1B7TY

Myosin digested by papain
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
138
structure length
138
Chain Sequence
PQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic structure of scallop myosin subfragment S1 complexed with MgADP: a novel conformation of the myosin head.
pubmed doi rcsb
molecule tags Myosin
molecule keywords MYOSIN HEAVY CHAIN
total genus 39
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 1999-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1b7tY01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1b7tY02
2H61C 3NSOA 1MXLC 2KI4B 3K21A 1OMVA 4GNKB 2LLTA 4PALA 1BMOA 1UHNA 1NX0A 1DJGA 2OTGB 2PASA 1J55A 3BYAA 2BBNA 3TUYC 4OCIA 5CSFA 1QX5B 5DKNA 1EG3A 3TZ1A 1F8HA 2F2PA 1CMGA 4E68A 2P6BB 3AAKA 2Q91A 2L50A 3KO0A 2HQWA 1CFDA 1JF2A 3CR2A 3EVRA 3LK1A 1QTXA 4XJKA 1ZOTB 1RROA 3WXAA 1NYAA 4I5NB 4CIDA 1S1EA 2K7BA 3IQOA 3GK1A 1CM1A 4YI9A 1K2HA 1WRLA 2MAZA 1OMRA 1XYDA 2OPOA 2WCFA 5HLOA 3QRXA 2KBIA 1OSAA 3FIAA 1NSHA 3BUWB 1EL4A 2KNEA 1GGWA 2JTZA 2M29A 4YGBB 2MJWB 1KK7Z 2M3WA 3SG4A 3RLZA 1F4QA 1KFUL 2HF5A 2K8MB 2M1UA 2BL0C 3I5HB 4N1FA 2BL0B 3I5HC 1K9UA 3FWCA 1XFZO 5TNCA 3TS5B 3OP0A 1IRJA 2KFHA 4D1EA 1M31A 1CLMA 4HREE 3OX6A 1J7OA 1AP4A 4PE7A 3CZTX 1NPQA 4OVNF 4IL1A 3KHEA 4PE0A 4YRUA 2FOTA 1TNPA 5FYXA 4ORAB 1F4OA 2KQ6A 2BCAA 1YR5A 1BLQA 1ZFSA 1OZSA 2JU0A 1S5GZ 2Y4QA 4P2YB 2BCBA 2NZ0A 3PM8A 5ER4X 5KTYA 2CTNA 2GGZA 5I2OA 3PLFB 1PULA 5BPJA 1SKTA 1F70A 1PSBA 1LVCD 1X02A 3BUNB 3DVMA 1B4CA 2HQ8A 1FI5A 1SCMB 2GV5A 4MRXA 3PFVA 3O2PA 1YVLA 1K8UA 3SIBA 1QXPA 1YX7A 2K7CA 4GPLB 5DKRA 1MR8A 3ZWHA 1RECA 4BY5A 2HPSA 1TCOB 4USLA 2OTGC 2LV7A 4JQ0D 4HRHA 1M46A 3VRNA 2KOTA 5K89A 1NCXA 1DTLA 4PHKA 2KBMA 3JTDB 2MHHA 1YVHA 1EXRA 1N2DA 1TTXA 2AMIA 3BUMB 2JNFA 3TDZA 1YUTA 3FWBA 3O4YA 1BR1B 2SCPA 3TDUA 1GGZA 4XYNA 1RK9A 2EHBA 3VRQA 2FJUB 1SRAA 4PE1A 3SG7A 1A4PA 4GAOA 5KSZA 2I18A 4M2QA 2K61A 2JC2A 2V53A 2GGMA 1B47A 2LC5A 4C0KA 4NDCA 4C0LA 4NDBA 1JFKA 3AKAA 3I5GB 1CFPA 1OMDA 1YURA 2MLEC 2WOSA 1JFJA 1C7VA 2LVJA 3BQ3A 1OE9B 3SIAA 1JC2A 2OS8B 1YRUB 5JJGA 2MLFC 1DJYA 1AVSA 1DT7B 1IH0A 4MZLA 1CB1A 1NWDA 2JPTA 4TNCA 3BUXB 1KK8B 1S6CA 3A4UB 3VGOA 3TUYB 4ORCB 1QLSA 5AFPA 3KPXA 3SJSA 3OHMB 2BBMA 3KEVA 5HLVA 3HX4A 4OV2A 1FPWA 1QIWA 2LLUA 3BUOB 2L98A 4DUQA 1XFYO 2ZNDA 2ZRSA 1KSOA 1JBAA 2NCPA 1NP8A 1SK6D 2H61A 2WCEA 3PSRA 3SG5A 3VRRA 1SYMA 1AUIB 1KFXL 4M2OA 1CDNA 1NX2A 4R1EA 2BCXA 3NXAA 2IS9A 3CTNA 1XK4C 3WNXB 2VRGA 1B7TY 1Y1AA 4DIRA 5KU1A 1K95A 2M1KB 3O78A 1IJ6A 3DF0A 2KYFA 1GJYA 1L7ZA 1WDCB 1IQ3A 4MSPA 5CSJA 1GQMA 2LNKA 3IF7A 1UUSA 3TS5C 3ZNIA 2BE6A 4ETOA 1KWOC 1CFFA 2LANA 1SR6B 2K2FA 2L51A 2LAPA 2LUCA 5HYDA 1CTRA 2AAOA 1QVIY 2PVBA 1LA3A 1G4YR 2B1UA 3NSLA 1JUOA 1SPYA 2F33A 2KI4C 2M49B 4MZJA 1HT9A 2PALA 3DVKA 3CGAA 3PN7B 4ORBB 1MHOA 4PCWA 2LVKA 5D69A 4CLNA 1A03A 1M63B 2JOJA 1K94A 1RFJA 1IQ5A 1K96A 1WLMA 1DJWA 1H8BA 1A29A 4QJ5B 2KGRA 2MRDA 3H4SE 2KYCA 3JTDC 3LLEA 3VROA 4A4BA 4DRWA 4I5KA 1U5IB 1FF1A 2NLNA 1UURA 2WNDA 1DMOA 2LUXA 4NDDA 3GOFA 4YGEB 4JWQA 1TRFA 3WHTB 1UHHA 5DKQA 2L4IA 1YTZC 4GGNA 1DJHA 1M45A 2LMUA 4N5XA 1WDCC 1M39A 1PSRA 1TCFA 2A4JA 1IGVA 1V1GA 2M7NA 4Q04A 4WRIA 2BKIB 4DS7A 1BOCA 2ZRTA 4L9MA 5AXIA 3DD4A 1JWDA 1XK4A 1G8IA 4QJ4B 1EH2A 2MA2A 2Y5IA 1IWQA 2I2RE 2PSRA 1KFUS 5B8IB 1J7QA 2MBXA 1R6PA 1XFVO 1ZUZA 1BU3A 4AQJA 1CNPA 1FBVA 1IKUA 1VRKA 5JOLA 5J3XA 2QACA 2JT8A 4OKHA 3DF0B 4GUKA 4PHJA 2LM5A 4ZCVA 1MF8B 1HQVA 2ZFDA 4YI8A 1IG5A 2JTTA 1SBJA 2JRFA 2ZN8A 1F54A 5CSNA 3EK8A 2JNXA 2JQ6A 1TNXA 2KGBC 3CR5X 1LKJA 1DJXA 1SR6C 2KI6C 1XFUO 2EGDA 2KDHA 1B8LA 2M7LA 4CFQA 4P5OE 1AJ5A 1UWOA 3JVTC 3O6BA 3I5FC 1CKKA 3LL8B 2L0PA 3BXKA 1RJVA 2EC6B 3RM1A 1KCYA 1MWNA 5I8NA 2BECA 2QPTA 2LMTA 2Q4UA 4MVFA 1BG1A 1SMGA 3I5IC 1Y0VH 3DVEA 2K7DA 2F2OA 2LP3A 3CLNA 4AQIA 2KSPA 1K90D 1L2OC 2JT3A 1OZOA 1NX3A 2LCPA 3EK7A 1EG4A 1LINA 1S3PA 2JULA 3NSIA 4NQGA 5AERA 3LK0A 1NCZA 1S5GY 1XA5A 2I94A 5PALA 4GGFA 1W7JB 1PVAA 3ICBA 1IJ5A 4YGDB 1AK8A 5CPVA 2F8PA 3PN7C 2LLSA 1H4BA 4GBAA 4PDZA 1CDPA 1JSAA 2KQYA 1N0YA 1XFWO 2M9GA 4ZCUA 2CNPA 4AOMA 3NSKA 3WHUB 2L4HA 1KK8C 4DCKA 3I5IB 4M2PA 1XO5A 4WQ2A 4MBEA 2D8NA 3GK4X 1BT6A 1KSMA 2KAVA 1F55A 2Y1MA 2G9BA 1QS7A 1W7IB 2KFFA 1SL7A 1B1GA 4YBHB 4FQOA 3MSEB 2R2IA 3TDIA 4I5LB 1DVIA 1V1FA 3D10A 1G33A 3EKJA 2LVVA 3C1VA 4MLWA 4QJ3B 4U8DA 2KHNA 1BR4B 1B7TZ 1TNQA 1CLLA 4PHNA 2ZKMX 1Y6WA 3E3RA 3HCMA 4JPZB 4GFTA 1K93D 2H2KA 3F45A 3FS7A 2G2BA 1KQMC 1CLBA 1UHKA 3CR4X 4YGCB 2K2AA 1A2XA 3SG2A 1FW4A 1ZACA 2O60A 5F6TA 2FCEA 1DGVA 2JXLA 1UHIA 1EJ3A 1QX7A 1L2OB 1J7RA 3EVVA 5HKZA 1RWYA 1DJZA 1QJTA 1OOJA 1NIWA 2L2EA 3DVJA 1MQ1A 1YUUA 1AHRA 1BF5A 2FCDA 4C0JA 2LVIA 3EVUA 2EC6C 1QV1A 2DOQA 1TOPA 3M0WA 2CBLA 1TIZA 2OS8C 2JWWA 1N65A 1OQPA 2E6WA 1WRZA 3IQQA 1DGUA 3I5FB 5I2QA 1KK7Y 1SW8A 2O5GA 1DJIA 1QIVA 2PRUA 2RGIA 2WCBA 1R2UA 3I5GC 2K0JA 1DF0A 4MZKA 4MRYA 2JT0A 1YX8A 1RTP1 3D0YB 1SNLA 4MEWA 3AKBA 2F3YA 2KI6D 2Y1NA 1CFCA 1WLZA 1PVBA 2JXCA 2KAYA 2HETA 1E8AA 1KQMB 1QV0A 2F3ZA 1A75B 1S6JA 1AJ4A 1S6IA 1CM4A 1MUXA 4CFRA 2I7AA 2NXQA 1ZMZA 1SL9A 1PK0D 1K9KA 3VRPA 5GQQC 1PRWA 1TN4A 1K9PA 4YGAA 1SCMC 4PE4A 2SASA 1D1OA 1S26D 2CXJA 4XJKB 4OR9B 1QVIZ 1KWOB 2JZIA 1LXFC 1UP5A 3OB2B 2NCOA 1SCVA 1TNWA 2TN4A 4HSZA 3CS1A 5HKWA 5G08A 4GGFC 1ALWA 1LA0A 3LCPC 1NUBA 2BE4A 1C07A 1F71A 1Y1UA 1XFXO 1SY9A 3KF9A 4PHMA 1MXEA 1CDMA 1QLKA 1A75A 1JF0A 1J1DA 1BJFA 1B8CA 2WORA 3OB1B 1KFXS 4CPVA 2ZNEA 4WQ3A 5CSIA 4ICBA 4MN0A 2KAXA 1CMFA 1DF0B 2M97A 1KQVA 2M0RA 1B8RA 3BOWA 2LMVA 1B9AA 3AAJA 2WC8A 1J1EA 1QX2A 2M8UA 4BY4A 2KFGA 2ISDA 1WY9A 3A8RA 1U5IA 3SG6A 1C7WA 2ZN9A 2LE9B 2PMYA 1ALVA 4UPGA 1Q80A 1SL8A 2K7OA 5ER5A 4I5JA 2COLB 5AANA 4F0ZB 5AEQA 2LHLA 1S36A 3PALA 1ODBA 1YUSA 3D0YA 3EK4A 1BODA 4N1GA 3JVTB 1FI6A 4FTGA 3PATA 5D7FA 5HKYA 4A4CA 2BKHB 2LP2A 2E30A 1NCYA 1WRKA 2CT9A 3SG3A 3EKHA 1QATA 1Y1XA 1PALA 5IBWA 5I2LA 3GK2A 1NX1A 3CWGA 1UHJA 3OX5A 1J7PA 2AUCA 3BOWB 2L5XB 1QASA 1YRTB 4HRGA 2CCMA 1CDLA 2LHIA 1XVJA
chains in the Genus database with same CATH superfamily
2H61C 3NSOA 1MXLC 2KI4B 3K21A 1OMVA 4GNKB 2LLTA 4PALA 1BMOA 1UHNA 1NX0A 1DJGA 2OTGB 4JKTA 2PASA 1J55A 2P71A 3BYAA 2BBNA 3TUYC 4OCIA 5CSFA 1IIOA 1QX5B 5DKNA 1EG3A 3TZ1A 1F8HA 2F2PA 1CMGA 4E68A 2JPOA 2P6BB 3AAKA 2Q91A 2L50A 3KO0A 2HQWA 4OZDA 1CFDA 1JF2A 3CR2A 3EVRA 3LK1A 1QTXA 4XJKA 1ZOTB 2L2CA 1RROA 3WXAA 1NYAA 4I5NB 4CIDA 1S1EA 2K7BA 3IQOA 3GK1A 1CM1A 1Z2CB 3R1OA 4YI9A 1K2HA 1WRLA 2MAZA 1OMRA 1XYDA 1DELA 2OPOA 2WCFA 5HLOA 3QRXA 2KBIA 3DZTA 1OSAA 3FIAA 1NSHA 1SSEB 3BUWB 1EL4A 2KNEA 3BFHA 1GGWA 2JTZA 2M29A 4YGBB 2MJWB 1KK7Z 2M3WA 3SG4A 3RLZA 1DC1A 1F4QA 1KFUL 2HF5A 2K8MB 2M1UA 2BL0C 3I5HB 3R1VA 4N1FA 2BL0B 3I5HC 1K9UA 3FWCA 1C3ZA 1OOIX 5EL2A 1XFZO 5TNCA 3TS5B 3OP0A 1IRJA 2KFHA 4D1EA 1M31A 1CLMA 4HREE 3OX6A 1J7OA 1AP4A 4PE7A 3B86A 3CZTX 1NPQA 4OVNF 4IL1A 3KHEA 4PE0A 4YRUA 2FOTA 1TNPA 5FYXA 4ORAB 1F4OA 2KQ6A 2BCAA 1YR5A 1BLQA 1ZFSA 1OZSA 2JU0A 3CZ1A 1S5GZ 3CDNA 2Y4QA 4INWA 4P2YB 2BCBA 2NZ0A 3PM8A 5ER4X 3D76A 5KTYA 2CTNA 2GGZA 5I2OA 3PLFB 1PULA 5BPJA 1SKTA 1F70A 1PSBA 1LVCD 1X02A 3BUNB 3DVMA 3S0EA 1B4CA 2HQ8A 1FI5A 1SCMB 2GV5A 1OOGA 3PFVA 3O2PA 1YVLA 4MRXA 1K8UA 3SIBA 3V2LA 1QXPA 1YX7A 2K7CA 4GPLB 5DKRA 1MR8A 3ZWHA 1RECA 4BY5A 2HPSA 1TCOB 4USLA 2OTGC 2LV7A 3Q8IA 4JQ0D 4HRHA 1M46A 2KPHA 3VRNA 2KOTA 5K89A 1NCXA 1DTLA 4PHKA 2KBMA 3JTDB 2MHHA 1YVHA 1EXRA 1N2DA 1TTXA 2AMIA 3BUMB 2JNFA 3CYZA 1YUTA 3N7HA 3R72A 3FWBA 3O4YA 1BR1B 2SCPA 3TDUA 1GGZA 4XYNA 1RK9A 2EHBA 3VRQA 2QDIA 2FJUB 1SRAA 4PE1A 3SG7A 1A4PA 3RZSA 4GAOA 5KSZA 2I18A 4M2QA 2K61A 2BAPA 2JC2A 2GGMA 1B47A 2LC5A 2V53A 4C0KA 3QMEA 4NDCA 4C0LA 4NDBA 1JFKA 3AKAA 1LS8A 3I5GB 1OMDA 1YURA 2MLEC 2WOSA 1JFJA 1C7VA 2LVJA 3BQ3A 1OE9B 3IVTA 3SIAA 1JC2A 2WCMA 2OS8B 1YRUB 5JJGA 2MLFC 2L5YA 3D77A 1DJYA 1AVSA 1DT7B 1IH0A 4MZLA 1CB1A 1NWDA 1Z4HA 2JPTA 4TNCA 3BUXB 1KK8B 1S6CA 3A4UB 3K1EA 3VGOA 3TUYB 4ORCB 1QLSA 5AFPA 3KPXA 3SJSA 3OHMB 2BBMA 3KEVA 5HLVA 3HX4A 1XFRA 4OV2A 1FPWA 1QIWA 2LLUA 3BUOB 2L98A 4DUQA 1XFYO 2ZNDA 2ZRSA 1KSOA 2ERBA 1JBAA 2NCPA 1NP8A 1SK6D 2H61A 2WCEA 3D78A 3PSRA 3SG5A 3VRRA 1SYMA 1AUIB 1KFXL 4M2OA 1CDNA 1NX2A 4R1EA 2BCXA 3NXAA 2IS9A 3CTNA 1XK4C 3WNXB 2VRGA 1B7TY 1Y1AA 4PT1A 4DIRA 5KU1A 1K95A 2M1KB 3O78A 1IJ6A 3FE9A 3D73A 3DF0A 2KYFA 1GJYA 1L7ZA 1WDCB 1IQ3A 4MSPA 5CSJA 1GQMA 5FI7A 3SS3A 2LNKA 3PM2A 3IF7A 1UUSA 3TS5C 3ZNIA 2BE6A 4ETOA 2WC6A 1KWOC 3B88A 1CFFA 2LANA 1SR6B 2K2FA 2L51A 2LAPA 2LUCA 5HYDA 1CTRA 2AAOA 1QVIY 2PVBA 1LA3A 1G4YR 2B1UA 3NSLA 1JUOA 1SPYA 2QEVA 4JD9A 3S0GA 2F33A 2KI4C 2M49B 4MZJA 1HT9A 2PALA 3DVKA 3CGAA 3PN7B 4ORBB 1MHOA 4PCWA 2LVKA 5D69A 4CLNA 1A03A 1M63B 2JOJA 1K94A 1RFJA 1C3YA 1IQ5A 1K96A 1WLMA 1DJWA 1H8BA 1A29A 4QJ5B 2KGRA 2MRDA 3H4SE 2KYCA 3JTDC 3LLEA 3VROA 4A4BA 4DRWA 4I5KA 1U5IB 1FF1A 2NLNA 1UURA 2WNDA 1DMOA 2LUXA 3CZ0A 4NDDA 3GOFA 4YGEB 4JWQA 1TRFA 3WHTB 1UHHA 5DKQA 2L4IA 1YTZC 4GGNA 4IJ7A 1DJHA 1M45A 2LMUA 4N5XA 1WDCC 3S0FA 1M39A 1PSRA 1TCFA 2A4JA 2GTEA 1IGVA 2WCLA 1V1GA 2M7NA 4Q04A 4WRIA 3D74A 2BKIB 4DS7A 1BOCA 2ZRTA 4L9MA 5AXIA 3DD4A 1JWDA 1XK4A 1G8IA 2K60A 4QJ4B 1EH2A 2MA2A 2Y5IA 1IWQA 2I2RE 2PSRA 1KFUS 5B8IB 5HL1A 2BNXA 1J7QA 2MBXA 1R6PA 1XFVO 1ZUZA 1BU3A 4AQJA 1CFPA 1CNPA 3NHIA 1FBVA 1IKUA 1VRKA 5JOLA 5J3XA 1OOFA 2QACA 2JT8A 4OKHA 3DF0B 4GUKA 4PHJA 2LM5A 4ZCVA 3UO9A 1MF8B 1HQVA 2ZFDA 4YI8A 1IG5A 2JTTA 1SBJA 2JRFA 2ZN8A 1F54A 5CSNA 3EK8A 1GM0A 2JNXA 2JQ6A 1TNXA 2KGBC 3CR5X 1LKJA 1DJXA 1SR6C 2KI6C 1XFUO 2EGDA 2KDHA 1B8LA 2M7LA 4CFQA 4P5OE 1AJ5A 1UWOA 3JVTC 3O6BA 3OBVA 3I5FC 1CKKA 3FE8A 3LL8B 2L0PA 3BXKA 1RJVA 2EC6B 5FI2A 3RM1A 1KCYA 1MWNA 3DY9A 2BECA 2QPTA 5I8NA 2LMTA 2Q4UA 4MVFA 1BG1A 1SMGA 3I5IC 1Y0VH 3DVEA 2K7DA 2F2OA 2LP3A 3BFBA 3CLNA 5D3OA 3O4XA 4AQIA 2KSPA 1K90D 1L2OC 2JT3A 1OZOA 1NX3A 2LCPA 3EK7A 1EG4A 1LINA 1S3PA 2JULA 3NSIA 4NQGA 5AERA 3LK0A 1NCZA 1S5GY 1XA5A 2I94A 2KLEA 3B87A 3L4LA 4GGFA 5PALA 3S0BA 1W7JB 1PVAA 3ICBA 1IJ5A 4YGDB 4KYNA 3CABA 1AK8A 5CPVA 2F8PA 3PN7C 2LLSA 1H4BA 4GBAA 4PDZA 1CDPA 3L4AA 1JSAA 2KQYA 1N0YA 1XFWO 2M9GA 4ZCUA 2CNPA 4AOMA 1OW4A 3NSKA 3WHUB 2L4HA 1KK8C 4DCKA 3I5IB 1W9ZA 4M2PA 1XO5A 2QEBA 4WQ2A 4MBEA 2D8NA 3GK4X 1BT6A 3UNWA 1KSMA 2KAVA 1F55A 2Y1MA 2G9BA 1QS7A 1W7IB 3NGVA 3S0AA 2KFFA 2KLDA 1SL7A 1B1GA 4YBHB 4FQOA 3MSEB 2PYQA 2R2IA 3TDIA 4I5LB 1DVIA 1V1FA 3D10A 1G33A 3DYEA 2LVVA 3C1VA 3EKJA 4MLWA 4QJ3B 4U8DA 1TUJA 1DQEA 2KHNA 1BR4B 1B7TZ 1TNQA 1CLLA 4PHNA 2ZKMX 1Y6WA 3E3RA 3HCMA 4JPZB 4GFTA 1K93D 2WC5A 2H2KA 3F45A 3FS7A 3DXLA 2G2BA 1KQMC 1CLBA 1UHKA 3CR4X 4YGCB 2K2AA 3NHTA 1A2XA 3SG2A 1FW4A 1ZACA 2O60A 5F6TA 1OOHA 1DGVA 2FCEA 2JXLA 1UHIA 1EJ3A 1QX7A 1L2OB 1J7RA 2H8VA 3EVVA 1RWYA 1DJZA 1QJTA 1OOJA 1NIWA 2L2EA 3DVJA 1MQ1A 3TDZA 1YUUA 1AHRA 1BF5A 2FCDA 4C0JA 2LVIA 3EVUA 2EC6C 1QV1A 2DOQA 1TOPA 3M0WA 2CBLA 1TIZA 2OS8C 1TUZA 2JWWA 1N65A 1OQPA 2E6WA 1WRZA 3IQQA 1DGUA 3I5FB 5I2QA 1KK7Y 1SW8A 3VB1A 2O5GA 1DJIA 1QIVA 2PRUA 2RGIA 2WCBA 1R2UA 3I5GC 2K0JA 1DF0A 4MZKA 3PJIA 4MRYA 2JT0A 1YX8A 3SS4A 1RTP1 3D0YB 1SNLA 4INXA 4MEWA 3AKBA 2F3YA 2KI6D 2Y1NA 1CFCA 1WLZA 1PVBA 2JXCA 2KAYA 2HETA 1E8AA 1KQMB 1QV0A 2F3ZA 2WCJA 1T14A 3BFAA 1A75B 1S6JA 1AJ4A 3S0DA 1S6IA 1CM4A 1MUXA 4CFRA 2I7AA 2NXQA 1ZMZA 1SL9A 1PK0D 1K9KA 3VRPA 5GQQC 1PRWA 1TN4A 1K9PA 4YGAA 1SCMC 4PE4A 2SASA 1D1OA 3L47A 1S26D 2CXJA 4XJKB 4OR9B 1QVIZ 1KWOB 2JZIA 1LXFC 1UP5A 3OB2B 2NCOA 1SCVA 1TNWA 2TN4A 2YGUA 3BJHA 3EG5B 4FQTA 4HSZA 3CS1A 5HKWA 5G08A 4GGFC 1ALWA 1LA0A 3LCPC 1NUBA 2BE4A 4F7FA 1C07A 1F71A 1Y1UA 1XFXO 1SY9A 3KF9A 4PHMA 1MXEA 1CDMA 1QLKA 1A75A 1P28A 1JF0A 1J1DA 3OGNA 1BJFA 1B8CA 2WORA 3FE6A 1ORGA 3OB1B 1KFXS 4CPVA 2ZNEA 4WQ3A 5CSIA 4ICBA 5DICA 4MN0A 2KAXA 1CMFA 1DF0B 2M97A 1KQVA 2M0RA 1B8RA 3BOWA 2FJYA 2LMVA 1B9AA 3AAJA 2WC8A 1J1EA 1QX2A 2M8UA 4BY4A 2KFGA 2ISDA 1WY9A 1QWVA 3A8RA 1U5IA 3SG6A 1C7WA 2ZN9A 1TWOA 2LE9B 2PMYA 1ALVA 2QEHA 3B7AA 5FI6A 4UPGA 1Q80A 1SL8A 2K7OA 5ER5A 4I5JA 2COLB 5AANA 3CZ2A 5AEQA 2LHLA 4F0ZB 1S36A 3PALA 1ODBA 1YUSA 3D0YA 3EK4A 1BODA 4N1GA 3D75A 3JVTB 4FTGA 3B6XA 2PQLA 1FI6A 5HKZA 2WCHA 3PATA 2QEOA 5D7FA 3R1PA 5HKYA 4A4CA 2BKHB 2LP2A 2E30A 1NCYA 1WRKA 2CT9A 3SG3A 3EKHA 2P70A 1DEKA 1QATA 1Y1XA 1PALA 5IBWA 5I2LA 3GK2A 1NX1A 3CWGA 1UHJA 3OX5A 1J7PA 2AUCA 3BOWB 3SS5A 2L5XB 1QASA 5I94A 1YRTB 4HRGA 2CCMA 1CDLA 2LHIA 1XVJA 2WCKA
chains in the Genus database with same CATH topology
2H61C 3NSOA 1MXLC 2KI4B 3K21A 1OMVA 4GNKB 2LLTA 4PALA 1BMOA 1UHNA 1NX0A 1DJGA 2OTGB 2PASA 1J55A 3BYAA 2BBNA 3TUYC 4OCIA 5CSFA 1QX5B 5DKNA 1EG3A 3TZ1A 1F8HA 2F2PA 1CMGA 4E68A 2P6BB 3AAKA 2Q91A 2L50A 3KO0A 2HQWA 1CFDA 1JF2A 3CR2A 3EVRA 3LK1A 1QTXA 4XJKA 1ZOTB 1RROA 3WXAA 1NYAA 4I5NB 4CIDA 1S1EA 2K7BA 3IQOA 3GK1A 1CM1A 4YI9A 1K2HA 1WRLA 2MAZA 1OMRA 1XYDA 2OPOA 2WCFA 5HLOA 3QRXA 2KBIA 1OSAA 3FIAA 1NSHA 3BUWB 1EL4A 2KNEA 1GGWA 2JTZA 2M29A 4YGBB 2MJWB 1KK7Z 2M3WA 3SG4A 3RLZA 1F4QA 1KFUL 2HF5A 2K8MB 2M1UA 2BL0C 3I5HB 4N1FA 2BL0B 3I5HC 1K9UA 3FWCA 1XFZO 5TNCA 3TS5B 3OP0A 1IRJA 2KFHA 4D1EA 1M31A 1CLMA 4HREE 3OX6A 1J7OA 1AP4A 4PE7A 3CZTX 1NPQA 4OVNF 4IL1A 3KHEA 4PE0A 4YRUA 2FOTA 1TNPA 5FYXA 4ORAB 1F4OA 2KQ6A 2BCAA 1YR5A 1BLQA 1ZFSA 1OZSA 2JU0A 1S5GZ 2Y4QA 4P2YB 2BCBA 2NZ0A 3PM8A 5ER4X 5KTYA 2CTNA 2GGZA 5I2OA 3PLFB 1PULA 5BPJA 1SKTA 1F70A 1PSBA 1LVCD 1X02A 3BUNB 3DVMA 1B4CA 2HQ8A 1FI5A 1SCMB 2GV5A 4MRXA 3PFVA 3O2PA 1YVLA 1K8UA 3SIBA 1QXPA 1YX7A 2K7CA 4GPLB 5DKRA 1MR8A 3ZWHA 1RECA 4BY5A 2HPSA 1TCOB 4USLA 2OTGC 2LV7A 4JQ0D 4HRHA 1M46A 3VRNA 2KOTA 5K89A 1NCXA 1DTLA 4PHKA 2KBMA 3JTDB 2MHHA 1YVHA 1EXRA 1N2DA 1TTXA 2AMIA 3BUMB 2JNFA 3TDZA 1YUTA 3FWBA 3O4YA 1BR1B 2SCPA 3TDUA 1GGZA 4XYNA 1RK9A 2EHBA 3VRQA 2FJUB 1SRAA 4PE1A 3SG7A 1A4PA 4GAOA 5KSZA 2I18A 4M2QA 2K61A 2JC2A 2V53A 2GGMA 1B47A 2LC5A 4C0KA 4NDCA 4C0LA 4NDBA 1JFKA 3AKAA 3I5GB 1CFPA 1OMDA 1YURA 2MLEC 2WOSA 1JFJA 1C7VA 2LVJA 3BQ3A 1OE9B 3SIAA 1JC2A 2OS8B 1YRUB 5JJGA 2MLFC 1DJYA 1AVSA 1DT7B 1IH0A 4MZLA 1CB1A 1NWDA 2JPTA 4TNCA 3BUXB 1KK8B 1S6CA 3A4UB 3VGOA 3TUYB 4ORCB 1QLSA 5AFPA 3KPXA 3SJSA 3OHMB 2BBMA 3KEVA 5HLVA 3HX4A 4OV2A 1FPWA 1QIWA 2LLUA 3BUOB 2L98A 4DUQA 1XFYO 2ZNDA 2ZRSA 1KSOA 1JBAA 2NCPA 1NP8A 1SK6D 2H61A 2WCEA 3PSRA 3SG5A 3VRRA 1SYMA 1AUIB 1KFXL 4M2OA 1CDNA 1NX2A 4R1EA 2BCXA 3NXAA 2IS9A 3CTNA 1XK4C 3WNXB 2VRGA 1B7TY 1Y1AA 4DIRA 5KU1A 1K95A 2M1KB 3O78A 1IJ6A 3DF0A 2KYFA 1GJYA 1L7ZA 1WDCB 1IQ3A 4MSPA 5CSJA 1GQMA 2LNKA 3IF7A 1UUSA 3TS5C 3ZNIA 2BE6A 4ETOA 1KWOC 1CFFA 2LANA 1SR6B 2K2FA 2L51A 2LAPA 2LUCA 5HYDA 1CTRA 2AAOA 1QVIY 2PVBA 1LA3A 1G4YR 2B1UA 3NSLA 1JUOA 1SPYA 2F33A 2KI4C 2M49B 4MZJA 1HT9A 2PALA 3DVKA 3CGAA 3PN7B 4ORBB 1MHOA 4PCWA 2LVKA 5D69A 4CLNA 1A03A 1M63B 2JOJA 1K94A 1RFJA 1IQ5A 1K96A 1WLMA 1DJWA 1H8BA 1A29A 4QJ5B 2KGRA 2MRDA 3H4SE 2KYCA 3JTDC 3LLEA 3VROA 4A4BA 4DRWA 4I5KA 1U5IB 1FF1A 2NLNA 1UURA 2WNDA 1DMOA 2LUXA 4NDDA 3GOFA 4YGEB 4JWQA 1TRFA 3WHTB 1UHHA 5DKQA 2L4IA 1YTZC 4GGNA 1DJHA 1M45A 2LMUA 4N5XA 1WDCC 1M39A 1PSRA 1TCFA 2A4JA 1IGVA 1V1GA 2M7NA 4Q04A 4WRIA 2BKIB 4DS7A 1BOCA 2ZRTA 4L9MA 5AXIA 3DD4A 1JWDA 1XK4A 1G8IA 4QJ4B 1EH2A 2MA2A 2Y5IA 1IWQA 2I2RE 2PSRA 1KFUS 5B8IB 1J7QA 2MBXA 1R6PA 1XFVO 1ZUZA 1BU3A 4AQJA 1CNPA 1FBVA 1IKUA 1VRKA 5JOLA 5J3XA 2QACA 2JT8A 4OKHA 3DF0B 4GUKA 4PHJA 2LM5A 4ZCVA 1MF8B 1HQVA 2ZFDA 4YI8A 1IG5A 2JTTA 1SBJA 2JRFA 2ZN8A 1F54A 5CSNA 3EK8A 2JNXA 2JQ6A 1TNXA 2KGBC 3CR5X 1LKJA 1DJXA 1SR6C 2KI6C 1XFUO 2EGDA 2KDHA 1B8LA 2M7LA 4CFQA 4P5OE 1AJ5A 1UWOA 3JVTC 3O6BA 3I5FC 1CKKA 3LL8B 2L0PA 3BXKA 1RJVA 2EC6B 3RM1A 1KCYA 1MWNA 5I8NA 2BECA 2QPTA 2LMTA 2Q4UA 4MVFA 1BG1A 1SMGA 3I5IC 1Y0VH 3DVEA 2K7DA 2F2OA 2LP3A 3CLNA 4AQIA 2KSPA 1K90D 1L2OC 2JT3A 1OZOA 1NX3A 2LCPA 3EK7A 1EG4A 1LINA 1S3PA 2JULA 3NSIA 4NQGA 5AERA 3LK0A 1NCZA 1S5GY 1XA5A 2I94A 5PALA 4GGFA 1W7JB 1PVAA 3ICBA 1IJ5A 4YGDB 1AK8A 5CPVA 2F8PA 3PN7C 2LLSA 1H4BA 4GBAA 4PDZA 1CDPA 1JSAA 2KQYA 1N0YA 1XFWO 2M9GA 4ZCUA 2CNPA 4AOMA 3NSKA 3WHUB 2L4HA 1KK8C 4DCKA 3I5IB 4M2PA 1XO5A 4WQ2A 4MBEA 2D8NA 3GK4X 1BT6A 1KSMA 2KAVA 1F55A 2Y1MA 2G9BA 1QS7A 1W7IB 2KFFA 1SL7A 1B1GA 4YBHB 4FQOA 3MSEB 2R2IA 3TDIA 4I5LB 1DVIA 1V1FA 3D10A 1G33A 3EKJA 2LVVA 3C1VA 4MLWA 4QJ3B 4U8DA 2KHNA 1BR4B 1B7TZ 1TNQA 1CLLA 4PHNA 2ZKMX 1Y6WA 3E3RA 3HCMA 4JPZB 4GFTA 1K93D 2H2KA 3F45A 3FS7A 2G2BA 1KQMC 1CLBA 1UHKA 3CR4X 4YGCB 2K2AA 1A2XA 3SG2A 1FW4A 1ZACA 2O60A 5F6TA 2FCEA 1DGVA 2JXLA 1UHIA 1EJ3A 1QX7A 1L2OB 1J7RA 3EVVA 5HKZA 1RWYA 1DJZA 1QJTA 1OOJA 1NIWA 2L2EA 3DVJA 1MQ1A 1YUUA 1AHRA 1BF5A 2FCDA 4C0JA 2LVIA 3EVUA 2EC6C 1QV1A 2DOQA 1TOPA 3M0WA 2CBLA 1TIZA 2OS8C 2JWWA 1N65A 1OQPA 2E6WA 1WRZA 3IQQA 1DGUA 3I5FB 5I2QA 1KK7Y 1SW8A 2O5GA 1DJIA 1QIVA 2PRUA 2RGIA 2WCBA 1R2UA 3I5GC 2K0JA 1DF0A 4MZKA 4MRYA 2JT0A 1YX8A 1RTP1 3D0YB 1SNLA 4MEWA 3AKBA 2F3YA 2KI6D 2Y1NA 1CFCA 1WLZA 1PVBA 2JXCA 2KAYA 2HETA 1E8AA 1KQMB 1QV0A 2F3ZA 1A75B 1S6JA 1AJ4A 1S6IA 1CM4A 1MUXA 4CFRA 2I7AA 2NXQA 1ZMZA 1SL9A 1PK0D 1K9KA 3VRPA 5GQQC 1PRWA 1TN4A 1K9PA 4YGAA 1SCMC 4PE4A 2SASA 1D1OA 1S26D 2CXJA 4XJKB 4OR9B 1QVIZ 1KWOB 2JZIA 1LXFC 1UP5A 3OB2B 2NCOA 1SCVA 1TNWA 2TN4A 4HSZA 3CS1A 5HKWA 5G08A 4GGFC 1ALWA 1LA0A 3LCPC 1NUBA 2BE4A 1C07A 1F71A 1Y1UA 1XFXO 1SY9A 3KF9A 4PHMA 1MXEA 1CDMA 1QLKA 1A75A 1JF0A 1J1DA 1BJFA 1B8CA 2WORA 3OB1B 1KFXS 4CPVA 2ZNEA 4WQ3A 5CSIA 4ICBA 4MN0A 2KAXA 1CMFA 1DF0B 2M97A 1KQVA 2M0RA 1B8RA 3BOWA 2LMVA 1B9AA 3AAJA 2WC8A 1J1EA 1QX2A 2M8UA 4BY4A 2KFGA 2ISDA 1WY9A 3A8RA 1U5IA 3SG6A 1C7WA 2ZN9A 2LE9B 2PMYA 1ALVA 4UPGA 1Q80A 1SL8A 2K7OA 5ER5A 4I5JA 2COLB 5AANA 4F0ZB 5AEQA 2LHLA 1S36A 3PALA 1ODBA 1YUSA 3D0YA 3EK4A 1BODA 4N1GA 3JVTB 1FI6A 4FTGA 3PATA 5D7FA 5HKYA 4A4CA 2BKHB 2LP2A 2E30A 1NCYA 1WRKA 2CT9A 3SG3A 3EKHA 1QATA 1Y1XA 1PALA 5IBWA 5I2LA 3GK2A 1NX1A 3CWGA 1UHJA 3OX5A 1J7PA 2AUCA 3BOWB 2L5XB 1QASA 1YRTB 4HRGA 2CCMA 1CDLA 2LHIA 1XVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H61 C;  3NSO A;  1MXL C;  2KI4 B;  3K21 A;  1OMV A;  4GNK B;  2LLT A;  4PAL A;  1BMO A;  1UHN A;  1NX0 A;  1DJG A;  2OTG B;  2PAS A;  1J55 A;  3BYA A;  2BBN A;  3TUY C;  4OCI A;  5CSF A;  1QX5 B;  5DKN A;  1EG3 A;  3TZ1 A;  1F8H A;  2F2P A;  1CMG A;  4E68 A;  2P6B B;  3AAK A;  2Q91 A;  2L50 A;  3KO0 A;  2HQW A;  1CFD A;  1JF2 A;  3CR2 A;  3EVR A;  3LK1 A;  1QTX A;  4XJK A;  1ZOT B;  1RRO A;  3WXA A;  1NYA A;  4I5N B;  4CID A;  1S1E A;  2K7B A;  3IQO A;  3GK1 A;  1CM1 A;  4YI9 A;  1K2H A;  1WRL A;  2MAZ A;  1OMR A;  1XYD A;  2OPO A;  2WCF A;  5HLO A;  3QRX A;  2KBI A;  1OSA A;  3FIA A;  1NSH A;  3BUW B;  1EL4 A;  2KNE A;  1GGW A;  2JTZ A;  2M29 A;  4YGB B;  2MJW B;  1KK7 Z;  2M3W A;  3SG4 A;  3RLZ A;  1F4Q A;  1KFU L;  2HF5 A;  2K8M B;  2M1U A;  2BL0 C;  3I5H B;  4N1F A;  2BL0 B;  3I5H C;  1K9U A;  3FWC A;  1XFZ O;  5TNC A;  3TS5 B;  3OP0 A;  1IRJ A;  2KFH A;  4D1E A;  1M31 A;  1CLM A;  4HRE E;  3OX6 A;  1J7O A;  1AP4 A;  4PE7 A;  3CZT X;  1NPQ A;  4OVN F;  4IL1 A;  3KHE A;  4PE0 A;  4YRU A;  2FOT A;  1TNP A;  5FYX A;  4ORA B;  1F4O A;  2KQ6 A;  2BCA A;  1YR5 A;  1BLQ A;  1ZFS A;  1OZS A;  2JU0 A;  1S5G Z;  2Y4Q A;  4P2Y B;  2BCB A;  2NZ0 A;  3PM8 A;  5ER4 X;  5KTY A;  2CTN A;  2GGZ A;  5I2O A;  3PLF B;  1PUL A;  5BPJ A;  1SKT A;  1F70 A;  1PSB A;  1LVC D;  1X02 A;  3BUN B;  3DVM A;  1B4C A;  2HQ8 A;  1FI5 A;  1SCM B;  2GV5 A;  4MRX A;  3PFV A;  3O2P A;  1YVL A;  1K8U A;  3SIB A;  1QXP A;  1YX7 A;  2K7C A;  4GPL B;  5DKR A;  1MR8 A;  3ZWH A;  1REC A;  4BY5 A;  2HPS A;  1TCO B;  4USL A;  2OTG C;  2LV7 A;  4JQ0 D;  4HRH A;  1M46 A;  3VRN A;  2KOT A;  5K89 A;  1NCX A;  1DTL A;  4PHK A;  2KBM A;  3JTD B;  2MHH A;  1YVH A;  1EXR A;  1N2D A;  1TTX A;  2AMI A;  3BUM B;  2JNF A;  3TDZ A;  1YUT A;  3FWB A;  3O4Y A;  1BR1 B;  2SCP A;  3TDU A;  1GGZ A;  4XYN A;  1RK9 A;  2EHB A;  3VRQ A;  2FJU B;  1SRA A;  4PE1 A;  3SG7 A;  1A4P A;  4GAO A;  5KSZ A;  2I18 A;  4M2Q A;  2K61 A;  2JC2 A;  2V53 A;  2GGM A;  1B47 A;  2LC5 A;  4C0K A;  4NDC A;  4C0L A;  4NDB A;  1JFK A;  3AKA A;  3I5G B;  1CFP A;  1OMD A;  1YUR A;  2MLE C;  2WOS A;  1JFJ A;  1C7V A;  2LVJ A;  3BQ3 A;  1OE9 B;  3SIA A;  1JC2 A;  2OS8 B;  1YRU B;  5JJG A;  2MLF C;  1DJY A;  1AVS A;  1DT7 B;  1IH0 A;  4MZL A;  1CB1 A;  1NWD A;  2JPT A;  4TNC A;  3BUX B;  1KK8 B;  1S6C A;  3A4U B;  3VGO A;  3TUY B;  4ORC B;  1QLS A;  5AFP A;  3KPX A;  3SJS A;  3OHM B;  2BBM A;  3KEV A;  5HLV A;  3HX4 A;  4OV2 A;  1FPW A;  1QIW A;  2LLU A;  3BUO B;  2L98 A;  4DUQ A;  1XFY O;  2ZND A;  2ZRS A;  1KSO A;  1JBA A;  2NCP A;  1NP8 A;  1SK6 D;  2H61 A;  2WCE A;  3PSR A;  3SG5 A;  3VRR A;  1SYM A;  1AUI B;  1KFX L;  4M2O A;  1CDN A;  1NX2 A;  4R1E A;  2BCX A;  3NXA A;  2IS9 A;  3CTN A;  1XK4 C;  3WNX B;  2VRG A;  1B7T Y;  1Y1A A;  4DIR A;  5KU1 A;  1K95 A;  2M1K B;  3O78 A;  1IJ6 A;  3DF0 A;  2KYF A;  1GJY A;  1L7Z A;  1WDC B;  1IQ3 A;  4MSP A;  5CSJ A;  1GQM A;  2LNK A;  3IF7 A;  1UUS A;  3TS5 C;  3ZNI A;  2BE6 A;  4ETO A;  1KWO C;  1CFF A;  2LAN A;  1SR6 B;  2K2F A;  2L51 A;  2LAP A;  2LUC A;  5HYD A;  1CTR A;  2AAO A;  1QVI Y;  2PVB A;  1LA3 A;  1G4Y R;  2B1U A;  3NSL A;  1JUO A;  1SPY A;  2F33 A;  2KI4 C;  2M49 B;  4MZJ A;  1HT9 A;  2PAL A;  3DVK A;  3CGA A;  3PN7 B;  4ORB B;  1MHO A;  4PCW A;  2LVK A;  5D69 A;  4CLN A;  1A03 A;  1M63 B;  2JOJ A;  1K94 A;  1RFJ A;  1IQ5 A;  1K96 A;  1WLM A;  1DJW A;  1H8B A;  1A29 A;  4QJ5 B;  2KGR A;  2MRD A;  3H4S E;  2KYC A;  3JTD C;  3LLE A;  3VRO A;  4A4B A;  4DRW A;  4I5K A;  1U5I B;  1FF1 A;  2NLN A;  1UUR A;  2WND A;  1DMO A;  2LUX A;  4NDD A;  3GOF A;  4YGE B;  4JWQ A;  1TRF A;  3WHT B;  1UHH A;  5DKQ A;  2L4I A;  1YTZ C;  4GGN A;  1DJH A;  1M45 A;  2LMU A;  4N5X A;  1WDC C;  1M39 A;  1PSR A;  1TCF A;  2A4J A;  1IGV A;  1V1G A;  2M7N A;  4Q04 A;  4WRI A;  2BKI B;  4DS7 A;  1BOC A;  2ZRT A;  4L9M A;  5AXI A;  3DD4 A;  1JWD A;  1XK4 A;  1G8I A;  4QJ4 B;  1EH2 A;  2MA2 A;  2Y5I A;  1IWQ A;  2I2R E;  2PSR A;  1KFU S;  5B8I B;  1J7Q A;  2MBX A;  1R6P A;  1XFV O;  1ZUZ A;  1BU3 A;  4AQJ A;  1CNP A;  1FBV A;  1IKU A;  1VRK A;  5JOL A;  5J3X A;  2QAC A;  2JT8 A;  4OKH A;  3DF0 B;  4GUK A;  4PHJ A;  2LM5 A;  4ZCV A;  1MF8 B;  1HQV A;  2ZFD A;  4YI8 A;  1IG5 A;  2JTT A;  1SBJ A;  2JRF A;  2ZN8 A;  1F54 A;  5CSN A;  3EK8 A;  2JNX A;  2JQ6 A;  1TNX A;  2KGB C;  3CR5 X;  1LKJ A;  1DJX A;  1SR6 C;  2KI6 C;  1XFU O;  2EGD A;  2KDH A;  1B8L A;  2M7L A;  4CFQ A;  4P5O E;  1AJ5 A;  1UWO A;  3JVT C;  3O6B A;  3I5F C;  1CKK A;  3LL8 B;  2L0P A;  3BXK A;  1RJV A;  2EC6 B;  3RM1 A;  1KCY A;  1MWN A;  5I8N A;  2BEC A;  2QPT A;  2LMT A;  2Q4U A;  4MVF A;  1BG1 A;  1SMG A;  3I5I C;  1Y0V H;  3DVE A;  2K7D A;  2F2O A;  2LP3 A;  3CLN A;  4AQI A;  2KSP A;  1K90 D;  1L2O C;  2JT3 A;  1OZO A;  1NX3 A;  2LCP A;  3EK7 A;  1EG4 A;  1LIN A;  1S3P A;  2JUL A;  3NSI A;  4NQG A;  5AER A;  3LK0 A;  1NCZ A;  1S5G Y;  1XA5 A;  2I94 A;  5PAL A;  4GGF A;  1W7J B;  1PVA A;  3ICB A;  1IJ5 A;  4YGD B;  1AK8 A;  5CPV A;  2F8P A;  3PN7 C;  2LLS A;  1H4B A;  4GBA A;  4PDZ A;  1CDP A;  1JSA A;  2KQY A;  1N0Y A;  1XFW O;  2M9G A;  4ZCU A;  2CNP A;  4AOM A;  3NSK A;  3WHU B;  2L4H A;  1KK8 C;  4DCK A;  3I5I B;  4M2P A;  1XO5 A;  4WQ2 A;  4MBE A;  2D8N A;  3GK4 X;  1BT6 A;  1KSM A;  2KAV A;  1F55 A;  2Y1M A;  2G9B A;  1QS7 A;  1W7I B;  2KFF A;  1SL7 A;  1B1G A;  4YBH B;  4FQO A;  3MSE B;  2R2I A;  3TDI A;  4I5L B;  1DVI A;  1V1F A;  3D10 A;  1G33 A;  3EKJ A;  2LVV A;  3C1V A;  4MLW A;  4QJ3 B;  4U8D A;  2KHN A;  1BR4 B;  1B7T Z;  1TNQ A;  1CLL A;  4PHN A;  2ZKM X;  1Y6W A;  3E3R A;  3HCM A;  4JPZ B;  4GFT A;  1K93 D;  2H2K A;  3F45 A;  3FS7 A;  2G2B A;  1KQM C;  1CLB A;  1UHK A;  3CR4 X;  4YGC B;  2K2A A;  1A2X A;  3SG2 A;  1FW4 A;  1ZAC A;  2O60 A;  5F6T A;  2FCE A;  1DGV A;  2JXL A;  1UHI A;  1EJ3 A;  1QX7 A;  1L2O B;  1J7R A;  3EVV A;  5HKZ A;  1RWY A;  1DJZ A;  1QJT A;  1OOJ A;  1NIW A;  2L2E A;  3DVJ A;  1MQ1 A;  1YUU A;  1AHR A;  1BF5 A;  2FCD A;  4C0J A;  2LVI A;  3EVU A;  2EC6 C;  1QV1 A;  2DOQ A;  1TOP A;  3M0W A;  2CBL A;  1TIZ A;  2OS8 C;  2JWW A;  1N65 A;  1OQP A;  2E6W A;  1WRZ A;  3IQQ A;  1DGU A;  3I5F B;  5I2Q A;  1KK7 Y;  1SW8 A;  2O5G A;  1DJI A;  1QIV A;  2PRU A;  2RGI A;  2WCB A;  1R2U A;  3I5G C;  2K0J A;  1DF0 A;  4MZK A;  4MRY A;  2JT0 A;  1YX8 A;  1RTP 1;  3D0Y B;  1SNL A;  4MEW A;  3AKB A;  2F3Y A;  2KI6 D;  2Y1N A;  1CFC A;  1WLZ A;  1PVB A;  2JXC A;  2KAY A;  2HET A;  1E8A A;  1KQM B;  1QV0 A;  2F3Z A;  1A75 B;  1S6J A;  1AJ4 A;  1S6I A;  1CM4 A;  1MUX A;  4CFR A;  2I7A A;  2NXQ A;  1ZMZ A;  1SL9 A;  1PK0 D;  1K9K A;  3VRP A;  5GQQ C;  1PRW A;  1TN4 A;  1K9P A;  4YGA A;  1SCM C;  4PE4 A;  2SAS A;  1D1O A;  1S26 D;  2CXJ A;  4XJK B;  4OR9 B;  1QVI Z;  1KWO B;  2JZI A;  1LXF C;  1UP5 A;  3OB2 B;  2NCO A;  1SCV A;  1TNW A;  2TN4 A;  4HSZ A;  3CS1 A;  5HKW A;  5G08 A;  4GGF C;  1ALW A;  1LA0 A;  3LCP C;  1NUB A;  2BE4 A;  1C07 A;  1F71 A;  1Y1U A;  1XFX O;  1SY9 A;  3KF9 A;  4PHM A;  1MXE A;  1CDM A;  1QLK A;  1A75 A;  1JF0 A;  1J1D A;  1BJF A;  1B8C A;  2WOR A;  3OB1 B;  1KFX S;  4CPV A;  2ZNE A;  4WQ3 A;  5CSI A;  4ICB A;  4MN0 A;  2KAX A;  1CMF A;  1DF0 B;  2M97 A;  1KQV A;  2M0R A;  1B8R A;  3BOW A;  2LMV A;  1B9A A;  3AAJ A;  2WC8 A;  1J1E A;  1QX2 A;  2M8U A;  4BY4 A;  2KFG A;  2ISD A;  1WY9 A;  3A8R A;  1U5I A;  3SG6 A;  1C7W A;  2ZN9 A;  2LE9 B;  2PMY A;  1ALV A;  4UPG A;  1Q80 A;  1SL8 A;  2K7O A;  5ER5 A;  4I5J A;  2COL B;  5AAN A;  4F0Z B;  5AEQ A;  2LHL A;  1S36 A;  3PAL A;  1ODB A;  1YUS A;  3D0Y A;  3EK4 A;  1BOD A;  4N1G A;  3JVT B;  1FI6 A;  4FTG A;  3PAT A;  5D7F A;  5HKY A;  4A4C A;  2BKH B;  2LP2 A;  2E30 A;  1NCY A;  1WRK A;  2CT9 A;  3SG3 A;  3EKH A;  1QAT A;  1Y1X A;  1PAL A;  5IBW A;  5I2L A;  3GK2 A;  1NX1 A;  3CWG A;  1UHJ A;  3OX5 A;  1J7P A;  2AUC A;  3BOW B;  2L5X B;  1QAS A;  1YRT B;  4HRG A;  2CCM A;  1CDL A;  2LHI A;  1XVJ A; 
#chains in the Genus database with same CATH topology
 2H61 C;  3NSO A;  1MXL C;  2KI4 B;  3K21 A;  1OMV A;  4GNK B;  2LLT A;  4PAL A;  1BMO A;  1UHN A;  1NX0 A;  1DJG A;  2OTG B;  4JKT A;  2PAS A;  1J55 A;  2P71 A;  3BYA A;  2BBN A;  3TUY C;  4OCI A;  5CSF A;  1IIO A;  1QX5 B;  5DKN A;  1EG3 A;  3TZ1 A;  1F8H A;  2F2P A;  1CMG A;  4E68 A;  2JPO A;  2P6B B;  3AAK A;  2Q91 A;  2L50 A;  3KO0 A;  2HQW A;  4OZD A;  1CFD A;  1JF2 A;  3CR2 A;  3EVR A;  3LK1 A;  1QTX A;  4XJK A;  1ZOT B;  2L2C A;  1RRO A;  3WXA A;  1NYA A;  4I5N B;  4CID A;  1S1E A;  2K7B A;  3IQO A;  3GK1 A;  1CM1 A;  1Z2C B;  3R1O A;  4YI9 A;  1K2H A;  1WRL A;  2MAZ A;  1OMR A;  1XYD A;  1DEL A;  2OPO A;  2WCF A;  5HLO A;  3QRX A;  2KBI A;  3DZT A;  1OSA A;  3FIA A;  1NSH A;  1SSE B;  3BUW B;  1EL4 A;  2KNE A;  3BFH A;  1GGW A;  2JTZ A;  2M29 A;  4YGB B;  2MJW B;  1KK7 Z;  2M3W A;  3SG4 A;  3RLZ A;  1DC1 A;  1F4Q A;  1KFU L;  2HF5 A;  2K8M B;  2M1U A;  2BL0 C;  3I5H B;  3R1V A;  4N1F A;  2BL0 B;  3I5H C;  1K9U A;  3FWC A;  1C3Z A;  1OOI X;  5EL2 A;  1XFZ O;  5TNC A;  3TS5 B;  3OP0 A;  1IRJ A;  2KFH A;  4D1E A;  1M31 A;  1CLM A;  4HRE E;  3OX6 A;  1J7O A;  1AP4 A;  4PE7 A;  3B86 A;  3CZT X;  1NPQ A;  4OVN F;  4IL1 A;  3KHE A;  4PE0 A;  4YRU A;  2FOT A;  1TNP A;  5FYX A;  4ORA B;  1F4O A;  2KQ6 A;  2BCA A;  1YR5 A;  1BLQ A;  1ZFS A;  1OZS A;  2JU0 A;  3CZ1 A;  1S5G Z;  3CDN A;  2Y4Q A;  4INW A;  4P2Y B;  2BCB A;  2NZ0 A;  3PM8 A;  5ER4 X;  3D76 A;  5KTY A;  2CTN A;  2GGZ A;  5I2O A;  3PLF B;  1PUL A;  5BPJ A;  1SKT A;  1F70 A;  1PSB A;  1LVC D;  1X02 A;  3BUN B;  3DVM A;  3S0E A;  1B4C A;  2HQ8 A;  1FI5 A;  1SCM B;  2GV5 A;  1OOG A;  3PFV A;  3O2P A;  1YVL A;  4MRX A;  1K8U A;  3SIB A;  3V2L A;  1QXP A;  1YX7 A;  2K7C A;  4GPL B;  5DKR A;  1MR8 A;  3ZWH A;  1REC A;  4BY5 A;  2HPS A;  1TCO B;  4USL A;  2OTG C;  2LV7 A;  3Q8I A;  4JQ0 D;  4HRH A;  1M46 A;  2KPH A;  3VRN A;  2KOT A;  5K89 A;  1NCX A;  1DTL A;  4PHK A;  2KBM A;  3JTD B;  2MHH A;  1YVH A;  1EXR A;  1N2D A;  1TTX A;  2AMI A;  3BUM B;  2JNF A;  3CYZ A;  1YUT A;  3N7H A;  3R72 A;  3FWB A;  3O4Y A;  1BR1 B;  2SCP A;  3TDU A;  1GGZ A;  4XYN A;  1RK9 A;  2EHB A;  3VRQ A;  2QDI A;  2FJU B;  1SRA A;  4PE1 A;  3SG7 A;  1A4P A;  3RZS A;  4GAO A;  5KSZ A;  2I18 A;  4M2Q A;  2K61 A;  2BAP A;  2JC2 A;  2GGM A;  1B47 A;  2LC5 A;  2V53 A;  4C0K A;  3QME A;  4NDC A;  4C0L A;  4NDB A;  1JFK A;  3AKA A;  1LS8 A;  3I5G B;  1OMD A;  1YUR A;  2MLE C;  2WOS A;  1JFJ A;  1C7V A;  2LVJ A;  3BQ3 A;  1OE9 B;  3IVT A;  3SIA A;  1JC2 A;  2WCM A;  2OS8 B;  1YRU B;  5JJG A;  2MLF C;  2L5Y A;  3D77 A;  1DJY A;  1AVS A;  1DT7 B;  1IH0 A;  4MZL A;  1CB1 A;  1NWD A;  1Z4H A;  2JPT A;  4TNC A;  3BUX B;  1KK8 B;  1S6C A;  3A4U B;  3K1E A;  3VGO A;  3TUY B;  4ORC B;  1QLS A;  5AFP A;  3KPX A;  3SJS A;  3OHM B;  2BBM A;  3KEV A;  5HLV A;  3HX4 A;  1XFR A;  4OV2 A;  1FPW A;  1QIW A;  2LLU A;  3BUO B;  2L98 A;  4DUQ A;  1XFY O;  2ZND A;  2ZRS A;  1KSO A;  2ERB A;  1JBA A;  2NCP A;  1NP8 A;  1SK6 D;  2H61 A;  2WCE A;  3D78 A;  3PSR A;  3SG5 A;  3VRR A;  1SYM A;  1AUI B;  1KFX L;  4M2O A;  1CDN A;  1NX2 A;  4R1E A;  2BCX A;  3NXA A;  2IS9 A;  3CTN A;  1XK4 C;  3WNX B;  2VRG A;  1B7T Y;  1Y1A A;  4PT1 A;  4DIR A;  5KU1 A;  1K95 A;  2M1K B;  3O78 A;  1IJ6 A;  3FE9 A;  3D73 A;  3DF0 A;  2KYF A;  1GJY A;  1L7Z A;  1WDC B;  1IQ3 A;  4MSP A;  5CSJ A;  1GQM A;  5FI7 A;  3SS3 A;  2LNK A;  3PM2 A;  3IF7 A;  1UUS A;  3TS5 C;  3ZNI A;  2BE6 A;  4ETO A;  2WC6 A;  1KWO C;  3B88 A;  1CFF A;  2LAN A;  1SR6 B;  2K2F A;  2L51 A;  2LAP A;  2LUC A;  5HYD A;  1CTR A;  2AAO A;  1QVI Y;  2PVB A;  1LA3 A;  1G4Y R;  2B1U A;  3NSL A;  1JUO A;  1SPY A;  2QEV A;  4JD9 A;  3S0G A;  2F33 A;  2KI4 C;  2M49 B;  4MZJ A;  1HT9 A;  2PAL A;  3DVK A;  3CGA A;  3PN7 B;  4ORB B;  1MHO A;  4PCW A;  2LVK A;  5D69 A;  4CLN A;  1A03 A;  1M63 B;  2JOJ A;  1K94 A;  1RFJ A;  1C3Y A;  1IQ5 A;  1K96 A;  1WLM A;  1DJW A;  1H8B A;  1A29 A;  4QJ5 B;  2KGR A;  2MRD A;  3H4S E;  2KYC A;  3JTD C;  3LLE A;  3VRO A;  4A4B A;  4DRW A;  4I5K A;  1U5I B;  1FF1 A;  2NLN A;  1UUR A;  2WND A;  1DMO A;  2LUX A;  3CZ0 A;  4NDD A;  3GOF A;  4YGE B;  4JWQ A;  1TRF A;  3WHT B;  1UHH A;  5DKQ A;  2L4I A;  1YTZ C;  4GGN A;  4IJ7 A;  1DJH A;  1M45 A;  2LMU A;  4N5X A;  1WDC C;  3S0F A;  1M39 A;  1PSR A;  1TCF A;  2A4J A;  2GTE A;  1IGV A;  2WCL A;  1V1G A;  2M7N A;  4Q04 A;  4WRI A;  3D74 A;  2BKI B;  4DS7 A;  1BOC A;  2ZRT A;  4L9M A;  5AXI A;  3DD4 A;  1JWD A;  1XK4 A;  1G8I A;  2K60 A;  4QJ4 B;  1EH2 A;  2MA2 A;  2Y5I A;  1IWQ A;  2I2R E;  2PSR A;  1KFU S;  5B8I B;  5HL1 A;  2BNX A;  1J7Q A;  2MBX A;  1R6P A;  1XFV O;  1ZUZ A;  1BU3 A;  4AQJ A;  1CFP A;  1CNP A;  3NHI A;  1FBV A;  1IKU A;  1VRK A;  5JOL A;  5J3X A;  1OOF A;  2QAC A;  2JT8 A;  4OKH A;  3DF0 B;  4GUK A;  4PHJ A;  2LM5 A;  4ZCV A;  3UO9 A;  1MF8 B;  1HQV A;  2ZFD A;  4YI8 A;  1IG5 A;  2JTT A;  1SBJ A;  2JRF A;  2ZN8 A;  1F54 A;  5CSN A;  3EK8 A;  1GM0 A;  2JNX A;  2JQ6 A;  1TNX A;  2KGB C;  3CR5 X;  1LKJ A;  1DJX A;  1SR6 C;  2KI6 C;  1XFU O;  2EGD A;  2KDH A;  1B8L A;  2M7L A;  4CFQ A;  4P5O E;  1AJ5 A;  1UWO A;  3JVT C;  3O6B A;  3OBV A;  3I5F C;  1CKK A;  3FE8 A;  3LL8 B;  2L0P A;  3BXK A;  1RJV A;  2EC6 B;  5FI2 A;  3RM1 A;  1KCY A;  1MWN A;  3DY9 A;  2BEC A;  2QPT A;  5I8N A;  2LMT A;  2Q4U A;  4MVF A;  1BG1 A;  1SMG A;  3I5I C;  1Y0V H;  3DVE A;  2K7D A;  2F2O A;  2LP3 A;  3BFB A;  3CLN A;  5D3O A;  3O4X A;  4AQI A;  2KSP A;  1K90 D;  1L2O C;  2JT3 A;  1OZO A;  1NX3 A;  2LCP A;  3EK7 A;  1EG4 A;  1LIN A;  1S3P A;  2JUL A;  3NSI A;  4NQG A;  5AER A;  3LK0 A;  1NCZ A;  1S5G Y;  1XA5 A;  2I94 A;  2KLE A;  3B87 A;  3L4L A;  4GGF A;  5PAL A;  3S0B A;  1W7J B;  1PVA A;  3ICB A;  1IJ5 A;  4YGD B;  4KYN A;  3CAB A;  1AK8 A;  5CPV A;  2F8P A;  3PN7 C;  2LLS A;  1H4B A;  4GBA A;  4PDZ A;  1CDP A;  3L4A A;  1JSA A;  2KQY A;  1N0Y A;  1XFW O;  2M9G A;  4ZCU A;  2CNP A;  4AOM A;  1OW4 A;  3NSK A;  3WHU B;  2L4H A;  1KK8 C;  4DCK A;  3I5I B;  1W9Z A;  4M2P A;  1XO5 A;  2QEB A;  4WQ2 A;  4MBE A;  2D8N A;  3GK4 X;  1BT6 A;  3UNW A;  1KSM A;  2KAV A;  1F55 A;  2Y1M A;  2G9B A;  1QS7 A;  1W7I B;  3NGV A;  3S0A A;  2KFF A;  2KLD A;  1SL7 A;  1B1G A;  4YBH B;  4FQO A;  3MSE B;  2PYQ A;  2R2I A;  3TDI A;  4I5L B;  1DVI A;  1V1F A;  3D10 A;  1G33 A;  3DYE A;  2LVV A;  3C1V A;  3EKJ A;  4MLW A;  4QJ3 B;  4U8D A;  1TUJ A;  1DQE A;  2KHN A;  1BR4 B;  1B7T Z;  1TNQ A;  1CLL A;  4PHN A;  2ZKM X;  1Y6W A;  3E3R A;  3HCM A;  4JPZ B;  4GFT A;  1K93 D;  2WC5 A;  2H2K A;  3F45 A;  3FS7 A;  3DXL A;  2G2B A;  1KQM C;  1CLB A;  1UHK A;  3CR4 X;  4YGC B;  2K2A A;  3NHT A;  1A2X A;  3SG2 A;  1FW4 A;  1ZAC A;  2O60 A;  5F6T A;  1OOH A;  1DGV A;  2FCE A;  2JXL A;  1UHI A;  1EJ3 A;  1QX7 A;  1L2O B;  1J7R A;  2H8V A;  3EVV A;  1RWY A;  1DJZ A;  1QJT A;  1OOJ A;  1NIW A;  2L2E A;  3DVJ A;  1MQ1 A;  3TDZ A;  1YUU A;  1AHR A;  1BF5 A;  2FCD A;  4C0J A;  2LVI A;  3EVU A;  2EC6 C;  1QV1 A;  2DOQ A;  1TOP A;  3M0W A;  2CBL A;  1TIZ A;  2OS8 C;  1TUZ A;  2JWW A;  1N65 A;  1OQP A;  2E6W A;  1WRZ A;  3IQQ A;  1DGU A;  3I5F B;  5I2Q A;  1KK7 Y;  1SW8 A;  3VB1 A;  2O5G A;  1DJI A;  1QIV A;  2PRU A;  2RGI A;  2WCB A;  1R2U A;  3I5G C;  2K0J A;  1DF0 A;  4MZK A;  3PJI A;  4MRY A;  2JT0 A;  1YX8 A;  3SS4 A;  1RTP 1;  3D0Y B;  1SNL A;  4INX A;  4MEW A;  3AKB A;  2F3Y A;  2KI6 D;  2Y1N A;  1CFC A;  1WLZ A;  1PVB A;  2JXC A;  2KAY A;  2HET A;  1E8A A;  1KQM B;  1QV0 A;  2F3Z A;  2WCJ A;  1T14 A;  3BFA A;  1A75 B;  1S6J A;  1AJ4 A;  3S0D A;  1S6I A;  1CM4 A;  1MUX A;  4CFR A;  2I7A A;  2NXQ A;  1ZMZ A;  1SL9 A;  1PK0 D;  1K9K A;  3VRP A;  5GQQ C;  1PRW A;  1TN4 A;  1K9P A;  4YGA A;  1SCM C;  4PE4 A;  2SAS A;  1D1O A;  3L47 A;  1S26 D;  2CXJ A;  4XJK B;  4OR9 B;  1QVI Z;  1KWO B;  2JZI A;  1LXF C;  1UP5 A;  3OB2 B;  2NCO A;  1SCV A;  1TNW A;  2TN4 A;  2YGU A;  3BJH A;  3EG5 B;  4FQT A;  4HSZ A;  3CS1 A;  5HKW A;  5G08 A;  4GGF C;  1ALW A;  1LA0 A;  3LCP C;  1NUB A;  2BE4 A;  4F7F A;  1C07 A;  1F71 A;  1Y1U A;  1XFX O;  1SY9 A;  3KF9 A;  4PHM A;  1MXE A;  1CDM A;  1QLK A;  1A75 A;  1P28 A;  1JF0 A;  1J1D A;  3OGN A;  1BJF A;  1B8C A;  2WOR A;  3FE6 A;  1ORG A;  3OB1 B;  1KFX S;  4CPV A;  2ZNE A;  4WQ3 A;  5CSI A;  4ICB A;  5DIC A;  4MN0 A;  2KAX A;  1CMF A;  1DF0 B;  2M97 A;  1KQV A;  2M0R A;  1B8R A;  3BOW A;  2FJY A;  2LMV A;  1B9A A;  3AAJ A;  2WC8 A;  1J1E A;  1QX2 A;  2M8U A;  4BY4 A;  2KFG A;  2ISD A;  1WY9 A;  1QWV A;  3A8R A;  1U5I A;  3SG6 A;  1C7W A;  2ZN9 A;  1TWO A;  2LE9 B;  2PMY A;  1ALV A;  2QEH A;  3B7A A;  5FI6 A;  4UPG A;  1Q80 A;  1SL8 A;  2K7O A;  5ER5 A;  4I5J A;  2COL B;  5AAN A;  3CZ2 A;  5AEQ A;  2LHL A;  4F0Z B;  1S36 A;  3PAL A;  1ODB A;  1YUS A;  3D0Y A;  3EK4 A;  1BOD A;  4N1G A;  3D75 A;  3JVT B;  4FTG A;  3B6X A;  2PQL A;  1FI6 A;  5HKZ A;  2WCH A;  3PAT A;  2QEO A;  5D7F A;  3R1P A;  5HKY A;  4A4C A;  2BKH B;  2LP2 A;  2E30 A;  1NCY A;  1WRK A;  2CT9 A;  3SG3 A;  3EKH A;  2P70 A;  1DEK A;  1QAT A;  1Y1X A;  1PAL A;  5IBW A;  5I2L A;  3GK2 A;  1NX1 A;  3CWG A;  1UHJ A;  3OX5 A;  1J7P A;  2AUC A;  3BOW B;  3SS5 A;  2L5X B;  1QAS A;  5I94 A;  1YRT B;  4HRG A;  2CCM A;  1CDL A;  2LHI A;  1XVJ A;  2WCK A; 
#chains in the Genus database with same CATH homology
 2H61 C;  3NSO A;  1MXL C;  2KI4 B;  3K21 A;  1OMV A;  4GNK B;  2LLT A;  4PAL A;  1BMO A;  1UHN A;  1NX0 A;  1DJG A;  2OTG B;  2PAS A;  1J55 A;  3BYA A;  2BBN A;  3TUY C;  4OCI A;  5CSF A;  1QX5 B;  5DKN A;  1EG3 A;  3TZ1 A;  1F8H A;  2F2P A;  1CMG A;  4E68 A;  2P6B B;  3AAK A;  2Q91 A;  2L50 A;  3KO0 A;  2HQW A;  1CFD A;  1JF2 A;  3CR2 A;  3EVR A;  3LK1 A;  1QTX A;  4XJK A;  1ZOT B;  1RRO A;  3WXA A;  1NYA A;  4I5N B;  4CID A;  1S1E A;  2K7B A;  3IQO A;  3GK1 A;  1CM1 A;  4YI9 A;  1K2H A;  1WRL A;  2MAZ A;  1OMR A;  1XYD A;  2OPO A;  2WCF A;  5HLO A;  3QRX A;  2KBI A;  1OSA A;  3FIA A;  1NSH A;  3BUW B;  1EL4 A;  2KNE A;  1GGW A;  2JTZ A;  2M29 A;  4YGB B;  2MJW B;  1KK7 Z;  2M3W A;  3SG4 A;  3RLZ A;  1F4Q A;  1KFU L;  2HF5 A;  2K8M B;  2M1U A;  2BL0 C;  3I5H B;  4N1F A;  2BL0 B;  3I5H C;  1K9U A;  3FWC A;  1XFZ O;  5TNC A;  3TS5 B;  3OP0 A;  1IRJ A;  2KFH A;  4D1E A;  1M31 A;  1CLM A;  4HRE E;  3OX6 A;  1J7O A;  1AP4 A;  4PE7 A;  3CZT X;  1NPQ A;  4OVN F;  4IL1 A;  3KHE A;  4PE0 A;  4YRU A;  2FOT A;  1TNP A;  5FYX A;  4ORA B;  1F4O A;  2KQ6 A;  2BCA A;  1YR5 A;  1BLQ A;  1ZFS A;  1OZS A;  2JU0 A;  1S5G Z;  2Y4Q A;  4P2Y B;  2BCB A;  2NZ0 A;  3PM8 A;  5ER4 X;  5KTY A;  2CTN A;  2GGZ A;  5I2O A;  3PLF B;  1PUL A;  5BPJ A;  1SKT A;  1F70 A;  1PSB A;  1LVC D;  1X02 A;  3BUN B;  3DVM A;  1B4C A;  2HQ8 A;  1FI5 A;  1SCM B;  2GV5 A;  4MRX A;  3PFV A;  3O2P A;  1YVL A;  1K8U A;  3SIB A;  1QXP A;  1YX7 A;  2K7C A;  4GPL B;  5DKR A;  1MR8 A;  3ZWH A;  1REC A;  4BY5 A;  2HPS A;  1TCO B;  4USL A;  2OTG C;  2LV7 A;  4JQ0 D;  4HRH A;  1M46 A;  3VRN A;  2KOT A;  5K89 A;  1NCX A;  1DTL A;  4PHK A;  2KBM A;  3JTD B;  2MHH A;  1YVH A;  1EXR A;  1N2D A;  1TTX A;  2AMI A;  3BUM B;  2JNF A;  3TDZ A;  1YUT A;  3FWB A;  3O4Y A;  1BR1 B;  2SCP A;  3TDU A;  1GGZ A;  4XYN A;  1RK9 A;  2EHB A;  3VRQ A;  2FJU B;  1SRA A;  4PE1 A;  3SG7 A;  1A4P A;  4GAO A;  5KSZ A;  2I18 A;  4M2Q A;  2K61 A;  2JC2 A;  2V53 A;  2GGM A;  1B47 A;  2LC5 A;  4C0K A;  4NDC A;  4C0L A;  4NDB A;  1JFK A;  3AKA A;  3I5G B;  1CFP A;  1OMD A;  1YUR A;  2MLE C;  2WOS A;  1JFJ A;  1C7V A;  2LVJ A;  3BQ3 A;  1OE9 B;  3SIA A;  1JC2 A;  2OS8 B;  1YRU B;  5JJG A;  2MLF C;  1DJY A;  1AVS A;  1DT7 B;  1IH0 A;  4MZL A;  1CB1 A;  1NWD A;  2JPT A;  4TNC A;  3BUX B;  1KK8 B;  1S6C A;  3A4U B;  3VGO A;  3TUY B;  4ORC B;  1QLS A;  5AFP A;  3KPX A;  3SJS A;  3OHM B;  2BBM A;  3KEV A;  5HLV A;  3HX4 A;  4OV2 A;  1FPW A;  1QIW A;  2LLU A;  3BUO B;  2L98 A;  4DUQ A;  1XFY O;  2ZND A;  2ZRS A;  1KSO A;  1JBA A;  2NCP A;  1NP8 A;  1SK6 D;  2H61 A;  2WCE A;  3PSR A;  3SG5 A;  3VRR A;  1SYM A;  1AUI B;  1KFX L;  4M2O A;  1CDN A;  1NX2 A;  4R1E A;  2BCX A;  3NXA A;  2IS9 A;  3CTN A;  1XK4 C;  3WNX B;  2VRG A;  1B7T Y;  1Y1A A;  4DIR A;  5KU1 A;  1K95 A;  2M1K B;  3O78 A;  1IJ6 A;  3DF0 A;  2KYF A;  1GJY A;  1L7Z A;  1WDC B;  1IQ3 A;  4MSP A;  5CSJ A;  1GQM A;  2LNK A;  3IF7 A;  1UUS A;  3TS5 C;  3ZNI A;  2BE6 A;  4ETO A;  1KWO C;  1CFF A;  2LAN A;  1SR6 B;  2K2F A;  2L51 A;  2LAP A;  2LUC A;  5HYD A;  1CTR A;  2AAO A;  1QVI Y;  2PVB A;  1LA3 A;  1G4Y R;  2B1U A;  3NSL A;  1JUO A;  1SPY A;  2F33 A;  2KI4 C;  2M49 B;  4MZJ A;  1HT9 A;  2PAL A;  3DVK A;  3CGA A;  3PN7 B;  4ORB B;  1MHO A;  4PCW A;  2LVK A;  5D69 A;  4CLN A;  1A03 A;  1M63 B;  2JOJ A;  1K94 A;  1RFJ A;  1IQ5 A;  1K96 A;  1WLM A;  1DJW A;  1H8B A;  1A29 A;  4QJ5 B;  2KGR A;  2MRD A;  3H4S E;  2KYC A;  3JTD C;  3LLE A;  3VRO A;  4A4B A;  4DRW A;  4I5K A;  1U5I B;  1FF1 A;  2NLN A;  1UUR A;  2WND A;  1DMO A;  2LUX A;  4NDD A;  3GOF A;  4YGE B;  4JWQ A;  1TRF A;  3WHT B;  1UHH A;  5DKQ A;  2L4I A;  1YTZ C;  4GGN A;  1DJH A;  1M45 A;  2LMU A;  4N5X A;  1WDC C;  1M39 A;  1PSR A;  1TCF A;  2A4J A;  1IGV A;  1V1G A;  2M7N A;  4Q04 A;  4WRI A;  2BKI B;  4DS7 A;  1BOC A;  2ZRT A;  4L9M A;  5AXI A;  3DD4 A;  1JWD A;  1XK4 A;  1G8I A;  4QJ4 B;  1EH2 A;  2MA2 A;  2Y5I A;  1IWQ A;  2I2R E;  2PSR A;  1KFU S;  5B8I B;  1J7Q A;  2MBX A;  1R6P A;  1XFV O;  1ZUZ A;  1BU3 A;  4AQJ A;  1CNP A;  1FBV A;  1IKU A;  1VRK A;  5JOL A;  5J3X A;  2QAC A;  2JT8 A;  4OKH A;  3DF0 B;  4GUK A;  4PHJ A;  2LM5 A;  4ZCV A;  1MF8 B;  1HQV A;  2ZFD A;  4YI8 A;  1IG5 A;  2JTT A;  1SBJ A;  2JRF A;  2ZN8 A;  1F54 A;  5CSN A;  3EK8 A;  2JNX A;  2JQ6 A;  1TNX A;  2KGB C;  3CR5 X;  1LKJ A;  1DJX A;  1SR6 C;  2KI6 C;  1XFU O;  2EGD A;  2KDH A;  1B8L A;  2M7L A;  4CFQ A;  4P5O E;  1AJ5 A;  1UWO A;  3JVT C;  3O6B A;  3I5F C;  1CKK A;  3LL8 B;  2L0P A;  3BXK A;  1RJV A;  2EC6 B;  3RM1 A;  1KCY A;  1MWN A;  5I8N A;  2BEC A;  2QPT A;  2LMT A;  2Q4U A;  4MVF A;  1BG1 A;  1SMG A;  3I5I C;  1Y0V H;  3DVE A;  2K7D A;  2F2O A;  2LP3 A;  3CLN A;  4AQI A;  2KSP A;  1K90 D;  1L2O C;  2JT3 A;  1OZO A;  1NX3 A;  2LCP A;  3EK7 A;  1EG4 A;  1LIN A;  1S3P A;  2JUL A;  3NSI A;  4NQG A;  5AER A;  3LK0 A;  1NCZ A;  1S5G Y;  1XA5 A;  2I94 A;  5PAL A;  4GGF A;  1W7J B;  1PVA A;  3ICB A;  1IJ5 A;  4YGD B;  1AK8 A;  5CPV A;  2F8P A;  3PN7 C;  2LLS A;  1H4B A;  4GBA A;  4PDZ A;  1CDP A;  1JSA A;  2KQY A;  1N0Y A;  1XFW O;  2M9G A;  4ZCU A;  2CNP A;  4AOM A;  3NSK A;  3WHU B;  2L4H A;  1KK8 C;  4DCK A;  3I5I B;  4M2P A;  1XO5 A;  4WQ2 A;  4MBE A;  2D8N A;  3GK4 X;  1BT6 A;  1KSM A;  2KAV A;  1F55 A;  2Y1M A;  2G9B A;  1QS7 A;  1W7I B;  2KFF A;  1SL7 A;  1B1G A;  4YBH B;  4FQO A;  3MSE B;  2R2I A;  3TDI A;  4I5L B;  1DVI A;  1V1F A;  3D10 A;  1G33 A;  3EKJ A;  2LVV A;  3C1V A;  4MLW A;  4QJ3 B;  4U8D A;  2KHN A;  1BR4 B;  1B7T Z;  1TNQ A;  1CLL A;  4PHN A;  2ZKM X;  1Y6W A;  3E3R A;  3HCM A;  4JPZ B;  4GFT A;  1K93 D;  2H2K A;  3F45 A;  3FS7 A;  2G2B A;  1KQM C;  1CLB A;  1UHK A;  3CR4 X;  4YGC B;  2K2A A;  1A2X A;  3SG2 A;  1FW4 A;  1ZAC A;  2O60 A;  5F6T A;  2FCE A;  1DGV A;  2JXL A;  1UHI A;  1EJ3 A;  1QX7 A;  1L2O B;  1J7R A;  3EVV A;  5HKZ A;  1RWY A;  1DJZ A;  1QJT A;  1OOJ A;  1NIW A;  2L2E A;  3DVJ A;  1MQ1 A;  1YUU A;  1AHR A;  1BF5 A;  2FCD A;  4C0J A;  2LVI A;  3EVU A;  2EC6 C;  1QV1 A;  2DOQ A;  1TOP A;  3M0W A;  2CBL A;  1TIZ A;  2OS8 C;  2JWW A;  1N65 A;  1OQP A;  2E6W A;  1WRZ A;  3IQQ A;  1DGU A;  3I5F B;  5I2Q A;  1KK7 Y;  1SW8 A;  2O5G A;  1DJI A;  1QIV A;  2PRU A;  2RGI A;  2WCB A;  1R2U A;  3I5G C;  2K0J A;  1DF0 A;  4MZK A;  4MRY A;  2JT0 A;  1YX8 A;  1RTP 1;  3D0Y B;  1SNL A;  4MEW A;  3AKB A;  2F3Y A;  2KI6 D;  2Y1N A;  1CFC A;  1WLZ A;  1PVB A;  2JXC A;  2KAY A;  2HET A;  1E8A A;  1KQM B;  1QV0 A;  2F3Z A;  1A75 B;  1S6J A;  1AJ4 A;  1S6I A;  1CM4 A;  1MUX A;  4CFR A;  2I7A A;  2NXQ A;  1ZMZ A;  1SL9 A;  1PK0 D;  1K9K A;  3VRP A;  5GQQ C;  1PRW A;  1TN4 A;  1K9P A;  4YGA A;  1SCM C;  4PE4 A;  2SAS A;  1D1O A;  1S26 D;  2CXJ A;  4XJK B;  4OR9 B;  1QVI Z;  1KWO B;  2JZI A;  1LXF C;  1UP5 A;  3OB2 B;  2NCO A;  1SCV A;  1TNW A;  2TN4 A;  4HSZ A;  3CS1 A;  5HKW A;  5G08 A;  4GGF C;  1ALW A;  1LA0 A;  3LCP C;  1NUB A;  2BE4 A;  1C07 A;  1F71 A;  1Y1U A;  1XFX O;  1SY9 A;  3KF9 A;  4PHM A;  1MXE A;  1CDM A;  1QLK A;  1A75 A;  1JF0 A;  1J1D A;  1BJF A;  1B8C A;  2WOR A;  3OB1 B;  1KFX S;  4CPV A;  2ZNE A;  4WQ3 A;  5CSI A;  4ICB A;  4MN0 A;  2KAX A;  1CMF A;  1DF0 B;  2M97 A;  1KQV A;  2M0R A;  1B8R A;  3BOW A;  2LMV A;  1B9A A;  3AAJ A;  2WC8 A;  1J1E A;  1QX2 A;  2M8U A;  4BY4 A;  2KFG A;  2ISD A;  1WY9 A;  3A8R A;  1U5I A;  3SG6 A;  1C7W A;  2ZN9 A;  2LE9 B;  2PMY A;  1ALV A;  4UPG A;  1Q80 A;  1SL8 A;  2K7O A;  5ER5 A;  4I5J A;  2COL B;  5AAN A;  4F0Z B;  5AEQ A;  2LHL A;  1S36 A;  3PAL A;  1ODB A;  1YUS A;  3D0Y A;  3EK4 A;  1BOD A;  4N1G A;  3JVT B;  1FI6 A;  4FTG A;  3PAT A;  5D7F A;  5HKY A;  4A4C A;  2BKH B;  2LP2 A;  2E30 A;  1NCY A;  1WRK A;  2CT9 A;  3SG3 A;  3EKH A;  1QAT A;  1Y1X A;  1PAL A;  5IBW A;  5I2L A;  3GK2 A;  1NX1 A;  3CWG A;  1UHJ A;  3OX5 A;  1J7P A;  2AUC A;  3BOW B;  2L5X B;  1QAS A;  1YRT B;  4HRG A;  2CCM A;  1CDL A;  2LHI A;  1XVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...