1B7TY

Myosin digested by papain
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
138
structure length
138
Chain Sequence
PQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYOSIN HEAVY CHAIN
publication title Atomic structure of scallop myosin subfragment S1 complexed with MgADP: a novel conformation of the myosin head.
pubmed doi rcsb
molecule tags Myosin
total genus 39
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 1999-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1b7tY01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1b7tY02
5HYDA 1YRTB 1TNWA 1K93D 1S5GY 2TN4A 1DJIA 1KSOA 1K9PA 1YX8A 2PALA 1CM4A 1JFJA 4E68A 5CSFA 1JF2A 2JNFA 2MJWB 2OTGC 3WNXB 1K94A 1F54A 2B1UA 2KQYA 4YRUA 1DJGA 1WRLA 5FYXA 1A75A 1TNPA 1CFFA 1UHIA 1M31A 1PK0D 1TRFA 4ICBA 4FQOA 1PALA 2BL0C 3WHTB 1PVAA 2BCXA 3O4YA 2MBXA 2P6BB 1BMOA 3OP0A 3GK2A 5K89A 3A4UB 4CLNA 3BQ3A 2LVVA 2HETA 4YI8A 3AKAA 1GQMA 4TNCA 1OZSA 1GGZA 1QS7A 2H2KA 2KYCA 2ISDA 5I2LA 2CBLA 3PN7C 4U8DA 1WY9A 2M97A 4MBEA 1EXRA 1QLKA 2KOTA 1NCYA 3JTDB 1QX7A 5DKRA 5BPJA 5JJGA 2KFHA 3DVJA 3NSIA 2KSPA 1YUTA 3EK7A 4MLWA 5DKNA 3VRPA 1YVHA 4Q04A 2LHIA 1QV1A 3H4SE 3I5HC 1BT6A 1XYDA 1YX7A 3D0YA 1RROA 3VRNA 1OMDA 2LP3A 1KQVA 5IBWA 1F8HA 1K96A 2KI6D 4MZKA 1XFWO 1QVIY 1S3PA 4N1GA 1UHJA 1R2UA 1G33A 1NX3A 2M8UA 4C0JA 1WRZA 1ZFSA 1NUBA 1JBAA 1YTZC 2OS8B 1AP4A 1OZOA 1AJ5A 3CR4X 1JSAA 3GK1A 1K90D 1M45A 1RJVA 3EVUA 5HKZA 2RGIA 2PMYA 4ETOA 4F0ZB 1KK8B 2SASA 1QJTA 1X02A 1KK7Z 3SIAA 1FI5A 2MRDA 4I5JA 2BE4A 2I7AA 1FI6A 2L50A 3DVKA 1DGVA 4DUQA 2Y1MA 1AK8A 3KHEA 4R1EA 2M7NA 1LVCD 3GOFA 2QPTA 1ZUZA 1XFVO 3SG3A 2LNKA 4DCKA 2L0PA 3BUNB 5AERA 3FWCA 1TIZA 1BODA 5D69A 4BY4A 1KCYA 1MF8B 4N1FA 2KI6C 1QXPA 2HPSA 2LM5A 1SL8A 2M29A 3PATA 4USLA 2O60A 1J7OA 3EKJA 2L4HA 2JZIA 1S26D 3TZ1A 3FS7A 4YGBB 2L4IA 1ODBA 1UURA 3BUXB 3SG4A 1SCVA 1J7PA 1MQ1A 3IQQA 3VRQA 1SR6B 1ZOTB 2F2OA 2JT8A 3CGAA 3I5GB 4D1EA 2EGDA 1FBVA 4I5KA 1Y1AA 1NWDA 1PSRA 2H61C 1B7TZ 3DVMA 2K7OA 1W7JB 1IGVA 3WHUB 3A8RA 1DJHA 2AUCA 2PVBA 4JQ0D 1TCOB 1CDNA 1B8LA 2GGMA 4FTGA 4YBHB 2BKHB 2CNPA 4PE1A 1XFXO 4QJ5B 5D7FA 1C7WA 4OVNF 3PFVA 4GUKA 1LINA 2LP2A 4PALA 3CTNA 2LCPA 3TUYB 1RTP1 4HREE 4CPVA 1IH0A 5DKQA 5I8NA 1CFPA 1OE9B 1IJ6A 2ZRTA 3BYAA 4L9MA 1UUSA 3RLZA 2KFGA 4CIDA 2A4JA 1QX2A 3CLNA 1AHRA 1SL7A 2FJUB 2GV5A 3O2PA 3ICBA 1FF1A 1BR4B 1SCMB 2ZNDA 2MAZA 1CM1A 4P2YB 3D10A 1KQMB 1XFUO 1PULA 1WDCB 4JPZB 2R2IA 1AJ4A 1DMOA 4MZJA 3NSLA 1SY9A 1S1EA 4WQ3A 1L2OB 1SMGA 2BKIB 2JOJA 2JT3A 1GJYA 2AAOA 2EC6C 2WOSA 2E6WA 2KBMA 4HRHA 4ZCUA 3O6BA 4GBAA 1AUIB 1CKKA 1E8AA 2ZN8A 2NCPA 3HX4A 4MSPA 2LUCA 4OV2A 3DF0B 2COLB 3ZNIA 1RK9A 3CR5X 1NIWA 1CB1A 4GPLB 3K21A 1CDLA 3AAKA 4PHJA 2WNDA 3EK8A 3CZTX 1EH2A 3NXAA 1B8CA 1YVLA 2M1UA 2F8PA 2JPTA 1B4CA 3F45A 4HSZA 2WCBA 1KWOB 2L98A 2LMUA 1D1OA 2FCDA 3TDZA 1NPQA 2KQ6A 2MHHA 1JF0A 2K2FA 2LVIA 2JU0A 3VGOA 1F55A 2LVJA 1DJXA 3EK4A 3PLFB 2K2AA 2F33A 3DD4A 2JULA 4XJKB 1GGWA 4M2PA 1LA3A 2KI4B 2CCMA 3JVTB 2M1KB 1KFXS 1S6JA 4YI9A 1SR6C 1W7IB 5PALA 1Y6WA 3BOWB 2SCPA 1YR5A 1JUOA 4A4CA 1DJWA 2Q4UA 1ALVA 3I5IC 3I5FC 4UPGA 1IWQA 1NSHA 2LE9B 2WORA 1DT7B 3LK0A 2LLUA 1U5IB 1TTXA 3TS5C 1SYMA 2ZRSA 1UHHA 2F3YA 2PASA 4CFQA 2OTGB 2KDHA 2HQ8A 1TN4A 4M2OA 5G08A 1SBJA 1DF0B 2G2BA 2LHLA 1XFYO 1J1DA 5HKYA 4AQIA 1MWNA 1V1GA 2K7BA 4IL1A 4PHNA 1BOCA 1A03A 1EG3A 1WLZA 1XA5A 3LLEA 1CLBA 1LA0A 3TUYC 2LANA 2BECA 1J7RA 2JNXA 2M7LA 4HRGA 4NDCA 2JWWA 1B8RA 4BY5A 5B8IB 2IS9A 1NCZA 1CLMA 5CSJA 1SCMC 2M49B 3OX6A 3AAJA 2ZKMX 3PN7B 1KQMC 3O78A 3PSRA 1JC2A 1WDCC 1NYAA 3SG2A 1A2XA 3MSEB 1S5GZ 1XFZO 2LLTA 2NZ0A 1EG4A 1IJ5A 1MXLC 3KPXA 2JXLA 3M0WA 4DIRA 1F4QA 1CLLA 2JT0A 2Q91A 3DF0A 1Y0VH 3EKHA 2LVKA 3SIBA 2Y4QA 5AEQA 4ORCB 4PE7A 1QV0A 1Y1UA 1N65A 4MN0A 1G8IA 4I5LB 4ORAB 4P5OE 1CDPA 1B47A 1SK6D 1UHNA 2JC2A 1QX5B 4AQJA 1BR1B 2JTZA 1CDMA 2LC5A 4YGEB 5HLOA 1QASA 1HQVA 1BG1A 1CTRA 4PDZA 1MUXA 3JTDC 3ZWHA 2F3ZA 4C0LA 1CMGA 1F71A 2NLNA 2V53A 1OMRA 2FCEA 1KWOC 2EHBA 2VRGA 3OHMB 3LL8B 1M63B 4GFTA 2KAXA 2ZFDA 1SL9A 3AKBA 2M3WA 3NSOA 2DOQA 1DTLA 2KAVA 3RM1A 3SG7A 1K9KA 3CWGA 4WRIA 4XJKA 5AFPA 1F70A 4MRXA 4GAOA 4PE0A 1ZMZA 1NX1A 2WCFA 4DS7A 1IQ5A 1CNPA 5KU1A 2KI4C 3DVEA 1UWOA 3IQOA 4M2QA 1BLQA 1PRWA 1IRJA 3BOWA 4ORBB 3C1VA 3VRRA 5I2QA 2OS8C 3TDUA 1QVIZ 1H4BA 2MA2A 2BBMA 2I18A 1U5IA 1RECA 2CTNA 4MZLA 1NX0A 1LKJA 2L5XB 3SG6A 3QRXA 1R6PA 1OSAA 5F6TA 1LXFC 1KK8C 1J7QA 1JWDA 4PHMA 1DF0A 1B7TY 4GNKB 1Q80A 4OKHA 1F4OA 1TCFA 1ALWA 2QACA 3EVRA 3KF9A 1QIWA 5CSIA 1TNXA 1EJ3A 1K95A 2G9BA 4QJ4B 2I94A 2ZNEA 2KNEA 5J3XA 1C7VA 1NX2A 1YRUB 2LMTA 4N5XA 5CSNA 3BUMB 2ZN9A 1S6CA 1SKTA 5ER5A 1NP8A 2HF5A 3CR2A 4XYNA 2LAPA 4YGDB 2K7DA 2K61A 4MRYA 2CXJA 2Y5IA 4YGCB 1N0YA 2KGBC 3OX5A 3I5GC 1MXEA 3PM8A 1KFUS 2BCAA 2NCOA 2D8NA 4MEWA 1QTXA 4PCWA 1Y1XA 4A4BA 4C0KA 1JFKA 1K9UA 4QJ3B 2KYFA 2MLFC 5KSZA 1YUUA 2I2RE 1M46A 3NSKA 2LV7A 4DRWA 5HKWA 2BE6A 3VROA 3EVVA 4I5NB 5AXIA 1J55A 1HT9A 1A4PA 1QATA 1QIVA 1UHKA 2KHNA 1FPWA 2AMIA 2PRUA 1A75B 1SW8A 1UP5A 2EC6B 2M9GA 2M0RA 4JWQA 4WQ2A 1G4YR 1OOJA 1TNQA 2BL0B 1A29A 5TNCA 2L2EA 1CFDA 1BF5A 1H8BA 1DJYA 1KFXL 2KBIA 1L7ZA 4CFRA 1RFJA 4MVFA 1KFUL 5ER4X 2K8MB 2PSRA 1DVIA 1M39A 1WRKA 1DGUA 2JTTA 1EL4A 1YURA 2GGZA 3E3RA 3SJSA 1MR8A 3BXKA 4ZCVA 5HLVA 2L51A 2CT9A 1IG5A 3KEVA 2LLSA 4OCIA 5I2OA 1B1GA 3FIAA 2O5GA 4GGFA 2LUXA 3KO0A 1CFCA 2OPOA 1L2OC 1SRAA 3I5HB 3OB2B 3TDIA 1MHOA 1AVSA 5JOLA 2BCBA 1XVJA 2WCEA 4GGFC 5AANA 3GK4X 1IQ3A 3IF7A 3D0YB 1SPYA 2KGRA 5GQQC 1B9AA 1S36A 1J1EA 2JQ6A 1K8UA 2Y1NA 4NDDA 1C07A 1VRKA 1K2HA 1IKUA 2FOTA 2E30A 1TOPA 1WLMA 1S6IA 2NXQA 3WXAA 1PSBA 1V1FA 2K7CA 5KTYA 1FW4A 2H61A 2F2PA 2MLEC 1YUSA 1KK7Y 3BUWB 3I5IB 3I5FB 1KSMA 3PALA 1XO5A 4YGAA 4AOMA 1QLSA 3FWBA 3TS5B 4OR9B 1CMFA 1N2DA 2BBNA 2HQWA 2JXCA 1BU3A 3LCPC 5CPVA 1OMVA 4NDBA 1SNLA 2KFFA 1OQPA 2KAYA 4PE4A 1ZACA 2WC8A 3BUOB 3SG5A 3CS1A 3JVTC 1DJZA 1PVBA 2LMVA 1XK4A 3OB1B 4GGNA 3LK1A 1RWYA 3HCMA 1XK4C 1BJFA 2JRFA 4PHKA 4NQGA 2K0JA 1NCXA
chains in the Genus database with same CATH superfamily
5HYDA 1YRTB 1TNWA 1K93D 1S5GY 2TN4A 1DJIA 1KSOA 1K9PA 1YX8A 2PALA 1CM4A 1JFJA 4E68A 5CSFA 1JF2A 2JNFA 2MJWB 2OTGC 3WNXB 1K94A 1F54A 2B1UA 2KQYA 2QEVA 4YRUA 1DJGA 1WRLA 5FYXA 1A75A 1TNPA 2QEHA 1CFFA 1UHIA 3D75A 1OOGA 1M31A 1PK0D 1TRFA 2WCMA 4ICBA 4FQOA 1PALA 4CIDA 2BL0C 3D77A 3WHTB 1PVAA 2BCXA 3FE9A 3O4YA 2MBXA 2P6BB 1BMOA 3OP0A 3CZ0A 3GK2A 3A4UB 5K89A 4CLNA 3BQ3A 1OW4A 2LVVA 2HETA 4YI8A 3AKAA 1GQMA 3FE6A 4TNCA 1OZSA 1GGZA 1QS7A 2H2KA 2KYCA 2ISDA 5I2LA 2CBLA 3PN7C 4U8DA 1WY9A 2M97A 4MBEA 5FI6A 1P28A 1EXRA 1QLKA 2KOTA 3S0EA 1NCYA 3DYEA 3JTDB 1QX7A 3VB1A 5DKRA 3SS5A 5BPJA 5JJGA 2KFHA 1DC1A 3DVJA 3NSIA 2KSPA 1YUTA 3D76A 3EK7A 3R72A 4MLWA 5DKNA 1YVHA 4Q04A 5FI7A 2LHIA 1QV1A 3H4SE 3I5HC 1BT6A 1XYDA 1YX7A 3D0YA 1RROA 3VRNA 1OMDA 2LP3A 1KQVA 1OOHA 5IBWA 3SS3A 1F8HA 1K96A 2KI6D 3R1OA 1XFWO 3CDNA 1QVIY 4MZKA 1S3PA 4N1GA 1UHJA 1R2UA 1G33A 1NX3A 2M8UA 4C0JA 1WRZA 1ZFSA 1NUBA 3V2LA 1JBAA 1YTZC 2OS8B 1AP4A 1OZOA 1AJ5A 3CR4X 2FJYA 1JSAA 3GK1A 1K90D 1M45A 1RJVA 3EVUA 5HKZA 2RGIA 2PMYA 2BNXA 4ETOA 4F0ZB 1KK8B 2SASA 1QJTA 1X02A 1KK7Z 3SIAA 1FI5A 2MRDA 3NHIA 4I5JA 2BE4A 2I7AA 1FI6A 3B86A 2L50A 3DVKA 1DGVA 3N7HA 4DUQA 2Y1MA 1AK8A 3KHEA 4R1EA 2M7NA 1LVCD 3GOFA 2QPTA 1ZUZA 1XFVO 3SG3A 2LNKA 4DCKA 2L0PA 3BUNB 5AERA 3FWCA 1TIZA 1BODA 5D69A 4BY4A 1KCYA 1MF8B 4N1FA 2KI6C 1QXPA 2HPSA 2LM5A 3D78A 1SL8A 2M29A 2GTEA 3PATA 2O60A 4USLA 3EKJA 2L4HA 1J7OA 2JZIA 1S26D 3TZ1A 3FS7A 4YGBB 2L4IA 1ODBA 1UURA 3BUXB 3SG4A 1SCVA 1J7PA 1MQ1A 3IQQA 3VRQA 1SR6B 1ZOTB 2F2OA 2JT8A 3CGAA 3I5GB 4D1EA 2EGDA 1FBVA 4I5KA 1Y1AA 1NWDA 1PSRA 2H61C 1B7TZ 3DVMA 2K7OA 4IJ7A 1W7JB 1IGVA 3WHUB 3R1VA 3A8RA 1DJHA 2AUCA 2PVBA 4JQ0D 3L4LA 3PM2A 1TCOB 1CDNA 1B8LA 2GGMA 4FTGA 4YBHB 2BKHB 2CNPA 4PE1A 1XFXO 4QJ5B 5D7FA 1C7WA 4OVNF 3PFVA 4GUKA 1LINA 2LP2A 4PALA 2BAPA 3CTNA 2LCPA 3TUYB 1RTP1 4HREE 4CPVA 1IH0A 5DKQA 3S0GA 5I8NA 1OE9B 1CFPA 1IJ6A 2ZRTA 3BYAA 4L9MA 1UUSA 3RLZA 2KFGA 3VRPA 2A4JA 1QX2A 3CLNA 1AHRA 1SL7A 2FJUB 2GV5A 3O2PA 3ICBA 1FF1A 1BR4B 1SCMB 2ZNDA 2MAZA 3PJIA 1CM1A 4P2YB 3D10A 1KQMB 4FQTA 1XFUO 1PULA 3D73A 4JKTA 1ORGA 1WDCB 3Q8IA 4JPZB 2R2IA 1AJ4A 1DMOA 4MZJA 3NSLA 1SY9A 1S1EA 2KLDA 4WQ3A 1L2OB 1SMGA 3UNWA 2BKIB 5D3OA 2JOJA 2L5YA 2JT3A 1GJYA 2AAOA 2EC6C 2WOSA 2E6WA 2KBMA 4HRHA 4ZCUA 3O6BA 4GBAA 1AUIB 1CKKA 1E8AA 2ZN8A 2NCPA 3HX4A 4MSPA 2LUCA 4OV2A 3DF0B 2COLB 3ZNIA 1RK9A 3CR5X 5FI2A 1QWVA 1NIWA 1CB1A 4GPLB 3K21A 1CDLA 3AAKA 4PHJA 2WNDA 3EK8A 3CZTX 1TWOA 1IIOA 1EH2A 3CZ2A 1B8CA 3NXAA 1YVLA 2M1UA 2F8PA 2JPTA 1B4CA 3F45A 4HSZA 2WCBA 1KWOB 3BFAA 2L98A 2LMUA 1D1OA 2FCDA 3TDZA 1NPQA 2KQ6A 2MHHA 1DEKA 1JF0A 2K2FA 2LVIA 2JU0A 3VGOA 1F55A 2LVJA 1DJXA 1TUZA 3EK4A 3PLFB 2K2AA 2F33A 3DD4A 2JULA 4XJKB 1GGWA 3R1PA 1LA3A 4M2PA 2KI4B 2CCMA 3JVTB 2WCJA 2M1KB 1KFXS 1S6JA 4YI9A 1SR6C 1W7IB 5PALA 1Y6WA 3BOWB 2SCPA 1YR5A 1JUOA 4A4CA 1DJWA 2Q4UA 1ALVA 3I5IC 3I5FC 4UPGA 1IWQA 1NSHA 2LE9B 2WORA 1DT7B 3LK0A 2LLUA 1U5IB 1TTXA 3TS5C 1SYMA 2ZRSA 3DZTA 1UHHA 2F3YA 2PASA 4CFQA 2OTGB 2KDHA 2HQ8A 1TN4A 4M2OA 3FE8A 5G08A 1SBJA 1DF0B 3O4XA 2G2BA 2P71A 2LHLA 1XFYO 1J1DA 2K60A 5HKYA 2P70A 4AQIA 1MWNA 1V1GA 2K7BA 4IL1A 4OZDA 4PHNA 1BOCA 1A03A 1EG3A 1WLZA 1XA5A 3LLEA 3S0FA 1CLBA 1LA0A 3TUYC 1C3YA 2LANA 3L4AA 2BECA 1J7RA 2JNXA 2M7LA 4HRGA 4NDCA 3RZSA 2JWWA 1B8RA 4BY5A 5B8IB 2IS9A 1NCZA 1CLMA 5CSJA 4INXA 1SCMC 2M49B 3K1EA 3OX6A 3AAJA 2ERBA 2ZKMX 1KQMC 3BJHA 3O78A 3PN7B 3PSRA 1JC2A 1WDCC 1NYAA 2PYQA 3NGVA 3SG2A 1A2XA 3MSEB 1S5GZ 1XFZO 2LLTA 2NZ0A 1EG4A 1IJ5A 1MXLC 3KPXA 2KPHA 2JXLA 3IVTA 3S0DA 3M0WA 4DIRA 3B88A 1F4QA 1CLLA 2JT0A 2Q91A 3DF0A 1Y0VH 3EKHA 2LVKA 3SIBA 2Y4QA 5AEQA 4PT1A 4ORCB 3SS4A 4PE7A 1QV0A 1Y1UA 1N65A 4MN0A 1G8IA 4I5LB 4ORAB 4P5OE 3S0AA 1CDPA 1B47A 2WCHA 1SK6D 1UHNA 2YGUA 4PHKA 2JC2A 1QX5B 4AQJA 1BR1B 2JTZA 1CDMA 2LC5A 4YGEB 5HLOA 1QASA 1HQVA 1BG1A 1CTRA 3EG5B 4PDZA 1MUXA 3JTDC 3ZWHA 2F3ZA 4C0LA 1CMGA 1F71A 2NLNA 2V53A 1OMRA 2FCEA 1KWOC 2EHBA 2VRGA 3BFHA 3OHMB 3LL8B 1M63B 4GFTA 2KAXA 2ZFDA 1SL9A 3AKBA 2M3WA 3NSOA 2DOQA 1DTLA 2KAVA 3RM1A 3SG7A 1C3ZA 1K9KA 3CWGA 2WC6A 4WRIA 4XJKA 5AFPA 1DELA 4MRXA 1F70A 4GAOA 4PE0A 1ZMZA 1NX1A 2WCFA 1TUJA 4DS7A 1IQ5A 1CNPA 5KU1A 2KI4C 3DVEA 1UWOA 3IQOA 4M2QA 1BLQA 1PRWA 1IRJA 3BOWA 4ORBB 3C1VA 3VRRA 5I2QA 2OS8C 3TDUA 1QVIZ 1H4BA 2MA2A 2BBMA 1Z4HA 2I18A 1U5IA 1RECA 2CTNA 4MZLA 1NX0A 2QEOA 1LKJA 2L5XB 3SG6A 3QRXA 1R6PA 1OSAA 2H8VA 5F6TA 1LXFC 1KK8C 1J7QA 1GM0A 1JWDA 4PHMA 1DF0A 1B7TY 4GNKB 1Q80A 4OKHA 1F4OA 1TCFA 1ALWA 2QACA 3EVRA 3KF9A 1QIWA 5CSIA 2PQLA 1TNXA 3CZ1A 1EJ3A 2WCKA 1K95A 2G9BA 4QJ4B 2I94A 2ZNEA 2KNEA 5J3XA 1C7VA 1NX2A 1YRUB 2LMTA 4N5XA 5CSNA 3BUMB 2ZN9A 1S6CA 1SKTA 5ER5A 1NP8A 2HF5A 3CR2A 3S0BA 2QEBA 2WCLA 4XYNA 2LAPA 3DY9A 4YGDB 2K7DA 2K61A 4MRYA 2CXJA 3D74A 3CABA 2QDIA 2Y5IA 4YGCB 1N0YA 2KGBC 3OX5A 2WC5A 3I5GC 1MXEA 3PM8A 3NHTA 1KFUS 2BCAA 2NCOA 2D8NA 4MEWA 1QTXA 3L47A 4PCWA 1Y1XA 3OBVA 1Z2CB 4A4BA 1JFKA 1K9UA 4C0KA 4QJ3B 2KYFA 2MLFC 5KSZA 1YUUA 2I2RE 1M46A 3NSKA 2LV7A 4DRWA 5HKWA 5EL2A 2BE6A 3VROA 3EVVA 4I5NB 5AXIA 1J55A 1HT9A 1A4PA 1QATA 1QIVA 1UHKA 2KHNA 1FPWA 2AMIA 4KYNA 4JD9A 3B7AA 1LS8A 1A75B 1SW8A 1UP5A 2EC6B 2M9GA 2M0RA 2PRUA 4JWQA 4WQ2A 1G4YR 3B87A 1OOIX 1OOJA 1TNQA 2BL0B 1A29A 5TNCA 2L2EA 1CFDA 1BF5A 1H8BA 1DJYA 1KFXL 2KBIA 1L7ZA 3UO9A 2KLEA 4CFRA 1RFJA 4MVFA 1KFUL 5ER4X 2K8MB 2PSRA 1DVIA 1M39A 1WRKA 1DGUA 4INWA 2JTTA 1EL4A 1YURA 2GGZA 3E3RA 3SJSA 1MR8A 3BXKA 4ZCVA 2JPOA 5HLVA 3CYZA 2L51A 2CT9A 1IG5A 3KEVA 2LLSA 4OCIA 5I2OA 1B1GA 3FIAA 2O5GA 3QMEA 2LUXA 3KO0A 4GGFA 2L2CA 2OPOA 1L2OC 1SRAA 3I5HB 3OB2B 1CFCA 3TDIA 1SSEB 1MHOA 1AVSA 5JOLA 2BCBA 1XVJA 2WCEA 4GGFC 5AANA 3GK4X 1IQ3A 3DXLA 1OOFA 3D0YB 3IF7A 1SPYA 2KGRA 5GQQC 1B9AA 1S36A 1J1EA 2JQ6A 1K8UA 4F7FA 2Y1NA 4NDDA 5DICA 1C07A 3B6XA 1VRKA 3BFBA 1IKUA 2FOTA 2E30A 1TOPA 1K2HA 1WLMA 1S6IA 2NXQA 3WXAA 1PSBA 1V1FA 2K7CA 5KTYA 1FW4A 2H61A 2F2PA 2MLEC 1YUSA 1KK7Y 3BUWB 3I5IB 1XFRA 3I5FB 1KSMA 3PALA 1XO5A 4YGAA 4AOMA 5I94A 1QLSA 3FWBA 3TS5B 4OR9B 1CMFA 1N2DA 2BBNA 5HL1A 2HQWA 2JXCA 3OGNA 1BU3A 3LCPC 5CPVA 1OMVA 4NDBA 1SNLA 2KFFA 1OQPA 2KAYA 1T14A 4PE4A 1ZACA 1W9ZA 2WC8A 3BUOB 3SG5A 3CS1A 3JVTC 1DJZA 1PVBA 2LMVA 1XK4A 3OB1B 4GGNA 3LK1A 1RWYA 3HCMA 1XK4C 1BJFA 1DQEA 2JRFA 4NQGA 2K0JA 1NCXA
chains in the Genus database with same CATH topology
5HYDA 1YRTB 1TNWA 1K93D 1S5GY 2TN4A 1DJIA 1KSOA 1K9PA 1YX8A 2PALA 1CM4A 1JFJA 4E68A 5CSFA 1JF2A 2JNFA 2MJWB 2OTGC 3WNXB 1K94A 1F54A 2B1UA 2KQYA 4YRUA 1DJGA 1WRLA 5FYXA 1A75A 1TNPA 1CFFA 1UHIA 1M31A 1PK0D 1TRFA 4ICBA 4FQOA 1PALA 2BL0C 3WHTB 1PVAA 2BCXA 3O4YA 2MBXA 2P6BB 1BMOA 3OP0A 3GK2A 5K89A 3A4UB 4CLNA 3BQ3A 2LVVA 2HETA 4YI8A 3AKAA 1GQMA 4TNCA 1OZSA 1GGZA 1QS7A 2H2KA 2KYCA 2ISDA 5I2LA 2CBLA 3PN7C 4U8DA 1WY9A 2M97A 4MBEA 1EXRA 1QLKA 2KOTA 1NCYA 3JTDB 1QX7A 5DKRA 5BPJA 5JJGA 2KFHA 3DVJA 3NSIA 2KSPA 1YUTA 3EK7A 4MLWA 5DKNA 3VRPA 1YVHA 4Q04A 2LHIA 1QV1A 3H4SE 3I5HC 1BT6A 1XYDA 1YX7A 3D0YA 1RROA 3VRNA 1OMDA 2LP3A 1KQVA 5IBWA 1F8HA 1K96A 2KI6D 4MZKA 1XFWO 1QVIY 1S3PA 4N1GA 1UHJA 1R2UA 1G33A 1NX3A 2M8UA 4C0JA 1WRZA 1ZFSA 1NUBA 1JBAA 1YTZC 2OS8B 1AP4A 1OZOA 1AJ5A 3CR4X 1JSAA 3GK1A 1K90D 1M45A 1RJVA 3EVUA 5HKZA 2RGIA 2PMYA 4ETOA 4F0ZB 1KK8B 2SASA 1QJTA 1X02A 1KK7Z 3SIAA 1FI5A 2MRDA 4I5JA 2BE4A 2I7AA 1FI6A 2L50A 3DVKA 1DGVA 4DUQA 2Y1MA 1AK8A 3KHEA 4R1EA 2M7NA 1LVCD 3GOFA 2QPTA 1ZUZA 1XFVO 3SG3A 2LNKA 4DCKA 2L0PA 3BUNB 5AERA 3FWCA 1TIZA 1BODA 5D69A 4BY4A 1KCYA 1MF8B 4N1FA 2KI6C 1QXPA 2HPSA 2LM5A 1SL8A 2M29A 3PATA 4USLA 2O60A 1J7OA 3EKJA 2L4HA 2JZIA 1S26D 3TZ1A 3FS7A 4YGBB 2L4IA 1ODBA 1UURA 3BUXB 3SG4A 1SCVA 1J7PA 1MQ1A 3IQQA 3VRQA 1SR6B 1ZOTB 2F2OA 2JT8A 3CGAA 3I5GB 4D1EA 2EGDA 1FBVA 4I5KA 1Y1AA 1NWDA 1PSRA 2H61C 1B7TZ 3DVMA 2K7OA 1W7JB 1IGVA 3WHUB 3A8RA 1DJHA 2AUCA 2PVBA 4JQ0D 1TCOB 1CDNA 1B8LA 2GGMA 4FTGA 4YBHB 2BKHB 2CNPA 4PE1A 1XFXO 4QJ5B 5D7FA 1C7WA 4OVNF 3PFVA 4GUKA 1LINA 2LP2A 4PALA 3CTNA 2LCPA 3TUYB 1RTP1 4HREE 4CPVA 1IH0A 5DKQA 5I8NA 1CFPA 1OE9B 1IJ6A 2ZRTA 3BYAA 4L9MA 1UUSA 3RLZA 2KFGA 4CIDA 2A4JA 1QX2A 3CLNA 1AHRA 1SL7A 2FJUB 2GV5A 3O2PA 3ICBA 1FF1A 1BR4B 1SCMB 2ZNDA 2MAZA 1CM1A 4P2YB 3D10A 1KQMB 1XFUO 1PULA 1WDCB 4JPZB 2R2IA 1AJ4A 1DMOA 4MZJA 3NSLA 1SY9A 1S1EA 4WQ3A 1L2OB 1SMGA 2BKIB 2JOJA 2JT3A 1GJYA 2AAOA 2EC6C 2WOSA 2E6WA 2KBMA 4HRHA 4ZCUA 3O6BA 4GBAA 1AUIB 1CKKA 1E8AA 2ZN8A 2NCPA 3HX4A 4MSPA 2LUCA 4OV2A 3DF0B 2COLB 3ZNIA 1RK9A 3CR5X 1NIWA 1CB1A 4GPLB 3K21A 1CDLA 3AAKA 4PHJA 2WNDA 3EK8A 3CZTX 1EH2A 3NXAA 1B8CA 1YVLA 2M1UA 2F8PA 2JPTA 1B4CA 3F45A 4HSZA 2WCBA 1KWOB 2L98A 2LMUA 1D1OA 2FCDA 3TDZA 1NPQA 2KQ6A 2MHHA 1JF0A 2K2FA 2LVIA 2JU0A 3VGOA 1F55A 2LVJA 1DJXA 3EK4A 3PLFB 2K2AA 2F33A 3DD4A 2JULA 4XJKB 1GGWA 4M2PA 1LA3A 2KI4B 2CCMA 3JVTB 2M1KB 1KFXS 1S6JA 4YI9A 1SR6C 1W7IB 5PALA 1Y6WA 3BOWB 2SCPA 1YR5A 1JUOA 4A4CA 1DJWA 2Q4UA 1ALVA 3I5IC 3I5FC 4UPGA 1IWQA 1NSHA 2LE9B 2WORA 1DT7B 3LK0A 2LLUA 1U5IB 1TTXA 3TS5C 1SYMA 2ZRSA 1UHHA 2F3YA 2PASA 4CFQA 2OTGB 2KDHA 2HQ8A 1TN4A 4M2OA 5G08A 1SBJA 1DF0B 2G2BA 2LHLA 1XFYO 1J1DA 5HKYA 4AQIA 1MWNA 1V1GA 2K7BA 4IL1A 4PHNA 1BOCA 1A03A 1EG3A 1WLZA 1XA5A 3LLEA 1CLBA 1LA0A 3TUYC 2LANA 2BECA 1J7RA 2JNXA 2M7LA 4HRGA 4NDCA 2JWWA 1B8RA 4BY5A 5B8IB 2IS9A 1NCZA 1CLMA 5CSJA 1SCMC 2M49B 3OX6A 3AAJA 2ZKMX 3PN7B 1KQMC 3O78A 3PSRA 1JC2A 1WDCC 1NYAA 3SG2A 1A2XA 3MSEB 1S5GZ 1XFZO 2LLTA 2NZ0A 1EG4A 1IJ5A 1MXLC 3KPXA 2JXLA 3M0WA 4DIRA 1F4QA 1CLLA 2JT0A 2Q91A 3DF0A 1Y0VH 3EKHA 2LVKA 3SIBA 2Y4QA 5AEQA 4ORCB 4PE7A 1QV0A 1Y1UA 1N65A 4MN0A 1G8IA 4I5LB 4ORAB 4P5OE 1CDPA 1B47A 1SK6D 1UHNA 2JC2A 1QX5B 4AQJA 1BR1B 2JTZA 1CDMA 2LC5A 4YGEB 5HLOA 1QASA 1HQVA 1BG1A 1CTRA 4PDZA 1MUXA 3JTDC 3ZWHA 2F3ZA 4C0LA 1CMGA 1F71A 2NLNA 2V53A 1OMRA 2FCEA 1KWOC 2EHBA 2VRGA 3OHMB 3LL8B 1M63B 4GFTA 2KAXA 2ZFDA 1SL9A 3AKBA 2M3WA 3NSOA 2DOQA 1DTLA 2KAVA 3RM1A 3SG7A 1K9KA 3CWGA 4WRIA 4XJKA 5AFPA 1F70A 4MRXA 4GAOA 4PE0A 1ZMZA 1NX1A 2WCFA 4DS7A 1IQ5A 1CNPA 5KU1A 2KI4C 3DVEA 1UWOA 3IQOA 4M2QA 1BLQA 1PRWA 1IRJA 3BOWA 4ORBB 3C1VA 3VRRA 5I2QA 2OS8C 3TDUA 1QVIZ 1H4BA 2MA2A 2BBMA 2I18A 1U5IA 1RECA 2CTNA 4MZLA 1NX0A 1LKJA 2L5XB 3SG6A 3QRXA 1R6PA 1OSAA 5F6TA 1LXFC 1KK8C 1J7QA 1JWDA 4PHMA 1DF0A 1B7TY 4GNKB 1Q80A 4OKHA 1F4OA 1TCFA 1ALWA 2QACA 3EVRA 3KF9A 1QIWA 5CSIA 1TNXA 1EJ3A 1K95A 2G9BA 4QJ4B 2I94A 2ZNEA 2KNEA 5J3XA 1C7VA 1NX2A 1YRUB 2LMTA 4N5XA 5CSNA 3BUMB 2ZN9A 1S6CA 1SKTA 5ER5A 1NP8A 2HF5A 3CR2A 4XYNA 2LAPA 4YGDB 2K7DA 2K61A 4MRYA 2CXJA 2Y5IA 4YGCB 1N0YA 2KGBC 3OX5A 3I5GC 1MXEA 3PM8A 1KFUS 2BCAA 2NCOA 2D8NA 4MEWA 1QTXA 4PCWA 1Y1XA 4A4BA 4C0KA 1JFKA 1K9UA 4QJ3B 2KYFA 2MLFC 5KSZA 1YUUA 2I2RE 1M46A 3NSKA 2LV7A 4DRWA 5HKWA 2BE6A 3VROA 3EVVA 4I5NB 5AXIA 1J55A 1HT9A 1A4PA 1QATA 1QIVA 1UHKA 2KHNA 1FPWA 2AMIA 2PRUA 1A75B 1SW8A 1UP5A 2EC6B 2M9GA 2M0RA 4JWQA 4WQ2A 1G4YR 1OOJA 1TNQA 2BL0B 1A29A 5TNCA 2L2EA 1CFDA 1BF5A 1H8BA 1DJYA 1KFXL 2KBIA 1L7ZA 4CFRA 1RFJA 4MVFA 1KFUL 5ER4X 2K8MB 2PSRA 1DVIA 1M39A 1WRKA 1DGUA 2JTTA 1EL4A 1YURA 2GGZA 3E3RA 3SJSA 1MR8A 3BXKA 4ZCVA 5HLVA 2L51A 2CT9A 1IG5A 3KEVA 2LLSA 4OCIA 5I2OA 1B1GA 3FIAA 2O5GA 4GGFA 2LUXA 3KO0A 1CFCA 2OPOA 1L2OC 1SRAA 3I5HB 3OB2B 3TDIA 1MHOA 1AVSA 5JOLA 2BCBA 1XVJA 2WCEA 4GGFC 5AANA 3GK4X 1IQ3A 3IF7A 3D0YB 1SPYA 2KGRA 5GQQC 1B9AA 1S36A 1J1EA 2JQ6A 1K8UA 2Y1NA 4NDDA 1C07A 1VRKA 1K2HA 1IKUA 2FOTA 2E30A 1TOPA 1WLMA 1S6IA 2NXQA 3WXAA 1PSBA 1V1FA 2K7CA 5KTYA 1FW4A 2H61A 2F2PA 2MLEC 1YUSA 1KK7Y 3BUWB 3I5IB 3I5FB 1KSMA 3PALA 1XO5A 4YGAA 4AOMA 1QLSA 3FWBA 3TS5B 4OR9B 1CMFA 1N2DA 2BBNA 2HQWA 2JXCA 1BU3A 3LCPC 5CPVA 1OMVA 4NDBA 1SNLA 2KFFA 1OQPA 2KAYA 4PE4A 1ZACA 2WC8A 3BUOB 3SG5A 3CS1A 3JVTC 1DJZA 1PVBA 2LMVA 1XK4A 3OB1B 4GGNA 3LK1A 1RWYA 3HCMA 1XK4C 1BJFA 2JRFA 4PHKA 4NQGA 2K0JA 1NCXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HYD A;  1YRT B;  1TNW A;  1K93 D;  1S5G Y;  2TN4 A;  1DJI A;  1KSO A;  1K9P A;  1YX8 A;  2PAL A;  1CM4 A;  1JFJ A;  4E68 A;  5CSF A;  1JF2 A;  2JNF A;  2MJW B;  2OTG C;  3WNX B;  1K94 A;  1F54 A;  2B1U A;  2KQY A;  4YRU A;  1DJG A;  1WRL A;  5FYX A;  1A75 A;  1TNP A;  1CFF A;  1UHI A;  1M31 A;  1PK0 D;  1TRF A;  4ICB A;  4FQO A;  1PAL A;  2BL0 C;  3WHT B;  1PVA A;  2BCX A;  3O4Y A;  2MBX A;  2P6B B;  1BMO A;  3OP0 A;  3GK2 A;  5K89 A;  3A4U B;  4CLN A;  3BQ3 A;  2LVV A;  2HET A;  4YI8 A;  3AKA A;  1GQM A;  4TNC A;  1OZS A;  1GGZ A;  1QS7 A;  2H2K A;  2KYC A;  2ISD A;  5I2L A;  2CBL A;  3PN7 C;  4U8D A;  1WY9 A;  2M97 A;  4MBE A;  1EXR A;  1QLK A;  2KOT A;  1NCY A;  3JTD B;  1QX7 A;  5DKR A;  5BPJ A;  5JJG A;  2KFH A;  3DVJ A;  3NSI A;  2KSP A;  1YUT A;  3EK7 A;  4MLW A;  5DKN A;  3VRP A;  1YVH A;  4Q04 A;  2LHI A;  1QV1 A;  3H4S E;  3I5H C;  1BT6 A;  1XYD A;  1YX7 A;  3D0Y A;  1RRO A;  3VRN A;  1OMD A;  2LP3 A;  1KQV A;  5IBW A;  1F8H A;  1K96 A;  2KI6 D;  4MZK A;  1XFW O;  1QVI Y;  1S3P A;  4N1G A;  1UHJ A;  1R2U A;  1G33 A;  1NX3 A;  2M8U A;  4C0J A;  1WRZ A;  1ZFS A;  1NUB A;  1JBA A;  1YTZ C;  2OS8 B;  1AP4 A;  1OZO A;  1AJ5 A;  3CR4 X;  1JSA A;  3GK1 A;  1K90 D;  1M45 A;  1RJV A;  3EVU A;  5HKZ A;  2RGI A;  2PMY A;  4ETO A;  4F0Z B;  1KK8 B;  2SAS A;  1QJT A;  1X02 A;  1KK7 Z;  3SIA A;  1FI5 A;  2MRD A;  4I5J A;  2BE4 A;  2I7A A;  1FI6 A;  2L50 A;  3DVK A;  1DGV A;  4DUQ A;  2Y1M A;  1AK8 A;  3KHE A;  4R1E A;  2M7N A;  1LVC D;  3GOF A;  2QPT A;  1ZUZ A;  1XFV O;  3SG3 A;  2LNK A;  4DCK A;  2L0P A;  3BUN B;  5AER A;  3FWC A;  1TIZ A;  1BOD A;  5D69 A;  4BY4 A;  1KCY A;  1MF8 B;  4N1F A;  2KI6 C;  1QXP A;  2HPS A;  2LM5 A;  1SL8 A;  2M29 A;  3PAT A;  4USL A;  2O60 A;  1J7O A;  3EKJ A;  2L4H A;  2JZI A;  1S26 D;  3TZ1 A;  3FS7 A;  4YGB B;  2L4I A;  1ODB A;  1UUR A;  3BUX B;  3SG4 A;  1SCV A;  1J7P A;  1MQ1 A;  3IQQ A;  3VRQ A;  1SR6 B;  1ZOT B;  2F2O A;  2JT8 A;  3CGA A;  3I5G B;  4D1E A;  2EGD A;  1FBV A;  4I5K A;  1Y1A A;  1NWD A;  1PSR A;  2H61 C;  1B7T Z;  3DVM A;  2K7O A;  1W7J B;  1IGV A;  3WHU B;  3A8R A;  1DJH A;  2AUC A;  2PVB A;  4JQ0 D;  1TCO B;  1CDN A;  1B8L A;  2GGM A;  4FTG A;  4YBH B;  2BKH B;  2CNP A;  4PE1 A;  1XFX O;  4QJ5 B;  5D7F A;  1C7W A;  4OVN F;  3PFV A;  4GUK A;  1LIN A;  2LP2 A;  4PAL A;  3CTN A;  2LCP A;  3TUY B;  1RTP 1;  4HRE E;  4CPV A;  1IH0 A;  5DKQ A;  5I8N A;  1CFP A;  1OE9 B;  1IJ6 A;  2ZRT A;  3BYA A;  4L9M A;  1UUS A;  3RLZ A;  2KFG A;  4CID A;  2A4J A;  1QX2 A;  3CLN A;  1AHR A;  1SL7 A;  2FJU B;  2GV5 A;  3O2P A;  3ICB A;  1FF1 A;  1BR4 B;  1SCM B;  2ZND A;  2MAZ A;  1CM1 A;  4P2Y B;  3D10 A;  1KQM B;  1XFU O;  1PUL A;  1WDC B;  4JPZ B;  2R2I A;  1AJ4 A;  1DMO A;  4MZJ A;  3NSL A;  1SY9 A;  1S1E A;  4WQ3 A;  1L2O B;  1SMG A;  2BKI B;  2JOJ A;  2JT3 A;  1GJY A;  2AAO A;  2EC6 C;  2WOS A;  2E6W A;  2KBM A;  4HRH A;  4ZCU A;  3O6B A;  4GBA A;  1AUI B;  1CKK A;  1E8A A;  2ZN8 A;  2NCP A;  3HX4 A;  4MSP A;  2LUC A;  4OV2 A;  3DF0 B;  2COL B;  3ZNI A;  1RK9 A;  3CR5 X;  1NIW A;  1CB1 A;  4GPL B;  3K21 A;  1CDL A;  3AAK A;  4PHJ A;  2WND A;  3EK8 A;  3CZT X;  1EH2 A;  3NXA A;  1B8C A;  1YVL A;  2M1U A;  2F8P A;  2JPT A;  1B4C A;  3F45 A;  4HSZ A;  2WCB A;  1KWO B;  2L98 A;  2LMU A;  1D1O A;  2FCD A;  3TDZ A;  1NPQ A;  2KQ6 A;  2MHH A;  1JF0 A;  2K2F A;  2LVI A;  2JU0 A;  3VGO A;  1F55 A;  2LVJ A;  1DJX A;  3EK4 A;  3PLF B;  2K2A A;  2F33 A;  3DD4 A;  2JUL A;  4XJK B;  1GGW A;  4M2P A;  1LA3 A;  2KI4 B;  2CCM A;  3JVT B;  2M1K B;  1KFX S;  1S6J A;  4YI9 A;  1SR6 C;  1W7I B;  5PAL A;  1Y6W A;  3BOW B;  2SCP A;  1YR5 A;  1JUO A;  4A4C A;  1DJW A;  2Q4U A;  1ALV A;  3I5I C;  3I5F C;  4UPG A;  1IWQ A;  1NSH A;  2LE9 B;  2WOR A;  1DT7 B;  3LK0 A;  2LLU A;  1U5I B;  1TTX A;  3TS5 C;  1SYM A;  2ZRS A;  1UHH A;  2F3Y A;  2PAS A;  4CFQ A;  2OTG B;  2KDH A;  2HQ8 A;  1TN4 A;  4M2O A;  5G08 A;  1SBJ A;  1DF0 B;  2G2B A;  2LHL A;  1XFY O;  1J1D A;  5HKY A;  4AQI A;  1MWN A;  1V1G A;  2K7B A;  4IL1 A;  4PHN A;  1BOC A;  1A03 A;  1EG3 A;  1WLZ A;  1XA5 A;  3LLE A;  1CLB A;  1LA0 A;  3TUY C;  2LAN A;  2BEC A;  1J7R A;  2JNX A;  2M7L A;  4HRG A;  4NDC A;  2JWW A;  1B8R A;  4BY5 A;  5B8I B;  2IS9 A;  1NCZ A;  1CLM A;  5CSJ A;  1SCM C;  2M49 B;  3OX6 A;  3AAJ A;  2ZKM X;  3PN7 B;  1KQM C;  3O78 A;  3PSR A;  1JC2 A;  1WDC C;  1NYA A;  3SG2 A;  1A2X A;  3MSE B;  1S5G Z;  1XFZ O;  2LLT A;  2NZ0 A;  1EG4 A;  1IJ5 A;  1MXL C;  3KPX A;  2JXL A;  3M0W A;  4DIR A;  1F4Q A;  1CLL A;  2JT0 A;  2Q91 A;  3DF0 A;  1Y0V H;  3EKH A;  2LVK A;  3SIB A;  2Y4Q A;  5AEQ A;  4ORC B;  4PE7 A;  1QV0 A;  1Y1U A;  1N65 A;  4MN0 A;  1G8I A;  4I5L B;  4ORA B;  4P5O E;  1CDP A;  1B47 A;  1SK6 D;  1UHN A;  2JC2 A;  1QX5 B;  4AQJ A;  1BR1 B;  2JTZ A;  1CDM A;  2LC5 A;  4YGE B;  5HLO A;  1QAS A;  1HQV A;  1BG1 A;  1CTR A;  4PDZ A;  1MUX A;  3JTD C;  3ZWH A;  2F3Z A;  4C0L A;  1CMG A;  1F71 A;  2NLN A;  2V53 A;  1OMR A;  2FCE A;  1KWO C;  2EHB A;  2VRG A;  3OHM B;  3LL8 B;  1M63 B;  4GFT A;  2KAX A;  2ZFD A;  1SL9 A;  3AKB A;  2M3W A;  3NSO A;  2DOQ A;  1DTL A;  2KAV A;  3RM1 A;  3SG7 A;  1K9K A;  3CWG A;  4WRI A;  4XJK A;  5AFP A;  1F70 A;  4MRX A;  4GAO A;  4PE0 A;  1ZMZ A;  1NX1 A;  2WCF A;  4DS7 A;  1IQ5 A;  1CNP A;  5KU1 A;  2KI4 C;  3DVE A;  1UWO A;  3IQO A;  4M2Q A;  1BLQ A;  1PRW A;  1IRJ A;  3BOW A;  4ORB B;  3C1V A;  3VRR A;  5I2Q A;  2OS8 C;  3TDU A;  1QVI Z;  1H4B A;  2MA2 A;  2BBM A;  2I18 A;  1U5I A;  1REC A;  2CTN A;  4MZL A;  1NX0 A;  1LKJ A;  2L5X B;  3SG6 A;  3QRX A;  1R6P A;  1OSA A;  5F6T A;  1LXF C;  1KK8 C;  1J7Q A;  1JWD A;  4PHM A;  1DF0 A;  1B7T Y;  4GNK B;  1Q80 A;  4OKH A;  1F4O A;  1TCF A;  1ALW A;  2QAC A;  3EVR A;  3KF9 A;  1QIW A;  5CSI A;  1TNX A;  1EJ3 A;  1K95 A;  2G9B A;  4QJ4 B;  2I94 A;  2ZNE A;  2KNE A;  5J3X A;  1C7V A;  1NX2 A;  1YRU B;  2LMT A;  4N5X A;  5CSN A;  3BUM B;  2ZN9 A;  1S6C A;  1SKT A;  5ER5 A;  1NP8 A;  2HF5 A;  3CR2 A;  4XYN A;  2LAP A;  4YGD B;  2K7D A;  2K61 A;  4MRY A;  2CXJ A;  2Y5I A;  4YGC B;  1N0Y A;  2KGB C;  3OX5 A;  3I5G C;  1MXE A;  3PM8 A;  1KFU S;  2BCA A;  2NCO A;  2D8N A;  4MEW A;  1QTX A;  4PCW A;  1Y1X A;  4A4B A;  4C0K A;  1JFK A;  1K9U A;  4QJ3 B;  2KYF A;  2MLF C;  5KSZ A;  1YUU A;  2I2R E;  1M46 A;  3NSK A;  2LV7 A;  4DRW A;  5HKW A;  2BE6 A;  3VRO A;  3EVV A;  4I5N B;  5AXI A;  1J55 A;  1HT9 A;  1A4P A;  1QAT A;  1QIV A;  1UHK A;  2KHN A;  1FPW A;  2AMI A;  2PRU A;  1A75 B;  1SW8 A;  1UP5 A;  2EC6 B;  2M9G A;  2M0R A;  4JWQ A;  4WQ2 A;  1G4Y R;  1OOJ A;  1TNQ A;  2BL0 B;  1A29 A;  5TNC A;  2L2E A;  1CFD A;  1BF5 A;  1H8B A;  1DJY A;  1KFX L;  2KBI A;  1L7Z A;  4CFR A;  1RFJ A;  4MVF A;  1KFU L;  5ER4 X;  2K8M B;  2PSR A;  1DVI A;  1M39 A;  1WRK A;  1DGU A;  2JTT A;  1EL4 A;  1YUR A;  2GGZ A;  3E3R A;  3SJS A;  1MR8 A;  3BXK A;  4ZCV A;  5HLV A;  2L51 A;  2CT9 A;  1IG5 A;  3KEV A;  2LLS A;  4OCI A;  5I2O A;  1B1G A;  3FIA A;  2O5G A;  4GGF A;  2LUX A;  3KO0 A;  1CFC A;  2OPO A;  1L2O C;  1SRA A;  3I5H B;  3OB2 B;  3TDI A;  1MHO A;  1AVS A;  5JOL A;  2BCB A;  1XVJ A;  2WCE A;  4GGF C;  5AAN A;  3GK4 X;  1IQ3 A;  3IF7 A;  3D0Y B;  1SPY A;  2KGR A;  5GQQ C;  1B9A A;  1S36 A;  1J1E A;  2JQ6 A;  1K8U A;  2Y1N A;  4NDD A;  1C07 A;  1VRK A;  1K2H A;  1IKU A;  2FOT A;  2E30 A;  1TOP A;  1WLM A;  1S6I A;  2NXQ A;  3WXA A;  1PSB A;  1V1F A;  2K7C A;  5KTY A;  1FW4 A;  2H61 A;  2F2P A;  2MLE C;  1YUS A;  1KK7 Y;  3BUW B;  3I5I B;  3I5F B;  1KSM A;  3PAL A;  1XO5 A;  4YGA A;  4AOM A;  1QLS A;  3FWB A;  3TS5 B;  4OR9 B;  1CMF A;  1N2D A;  2BBN A;  2HQW A;  2JXC A;  1BU3 A;  3LCP C;  5CPV A;  1OMV A;  4NDB A;  1SNL A;  2KFF A;  1OQP A;  2KAY A;  4PE4 A;  1ZAC A;  2WC8 A;  3BUO B;  3SG5 A;  3CS1 A;  3JVT C;  1DJZ A;  1PVB A;  2LMV A;  1XK4 A;  3OB1 B;  4GGN A;  3LK1 A;  1RWY A;  3HCM A;  1XK4 C;  1BJF A;  2JRF A;  4PHK A;  4NQG A;  2K0J A;  1NCX A; 
#chains in the Genus database with same CATH topology
 5HYD A;  1YRT B;  1TNW A;  1K93 D;  1S5G Y;  2TN4 A;  1DJI A;  1KSO A;  1K9P A;  1YX8 A;  2PAL A;  1CM4 A;  1JFJ A;  4E68 A;  5CSF A;  1JF2 A;  2JNF A;  2MJW B;  2OTG C;  3WNX B;  1K94 A;  1F54 A;  2B1U A;  2KQY A;  2QEV A;  4YRU A;  1DJG A;  1WRL A;  5FYX A;  1A75 A;  1TNP A;  2QEH A;  1CFF A;  1UHI A;  3D75 A;  1OOG A;  1M31 A;  1PK0 D;  1TRF A;  2WCM A;  4ICB A;  4FQO A;  1PAL A;  4CID A;  2BL0 C;  3D77 A;  3WHT B;  1PVA A;  2BCX A;  3FE9 A;  3O4Y A;  2MBX A;  2P6B B;  1BMO A;  3OP0 A;  3CZ0 A;  3GK2 A;  3A4U B;  5K89 A;  4CLN A;  3BQ3 A;  1OW4 A;  2LVV A;  2HET A;  4YI8 A;  3AKA A;  1GQM A;  3FE6 A;  4TNC A;  1OZS A;  1GGZ A;  1QS7 A;  2H2K A;  2KYC A;  2ISD A;  5I2L A;  2CBL A;  3PN7 C;  4U8D A;  1WY9 A;  2M97 A;  4MBE A;  5FI6 A;  1P28 A;  1EXR A;  1QLK A;  2KOT A;  3S0E A;  1NCY A;  3DYE A;  3JTD B;  1QX7 A;  3VB1 A;  5DKR A;  3SS5 A;  5BPJ A;  5JJG A;  2KFH A;  1DC1 A;  3DVJ A;  3NSI A;  2KSP A;  1YUT A;  3D76 A;  3EK7 A;  3R72 A;  4MLW A;  5DKN A;  1YVH A;  4Q04 A;  5FI7 A;  2LHI A;  1QV1 A;  3H4S E;  3I5H C;  1BT6 A;  1XYD A;  1YX7 A;  3D0Y A;  1RRO A;  3VRN A;  1OMD A;  2LP3 A;  1KQV A;  1OOH A;  5IBW A;  3SS3 A;  1F8H A;  1K96 A;  2KI6 D;  3R1O A;  1XFW O;  3CDN A;  1QVI Y;  4MZK A;  1S3P A;  4N1G A;  1UHJ A;  1R2U A;  1G33 A;  1NX3 A;  2M8U A;  4C0J A;  1WRZ A;  1ZFS A;  1NUB A;  3V2L A;  1JBA A;  1YTZ C;  2OS8 B;  1AP4 A;  1OZO A;  1AJ5 A;  3CR4 X;  2FJY A;  1JSA A;  3GK1 A;  1K90 D;  1M45 A;  1RJV A;  3EVU A;  5HKZ A;  2RGI A;  2PMY A;  2BNX A;  4ETO A;  4F0Z B;  1KK8 B;  2SAS A;  1QJT A;  1X02 A;  1KK7 Z;  3SIA A;  1FI5 A;  2MRD A;  3NHI A;  4I5J A;  2BE4 A;  2I7A A;  1FI6 A;  3B86 A;  2L50 A;  3DVK A;  1DGV A;  3N7H A;  4DUQ A;  2Y1M A;  1AK8 A;  3KHE A;  4R1E A;  2M7N A;  1LVC D;  3GOF A;  2QPT A;  1ZUZ A;  1XFV O;  3SG3 A;  2LNK A;  4DCK A;  2L0P A;  3BUN B;  5AER A;  3FWC A;  1TIZ A;  1BOD A;  5D69 A;  4BY4 A;  1KCY A;  1MF8 B;  4N1F A;  2KI6 C;  1QXP A;  2HPS A;  2LM5 A;  3D78 A;  1SL8 A;  2M29 A;  2GTE A;  3PAT A;  2O60 A;  4USL A;  3EKJ A;  2L4H A;  1J7O A;  2JZI A;  1S26 D;  3TZ1 A;  3FS7 A;  4YGB B;  2L4I A;  1ODB A;  1UUR A;  3BUX B;  3SG4 A;  1SCV A;  1J7P A;  1MQ1 A;  3IQQ A;  3VRQ A;  1SR6 B;  1ZOT B;  2F2O A;  2JT8 A;  3CGA A;  3I5G B;  4D1E A;  2EGD A;  1FBV A;  4I5K A;  1Y1A A;  1NWD A;  1PSR A;  2H61 C;  1B7T Z;  3DVM A;  2K7O A;  4IJ7 A;  1W7J B;  1IGV A;  3WHU B;  3R1V A;  3A8R A;  1DJH A;  2AUC A;  2PVB A;  4JQ0 D;  3L4L A;  3PM2 A;  1TCO B;  1CDN A;  1B8L A;  2GGM A;  4FTG A;  4YBH B;  2BKH B;  2CNP A;  4PE1 A;  1XFX O;  4QJ5 B;  5D7F A;  1C7W A;  4OVN F;  3PFV A;  4GUK A;  1LIN A;  2LP2 A;  4PAL A;  2BAP A;  3CTN A;  2LCP A;  3TUY B;  1RTP 1;  4HRE E;  4CPV A;  1IH0 A;  5DKQ A;  3S0G A;  5I8N A;  1OE9 B;  1CFP A;  1IJ6 A;  2ZRT A;  3BYA A;  4L9M A;  1UUS A;  3RLZ A;  2KFG A;  3VRP A;  2A4J A;  1QX2 A;  3CLN A;  1AHR A;  1SL7 A;  2FJU B;  2GV5 A;  3O2P A;  3ICB A;  1FF1 A;  1BR4 B;  1SCM B;  2ZND A;  2MAZ A;  3PJI A;  1CM1 A;  4P2Y B;  3D10 A;  1KQM B;  4FQT A;  1XFU O;  1PUL A;  3D73 A;  4JKT A;  1ORG A;  1WDC B;  3Q8I A;  4JPZ B;  2R2I A;  1AJ4 A;  1DMO A;  4MZJ A;  3NSL A;  1SY9 A;  1S1E A;  2KLD A;  4WQ3 A;  1L2O B;  1SMG A;  3UNW A;  2BKI B;  5D3O A;  2JOJ A;  2L5Y A;  2JT3 A;  1GJY A;  2AAO A;  2EC6 C;  2WOS A;  2E6W A;  2KBM A;  4HRH A;  4ZCU A;  3O6B A;  4GBA A;  1AUI B;  1CKK A;  1E8A A;  2ZN8 A;  2NCP A;  3HX4 A;  4MSP A;  2LUC A;  4OV2 A;  3DF0 B;  2COL B;  3ZNI A;  1RK9 A;  3CR5 X;  5FI2 A;  1QWV A;  1NIW A;  1CB1 A;  4GPL B;  3K21 A;  1CDL A;  3AAK A;  4PHJ A;  2WND A;  3EK8 A;  3CZT X;  1TWO A;  1IIO A;  1EH2 A;  3CZ2 A;  1B8C A;  3NXA A;  1YVL A;  2M1U A;  2F8P A;  2JPT A;  1B4C A;  3F45 A;  4HSZ A;  2WCB A;  1KWO B;  3BFA A;  2L98 A;  2LMU A;  1D1O A;  2FCD A;  3TDZ A;  1NPQ A;  2KQ6 A;  2MHH A;  1DEK A;  1JF0 A;  2K2F A;  2LVI A;  2JU0 A;  3VGO A;  1F55 A;  2LVJ A;  1DJX A;  1TUZ A;  3EK4 A;  3PLF B;  2K2A A;  2F33 A;  3DD4 A;  2JUL A;  4XJK B;  1GGW A;  3R1P A;  1LA3 A;  4M2P A;  2KI4 B;  2CCM A;  3JVT B;  2WCJ A;  2M1K B;  1KFX S;  1S6J A;  4YI9 A;  1SR6 C;  1W7I B;  5PAL A;  1Y6W A;  3BOW B;  2SCP A;  1YR5 A;  1JUO A;  4A4C A;  1DJW A;  2Q4U A;  1ALV A;  3I5I C;  3I5F C;  4UPG A;  1IWQ A;  1NSH A;  2LE9 B;  2WOR A;  1DT7 B;  3LK0 A;  2LLU A;  1U5I B;  1TTX A;  3TS5 C;  1SYM A;  2ZRS A;  3DZT A;  1UHH A;  2F3Y A;  2PAS A;  4CFQ A;  2OTG B;  2KDH A;  2HQ8 A;  1TN4 A;  4M2O A;  3FE8 A;  5G08 A;  1SBJ A;  1DF0 B;  3O4X A;  2G2B A;  2P71 A;  2LHL A;  1XFY O;  1J1D A;  2K60 A;  5HKY A;  2P70 A;  4AQI A;  1MWN A;  1V1G A;  2K7B A;  4IL1 A;  4OZD A;  4PHN A;  1BOC A;  1A03 A;  1EG3 A;  1WLZ A;  1XA5 A;  3LLE A;  3S0F A;  1CLB A;  1LA0 A;  3TUY C;  1C3Y A;  2LAN A;  3L4A A;  2BEC A;  1J7R A;  2JNX A;  2M7L A;  4HRG A;  4NDC A;  3RZS A;  2JWW A;  1B8R A;  4BY5 A;  5B8I B;  2IS9 A;  1NCZ A;  1CLM A;  5CSJ A;  4INX A;  1SCM C;  2M49 B;  3K1E A;  3OX6 A;  3AAJ A;  2ERB A;  2ZKM X;  1KQM C;  3BJH A;  3O78 A;  3PN7 B;  3PSR A;  1JC2 A;  1WDC C;  1NYA A;  2PYQ A;  3NGV A;  3SG2 A;  1A2X A;  3MSE B;  1S5G Z;  1XFZ O;  2LLT A;  2NZ0 A;  1EG4 A;  1IJ5 A;  1MXL C;  3KPX A;  2KPH A;  2JXL A;  3IVT A;  3S0D A;  3M0W A;  4DIR A;  3B88 A;  1F4Q A;  1CLL A;  2JT0 A;  2Q91 A;  3DF0 A;  1Y0V H;  3EKH A;  2LVK A;  3SIB A;  2Y4Q A;  5AEQ A;  4PT1 A;  4ORC B;  3SS4 A;  4PE7 A;  1QV0 A;  1Y1U A;  1N65 A;  4MN0 A;  1G8I A;  4I5L B;  4ORA B;  4P5O E;  3S0A A;  1CDP A;  1B47 A;  2WCH A;  1SK6 D;  1UHN A;  2YGU A;  4PHK A;  2JC2 A;  1QX5 B;  4AQJ A;  1BR1 B;  2JTZ A;  1CDM A;  2LC5 A;  4YGE B;  5HLO A;  1QAS A;  1HQV A;  1BG1 A;  1CTR A;  3EG5 B;  4PDZ A;  1MUX A;  3JTD C;  3ZWH A;  2F3Z A;  4C0L A;  1CMG A;  1F71 A;  2NLN A;  2V53 A;  1OMR A;  2FCE A;  1KWO C;  2EHB A;  2VRG A;  3BFH A;  3OHM B;  3LL8 B;  1M63 B;  4GFT A;  2KAX A;  2ZFD A;  1SL9 A;  3AKB A;  2M3W A;  3NSO A;  2DOQ A;  1DTL A;  2KAV A;  3RM1 A;  3SG7 A;  1C3Z A;  1K9K A;  3CWG A;  2WC6 A;  4WRI A;  4XJK A;  5AFP A;  1DEL A;  4MRX A;  1F70 A;  4GAO A;  4PE0 A;  1ZMZ A;  1NX1 A;  2WCF A;  1TUJ A;  4DS7 A;  1IQ5 A;  1CNP A;  5KU1 A;  2KI4 C;  3DVE A;  1UWO A;  3IQO A;  4M2Q A;  1BLQ A;  1PRW A;  1IRJ A;  3BOW A;  4ORB B;  3C1V A;  3VRR A;  5I2Q A;  2OS8 C;  3TDU A;  1QVI Z;  1H4B A;  2MA2 A;  2BBM A;  1Z4H A;  2I18 A;  1U5I A;  1REC A;  2CTN A;  4MZL A;  1NX0 A;  2QEO A;  1LKJ A;  2L5X B;  3SG6 A;  3QRX A;  1R6P A;  1OSA A;  2H8V A;  5F6T A;  1LXF C;  1KK8 C;  1J7Q A;  1GM0 A;  1JWD A;  4PHM A;  1DF0 A;  1B7T Y;  4GNK B;  1Q80 A;  4OKH A;  1F4O A;  1TCF A;  1ALW A;  2QAC A;  3EVR A;  3KF9 A;  1QIW A;  5CSI A;  2PQL A;  1TNX A;  3CZ1 A;  1EJ3 A;  2WCK A;  1K95 A;  2G9B A;  4QJ4 B;  2I94 A;  2ZNE A;  2KNE A;  5J3X A;  1C7V A;  1NX2 A;  1YRU B;  2LMT A;  4N5X A;  5CSN A;  3BUM B;  2ZN9 A;  1S6C A;  1SKT A;  5ER5 A;  1NP8 A;  2HF5 A;  3CR2 A;  3S0B A;  2QEB A;  2WCL A;  4XYN A;  2LAP A;  3DY9 A;  4YGD B;  2K7D A;  2K61 A;  4MRY A;  2CXJ A;  3D74 A;  3CAB A;  2QDI A;  2Y5I A;  4YGC B;  1N0Y A;  2KGB C;  3OX5 A;  2WC5 A;  3I5G C;  1MXE A;  3PM8 A;  3NHT A;  1KFU S;  2BCA A;  2NCO A;  2D8N A;  4MEW A;  1QTX A;  3L47 A;  4PCW A;  1Y1X A;  3OBV A;  1Z2C B;  4A4B A;  1JFK A;  1K9U A;  4C0K A;  4QJ3 B;  2KYF A;  2MLF C;  5KSZ A;  1YUU A;  2I2R E;  1M46 A;  3NSK A;  2LV7 A;  4DRW A;  5HKW A;  5EL2 A;  2BE6 A;  3VRO A;  3EVV A;  4I5N B;  5AXI A;  1J55 A;  1HT9 A;  1A4P A;  1QAT A;  1QIV A;  1UHK A;  2KHN A;  1FPW A;  2AMI A;  4KYN A;  4JD9 A;  3B7A A;  1LS8 A;  1A75 B;  1SW8 A;  1UP5 A;  2EC6 B;  2M9G A;  2M0R A;  2PRU A;  4JWQ A;  4WQ2 A;  1G4Y R;  3B87 A;  1OOI X;  1OOJ A;  1TNQ A;  2BL0 B;  1A29 A;  5TNC A;  2L2E A;  1CFD A;  1BF5 A;  1H8B A;  1DJY A;  1KFX L;  2KBI A;  1L7Z A;  3UO9 A;  2KLE A;  4CFR A;  1RFJ A;  4MVF A;  1KFU L;  5ER4 X;  2K8M B;  2PSR A;  1DVI A;  1M39 A;  1WRK A;  1DGU A;  4INW A;  2JTT A;  1EL4 A;  1YUR A;  2GGZ A;  3E3R A;  3SJS A;  1MR8 A;  3BXK A;  4ZCV A;  2JPO A;  5HLV A;  3CYZ A;  2L51 A;  2CT9 A;  1IG5 A;  3KEV A;  2LLS A;  4OCI A;  5I2O A;  1B1G A;  3FIA A;  2O5G A;  3QME A;  2LUX A;  3KO0 A;  4GGF A;  2L2C A;  2OPO A;  1L2O C;  1SRA A;  3I5H B;  3OB2 B;  1CFC A;  3TDI A;  1SSE B;  1MHO A;  1AVS A;  5JOL A;  2BCB A;  1XVJ A;  2WCE A;  4GGF C;  5AAN A;  3GK4 X;  1IQ3 A;  3DXL A;  1OOF A;  3D0Y B;  3IF7 A;  1SPY A;  2KGR A;  5GQQ C;  1B9A A;  1S36 A;  1J1E A;  2JQ6 A;  1K8U A;  4F7F A;  2Y1N A;  4NDD A;  5DIC A;  1C07 A;  3B6X A;  1VRK A;  3BFB A;  1IKU A;  2FOT A;  2E30 A;  1TOP A;  1K2H A;  1WLM A;  1S6I A;  2NXQ A;  3WXA A;  1PSB A;  1V1F A;  2K7C A;  5KTY A;  1FW4 A;  2H61 A;  2F2P A;  2MLE C;  1YUS A;  1KK7 Y;  3BUW B;  3I5I B;  1XFR A;  3I5F B;  1KSM A;  3PAL A;  1XO5 A;  4YGA A;  4AOM A;  5I94 A;  1QLS A;  3FWB A;  3TS5 B;  4OR9 B;  1CMF A;  1N2D A;  2BBN A;  5HL1 A;  2HQW A;  2JXC A;  3OGN A;  1BU3 A;  3LCP C;  5CPV A;  1OMV A;  4NDB A;  1SNL A;  2KFF A;  1OQP A;  2KAY A;  1T14 A;  4PE4 A;  1ZAC A;  1W9Z A;  2WC8 A;  3BUO B;  3SG5 A;  3CS1 A;  3JVT C;  1DJZ A;  1PVB A;  2LMV A;  1XK4 A;  3OB1 B;  4GGN A;  3LK1 A;  1RWY A;  3HCM A;  1XK4 C;  1BJF A;  1DQE A;  2JRF A;  4NQG A;  2K0J A;  1NCX A; 
#chains in the Genus database with same CATH homology
 5HYD A;  1YRT B;  1TNW A;  1K93 D;  1S5G Y;  2TN4 A;  1DJI A;  1KSO A;  1K9P A;  1YX8 A;  2PAL A;  1CM4 A;  1JFJ A;  4E68 A;  5CSF A;  1JF2 A;  2JNF A;  2MJW B;  2OTG C;  3WNX B;  1K94 A;  1F54 A;  2B1U A;  2KQY A;  4YRU A;  1DJG A;  1WRL A;  5FYX A;  1A75 A;  1TNP A;  1CFF A;  1UHI A;  1M31 A;  1PK0 D;  1TRF A;  4ICB A;  4FQO A;  1PAL A;  2BL0 C;  3WHT B;  1PVA A;  2BCX A;  3O4Y A;  2MBX A;  2P6B B;  1BMO A;  3OP0 A;  3GK2 A;  5K89 A;  3A4U B;  4CLN A;  3BQ3 A;  2LVV A;  2HET A;  4YI8 A;  3AKA A;  1GQM A;  4TNC A;  1OZS A;  1GGZ A;  1QS7 A;  2H2K A;  2KYC A;  2ISD A;  5I2L A;  2CBL A;  3PN7 C;  4U8D A;  1WY9 A;  2M97 A;  4MBE A;  1EXR A;  1QLK A;  2KOT A;  1NCY A;  3JTD B;  1QX7 A;  5DKR A;  5BPJ A;  5JJG A;  2KFH A;  3DVJ A;  3NSI A;  2KSP A;  1YUT A;  3EK7 A;  4MLW A;  5DKN A;  3VRP A;  1YVH A;  4Q04 A;  2LHI A;  1QV1 A;  3H4S E;  3I5H C;  1BT6 A;  1XYD A;  1YX7 A;  3D0Y A;  1RRO A;  3VRN A;  1OMD A;  2LP3 A;  1KQV A;  5IBW A;  1F8H A;  1K96 A;  2KI6 D;  4MZK A;  1XFW O;  1QVI Y;  1S3P A;  4N1G A;  1UHJ A;  1R2U A;  1G33 A;  1NX3 A;  2M8U A;  4C0J A;  1WRZ A;  1ZFS A;  1NUB A;  1JBA A;  1YTZ C;  2OS8 B;  1AP4 A;  1OZO A;  1AJ5 A;  3CR4 X;  1JSA A;  3GK1 A;  1K90 D;  1M45 A;  1RJV A;  3EVU A;  5HKZ A;  2RGI A;  2PMY A;  4ETO A;  4F0Z B;  1KK8 B;  2SAS A;  1QJT A;  1X02 A;  1KK7 Z;  3SIA A;  1FI5 A;  2MRD A;  4I5J A;  2BE4 A;  2I7A A;  1FI6 A;  2L50 A;  3DVK A;  1DGV A;  4DUQ A;  2Y1M A;  1AK8 A;  3KHE A;  4R1E A;  2M7N A;  1LVC D;  3GOF A;  2QPT A;  1ZUZ A;  1XFV O;  3SG3 A;  2LNK A;  4DCK A;  2L0P A;  3BUN B;  5AER A;  3FWC A;  1TIZ A;  1BOD A;  5D69 A;  4BY4 A;  1KCY A;  1MF8 B;  4N1F A;  2KI6 C;  1QXP A;  2HPS A;  2LM5 A;  1SL8 A;  2M29 A;  3PAT A;  4USL A;  2O60 A;  1J7O A;  3EKJ A;  2L4H A;  2JZI A;  1S26 D;  3TZ1 A;  3FS7 A;  4YGB B;  2L4I A;  1ODB A;  1UUR A;  3BUX B;  3SG4 A;  1SCV A;  1J7P A;  1MQ1 A;  3IQQ A;  3VRQ A;  1SR6 B;  1ZOT B;  2F2O A;  2JT8 A;  3CGA A;  3I5G B;  4D1E A;  2EGD A;  1FBV A;  4I5K A;  1Y1A A;  1NWD A;  1PSR A;  2H61 C;  1B7T Z;  3DVM A;  2K7O A;  1W7J B;  1IGV A;  3WHU B;  3A8R A;  1DJH A;  2AUC A;  2PVB A;  4JQ0 D;  1TCO B;  1CDN A;  1B8L A;  2GGM A;  4FTG A;  4YBH B;  2BKH B;  2CNP A;  4PE1 A;  1XFX O;  4QJ5 B;  5D7F A;  1C7W A;  4OVN F;  3PFV A;  4GUK A;  1LIN A;  2LP2 A;  4PAL A;  3CTN A;  2LCP A;  3TUY B;  1RTP 1;  4HRE E;  4CPV A;  1IH0 A;  5DKQ A;  5I8N A;  1CFP A;  1OE9 B;  1IJ6 A;  2ZRT A;  3BYA A;  4L9M A;  1UUS A;  3RLZ A;  2KFG A;  4CID A;  2A4J A;  1QX2 A;  3CLN A;  1AHR A;  1SL7 A;  2FJU B;  2GV5 A;  3O2P A;  3ICB A;  1FF1 A;  1BR4 B;  1SCM B;  2ZND A;  2MAZ A;  1CM1 A;  4P2Y B;  3D10 A;  1KQM B;  1XFU O;  1PUL A;  1WDC B;  4JPZ B;  2R2I A;  1AJ4 A;  1DMO A;  4MZJ A;  3NSL A;  1SY9 A;  1S1E A;  4WQ3 A;  1L2O B;  1SMG A;  2BKI B;  2JOJ A;  2JT3 A;  1GJY A;  2AAO A;  2EC6 C;  2WOS A;  2E6W A;  2KBM A;  4HRH A;  4ZCU A;  3O6B A;  4GBA A;  1AUI B;  1CKK A;  1E8A A;  2ZN8 A;  2NCP A;  3HX4 A;  4MSP A;  2LUC A;  4OV2 A;  3DF0 B;  2COL B;  3ZNI A;  1RK9 A;  3CR5 X;  1NIW A;  1CB1 A;  4GPL B;  3K21 A;  1CDL A;  3AAK A;  4PHJ A;  2WND A;  3EK8 A;  3CZT X;  1EH2 A;  3NXA A;  1B8C A;  1YVL A;  2M1U A;  2F8P A;  2JPT A;  1B4C A;  3F45 A;  4HSZ A;  2WCB A;  1KWO B;  2L98 A;  2LMU A;  1D1O A;  2FCD A;  3TDZ A;  1NPQ A;  2KQ6 A;  2MHH A;  1JF0 A;  2K2F A;  2LVI A;  2JU0 A;  3VGO A;  1F55 A;  2LVJ A;  1DJX A;  3EK4 A;  3PLF B;  2K2A A;  2F33 A;  3DD4 A;  2JUL A;  4XJK B;  1GGW A;  4M2P A;  1LA3 A;  2KI4 B;  2CCM A;  3JVT B;  2M1K B;  1KFX S;  1S6J A;  4YI9 A;  1SR6 C;  1W7I B;  5PAL A;  1Y6W A;  3BOW B;  2SCP A;  1YR5 A;  1JUO A;  4A4C A;  1DJW A;  2Q4U A;  1ALV A;  3I5I C;  3I5F C;  4UPG A;  1IWQ A;  1NSH A;  2LE9 B;  2WOR A;  1DT7 B;  3LK0 A;  2LLU A;  1U5I B;  1TTX A;  3TS5 C;  1SYM A;  2ZRS A;  1UHH A;  2F3Y A;  2PAS A;  4CFQ A;  2OTG B;  2KDH A;  2HQ8 A;  1TN4 A;  4M2O A;  5G08 A;  1SBJ A;  1DF0 B;  2G2B A;  2LHL A;  1XFY O;  1J1D A;  5HKY A;  4AQI A;  1MWN A;  1V1G A;  2K7B A;  4IL1 A;  4PHN A;  1BOC A;  1A03 A;  1EG3 A;  1WLZ A;  1XA5 A;  3LLE A;  1CLB A;  1LA0 A;  3TUY C;  2LAN A;  2BEC A;  1J7R A;  2JNX A;  2M7L A;  4HRG A;  4NDC A;  2JWW A;  1B8R A;  4BY5 A;  5B8I B;  2IS9 A;  1NCZ A;  1CLM A;  5CSJ A;  1SCM C;  2M49 B;  3OX6 A;  3AAJ A;  2ZKM X;  3PN7 B;  1KQM C;  3O78 A;  3PSR A;  1JC2 A;  1WDC C;  1NYA A;  3SG2 A;  1A2X A;  3MSE B;  1S5G Z;  1XFZ O;  2LLT A;  2NZ0 A;  1EG4 A;  1IJ5 A;  1MXL C;  3KPX A;  2JXL A;  3M0W A;  4DIR A;  1F4Q A;  1CLL A;  2JT0 A;  2Q91 A;  3DF0 A;  1Y0V H;  3EKH A;  2LVK A;  3SIB A;  2Y4Q A;  5AEQ A;  4ORC B;  4PE7 A;  1QV0 A;  1Y1U A;  1N65 A;  4MN0 A;  1G8I A;  4I5L B;  4ORA B;  4P5O E;  1CDP A;  1B47 A;  1SK6 D;  1UHN A;  2JC2 A;  1QX5 B;  4AQJ A;  1BR1 B;  2JTZ A;  1CDM A;  2LC5 A;  4YGE B;  5HLO A;  1QAS A;  1HQV A;  1BG1 A;  1CTR A;  4PDZ A;  1MUX A;  3JTD C;  3ZWH A;  2F3Z A;  4C0L A;  1CMG A;  1F71 A;  2NLN A;  2V53 A;  1OMR A;  2FCE A;  1KWO C;  2EHB A;  2VRG A;  3OHM B;  3LL8 B;  1M63 B;  4GFT A;  2KAX A;  2ZFD A;  1SL9 A;  3AKB A;  2M3W A;  3NSO A;  2DOQ A;  1DTL A;  2KAV A;  3RM1 A;  3SG7 A;  1K9K A;  3CWG A;  4WRI A;  4XJK A;  5AFP A;  1F70 A;  4MRX A;  4GAO A;  4PE0 A;  1ZMZ A;  1NX1 A;  2WCF A;  4DS7 A;  1IQ5 A;  1CNP A;  5KU1 A;  2KI4 C;  3DVE A;  1UWO A;  3IQO A;  4M2Q A;  1BLQ A;  1PRW A;  1IRJ A;  3BOW A;  4ORB B;  3C1V A;  3VRR A;  5I2Q A;  2OS8 C;  3TDU A;  1QVI Z;  1H4B A;  2MA2 A;  2BBM A;  2I18 A;  1U5I A;  1REC A;  2CTN A;  4MZL A;  1NX0 A;  1LKJ A;  2L5X B;  3SG6 A;  3QRX A;  1R6P A;  1OSA A;  5F6T A;  1LXF C;  1KK8 C;  1J7Q A;  1JWD A;  4PHM A;  1DF0 A;  1B7T Y;  4GNK B;  1Q80 A;  4OKH A;  1F4O A;  1TCF A;  1ALW A;  2QAC A;  3EVR A;  3KF9 A;  1QIW A;  5CSI A;  1TNX A;  1EJ3 A;  1K95 A;  2G9B A;  4QJ4 B;  2I94 A;  2ZNE A;  2KNE A;  5J3X A;  1C7V A;  1NX2 A;  1YRU B;  2LMT A;  4N5X A;  5CSN A;  3BUM B;  2ZN9 A;  1S6C A;  1SKT A;  5ER5 A;  1NP8 A;  2HF5 A;  3CR2 A;  4XYN A;  2LAP A;  4YGD B;  2K7D A;  2K61 A;  4MRY A;  2CXJ A;  2Y5I A;  4YGC B;  1N0Y A;  2KGB C;  3OX5 A;  3I5G C;  1MXE A;  3PM8 A;  1KFU S;  2BCA A;  2NCO A;  2D8N A;  4MEW A;  1QTX A;  4PCW A;  1Y1X A;  4A4B A;  4C0K A;  1JFK A;  1K9U A;  4QJ3 B;  2KYF A;  2MLF C;  5KSZ A;  1YUU A;  2I2R E;  1M46 A;  3NSK A;  2LV7 A;  4DRW A;  5HKW A;  2BE6 A;  3VRO A;  3EVV A;  4I5N B;  5AXI A;  1J55 A;  1HT9 A;  1A4P A;  1QAT A;  1QIV A;  1UHK A;  2KHN A;  1FPW A;  2AMI A;  2PRU A;  1A75 B;  1SW8 A;  1UP5 A;  2EC6 B;  2M9G A;  2M0R A;  4JWQ A;  4WQ2 A;  1G4Y R;  1OOJ A;  1TNQ A;  2BL0 B;  1A29 A;  5TNC A;  2L2E A;  1CFD A;  1BF5 A;  1H8B A;  1DJY A;  1KFX L;  2KBI A;  1L7Z A;  4CFR A;  1RFJ A;  4MVF A;  1KFU L;  5ER4 X;  2K8M B;  2PSR A;  1DVI A;  1M39 A;  1WRK A;  1DGU A;  2JTT A;  1EL4 A;  1YUR A;  2GGZ A;  3E3R A;  3SJS A;  1MR8 A;  3BXK A;  4ZCV A;  5HLV A;  2L51 A;  2CT9 A;  1IG5 A;  3KEV A;  2LLS A;  4OCI A;  5I2O A;  1B1G A;  3FIA A;  2O5G A;  4GGF A;  2LUX A;  3KO0 A;  1CFC A;  2OPO A;  1L2O C;  1SRA A;  3I5H B;  3OB2 B;  3TDI A;  1MHO A;  1AVS A;  5JOL A;  2BCB A;  1XVJ A;  2WCE A;  4GGF C;  5AAN A;  3GK4 X;  1IQ3 A;  3IF7 A;  3D0Y B;  1SPY A;  2KGR A;  5GQQ C;  1B9A A;  1S36 A;  1J1E A;  2JQ6 A;  1K8U A;  2Y1N A;  4NDD A;  1C07 A;  1VRK A;  1K2H A;  1IKU A;  2FOT A;  2E30 A;  1TOP A;  1WLM A;  1S6I A;  2NXQ A;  3WXA A;  1PSB A;  1V1F A;  2K7C A;  5KTY A;  1FW4 A;  2H61 A;  2F2P A;  2MLE C;  1YUS A;  1KK7 Y;  3BUW B;  3I5I B;  3I5F B;  1KSM A;  3PAL A;  1XO5 A;  4YGA A;  4AOM A;  1QLS A;  3FWB A;  3TS5 B;  4OR9 B;  1CMF A;  1N2D A;  2BBN A;  2HQW A;  2JXC A;  1BU3 A;  3LCP C;  5CPV A;  1OMV A;  4NDB A;  1SNL A;  2KFF A;  1OQP A;  2KAY A;  4PE4 A;  1ZAC A;  2WC8 A;  3BUO B;  3SG5 A;  3CS1 A;  3JVT C;  1DJZ A;  1PVB A;  2LMV A;  1XK4 A;  3OB1 B;  4GGN A;  3LK1 A;  1RWY A;  3HCM A;  1XK4 C;  1BJF A;  2JRF A;  4PHK A;  4NQG A;  2K0J A;  1NCX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...