A 5I2LA 2BCXA 3S0AA 1K95A 4PDZA 1KQVA 3FWBA 3SS4A 2BECA 2BL0B 1QV0A 2BL0C 3SG5A 1B7TZ 1CDMA 2MLEC 3LK0A 2LVVA 3AKAA 3OBVA 4QJ3B 3WXAA 4D1EA 2NCPA 3I5GB 1EJ3A 1LA0A 3NSIA 3CABA 1C7WA 4YGAA 2H2KA 2KI4B 2M49B 1IIOA 1CDLA 1MF8B 2L4IA 2F3YA 3VRQA 2LP3A 3OX6A 1F55A 4R1EA 1Y1UA 3LLEA 3EK7A
chains in the Genus database with same CATH topology
3FE6A 3S0BA 1OOFA 2QDIA 3DXLA 4JD9A 1OW4A 3S0FA 2WCKA 3B88A 2H8VA 3NHTA 2P70A 3L47A 4F7FA 3DYEA 3QMEA 3V2LA 3BFBA 3BFHA 1C3YA 4OZDA 3L4LA 3Q8IA 3K1EA 3BJHA 3DZTA 2QEHA 3N7HA 1OOHA 3R1OA 5EL2A 3D78A 3B86A 3R1PA 3NHIA 1QWVA 1TUJA 3FE8A 3R1VA 2KPHA 3R72A 3NGVA 2PQLA 3CZ1A 1T14A 1ORGA 3D74A 5DICA 1OOIX 4INXA 2QEVA 1XFRA 1OOGA 2WCLA 3CYZA 2WC5A 3S0EA 3L4AA 3VB1A 2WCMA 3D75A 3S0DA 2L2CA 2ERBA 2P71A 4INWA 3FE9A 3S0GA 1P28A 1LS8A 2FJYA 2GTEA 3D73A 2JPOA 1TWOA 4FQTA 3D77A 1DQEA 2WCJA 3DY9A 3PJIA 3RZSA 1C3ZA 2QEOA 3B6XA 3CZ0A 3CZ2A 3OGNA 3S0AA 4PT1A 3B7AA 2WCHA 3BFAA 3CDNA 3CABA 1GM0A 3B87A 2QEBA 2WC6A 3D76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FE6 A;  3S0B A;  1OOF A;  2QDI A;  3DXL A;  4JD9 A;  1OW4 A;  3S0F A;  2WCK A;  3B88 A;  2H8V A;  3NHT A;  2P70 A;  3L47 A;  4F7F A;  3DYE A;  3QME A;  3V2L A;  3BFB A;  3BFH A;  1C3Y A;  4OZD A;  3L4L A;  3Q8I A;  3K1E A;  3BJH A;  3DZT A;  2QEH A;  3N7H A;  1OOH A;  3R1O A;  5EL2 A;  3D78 A;  3B86 A;  3R1P A;  3NHI A;  1QWV A;  1TUJ A;  3FE8 A;  3R1V A;  2KPH A;  3R72 A;  3NGV A;  2PQL A;  3CZ1 A;  1T14 A;  1ORG A;  3D74 A;  5DIC A;  1OOI X;  4INX A;  2QEV A;  1XFR A;  1OOG A;  2WCL A;  3CYZ A;  2WC5 A;  3S0E A;  3L4A A;  3VB1 A;  2WCM A;  3D75 A;  3S0D A;  2L2C A;  2ERB A;  2P71 A;  4INW A;  3FE9 A;  3S0G A;  1P28 A;  1LS8 A;  2FJY A;  2GTE A;  3D73 A;  2JPO A;  1TWO A;  4FQT A;  3D77 A;  1DQE A;  2WCJ A;  3DY9 A;  3PJI A;  3RZS A;  1C3Z A;  2QEO A;  3B6X A;  3CZ0 A;  3CZ2 A;  3OGN A;  3S0A A;  4PT1 A;  3B7A A;  2WCH A;  3BFA A;  3CDN A;  3CAB A;  1GM0 A;  3B87 A;  2QEB A;  2WC6 A;  3D76 A; 
#chains in the Genus database with same CATH topology
 4MRY A;  3BOW A;  3UO9 A;  2PRU A;  3NSL A;  3NSK A;  1OOJ A;  3DXL A;  4JD9 A;  3S0F A;  1SY9 A;  2CTN A;  4C0K A;  1NWD A;  2G2B A;  1JF0 A;  1H8B A;  1NP8 A;  1AJ4 A;  1XFW O;  2F8P A;  1IH0 A;  3VGO A;  4F7F A;  3BFB A;  2L2E A;  2LAP A;  2K7C A;  4HSZ A;  4OR9 B;  2K61 A;  1OMV A;  1QX5 B;  4HRG A;  1BR4 B;  4CFQ A;  3Q8I A;  3EVR A;  1FPW A;  4MRX A;  3AKB A;  2HQ8 A;  1NYA A;  2L50 A;  3BJH A;  4ETO A;  1CNP A;  1J1E A;  5ER5 A;  1F70 A;  1MWN A;  3IQQ A;  3NSO A;  1DEL A;  1NX1 A;  1F4Q A;  1PRW A;  1E8A A;  2ZNE A;  3R1O A;  3WNX B;  2QPT A;  5HKZ A;  5EL2 A;  1SCM B;  1CM4 A;  5FI7 A;  3BOW B;  2SAS A;  1X02 A;  1ALW A;  1HT9 A;  2VRG A;  1KSO A;  1CMF A;  4N1G A;  1TUJ A;  1B47 A;  1K9U A;  3KHE A;  5HLO A;  3SG6 A;  4E68 A;  5G08 A;  1Y1A A;  1KFU L;  2NLN A;  2LP2 A;  4PE4 A;  2KOT A;  1BG1 A;  1EH2 A;  2MBX A;  1CLL A;  2K0J A;  1KFX S;  1B9A A;  1KK7 Z;  1S6C A;  2CNP A;  1SNL A;  2OTG C;  2OS8 B;  2Y1N A;  1JC2 A;  3CYZ A;  3SIB A;  3IVT A;  4GBA A;  3CR5 X;  5KSZ A;  2A4J A;  3BYA A;  4PE0 A;  4CLN A;  1K2H A;  1LA3 A;  4YBH B;  1XFU O;  1SKT A;  2KQY A;  2LCP A;  1A75 A;  2PYQ A;  2MAZ A;  3E3R A;  3UNW A;  1XO5 A;  1SK6 D;  2ERB A;  2P71 A;  1C07 A;  2KI6 D;  1DJW A;  3DF0 B;  4N5X A;  4INW A;  2BBN A;  3SG3 A;  1BR1 B;  1DJY A;  1QV1 A;  1SRA A;  1UUR A;  2WCB A;  3BUW B;  1IKU A;  1L2O C;  1P28 A;  4AQJ A;  3EKH A;  1MHO A;  1F4O A;  1PK0 D;  1C7V A;  2HQW A;  2V53 A;  4FQT A;  5TNC A;  3DVJ A;  4I5K A;  1M39 A;  3BUX B;  4A4C A;  4BY4 A;  3PSR A;  2JXL A;  4NQG A;  2GV5 A;  1NX3 A;  4PHM A;  2KDH A;  3TZ1 A;  2K7D A;  4PE1 A;  1OMR A;  2WOR A;  3DY9 A;  4DS7 A;  2BKH B;  5I94 A;  2JOJ A;  1DF0 B;  2CT9 A;  2K2A A;  5BPJ A;  1BU3 A;  1SL7 A;  1MUX A;  4DCK A;  1AK8 A;  2L51 A;  2KBM A;  2P6B B;  2MLF C;  2LLT A;  1GGW A;  2KFH A;  3H4S E;  5CSF A;  1NCZ A;  2AAO A;  3ZNI A;  3D10 A;  1SR6 B;  3I5H C;  2MA2 A;  5CSJ A;  2K7O A;  1KK8 C;  1PSR A;  1PUL A;  2JTZ A;  4GUK A;  3TDI A;  2WCH A;  1U5I B;  4ICB A;  3PM2 A;  2KI6 C;  1KSM A;  2EC6 C;  1GQM A;  1ALV A;  2Q4U A;  2JPT A;  1BT6 A;  1S5G Y;  4XJK B;  1GM0 A;  2L4H A;  4PE7 A;  3F45 A;  1UHI A;  3OB1 B;  2BAP A;  1BOD A;  1J7Q A;  1WDC C;  2JXC A;  3B87 A;  2KQ6 A;  3O78 A;  1W7J B;  1UUS A;  2LHI A;  3DD4 A;  5FI6 A;  3A4U B;  3S0B A;  4AOM A;  3FE6 A;  4YGD B;  2G9B A;  4XYN A;  3BUN B;  1YVH A;  1G33 A;  1DEK A;  1Z2C B;  1NUB A;  1F71 A;  4M2O A;  3B88 A;  4MZJ A;  2JT8 A;  3CWG A;  1KCY A;  3O2P A;  1AP4 A;  1YX7 A;  1QVI Y;  3PM8 A;  1TN4 A;  4KYN A;  4WRI A;  1SL9 A;  3SG7 A;  1K94 A;  3A8R A;  2BBM A;  2LM5 A;  2WOS A;  3BFH A;  5FI2 A;  1DGV A;  3IF7 A;  2L98 A;  1J7P A;  2QAC A;  1UWO A;  3WHU B;  2PVB A;  3L4L A;  4IJ7 A;  2BCB A;  1B7T Y;  2AMI A;  3I5G C;  2QEH A;  4Q04 A;  1NIW A;  4YRU A;  1J1D A;  2KBI A;  3BXK A;  5ER4 X;  1OOH A;  2K2F A;  2KI4 C;  2MJW B;  2KAY A;  3BUO B;  3BQ3 A;  3D78 A;  1ZOT B;  2LAN A;  2D8N A;  5IBW A;  1K9P A;  1XA5 A;  2BCA A;  4ORB B;  1EG4 A;  4C0L A;  2TN4 A;  2ZKM X;  4YI9 A;  5CSN A;  5J3X A;  3PAT A;  1ZFS A;  4GPL B;  2ZND A;  1B8R A;  4DIR A;  3GK2 A;  3ZWH A;  3CZ1 A;  4PHJ A;  3TS5 B;  2EGD A;  3TS5 C;  1NSH A;  1EG3 A;  5JJG A;  1JWD A;  3DVK A;  4OVN F;  1CLM A;  3D74 A;  1NCX A;  1XFR A;  1OOG A;  4USL A;  2WCL A;  2BKI B;  3FS7 A;  2LMV A;  1XYD A;  4MEW A;  3S0E A;  2JTT A;  4U8D A;  2K7B A;  2BE4 A;  3L4A A;  3VB1 A;  1AVS A;  2KLD A;  3I5F B;  2M8U A;  3I5F C;  2IS9 A;  2JT3 A;  3O4X A;  1YX8 A;  1KWO B;  1RWY A;  1S26 D;  3O4Y A;  4M2P A;  1KQM B;  1TNQ A;  1SCM C;  2FOT A;  1Y0V H;  3CR4 X;  4JPZ B;  1M31 A;  1TUZ A;  1Y6W A;  4PHN A;  4YGB B;  5AEQ A;  3DF0 A;  4WQ3 A;  1BF5 A;  1BMO A;  1NX0 A;  2WC6 A;  2AUC A;  2GGZ A;  2HF5 A;  2I94 A;  1TCO B;  1OZS A;  1B1G A;  2FJY A;  3OX5 A;  3LCP C;  1K93 D;  2JNF A;  4F0Z B;  1WRZ A;  1IJ6 A;  1M46 A;  1B8C A;  5HLV A;  1VRK A;  1RK9 A;  1YUU A;  2COL B;  2Y5I A;  3D77 A;  5PAL A;  5KU1 A;  4I5N B;  1TOP A;  2OS8 C;  1F8H A;  1CDN A;  1JBA A;  1DQE A;  1KK7 Y;  1WLM A;  1MXE A;  1SBJ A;  4NDD A;  2I18 A;  1EL4 A;  5K89 A;  1TCF A;  4MLW A;  2KGR A;  1QAT A;  1CLB A;  1REC A;  4WQ2 A;  3AAJ A;  2LUC A;  2PAL A;  1YR5 A;  1FI5 A;  1PSB A;  4ZCV A;  1DF0 A;  4ZCU A;  3I5I B;  1XFV O;  2H61 A;  1WRL A;  3MSE B;  1V1G A;  3NXA A;  1B8L A;  2MRD A;  1NX2 A;  1RTP 1;  2QEO A;  4YGE B;  2M97 A;  5DKR A;  2JT0 A;  2JWW A;  3OGN A;  1CFF A;  1UHK A;  1ODB A;  4YI8 A;  4MN0 A;  1NCY A;  5D69 A;  1J55 A;  2JQ6 A;  3BFA A;  3KEV A;  1IGV A;  1U5I A;  2JNX A;  1OZO A;  2PSR A;  4XJK A;  3O6B A;  2JRF A;  3EK4 A;  3VRR A;  2KNE A;  2QEB A;  4P2Y B;  1M63 B;  4PAL A;  4GAO A;  4I5J A;  2GGM A;  1XVJ A;  2ZN9 A;  3D76 A;  2SCP A;  2ZFD A;  1MR8 A;  3WHT B;  3AAK A;  2QDI A;  1OW4 A;  2H61 C;  2WCK A;  3LK1 A;  1JFJ A;  1F54 A;  3TUY B;  2F2O A;  1SL8 A;  1IRJ A;  2FCE A;  2H8V A;  1DJH A;  2KLE A;  2P70 A;  3L47 A;  1AHR A;  1ZAC A;  5AAN A;  1C3Y A;  3QME A;  1J7O A;  1XFY O;  4CFR A;  3PFV A;  1SR6 C;  2KYF A;  5D7F A;  5JOL A;  1WRK A;  1LKJ A;  4OZD A;  1DJX A;  3PLF B;  5HKW A;  5CSI A;  3HX4 A;  3CZT X;  5CPV A;  2CXJ A;  2L5Y A;  3DZT A;  3K1E A;  1B4C A;  2KGB C;  4GGF A;  2B1U A;  4JWQ A;  2Y4Q A;  3N7H A;  4MBE A;  3D0Y A;  1PAL A;  1QLK A;  4IL1 A;  2NZ0 A;  3KO0 A;  1A03 A;  1PVB A;  3B86 A;  2M1U A;  1S36 A;  1Z4H A;  2KSP A;  2WCF A;  1QWV A;  3KPX A;  3CR2 A;  2RGI A;  5AER A;  1FBV A;  3R1V A;  2FCD A;  2O5G A;  1LVC D;  4JKT A;  3R72 A;  3JTD B;  2F3Z A;  1A2X A;  1OSA A;  2PQL A;  1UHN A;  3OHM B;  1S5G Z;  1T14 A;  1XFZ O;  5KTY A;  1CFC A;  5D3O A;  2LLS A;  2LVJ A;  1YRU B;  3SG2 A;  1QS7 A;  2ZRS A;  5HYD A;  1CFD A;  1IQ5 A;  2LNK A;  4MZL A;  1QAS A;  2KFG A;  3PN7 B;  3PN7 C;  4GGF C;  4NDC A;  5DKN A;  5GQQ C;  4QJ4 B;  1FF1 A;  3BUM B;  1BOC A;  3D0Y B;  1XFX O;  2WCM A;  4FTG A;  4P5O E;  4MZK A;  1KFU S;  1QIV A;  2ZRT A;  4MVF A;  1QVI Z;  2ISD A;  4ORC B;  2M1K B;  1EXR A;  3FE9 A;  1LS8 A;  3D73 A;  1W7I B;  3PAL A;  1TNP A;  2JPO A;  1TNX A;  1W9Z A;  1TWO A;  4CID A;  4L9M A;  1M45 A;  3LL8 B;  1J7R A;  1SMG A;  3VRO A;  1A4P A;  1BLQ A;  1CFP A;  2M29 A;  1N0Y A;  1CKK A;  2LMT A;  2M7L A;  3TDZ A;  1OQP A;  1N65 A;  2PMY A;  1YUS A;  2M3W A;  1N2D A;  4DRW A;  5I8N A;  1KWO C;  3RZS A;  3SIA A;  1DC1 A;  2LE9 B;  1S1E A;  1KQM C;  1C3Z A;  4MSP A;  3EKJ A;  3DVM A;  1DJI A;  2K8M B;  2NCO A;  3CTN A;  1Y1X A;  4ORA B;  3CZ2 A;  1MQ1 A;  3QRX A;  2LMU A;  4PT1 A;  3K21 A;  3B7A A;  1RRO A;  3OB2 B;  2ZN8 A;  2E6W A;  1YUR A;  3EVU A;  3CDN A;  1YVL A;  3SS5 A;  2LVI A;  1LXF C;  1R6P A;  1XK4 A;  1G4Y R;  1RFJ A;  3SG4 A;  2M0R A;  1UHJ A;  2HET A;  2KHN A;  4AQI A;  1CM1 A;  1Q80 A;  2KYC A;  1OOF A;  2NXQ A;  3I5I C;  1HQV A;  1QJT A;  3M0W A;  4UPG A;  1TNW A;  2JU0 A;  4HRH A;  1GJY A;  3EK8 A;  1A29 A;  3NHT A;  4CPV A;  2LVK A;  5HL1 A;  1UP5 A;  1DGU A;  4C0J A;  3DYE A;  3V2L A;  2CBL A;  3FIA A;  1RJV A;  5I2O A;  4GGN A;  2FJU B;  1IWQ A;  1GGZ A;  1QIW A;  1SYM A;  2OTG B;  1ZUZ A;  4QJ5 B;  2WC8 A;  1CTR A;  1SSE B;  3EG5 B;  1FI6 A;  3GK4 X;  1TRF A;  2M9G A;  3HCM A;  1YTZ C;  4TNC A;  1H4B A;  1SPY A;  3KF9 A;  3CGA A;  1DVI A;  2LLU A;  3CS1 A;  1XK4 C;  3RM1 A;  2Y1M A;  5B8I B;  4FQO A;  2KAV A;  3IQO A;  1UHH A;  4YGC B;  1AUI B;  3ICB A;  3R1P A;  1K90 D;  3GK1 A;  1LIN A;  3NHI A;  2M7N A;  2LHL A;  4HRE E;  1L2O B;  3FE8 A;  3JVT B;  3JVT C;  2Q91 A;  4DUQ A;  2BE6 A;  2EHB A;  3TUY C;  3TDU A;  1DJG A;  2KPH A;  2JUL A;  1YUT A;  3NGV A;  5AXI A;  3VRP A;  3SS3 A;  4I5L B;  1ORG A;  2K60 A;  1TIZ A;  2JZI A;  2OPO A;  3OP0 A;  4M2Q A;  5DIC A;  1DJZ A;  1K96 A;  1OOI X;  4INX A;  2QEV A;  1CMG A;  1AJ5 A;  2E30 A;  1CDP A;  1QLS A;  2F33 A;  2I2R E;  2WC5 A;  1TTX A;  2MHH A;  2YGU A;  1IQ3 A;  1ZMZ A;  1WLZ A;  2L5X B;  3D75 A;  1A75 B;  2L0P A;  1WY9 A;  2BNX A;  3S0D A;  1DMO A;  1S3P A;  1PVA A;  2L2C A;  2O60 A;  1DT7 B;  4PHK A;  1G8I A;  2JC2 A;  1OMD A;  3GOF A;  2KFF A;  1SW8 A;  4OKH A;  3CLN A;  1KFX L;  2LUX A;  1JF2 A;  2WCE A;  1R2U A;  1DTL A;  1K8U A;  2CCM A;  5F6T A;  3S0G A;  1IG5 A;  3I5H B;  2GTE A;  1KK8 B;  4GNK B;  4A4B A;  1FW4 A;  3RLZ A;  1V1F A;  1QTX A;  4OV2 A;  2DOQ A;  3JTD C;  3SJS A;  2EC6 B;  1JUO A;  1OE9 B;  2F2P A;  3VRN A;  1QXP A;  1SCV A;  2LV7 A;  3FWC A;  4N1F A;  4PCW A;  1CB1 A;  2PAS A;  5I2Q A;  1WDC B;  2WCJ A;  3EVV A;  4GFT A;  1K9K A;  4JQ0 D;  1L7Z A;  1QX2 A;  5FYX A;  1S6J A;  1IJ5 A;  1MXL C;  1NPQ A;  3PJI A;  2I7A A;  5AFP A;  1BJF A;  2LC5 A;  4NDB A;  5DKQ A;  1S6I A;  2KAX A;  3DVE A;  1JFK A;  1QX7 A;  1D1O A;  4BY5 A;  2R2I A;  1JSA A;  4OCI A;  2HPS A;  2WND A;  3C1V A;  3B6X A;  1YRT B;  5HKY A;  3CZ0 A;  5I2L A;  2BCX A;  3S0A A;  1K95 A;  4PDZ A;  1KQV A;  3FWB A;  3SS4 A;  2BEC A;  2BL0 B;  1QV0 A;  2BL0 C;  3SG5 A;  1B7T Z;  1CDM A;  2MLE C;  3LK0 A;  2LVV A;  3AKA A;  3OBV A;  4QJ3 B;  3WXA A;  4D1E A;  2NCP A;  3I5G B;  1EJ3 A;  1LA0 A;  3NSI A;  3CAB A;  1C7W A;  4YGA A;  2H2K A;  2KI4 B;  2M49 B;  1IIO A;  1CDL A;  1MF8 B;  2L4I A;  2F3Y A;  3VRQ A;  2LP3 A;  3OX6 A;  1F55 A;  4R1E A;  1Y1U A;  3LLE A;  3EK7 A; 
#chains in the Genus database with same CATH homology
 3FE6 A;  3S0B A;  1OOF A;  2QDI A;  3DXL A;  4JD9 A;  1OW4 A;  3S0F A;  2WCK A;  3B88 A;  2H8V A;  3NHT A;  2P70 A;  3L47 A;  4F7F A;  3DYE A;  3QME A;  3V2L A;  3BFB A;  3BFH A;  1C3Y A;  4OZD A;  3L4L A;  3Q8I A;  3K1E A;  3BJH A;  3DZT A;  2QEH A;  3N7H A;  1OOH A;  3R1O A;  5EL2 A;  3D78 A;  3B86 A;  3R1P A;  3NHI A;  1QWV A;  1TUJ A;  3FE8 A;  3R1V A;  2KPH A;  3R72 A;  3NGV A;  2PQL A;  3CZ1 A;  1T14 A;  1ORG A;  3D74 A;  5DIC A;  1OOI X;  4INX A;  2QEV A;  1XFR A;  1OOG A;  2WCL A;  3CYZ A;  2WC5 A;  3S0E A;  3L4A A;  3VB1 A;  2WCM A;  3D75 A;  3S0D A;  2L2C A;  2ERB A;  2P71 A;  4INW A;  3FE9 A;  3S0G A;  1P28 A;  1LS8 A;  2FJY A;  2GTE A;  3D73 A;  2JPO A;  1TWO A;  4FQT A;  3D77 A;  1DQE A;  2WCJ A;  3DY9 A;  3PJI A;  3RZS A;  1C3Z A;  2QEO A;  3B6X A;  3CZ0 A;  3CZ2 A;  3OGN A;  3S0A A;  4PT1 A;  3B7A A;  2WCH A;  3BFA A;  3CDN A;  3CAB A;  1GM0 A;  3B87 A;  2QEB A;  2WC6 A;  3D76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...