1B7TY

Myosin digested by papain
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
138
structure length
138
Chain Sequence
PQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Myosin
molecule keywords MYOSIN HEAVY CHAIN
publication title Atomic structure of scallop myosin subfragment S1 complexed with MgADP: a novel conformation of the myosin head.
pubmed doi rcsb
total genus 39
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 1999-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1b7tY01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1b7tY02
3AKBA 1JF2A 4JPZB 2KGRA 2KSPA 2GGZA 3VRQA 2NLNA 3OX5A 1RFJA 1BMOA 5DKQA 2F33A 3D0YB 1J1DA 4CPVA 4I5NB 1CMFA 1B7TY 2E30A 1GJYA 4MZJA 1K8UA 1JC2A 2BCAA 2FCDA 1QIVA 1QX7A 2LLTA 4OCIA 1AK8A 1S3PA 1TNXA 1DGVA 2BECA 3GOFA 2M49B 2PASA 1LXFC 3I5GB 2BCBA 1J7QA 3SG2A 2H61C 1JBAA 1K9PA 1MQ1A 4I5KA 1TCOB 2H61A 1G8IA 1F4QA 2LLUA 1OMVA 2KQ6A 2F3YA 1M39A 4ORAB 1B47A 3I5HC 2LMVA 4YRUA 1Y6WA 1RJVA 1KQMB 1V1FA 1DTLA 2PALA 4IL1A 2I18A 4ZCVA 2EC6C 3GK4X 3VROA 1TNWA 1CM4A 4BY5A 3CWGA 4PE0A 3DF0B 2LNKA 5IBWA 4L9MA 3CR2A 2F2OA 1M46A 1ZUZA 2LC5A 1LA3A 1NPQA 3BUNB 3OB1B 2OS8C 1EH2A 1GGZA 2HQ8A 2HPSA 4OV2A 5JJGA 2CXJA 1IGVA 2JNFA 1KK8B 1BR1B 1AVSA 4A4BA 2FJUB 4GBAA 2NXQA 4ORCB 1UP5A 2ZFDA 3CTNA 1J7RA 2L4HA 1N2DA 1IRJA 3FS7A 2EHBA 2BE6A 2WORA 4YBHB 5HLVA 3KF9A 1IKUA 1EJ3A 1DF0A 1B8CA 1WY9A 4HSZA 1CDMA 4NDCA 1KFUL 2K8MB 3PN7C 3TDIA 1S6IA 1D1OA 2LVJA 4JQ0D 3SG7A 4PDZA 2CT9A 1KFUS 1N0YA 2RGIA 3RLZA 1Y1XA 3WHUB 2LLSA 1OZOA 2L0PA 5KU1A 2JULA 3DD4A 1K94A 3DVJA 1XFYO 1AHRA 2LP3A 1NX1A 2NZ0A 2PRUA 1CTRA 5HLOA 4AQJA 1KWOB 1DJIA 2HETA 1M63B 4YGDB 4DS7A 2Y4QA 4MZKA 2WCEA 4ICBA 1TIZA 3TDZA 2V53A 4C0JA 1FI6A 1RTP1 3TS5C 1QV1A 3DVKA 1XFUO 3KPXA 5AEQA 1W7JB 1QS7A 1SCMC 2E6WA 1ZOTB 1LA0A 4MZLA 2COLB 2K7BA 1K90D 1KFXL 1SMGA 5AFPA 2AAOA 1L2OC 3I5FB 1DT7B 1YX8A 4DIRA 1UHHA 4E68A 1KFXS 1CFPA 2ZN9A 2JTZA 3D10A 1JWDA 5I2LA 5HKWA 2JT0A 4WRIA 4MSPA 1JUOA 2KDHA 2KNEA 3I5IC 1F71A 5G08A 1SNLA 4XYNA 1IWQA 3CS1A 1DJHA 2BBMA 4MLWA 1MXEA 1NCYA 2H2KA 2ZRSA 1B1GA 2PMYA 4A4CA 1TOPA 1XFVO 4MRYA 3GK2A 2CNPA 2LCPA 2P6BB 4D1EA 1J1EA 1PRWA 1BF5A 2JPTA 2MAZA 1CLMA 1RECA 2KI4C 1QLKA 2OS8B 1YRUB 2JZIA 2BCXA 4FQOA 2LM5A 1DJWA 2LAPA 4PHKA 2F8PA 4MN0A 3C1VA 2MRDA 1BODA 1UWOA 3FWBA 5HKZA 1QX2A 3PALA 2FOTA 1A75A 2OTGB 1CFFA 3A8RA 1PVAA 2M3WA 3SG3A 4OKHA 1XK4C 3O2PA 2L2EA 5CPVA 1UHNA 1XK4A 5D7FA 4GUKA 1XVJA 2O5GA 1CLBA 1CM1A 2MLFC 5CSFA 5KSZA 2L98A 2ZNDA 3JTDC 2I2RE 2WCBA 1CB1A 1DMOA 1NWDA 4R1EA 1YR5A 1WLMA 3VRRA 4PE1A 3ZNIA 1YX7A 1SL9A 3EKHA 1LKJA 1N65A 5GQQC 4HREE 3NSIA 3FIAA 2K7CA 3JVTC 4Q04A 1B8LA 1CFDA 2LE9B 1G33A 5DKNA 4DRWA 2M29A 3M0WA 2KYFA 3NSLA 4HRGA 3LK1A 3TS5B 4XJKB 1KSMA 1QIWA 1IH0A 1F55A 1XFWO 1SCMB 1ODBA 2DOQA 1S1EA 1UUSA 2A4JA 5TNCA 5CSIA 5ER4X 1FBVA 2K7DA 4GFTA 5PALA 5J3XA 1QVIZ 2B1UA 1TTXA 3CZTX 1JSAA 1XA5A 1NX0A 1RROA 4YGCB 1ZMZA 3IQOA 4DCKA 1K9UA 2O60A 1PSBA 3F45A 4PE7A 1JFJA 1YRTB 4C0LA 2BL0B 3I5IB 1B4CA 1PALA 3AAJA 3BUWB 1PVBA 2K2FA 1S6JA 1SL8A 5DKRA 1C7WA 1SYMA 1WRKA 4NDDA 1GGWA 1WRZA 3K21A 1YUUA 3SIBA 2VRGA 4F0ZB 1LINA 1MXLC 1KCYA 3EKJA 1EG3A 2KAXA 1RWYA 2ZN8A 4PHJA 1MF8B 1YVHA 2KI4B 4M2OA 1UHIA 3QRXA 1X02A 2JXCA 4USLA 3VGOA 2JQ6A 1EG4A 2BKHB 2Q91A 2R2IA 3BYAA 5CSJA 3D0YA 1YTZC 1SY9A 1IJ6A 2D8NA 3KEVA 1DJZA 4MBEA 1Y1AA 1YVLA 1G4YR 1OSAA 1Q80A 3TZ1A 2LV7A 2KYCA 1A75B 1UHJA 1A2XA 1FF1A 1QVIY 1FW4A 2ZRTA 1TNQA 1IJ5A 1OOJA 4CIDA 1CMGA 2M1KB 1VRKA 2TN4A 1V1GA 3BXKA 3AAKA 3FWCA 3A4UB 3GK1A 4QJ3B 5AANA 1C7VA 5I2OA 1CDNA 1M31A 2AUCA 5ER5A 1XFXO 4I5LB 1XFZO 4YI8A 4CFQA 4MEWA 1UHKA 1KQMC 1F54A 1QJTA 4ZCUA 4WQ3A 1AUIB 4MVFA 5I8NA 2JWWA 4N1FA 5KTYA 3BQ3A 3I5HB 3CLNA 1J55A 3NSKA 3CGAA 1SL7A 3DF0A 3EK8A 3EVVA 3SJSA 1K96A 1YUTA 3JVTB 2EC6B 1DVIA 1WRLA 1H4BA 3EVUA 2KAYA 3LK0A 3LLEA 1AJ4A 1QLSA 2HQWA 2LUXA 2OPOA 1OE9B 3EK7A 3BOWA 2LANA 2BBNA 2Y1NA 3H4SE 2M7LA 3VRNA 5JOLA 1NUBA 1S36A 1CDPA 4CLNA 1K93D 1NX2A 1SPYA 1IQ3A 1Y1UA 1H8BA 2KFHA 3O6BA 1SR6C 4TNCA 1NP8A 5HKYA 2KOTA 2F3ZA 5B8IB 1OQPA 3CR4X 5AERA 1A29A 1DF0B 1QTXA 4YGAA 3WHTB 2LUCA 2PSRA 1R6PA 3ZWHA 1MHOA 1CLLA 1W7IB 5AXIA 3VRPA 1QV0A 2LVKA 1IG5A 1B9AA 3BUOB 4PE4A 2Y5IA 3PN7B 1KK7Z 2JXLA 2SASA 1M45A 1NCXA 1QXPA 1U5IA 1L7ZA 4GGNA 4PHNA 1ALVA 4FTGA 1DJGA 1BOCA 1KWOC 2Q4UA 1XYDA 1OMDA 2KBIA 5I2QA 1NX3A 1PK0D 4PALA 2L4IA 2MA2A 2K61A 1DJXA 1SRAA 5HYDA 1NCZA 2Y1MA 2FCEA 2M1UA 2ZKMX 2AMIA 2LMTA 1KQVA 2G9BA 1MR8A 2JU0A 3WXAA 2F2PA 1MWNA 3LCPC 2CBLA 2KBMA 1OMRA 5FYXA 1J7PA 3TUYC 3I5FC 2L51A 3IF7A 2JT3A 2K7OA 2ZNEA 3AKAA 1K9KA 3EVRA 4NQGA 2KHNA 3PM8A 4P2YB 1RK9A 4QJ5B 4N5XA 1KSOA 1L2OB 3NXAA 4QJ4B 2JC2A 1TN4A 1S5GZ 3SG6A 2NCPA 5F6TA 1ZACA 1ZFSA 1KK7Y 2WC8A 2MBXA 3EK4A 3OB2B 1YUSA 3PATA 1WDCC 1HQVA 2WNDA 2LP2A 2WOSA 4P5OE 1WLZA 1CDLA 1FI5A 1YURA 4N1GA 4AOMA 1EL4A 2LMUA 3HX4A 2CCMA 4OR9B 1TNPA 2EGDA 2I94A 1AP4A 2JNXA 1DGUA 4AQIA 2MHHA 4NDBA 1SKTA 2WCFA 3MSEB 2LHIA 3BOWB 1FPWA 1IQ5A 1F70A 1PSRA 1F4OA 1SK6D 2M7NA 2BE4A 3PLFB 1NIWA 1JFKA 3OP0A 2JOJA 1CKKA 2BKIB 2KI6D 2M0RA 2HF5A 1K2HA 1SW8A 2KQYA 2OTGC 1S26D 1NSHA 4ORBB 1BU3A 4OVNF 4GAOA 1J7OA 1SR6B 2ISDA 4UPGA 3KHEA 4YGBB 1B8RA 4DUQA 3IQQA 4GNKB 3KO0A 1A4PA 1S5GY 1TRFA 2G2BA 2M97A 2QPTA 3I5GC 3DVMA 3BUMB 3TDUA 4ETOA 1UURA 1K95A 2GV5A 2PVBA 3RM1A 1CFCA 1BLQA 1S6CA 1LVCD 3SG5A 4WQ2A 1JF0A 1DJYA 2L50A 1U5IB 1BJFA 2IS9A 2JTTA 2LVIA 3ICBA 1QX5B 1SBJA 2CTNA 4BY4A 1OZSA 2I7AA 2KFGA 4C0KA 2MLEC 4YGEB 1E8AA 3JTDB 2JT8A 1XO5A 3O4YA 4MRXA 3PSRA 2LVVA 2M8UA 4YI9A 1SCVA 2K0JA 1EXRA 1A03A 2GGMA 1GQMA 1BR4B 2MJWB 1HT9A 1PULA 3SG4A 1NYAA 4PHMA 2L5XB 4XJKA 4U8DA 1F8HA 2KGBC 3NSOA 2NCOA 3CR5X 3PFVA 3DVEA 1KK8C 3TUYB 4GPLB 4HRHA 1B7TZ 4M2QA 4M2PA 4GGFC 2SCPA 2M9GA 4I5JA 1BG1A 5D69A 4GGFA 4JWQA 1QASA 2KAVA 3HCMA 1MUXA 3OHMB 2BL0C 1C07A 1R2UA 1BT6A 2KI6C 2JRFA 4CFRA 1CNPA 3WNXB 3BUXB 3LL8B 1WDCB 1TCFA 2LHLA 3O78A 1ALWA 5BPJA 1AJ5A 2K2AA 5CSNA 3E3RA 1Y0VH 3SIAA 5K89A 2QACA 1QATA 3OX6A 2KFFA 4PCWA
chains in the Genus database with same CATH superfamily
3AKBA 5EL2A 1JF2A 1OW4A 2L2CA 4JPZB 2KGRA 2KSPA 2GGZA 3VRQA 1TWOA 2NLNA 1RFJA 1BMOA 3OX5A 5DKQA 5DICA 2F33A 3D0YB 1J1DA 4CPVA 4I5NB 1CMFA 1B7TY 2E30A 1GJYA 2P70A 4MZJA 1K8UA 1JC2A 3FE6A 2BCAA 2FCDA 1QIVA 1QX7A 2LLTA 4OCIA 1AK8A 1S3PA 1TNXA 1DGVA 2BECA 3GOFA 2M49B 3BJHA 2PASA 1LXFC 2QEOA 3I5GB 2BCBA 1J7QA 3SG2A 2H61C 1JBAA 1K9PA 1MQ1A 1IIOA 4I5KA 1TCOB 2H61A 1G8IA 1F4QA 2PYQA 2LLUA 1OMVA 2KQ6A 2F3YA 1M39A 4ORAB 1B47A 3I5HC 2LMVA 3NHTA 4YRUA 3OGNA 1Y6WA 1RJVA 4INXA 1KQMB 3UO9A 1V1FA 1DTLA 2PALA 4IL1A 5I94A 2I18A 4ZCVA 2EC6C 3GK4X 3VROA 1TNWA 1CM4A 4BY5A 3CWGA 4PE0A 3DF0B 2LNKA 5IBWA 3Q8IA 3CR2A 4L9MA 2F2OA 1DC1A 3S0DA 1M46A 1ZUZA 2LC5A 1LA3A 1NPQA 3BUNB 3OB1B 2OS8C 1EH2A 1GGZA 2HQ8A 2HPSA 4OV2A 5JJGA 2CXJA 1IGVA 2JNFA 1KK8B 1BR1B 1AVSA 4A4BA 2FJUB 4GBAA 2NXQA 4ORCB 1UP5A 2ZFDA 3CTNA 2JPOA 1J7RA 2L4HA 1N2DA 1IRJA 4PT1A 3FS7A 2EHBA 2BE6A 2WORA 4YBHB 5HLVA 3KF9A 1IKUA 1EJ3A 1WY9A 1DF0A 1B8CA 1QWVA 4HSZA 1CDMA 1Z4HA 4NDCA 3S0AA 1KFUL 2K8MB 2PQLA 3PN7C 3TDIA 1S6IA 1D1OA 2LVJA 4JQ0D 3SG7A 4PDZA 2CT9A 1KFUS 1N0YA 2RGIA 3RLZA 1Y1XA 3WHUB 2LLSA 1OZOA 2L0PA 5KU1A 1ORGA 2JULA 3DD4A 1K94A 3DVJA 1XFYO 1AHRA 2LP3A 2YGUA 1NX1A 2NZ0A 2PRUA 1CTRA 5HLOA 4AQJA 1KWOB 1DJIA 2HETA 1M63B 4YGDB 4DS7A 2Y4QA 4MZKA 2WCEA 4ICBA 1TIZA 3IVTA 3TDZA 2V53A 4C0JA 1FI6A 1RTP1 3TS5C 1QV1A 3DVKA 1XFUO 3KPXA 5AEQA 1W7JB 1QS7A 1SCMC 2E6WA 1ZOTB 1LA0A 2WCMA 2COLB 2K7BA 4MZLA 1K90D 1KFXL 1SMGA 5AFPA 2AAOA 1L2OC 3EG5B 3I5FB 1DT7B 1YX8A 3DYEA 4DIRA 3D78A 1UHHA 4E68A 1KFXS 1CFPA 2ZN9A 2BNXA 2JTZA 3D10A 1JWDA 1P28A 5HKWA 5I2LA 2JT0A 4WRIA 4MSPA 1JUOA 2KDHA 2KNEA 3O4XA 3I5IC 1F71A 5G08A 1SNLA 4XYNA 1IWQA 3CS1A 1DJHA 2BBMA 4MLWA 1MXEA 1NCYA 2H2KA 2ZRSA 3R72A 1B1GA 2PMYA 4A4CA 1TOPA 1XFVO 4MRYA 3GK2A 2CNPA 2LCPA 2P6BB 5FI6A 4D1EA 1J1EA 1PRWA 1BF5A 2JPTA 2MAZA 1CLMA 1RECA 2KI4C 1QLKA 2OS8B 1YRUB 2JZIA 2BCXA 4FQOA 2LM5A 1DJWA 2GTEA 2LAPA 4PHKA 2F8PA 3CYZA 4MN0A 3C1VA 2MRDA 1BODA 1UWOA 3FWBA 5HKZA 1QX2A 3PALA 2FOTA 1A75A 2OTGB 3CZ0A 3A8RA 1PVAA 1CFFA 2M3WA 1T14A 3SG3A 4OKHA 1XK4C 3O2PA 2L2EA 5CPVA 1DEKA 1UHNA 1XK4A 1OOGA 3DY9A 5D7FA 3S0GA 4GUKA 1XVJA 2O5GA 1CLBA 1CM1A 2MLFC 5CSFA 5KSZA 2L98A 2ZNDA 3JTDC 2I2RE 2WCBA 1CB1A 1DMOA 1NWDA 2QEBA 4R1EA 1YR5A 1WLMA 3VRRA 4PE1A 3D74A 1YX7A 3FE9A 1SL9A 3ZNIA 3B87A 3EKHA 1LKJA 1N65A 5GQQC 3K1EA 4HREE 3NSIA 3FIAA 2K7CA 3JVTC 4Q04A 1B8LA 1CFDA 2LE9B 1G33A 5DKNA 4DRWA 2M29A 3M0WA 1TUZA 2KYFA 3NHIA 3NSLA 4HRGA 4IJ7A 2ERBA 3R1VA 3B86A 3LK1A 3TS5B 4XJKB 1KSMA 1QIWA 1IH0A 1F55A 1XFWO 1SCMB 1ODBA 2DOQA 1S1EA 1UUSA 2A4JA 3BFBA 3N7HA 5CSIA 5TNCA 5ER4X 1FBVA 2K7DA 4GFTA 5PALA 5J3XA 1QVIZ 2B1UA 1TTXA 3CZTX 1JSAA 1XA5A 1NX0A 1RROA 4YGCB 1ZMZA 3IQOA 4DCKA 1K9UA 2O60A 3CZ1A 2L5YA 1PSBA 3F45A 4PE7A 2KLDA 3CZ2A 4FQTA 1YRTB 3CDNA 1JFJA 4C0LA 2BL0B 3I5IB 4OZDA 1B4CA 1PALA 3AAJA 3BUWB 1PVBA 2K2FA 1S6JA 1SL8A 5DKRA 1C7WA 1SYMA 1WRKA 4NDDA 1GGWA 1WRZA 3K21A 1YUUA 3SIBA 2VRGA 4F0ZB 1LINA 3PJIA 1MXLC 3B88A 1KCYA 3EKJA 1EG3A 3SS5A 2KAXA 1RWYA 2ZN8A 1OOIX 1MF8B 1YVHA 4PHJA 2KI4B 4M2OA 1UHIA 3QRXA 1X02A 2JXCA 4USLA 3VGOA 2JQ6A 1EG4A 2BKHB 2H8VA 2Q91A 2R2IA 3BYAA 5CSJA 3D0YA 1YTZC 1SY9A 1IJ6A 2D8NA 3KEVA 3SS4A 1DJZA 4MBEA 1Y1AA 1YVLA 1G4YR 1OSAA 1Q80A 3TZ1A 2LV7A 2KYCA 1A75B 1UHJA 1A2XA 2FJYA 1FF1A 3B6XA 1QVIY 1FW4A 2ZRTA 1TNQA 1IJ5A 1OOJA 3UNWA 4CIDA 3VB1A 1CMGA 2M1KB 1VRKA 2TN4A 1V1GA 3BXKA 3AAKA 3FWCA 3A4UB 3GK1A 4QJ3B 1TUJA 5AANA 1C7VA 3SS3A 5I2OA 1CDNA 1M31A 2AUCA 5ER5A 1XFXO 4I5LB 1XFZO 4YI8A 4CFQA 4MEWA 1UHKA 1KQMC 1F54A 1QJTA 4ZCUA 4WQ3A 1AUIB 4MVFA 5I8NA 2JWWA 4N1FA 5KTYA 3BQ3A 3I5HB 3CLNA 2WCJA 1J55A 3S0EA 3NSKA 3CGAA 1SL7A 3DF0A 3D75A 3EK8A 3EVVA 3SJSA 1K96A 1YUTA 3JVTB 3R1PA 2EC6B 1DVIA 1WRLA 1H4BA 1OOFA 3EVUA 2KAYA 3LK0A 3LLEA 1AJ4A 1QLSA 2HQWA 3BFHA 2LUXA 2OPOA 1OE9B 3DZTA 3EK7A 3BOWA 2LANA 2BBNA 2Y1NA 3H4SE 2M7LA 3VRNA 5JOLA 1NUBA 1S36A 1C3ZA 5D3OA 1CDPA 1DELA 4CLNA 1K93D 1NX2A 1SPYA 3D73A 1Y1UA 1IQ3A 1H8BA 2KFHA 3O6BA 1SR6C 4TNCA 1NP8A 5HKYA 2KOTA 2F3ZA 5B8IB 1OQPA 3CR4X 5AERA 1A29A 1DF0B 1QTXA 4YGAA 3WHTB 2LUCA 2PSRA 1OOHA 1R6PA 3ZWHA 1MHOA 1CLLA 1W7IB 5AXIA 3VRPA 1QV0A 2LVKA 1IG5A 1B9AA 3BUOB 4PE4A 2Y5IA 3PN7B 4INWA 1KK7Z 2WCLA 2JXLA 2SASA 1M45A 1NCXA 1QXPA 1U5IA 1L7ZA 2WCKA 3L4AA 4GGNA 4PHNA 1ALVA 1SSEB 1DJGA 4FTGA 1BOCA 1KWOC 2Q4UA 1XYDA 1OMDA 2KBIA 5I2QA 1NX3A 3CABA 1PK0D 4PALA 2L4IA 2MA2A 2K61A 1DJXA 1SRAA 5HYDA 1NCZA 2Y1MA 2FCEA 2M1UA 2ZKMX 2AMIA 2LMTA 1KQVA 2G9BA 1MR8A 2JU0A 3S0FA 3WXAA 2F2PA 1MWNA 3LCPC 2CBLA 2KBMA 1OMRA 3NGVA 5FYXA 3RZSA 3TUYC 3I5FC 3BFAA 1J7PA 2L51A 3IF7A 2JT3A 2K7OA 2QEVA 3L4LA 2ZNEA 3AKAA 1K9KA 3D76A 3EVRA 4NQGA 2KHNA 3PM8A 4P2YB 1RK9A 4QJ5B 1C3YA 4N5XA 1KSOA 1L2OB 3NXAA 3DXLA 4QJ4B 2JC2A 1TN4A 1S5GZ 3FE8A 3SG6A 2NCPA 5F6TA 1ZACA 1ZFSA 1KK7Y 2WC8A 2MBXA 3EK4A 3OB2B 1YUSA 3PATA 1WDCC 1HQVA 2WNDA 2LP2A 2WOSA 4P5OE 1WLZA 1CDLA 1FI5A 1YURA 4N1GA 4AOMA 1EL4A 2LMUA 3HX4A 2CCMA 4OR9B 1TNPA 2EGDA 2I94A 1AP4A 2JNXA 1DGUA 4AQIA 1Z2CB 2MHHA 1SKTA 2WCFA 3MSEB 4NDBA 2LHIA 3BOWB 1FPWA 1IQ5A 1F70A 1PSRA 1F4OA 1SK6D 2M7NA 2BE4A 3PLFB 1NIWA 4KYNA 1JFKA 3OP0A 2QEHA 2JOJA 5HL1A 2BKIB 2KI6D 2M0RA 3D77A 2HF5A 1CKKA 1SW8A 2KQYA 2OTGC 3B7AA 1K2HA 2QDIA 1S26D 1NSHA 4ORBB 1BU3A 4OVNF 4GAOA 1J7OA 1SR6B 2ISDA 4UPGA 3KHEA 4YGBB 1XFRA 1B8RA 4DUQA 3IQQA 4GNKB 2BAPA 3KO0A 1A4PA 1S5GY 1TRFA 2G2BA 2M97A 2QPTA 3I5GC 3DVMA 3BUMB 3TDUA 4ETOA 1UURA 1K95A 2GV5A 2PVBA 4F7FA 3RM1A 1CFCA 1BLQA 1S6CA 1LVCD 3SG5A 4WQ2A 1LS8A 2P71A 1JF0A 1DJYA 2L50A 4JKTA 1U5IB 4JD9A 1BJFA 2IS9A 2JTTA 2LVIA 3ICBA 1QX5B 1SBJA 2CTNA 4BY4A 1OZSA 2I7AA 2KFGA 4C0KA 2MLEC 4YGEB 1E8AA 3JTDB 2JT8A 1XO5A 2WC5A 3O4YA 4MRXA 3PSRA 2LVVA 2M8UA 4YI9A 1SCVA 2K0JA 1EXRA 1W9ZA 3QMEA 1A03A 2GGMA 1GQMA 1BR4B 2MJWB 1HT9A 1PULA 3SG4A 1NYAA 4PHMA 2WC6A 3OBVA 2L5XB 4XJKA 4U8DA 3V2LA 1F8HA 2WCHA 2KGBC 3NSOA 5FI2A 2NCOA 3CR5X 3PFVA 3DVEA 2KPHA 1KK8C 3TUYB 4GPLB 3L47A 1B7TZ 4HRHA 2KLEA 4M2QA 4GGFC 2SCPA 4M2PA 2M9GA 3S0BA 4I5JA 1BG1A 5D69A 4GGFA 4JWQA 3R1OA 1QASA 2KAVA 3HCMA 1MUXA 3OHMB 2BL0C 5FI7A 1C07A 1R2UA 1GM0A 1BT6A 2KI6C 2JRFA 3PM2A 4CFRA 1CNPA 1DQEA 3WNXB 3BUXB 3LL8B 1WDCB 2K60A 1TCFA 2LHLA 3O78A 1ALWA 5BPJA 1AJ5A 2K2AA 5CSNA 3E3RA 1Y0VH 3SIAA 5K89A 2QACA 1QATA 3OX6A 2KFFA 4PCWA
chains in the Genus database with same CATH topology
3AKBA 1JF2A 4JPZB 2KGRA 2KSPA 2GGZA 3VRQA 2NLNA 3OX5A 1RFJA 1BMOA 5DKQA 2F33A 3D0YB 1J1DA 4CPVA 4I5NB 1CMFA 1B7TY 2E30A 1GJYA 4MZJA 1K8UA 1JC2A 2BCAA 2FCDA 1QIVA 1QX7A 2LLTA 4OCIA 1AK8A 1S3PA 1TNXA 1DGVA 2BECA 3GOFA 2M49B 2PASA 1LXFC 3I5GB 2BCBA 1J7QA 3SG2A 2H61C 1JBAA 1K9PA 1MQ1A 4I5KA 1TCOB 2H61A 1G8IA 1F4QA 2LLUA 1OMVA 2KQ6A 2F3YA 1M39A 4ORAB 1B47A 3I5HC 2LMVA 4YRUA 1Y6WA 1RJVA 1KQMB 1V1FA 1DTLA 2PALA 4IL1A 2I18A 4ZCVA 2EC6C 3GK4X 3VROA 1TNWA 1CM4A 4BY5A 3CWGA 4PE0A 3DF0B 2LNKA 5IBWA 4L9MA 3CR2A 2F2OA 1M46A 1ZUZA 2LC5A 1LA3A 1NPQA 3BUNB 3OB1B 2OS8C 1EH2A 1GGZA 2HQ8A 2HPSA 4OV2A 5JJGA 2CXJA 1IGVA 2JNFA 1KK8B 1BR1B 1AVSA 4A4BA 2FJUB 4GBAA 2NXQA 4ORCB 1UP5A 2ZFDA 3CTNA 1J7RA 2L4HA 1N2DA 1IRJA 3FS7A 2EHBA 2BE6A 2WORA 4YBHB 5HLVA 3KF9A 1IKUA 1EJ3A 1DF0A 1B8CA 1WY9A 4HSZA 1CDMA 4NDCA 1KFUL 2K8MB 3PN7C 3TDIA 1S6IA 1D1OA 2LVJA 4JQ0D 3SG7A 4PDZA 2CT9A 1KFUS 1N0YA 2RGIA 3RLZA 1Y1XA 3WHUB 2LLSA 1OZOA 2L0PA 5KU1A 2JULA 3DD4A 1K94A 3DVJA 1XFYO 1AHRA 2LP3A 1NX1A 2NZ0A 2PRUA 1CTRA 5HLOA 4AQJA 1KWOB 1DJIA 2HETA 1M63B 4YGDB 4DS7A 2Y4QA 4MZKA 2WCEA 4ICBA 1TIZA 3TDZA 2V53A 4C0JA 1FI6A 1RTP1 3TS5C 1QV1A 3DVKA 1XFUO 3KPXA 5AEQA 1W7JB 1QS7A 1SCMC 2E6WA 1ZOTB 1LA0A 4MZLA 2COLB 2K7BA 1K90D 1KFXL 1SMGA 5AFPA 2AAOA 1L2OC 3I5FB 1DT7B 1YX8A 4DIRA 1UHHA 4E68A 1KFXS 1CFPA 2ZN9A 2JTZA 3D10A 1JWDA 5I2LA 5HKWA 2JT0A 4WRIA 4MSPA 1JUOA 2KDHA 2KNEA 3I5IC 1F71A 5G08A 1SNLA 4XYNA 1IWQA 3CS1A 1DJHA 2BBMA 4MLWA 1MXEA 1NCYA 2H2KA 2ZRSA 1B1GA 2PMYA 4A4CA 1TOPA 1XFVO 4MRYA 3GK2A 2CNPA 2LCPA 2P6BB 4D1EA 1J1EA 1PRWA 1BF5A 2JPTA 2MAZA 1CLMA 1RECA 2KI4C 1QLKA 2OS8B 1YRUB 2JZIA 2BCXA 4FQOA 2LM5A 1DJWA 2LAPA 4PHKA 2F8PA 4MN0A 3C1VA 2MRDA 1BODA 1UWOA 3FWBA 5HKZA 1QX2A 3PALA 2FOTA 1A75A 2OTGB 1CFFA 3A8RA 1PVAA 2M3WA 3SG3A 4OKHA 1XK4C 3O2PA 2L2EA 5CPVA 1UHNA 1XK4A 5D7FA 4GUKA 1XVJA 2O5GA 1CLBA 1CM1A 2MLFC 5CSFA 5KSZA 2L98A 2ZNDA 3JTDC 2I2RE 2WCBA 1CB1A 1DMOA 1NWDA 4R1EA 1YR5A 1WLMA 3VRRA 4PE1A 3ZNIA 1YX7A 1SL9A 3EKHA 1LKJA 1N65A 5GQQC 4HREE 3NSIA 3FIAA 2K7CA 3JVTC 4Q04A 1B8LA 1CFDA 2LE9B 1G33A 5DKNA 4DRWA 2M29A 3M0WA 2KYFA 3NSLA 4HRGA 3LK1A 3TS5B 4XJKB 1KSMA 1QIWA 1IH0A 1F55A 1XFWO 1SCMB 1ODBA 2DOQA 1S1EA 1UUSA 2A4JA 5TNCA 5CSIA 5ER4X 1FBVA 2K7DA 4GFTA 5PALA 5J3XA 1QVIZ 2B1UA 1TTXA 3CZTX 1JSAA 1XA5A 1NX0A 1RROA 4YGCB 1ZMZA 3IQOA 4DCKA 1K9UA 2O60A 1PSBA 3F45A 4PE7A 1JFJA 1YRTB 4C0LA 2BL0B 3I5IB 1B4CA 1PALA 3AAJA 3BUWB 1PVBA 2K2FA 1S6JA 1SL8A 5DKRA 1C7WA 1SYMA 1WRKA 4NDDA 1GGWA 1WRZA 3K21A 1YUUA 3SIBA 2VRGA 4F0ZB 1LINA 1MXLC 1KCYA 3EKJA 1EG3A 2KAXA 1RWYA 2ZN8A 4PHJA 1MF8B 1YVHA 2KI4B 4M2OA 1UHIA 3QRXA 1X02A 2JXCA 4USLA 3VGOA 2JQ6A 1EG4A 2BKHB 2Q91A 2R2IA 3BYAA 5CSJA 3D0YA 1YTZC 1SY9A 1IJ6A 2D8NA 3KEVA 1DJZA 4MBEA 1Y1AA 1YVLA 1G4YR 1OSAA 1Q80A 3TZ1A 2LV7A 2KYCA 1A75B 1UHJA 1A2XA 1FF1A 1QVIY 1FW4A 2ZRTA 1TNQA 1IJ5A 1OOJA 4CIDA 1CMGA 2M1KB 1VRKA 2TN4A 1V1GA 3BXKA 3AAKA 3FWCA 3A4UB 3GK1A 4QJ3B 5AANA 1C7VA 5I2OA 1CDNA 1M31A 2AUCA 5ER5A 1XFXO 4I5LB 1XFZO 4YI8A 4CFQA 4MEWA 1UHKA 1KQMC 1F54A 1QJTA 4ZCUA 4WQ3A 1AUIB 4MVFA 5I8NA 2JWWA 4N1FA 5KTYA 3BQ3A 3I5HB 3CLNA 1J55A 3NSKA 3CGAA 1SL7A 3DF0A 3EK8A 3EVVA 3SJSA 1K96A 1YUTA 3JVTB 2EC6B 1DVIA 1WRLA 1H4BA 3EVUA 2KAYA 3LK0A 3LLEA 1AJ4A 1QLSA 2HQWA 2LUXA 2OPOA 1OE9B 3EK7A 3BOWA 2LANA 2BBNA 2Y1NA 3H4SE 2M7LA 3VRNA 5JOLA 1NUBA 1S36A 1CDPA 4CLNA 1K93D 1NX2A 1SPYA 1IQ3A 1Y1UA 1H8BA 2KFHA 3O6BA 1SR6C 4TNCA 1NP8A 5HKYA 2KOTA 2F3ZA 5B8IB 1OQPA 3CR4X 5AERA 1A29A 1DF0B 1QTXA 4YGAA 3WHTB 2LUCA 2PSRA 1R6PA 3ZWHA 1MHOA 1CLLA 1W7IB 5AXIA 3VRPA 1QV0A 2LVKA 1IG5A 1B9AA 3BUOB 4PE4A 2Y5IA 3PN7B 1KK7Z 2JXLA 2SASA 1M45A 1NCXA 1QXPA 1U5IA 1L7ZA 4GGNA 4PHNA 1ALVA 4FTGA 1DJGA 1BOCA 1KWOC 2Q4UA 1XYDA 1OMDA 2KBIA 5I2QA 1NX3A 1PK0D 4PALA 2L4IA 2MA2A 2K61A 1DJXA 1SRAA 5HYDA 1NCZA 2Y1MA 2FCEA 2M1UA 2ZKMX 2AMIA 2LMTA 1KQVA 2G9BA 1MR8A 2JU0A 3WXAA 2F2PA 1MWNA 3LCPC 2CBLA 2KBMA 1OMRA 5FYXA 1J7PA 3TUYC 3I5FC 2L51A 3IF7A 2JT3A 2K7OA 2ZNEA 3AKAA 1K9KA 3EVRA 4NQGA 2KHNA 3PM8A 4P2YB 1RK9A 4QJ5B 4N5XA 1KSOA 1L2OB 3NXAA 4QJ4B 2JC2A 1TN4A 1S5GZ 3SG6A 2NCPA 5F6TA 1ZACA 1ZFSA 1KK7Y 2WC8A 2MBXA 3EK4A 3OB2B 1YUSA 3PATA 1WDCC 1HQVA 2WNDA 2LP2A 2WOSA 4P5OE 1WLZA 1CDLA 1FI5A 1YURA 4N1GA 4AOMA 1EL4A 2LMUA 3HX4A 2CCMA 4OR9B 1TNPA 2EGDA 2I94A 1AP4A 2JNXA 1DGUA 4AQIA 2MHHA 4NDBA 1SKTA 2WCFA 3MSEB 2LHIA 3BOWB 1FPWA 1IQ5A 1F70A 1PSRA 1F4OA 1SK6D 2M7NA 2BE4A 3PLFB 1NIWA 1JFKA 3OP0A 2JOJA 1CKKA 2BKIB 2KI6D 2M0RA 2HF5A 1K2HA 1SW8A 2KQYA 2OTGC 1S26D 1NSHA 4ORBB 1BU3A 4OVNF 4GAOA 1J7OA 1SR6B 2ISDA 4UPGA 3KHEA 4YGBB 1B8RA 4DUQA 3IQQA 4GNKB 3KO0A 1A4PA 1S5GY 1TRFA 2G2BA 2M97A 2QPTA 3I5GC 3DVMA 3BUMB 3TDUA 4ETOA 1UURA 1K95A 2GV5A 2PVBA 3RM1A 1CFCA 1BLQA 1S6CA 1LVCD 3SG5A 4WQ2A 1JF0A 1DJYA 2L50A 1U5IB 1BJFA 2IS9A 2JTTA 2LVIA 3ICBA 1QX5B 1SBJA 2CTNA 4BY4A 1OZSA 2I7AA 2KFGA 4C0KA 2MLEC 4YGEB 1E8AA 3JTDB 2JT8A 1XO5A 3O4YA 4MRXA 3PSRA 2LVVA 2M8UA 4YI9A 1SCVA 2K0JA 1EXRA 1A03A 2GGMA 1GQMA 1BR4B 2MJWB 1HT9A 1PULA 3SG4A 1NYAA 4PHMA 2L5XB 4XJKA 4U8DA 1F8HA 2KGBC 3NSOA 2NCOA 3CR5X 3PFVA 3DVEA 1KK8C 3TUYB 4GPLB 4HRHA 1B7TZ 4M2QA 4M2PA 4GGFC 2SCPA 2M9GA 4I5JA 1BG1A 5D69A 4GGFA 4JWQA 1QASA 2KAVA 3HCMA 1MUXA 3OHMB 2BL0C 1C07A 1R2UA 1BT6A 2KI6C 2JRFA 4CFRA 1CNPA 3WNXB 3BUXB 3LL8B 1WDCB 1TCFA 2LHLA 3O78A 1ALWA 5BPJA 1AJ5A 2K2AA 5CSNA 3E3RA 1Y0VH 3SIAA 5K89A 2QACA 1QATA 3OX6A 2KFFA 4PCWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AKB A;  1JF2 A;  4JPZ B;  2KGR A;  2KSP A;  2GGZ A;  3VRQ A;  2NLN A;  3OX5 A;  1RFJ A;  1BMO A;  5DKQ A;  2F33 A;  3D0Y B;  1J1D A;  4CPV A;  4I5N B;  1CMF A;  1B7T Y;  2E30 A;  1GJY A;  4MZJ A;  1K8U A;  1JC2 A;  2BCA A;  2FCD A;  1QIV A;  1QX7 A;  2LLT A;  4OCI A;  1AK8 A;  1S3P A;  1TNX A;  1DGV A;  2BEC A;  3GOF A;  2M49 B;  2PAS A;  1LXF C;  3I5G B;  2BCB A;  1J7Q A;  3SG2 A;  2H61 C;  1JBA A;  1K9P A;  1MQ1 A;  4I5K A;  1TCO B;  2H61 A;  1G8I A;  1F4Q A;  2LLU A;  1OMV A;  2KQ6 A;  2F3Y A;  1M39 A;  4ORA B;  1B47 A;  3I5H C;  2LMV A;  4YRU A;  1Y6W A;  1RJV A;  1KQM B;  1V1F A;  1DTL A;  2PAL A;  4IL1 A;  2I18 A;  4ZCV A;  2EC6 C;  3GK4 X;  3VRO A;  1TNW A;  1CM4 A;  4BY5 A;  3CWG A;  4PE0 A;  3DF0 B;  2LNK A;  5IBW A;  4L9M A;  3CR2 A;  2F2O A;  1M46 A;  1ZUZ A;  2LC5 A;  1LA3 A;  1NPQ A;  3BUN B;  3OB1 B;  2OS8 C;  1EH2 A;  1GGZ A;  2HQ8 A;  2HPS A;  4OV2 A;  5JJG A;  2CXJ A;  1IGV A;  2JNF A;  1KK8 B;  1BR1 B;  1AVS A;  4A4B A;  2FJU B;  4GBA A;  2NXQ A;  4ORC B;  1UP5 A;  2ZFD A;  3CTN A;  1J7R A;  2L4H A;  1N2D A;  1IRJ A;  3FS7 A;  2EHB A;  2BE6 A;  2WOR A;  4YBH B;  5HLV A;  3KF9 A;  1IKU A;  1EJ3 A;  1DF0 A;  1B8C A;  1WY9 A;  4HSZ A;  1CDM A;  4NDC A;  1KFU L;  2K8M B;  3PN7 C;  3TDI A;  1S6I A;  1D1O A;  2LVJ A;  4JQ0 D;  3SG7 A;  4PDZ A;  2CT9 A;  1KFU S;  1N0Y A;  2RGI A;  3RLZ A;  1Y1X A;  3WHU B;  2LLS A;  1OZO A;  2L0P A;  5KU1 A;  2JUL A;  3DD4 A;  1K94 A;  3DVJ A;  1XFY O;  1AHR A;  2LP3 A;  1NX1 A;  2NZ0 A;  2PRU A;  1CTR A;  5HLO A;  4AQJ A;  1KWO B;  1DJI A;  2HET A;  1M63 B;  4YGD B;  4DS7 A;  2Y4Q A;  4MZK A;  2WCE A;  4ICB A;  1TIZ A;  3TDZ A;  2V53 A;  4C0J A;  1FI6 A;  1RTP 1;  3TS5 C;  1QV1 A;  3DVK A;  1XFU O;  3KPX A;  5AEQ A;  1W7J B;  1QS7 A;  1SCM C;  2E6W A;  1ZOT B;  1LA0 A;  4MZL A;  2COL B;  2K7B A;  1K90 D;  1KFX L;  1SMG A;  5AFP A;  2AAO A;  1L2O C;  3I5F B;  1DT7 B;  1YX8 A;  4DIR A;  1UHH A;  4E68 A;  1KFX S;  1CFP A;  2ZN9 A;  2JTZ A;  3D10 A;  1JWD A;  5I2L A;  5HKW A;  2JT0 A;  4WRI A;  4MSP A;  1JUO A;  2KDH A;  2KNE A;  3I5I C;  1F71 A;  5G08 A;  1SNL A;  4XYN A;  1IWQ A;  3CS1 A;  1DJH A;  2BBM A;  4MLW A;  1MXE A;  1NCY A;  2H2K A;  2ZRS A;  1B1G A;  2PMY A;  4A4C A;  1TOP A;  1XFV O;  4MRY A;  3GK2 A;  2CNP A;  2LCP A;  2P6B B;  4D1E A;  1J1E A;  1PRW A;  1BF5 A;  2JPT A;  2MAZ A;  1CLM A;  1REC A;  2KI4 C;  1QLK A;  2OS8 B;  1YRU B;  2JZI A;  2BCX A;  4FQO A;  2LM5 A;  1DJW A;  2LAP A;  4PHK A;  2F8P A;  4MN0 A;  3C1V A;  2MRD A;  1BOD A;  1UWO A;  3FWB A;  5HKZ A;  1QX2 A;  3PAL A;  2FOT A;  1A75 A;  2OTG B;  1CFF A;  3A8R A;  1PVA A;  2M3W A;  3SG3 A;  4OKH A;  1XK4 C;  3O2P A;  2L2E A;  5CPV A;  1UHN A;  1XK4 A;  5D7F A;  4GUK A;  1XVJ A;  2O5G A;  1CLB A;  1CM1 A;  2MLF C;  5CSF A;  5KSZ A;  2L98 A;  2ZND A;  3JTD C;  2I2R E;  2WCB A;  1CB1 A;  1DMO A;  1NWD A;  4R1E A;  1YR5 A;  1WLM A;  3VRR A;  4PE1 A;  3ZNI A;  1YX7 A;  1SL9 A;  3EKH A;  1LKJ A;  1N65 A;  5GQQ C;  4HRE E;  3NSI A;  3FIA A;  2K7C A;  3JVT C;  4Q04 A;  1B8L A;  1CFD A;  2LE9 B;  1G33 A;  5DKN A;  4DRW A;  2M29 A;  3M0W A;  2KYF A;  3NSL A;  4HRG A;  3LK1 A;  3TS5 B;  4XJK B;  1KSM A;  1QIW A;  1IH0 A;  1F55 A;  1XFW O;  1SCM B;  1ODB A;  2DOQ A;  1S1E A;  1UUS A;  2A4J A;  5TNC A;  5CSI A;  5ER4 X;  1FBV A;  2K7D A;  4GFT A;  5PAL A;  5J3X A;  1QVI Z;  2B1U A;  1TTX A;  3CZT X;  1JSA A;  1XA5 A;  1NX0 A;  1RRO A;  4YGC B;  1ZMZ A;  3IQO A;  4DCK A;  1K9U A;  2O60 A;  1PSB A;  3F45 A;  4PE7 A;  1JFJ A;  1YRT B;  4C0L A;  2BL0 B;  3I5I B;  1B4C A;  1PAL A;  3AAJ A;  3BUW B;  1PVB A;  2K2F A;  1S6J A;  1SL8 A;  5DKR A;  1C7W A;  1SYM A;  1WRK A;  4NDD A;  1GGW A;  1WRZ A;  3K21 A;  1YUU A;  3SIB A;  2VRG A;  4F0Z B;  1LIN A;  1MXL C;  1KCY A;  3EKJ A;  1EG3 A;  2KAX A;  1RWY A;  2ZN8 A;  4PHJ A;  1MF8 B;  1YVH A;  2KI4 B;  4M2O A;  1UHI A;  3QRX A;  1X02 A;  2JXC A;  4USL A;  3VGO A;  2JQ6 A;  1EG4 A;  2BKH B;  2Q91 A;  2R2I A;  3BYA A;  5CSJ A;  3D0Y A;  1YTZ C;  1SY9 A;  1IJ6 A;  2D8N A;  3KEV A;  1DJZ A;  4MBE A;  1Y1A A;  1YVL A;  1G4Y R;  1OSA A;  1Q80 A;  3TZ1 A;  2LV7 A;  2KYC A;  1A75 B;  1UHJ A;  1A2X A;  1FF1 A;  1QVI Y;  1FW4 A;  2ZRT A;  1TNQ A;  1IJ5 A;  1OOJ A;  4CID A;  1CMG A;  2M1K B;  1VRK A;  2TN4 A;  1V1G A;  3BXK A;  3AAK A;  3FWC A;  3A4U B;  3GK1 A;  4QJ3 B;  5AAN A;  1C7V A;  5I2O A;  1CDN A;  1M31 A;  2AUC A;  5ER5 A;  1XFX O;  4I5L B;  1XFZ O;  4YI8 A;  4CFQ A;  4MEW A;  1UHK A;  1KQM C;  1F54 A;  1QJT A;  4ZCU A;  4WQ3 A;  1AUI B;  4MVF A;  5I8N A;  2JWW A;  4N1F A;  5KTY A;  3BQ3 A;  3I5H B;  3CLN A;  1J55 A;  3NSK A;  3CGA A;  1SL7 A;  3DF0 A;  3EK8 A;  3EVV A;  3SJS A;  1K96 A;  1YUT A;  3JVT B;  2EC6 B;  1DVI A;  1WRL A;  1H4B A;  3EVU A;  2KAY A;  3LK0 A;  3LLE A;  1AJ4 A;  1QLS A;  2HQW A;  2LUX A;  2OPO A;  1OE9 B;  3EK7 A;  3BOW A;  2LAN A;  2BBN A;  2Y1N A;  3H4S E;  2M7L A;  3VRN A;  5JOL A;  1NUB A;  1S36 A;  1CDP A;  4CLN A;  1K93 D;  1NX2 A;  1SPY A;  1IQ3 A;  1Y1U A;  1H8B A;  2KFH A;  3O6B A;  1SR6 C;  4TNC A;  1NP8 A;  5HKY A;  2KOT A;  2F3Z A;  5B8I B;  1OQP A;  3CR4 X;  5AER A;  1A29 A;  1DF0 B;  1QTX A;  4YGA A;  3WHT B;  2LUC A;  2PSR A;  1R6P A;  3ZWH A;  1MHO A;  1CLL A;  1W7I B;  5AXI A;  3VRP A;  1QV0 A;  2LVK A;  1IG5 A;  1B9A A;  3BUO B;  4PE4 A;  2Y5I A;  3PN7 B;  1KK7 Z;  2JXL A;  2SAS A;  1M45 A;  1NCX A;  1QXP A;  1U5I A;  1L7Z A;  4GGN A;  4PHN A;  1ALV A;  4FTG A;  1DJG A;  1BOC A;  1KWO C;  2Q4U A;  1XYD A;  1OMD A;  2KBI A;  5I2Q A;  1NX3 A;  1PK0 D;  4PAL A;  2L4I A;  2MA2 A;  2K61 A;  1DJX A;  1SRA A;  5HYD A;  1NCZ A;  2Y1M A;  2FCE A;  2M1U A;  2ZKM X;  2AMI A;  2LMT A;  1KQV A;  2G9B A;  1MR8 A;  2JU0 A;  3WXA A;  2F2P A;  1MWN A;  3LCP C;  2CBL A;  2KBM A;  1OMR A;  5FYX A;  1J7P A;  3TUY C;  3I5F C;  2L51 A;  3IF7 A;  2JT3 A;  2K7O A;  2ZNE A;  3AKA A;  1K9K A;  3EVR A;  4NQG A;  2KHN A;  3PM8 A;  4P2Y B;  1RK9 A;  4QJ5 B;  4N5X A;  1KSO A;  1L2O B;  3NXA A;  4QJ4 B;  2JC2 A;  1TN4 A;  1S5G Z;  3SG6 A;  2NCP A;  5F6T A;  1ZAC A;  1ZFS A;  1KK7 Y;  2WC8 A;  2MBX A;  3EK4 A;  3OB2 B;  1YUS A;  3PAT A;  1WDC C;  1HQV A;  2WND A;  2LP2 A;  2WOS A;  4P5O E;  1WLZ A;  1CDL A;  1FI5 A;  1YUR A;  4N1G A;  4AOM A;  1EL4 A;  2LMU A;  3HX4 A;  2CCM A;  4OR9 B;  1TNP A;  2EGD A;  2I94 A;  1AP4 A;  2JNX A;  1DGU A;  4AQI A;  2MHH A;  4NDB A;  1SKT A;  2WCF A;  3MSE B;  2LHI A;  3BOW B;  1FPW A;  1IQ5 A;  1F70 A;  1PSR A;  1F4O A;  1SK6 D;  2M7N A;  2BE4 A;  3PLF B;  1NIW A;  1JFK A;  3OP0 A;  2JOJ A;  1CKK A;  2BKI B;  2KI6 D;  2M0R A;  2HF5 A;  1K2H A;  1SW8 A;  2KQY A;  2OTG C;  1S26 D;  1NSH A;  4ORB B;  1BU3 A;  4OVN F;  4GAO A;  1J7O A;  1SR6 B;  2ISD A;  4UPG A;  3KHE A;  4YGB B;  1B8R A;  4DUQ A;  3IQQ A;  4GNK B;  3KO0 A;  1A4P A;  1S5G Y;  1TRF A;  2G2B A;  2M97 A;  2QPT A;  3I5G C;  3DVM A;  3BUM B;  3TDU A;  4ETO A;  1UUR A;  1K95 A;  2GV5 A;  2PVB A;  3RM1 A;  1CFC A;  1BLQ A;  1S6C A;  1LVC D;  3SG5 A;  4WQ2 A;  1JF0 A;  1DJY A;  2L50 A;  1U5I B;  1BJF A;  2IS9 A;  2JTT A;  2LVI A;  3ICB A;  1QX5 B;  1SBJ A;  2CTN A;  4BY4 A;  1OZS A;  2I7A A;  2KFG A;  4C0K A;  2MLE C;  4YGE B;  1E8A A;  3JTD B;  2JT8 A;  1XO5 A;  3O4Y A;  4MRX A;  3PSR A;  2LVV A;  2M8U A;  4YI9 A;  1SCV A;  2K0J A;  1EXR A;  1A03 A;  2GGM A;  1GQM A;  1BR4 B;  2MJW B;  1HT9 A;  1PUL A;  3SG4 A;  1NYA A;  4PHM A;  2L5X B;  4XJK A;  4U8D A;  1F8H A;  2KGB C;  3NSO A;  2NCO A;  3CR5 X;  3PFV A;  3DVE A;  1KK8 C;  3TUY B;  4GPL B;  4HRH A;  1B7T Z;  4M2Q A;  4M2P A;  4GGF C;  2SCP A;  2M9G A;  4I5J A;  1BG1 A;  5D69 A;  4GGF A;  4JWQ A;  1QAS A;  2KAV A;  3HCM A;  1MUX A;  3OHM B;  2BL0 C;  1C07 A;  1R2U A;  1BT6 A;  2KI6 C;  2JRF A;  4CFR A;  1CNP A;  3WNX B;  3BUX B;  3LL8 B;  1WDC B;  1TCF A;  2LHL A;  3O78 A;  1ALW A;  5BPJ A;  1AJ5 A;  2K2A A;  5CSN A;  3E3R A;  1Y0V H;  3SIA A;  5K89 A;  2QAC A;  1QAT A;  3OX6 A;  2KFF A;  4PCW A; 
#chains in the Genus database with same CATH topology
 3AKB A;  5EL2 A;  1JF2 A;  1OW4 A;  2L2C A;  4JPZ B;  2KGR A;  2KSP A;  2GGZ A;  3VRQ A;  1TWO A;  2NLN A;  1RFJ A;  1BMO A;  3OX5 A;  5DKQ A;  5DIC A;  2F33 A;  3D0Y B;  1J1D A;  4CPV A;  4I5N B;  1CMF A;  1B7T Y;  2E30 A;  1GJY A;  2P70 A;  4MZJ A;  1K8U A;  1JC2 A;  3FE6 A;  2BCA A;  2FCD A;  1QIV A;  1QX7 A;  2LLT A;  4OCI A;  1AK8 A;  1S3P A;  1TNX A;  1DGV A;  2BEC A;  3GOF A;  2M49 B;  3BJH A;  2PAS A;  1LXF C;  2QEO A;  3I5G B;  2BCB A;  1J7Q A;  3SG2 A;  2H61 C;  1JBA A;  1K9P A;  1MQ1 A;  1IIO A;  4I5K A;  1TCO B;  2H61 A;  1G8I A;  1F4Q A;  2PYQ A;  2LLU A;  1OMV A;  2KQ6 A;  2F3Y A;  1M39 A;  4ORA B;  1B47 A;  3I5H C;  2LMV A;  3NHT A;  4YRU A;  3OGN A;  1Y6W A;  1RJV A;  4INX A;  1KQM B;  3UO9 A;  1V1F A;  1DTL A;  2PAL A;  4IL1 A;  5I94 A;  2I18 A;  4ZCV A;  2EC6 C;  3GK4 X;  3VRO A;  1TNW A;  1CM4 A;  4BY5 A;  3CWG A;  4PE0 A;  3DF0 B;  2LNK A;  5IBW A;  3Q8I A;  3CR2 A;  4L9M A;  2F2O A;  1DC1 A;  3S0D A;  1M46 A;  1ZUZ A;  2LC5 A;  1LA3 A;  1NPQ A;  3BUN B;  3OB1 B;  2OS8 C;  1EH2 A;  1GGZ A;  2HQ8 A;  2HPS A;  4OV2 A;  5JJG A;  2CXJ A;  1IGV A;  2JNF A;  1KK8 B;  1BR1 B;  1AVS A;  4A4B A;  2FJU B;  4GBA A;  2NXQ A;  4ORC B;  1UP5 A;  2ZFD A;  3CTN A;  2JPO A;  1J7R A;  2L4H A;  1N2D A;  1IRJ A;  4PT1 A;  3FS7 A;  2EHB A;  2BE6 A;  2WOR A;  4YBH B;  5HLV A;  3KF9 A;  1IKU A;  1EJ3 A;  1WY9 A;  1DF0 A;  1B8C A;  1QWV A;  4HSZ A;  1CDM A;  1Z4H A;  4NDC A;  3S0A A;  1KFU L;  2K8M B;  2PQL A;  3PN7 C;  3TDI A;  1S6I A;  1D1O A;  2LVJ A;  4JQ0 D;  3SG7 A;  4PDZ A;  2CT9 A;  1KFU S;  1N0Y A;  2RGI A;  3RLZ A;  1Y1X A;  3WHU B;  2LLS A;  1OZO A;  2L0P A;  5KU1 A;  1ORG A;  2JUL A;  3DD4 A;  1K94 A;  3DVJ A;  1XFY O;  1AHR A;  2LP3 A;  2YGU A;  1NX1 A;  2NZ0 A;  2PRU A;  1CTR A;  5HLO A;  4AQJ A;  1KWO B;  1DJI A;  2HET A;  1M63 B;  4YGD B;  4DS7 A;  2Y4Q A;  4MZK A;  2WCE A;  4ICB A;  1TIZ A;  3IVT A;  3TDZ A;  2V53 A;  4C0J A;  1FI6 A;  1RTP 1;  3TS5 C;  1QV1 A;  3DVK A;  1XFU O;  3KPX A;  5AEQ A;  1W7J B;  1QS7 A;  1SCM C;  2E6W A;  1ZOT B;  1LA0 A;  2WCM A;  2COL B;  2K7B A;  4MZL A;  1K90 D;  1KFX L;  1SMG A;  5AFP A;  2AAO A;  1L2O C;  3EG5 B;  3I5F B;  1DT7 B;  1YX8 A;  3DYE A;  4DIR A;  3D78 A;  1UHH A;  4E68 A;  1KFX S;  1CFP A;  2ZN9 A;  2BNX A;  2JTZ A;  3D10 A;  1JWD A;  1P28 A;  5HKW A;  5I2L A;  2JT0 A;  4WRI A;  4MSP A;  1JUO A;  2KDH A;  2KNE A;  3O4X A;  3I5I C;  1F71 A;  5G08 A;  1SNL A;  4XYN A;  1IWQ A;  3CS1 A;  1DJH A;  2BBM A;  4MLW A;  1MXE A;  1NCY A;  2H2K A;  2ZRS A;  3R72 A;  1B1G A;  2PMY A;  4A4C A;  1TOP A;  1XFV O;  4MRY A;  3GK2 A;  2CNP A;  2LCP A;  2P6B B;  5FI6 A;  4D1E A;  1J1E A;  1PRW A;  1BF5 A;  2JPT A;  2MAZ A;  1CLM A;  1REC A;  2KI4 C;  1QLK A;  2OS8 B;  1YRU B;  2JZI A;  2BCX A;  4FQO A;  2LM5 A;  1DJW A;  2GTE A;  2LAP A;  4PHK A;  2F8P A;  3CYZ A;  4MN0 A;  3C1V A;  2MRD A;  1BOD A;  1UWO A;  3FWB A;  5HKZ A;  1QX2 A;  3PAL A;  2FOT A;  1A75 A;  2OTG B;  3CZ0 A;  3A8R A;  1PVA A;  1CFF A;  2M3W A;  1T14 A;  3SG3 A;  4OKH A;  1XK4 C;  3O2P A;  2L2E A;  5CPV A;  1DEK A;  1UHN A;  1XK4 A;  1OOG A;  3DY9 A;  5D7F A;  3S0G A;  4GUK A;  1XVJ A;  2O5G A;  1CLB A;  1CM1 A;  2MLF C;  5CSF A;  5KSZ A;  2L98 A;  2ZND A;  3JTD C;  2I2R E;  2WCB A;  1CB1 A;  1DMO A;  1NWD A;  2QEB A;  4R1E A;  1YR5 A;  1WLM A;  3VRR A;  4PE1 A;  3D74 A;  1YX7 A;  3FE9 A;  1SL9 A;  3ZNI A;  3B87 A;  3EKH A;  1LKJ A;  1N65 A;  5GQQ C;  3K1E A;  4HRE E;  3NSI A;  3FIA A;  2K7C A;  3JVT C;  4Q04 A;  1B8L A;  1CFD A;  2LE9 B;  1G33 A;  5DKN A;  4DRW A;  2M29 A;  3M0W A;  1TUZ A;  2KYF A;  3NHI A;  3NSL A;  4HRG A;  4IJ7 A;  2ERB A;  3R1V A;  3B86 A;  3LK1 A;  3TS5 B;  4XJK B;  1KSM A;  1QIW A;  1IH0 A;  1F55 A;  1XFW O;  1SCM B;  1ODB A;  2DOQ A;  1S1E A;  1UUS A;  2A4J A;  3BFB A;  3N7H A;  5CSI A;  5TNC A;  5ER4 X;  1FBV A;  2K7D A;  4GFT A;  5PAL A;  5J3X A;  1QVI Z;  2B1U A;  1TTX A;  3CZT X;  1JSA A;  1XA5 A;  1NX0 A;  1RRO A;  4YGC B;  1ZMZ A;  3IQO A;  4DCK A;  1K9U A;  2O60 A;  3CZ1 A;  2L5Y A;  1PSB A;  3F45 A;  4PE7 A;  2KLD A;  3CZ2 A;  4FQT A;  1YRT B;  3CDN A;  1JFJ A;  4C0L A;  2BL0 B;  3I5I B;  4OZD A;  1B4C A;  1PAL A;  3AAJ A;  3BUW B;  1PVB A;  2K2F A;  1S6J A;  1SL8 A;  5DKR A;  1C7W A;  1SYM A;  1WRK A;  4NDD A;  1GGW A;  1WRZ A;  3K21 A;  1YUU A;  3SIB A;  2VRG A;  4F0Z B;  1LIN A;  3PJI A;  1MXL C;  3B88 A;  1KCY A;  3EKJ A;  1EG3 A;  3SS5 A;  2KAX A;  1RWY A;  2ZN8 A;  1OOI X;  1MF8 B;  1YVH A;  4PHJ A;  2KI4 B;  4M2O A;  1UHI A;  3QRX A;  1X02 A;  2JXC A;  4USL A;  3VGO A;  2JQ6 A;  1EG4 A;  2BKH B;  2H8V A;  2Q91 A;  2R2I A;  3BYA A;  5CSJ A;  3D0Y A;  1YTZ C;  1SY9 A;  1IJ6 A;  2D8N A;  3KEV A;  3SS4 A;  1DJZ A;  4MBE A;  1Y1A A;  1YVL A;  1G4Y R;  1OSA A;  1Q80 A;  3TZ1 A;  2LV7 A;  2KYC A;  1A75 B;  1UHJ A;  1A2X A;  2FJY A;  1FF1 A;  3B6X A;  1QVI Y;  1FW4 A;  2ZRT A;  1TNQ A;  1IJ5 A;  1OOJ A;  3UNW A;  4CID A;  3VB1 A;  1CMG A;  2M1K B;  1VRK A;  2TN4 A;  1V1G A;  3BXK A;  3AAK A;  3FWC A;  3A4U B;  3GK1 A;  4QJ3 B;  1TUJ A;  5AAN A;  1C7V A;  3SS3 A;  5I2O A;  1CDN A;  1M31 A;  2AUC A;  5ER5 A;  1XFX O;  4I5L B;  1XFZ O;  4YI8 A;  4CFQ A;  4MEW A;  1UHK A;  1KQM C;  1F54 A;  1QJT A;  4ZCU A;  4WQ3 A;  1AUI B;  4MVF A;  5I8N A;  2JWW A;  4N1F A;  5KTY A;  3BQ3 A;  3I5H B;  3CLN A;  2WCJ A;  1J55 A;  3S0E A;  3NSK A;  3CGA A;  1SL7 A;  3DF0 A;  3D75 A;  3EK8 A;  3EVV A;  3SJS A;  1K96 A;  1YUT A;  3JVT B;  3R1P A;  2EC6 B;  1DVI A;  1WRL A;  1H4B A;  1OOF A;  3EVU A;  2KAY A;  3LK0 A;  3LLE A;  1AJ4 A;  1QLS A;  2HQW A;  3BFH A;  2LUX A;  2OPO A;  1OE9 B;  3DZT A;  3EK7 A;  3BOW A;  2LAN A;  2BBN A;  2Y1N A;  3H4S E;  2M7L A;  3VRN A;  5JOL A;  1NUB A;  1S36 A;  1C3Z A;  5D3O A;  1CDP A;  1DEL A;  4CLN A;  1K93 D;  1NX2 A;  1SPY A;  3D73 A;  1Y1U A;  1IQ3 A;  1H8B A;  2KFH A;  3O6B A;  1SR6 C;  4TNC A;  1NP8 A;  5HKY A;  2KOT A;  2F3Z A;  5B8I B;  1OQP A;  3CR4 X;  5AER A;  1A29 A;  1DF0 B;  1QTX A;  4YGA A;  3WHT B;  2LUC A;  2PSR A;  1OOH A;  1R6P A;  3ZWH A;  1MHO A;  1CLL A;  1W7I B;  5AXI A;  3VRP A;  1QV0 A;  2LVK A;  1IG5 A;  1B9A A;  3BUO B;  4PE4 A;  2Y5I A;  3PN7 B;  4INW A;  1KK7 Z;  2WCL A;  2JXL A;  2SAS A;  1M45 A;  1NCX A;  1QXP A;  1U5I A;  1L7Z A;  2WCK A;  3L4A A;  4GGN A;  4PHN A;  1ALV A;  1SSE B;  1DJG A;  4FTG A;  1BOC A;  1KWO C;  2Q4U A;  1XYD A;  1OMD A;  2KBI A;  5I2Q A;  1NX3 A;  3CAB A;  1PK0 D;  4PAL A;  2L4I A;  2MA2 A;  2K61 A;  1DJX A;  1SRA A;  5HYD A;  1NCZ A;  2Y1M A;  2FCE A;  2M1U A;  2ZKM X;  2AMI A;  2LMT A;  1KQV A;  2G9B A;  1MR8 A;  2JU0 A;  3S0F A;  3WXA A;  2F2P A;  1MWN A;  3LCP C;  2CBL A;  2KBM A;  1OMR A;  3NGV A;  5FYX A;  3RZS A;  3TUY C;  3I5F C;  3BFA A;  1J7P A;  2L51 A;  3IF7 A;  2JT3 A;  2K7O A;  2QEV A;  3L4L A;  2ZNE A;  3AKA A;  1K9K A;  3D76 A;  3EVR A;  4NQG A;  2KHN A;  3PM8 A;  4P2Y B;  1RK9 A;  4QJ5 B;  1C3Y A;  4N5X A;  1KSO A;  1L2O B;  3NXA A;  3DXL A;  4QJ4 B;  2JC2 A;  1TN4 A;  1S5G Z;  3FE8 A;  3SG6 A;  2NCP A;  5F6T A;  1ZAC A;  1ZFS A;  1KK7 Y;  2WC8 A;  2MBX A;  3EK4 A;  3OB2 B;  1YUS A;  3PAT A;  1WDC C;  1HQV A;  2WND A;  2LP2 A;  2WOS A;  4P5O E;  1WLZ A;  1CDL A;  1FI5 A;  1YUR A;  4N1G A;  4AOM A;  1EL4 A;  2LMU A;  3HX4 A;  2CCM A;  4OR9 B;  1TNP A;  2EGD A;  2I94 A;  1AP4 A;  2JNX A;  1DGU A;  4AQI A;  1Z2C B;  2MHH A;  1SKT A;  2WCF A;  3MSE B;  4NDB A;  2LHI A;  3BOW B;  1FPW A;  1IQ5 A;  1F70 A;  1PSR A;  1F4O A;  1SK6 D;  2M7N A;  2BE4 A;  3PLF B;  1NIW A;  4KYN A;  1JFK A;  3OP0 A;  2QEH A;  2JOJ A;  5HL1 A;  2BKI B;  2KI6 D;  2M0R A;  3D77 A;  2HF5 A;  1CKK A;  1SW8 A;  2KQY A;  2OTG C;  3B7A A;  1K2H A;  2QDI A;  1S26 D;  1NSH A;  4ORB B;  1BU3 A;  4OVN F;  4GAO A;  1J7O A;  1SR6 B;  2ISD A;  4UPG A;  3KHE A;  4YGB B;  1XFR A;  1B8R A;  4DUQ A;  3IQQ A;  4GNK B;  2BAP A;  3KO0 A;  1A4P A;  1S5G Y;  1TRF A;  2G2B A;  2M97 A;  2QPT A;  3I5G C;  3DVM A;  3BUM B;  3TDU A;  4ETO A;  1UUR A;  1K95 A;  2GV5 A;  2PVB A;  4F7F A;  3RM1 A;  1CFC A;  1BLQ A;  1S6C A;  1LVC D;  3SG5 A;  4WQ2 A;  1LS8 A;  2P71 A;  1JF0 A;  1DJY A;  2L50 A;  4JKT A;  1U5I B;  4JD9 A;  1BJF A;  2IS9 A;  2JTT A;  2LVI A;  3ICB A;  1QX5 B;  1SBJ A;  2CTN A;  4BY4 A;  1OZS A;  2I7A A;  2KFG A;  4C0K A;  2MLE C;  4YGE B;  1E8A A;  3JTD B;  2JT8 A;  1XO5 A;  2WC5 A;  3O4Y A;  4MRX A;  3PSR A;  2LVV A;  2M8U A;  4YI9 A;  1SCV A;  2K0J A;  1EXR A;  1W9Z A;  3QME A;  1A03 A;  2GGM A;  1GQM A;  1BR4 B;  2MJW B;  1HT9 A;  1PUL A;  3SG4 A;  1NYA A;  4PHM A;  2WC6 A;  3OBV A;  2L5X B;  4XJK A;  4U8D A;  3V2L A;  1F8H A;  2WCH A;  2KGB C;  3NSO A;  5FI2 A;  2NCO A;  3CR5 X;  3PFV A;  3DVE A;  2KPH A;  1KK8 C;  3TUY B;  4GPL B;  3L47 A;  1B7T Z;  4HRH A;  2KLE A;  4M2Q A;  4GGF C;  2SCP A;  4M2P A;  2M9G A;  3S0B A;  4I5J A;  1BG1 A;  5D69 A;  4GGF A;  4JWQ A;  3R1O A;  1QAS A;  2KAV A;  3HCM A;  1MUX A;  3OHM B;  2BL0 C;  5FI7 A;  1C07 A;  1R2U A;  1GM0 A;  1BT6 A;  2KI6 C;  2JRF A;  3PM2 A;  4CFR A;  1CNP A;  1DQE A;  3WNX B;  3BUX B;  3LL8 B;  1WDC B;  2K60 A;  1TCF A;  2LHL A;  3O78 A;  1ALW A;  5BPJ A;  1AJ5 A;  2K2A A;  5CSN A;  3E3R A;  1Y0V H;  3SIA A;  5K89 A;  2QAC A;  1QAT A;  3OX6 A;  2KFF A;  4PCW A; 
#chains in the Genus database with same CATH homology
 3AKB A;  1JF2 A;  4JPZ B;  2KGR A;  2KSP A;  2GGZ A;  3VRQ A;  2NLN A;  3OX5 A;  1RFJ A;  1BMO A;  5DKQ A;  2F33 A;  3D0Y B;  1J1D A;  4CPV A;  4I5N B;  1CMF A;  1B7T Y;  2E30 A;  1GJY A;  4MZJ A;  1K8U A;  1JC2 A;  2BCA A;  2FCD A;  1QIV A;  1QX7 A;  2LLT A;  4OCI A;  1AK8 A;  1S3P A;  1TNX A;  1DGV A;  2BEC A;  3GOF A;  2M49 B;  2PAS A;  1LXF C;  3I5G B;  2BCB A;  1J7Q A;  3SG2 A;  2H61 C;  1JBA A;  1K9P A;  1MQ1 A;  4I5K A;  1TCO B;  2H61 A;  1G8I A;  1F4Q A;  2LLU A;  1OMV A;  2KQ6 A;  2F3Y A;  1M39 A;  4ORA B;  1B47 A;  3I5H C;  2LMV A;  4YRU A;  1Y6W A;  1RJV A;  1KQM B;  1V1F A;  1DTL A;  2PAL A;  4IL1 A;  2I18 A;  4ZCV A;  2EC6 C;  3GK4 X;  3VRO A;  1TNW A;  1CM4 A;  4BY5 A;  3CWG A;  4PE0 A;  3DF0 B;  2LNK A;  5IBW A;  4L9M A;  3CR2 A;  2F2O A;  1M46 A;  1ZUZ A;  2LC5 A;  1LA3 A;  1NPQ A;  3BUN B;  3OB1 B;  2OS8 C;  1EH2 A;  1GGZ A;  2HQ8 A;  2HPS A;  4OV2 A;  5JJG A;  2CXJ A;  1IGV A;  2JNF A;  1KK8 B;  1BR1 B;  1AVS A;  4A4B A;  2FJU B;  4GBA A;  2NXQ A;  4ORC B;  1UP5 A;  2ZFD A;  3CTN A;  1J7R A;  2L4H A;  1N2D A;  1IRJ A;  3FS7 A;  2EHB A;  2BE6 A;  2WOR A;  4YBH B;  5HLV A;  3KF9 A;  1IKU A;  1EJ3 A;  1DF0 A;  1B8C A;  1WY9 A;  4HSZ A;  1CDM A;  4NDC A;  1KFU L;  2K8M B;  3PN7 C;  3TDI A;  1S6I A;  1D1O A;  2LVJ A;  4JQ0 D;  3SG7 A;  4PDZ A;  2CT9 A;  1KFU S;  1N0Y A;  2RGI A;  3RLZ A;  1Y1X A;  3WHU B;  2LLS A;  1OZO A;  2L0P A;  5KU1 A;  2JUL A;  3DD4 A;  1K94 A;  3DVJ A;  1XFY O;  1AHR A;  2LP3 A;  1NX1 A;  2NZ0 A;  2PRU A;  1CTR A;  5HLO A;  4AQJ A;  1KWO B;  1DJI A;  2HET A;  1M63 B;  4YGD B;  4DS7 A;  2Y4Q A;  4MZK A;  2WCE A;  4ICB A;  1TIZ A;  3TDZ A;  2V53 A;  4C0J A;  1FI6 A;  1RTP 1;  3TS5 C;  1QV1 A;  3DVK A;  1XFU O;  3KPX A;  5AEQ A;  1W7J B;  1QS7 A;  1SCM C;  2E6W A;  1ZOT B;  1LA0 A;  4MZL A;  2COL B;  2K7B A;  1K90 D;  1KFX L;  1SMG A;  5AFP A;  2AAO A;  1L2O C;  3I5F B;  1DT7 B;  1YX8 A;  4DIR A;  1UHH A;  4E68 A;  1KFX S;  1CFP A;  2ZN9 A;  2JTZ A;  3D10 A;  1JWD A;  5I2L A;  5HKW A;  2JT0 A;  4WRI A;  4MSP A;  1JUO A;  2KDH A;  2KNE A;  3I5I C;  1F71 A;  5G08 A;  1SNL A;  4XYN A;  1IWQ A;  3CS1 A;  1DJH A;  2BBM A;  4MLW A;  1MXE A;  1NCY A;  2H2K A;  2ZRS A;  1B1G A;  2PMY A;  4A4C A;  1TOP A;  1XFV O;  4MRY A;  3GK2 A;  2CNP A;  2LCP A;  2P6B B;  4D1E A;  1J1E A;  1PRW A;  1BF5 A;  2JPT A;  2MAZ A;  1CLM A;  1REC A;  2KI4 C;  1QLK A;  2OS8 B;  1YRU B;  2JZI A;  2BCX A;  4FQO A;  2LM5 A;  1DJW A;  2LAP A;  4PHK A;  2F8P A;  4MN0 A;  3C1V A;  2MRD A;  1BOD A;  1UWO A;  3FWB A;  5HKZ A;  1QX2 A;  3PAL A;  2FOT A;  1A75 A;  2OTG B;  1CFF A;  3A8R A;  1PVA A;  2M3W A;  3SG3 A;  4OKH A;  1XK4 C;  3O2P A;  2L2E A;  5CPV A;  1UHN A;  1XK4 A;  5D7F A;  4GUK A;  1XVJ A;  2O5G A;  1CLB A;  1CM1 A;  2MLF C;  5CSF A;  5KSZ A;  2L98 A;  2ZND A;  3JTD C;  2I2R E;  2WCB A;  1CB1 A;  1DMO A;  1NWD A;  4R1E A;  1YR5 A;  1WLM A;  3VRR A;  4PE1 A;  3ZNI A;  1YX7 A;  1SL9 A;  3EKH A;  1LKJ A;  1N65 A;  5GQQ C;  4HRE E;  3NSI A;  3FIA A;  2K7C A;  3JVT C;  4Q04 A;  1B8L A;  1CFD A;  2LE9 B;  1G33 A;  5DKN A;  4DRW A;  2M29 A;  3M0W A;  2KYF A;  3NSL A;  4HRG A;  3LK1 A;  3TS5 B;  4XJK B;  1KSM A;  1QIW A;  1IH0 A;  1F55 A;  1XFW O;  1SCM B;  1ODB A;  2DOQ A;  1S1E A;  1UUS A;  2A4J A;  5TNC A;  5CSI A;  5ER4 X;  1FBV A;  2K7D A;  4GFT A;  5PAL A;  5J3X A;  1QVI Z;  2B1U A;  1TTX A;  3CZT X;  1JSA A;  1XA5 A;  1NX0 A;  1RRO A;  4YGC B;  1ZMZ A;  3IQO A;  4DCK A;  1K9U A;  2O60 A;  1PSB A;  3F45 A;  4PE7 A;  1JFJ A;  1YRT B;  4C0L A;  2BL0 B;  3I5I B;  1B4C A;  1PAL A;  3AAJ A;  3BUW B;  1PVB A;  2K2F A;  1S6J A;  1SL8 A;  5DKR A;  1C7W A;  1SYM A;  1WRK A;  4NDD A;  1GGW A;  1WRZ A;  3K21 A;  1YUU A;  3SIB A;  2VRG A;  4F0Z B;  1LIN A;  1MXL C;  1KCY A;  3EKJ A;  1EG3 A;  2KAX A;  1RWY A;  2ZN8 A;  4PHJ A;  1MF8 B;  1YVH A;  2KI4 B;  4M2O A;  1UHI A;  3QRX A;  1X02 A;  2JXC A;  4USL A;  3VGO A;  2JQ6 A;  1EG4 A;  2BKH B;  2Q91 A;  2R2I A;  3BYA A;  5CSJ A;  3D0Y A;  1YTZ C;  1SY9 A;  1IJ6 A;  2D8N A;  3KEV A;  1DJZ A;  4MBE A;  1Y1A A;  1YVL A;  1G4Y R;  1OSA A;  1Q80 A;  3TZ1 A;  2LV7 A;  2KYC A;  1A75 B;  1UHJ A;  1A2X A;  1FF1 A;  1QVI Y;  1FW4 A;  2ZRT A;  1TNQ A;  1IJ5 A;  1OOJ A;  4CID A;  1CMG A;  2M1K B;  1VRK A;  2TN4 A;  1V1G A;  3BXK A;  3AAK A;  3FWC A;  3A4U B;  3GK1 A;  4QJ3 B;  5AAN A;  1C7V A;  5I2O A;  1CDN A;  1M31 A;  2AUC A;  5ER5 A;  1XFX O;  4I5L B;  1XFZ O;  4YI8 A;  4CFQ A;  4MEW A;  1UHK A;  1KQM C;  1F54 A;  1QJT A;  4ZCU A;  4WQ3 A;  1AUI B;  4MVF A;  5I8N A;  2JWW A;  4N1F A;  5KTY A;  3BQ3 A;  3I5H B;  3CLN A;  1J55 A;  3NSK A;  3CGA A;  1SL7 A;  3DF0 A;  3EK8 A;  3EVV A;  3SJS A;  1K96 A;  1YUT A;  3JVT B;  2EC6 B;  1DVI A;  1WRL A;  1H4B A;  3EVU A;  2KAY A;  3LK0 A;  3LLE A;  1AJ4 A;  1QLS A;  2HQW A;  2LUX A;  2OPO A;  1OE9 B;  3EK7 A;  3BOW A;  2LAN A;  2BBN A;  2Y1N A;  3H4S E;  2M7L A;  3VRN A;  5JOL A;  1NUB A;  1S36 A;  1CDP A;  4CLN A;  1K93 D;  1NX2 A;  1SPY A;  1IQ3 A;  1Y1U A;  1H8B A;  2KFH A;  3O6B A;  1SR6 C;  4TNC A;  1NP8 A;  5HKY A;  2KOT A;  2F3Z A;  5B8I B;  1OQP A;  3CR4 X;  5AER A;  1A29 A;  1DF0 B;  1QTX A;  4YGA A;  3WHT B;  2LUC A;  2PSR A;  1R6P A;  3ZWH A;  1MHO A;  1CLL A;  1W7I B;  5AXI A;  3VRP A;  1QV0 A;  2LVK A;  1IG5 A;  1B9A A;  3BUO B;  4PE4 A;  2Y5I A;  3PN7 B;  1KK7 Z;  2JXL A;  2SAS A;  1M45 A;  1NCX A;  1QXP A;  1U5I A;  1L7Z A;  4GGN A;  4PHN A;  1ALV A;  4FTG A;  1DJG A;  1BOC A;  1KWO C;  2Q4U A;  1XYD A;  1OMD A;  2KBI A;  5I2Q A;  1NX3 A;  1PK0 D;  4PAL A;  2L4I A;  2MA2 A;  2K61 A;  1DJX A;  1SRA A;  5HYD A;  1NCZ A;  2Y1M A;  2FCE A;  2M1U A;  2ZKM X;  2AMI A;  2LMT A;  1KQV A;  2G9B A;  1MR8 A;  2JU0 A;  3WXA A;  2F2P A;  1MWN A;  3LCP C;  2CBL A;  2KBM A;  1OMR A;  5FYX A;  1J7P A;  3TUY C;  3I5F C;  2L51 A;  3IF7 A;  2JT3 A;  2K7O A;  2ZNE A;  3AKA A;  1K9K A;  3EVR A;  4NQG A;  2KHN A;  3PM8 A;  4P2Y B;  1RK9 A;  4QJ5 B;  4N5X A;  1KSO A;  1L2O B;  3NXA A;  4QJ4 B;  2JC2 A;  1TN4 A;  1S5G Z;  3SG6 A;  2NCP A;  5F6T A;  1ZAC A;  1ZFS A;  1KK7 Y;  2WC8 A;  2MBX A;  3EK4 A;  3OB2 B;  1YUS A;  3PAT A;  1WDC C;  1HQV A;  2WND A;  2LP2 A;  2WOS A;  4P5O E;  1WLZ A;  1CDL A;  1FI5 A;  1YUR A;  4N1G A;  4AOM A;  1EL4 A;  2LMU A;  3HX4 A;  2CCM A;  4OR9 B;  1TNP A;  2EGD A;  2I94 A;  1AP4 A;  2JNX A;  1DGU A;  4AQI A;  2MHH A;  4NDB A;  1SKT A;  2WCF A;  3MSE B;  2LHI A;  3BOW B;  1FPW A;  1IQ5 A;  1F70 A;  1PSR A;  1F4O A;  1SK6 D;  2M7N A;  2BE4 A;  3PLF B;  1NIW A;  1JFK A;  3OP0 A;  2JOJ A;  1CKK A;  2BKI B;  2KI6 D;  2M0R A;  2HF5 A;  1K2H A;  1SW8 A;  2KQY A;  2OTG C;  1S26 D;  1NSH A;  4ORB B;  1BU3 A;  4OVN F;  4GAO A;  1J7O A;  1SR6 B;  2ISD A;  4UPG A;  3KHE A;  4YGB B;  1B8R A;  4DUQ A;  3IQQ A;  4GNK B;  3KO0 A;  1A4P A;  1S5G Y;  1TRF A;  2G2B A;  2M97 A;  2QPT A;  3I5G C;  3DVM A;  3BUM B;  3TDU A;  4ETO A;  1UUR A;  1K95 A;  2GV5 A;  2PVB A;  3RM1 A;  1CFC A;  1BLQ A;  1S6C A;  1LVC D;  3SG5 A;  4WQ2 A;  1JF0 A;  1DJY A;  2L50 A;  1U5I B;  1BJF A;  2IS9 A;  2JTT A;  2LVI A;  3ICB A;  1QX5 B;  1SBJ A;  2CTN A;  4BY4 A;  1OZS A;  2I7A A;  2KFG A;  4C0K A;  2MLE C;  4YGE B;  1E8A A;  3JTD B;  2JT8 A;  1XO5 A;  3O4Y A;  4MRX A;  3PSR A;  2LVV A;  2M8U A;  4YI9 A;  1SCV A;  2K0J A;  1EXR A;  1A03 A;  2GGM A;  1GQM A;  1BR4 B;  2MJW B;  1HT9 A;  1PUL A;  3SG4 A;  1NYA A;  4PHM A;  2L5X B;  4XJK A;  4U8D A;  1F8H A;  2KGB C;  3NSO A;  2NCO A;  3CR5 X;  3PFV A;  3DVE A;  1KK8 C;  3TUY B;  4GPL B;  4HRH A;  1B7T Z;  4M2Q A;  4M2P A;  4GGF C;  2SCP A;  2M9G A;  4I5J A;  1BG1 A;  5D69 A;  4GGF A;  4JWQ A;  1QAS A;  2KAV A;  3HCM A;  1MUX A;  3OHM B;  2BL0 C;  1C07 A;  1R2U A;  1BT6 A;  2KI6 C;  2JRF A;  4CFR A;  1CNP A;  3WNX B;  3BUX B;  3LL8 B;  1WDC B;  1TCF A;  2LHL A;  3O78 A;  1ALW A;  5BPJ A;  1AJ5 A;  2K2A A;  5CSN A;  3E3R A;  1Y0V H;  3SIA A;  5K89 A;  2QAC A;  1QAT A;  3OX6 A;  2KFF A;  4PCW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...