1B7TY

Myosin digested by papain
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
138
structure length
138
Chain Sequence
b'PQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYOSIN HEAVY CHAIN
publication title Atomic structure of scallop myosin subfragment S1 complexed with MgADP: a novel conformation of the myosin head.
pubmed doi rcsb
molecule tags Myosin
total genus 39
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 1999-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1b7tY01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1b7tY02
1S5GZ 4MBEA 1B7TZ 4OKHA 1B9AA 3FWBA 1C07A 1QASA 3EVUA 1F4OA 1SMGA 2JT0A 4PHNA 2FOTA 2K8MB 1YRTB 3PN7C 1UHJA 2A4JA 2RGIA 4PHMA 1XVJA 2HQWA 1W7IB 1JF0A 1IGVA 1F4QA 2LNKA 1M39A 3EKJA 3RM1A 5B8IB 1RFJA 1JWDA 1XFUO 1DGUA 3OX6A 4YGCB 3SG5A 2SASA 2BCBA 3SJSA 1K8UA 1M45A 1QXPA 2MLFC 1KK8C 2I7AA 1WRLA 2KAVA 1KK7Z 4I5NB 3TUYC 5DKNA 1FI5A 2KGBC 1PULA 1Y1XA 1EXRA 2M49B 2NLNA 4BY4A 4CLNA 4FQOA 5HYDA 2BBNA 2LHIA 1CFFA 1QX2A 2JWWA 3KO0A 5GQQC 3TZ1A 3LCPC 4D1EA 1QLSA 2Y4QA 3EVRA 4DIRA 3KF9A 2OS8B 1WY9A 2L98A 1SCVA 2MLEC 2KAXA 1SYMA 5CSIA 2JC2A 1KWOC 4HRGA 1M31A 1TIZA 1SL9A 1SW8A 2K2FA 1Y1UA 2NCOA 2WC8A 2LVIA 1IKUA 1K9PA 4MZKA 1H8BA 3BOWA 2M9GA 1ODBA 2WCFA 3CR5X 2NCPA 3O2PA 1MHOA 4WQ2A 2JTZA 3WHUB 1J1DA 3WHTB 3AAKA 1YTZC 2I2RE 1YUTA 1Y0VH 4XYNA 3BUWB 2KAYA 1LXFC 1TTXA 1ZMZA 5FYXA 1L2OC 2H61A 3TDZA 2WORA 3WNXB 4QJ4B 1H4BA 2OPOA 3BUMB 3SG6A 1F8HA 1FPWA 1KCYA 4NDBA 1CMGA 2JPTA 1DJHA 2BBMA 3I5IC 1RWYA 2DOQA 3AKBA 1FI6A 1U5IB 2K7OA 4PALA 2KFFA 3PLFB 2VRGA 3NSKA 1NP8A 3IF7A 4U8DA 1QX7A 3NSLA 1UHKA 1B1GA 1OZSA 1RTP1 3GOFA 1K93D 2ZRSA 5ER4X 1KK8B 2KQYA 3TUYB 1QVIZ 1K9KA 5TNCA 1ZUZA 1U5IA 1JUOA 1GJYA 1YURA 4P2YB 5D7FA 2MBXA 3ZNIA 1CB1A 4OR9B 3M0WA 5JOLA 2KQ6A 1SRAA 1JFJA 1PSBA 3FS7A 1YUUA 1SNLA 2GGZA 4YBHB 5I2QA 3SG3A 1F70A 1DGVA 2WCBA 1UP5A 4HRHA 4ZCVA 1CDMA 1C7WA 2FJUB 1QV1A 1AJ4A 1JF2A 2F3YA 1XYDA 1DJZA 4R1EA 5HLOA 1QX5B 1IH0A 1LA0A 1JC2A 2ZKMX 1Q80A 4PHKA 3SIBA 2OS8C 1OQPA 2NXQA 2O60A 4MEWA 1S1EA 3OX5A 2PRUA 3RLZA 2K7DA 2BL0C 3K21A 2PALA 1YVLA 5BPJA 4MRXA 1PRWA 2K2AA 1K9UA 1EG4A 3BXKA 1OSAA 2LM5A 1HT9A 3LK0A 4CIDA 1S36A 1S5GY 2BE4A 1B7TY 4OV2A 1YVHA 4PE0A 2KDHA 2KOTA 1QLKA 2LLSA 3I5IB 1BOCA 2CT9A 1NCXA 1PVBA 3D10A 4YRUA 3TS5B 1DT7B 1S6IA 2CBLA 2MRDA 2K7BA 1SK6D 2KI6D 3SIAA 1DF0B 1NUBA 4MSPA 1DJWA 4YI8A 1RECA 2L51A 4GNKB 4PE1A 4YGBB 2KSPA 1NX1A 1K90D 2R2IA 1LA3A 4C0JA 1MUXA 1DMOA 1OOJA 3IQQA 2Y1MA 2KI4B 1SBJA 3I5HC 1KK7Y 2M8UA 4YGAA 1CKKA 1S6JA 1S6CA 2M97A 5I8NA 3O6BA 1DF0A 2JT3A 3CTNA 1RROA 1M63B 1G8IA 2F33A 1K95A 2KGRA 3I5GC 5DKQA 4NDCA 2G2BA 1JFKA 1NPQA 3EK7A 1OE9B 5I2LA 5I2OA 3BOWB 2JOJA 2QACA 2LCPA 1UHIA 3OP0A 1K2HA 1NCYA 2I18A 1B4CA 1AP4A 3OHMB 2Y5IA 4UPGA 1JSAA 4I5JA 2LANA 1AUIB 1WLMA 2ISDA 1MXLC 4PE7A 4NQGA 2L5XB 2JT8A 2JU0A 2BL0B 4FTGA 3VRNA 2O5GA 5KSZA 1ZACA 2F8PA 1TCOB 1SKTA 1JBAA 3NSIA 2WCEA 4HSZA 4I5KA 1AK8A 1CFDA 2F3ZA 1V1FA 1IJ6A 1MXEA 3MSEB 1TNQA 4N1FA 5KTYA 2KNEA 2LMUA 1YX7A 1BR4B 1KFUL 3DD4A 1XFXO 4MZJA 4ORAB 2Q91A 4GBAA 3BUNB 5AERA 2Q4UA 1OZOA 1QIWA 1DJGA 2AUCA 1J7OA 1AJ5A 4NDDA 2EC6C 3TS5C 3KHEA 1QJTA 1IQ3A 4PE4A 1SPYA 2JNXA 2BCAA 3I5HB 2TN4A 1CDPA 5IBWA 2JTTA 3KPXA 1QVIY 2KHNA 1XFYO 4N5XA 4GGNA 4WRIA 1FW4A 1BMOA 5AANA 3PSRA 2NZ0A 4YGEB 2CXJA 4YI9A 3JVTC 2AAOA 1SR6B 4PCWA 3I5GB 3LLEA 2E30A 4C0KA 1GGZA 4XJKA 1A4PA 1E8AA 1R2UA 3DF0B 3VRPA 1CFCA 3VROA 2KI4C 3DVJA 2V53A 1S3PA 2WNDA 3VRQA 3BUOB 3CR4X 2IS9A 1BF5A 4MVFA 1X02A 4N1GA 3SG2A 2BKHB 3NXAA 4L9MA 3D0YA 1G4YR 1Y1AA 1WLZA 1F71A 3DF0A 4CFRA 3I5FC 3CR2A 3OB2B 4AOMA 3A8RA 1F55A 1AHRA 1R6PA 5CSNA 1WRZA 2CCMA 1A03A 4C0LA 1LINA 5DKRA 2PASA 4YGDB 1D1OA 3CGAA 2LHLA 3SG7A 1EH2A 1AVSA 2LVKA 3EK8A 2BE6A 1Y6WA 2LVJA 3CZTX 2K7CA 5F6TA 1SCMC 2AMIA 1J7RA 4ETOA 1TNPA 2K61A 1UUSA 1NX3A 2LP2A 2M1UA 1NYAA 1RJVA 1G33A 2K0JA 2PSRA 2WOSA 2KFGA 4PHJA 2EC6B 4WQ3A 2JXCA 4A4CA 2COLB 1N0YA 2ZNEA 1DTLA 2QPTA 3LL8B 2EHBA 3EKHA 2LLUA 2KYCA 2OTGC 1UHHA 1A75A 1IWQA 1B8RA 2LC5A 3LK1A 4TNCA 4OCIA 4M2PA 4ZCUA 4CFQA 3JVTB 3PFVA 1L7ZA 2GGMA 1QS7A 1CFPA 4PDZA 4MN0A 3JTDC 1M46A 3FWCA 4GGFA 3ICBA 4A4BA 5K89A 3AKAA 3BYAA 5CSJA 1NWDA 1QV0A 4DCKA 1BR1B 1KSOA 2ZNDA 5G08A 5HKYA 1GQMA 1B8CA 1WRKA 1BG1A 4GAOA 3GK4X 1SR6C 3DVMA 1KSMA 1CTRA 1UWOA 1XFWO 5AXIA 2M29A 3I5FB 1KQVA 1XO5A 3BUXB 1KFXL 1FBVA 1EG3A 1LKJA 3DVEA 1KQMC 1PSRA 5HLVA 2L50A 3VRRA 1QTXA 1XFZO 2M7NA 1J7QA 1J55A 1TNXA 2G9BA 2LUCA 2I94A 1C7VA 3ZWHA 4HREE 1NSHA 1SCMB 1N2DA 3HX4A 2CNPA 1OMDA 2FCEA 4M2QA 4USLA 1J7PA 1MF8B 2JXLA 1CDLA 2ZRTA 1WDCC 2LUXA 3IQOA 1CLLA 2HQ8A 1YUSA 1IRJA 1BT6A 2LP3A 1BJFA 1S26D 2LMTA 5HKWA 3PM8A 1CDNA 3PATA 3EK4A 2BKIB 1ALVA 2P6BB 3GK2A 2L2EA 1BU3A 1B8LA 2KBMA 4GPLB 4GUKA 4MRYA 1ZOTB 2LE9B 2M1KB 1LVCD 2OTGB 1TRFA 1CNPA 3CLNA 2L4IA 2F2OA 3H4SE 5HKZA 4XJKB 1PK0D 1SL8A 1BLQA 2CTNA 1UHNA 1XK4A 2MA2A 1TOPA 4GGFC 4I5LB 4OVNF 3WXAA 1V1GA 3JTDB 1IJ5A 3AAJA 1DJIA 4DRWA 5PALA 2KYFA 1MQ1A 2SCPA 1NCZA 2MJWB 2M7LA 1DVIA 2KI6C 3D0YB 2BECA 2D8NA 4GFTA 3EVVA 2LV7A 5CPVA 2KFHA 3GK1A 2ZFDA 1NX2A 3CWGA 1IQ5A 1YR5A 2H2KA 3E3RA 3PN7B 1TNWA 2B1UA 3KEVA 4QJ5B 2HPSA 3OB1B 2JQ6A 1ALWA 1CM4A 1HQVA 4JPZB 2BCXA 1KQMB 4ORCB 4ORBB 1TN4A 1QATA 1OMVA 4M2OA 1XA5A 1NX0A 2MHHA 1MWNA 1A2XA 2EGDA 2FCDA 1N65A 2E6WA 2PMYA 2PVBA 3O78A 3VGOA 1CM1A 1NIWA 4DS7A 4P5OE 1YX8A 4DUQA 2M3WA 3O4YA 2KBIA 3A4UB 2GV5A 3CS1A 2MAZA 1DJYA 1WDCB 1RK9A 1XFVO 1SY9A 2LVVA 3HCMA 2M0RA 1CLBA 2JNFA 1A29A 1QIVA 4JQ0D 2LAPA 2HETA 1KFXS 1PVAA 2ZN9A 1EJ3A 5KU1A 5CSFA 5J3XA 1KWOB 5ER5A 4E68A 2L4HA 1W7JB 3TDIA 1A75B 2JULA 2LLTA 4JWQA 1UURA 5AFPA 5JJGA 1CLMA 3QRXA 1VRKA 2ZN8A 3BQ3A 1MR8A 2LMVA 1ZFSA 1DJXA 3F45A 1TCFA 1XK4C 1EL4A 4MZLA 5D69A 2HF5A 4ICBA 4QJ3B 4Q04A 4F0ZB 3PALA 1F54A 2H61C 3SG4A 1L2OB 1IG5A 1K96A 3FIAA 1YRUB 1B47A 1PALA 1KFUS 2JZIA 3NSOA 1FF1A 1GGWA 4AQIA 2F2PA 2JRFA 1J1EA 3C1VA 3TDUA 5AEQA 1SL7A 1BODA 3DVKA 1K94A 2L0PA 2Y1NA 4BY5A 4CPVA 1OMRA 1CMFA 4MLWA 4AQJA 4IL1A
chains in the Genus database with same CATH superfamily
1S5GZ 4MBEA 1B7TZ 4OKHA 1B9AA 3FWBA 1C07A 1QASA 3EVUA 1F4OA 1SMGA 2JT0A 4PHNA 2FOTA 2K8MB 1YRTB 3PN7C 1UHJA 2A4JA 2RGIA 4PHMA 3CYZA 3R1OA 1XVJA 2HQWA 1W7IB 1Z2CB 1JF0A 1IGVA 1F4QA 2LNKA 1M39A 3EKJA 3RM1A 5B8IB 1RFJA 1SSEB 1JWDA 1XFUO 1DGUA 3OX6A 4YGCB 3SG5A 2SASA 2BCBA 3SJSA 1K8UA 1M45A 1QXPA 3BJHA 2MLFC 1KK8C 2I7AA 1WRLA 2KAVA 1KK7Z 4I5NB 3TUYC 5DKNA 1FI5A 2KGBC 1PULA 1Y1XA 3BFAA 1EXRA 2M49B 2NLNA 4BY4A 4CLNA 4FQOA 5HYDA 3RZSA 2BBNA 2LHIA 1CFFA 1QX2A 2BAPA 2JWWA 3KO0A 5GQQC 3LCPC 3TZ1A 2QDIA 1QLSA 2Y4QA 4D1EA 3EVRA 4DIRA 3KF9A 2OS8B 1WY9A 2L98A 1SCVA 2MLEC 2KAXA 1SYMA 5CSIA 2JC2A 1KWOC 3R1PA 4HRGA 1M31A 1TIZA 1SL9A 1SW8A 2K2FA 1Y1UA 2NCOA 2WC8A 2LVIA 1IKUA 1K9PA 4MZKA 1H8BA 3BOWA 2M9GA 1ODBA 2WCFA 3CR5X 2NCPA 3O2PA 1MHOA 4WQ2A 2JPOA 3Q8IA 2JTZA 3WHUB 1J1DA 3WHTB 3AAKA 1YTZC 4FQTA 3DYEA 2I2RE 5I94A 1YUTA 1Y0VH 4XYNA 3BUWB 2KAYA 1LXFC 1TTXA 1ZMZA 5FYXA 1L2OC 2H61A 3TDZA 2WORA 3WNXB 2P70A 4QJ4B 2WCKA 1H4BA 2OPOA 3BUMB 3SG6A 1F8HA 1FPWA 1KCYA 3FE9A 4NDBA 4F7FA 1CMGA 2JPTA 1DJHA 2BBMA 3BFHA 3I5IC 1RWYA 2DOQA 3AKBA 1FI6A 1U5IB 2K7OA 4PALA 5D3OA 2KFFA 3PLFB 2VRGA 3NSKA 1NP8A 3IF7A 4U8DA 1QX7A 3NSLA 1UHKA 1B1GA 1OZSA 1RTP1 3GOFA 1K93D 2ZRSA 5ER4X 1KK8B 3B7AA 2KQYA 3D77A 2PYQA 3TUYB 1QVIZ 1K9KA 5TNCA 1ZUZA 1U5IA 1JUOA 1GJYA 1YURA 2P71A 4P2YB 5D7FA 2MBXA 3ZNIA 1CB1A 4OR9B 3M0WA 5JOLA 2KQ6A 1SRAA 1JFJA 1PSBA 3FS7A 1YUUA 1SNLA 2GGZA 4YBHB 5I2QA 3SG3A 4INWA 1F70A 4JD9A 1DGVA 2WCBA 1UP5A 4HRHA 4ZCVA 1CDMA 1C7WA 2FJUB 1QV1A 1AJ4A 1JF2A 2F3YA 1XYDA 1DJZA 3D74A 4R1EA 1QX5B 5HLOA 1IH0A 3B6XA 1OOGA 1LA0A 1JC2A 2ZKMX 1Q80A 4PHKA 3SIBA 2OS8C 2YGUA 1OQPA 2NXQA 2O60A 2KLDA 3L4AA 1S1EA 3OX5A 2PRUA 4MEWA 3RLZA 2K7DA 2BL0C 3BFBA 3K21A 3B88A 1DC1A 2PALA 1YVLA 5DICA 3CDNA 5BPJA 4MRXA 3S0BA 1PRWA 2WC6A 2K2AA 1K9UA 1EG4A 3BXKA 1OSAA 2LM5A 1HT9A 3FE8A 3LK0A 4CIDA 1S36A 1S5GY 2BE4A 1B7TY 4OV2A 3EG5B 3VB1A 1YVHA 2WCLA 2KDHA 2KOTA 4PE0A 1QLKA 2LLSA 3I5IB 1BOCA 2CT9A 1NCXA 1PVBA 3SS3A 3D10A 4YRUA 3TS5B 1DT7B 1W9ZA 1S6IA 2CBLA 2MRDA 2K7BA 1SK6D 2KI6D 3SIAA 1DF0B 1NUBA 4KYNA 4MSPA 1DJWA 5EL2A 4YI8A 1RECA 2L51A 4GNKB 4PE1A 4YGBB 2KSPA 1NX1A 1K90D 2R2IA 1LA3A 4C0JA 1MUXA 1DMOA 1OOJA 3IQQA 2Y1MA 2KI4B 1SBJA 3I5HC 1KK7Y 2M8UA 4YGAA 2BNXA 1CKKA 1S6JA 1S6CA 2M97A 5I8NA 3O6BA 1DF0A 2JT3A 3CTNA 1RROA 1M63B 1G8IA 2F33A 1K95A 2KGRA 3I5GC 5DKQA 4IJ7A 2G2BA 1JFKA 1NPQA 3EK7A 1OE9B 4NDCA 2L5YA 5I2LA 5I2OA 3BOWB 2JOJA 2QACA 2LCPA 1UHIA 3OP0A 1K2HA 1NCYA 2I18A 1B4CA 1AP4A 3OHMB 2Y5IA 4UPGA 1JSAA 3D78A 4I5JA 2LANA 1AUIB 1WLMA 2ISDA 3CZ0A 1MXLC 4PE7A 4NQGA 2L5XB 2JT8A 2JU0A 2BL0B 4FTGA 3VRNA 2O5GA 5KSZA 1ZACA 2F8PA 1TCOB 1SKTA 3L4LA 1JBAA 3NSIA 3NGVA 2WCEA 4HSZA 1Z4HA 4I5KA 4JKTA 1AK8A 1CFDA 2F3ZA 1LS8A 1V1FA 1IJ6A 1MXEA 3MSEB 1TNQA 1C3YA 4N1FA 5KTYA 3S0FA 2KNEA 2LMUA 2QEVA 1YX7A 3S0GA 1BR4B 1KFUL 3DD4A 1P28A 1XFXO 4MZJA 4ORAB 2Q91A 4GBAA 3BUNB 5AERA 2Q4UA 2WC5A 1OZOA 1QIWA 1DJGA 2AUCA 1J7OA 1AJ5A 4NDDA 2EC6C 3TS5C 3KHEA 1QJTA 2WCJA 3DZTA 1IQ3A 4PE4A 1SPYA 2JNXA 2BCAA 3I5HB 2TN4A 1CDPA 5IBWA 1ORGA 2JTTA 3KPXA 1QVIY 2KHNA 1XFYO 4N5XA 4GGNA 3B87A 1OOIX 4WRIA 1FW4A 1BMOA 5AANA 3PSRA 2NZ0A 4YGEB 3B86A 2CXJA 4YI9A 3JVTC 2AAOA 1SR6B 4PCWA 3I5GB 3LLEA 2E30A 4C0KA 1GGZA 4XJKA 1A4PA 1E8AA 1R2UA 3DF0B 1OOHA 3VRPA 1CFCA 3VROA 2KI4C 3DVJA 2V53A 1S3PA 2WNDA 3VRQA 2KPHA 3BUOB 3CR4X 2IS9A 1BF5A 4MVFA 1X02A 4N1GA 3SG2A 2BKHB 3NXAA 4L9MA 3D0YA 1G4YR 1Y1AA 1WLZA 1F71A 3DF0A 3O4XA 4CFRA 3I5FC 3CR2A 3OB2B 4AOMA 3A8RA 3DXLA 1F55A 1AHRA 1R6PA 5CSNA 1WRZA 2CCMA 1A03A 4C0LA 1LINA 5DKRA 2PASA 4YGDB 1D1OA 3CGAA 2LHLA 3L47A 3SG7A 3QMEA 1EH2A 1AVSA 2LVKA 3EK8A 3S0AA 2BE6A 1Y6WA 2LVJA 3CZTX 2K7CA 5F6TA 1SCMC 2AMIA 3S0EA 1J7RA 4ETOA 1TNPA 2K61A 1UUSA 1NX3A 2LP2A 2M1UA 1NYAA 1RJVA 1G33A 2K0JA 2PSRA 2WOSA 3PJIA 1TUJA 2KFGA 4PHJA 2EC6B 4WQ3A 2JXCA 4A4CA 2KLEA 2COLB 1N0YA 2ZNEA 1DTLA 2QPTA 1TWOA 3LL8B 2EHBA 2QEHA 2LLUA 3EKHA 2KYCA 4OZDA 2OTGC 1UHHA 1A75A 1IWQA 1B8RA 2LC5A 3LK1A 4TNCA 4OCIA 4M2PA 4ZCUA 4CFQA 3JVTB 3PFVA 1L7ZA 2GGMA 1QS7A 1CFPA 4PDZA 4MN0A 3CABA 1M46A 3FWCA 3JTDC 4GGFA 3ICBA 4A4BA 5K89A 3AKAA 3BYAA 5CSJA 1NWDA 1QV0A 4DCKA 1BR1B 1KSOA 2ZNDA 5G08A 5HKYA 1B8CA 1GQMA 1QWVA 1WRKA 3CZ2A 3DY9A 1BG1A 4GAOA 3GK4X 1SR6C 3DVMA 1KSMA 1CTRA 1UWOA 1XFWO 5AXIA 2M29A 3I5FB 1KQVA 1XO5A 3BUXB 1KFXL 1FBVA 1EG3A 1LKJA 3DVEA 1KQMC 1PSRA 5HLVA 2L50A 3D76A 5FI6A 1QTXA 1XFZO 3VRRA 2M7NA 3V2LA 1J7QA 1J55A 1TNXA 2G9BA 1XFRA 2LUCA 2I94A 1C7VA 3ZWHA 1IIOA 4HREE 1NSHA 1SCMB 1N2DA 3HX4A 3D75A 2CNPA 1OMDA 2FCEA 4M2QA 4USLA 1J7PA 1DEKA 1MF8B 1T14A 2JXLA 1CDLA 2ZRTA 1WDCC 2LUXA 3IQOA 1CLLA 2HQ8A 1YUSA 1IRJA 1BT6A 2WCHA 2LP3A 1BJFA 1S26D 2LMTA 5HKWA 3PM8A 1CDNA 3PATA 3EK4A 2BKIB 1ALVA 2P6BB 3GK2A 3UO9A 2L2EA 1BU3A 3FE6A 1B8LA 3IVTA 2KBMA 4GPLB 4GUKA 4MRYA 1ZOTB 2LE9B 2M1KB 1LVCD 2OTGB 1TRFA 1CNPA 3CLNA 2L4IA 2F2OA 3H4SE 5HKZA 4XJKB 1PK0D 1SL8A 1BLQA 2CTNA 1UHNA 1XK4A 2MA2A 1TOPA 4GGFC 4I5LB 4OVNF 3WXAA 1V1GA 3JTDB 1IJ5A 2ERBA 3AAJA 1DJIA 4DRWA 5PALA 2KYFA 1MQ1A 2SCPA 1NCZA 2MJWB 2M7LA 1DVIA 2K60A 2KI6C 3D0YB 2BECA 2D8NA 4GFTA 3EVVA 2LV7A 5CPVA 3NHIA 2KFHA 3GK1A 2ZFDA 1NX2A 3CWGA 1IQ5A 1YR5A 2H2KA 3E3RA 3OBVA 3PN7B 4PT1A 1TNWA 2B1UA 3KEVA 3K1EA 4QJ5B 2HPSA 3OB1B 2JQ6A 1ALWA 1CM4A 1HQVA 4JPZB 2BCXA 1KQMB 4ORCB 2GTEA 4ORBB 1TN4A 1QATA 2FJYA 5FI7A 1OMVA 5FI2A 4M2OA 1XA5A 1NX0A 2MHHA 1MWNA 1A2XA 2WCMA 2EGDA 2FCDA 1N65A 2E6WA 2PMYA 2PVBA 3O78A 3VGOA 1CM1A 1NIWA 4DS7A 4P5OE 1YX8A 2QEOA 3OGNA 4DUQA 2M3WA 2H8VA 3O4YA 2KBIA 3A4UB 2GV5A 3CS1A 2MAZA 1DJYA 4INXA 1WDCB 1RK9A 1XFVO 1SY9A 2LVVA 1GM0A 3HCMA 2M0RA 3NHTA 1CLBA 2JNFA 1A29A 1QIVA 4JQ0D 2LAPA 2HETA 1KFXS 1TUZA 1PVAA 2ZN9A 1EJ3A 5KU1A 5CSFA 5J3XA 1KWOB 5ER5A 3PM2A 4E68A 2L4HA 1DELA 1W7JB 3SS5A 3TDIA 1A75B 2JULA 2LLTA 4JWQA 1UURA 5AFPA 5JJGA 1CLMA 3QRXA 1C3ZA 1VRKA 2ZN8A 3BQ3A 3R72A 3N7HA 1MR8A 2LMVA 1ZFSA 1DJXA 3F45A 1TCFA 1XK4C 1EL4A 4MZLA 5D69A 3R1VA 2HF5A 3S0DA 5HL1A 4ICBA 4QJ3B 4Q04A 4F0ZB 3PALA 1DQEA 1F54A 2H61C 3UNWA 3SG4A 1L2OB 1IG5A 1OW4A 1K96A 3FIAA 1YRUB 1B47A 1PALA 3D73A 2QEBA 1KFUS 2JZIA 3NSOA 1FF1A 3CZ1A 1GGWA 4AQIA 2F2PA 2JRFA 1J1EA 3C1VA 3TDUA 5AEQA 2PQLA 3SS4A 1OOFA 1SL7A 1BODA 3DVKA 1K94A 2L0PA 2Y1NA 4BY5A 4CPVA 1OMRA 1CMFA 4MLWA 4AQJA 2L2CA 4IL1A
chains in the Genus database with same CATH topology
1S5GZ 4MBEA 1B7TZ 4OKHA 1B9AA 3FWBA 1C07A 1QASA 3EVUA 1F4OA 1SMGA 2JT0A 4PHNA 2FOTA 2K8MB 1YRTB 3PN7C 1UHJA 2A4JA 2RGIA 4PHMA 1XVJA 2HQWA 1W7IB 1JF0A 1IGVA 1F4QA 2LNKA 1M39A 3EKJA 3RM1A 5B8IB 1RFJA 1JWDA 1XFUO 1DGUA 3OX6A 4YGCB 3SG5A 2SASA 2BCBA 3SJSA 1K8UA 1M45A 1QXPA 2MLFC 1KK8C 2I7AA 1WRLA 2KAVA 1KK7Z 4I5NB 3TUYC 5DKNA 1FI5A 2KGBC 1PULA 1Y1XA 1EXRA 2M49B 2NLNA 4BY4A 4CLNA 4FQOA 5HYDA 2BBNA 2LHIA 1CFFA 1QX2A 2JWWA 3KO0A 5GQQC 3TZ1A 3LCPC 4D1EA 1QLSA 2Y4QA 3EVRA 4DIRA 3KF9A 2OS8B 1WY9A 2L98A 1SCVA 2MLEC 2KAXA 1SYMA 5CSIA 2JC2A 1KWOC 4HRGA 1M31A 1TIZA 1SL9A 1SW8A 2K2FA 1Y1UA 2NCOA 2WC8A 2LVIA 1IKUA 1K9PA 4MZKA 1H8BA 3BOWA 2M9GA 1ODBA 2WCFA 3CR5X 2NCPA 3O2PA 1MHOA 4WQ2A 2JTZA 3WHUB 1J1DA 3WHTB 3AAKA 1YTZC 2I2RE 1YUTA 1Y0VH 4XYNA 3BUWB 2KAYA 1LXFC 1TTXA 1ZMZA 5FYXA 1L2OC 2H61A 3TDZA 2WORA 3WNXB 4QJ4B 1H4BA 2OPOA 3BUMB 3SG6A 1F8HA 1FPWA 1KCYA 4NDBA 1CMGA 2JPTA 1DJHA 2BBMA 3I5IC 1RWYA 2DOQA 3AKBA 1FI6A 1U5IB 2K7OA 4PALA 2KFFA 3PLFB 2VRGA 3NSKA 1NP8A 3IF7A 4U8DA 1QX7A 3NSLA 1UHKA 1B1GA 1OZSA 1RTP1 3GOFA 1K93D 2ZRSA 5ER4X 1KK8B 2KQYA 3TUYB 1QVIZ 1K9KA 5TNCA 1ZUZA 1U5IA 1JUOA 1GJYA 1YURA 4P2YB 5D7FA 2MBXA 3ZNIA 1CB1A 4OR9B 3M0WA 5JOLA 2KQ6A 1SRAA 1JFJA 1PSBA 3FS7A 1YUUA 1SNLA 2GGZA 4YBHB 5I2QA 3SG3A 1F70A 1DGVA 2WCBA 1UP5A 4HRHA 4ZCVA 1CDMA 1C7WA 2FJUB 1QV1A 1AJ4A 1JF2A 2F3YA 1XYDA 1DJZA 4R1EA 5HLOA 1QX5B 1IH0A 1LA0A 1JC2A 2ZKMX 1Q80A 4PHKA 3SIBA 2OS8C 1OQPA 2NXQA 2O60A 4MEWA 1S1EA 3OX5A 2PRUA 3RLZA 2K7DA 2BL0C 3K21A 2PALA 1YVLA 5BPJA 4MRXA 1PRWA 2K2AA 1K9UA 1EG4A 3BXKA 1OSAA 2LM5A 1HT9A 3LK0A 4CIDA 1S36A 1S5GY 2BE4A 1B7TY 4OV2A 1YVHA 4PE0A 2KDHA 2KOTA 1QLKA 2LLSA 3I5IB 1BOCA 2CT9A 1NCXA 1PVBA 3D10A 4YRUA 3TS5B 1DT7B 1S6IA 2CBLA 2MRDA 2K7BA 1SK6D 2KI6D 3SIAA 1DF0B 1NUBA 4MSPA 1DJWA 4YI8A 1RECA 2L51A 4GNKB 4PE1A 4YGBB 2KSPA 1NX1A 1K90D 2R2IA 1LA3A 4C0JA 1MUXA 1DMOA 1OOJA 3IQQA 2Y1MA 2KI4B 1SBJA 3I5HC 1KK7Y 2M8UA 4YGAA 1CKKA 1S6JA 1S6CA 2M97A 5I8NA 3O6BA 1DF0A 2JT3A 3CTNA 1RROA 1M63B 1G8IA 2F33A 1K95A 2KGRA 3I5GC 5DKQA 4NDCA 2G2BA 1JFKA 1NPQA 3EK7A 1OE9B 5I2LA 5I2OA 3BOWB 2JOJA 2QACA 2LCPA 1UHIA 3OP0A 1K2HA 1NCYA 2I18A 1B4CA 1AP4A 3OHMB 2Y5IA 4UPGA 1JSAA 4I5JA 2LANA 1AUIB 1WLMA 2ISDA 1MXLC 4PE7A 4NQGA 2L5XB 2JT8A 2JU0A 2BL0B 4FTGA 3VRNA 2O5GA 5KSZA 1ZACA 2F8PA 1TCOB 1SKTA 1JBAA 3NSIA 2WCEA 4HSZA 4I5KA 1AK8A 1CFDA 2F3ZA 1V1FA 1IJ6A 1MXEA 3MSEB 1TNQA 4N1FA 5KTYA 2KNEA 2LMUA 1YX7A 1BR4B 1KFUL 3DD4A 1XFXO 4MZJA 4ORAB 2Q91A 4GBAA 3BUNB 5AERA 2Q4UA 1OZOA 1QIWA 1DJGA 2AUCA 1J7OA 1AJ5A 4NDDA 2EC6C 3TS5C 3KHEA 1QJTA 1IQ3A 4PE4A 1SPYA 2JNXA 2BCAA 3I5HB 2TN4A 1CDPA 5IBWA 2JTTA 3KPXA 1QVIY 2KHNA 1XFYO 4N5XA 4GGNA 4WRIA 1FW4A 1BMOA 5AANA 3PSRA 2NZ0A 4YGEB 2CXJA 4YI9A 3JVTC 2AAOA 1SR6B 4PCWA 3I5GB 3LLEA 2E30A 4C0KA 1GGZA 4XJKA 1A4PA 1E8AA 1R2UA 3DF0B 3VRPA 1CFCA 3VROA 2KI4C 3DVJA 2V53A 1S3PA 2WNDA 3VRQA 3BUOB 3CR4X 2IS9A 1BF5A 4MVFA 1X02A 4N1GA 3SG2A 2BKHB 3NXAA 4L9MA 3D0YA 1G4YR 1Y1AA 1WLZA 1F71A 3DF0A 4CFRA 3I5FC 3CR2A 3OB2B 4AOMA 3A8RA 1F55A 1AHRA 1R6PA 5CSNA 1WRZA 2CCMA 1A03A 4C0LA 1LINA 5DKRA 2PASA 4YGDB 1D1OA 3CGAA 2LHLA 3SG7A 1EH2A 1AVSA 2LVKA 3EK8A 2BE6A 1Y6WA 2LVJA 3CZTX 2K7CA 5F6TA 1SCMC 2AMIA 1J7RA 4ETOA 1TNPA 2K61A 1UUSA 1NX3A 2LP2A 2M1UA 1NYAA 1RJVA 1G33A 2K0JA 2PSRA 2WOSA 2KFGA 4PHJA 2EC6B 4WQ3A 2JXCA 4A4CA 2COLB 1N0YA 2ZNEA 1DTLA 2QPTA 3LL8B 2EHBA 3EKHA 2LLUA 2KYCA 2OTGC 1UHHA 1A75A 1IWQA 1B8RA 2LC5A 3LK1A 4TNCA 4OCIA 4M2PA 4ZCUA 4CFQA 3JVTB 3PFVA 1L7ZA 2GGMA 1QS7A 1CFPA 4PDZA 4MN0A 3JTDC 1M46A 3FWCA 4GGFA 3ICBA 4A4BA 5K89A 3AKAA 3BYAA 5CSJA 1NWDA 1QV0A 4DCKA 1BR1B 1KSOA 2ZNDA 5G08A 5HKYA 1GQMA 1B8CA 1WRKA 1BG1A 4GAOA 3GK4X 1SR6C 3DVMA 1KSMA 1CTRA 1UWOA 1XFWO 5AXIA 2M29A 3I5FB 1KQVA 1XO5A 3BUXB 1KFXL 1FBVA 1EG3A 1LKJA 3DVEA 1KQMC 1PSRA 5HLVA 2L50A 3VRRA 1QTXA 1XFZO 2M7NA 1J7QA 1J55A 1TNXA 2G9BA 2LUCA 2I94A 1C7VA 3ZWHA 4HREE 1NSHA 1SCMB 1N2DA 3HX4A 2CNPA 1OMDA 2FCEA 4M2QA 4USLA 1J7PA 1MF8B 2JXLA 1CDLA 2ZRTA 1WDCC 2LUXA 3IQOA 1CLLA 2HQ8A 1YUSA 1IRJA 1BT6A 2LP3A 1BJFA 1S26D 2LMTA 5HKWA 3PM8A 1CDNA 3PATA 3EK4A 2BKIB 1ALVA 2P6BB 3GK2A 2L2EA 1BU3A 1B8LA 2KBMA 4GPLB 4GUKA 4MRYA 1ZOTB 2LE9B 2M1KB 1LVCD 2OTGB 1TRFA 1CNPA 3CLNA 2L4IA 2F2OA 3H4SE 5HKZA 4XJKB 1PK0D 1SL8A 1BLQA 2CTNA 1UHNA 1XK4A 2MA2A 1TOPA 4GGFC 4I5LB 4OVNF 3WXAA 1V1GA 3JTDB 1IJ5A 3AAJA 1DJIA 4DRWA 5PALA 2KYFA 1MQ1A 2SCPA 1NCZA 2MJWB 2M7LA 1DVIA 2KI6C 3D0YB 2BECA 2D8NA 4GFTA 3EVVA 2LV7A 5CPVA 2KFHA 3GK1A 2ZFDA 1NX2A 3CWGA 1IQ5A 1YR5A 2H2KA 3E3RA 3PN7B 1TNWA 2B1UA 3KEVA 4QJ5B 2HPSA 3OB1B 2JQ6A 1ALWA 1CM4A 1HQVA 4JPZB 2BCXA 1KQMB 4ORCB 4ORBB 1TN4A 1QATA 1OMVA 4M2OA 1XA5A 1NX0A 2MHHA 1MWNA 1A2XA 2EGDA 2FCDA 1N65A 2E6WA 2PMYA 2PVBA 3O78A 3VGOA 1CM1A 1NIWA 4DS7A 4P5OE 1YX8A 4DUQA 2M3WA 3O4YA 2KBIA 3A4UB 2GV5A 3CS1A 2MAZA 1DJYA 1WDCB 1RK9A 1XFVO 1SY9A 2LVVA 3HCMA 2M0RA 1CLBA 2JNFA 1A29A 1QIVA 4JQ0D 2LAPA 2HETA 1KFXS 1PVAA 2ZN9A 1EJ3A 5KU1A 5CSFA 5J3XA 1KWOB 5ER5A 4E68A 2L4HA 1W7JB 3TDIA 1A75B 2JULA 2LLTA 4JWQA 1UURA 5AFPA 5JJGA 1CLMA 3QRXA 1VRKA 2ZN8A 3BQ3A 1MR8A 2LMVA 1ZFSA 1DJXA 3F45A 1TCFA 1XK4C 1EL4A 4MZLA 5D69A 2HF5A 4ICBA 4QJ3B 4Q04A 4F0ZB 3PALA 1F54A 2H61C 3SG4A 1L2OB 1IG5A 1K96A 3FIAA 1YRUB 1B47A 1PALA 1KFUS 2JZIA 3NSOA 1FF1A 1GGWA 4AQIA 2F2PA 2JRFA 1J1EA 3C1VA 3TDUA 5AEQA 1SL7A 1BODA 3DVKA 1K94A 2L0PA 2Y1NA 4BY5A 4CPVA 1OMRA 1CMFA 4MLWA 4AQJA 4IL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5G Z;  4MBE A;  1B7T Z;  4OKH A;  1B9A A;  3FWB A;  1C07 A;  1QAS A;  3EVU A;  1F4O A;  1SMG A;  2JT0 A;  4PHN A;  2FOT A;  2K8M B;  1YRT B;  3PN7 C;  1UHJ A;  2A4J A;  2RGI A;  4PHM A;  1XVJ A;  2HQW A;  1W7I B;  1JF0 A;  1IGV A;  1F4Q A;  2LNK A;  1M39 A;  3EKJ A;  3RM1 A;  5B8I B;  1RFJ A;  1JWD A;  1XFU O;  1DGU A;  3OX6 A;  4YGC B;  3SG5 A;  2SAS A;  2BCB A;  3SJS A;  1K8U A;  1M45 A;  1QXP A;  2MLF C;  1KK8 C;  2I7A A;  1WRL A;  2KAV A;  1KK7 Z;  4I5N B;  3TUY C;  5DKN A;  1FI5 A;  2KGB C;  1PUL A;  1Y1X A;  1EXR A;  2M49 B;  2NLN A;  4BY4 A;  4CLN A;  4FQO A;  5HYD A;  2BBN A;  2LHI A;  1CFF A;  1QX2 A;  2JWW A;  3KO0 A;  5GQQ C;  3TZ1 A;  3LCP C;  4D1E A;  1QLS A;  2Y4Q A;  3EVR A;  4DIR A;  3KF9 A;  2OS8 B;  1WY9 A;  2L98 A;  1SCV A;  2MLE C;  2KAX A;  1SYM A;  5CSI A;  2JC2 A;  1KWO C;  4HRG A;  1M31 A;  1TIZ A;  1SL9 A;  1SW8 A;  2K2F A;  1Y1U A;  2NCO A;  2WC8 A;  2LVI A;  1IKU A;  1K9P A;  4MZK A;  1H8B A;  3BOW A;  2M9G A;  1ODB A;  2WCF A;  3CR5 X;  2NCP A;  3O2P A;  1MHO A;  4WQ2 A;  2JTZ A;  3WHU B;  1J1D A;  3WHT B;  3AAK A;  1YTZ C;  2I2R E;  1YUT A;  1Y0V H;  4XYN A;  3BUW B;  2KAY A;  1LXF C;  1TTX A;  1ZMZ A;  5FYX A;  1L2O C;  2H61 A;  3TDZ A;  2WOR A;  3WNX B;  4QJ4 B;  1H4B A;  2OPO A;  3BUM B;  3SG6 A;  1F8H A;  1FPW A;  1KCY A;  4NDB A;  1CMG A;  2JPT A;  1DJH A;  2BBM A;  3I5I C;  1RWY A;  2DOQ A;  3AKB A;  1FI6 A;  1U5I B;  2K7O A;  4PAL A;  2KFF A;  3PLF B;  2VRG A;  3NSK A;  1NP8 A;  3IF7 A;  4U8D A;  1QX7 A;  3NSL A;  1UHK A;  1B1G A;  1OZS A;  1RTP 1;  3GOF A;  1K93 D;  2ZRS A;  5ER4 X;  1KK8 B;  2KQY A;  3TUY B;  1QVI Z;  1K9K A;  5TNC A;  1ZUZ A;  1U5I A;  1JUO A;  1GJY A;  1YUR A;  4P2Y B;  5D7F A;  2MBX A;  3ZNI A;  1CB1 A;  4OR9 B;  3M0W A;  5JOL A;  2KQ6 A;  1SRA A;  1JFJ A;  1PSB A;  3FS7 A;  1YUU A;  1SNL A;  2GGZ A;  4YBH B;  5I2Q A;  3SG3 A;  1F70 A;  1DGV A;  2WCB A;  1UP5 A;  4HRH A;  4ZCV A;  1CDM A;  1C7W A;  2FJU B;  1QV1 A;  1AJ4 A;  1JF2 A;  2F3Y A;  1XYD A;  1DJZ A;  4R1E A;  5HLO A;  1QX5 B;  1IH0 A;  1LA0 A;  1JC2 A;  2ZKM X;  1Q80 A;  4PHK A;  3SIB A;  2OS8 C;  1OQP A;  2NXQ A;  2O60 A;  4MEW A;  1S1E A;  3OX5 A;  2PRU A;  3RLZ A;  2K7D A;  2BL0 C;  3K21 A;  2PAL A;  1YVL A;  5BPJ A;  4MRX A;  1PRW A;  2K2A A;  1K9U A;  1EG4 A;  3BXK A;  1OSA A;  2LM5 A;  1HT9 A;  3LK0 A;  4CID A;  1S36 A;  1S5G Y;  2BE4 A;  1B7T Y;  4OV2 A;  1YVH A;  4PE0 A;  2KDH A;  2KOT A;  1QLK A;  2LLS A;  3I5I B;  1BOC A;  2CT9 A;  1NCX A;  1PVB A;  3D10 A;  4YRU A;  3TS5 B;  1DT7 B;  1S6I A;  2CBL A;  2MRD A;  2K7B A;  1SK6 D;  2KI6 D;  3SIA A;  1DF0 B;  1NUB A;  4MSP A;  1DJW A;  4YI8 A;  1REC A;  2L51 A;  4GNK B;  4PE1 A;  4YGB B;  2KSP A;  1NX1 A;  1K90 D;  2R2I A;  1LA3 A;  4C0J A;  1MUX A;  1DMO A;  1OOJ A;  3IQQ A;  2Y1M A;  2KI4 B;  1SBJ A;  3I5H C;  1KK7 Y;  2M8U A;  4YGA A;  1CKK A;  1S6J A;  1S6C A;  2M97 A;  5I8N A;  3O6B A;  1DF0 A;  2JT3 A;  3CTN A;  1RRO A;  1M63 B;  1G8I A;  2F33 A;  1K95 A;  2KGR A;  3I5G C;  5DKQ A;  4NDC A;  2G2B A;  1JFK A;  1NPQ A;  3EK7 A;  1OE9 B;  5I2L A;  5I2O A;  3BOW B;  2JOJ A;  2QAC A;  2LCP A;  1UHI A;  3OP0 A;  1K2H A;  1NCY A;  2I18 A;  1B4C A;  1AP4 A;  3OHM B;  2Y5I A;  4UPG A;  1JSA A;  4I5J A;  2LAN A;  1AUI B;  1WLM A;  2ISD A;  1MXL C;  4PE7 A;  4NQG A;  2L5X B;  2JT8 A;  2JU0 A;  2BL0 B;  4FTG A;  3VRN A;  2O5G A;  5KSZ A;  1ZAC A;  2F8P A;  1TCO B;  1SKT A;  1JBA A;  3NSI A;  2WCE A;  4HSZ A;  4I5K A;  1AK8 A;  1CFD A;  2F3Z A;  1V1F A;  1IJ6 A;  1MXE A;  3MSE B;  1TNQ A;  4N1F A;  5KTY A;  2KNE A;  2LMU A;  1YX7 A;  1BR4 B;  1KFU L;  3DD4 A;  1XFX O;  4MZJ A;  4ORA B;  2Q91 A;  4GBA A;  3BUN B;  5AER A;  2Q4U A;  1OZO A;  1QIW A;  1DJG A;  2AUC A;  1J7O A;  1AJ5 A;  4NDD A;  2EC6 C;  3TS5 C;  3KHE A;  1QJT A;  1IQ3 A;  4PE4 A;  1SPY A;  2JNX A;  2BCA A;  3I5H B;  2TN4 A;  1CDP A;  5IBW A;  2JTT A;  3KPX A;  1QVI Y;  2KHN A;  1XFY O;  4N5X A;  4GGN A;  4WRI A;  1FW4 A;  1BMO A;  5AAN A;  3PSR A;  2NZ0 A;  4YGE B;  2CXJ A;  4YI9 A;  3JVT C;  2AAO A;  1SR6 B;  4PCW A;  3I5G B;  3LLE A;  2E30 A;  4C0K A;  1GGZ A;  4XJK A;  1A4P A;  1E8A A;  1R2U A;  3DF0 B;  3VRP A;  1CFC A;  3VRO A;  2KI4 C;  3DVJ A;  2V53 A;  1S3P A;  2WND A;  3VRQ A;  3BUO B;  3CR4 X;  2IS9 A;  1BF5 A;  4MVF A;  1X02 A;  4N1G A;  3SG2 A;  2BKH B;  3NXA A;  4L9M A;  3D0Y A;  1G4Y R;  1Y1A A;  1WLZ A;  1F71 A;  3DF0 A;  4CFR A;  3I5F C;  3CR2 A;  3OB2 B;  4AOM A;  3A8R A;  1F55 A;  1AHR A;  1R6P A;  5CSN A;  1WRZ A;  2CCM A;  1A03 A;  4C0L A;  1LIN A;  5DKR A;  2PAS A;  4YGD B;  1D1O A;  3CGA A;  2LHL A;  3SG7 A;  1EH2 A;  1AVS A;  2LVK A;  3EK8 A;  2BE6 A;  1Y6W A;  2LVJ A;  3CZT X;  2K7C A;  5F6T A;  1SCM C;  2AMI A;  1J7R A;  4ETO A;  1TNP A;  2K61 A;  1UUS A;  1NX3 A;  2LP2 A;  2M1U A;  1NYA A;  1RJV A;  1G33 A;  2K0J A;  2PSR A;  2WOS A;  2KFG A;  4PHJ A;  2EC6 B;  4WQ3 A;  2JXC A;  4A4C A;  2COL B;  1N0Y A;  2ZNE A;  1DTL A;  2QPT A;  3LL8 B;  2EHB A;  3EKH A;  2LLU A;  2KYC A;  2OTG C;  1UHH A;  1A75 A;  1IWQ A;  1B8R A;  2LC5 A;  3LK1 A;  4TNC A;  4OCI A;  4M2P A;  4ZCU A;  4CFQ A;  3JVT B;  3PFV A;  1L7Z A;  2GGM A;  1QS7 A;  1CFP A;  4PDZ A;  4MN0 A;  3JTD C;  1M46 A;  3FWC A;  4GGF A;  3ICB A;  4A4B A;  5K89 A;  3AKA A;  3BYA A;  5CSJ A;  1NWD A;  1QV0 A;  4DCK A;  1BR1 B;  1KSO A;  2ZND A;  5G08 A;  5HKY A;  1GQM A;  1B8C A;  1WRK A;  1BG1 A;  4GAO A;  3GK4 X;  1SR6 C;  3DVM A;  1KSM A;  1CTR A;  1UWO A;  1XFW O;  5AXI A;  2M29 A;  3I5F B;  1KQV A;  1XO5 A;  3BUX B;  1KFX L;  1FBV A;  1EG3 A;  1LKJ A;  3DVE A;  1KQM C;  1PSR A;  5HLV A;  2L50 A;  3VRR A;  1QTX A;  1XFZ O;  2M7N A;  1J7Q A;  1J55 A;  1TNX A;  2G9B A;  2LUC A;  2I94 A;  1C7V A;  3ZWH A;  4HRE E;  1NSH A;  1SCM B;  1N2D A;  3HX4 A;  2CNP A;  1OMD A;  2FCE A;  4M2Q A;  4USL A;  1J7P A;  1MF8 B;  2JXL A;  1CDL A;  2ZRT A;  1WDC C;  2LUX A;  3IQO A;  1CLL A;  2HQ8 A;  1YUS A;  1IRJ A;  1BT6 A;  2LP3 A;  1BJF A;  1S26 D;  2LMT A;  5HKW A;  3PM8 A;  1CDN A;  3PAT A;  3EK4 A;  2BKI B;  1ALV A;  2P6B B;  3GK2 A;  2L2E A;  1BU3 A;  1B8L A;  2KBM A;  4GPL B;  4GUK A;  4MRY A;  1ZOT B;  2LE9 B;  2M1K B;  1LVC D;  2OTG B;  1TRF A;  1CNP A;  3CLN A;  2L4I A;  2F2O A;  3H4S E;  5HKZ A;  4XJK B;  1PK0 D;  1SL8 A;  1BLQ A;  2CTN A;  1UHN A;  1XK4 A;  2MA2 A;  1TOP A;  4GGF C;  4I5L B;  4OVN F;  3WXA A;  1V1G A;  3JTD B;  1IJ5 A;  3AAJ A;  1DJI A;  4DRW A;  5PAL A;  2KYF A;  1MQ1 A;  2SCP A;  1NCZ A;  2MJW B;  2M7L A;  1DVI A;  2KI6 C;  3D0Y B;  2BEC A;  2D8N A;  4GFT A;  3EVV A;  2LV7 A;  5CPV A;  2KFH A;  3GK1 A;  2ZFD A;  1NX2 A;  3CWG A;  1IQ5 A;  1YR5 A;  2H2K A;  3E3R A;  3PN7 B;  1TNW A;  2B1U A;  3KEV A;  4QJ5 B;  2HPS A;  3OB1 B;  2JQ6 A;  1ALW A;  1CM4 A;  1HQV A;  4JPZ B;  2BCX A;  1KQM B;  4ORC B;  4ORB B;  1TN4 A;  1QAT A;  1OMV A;  4M2O A;  1XA5 A;  1NX0 A;  2MHH A;  1MWN A;  1A2X A;  2EGD A;  2FCD A;  1N65 A;  2E6W A;  2PMY A;  2PVB A;  3O78 A;  3VGO A;  1CM1 A;  1NIW A;  4DS7 A;  4P5O E;  1YX8 A;  4DUQ A;  2M3W A;  3O4Y A;  2KBI A;  3A4U B;  2GV5 A;  3CS1 A;  2MAZ A;  1DJY A;  1WDC B;  1RK9 A;  1XFV O;  1SY9 A;  2LVV A;  3HCM A;  2M0R A;  1CLB A;  2JNF A;  1A29 A;  1QIV A;  4JQ0 D;  2LAP A;  2HET A;  1KFX S;  1PVA A;  2ZN9 A;  1EJ3 A;  5KU1 A;  5CSF A;  5J3X A;  1KWO B;  5ER5 A;  4E68 A;  2L4H A;  1W7J B;  3TDI A;  1A75 B;  2JUL A;  2LLT A;  4JWQ A;  1UUR A;  5AFP A;  5JJG A;  1CLM A;  3QRX A;  1VRK A;  2ZN8 A;  3BQ3 A;  1MR8 A;  2LMV A;  1ZFS A;  1DJX A;  3F45 A;  1TCF A;  1XK4 C;  1EL4 A;  4MZL A;  5D69 A;  2HF5 A;  4ICB A;  4QJ3 B;  4Q04 A;  4F0Z B;  3PAL A;  1F54 A;  2H61 C;  3SG4 A;  1L2O B;  1IG5 A;  1K96 A;  3FIA A;  1YRU B;  1B47 A;  1PAL A;  1KFU S;  2JZI A;  3NSO A;  1FF1 A;  1GGW A;  4AQI A;  2F2P A;  2JRF A;  1J1E A;  3C1V A;  3TDU A;  5AEQ A;  1SL7 A;  1BOD A;  3DVK A;  1K94 A;  2L0P A;  2Y1N A;  4BY5 A;  4CPV A;  1OMR A;  1CMF A;  4MLW A;  4AQJ A;  4IL1 A; 
#chains in the Genus database with same CATH topology
 1S5G Z;  4MBE A;  1B7T Z;  4OKH A;  1B9A A;  3FWB A;  1C07 A;  1QAS A;  3EVU A;  1F4O A;  1SMG A;  2JT0 A;  4PHN A;  2FOT A;  2K8M B;  1YRT B;  3PN7 C;  1UHJ A;  2A4J A;  2RGI A;  4PHM A;  3CYZ A;  3R1O A;  1XVJ A;  2HQW A;  1W7I B;  1Z2C B;  1JF0 A;  1IGV A;  1F4Q A;  2LNK A;  1M39 A;  3EKJ A;  3RM1 A;  5B8I B;  1RFJ A;  1SSE B;  1JWD A;  1XFU O;  1DGU A;  3OX6 A;  4YGC B;  3SG5 A;  2SAS A;  2BCB A;  3SJS A;  1K8U A;  1M45 A;  1QXP A;  3BJH A;  2MLF C;  1KK8 C;  2I7A A;  1WRL A;  2KAV A;  1KK7 Z;  4I5N B;  3TUY C;  5DKN A;  1FI5 A;  2KGB C;  1PUL A;  1Y1X A;  3BFA A;  1EXR A;  2M49 B;  2NLN A;  4BY4 A;  4CLN A;  4FQO A;  5HYD A;  3RZS A;  2BBN A;  2LHI A;  1CFF A;  1QX2 A;  2BAP A;  2JWW A;  3KO0 A;  5GQQ C;  3LCP C;  3TZ1 A;  2QDI A;  1QLS A;  2Y4Q A;  4D1E A;  3EVR A;  4DIR A;  3KF9 A;  2OS8 B;  1WY9 A;  2L98 A;  1SCV A;  2MLE C;  2KAX A;  1SYM A;  5CSI A;  2JC2 A;  1KWO C;  3R1P A;  4HRG A;  1M31 A;  1TIZ A;  1SL9 A;  1SW8 A;  2K2F A;  1Y1U A;  2NCO A;  2WC8 A;  2LVI A;  1IKU A;  1K9P A;  4MZK A;  1H8B A;  3BOW A;  2M9G A;  1ODB A;  2WCF A;  3CR5 X;  2NCP A;  3O2P A;  1MHO A;  4WQ2 A;  2JPO A;  3Q8I A;  2JTZ A;  3WHU B;  1J1D A;  3WHT B;  3AAK A;  1YTZ C;  4FQT A;  3DYE A;  2I2R E;  5I94 A;  1YUT A;  1Y0V H;  4XYN A;  3BUW B;  2KAY A;  1LXF C;  1TTX A;  1ZMZ A;  5FYX A;  1L2O C;  2H61 A;  3TDZ A;  2WOR A;  3WNX B;  2P70 A;  4QJ4 B;  2WCK A;  1H4B A;  2OPO A;  3BUM B;  3SG6 A;  1F8H A;  1FPW A;  1KCY A;  3FE9 A;  4NDB A;  4F7F A;  1CMG A;  2JPT A;  1DJH A;  2BBM A;  3BFH A;  3I5I C;  1RWY A;  2DOQ A;  3AKB A;  1FI6 A;  1U5I B;  2K7O A;  4PAL A;  5D3O A;  2KFF A;  3PLF B;  2VRG A;  3NSK A;  1NP8 A;  3IF7 A;  4U8D A;  1QX7 A;  3NSL A;  1UHK A;  1B1G A;  1OZS A;  1RTP 1;  3GOF A;  1K93 D;  2ZRS A;  5ER4 X;  1KK8 B;  3B7A A;  2KQY A;  3D77 A;  2PYQ A;  3TUY B;  1QVI Z;  1K9K A;  5TNC A;  1ZUZ A;  1U5I A;  1JUO A;  1GJY A;  1YUR A;  2P71 A;  4P2Y B;  5D7F A;  2MBX A;  3ZNI A;  1CB1 A;  4OR9 B;  3M0W A;  5JOL A;  2KQ6 A;  1SRA A;  1JFJ A;  1PSB A;  3FS7 A;  1YUU A;  1SNL A;  2GGZ A;  4YBH B;  5I2Q A;  3SG3 A;  4INW A;  1F70 A;  4JD9 A;  1DGV A;  2WCB A;  1UP5 A;  4HRH A;  4ZCV A;  1CDM A;  1C7W A;  2FJU B;  1QV1 A;  1AJ4 A;  1JF2 A;  2F3Y A;  1XYD A;  1DJZ A;  3D74 A;  4R1E A;  1QX5 B;  5HLO A;  1IH0 A;  3B6X A;  1OOG A;  1LA0 A;  1JC2 A;  2ZKM X;  1Q80 A;  4PHK A;  3SIB A;  2OS8 C;  2YGU A;  1OQP A;  2NXQ A;  2O60 A;  2KLD A;  3L4A A;  1S1E A;  3OX5 A;  2PRU A;  4MEW A;  3RLZ A;  2K7D A;  2BL0 C;  3BFB A;  3K21 A;  3B88 A;  1DC1 A;  2PAL A;  1YVL A;  5DIC A;  3CDN A;  5BPJ A;  4MRX A;  3S0B A;  1PRW A;  2WC6 A;  2K2A A;  1K9U A;  1EG4 A;  3BXK A;  1OSA A;  2LM5 A;  1HT9 A;  3FE8 A;  3LK0 A;  4CID A;  1S36 A;  1S5G Y;  2BE4 A;  1B7T Y;  4OV2 A;  3EG5 B;  3VB1 A;  1YVH A;  2WCL A;  2KDH A;  2KOT A;  4PE0 A;  1QLK A;  2LLS A;  3I5I B;  1BOC A;  2CT9 A;  1NCX A;  1PVB A;  3SS3 A;  3D10 A;  4YRU A;  3TS5 B;  1DT7 B;  1W9Z A;  1S6I A;  2CBL A;  2MRD A;  2K7B A;  1SK6 D;  2KI6 D;  3SIA A;  1DF0 B;  1NUB A;  4KYN A;  4MSP A;  1DJW A;  5EL2 A;  4YI8 A;  1REC A;  2L51 A;  4GNK B;  4PE1 A;  4YGB B;  2KSP A;  1NX1 A;  1K90 D;  2R2I A;  1LA3 A;  4C0J A;  1MUX A;  1DMO A;  1OOJ A;  3IQQ A;  2Y1M A;  2KI4 B;  1SBJ A;  3I5H C;  1KK7 Y;  2M8U A;  4YGA A;  2BNX A;  1CKK A;  1S6J A;  1S6C A;  2M97 A;  5I8N A;  3O6B A;  1DF0 A;  2JT3 A;  3CTN A;  1RRO A;  1M63 B;  1G8I A;  2F33 A;  1K95 A;  2KGR A;  3I5G C;  5DKQ A;  4IJ7 A;  2G2B A;  1JFK A;  1NPQ A;  3EK7 A;  1OE9 B;  4NDC A;  2L5Y A;  5I2L A;  5I2O A;  3BOW B;  2JOJ A;  2QAC A;  2LCP A;  1UHI A;  3OP0 A;  1K2H A;  1NCY A;  2I18 A;  1B4C A;  1AP4 A;  3OHM B;  2Y5I A;  4UPG A;  1JSA A;  3D78 A;  4I5J A;  2LAN A;  1AUI B;  1WLM A;  2ISD A;  3CZ0 A;  1MXL C;  4PE7 A;  4NQG A;  2L5X B;  2JT8 A;  2JU0 A;  2BL0 B;  4FTG A;  3VRN A;  2O5G A;  5KSZ A;  1ZAC A;  2F8P A;  1TCO B;  1SKT A;  3L4L A;  1JBA A;  3NSI A;  3NGV A;  2WCE A;  4HSZ A;  1Z4H A;  4I5K A;  4JKT A;  1AK8 A;  1CFD A;  2F3Z A;  1LS8 A;  1V1F A;  1IJ6 A;  1MXE A;  3MSE B;  1TNQ A;  1C3Y A;  4N1F A;  5KTY A;  3S0F A;  2KNE A;  2LMU A;  2QEV A;  1YX7 A;  3S0G A;  1BR4 B;  1KFU L;  3DD4 A;  1P28 A;  1XFX O;  4MZJ A;  4ORA B;  2Q91 A;  4GBA A;  3BUN B;  5AER A;  2Q4U A;  2WC5 A;  1OZO A;  1QIW A;  1DJG A;  2AUC A;  1J7O A;  1AJ5 A;  4NDD A;  2EC6 C;  3TS5 C;  3KHE A;  1QJT A;  2WCJ A;  3DZT A;  1IQ3 A;  4PE4 A;  1SPY A;  2JNX A;  2BCA A;  3I5H B;  2TN4 A;  1CDP A;  5IBW A;  1ORG A;  2JTT A;  3KPX A;  1QVI Y;  2KHN A;  1XFY O;  4N5X A;  4GGN A;  3B87 A;  1OOI X;  4WRI A;  1FW4 A;  1BMO A;  5AAN A;  3PSR A;  2NZ0 A;  4YGE B;  3B86 A;  2CXJ A;  4YI9 A;  3JVT C;  2AAO A;  1SR6 B;  4PCW A;  3I5G B;  3LLE A;  2E30 A;  4C0K A;  1GGZ A;  4XJK A;  1A4P A;  1E8A A;  1R2U A;  3DF0 B;  1OOH A;  3VRP A;  1CFC A;  3VRO A;  2KI4 C;  3DVJ A;  2V53 A;  1S3P A;  2WND A;  3VRQ A;  2KPH A;  3BUO B;  3CR4 X;  2IS9 A;  1BF5 A;  4MVF A;  1X02 A;  4N1G A;  3SG2 A;  2BKH B;  3NXA A;  4L9M A;  3D0Y A;  1G4Y R;  1Y1A A;  1WLZ A;  1F71 A;  3DF0 A;  3O4X A;  4CFR A;  3I5F C;  3CR2 A;  3OB2 B;  4AOM A;  3A8R A;  3DXL A;  1F55 A;  1AHR A;  1R6P A;  5CSN A;  1WRZ A;  2CCM A;  1A03 A;  4C0L A;  1LIN A;  5DKR A;  2PAS A;  4YGD B;  1D1O A;  3CGA A;  2LHL A;  3L47 A;  3SG7 A;  3QME A;  1EH2 A;  1AVS A;  2LVK A;  3EK8 A;  3S0A A;  2BE6 A;  1Y6W A;  2LVJ A;  3CZT X;  2K7C A;  5F6T A;  1SCM C;  2AMI A;  3S0E A;  1J7R A;  4ETO A;  1TNP A;  2K61 A;  1UUS A;  1NX3 A;  2LP2 A;  2M1U A;  1NYA A;  1RJV A;  1G33 A;  2K0J A;  2PSR A;  2WOS A;  3PJI A;  1TUJ A;  2KFG A;  4PHJ A;  2EC6 B;  4WQ3 A;  2JXC A;  4A4C A;  2KLE A;  2COL B;  1N0Y A;  2ZNE A;  1DTL A;  2QPT A;  1TWO A;  3LL8 B;  2EHB A;  2QEH A;  2LLU A;  3EKH A;  2KYC A;  4OZD A;  2OTG C;  1UHH A;  1A75 A;  1IWQ A;  1B8R A;  2LC5 A;  3LK1 A;  4TNC A;  4OCI A;  4M2P A;  4ZCU A;  4CFQ A;  3JVT B;  3PFV A;  1L7Z A;  2GGM A;  1QS7 A;  1CFP A;  4PDZ A;  4MN0 A;  3CAB A;  1M46 A;  3FWC A;  3JTD C;  4GGF A;  3ICB A;  4A4B A;  5K89 A;  3AKA A;  3BYA A;  5CSJ A;  1NWD A;  1QV0 A;  4DCK A;  1BR1 B;  1KSO A;  2ZND A;  5G08 A;  5HKY A;  1B8C A;  1GQM A;  1QWV A;  1WRK A;  3CZ2 A;  3DY9 A;  1BG1 A;  4GAO A;  3GK4 X;  1SR6 C;  3DVM A;  1KSM A;  1CTR A;  1UWO A;  1XFW O;  5AXI A;  2M29 A;  3I5F B;  1KQV A;  1XO5 A;  3BUX B;  1KFX L;  1FBV A;  1EG3 A;  1LKJ A;  3DVE A;  1KQM C;  1PSR A;  5HLV A;  2L50 A;  3D76 A;  5FI6 A;  1QTX A;  1XFZ O;  3VRR A;  2M7N A;  3V2L A;  1J7Q A;  1J55 A;  1TNX A;  2G9B A;  1XFR A;  2LUC A;  2I94 A;  1C7V A;  3ZWH A;  1IIO A;  4HRE E;  1NSH A;  1SCM B;  1N2D A;  3HX4 A;  3D75 A;  2CNP A;  1OMD A;  2FCE A;  4M2Q A;  4USL A;  1J7P A;  1DEK A;  1MF8 B;  1T14 A;  2JXL A;  1CDL A;  2ZRT A;  1WDC C;  2LUX A;  3IQO A;  1CLL A;  2HQ8 A;  1YUS A;  1IRJ A;  1BT6 A;  2WCH A;  2LP3 A;  1BJF A;  1S26 D;  2LMT A;  5HKW A;  3PM8 A;  1CDN A;  3PAT A;  3EK4 A;  2BKI B;  1ALV A;  2P6B B;  3GK2 A;  3UO9 A;  2L2E A;  1BU3 A;  3FE6 A;  1B8L A;  3IVT A;  2KBM A;  4GPL B;  4GUK A;  4MRY A;  1ZOT B;  2LE9 B;  2M1K B;  1LVC D;  2OTG B;  1TRF A;  1CNP A;  3CLN A;  2L4I A;  2F2O A;  3H4S E;  5HKZ A;  4XJK B;  1PK0 D;  1SL8 A;  1BLQ A;  2CTN A;  1UHN A;  1XK4 A;  2MA2 A;  1TOP A;  4GGF C;  4I5L B;  4OVN F;  3WXA A;  1V1G A;  3JTD B;  1IJ5 A;  2ERB A;  3AAJ A;  1DJI A;  4DRW A;  5PAL A;  2KYF A;  1MQ1 A;  2SCP A;  1NCZ A;  2MJW B;  2M7L A;  1DVI A;  2K60 A;  2KI6 C;  3D0Y B;  2BEC A;  2D8N A;  4GFT A;  3EVV A;  2LV7 A;  5CPV A;  3NHI A;  2KFH A;  3GK1 A;  2ZFD A;  1NX2 A;  3CWG A;  1IQ5 A;  1YR5 A;  2H2K A;  3E3R A;  3OBV A;  3PN7 B;  4PT1 A;  1TNW A;  2B1U A;  3KEV A;  3K1E A;  4QJ5 B;  2HPS A;  3OB1 B;  2JQ6 A;  1ALW A;  1CM4 A;  1HQV A;  4JPZ B;  2BCX A;  1KQM B;  4ORC B;  2GTE A;  4ORB B;  1TN4 A;  1QAT A;  2FJY A;  5FI7 A;  1OMV A;  5FI2 A;  4M2O A;  1XA5 A;  1NX0 A;  2MHH A;  1MWN A;  1A2X A;  2WCM A;  2EGD A;  2FCD A;  1N65 A;  2E6W A;  2PMY A;  2PVB A;  3O78 A;  3VGO A;  1CM1 A;  1NIW A;  4DS7 A;  4P5O E;  1YX8 A;  2QEO A;  3OGN A;  4DUQ A;  2M3W A;  2H8V A;  3O4Y A;  2KBI A;  3A4U B;  2GV5 A;  3CS1 A;  2MAZ A;  1DJY A;  4INX A;  1WDC B;  1RK9 A;  1XFV O;  1SY9 A;  2LVV A;  1GM0 A;  3HCM A;  2M0R A;  3NHT A;  1CLB A;  2JNF A;  1A29 A;  1QIV A;  4JQ0 D;  2LAP A;  2HET A;  1KFX S;  1TUZ A;  1PVA A;  2ZN9 A;  1EJ3 A;  5KU1 A;  5CSF A;  5J3X A;  1KWO B;  5ER5 A;  3PM2 A;  4E68 A;  2L4H A;  1DEL A;  1W7J B;  3SS5 A;  3TDI A;  1A75 B;  2JUL A;  2LLT A;  4JWQ A;  1UUR A;  5AFP A;  5JJG A;  1CLM A;  3QRX A;  1C3Z A;  1VRK A;  2ZN8 A;  3BQ3 A;  3R72 A;  3N7H A;  1MR8 A;  2LMV A;  1ZFS A;  1DJX A;  3F45 A;  1TCF A;  1XK4 C;  1EL4 A;  4MZL A;  5D69 A;  3R1V A;  2HF5 A;  3S0D A;  5HL1 A;  4ICB A;  4QJ3 B;  4Q04 A;  4F0Z B;  3PAL A;  1DQE A;  1F54 A;  2H61 C;  3UNW A;  3SG4 A;  1L2O B;  1IG5 A;  1OW4 A;  1K96 A;  3FIA A;  1YRU B;  1B47 A;  1PAL A;  3D73 A;  2QEB A;  1KFU S;  2JZI A;  3NSO A;  1FF1 A;  3CZ1 A;  1GGW A;  4AQI A;  2F2P A;  2JRF A;  1J1E A;  3C1V A;  3TDU A;  5AEQ A;  2PQL A;  3SS4 A;  1OOF A;  1SL7 A;  1BOD A;  3DVK A;  1K94 A;  2L0P A;  2Y1N A;  4BY5 A;  4CPV A;  1OMR A;  1CMF A;  4MLW A;  4AQJ A;  2L2C A;  4IL1 A; 
#chains in the Genus database with same CATH homology
 1S5G Z;  4MBE A;  1B7T Z;  4OKH A;  1B9A A;  3FWB A;  1C07 A;  1QAS A;  3EVU A;  1F4O A;  1SMG A;  2JT0 A;  4PHN A;  2FOT A;  2K8M B;  1YRT B;  3PN7 C;  1UHJ A;  2A4J A;  2RGI A;  4PHM A;  1XVJ A;  2HQW A;  1W7I B;  1JF0 A;  1IGV A;  1F4Q A;  2LNK A;  1M39 A;  3EKJ A;  3RM1 A;  5B8I B;  1RFJ A;  1JWD A;  1XFU O;  1DGU A;  3OX6 A;  4YGC B;  3SG5 A;  2SAS A;  2BCB A;  3SJS A;  1K8U A;  1M45 A;  1QXP A;  2MLF C;  1KK8 C;  2I7A A;  1WRL A;  2KAV A;  1KK7 Z;  4I5N B;  3TUY C;  5DKN A;  1FI5 A;  2KGB C;  1PUL A;  1Y1X A;  1EXR A;  2M49 B;  2NLN A;  4BY4 A;  4CLN A;  4FQO A;  5HYD A;  2BBN A;  2LHI A;  1CFF A;  1QX2 A;  2JWW A;  3KO0 A;  5GQQ C;  3TZ1 A;  3LCP C;  4D1E A;  1QLS A;  2Y4Q A;  3EVR A;  4DIR A;  3KF9 A;  2OS8 B;  1WY9 A;  2L98 A;  1SCV A;  2MLE C;  2KAX A;  1SYM A;  5CSI A;  2JC2 A;  1KWO C;  4HRG A;  1M31 A;  1TIZ A;  1SL9 A;  1SW8 A;  2K2F A;  1Y1U A;  2NCO A;  2WC8 A;  2LVI A;  1IKU A;  1K9P A;  4MZK A;  1H8B A;  3BOW A;  2M9G A;  1ODB A;  2WCF A;  3CR5 X;  2NCP A;  3O2P A;  1MHO A;  4WQ2 A;  2JTZ A;  3WHU B;  1J1D A;  3WHT B;  3AAK A;  1YTZ C;  2I2R E;  1YUT A;  1Y0V H;  4XYN A;  3BUW B;  2KAY A;  1LXF C;  1TTX A;  1ZMZ A;  5FYX A;  1L2O C;  2H61 A;  3TDZ A;  2WOR A;  3WNX B;  4QJ4 B;  1H4B A;  2OPO A;  3BUM B;  3SG6 A;  1F8H A;  1FPW A;  1KCY A;  4NDB A;  1CMG A;  2JPT A;  1DJH A;  2BBM A;  3I5I C;  1RWY A;  2DOQ A;  3AKB A;  1FI6 A;  1U5I B;  2K7O A;  4PAL A;  2KFF A;  3PLF B;  2VRG A;  3NSK A;  1NP8 A;  3IF7 A;  4U8D A;  1QX7 A;  3NSL A;  1UHK A;  1B1G A;  1OZS A;  1RTP 1;  3GOF A;  1K93 D;  2ZRS A;  5ER4 X;  1KK8 B;  2KQY A;  3TUY B;  1QVI Z;  1K9K A;  5TNC A;  1ZUZ A;  1U5I A;  1JUO A;  1GJY A;  1YUR A;  4P2Y B;  5D7F A;  2MBX A;  3ZNI A;  1CB1 A;  4OR9 B;  3M0W A;  5JOL A;  2KQ6 A;  1SRA A;  1JFJ A;  1PSB A;  3FS7 A;  1YUU A;  1SNL A;  2GGZ A;  4YBH B;  5I2Q A;  3SG3 A;  1F70 A;  1DGV A;  2WCB A;  1UP5 A;  4HRH A;  4ZCV A;  1CDM A;  1C7W A;  2FJU B;  1QV1 A;  1AJ4 A;  1JF2 A;  2F3Y A;  1XYD A;  1DJZ A;  4R1E A;  5HLO A;  1QX5 B;  1IH0 A;  1LA0 A;  1JC2 A;  2ZKM X;  1Q80 A;  4PHK A;  3SIB A;  2OS8 C;  1OQP A;  2NXQ A;  2O60 A;  4MEW A;  1S1E A;  3OX5 A;  2PRU A;  3RLZ A;  2K7D A;  2BL0 C;  3K21 A;  2PAL A;  1YVL A;  5BPJ A;  4MRX A;  1PRW A;  2K2A A;  1K9U A;  1EG4 A;  3BXK A;  1OSA A;  2LM5 A;  1HT9 A;  3LK0 A;  4CID A;  1S36 A;  1S5G Y;  2BE4 A;  1B7T Y;  4OV2 A;  1YVH A;  4PE0 A;  2KDH A;  2KOT A;  1QLK A;  2LLS A;  3I5I B;  1BOC A;  2CT9 A;  1NCX A;  1PVB A;  3D10 A;  4YRU A;  3TS5 B;  1DT7 B;  1S6I A;  2CBL A;  2MRD A;  2K7B A;  1SK6 D;  2KI6 D;  3SIA A;  1DF0 B;  1NUB A;  4MSP A;  1DJW A;  4YI8 A;  1REC A;  2L51 A;  4GNK B;  4PE1 A;  4YGB B;  2KSP A;  1NX1 A;  1K90 D;  2R2I A;  1LA3 A;  4C0J A;  1MUX A;  1DMO A;  1OOJ A;  3IQQ A;  2Y1M A;  2KI4 B;  1SBJ A;  3I5H C;  1KK7 Y;  2M8U A;  4YGA A;  1CKK A;  1S6J A;  1S6C A;  2M97 A;  5I8N A;  3O6B A;  1DF0 A;  2JT3 A;  3CTN A;  1RRO A;  1M63 B;  1G8I A;  2F33 A;  1K95 A;  2KGR A;  3I5G C;  5DKQ A;  4NDC A;  2G2B A;  1JFK A;  1NPQ A;  3EK7 A;  1OE9 B;  5I2L A;  5I2O A;  3BOW B;  2JOJ A;  2QAC A;  2LCP A;  1UHI A;  3OP0 A;  1K2H A;  1NCY A;  2I18 A;  1B4C A;  1AP4 A;  3OHM B;  2Y5I A;  4UPG A;  1JSA A;  4I5J A;  2LAN A;  1AUI B;  1WLM A;  2ISD A;  1MXL C;  4PE7 A;  4NQG A;  2L5X B;  2JT8 A;  2JU0 A;  2BL0 B;  4FTG A;  3VRN A;  2O5G A;  5KSZ A;  1ZAC A;  2F8P A;  1TCO B;  1SKT A;  1JBA A;  3NSI A;  2WCE A;  4HSZ A;  4I5K A;  1AK8 A;  1CFD A;  2F3Z A;  1V1F A;  1IJ6 A;  1MXE A;  3MSE B;  1TNQ A;  4N1F A;  5KTY A;  2KNE A;  2LMU A;  1YX7 A;  1BR4 B;  1KFU L;  3DD4 A;  1XFX O;  4MZJ A;  4ORA B;  2Q91 A;  4GBA A;  3BUN B;  5AER A;  2Q4U A;  1OZO A;  1QIW A;  1DJG A;  2AUC A;  1J7O A;  1AJ5 A;  4NDD A;  2EC6 C;  3TS5 C;  3KHE A;  1QJT A;  1IQ3 A;  4PE4 A;  1SPY A;  2JNX A;  2BCA A;  3I5H B;  2TN4 A;  1CDP A;  5IBW A;  2JTT A;  3KPX A;  1QVI Y;  2KHN A;  1XFY O;  4N5X A;  4GGN A;  4WRI A;  1FW4 A;  1BMO A;  5AAN A;  3PSR A;  2NZ0 A;  4YGE B;  2CXJ A;  4YI9 A;  3JVT C;  2AAO A;  1SR6 B;  4PCW A;  3I5G B;  3LLE A;  2E30 A;  4C0K A;  1GGZ A;  4XJK A;  1A4P A;  1E8A A;  1R2U A;  3DF0 B;  3VRP A;  1CFC A;  3VRO A;  2KI4 C;  3DVJ A;  2V53 A;  1S3P A;  2WND A;  3VRQ A;  3BUO B;  3CR4 X;  2IS9 A;  1BF5 A;  4MVF A;  1X02 A;  4N1G A;  3SG2 A;  2BKH B;  3NXA A;  4L9M A;  3D0Y A;  1G4Y R;  1Y1A A;  1WLZ A;  1F71 A;  3DF0 A;  4CFR A;  3I5F C;  3CR2 A;  3OB2 B;  4AOM A;  3A8R A;  1F55 A;  1AHR A;  1R6P A;  5CSN A;  1WRZ A;  2CCM A;  1A03 A;  4C0L A;  1LIN A;  5DKR A;  2PAS A;  4YGD B;  1D1O A;  3CGA A;  2LHL A;  3SG7 A;  1EH2 A;  1AVS A;  2LVK A;  3EK8 A;  2BE6 A;  1Y6W A;  2LVJ A;  3CZT X;  2K7C A;  5F6T A;  1SCM C;  2AMI A;  1J7R A;  4ETO A;  1TNP A;  2K61 A;  1UUS A;  1NX3 A;  2LP2 A;  2M1U A;  1NYA A;  1RJV A;  1G33 A;  2K0J A;  2PSR A;  2WOS A;  2KFG A;  4PHJ A;  2EC6 B;  4WQ3 A;  2JXC A;  4A4C A;  2COL B;  1N0Y A;  2ZNE A;  1DTL A;  2QPT A;  3LL8 B;  2EHB A;  3EKH A;  2LLU A;  2KYC A;  2OTG C;  1UHH A;  1A75 A;  1IWQ A;  1B8R A;  2LC5 A;  3LK1 A;  4TNC A;  4OCI A;  4M2P A;  4ZCU A;  4CFQ A;  3JVT B;  3PFV A;  1L7Z A;  2GGM A;  1QS7 A;  1CFP A;  4PDZ A;  4MN0 A;  3JTD C;  1M46 A;  3FWC A;  4GGF A;  3ICB A;  4A4B A;  5K89 A;  3AKA A;  3BYA A;  5CSJ A;  1NWD A;  1QV0 A;  4DCK A;  1BR1 B;  1KSO A;  2ZND A;  5G08 A;  5HKY A;  1GQM A;  1B8C A;  1WRK A;  1BG1 A;  4GAO A;  3GK4 X;  1SR6 C;  3DVM A;  1KSM A;  1CTR A;  1UWO A;  1XFW O;  5AXI A;  2M29 A;  3I5F B;  1KQV A;  1XO5 A;  3BUX B;  1KFX L;  1FBV A;  1EG3 A;  1LKJ A;  3DVE A;  1KQM C;  1PSR A;  5HLV A;  2L50 A;  3VRR A;  1QTX A;  1XFZ O;  2M7N A;  1J7Q A;  1J55 A;  1TNX A;  2G9B A;  2LUC A;  2I94 A;  1C7V A;  3ZWH A;  4HRE E;  1NSH A;  1SCM B;  1N2D A;  3HX4 A;  2CNP A;  1OMD A;  2FCE A;  4M2Q A;  4USL A;  1J7P A;  1MF8 B;  2JXL A;  1CDL A;  2ZRT A;  1WDC C;  2LUX A;  3IQO A;  1CLL A;  2HQ8 A;  1YUS A;  1IRJ A;  1BT6 A;  2LP3 A;  1BJF A;  1S26 D;  2LMT A;  5HKW A;  3PM8 A;  1CDN A;  3PAT A;  3EK4 A;  2BKI B;  1ALV A;  2P6B B;  3GK2 A;  2L2E A;  1BU3 A;  1B8L A;  2KBM A;  4GPL B;  4GUK A;  4MRY A;  1ZOT B;  2LE9 B;  2M1K B;  1LVC D;  2OTG B;  1TRF A;  1CNP A;  3CLN A;  2L4I A;  2F2O A;  3H4S E;  5HKZ A;  4XJK B;  1PK0 D;  1SL8 A;  1BLQ A;  2CTN A;  1UHN A;  1XK4 A;  2MA2 A;  1TOP A;  4GGF C;  4I5L B;  4OVN F;  3WXA A;  1V1G A;  3JTD B;  1IJ5 A;  3AAJ A;  1DJI A;  4DRW A;  5PAL A;  2KYF A;  1MQ1 A;  2SCP A;  1NCZ A;  2MJW B;  2M7L A;  1DVI A;  2KI6 C;  3D0Y B;  2BEC A;  2D8N A;  4GFT A;  3EVV A;  2LV7 A;  5CPV A;  2KFH A;  3GK1 A;  2ZFD A;  1NX2 A;  3CWG A;  1IQ5 A;  1YR5 A;  2H2K A;  3E3R A;  3PN7 B;  1TNW A;  2B1U A;  3KEV A;  4QJ5 B;  2HPS A;  3OB1 B;  2JQ6 A;  1ALW A;  1CM4 A;  1HQV A;  4JPZ B;  2BCX A;  1KQM B;  4ORC B;  4ORB B;  1TN4 A;  1QAT A;  1OMV A;  4M2O A;  1XA5 A;  1NX0 A;  2MHH A;  1MWN A;  1A2X A;  2EGD A;  2FCD A;  1N65 A;  2E6W A;  2PMY A;  2PVB A;  3O78 A;  3VGO A;  1CM1 A;  1NIW A;  4DS7 A;  4P5O E;  1YX8 A;  4DUQ A;  2M3W A;  3O4Y A;  2KBI A;  3A4U B;  2GV5 A;  3CS1 A;  2MAZ A;  1DJY A;  1WDC B;  1RK9 A;  1XFV O;  1SY9 A;  2LVV A;  3HCM A;  2M0R A;  1CLB A;  2JNF A;  1A29 A;  1QIV A;  4JQ0 D;  2LAP A;  2HET A;  1KFX S;  1PVA A;  2ZN9 A;  1EJ3 A;  5KU1 A;  5CSF A;  5J3X A;  1KWO B;  5ER5 A;  4E68 A;  2L4H A;  1W7J B;  3TDI A;  1A75 B;  2JUL A;  2LLT A;  4JWQ A;  1UUR A;  5AFP A;  5JJG A;  1CLM A;  3QRX A;  1VRK A;  2ZN8 A;  3BQ3 A;  1MR8 A;  2LMV A;  1ZFS A;  1DJX A;  3F45 A;  1TCF A;  1XK4 C;  1EL4 A;  4MZL A;  5D69 A;  2HF5 A;  4ICB A;  4QJ3 B;  4Q04 A;  4F0Z B;  3PAL A;  1F54 A;  2H61 C;  3SG4 A;  1L2O B;  1IG5 A;  1K96 A;  3FIA A;  1YRU B;  1B47 A;  1PAL A;  1KFU S;  2JZI A;  3NSO A;  1FF1 A;  1GGW A;  4AQI A;  2F2P A;  2JRF A;  1J1E A;  3C1V A;  3TDU A;  5AEQ A;  1SL7 A;  1BOD A;  3DVK A;  1K94 A;  2L0P A;  2Y1N A;  4BY5 A;  4CPV A;  1OMR A;  1CMF A;  4MLW A;  4AQJ A;  4IL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...