3DXLA

Crystal structure of aed7 from aedes aegypti
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
303
structure length
299
Chain Sequence
MGPFDPEEMLFIFTRCMEDNLEDGANRLPMLAKWKEWINEPVDSPATQCFGKCVLVRTGLYDPVAQKFDASVIQEQFKAYPSLGEKSKVEAYANAVKQLPSTNNDCAAVFKAYDPVHKAHKDTSKNLFHGNKELTKGLYEKLGKDIRQKKQSYFEFCENKYYPAGSDKRQQLCQIRQYTVLDDALFKEHTDCVMKGIRYITKDNQLDVEEVKRDFKLVNKDTKALEEVLNDCKSKEPSNAKEKSWHYYKCLVESSVKDDFKEAFDYREVRSQIYAFNLPKNQAYSKPAVMEIDGKQCPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multifunctionality and mechanism of ligand binding in a mosquito antiinflammatory protein
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Odorant-binding protein
molecule keywords Allergen Aed a 2
total genus 117
structure length 299
sequence length 303
ec nomenclature
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3dxlA01
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3dxlA02
3FE8A 2P70A 3CDNA 1C3YA 2WC5A 3CYZA 2WC6A 2FJYA 1OOHA 1P28A 2PQLA 3L47A 3DY9A 3DYEA 3K1EA 3L4LA 3D75A 4INWA 3D76A 1ORGA 3CABA 2WCKA 2L2CA 3NHTA 2WCHA 2ERBA 2JPOA 1GM0A 3BFAA 3CZ0A 3CZ2A 3Q8IA 3BFHA 3R1OA 4OZDA 4FQTA 1OOFA 3S0FA 3BJHA 3N7HA 2QDIA 2QEOA 4JD9A 3S0AA 3D78A 2GTEA 3R1VA 3B6XA 3FE6A 1XFRA 3S0EA 3QMEA 3OGNA 3CZ1A 5EL2A 4INXA 5DICA 3RZSA 3B86A 2WCJA 1C3ZA 1OW4A 3DXLA 3VB1A 3S0DA 1OOGA 1TUJA 3BFBA 1OOIX 3D74A 3D77A 3S0BA 3R1PA 2H8VA 4F7FA 2KPHA 2P71A 3D73A 3FE9A 4PT1A 3B88A 1T14A 2QEVA 3V2LA 3R72A 3B7AA 3L4AA 3NHIA 3DZTA 1LS8A 3NGVA 1TWOA 2WCLA 3PJIA 3S0GA 2QEBA 1DQEA 2WCMA 1QWVA 2QEHA 3B87A
chains in the Genus database with same CATH superfamily
3OBVA 3OX5A 5F6TA 1PULA 2MLEC 2KHNA 1ODBA 2P70A 1FF1A 1RROA 1YVHA 1JUOA 2LUXA 3PATA 1ALWA 2WC8A 4N1GA 1N2DA 1OZOA 1MWNA 3OHMB 4M2QA 1J1DA 1QIVA 2PASA 3OB1B 1XFVO 2Q91A 4JKTA 3SG2A 1YR5A 3SG4A 1KWOC 3EVVA 1OOHA 3BUOB 3DF0A 5KSZA 1OSAA 4MRXA 1QS7A 4USLA 2F2OA 2P6BB 1DJYA 1DVIA 1XFXO 2JRFA 2KOTA 2Y5IA 1XO5A 3SS4A 2PQLA 1PVBA 1CNPA 1FI6A 2O60A 1M46A 2K7OA 3BUWB 2HF5A 1S1EA 3JVTB 2A4JA 1M45A 2K8MB 3D76A 1M31A 3CGAA 1R6PA 3EVRA 5TNCA 1AUIB 4HSZA 2WNDA 3NHTA 2M8UA 2LVVA 3LCPC 2ERBA 3VRQA 2JXCA 2LP2A 2ISDA 1B8LA 1J1EA 3UNWA 2L51A 2LHLA 5JOLA 1W7IB 4AQJA 1OMDA 3I5HB 1KFXS 1CMGA 2NCPA 1JFKA 1MHOA 1RJVA 1RTP1 1S5GY 1SL8A 2KQYA 1NYAA 3SG7A 1BMOA 4NDDA 2KLDA 3KO0A 2LMVA 1XFUO 1W7JB 4JPZB 3VGOA 5KTYA 4OCIA 5HYDA 1SNLA 1QJTA 2FJUB 3N7HA 4OR9B 1KWOB 1SPYA 1TN4A 4NDCA 1JWDA 1U5IA 2MRDA 1MXEA 4I5NB 4NQGA 1K2HA 4YGEB 4XJKB 1OE9B 3ZWHA 1XFYO 1S26D 1S6CA 1HT9A 2WORA 1J7QA 1B8RA 2KI6C 2Q4UA 4CPVA 4F0ZB 3QMEA 2BBMA 3OGNA 4CFRA 3CZ1A 3AKBA 5ER4X 2R2IA 1CLMA 1GJYA 4ORCB 1CFPA 1EL4A 1W9ZA 2WCJA 4P2YB 2K0JA 2K7BA 1EXRA 3SJSA 2KBIA 1J7OA 1MF8B 1H4BA 1OOGA 3LK1A 2MBXA 4AQIA 1SL7A 1K8UA 2KAYA 3BFBA 1OOIX 1NCZA 3EVUA 3KEVA 1PALA 1SMGA 2NZ0A 3R1PA 1JC2A 4PE4A 3AAJA 1NCXA 1OMRA 3D73A 2WOSA 1TCOB 1DJIA 1K9PA 1RWYA 2NXQA 2EHBA 5JJGA 1KK7Z 1T14A 1B8CA 4MBEA 4MN0A 2BKIB 2KI4B 1CFFA 2CCMA 4ZCUA 5I94A 1LS8A 2BE4A 3FWBA 1MQ1A 2M1UA 2F8PA 2BBNA 3ZNIA 1LXFC 4XYNA 1E8AA 3BUMB 4ICBA 2KDHA 5I2OA 1IWQA 3BOWB 3PJIA 4IJ7A 3WHTB 1DQEA 1GGZA 4M2OA 3OB2B 3CLNA 1DGUA 1FBVA 1QWVA 2OS8C 2Y1MA 3DF0B 4DRWA 1BF5A 2OPOA 1BODA 3PM8A 1UHIA 4D1EA 2AMIA 1G8IA 3KHEA 1XK4A 3CDNA 2WC5A 2ZFDA 4DCKA 1SCVA 4CLNA 5HLOA 1KFUL 2WC6A 4PCWA 1ZOTB 1SR6B 4N1FA 2WCFA 2FJYA 2ZRSA 1CMFA 1OQPA 1PSBA 5HKWA 4QJ3B 3NSKA 2EGDA 3CWGA 5I8NA 1A03A 2WCBA 4PALA 2NLNA 3L47A 3DY9A 2AUCA 1S5GZ 4PE1A 3L4LA 2KI4C 3O78A 1BU3A 1OMVA 1MUXA 2PALA 4PE7A 4P5OE 1KSOA 3BXKA 2BAPA 1J7PA 2JNXA 3I5GC 3CABA 2JT0A 2B1UA 2WCKA 1U5IB 2L2CA 2G9BA 3DVJA 1DF0B 4CIDA 3EKHA 2KLEA 1YUTA 2MA2A 2LVIA 2JPOA 1QLSA 2LC5A 2BECA 2MLFC 2YGUA 1AK8A 2D8NA 1BT6A 4MSPA 4R1EA 1F54A 1GM0A 1AJ4A 1QX2A 2KYCA 3O4YA 3CZ2A 4MRYA 3CR2A 2F2PA 3Q8IA 1JSAA 3BFHA 1SCMC 3PALA 2HPSA 2EC6C 4FTGA 1K94A 3CR5X 4HRGA 2COLB 3BOWA 3GK4X 1PK0D 1IGVA 2Y1NA 4MZLA 1SK6D 1SR6C 1C7WA 1CFDA 1KSMA 1QXPA 2K2FA 2KFHA 2ZN8A 3IQOA 5PALA 1TRFA 1YRTB 3VROA 2ZRTA 3PM2A 1G33A 2JXLA 2GTEA 3R1VA 1DELA 5AXIA 4HREE 1WRKA 3VRRA 2OS8B 4Q04A 4BY5A 1CLBA 2LHIA 3TDZA 3FS7A 2I18A 4ORBB 3EK7A 1XFRA 3S0EA 1M63B 4AOMA 1BLQA 1B7TZ 1JFJA 2JT3A 1LA3A 1KQMB 2JZIA 2KNEA 2QPTA 3FIAA 1OZSA 2RGIA 3I5GB 3ICBA 1F71A 1KK7Y 1TTXA 3IVTA 1UHJA 2JC2A 2LAPA 3O4XA 3SS3A 3DXLA 2LV7A 1QV1A 3NSOA 3CTNA 1Y1AA 1G4YR 1K90D 5J3XA 1PRWA 3D77A 1R2UA 4GUKA 2EC6B 3E3RA 2F3YA 1DJWA 1CM1A 2IS9A 4GGFA 3I5IB 1DGVA 1A4PA 1CB1A 1B1GA 1CLLA 3TDUA 1Y1XA 3BQ3A 1GQMA 1YTZC 3SG5A 3B88A 3GOFA 2ZNEA 2QEVA 3HCMA 1TNPA 3TUYB 2LCPA 1DEKA 1M39A 4PHNA 3TS5C 3L4AA 3NHIA 1FI5A 1RECA 5FYXA 2M7NA 3DD4A 1SKTA 2L5XB 2ZN9A 1UHKA 2K61A 4TNCA 1J55A 1L2OB 1TWOA 3TZ1A 2WCLA 1VRKA 3LL8B 2KYFA 1NSHA 2WCMA 3DVEA 3I5HC 1WRLA 1B9AA 1J7RA 1XFZO 1F4OA 3FE8A 1NWDA 3IF7A 1NCYA 3RM1A 2I7AA 1F8HA 5FI6A 1IIOA 1B7TY 2PSRA 1LKJA 3M0WA 4PHMA 5D7FA 5D3OA 3CYZA 3RLZA 2DOQA 1SRAA 2LLSA 1H8BA 1EG3A 4BY4A 1TCFA 4DS7A 1XFWO 1HQVA 4M2PA 1QX5B 2H61A 3O6BA 2BCXA 1CFCA 1XYDA 2BCAA 1YUSA 2V53A 1A29A 2WCEA 1Q80A 2LM5A 3DYEA 3K1EA 3LLEA 3TDIA 2KSPA 3EKJA 5K89A 3D75A 2JULA 4WQ2A 2L4HA 4I5JA 3VRPA 1D1OA 5D69A 4L9MA 3GK2A 4YGCB 4OVNF 1JF0A 1L7ZA 3NSIA 5FI7A 4ETOA 1DTLA 1ZUZA 2JPTA 3OX6A 1BR4B 2E6WA 2H2KA 1WLZA 2OTGB 1NUBA 1K9UA 2WCHA 3AAKA 3AKAA 1RK9A 2M29A 4OV2A 3SIBA 1B4CA 2JQ6A 1DC1A 4I5LB 1TIZA 5CSNA 1TOPA 1KFUS 2LMUA 1CKKA 2KFFA 3BFAA 1CDNA 1QTXA 2M0RA 2M49B 3CZ0A 2CTNA 4MVFA 1B47A 1DJZA 3TUYC 5CSIA 1WLMA 1XK4C 1Z4HA 2AAOA 2GGZA 3D0YA 5IBWA 4E68A 4JQ0D 1XVJA 2BCBA 3R1OA 2CXJA 3BUXB 2BNXA 2L98A 2QACA 1OOFA 3PN7B 4FQTA 4N5XA 3S0FA 2BE6A 4ORAB 1QVIY 2JU0A 2TN4A 1QX7A 1YX7A 1PVAA 3KPXA 2QDIA 2L4IA 1MR8A 2HQWA 1UHNA 3HX4A 2QEOA 3JTDB 5DKRA 3S0AA 1F55A 1NX1A 4IL1A 3D78A 5G08A 3UO9A 1QATA 3F45A 2LMTA 4C0JA 4C0LA 1LVCD 1N0YA 1EG4A 3EK4A 4MZJA 4PDZA 4MEWA 3FE6A 3NXAA 2GGMA 1S3PA 1Y0VH 1QLKA 2LUCA 2CNPA 1NPQA 2BL0C 4GGNA 1MXLC 1CTRA 1UUSA 3EK8A 3PFVA 2L2EA 2OTGC 4C0KA 1S36A 3NSLA 3RZSA 1FPWA 2L50A 2G2BA 1OW4A 1DF0A 2K60A 5AEQA 1AVSA 1YRUB 5AERA 1S6IA 1YVLA 1TUJA 2LVKA 5CPVA 3WXAA 4MLWA 2LP3A 1F70A 3D74A 1WRZA 2PVBA 1NP8A 3S0BA 5CSJA 1K95A 2H8VA 2M97A 3WHUB 1OOJA 1TUZA 4WRIA 1DJXA 5DKQA 4F7FA 1JBAA 2P71A 4MZKA 4PT1A 2PRUA 1NIWA 4GPLB 4I5KA 1SYMA 4YGBB 1SCMB 3JTDC 4GBAA 2KGBC 4PHKA 1ZMZA 3BYAA 4GFTA 1CDMA 1C7VA 3I5FC 1IG5A 2KGRA 2JT8A 2H61C 4YI8A 2SCPA 3GK1A 2HETA 4YRUA 4YI9A 1SY9A 4OKHA 4GGFC 2KQ6A 1DJGA 2M1KB 3CR4X 2BL0B 5HKYA 4DUQA 1SBJA 1UHHA 1V1GA 1FW4A 2GV5A 3EG5B 4YGDB 2L5YA 2I94A 2QEHA 3B87A 4A4CA 3FWCA 1CDPA 2PYQA 5I2QA 1KQVA 3SS5A 1BR1B 2KBMA 3VRNA 1NX2A 2LNKA 1TNXA 4XJKA 5HL1A 1KQMC 1C3YA 1K93D 2VRGA 2HQ8A 5AANA 1KFXL 5DKNA 2CBLA 2F33A 1AP4A 2KI6D 1UWOA 1IH0A 5ER5A 2FCEA 1NX0A 5AFPA 2LLUA 1P28A 3IQQA 2JTZA 2NCOA 1KCYA 2ZNDA 2M7LA 3PLFB 2FOTA 1KK8C 1ZACA 1WDCC 2JNFA 5HKZA 2E30A 2MHHA 1A75B 4INWA 3I5FB 1ORGA 2KFGA 1QVIZ 2O5GA 1ZFSA 2ZKMX 1QV0A 1DT7B 1WY9A 4HRHA 3TS5B 1PSRA 4U8DA 1IRJA 1JF2A 1N65A 1NX3A 2LVJA 3K21A 1RFJA 1Z2CB 2KAXA 1BG1A 1IQ5A 1UP5A 2CT9A 1UURA 3PSRA 2KAVA 1K96A 3D0YB 1CM4A 1EJ3A 4OZDA 2K2AA 3I5IC 3SIAA 4KYNA 2JWWA 3MSEB 1XA5A 4FQOA 3A4UB 3BJHA 5KU1A 1GGWA 4JD9A 1V1FA 1BJFA 1F4QA 3H4SE 4UPGA 1X02A 3BUNB 1SL9A 4PE0A 3O2PA 1IQ3A 3B6XA 1Y6WA 1QIWA 3CZTX 1L2OC 5B8IB 1BOCA 1LA0A 1WDCB 3KF9A 3LK0A 4QJ4B 3D10A 4YBHB 1K9KA 2MJWB 1A2XA 1QASA 1YUUA 4DIRA 3CS1A 1YX8A 2K7CA 4JWQA 1Y1UA 2LANA 4INXA 5EL2A 5BPJA 4NDBA 4WQ3A 5DICA 1SSEB 3B86A 4YGAA 1C3ZA 2I2RE 4GNKB 3VB1A 3S0DA 1SW8A 1AJ5A 2LLTA 1KK8B 1AHRA 1DJHA 2Y4QA 2SASA 4PHJA 2LE9B 1TNWA 1YURA 2F3ZA 1LINA 3SG6A 1IJ5A 2KPHA 3FE9A 3QRXA 4A4BA 2FCDA 1EH2A 2JOJA 5FI2A 3OP0A 1IKUA 1C07A 3DVKA 3V2LA 2JTTA 3DVMA 2K7DA 3B7AA 3R72A 3JVTC 5I2LA 3DZTA 3PN7C 2M3WA 2L0PA 3A8RA 4GAOA 2PMYA 3NGVA 3SG3A 3C1VA 2M9GA 4CFQA 1S6JA 4ZCVA 1DMOA 1IJ6A 3S0GA 3WNXB 4QJ5B 2QEBA 5HLVA 1A75A 2BKHB 1ALVA 5CSFA 5GQQC 2MAZA 1CDLA 1TNQA
chains in the Genus database with same CATH topology
3FE8A 2P70A 3CDNA 1C3YA 2WC5A 3CYZA 2WC6A 2FJYA 1OOHA 1P28A 2PQLA 3L47A 3DY9A 3DYEA 3K1EA 3L4LA 3D75A 4INWA 3D76A 1ORGA 3CABA 2WCKA 2L2CA 3NHTA 2WCHA 2ERBA 2JPOA 1GM0A 3BFAA 3CZ0A 3CZ2A 3Q8IA 3BFHA 3R1OA 4OZDA 4FQTA 1OOFA 3S0FA 3BJHA 3N7HA 2QDIA 2QEOA 4JD9A 3S0AA 3D78A 2GTEA 3R1VA 3B6XA 3FE6A 1XFRA 3S0EA 3QMEA 3OGNA 3CZ1A 5EL2A 4INXA 5DICA 3RZSA 3B86A 2WCJA 1C3ZA 1OW4A 3DXLA 3VB1A 3S0DA 1OOGA 1TUJA 3BFBA 1OOIX 3D74A 3D77A 3S0BA 3R1PA 2H8VA 4F7FA 2KPHA 2P71A 3D73A 3FE9A 4PT1A 3B88A 1T14A 2QEVA 3V2LA 3R72A 3B7AA 3L4AA 3NHIA 3DZTA 1LS8A 3NGVA 1TWOA 2WCLA 3PJIA 3S0GA 2QEBA 1DQEA 2WCMA 1QWVA 2QEHA 3B87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FE8 A;  2P70 A;  3CDN A;  1C3Y A;  2WC5 A;  3CYZ A;  2WC6 A;  2FJY A;  1OOH A;  1P28 A;  2PQL A;  3L47 A;  3DY9 A;  3DYE A;  3K1E A;  3L4L A;  3D75 A;  4INW A;  3D76 A;  1ORG A;  3CAB A;  2WCK A;  2L2C A;  3NHT A;  2WCH A;  2ERB A;  2JPO A;  1GM0 A;  3BFA A;  3CZ0 A;  3CZ2 A;  3Q8I A;  3BFH A;  3R1O A;  4OZD A;  4FQT A;  1OOF A;  3S0F A;  3BJH A;  3N7H A;  2QDI A;  2QEO A;  4JD9 A;  3S0A A;  3D78 A;  2GTE A;  3R1V A;  3B6X A;  3FE6 A;  1XFR A;  3S0E A;  3QME A;  3OGN A;  3CZ1 A;  5EL2 A;  4INX A;  5DIC A;  3RZS A;  3B86 A;  2WCJ A;  1C3Z A;  1OW4 A;  3DXL A;  3VB1 A;  3S0D A;  1OOG A;  1TUJ A;  3BFB A;  1OOI X;  3D74 A;  3D77 A;  3S0B A;  3R1P A;  2H8V A;  4F7F A;  2KPH A;  2P71 A;  3D73 A;  3FE9 A;  4PT1 A;  3B88 A;  1T14 A;  2QEV A;  3V2L A;  3R72 A;  3B7A A;  3L4A A;  3NHI A;  3DZT A;  1LS8 A;  3NGV A;  1TWO A;  2WCL A;  3PJI A;  3S0G A;  2QEB A;  1DQE A;  2WCM A;  1QWV A;  2QEH A;  3B87 A; 
#chains in the Genus database with same CATH topology
 3OBV A;  3OX5 A;  5F6T A;  1PUL A;  2MLE C;  2KHN A;  1ODB A;  2P70 A;  1FF1 A;  1RRO A;  1YVH A;  1JUO A;  2LUX A;  3PAT A;  1ALW A;  2WC8 A;  4N1G A;  1N2D A;  1OZO A;  1MWN A;  3OHM B;  4M2Q A;  1J1D A;  1QIV A;  2PAS A;  3OB1 B;  1XFV O;  2Q91 A;  4JKT A;  3SG2 A;  1YR5 A;  3SG4 A;  1KWO C;  3EVV A;  1OOH A;  3BUO B;  3DF0 A;  5KSZ A;  1OSA A;  4MRX A;  1QS7 A;  4USL A;  2F2O A;  2P6B B;  1DJY A;  1DVI A;  1XFX O;  2JRF A;  2KOT A;  2Y5I A;  1XO5 A;  3SS4 A;  2PQL A;  1PVB A;  1CNP A;  1FI6 A;  2O60 A;  1M46 A;  2K7O A;  3BUW B;  2HF5 A;  1S1E A;  3JVT B;  2A4J A;  1M45 A;  2K8M B;  3D76 A;  1M31 A;  3CGA A;  1R6P A;  3EVR A;  5TNC A;  1AUI B;  4HSZ A;  2WND A;  3NHT A;  2M8U A;  2LVV A;  3LCP C;  2ERB A;  3VRQ A;  2JXC A;  2LP2 A;  2ISD A;  1B8L A;  1J1E A;  3UNW A;  2L51 A;  2LHL A;  5JOL A;  1W7I B;  4AQJ A;  1OMD A;  3I5H B;  1KFX S;  1CMG A;  2NCP A;  1JFK A;  1MHO A;  1RJV A;  1RTP 1;  1S5G Y;  1SL8 A;  2KQY A;  1NYA A;  3SG7 A;  1BMO A;  4NDD A;  2KLD A;  3KO0 A;  2LMV A;  1XFU O;  1W7J B;  4JPZ B;  3VGO A;  5KTY A;  4OCI A;  5HYD A;  1SNL A;  1QJT A;  2FJU B;  3N7H A;  4OR9 B;  1KWO B;  1SPY A;  1TN4 A;  4NDC A;  1JWD A;  1U5I A;  2MRD A;  1MXE A;  4I5N B;  4NQG A;  1K2H A;  4YGE B;  4XJK B;  1OE9 B;  3ZWH A;  1XFY O;  1S26 D;  1S6C A;  1HT9 A;  2WOR A;  1J7Q A;  1B8R A;  2KI6 C;  2Q4U A;  4CPV A;  4F0Z B;  3QME A;  2BBM A;  3OGN A;  4CFR A;  3CZ1 A;  3AKB A;  5ER4 X;  2R2I A;  1CLM A;  1GJY A;  4ORC B;  1CFP A;  1EL4 A;  1W9Z A;  2WCJ A;  4P2Y B;  2K0J A;  2K7B A;  1EXR A;  3SJS A;  2KBI A;  1J7O A;  1MF8 B;  1H4B A;  1OOG A;  3LK1 A;  2MBX A;  4AQI A;  1SL7 A;  1K8U A;  2KAY A;  3BFB A;  1OOI X;  1NCZ A;  3EVU A;  3KEV A;  1PAL A;  1SMG A;  2NZ0 A;  3R1P A;  1JC2 A;  4PE4 A;  3AAJ A;  1NCX A;  1OMR A;  3D73 A;  2WOS A;  1TCO B;  1DJI A;  1K9P A;  1RWY A;  2NXQ A;  2EHB A;  5JJG A;  1KK7 Z;  1T14 A;  1B8C A;  4MBE A;  4MN0 A;  2BKI B;  2KI4 B;  1CFF A;  2CCM A;  4ZCU A;  5I94 A;  1LS8 A;  2BE4 A;  3FWB A;  1MQ1 A;  2M1U A;  2F8P A;  2BBN A;  3ZNI A;  1LXF C;  4XYN A;  1E8A A;  3BUM B;  4ICB A;  2KDH A;  5I2O A;  1IWQ A;  3BOW B;  3PJI A;  4IJ7 A;  3WHT B;  1DQE A;  1GGZ A;  4M2O A;  3OB2 B;  3CLN A;  1DGU A;  1FBV A;  1QWV A;  2OS8 C;  2Y1M A;  3DF0 B;  4DRW A;  1BF5 A;  2OPO A;  1BOD A;  3PM8 A;  1UHI A;  4D1E A;  2AMI A;  1G8I A;  3KHE A;  1XK4 A;  3CDN A;  2WC5 A;  2ZFD A;  4DCK A;  1SCV A;  4CLN A;  5HLO A;  1KFU L;  2WC6 A;  4PCW A;  1ZOT B;  1SR6 B;  4N1F A;  2WCF A;  2FJY A;  2ZRS A;  1CMF A;  1OQP A;  1PSB A;  5HKW A;  4QJ3 B;  3NSK A;  2EGD A;  3CWG A;  5I8N A;  1A03 A;  2WCB A;  4PAL A;  2NLN A;  3L47 A;  3DY9 A;  2AUC A;  1S5G Z;  4PE1 A;  3L4L A;  2KI4 C;  3O78 A;  1BU3 A;  1OMV A;  1MUX A;  2PAL A;  4PE7 A;  4P5O E;  1KSO A;  3BXK A;  2BAP A;  1J7P A;  2JNX A;  3I5G C;  3CAB A;  2JT0 A;  2B1U A;  2WCK A;  1U5I B;  2L2C A;  2G9B A;  3DVJ A;  1DF0 B;  4CID A;  3EKH A;  2KLE A;  1YUT A;  2MA2 A;  2LVI A;  2JPO A;  1QLS A;  2LC5 A;  2BEC A;  2MLF C;  2YGU A;  1AK8 A;  2D8N A;  1BT6 A;  4MSP A;  4R1E A;  1F54 A;  1GM0 A;  1AJ4 A;  1QX2 A;  2KYC A;  3O4Y A;  3CZ2 A;  4MRY A;  3CR2 A;  2F2P A;  3Q8I A;  1JSA A;  3BFH A;  1SCM C;  3PAL A;  2HPS A;  2EC6 C;  4FTG A;  1K94 A;  3CR5 X;  4HRG A;  2COL B;  3BOW A;  3GK4 X;  1PK0 D;  1IGV A;  2Y1N A;  4MZL A;  1SK6 D;  1SR6 C;  1C7W A;  1CFD A;  1KSM A;  1QXP A;  2K2F A;  2KFH A;  2ZN8 A;  3IQO A;  5PAL A;  1TRF A;  1YRT B;  3VRO A;  2ZRT A;  3PM2 A;  1G33 A;  2JXL A;  2GTE A;  3R1V A;  1DEL A;  5AXI A;  4HRE E;  1WRK A;  3VRR A;  2OS8 B;  4Q04 A;  4BY5 A;  1CLB A;  2LHI A;  3TDZ A;  3FS7 A;  2I18 A;  4ORB B;  3EK7 A;  1XFR A;  3S0E A;  1M63 B;  4AOM A;  1BLQ A;  1B7T Z;  1JFJ A;  2JT3 A;  1LA3 A;  1KQM B;  2JZI A;  2KNE A;  2QPT A;  3FIA A;  1OZS A;  2RGI A;  3I5G B;  3ICB A;  1F71 A;  1KK7 Y;  1TTX A;  3IVT A;  1UHJ A;  2JC2 A;  2LAP A;  3O4X A;  3SS3 A;  3DXL A;  2LV7 A;  1QV1 A;  3NSO A;  3CTN A;  1Y1A A;  1G4Y R;  1K90 D;  5J3X A;  1PRW A;  3D77 A;  1R2U A;  4GUK A;  2EC6 B;  3E3R A;  2F3Y A;  1DJW A;  1CM1 A;  2IS9 A;  4GGF A;  3I5I B;  1DGV A;  1A4P A;  1CB1 A;  1B1G A;  1CLL A;  3TDU A;  1Y1X A;  3BQ3 A;  1GQM A;  1YTZ C;  3SG5 A;  3B88 A;  3GOF A;  2ZNE A;  2QEV A;  3HCM A;  1TNP A;  3TUY B;  2LCP A;  1DEK A;  1M39 A;  4PHN A;  3TS5 C;  3L4A A;  3NHI A;  1FI5 A;  1REC A;  5FYX A;  2M7N A;  3DD4 A;  1SKT A;  2L5X B;  2ZN9 A;  1UHK A;  2K61 A;  4TNC A;  1J55 A;  1L2O B;  1TWO A;  3TZ1 A;  2WCL A;  1VRK A;  3LL8 B;  2KYF A;  1NSH A;  2WCM A;  3DVE A;  3I5H C;  1WRL A;  1B9A A;  1J7R A;  1XFZ O;  1F4O A;  3FE8 A;  1NWD A;  3IF7 A;  1NCY A;  3RM1 A;  2I7A A;  1F8H A;  5FI6 A;  1IIO A;  1B7T Y;  2PSR A;  1LKJ A;  3M0W A;  4PHM A;  5D7F A;  5D3O A;  3CYZ A;  3RLZ A;  2DOQ A;  1SRA A;  2LLS A;  1H8B A;  1EG3 A;  4BY4 A;  1TCF A;  4DS7 A;  1XFW O;  1HQV A;  4M2P A;  1QX5 B;  2H61 A;  3O6B A;  2BCX A;  1CFC A;  1XYD A;  2BCA A;  1YUS A;  2V53 A;  1A29 A;  2WCE A;  1Q80 A;  2LM5 A;  3DYE A;  3K1E A;  3LLE A;  3TDI A;  2KSP A;  3EKJ A;  5K89 A;  3D75 A;  2JUL A;  4WQ2 A;  2L4H A;  4I5J A;  3VRP A;  1D1O A;  5D69 A;  4L9M A;  3GK2 A;  4YGC B;  4OVN F;  1JF0 A;  1L7Z A;  3NSI A;  5FI7 A;  4ETO A;  1DTL A;  1ZUZ A;  2JPT A;  3OX6 A;  1BR4 B;  2E6W A;  2H2K A;  1WLZ A;  2OTG B;  1NUB A;  1K9U A;  2WCH A;  3AAK A;  3AKA A;  1RK9 A;  2M29 A;  4OV2 A;  3SIB A;  1B4C A;  2JQ6 A;  1DC1 A;  4I5L B;  1TIZ A;  5CSN A;  1TOP A;  1KFU S;  2LMU A;  1CKK A;  2KFF A;  3BFA A;  1CDN A;  1QTX A;  2M0R A;  2M49 B;  3CZ0 A;  2CTN A;  4MVF A;  1B47 A;  1DJZ A;  3TUY C;  5CSI A;  1WLM A;  1XK4 C;  1Z4H A;  2AAO A;  2GGZ A;  3D0Y A;  5IBW A;  4E68 A;  4JQ0 D;  1XVJ A;  2BCB A;  3R1O A;  2CXJ A;  3BUX B;  2BNX A;  2L98 A;  2QAC A;  1OOF A;  3PN7 B;  4FQT A;  4N5X A;  3S0F A;  2BE6 A;  4ORA B;  1QVI Y;  2JU0 A;  2TN4 A;  1QX7 A;  1YX7 A;  1PVA A;  3KPX A;  2QDI A;  2L4I A;  1MR8 A;  2HQW A;  1UHN A;  3HX4 A;  2QEO A;  3JTD B;  5DKR A;  3S0A A;  1F55 A;  1NX1 A;  4IL1 A;  3D78 A;  5G08 A;  3UO9 A;  1QAT A;  3F45 A;  2LMT A;  4C0J A;  4C0L A;  1LVC D;  1N0Y A;  1EG4 A;  3EK4 A;  4MZJ A;  4PDZ A;  4MEW A;  3FE6 A;  3NXA A;  2GGM A;  1S3P A;  1Y0V H;  1QLK A;  2LUC A;  2CNP A;  1NPQ A;  2BL0 C;  4GGN A;  1MXL C;  1CTR A;  1UUS A;  3EK8 A;  3PFV A;  2L2E A;  2OTG C;  4C0K A;  1S36 A;  3NSL A;  3RZS A;  1FPW A;  2L50 A;  2G2B A;  1OW4 A;  1DF0 A;  2K60 A;  5AEQ A;  1AVS A;  1YRU B;  5AER A;  1S6I A;  1YVL A;  1TUJ A;  2LVK A;  5CPV A;  3WXA A;  4MLW A;  2LP3 A;  1F70 A;  3D74 A;  1WRZ A;  2PVB A;  1NP8 A;  3S0B A;  5CSJ A;  1K95 A;  2H8V A;  2M97 A;  3WHU B;  1OOJ A;  1TUZ A;  4WRI A;  1DJX A;  5DKQ A;  4F7F A;  1JBA A;  2P71 A;  4MZK A;  4PT1 A;  2PRU A;  1NIW A;  4GPL B;  4I5K A;  1SYM A;  4YGB B;  1SCM B;  3JTD C;  4GBA A;  2KGB C;  4PHK A;  1ZMZ A;  3BYA A;  4GFT A;  1CDM A;  1C7V A;  3I5F C;  1IG5 A;  2KGR A;  2JT8 A;  2H61 C;  4YI8 A;  2SCP A;  3GK1 A;  2HET A;  4YRU A;  4YI9 A;  1SY9 A;  4OKH A;  4GGF C;  2KQ6 A;  1DJG A;  2M1K B;  3CR4 X;  2BL0 B;  5HKY A;  4DUQ A;  1SBJ A;  1UHH A;  1V1G A;  1FW4 A;  2GV5 A;  3EG5 B;  4YGD B;  2L5Y A;  2I94 A;  2QEH A;  3B87 A;  4A4C A;  3FWC A;  1CDP A;  2PYQ A;  5I2Q A;  1KQV A;  3SS5 A;  1BR1 B;  2KBM A;  3VRN A;  1NX2 A;  2LNK A;  1TNX A;  4XJK A;  5HL1 A;  1KQM C;  1C3Y A;  1K93 D;  2VRG A;  2HQ8 A;  5AAN A;  1KFX L;  5DKN A;  2CBL A;  2F33 A;  1AP4 A;  2KI6 D;  1UWO A;  1IH0 A;  5ER5 A;  2FCE A;  1NX0 A;  5AFP A;  2LLU A;  1P28 A;  3IQQ A;  2JTZ A;  2NCO A;  1KCY A;  2ZND A;  2M7L A;  3PLF B;  2FOT A;  1KK8 C;  1ZAC A;  1WDC C;  2JNF A;  5HKZ A;  2E30 A;  2MHH A;  1A75 B;  4INW A;  3I5F B;  1ORG A;  2KFG A;  1QVI Z;  2O5G A;  1ZFS A;  2ZKM X;  1QV0 A;  1DT7 B;  1WY9 A;  4HRH A;  3TS5 B;  1PSR A;  4U8D A;  1IRJ A;  1JF2 A;  1N65 A;  1NX3 A;  2LVJ A;  3K21 A;  1RFJ A;  1Z2C B;  2KAX A;  1BG1 A;  1IQ5 A;  1UP5 A;  2CT9 A;  1UUR A;  3PSR A;  2KAV A;  1K96 A;  3D0Y B;  1CM4 A;  1EJ3 A;  4OZD A;  2K2A A;  3I5I C;  3SIA A;  4KYN A;  2JWW A;  3MSE B;  1XA5 A;  4FQO A;  3A4U B;  3BJH A;  5KU1 A;  1GGW A;  4JD9 A;  1V1F A;  1BJF A;  1F4Q A;  3H4S E;  4UPG A;  1X02 A;  3BUN B;  1SL9 A;  4PE0 A;  3O2P A;  1IQ3 A;  3B6X A;  1Y6W A;  1QIW A;  3CZT X;  1L2O C;  5B8I B;  1BOC A;  1LA0 A;  1WDC B;  3KF9 A;  3LK0 A;  4QJ4 B;  3D10 A;  4YBH B;  1K9K A;  2MJW B;  1A2X A;  1QAS A;  1YUU A;  4DIR A;  3CS1 A;  1YX8 A;  2K7C A;  4JWQ A;  1Y1U A;  2LAN A;  4INX A;  5EL2 A;  5BPJ A;  4NDB A;  4WQ3 A;  5DIC A;  1SSE B;  3B86 A;  4YGA A;  1C3Z A;  2I2R E;  4GNK B;  3VB1 A;  3S0D A;  1SW8 A;  1AJ5 A;  2LLT A;  1KK8 B;  1AHR A;  1DJH A;  2Y4Q A;  2SAS A;  4PHJ A;  2LE9 B;  1TNW A;  1YUR A;  2F3Z A;  1LIN A;  3SG6 A;  1IJ5 A;  2KPH A;  3FE9 A;  3QRX A;  4A4B A;  2FCD A;  1EH2 A;  2JOJ A;  5FI2 A;  3OP0 A;  1IKU A;  1C07 A;  3DVK A;  3V2L A;  2JTT A;  3DVM A;  2K7D A;  3B7A A;  3R72 A;  3JVT C;  5I2L A;  3DZT A;  3PN7 C;  2M3W A;  2L0P A;  3A8R A;  4GAO A;  2PMY A;  3NGV A;  3SG3 A;  3C1V A;  2M9G A;  4CFQ A;  1S6J A;  4ZCV A;  1DMO A;  1IJ6 A;  3S0G A;  3WNX B;  4QJ5 B;  2QEB A;  5HLV A;  1A75 A;  2BKH B;  1ALV A;  5CSF A;  5GQQ C;  2MAZ A;  1CDL A;  1TNQ A; 
#chains in the Genus database with same CATH homology
 3FE8 A;  2P70 A;  3CDN A;  1C3Y A;  2WC5 A;  3CYZ A;  2WC6 A;  2FJY A;  1OOH A;  1P28 A;  2PQL A;  3L47 A;  3DY9 A;  3DYE A;  3K1E A;  3L4L A;  3D75 A;  4INW A;  3D76 A;  1ORG A;  3CAB A;  2WCK A;  2L2C A;  3NHT A;  2WCH A;  2ERB A;  2JPO A;  1GM0 A;  3BFA A;  3CZ0 A;  3CZ2 A;  3Q8I A;  3BFH A;  3R1O A;  4OZD A;  4FQT A;  1OOF A;  3S0F A;  3BJH A;  3N7H A;  2QDI A;  2QEO A;  4JD9 A;  3S0A A;  3D78 A;  2GTE A;  3R1V A;  3B6X A;  3FE6 A;  1XFR A;  3S0E A;  3QME A;  3OGN A;  3CZ1 A;  5EL2 A;  4INX A;  5DIC A;  3RZS A;  3B86 A;  2WCJ A;  1C3Z A;  1OW4 A;  3DXL A;  3VB1 A;  3S0D A;  1OOG A;  1TUJ A;  3BFB A;  1OOI X;  3D74 A;  3D77 A;  3S0B A;  3R1P A;  2H8V A;  4F7F A;  2KPH A;  2P71 A;  3D73 A;  3FE9 A;  4PT1 A;  3B88 A;  1T14 A;  2QEV A;  3V2L A;  3R72 A;  3B7A A;  3L4A A;  3NHI A;  3DZT A;  1LS8 A;  3NGV A;  1TWO A;  2WCL A;  3PJI A;  3S0G A;  2QEB A;  1DQE A;  2WCM A;  1QWV A;  2QEH A;  3B87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...