1B7TY

Myosin digested by papain
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
138
structure length
138
Chain Sequence
PQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic structure of scallop myosin subfragment S1 complexed with MgADP: a novel conformation of the myosin head.
pubmed doi rcsb
molecule tags Myosin
molecule keywords MYOSIN HEAVY CHAIN
total genus 39
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 1999-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1b7tY01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1b7tY02
4USLA 3BXKA 5FYXA 1BU3A 1XFWO 4DRWA 3VRPA 5CSFA 3DF0B 1FBVA 1YRUB 1J1EA 3KHEA 1KSMA 4GGFC 2LHIA 1RECA 1TNQA 5HKYA 4XJKB 2KBMA 3RLZA 1OMDA 1NSHA 2KBIA 4MZKA 1YUTA 4WRIA 5D69A 3WNXB 1SNLA 3DVMA 1IRJA 3OX6A 1D1OA 2JOJA 3VGOA 1FPWA 1JSAA 1QTXA 4M2QA 3CLNA 3LL8B 3HX4A 2KFFA 1CM4A 2LV7A 2WCBA 3I5FB 3VRQA 2OS8B 3KF9A 4WQ3A 1N2DA 5ER5A 2OTGB 1ZOTB 4NDDA 5F6TA 1EL4A 1A75B 5G08A 4A4CA 1JFJA 2BBMA 1MXLC 1QLKA 4DCKA 2LMUA 3CR4X 1B7TY 1F70A 1OOJA 1JUOA 2GGMA 1YX7A 1Y0VH 2M3WA 1K90D 2K8MB 3M0WA 5CSJA 3TZ1A 2VRGA 3DVEA 1Y1UA 2ZN8A 3FS7A 1UURA 2KI6D 2KQ6A 2PRUA 1CLMA 2D8NA 2K61A 4OVNF 4FTGA 4AOMA 4OCIA 1JF0A 4CFRA 2I94A 3ICBA 2HQWA 3TDIA 2KAVA 1IQ3A 3QRXA 2MLFC 1BJFA 3MSEB 1KK8B 2LE9B 1MQ1A 2M7NA 1QLSA 4PE1A 3NXAA 3E3RA 5AXIA 1NX1A 3TDUA 1B8CA 2KNEA 2NCOA 4ORAB 1KCYA 2EC6B 2FJUB 4PE0A 1L2OB 1AVSA 5I2QA 1RJVA 1QATA 2M49B 1TCFA 1J55A 1UUSA 1C7VA 1S6CA 3AAKA 1KK8C 1R2UA 1H8BA 1G4YR 2BCXA 1G8IA 1K96A 1ZACA 3GK1A 3FWCA 2ZKMX 2HF5A 1DGVA 2LCPA 1OMRA 1S36A 2GGZA 4PHMA 4UPGA 3PN7B 1K9PA 4ZCVA 1K8UA 2K2AA 2KI4B 2OPOA 1BODA 4DUQA 1ODBA 1CDMA 2KI4C 4HRGA 1Y1AA 2I7AA 1B47A 4MSPA 1UHJA 3I5HB 1CNPA 1EH2A 4GNKB 2HETA 3I5FC 4PHKA 5HYDA 2LM5A 2L4HA 1BG1A 1CFFA 2Q4UA 1M31A 1PULA 2LLTA 1X02A 5KTYA 2JPTA 1ZMZA 4BY5A 1NWDA 5B8IB 4C0JA 2KAYA 1JBAA 4MN0A 2LLSA 3BOWB 5CSNA 3LCPC 1FI6A 3SG5A 3JVTC 3IQOA 2ISDA 2JT0A 3O4YA 5J3XA 2LLUA 2WNDA 3NSOA 4AQIA 3D10A 1XYDA 4FQOA 4YGCB 2PSRA 2M7LA 5I2LA 2JU0A 4P2YB 1SCVA 2BL0B 5HLOA 1QASA 5AFPA 1TNXA 1MUXA 1TRFA 2L50A 2MJWB 4GGNA 4MZJA 4YI8A 4YGBB 4CLNA 1FF1A 4I5JA 1JC2A 4ORCB 2Y1MA 1FW4A 2LC5A 3EK7A 2KHNA 1CB1A 2ZNDA 1NX2A 2MA2A 2JTTA 1CFDA 1ALWA 1MWNA 2DOQA 3EK8A 1NX0A 1QIVA 2A4JA 1QV0A 4YI9A 1QVIZ 4D1EA 3SG3A 3CGAA 2F3ZA 1DF0A 1C07A 4ICBA 4F0ZB 1PSBA 1CFCA 1GQMA 2BKIB 3D0YB 2WCEA 1BF5A 1DJYA 2H2KA 1WLZA 2PMYA 3BUMB 3FIAA 4YRUA 3KEVA 3PN7C 4JQ0D 1SRAA 2ZRTA 1CDNA 1EJ3A 2O5GA 1MXEA 1SL9A 3GOFA 1BOCA 1NCXA 2CBLA 4A4BA 1HT9A 2M29A 3IQQA 4ORBB 2GV5A 5IBWA 2CT9A 2CNPA 3AAJA 1MHOA 1PRWA 1G33A 4OKHA 4N1GA 3I5IB 5JJGA 1NCYA 1Q80A 1V1GA 3K21A 4CFQA 1A4PA 3I5GC 1U5IB 1LKJA 3BUNB 5HKWA 3SG4A 3BUXB 1KQMB 2JRFA 2JNFA 1CDPA 1J7OA 2KGRA 3KPXA 1OZSA 5CPVA 1XFYO 2BE6A 1K95A 2JT8A 1J7PA 1M45A 4GPLB 1CLLA 1DF0B 1F55A 3PALA 1SR6C 1B7TZ 1YX8A 2JULA 2LNKA 1F4QA 4M2PA 4GUKA 2O60A 2F33A 4PE4A 4OV2A 2NLNA 1VRKA 1SW8A 4JPZB 1YVLA 1MF8B 1DJHA 1YTZC 2HQ8A 4YBHB 3DVJA 2B1UA 2OS8C 2NXQA 1PALA 3CTNA 1N65A 4NDCA 5KU1A 1H4BA 1UP5A 1SCMB 2EGDA 2Y1NA 4QJ4B 1QV1A 3O2PA 2K0JA 2F2PA 2ZNEA 4PDZA 3O78A 5PALA 1XFVO 3BOWA 4MRYA 1SL7A 1XFZO 2G9BA 2M1KB 1M63B 1SL8A 4MLWA 1BR1B 1IJ5A 1CM1A 1S3PA 1QJTA 1TNPA 2LANA 4DIRA 1LXFC 2KYFA 3HCMA 5HKZA 1A2XA 1K94A 5TNCA 2ZFDA 3CZTX 1L2OC 1NIWA 1RROA 4C0LA 2PASA 2MLEC 4I5LB 2TN4A 1SY9A 1EXRA 2QACA 3BUWB 2PALA 1A29A 2ZN9A 2K7CA 2KAXA 2SCPA 4XJKA 5K89A 2MHHA 4QJ5B 4GBAA 1AUIB 1IG5A 1SMGA 1LVCD 1K9KA 2KSPA 1CDLA 4E68A 4NQGA 1Y6WA 1IH0A 3WHUB 2F8PA 2KFHA 2WC8A 2JQ6A 1TOPA 4AQJA 1NP8A 2LMVA 1WY9A 1CLBA 2L4IA 2WORA 2HPSA 2CXJA 3LK0A 1KK7Y 1IJ6A 1DMOA 3CR2A 2FCEA 1BT6A 1F4OA 1DGUA 3TUYB 4I5KA 4QJ3B 4MEWA 1NX3A 2KQYA 4MBEA 1KWOB 1TNWA 4N5XA 2M97A 3KO0A 2Y4QA 2JZIA 2E6WA 1BR4B 1S5GY 2AUCA 1B1GA 1M39A 3NSLA 3DD4A 5GQQC 2LUXA 2PVBA 1B4CA 3EK4A 1YURA 2CCMA 1Y1XA 2I2RE 1PVAA 3IF7A 1CMFA 2IS9A 3LK1A 3AKBA 2M0RA 2L0PA 2K7DA 1RWYA 2KFGA 3SG2A 1GGWA 1K93D 2Y5IA 2K2FA 1LINA 3PATA 3C1VA 5DKRA 1B8RA 3A8RA 3OB2B 1RTP1 1W7JB 4HREE 3SG6A 1PSRA 4PE7A 3VRRA 5KSZA 1DJZA 2LVJA 1AK8A 1HQVA 3RM1A 1GGZA 1J7RA 2M1UA 1XK4C 3TS5C 2JXLA 2LVVA 1AHRA 2H61C 3ZWHA 1B9AA 2OTGC 2CTNA 1LA3A 1SK6D 4YGDB 1XVJA 1BLQA 1U5IA 5BPJA 1BMOA 1QXPA 1KQVA 1MR8A 1JWDA 4HRHA 3EKHA 1TTXA 1YRTB 1QVIY 1LA0A 1GJYA 3TS5B 2L51A 3PSRA 3EKJA 4C0KA 1OMVA 1IWQA 4CIDA 3CR5X 1DTLA 2AMIA 4MRXA 1OE9B 1R6PA 3O6BA 1KQMC 3BYAA 3JTDB 1CKKA 1S6JA 3OX5A 2E30A 4JWQA 3BQ3A 2L2EA 1UHKA 1SKTA 2K7BA 2NZ0A 3JVTB 2JXCA 4GAOA 1WRLA 4IL1A 1K2HA 3SJSA 1DJGA 3NSIA 1IKUA 3A4UB 1WRKA 1KFXS 1TIZA 2BL0C 2M8UA 3I5IC 4U8DA 1EG4A 2JT3A 4TNCA 1J7QA 2JTZA 1DJIA 3JTDC 3LLEA 3PFVA 4CPVA 1DVIA 1OZOA 1SBJA 1KWOC 3CWGA 3NSKA 2LHLA 2WOSA 1SPYA 4YGEB 1UHNA 2WCFA 4OR9B 1QX2A 1W7IB 3SIAA 4ETOA 1NUBA 1IQ5A 3EVUA 1KSOA 1V1FA 1WDCC 2LVKA 5HLVA 5ER4X 2FCDA 1YVHA 2R2IA 4PALA 2NCPA 1QX5B 1S5GZ 2L98A 1OQPA 1IGVA 1QS7A 1XK4A 3DF0A 1M46A 1DJWA 3F45A 1YUUA 1KFUS 3PM8A 1A03A 4PHJA 1CFPA 3GK4X 1S1EA 5AEQA 1C7WA 5AERA 1ALVA 1AJ4A 4XYNA 3I5HC 4MVFA 2MBXA 2JNXA 2KOTA 1JFKA 4I5NB 2ZRSA 3TDZA 4L9MA 2LUCA 5JOLA 1DJXA 1QIWA 3WXAA 3EVRA 1E8AA 1TCOB 2I18A 2H61A 1YUSA 1K9UA 1YR5A 1N0YA 1EG3A 1B8LA 3VRNA 4PCWA 2MRDA 3AKAA 2P6BB 2F3YA 3BUOB 2G2BA 2F2OA 3OHMB 2KGBC 2QPTA 2BECA 1WRZA 2LP3A 2V53A 4MZLA 1QX7A 1XA5A 4PHNA 4DS7A 1F8HA 4N1FA 4WQ2A 1NPQA 3SG7A 3D0YA 1OSAA 1AP4A 1XO5A 2KI6C 4Q04A 4HSZA 1SYMA 4NDBA 2LP2A 4YGAA 1XFXO 2FOTA 2COLB 1UHIA 1CMGA 3GK2A 1RK9A 1CTRA 3WHTB 1UWOA 2BCBA 1FI5A 2SASA 4BY4A 3TUYC 5I2OA 1L7ZA 2M9GA 1F71A 1AJ5A 1NCZA 1TN4A 2JWWA 1KFUL 2LVIA 2LAPA 2AAOA 2BE4A 2RGIA 3CS1A 2EHBA 5CSIA 1ZFSA 1SR6B 1KK7Z 1SCMC 5AANA 5DKQA 1XFUO 3OB1B 3OP0A 1WDCB 2Q91A 2BCAA 1NYAA 4GGFA 5D7FA 4R1EA 1S6IA 2K7OA 2JC2A 5I8NA 1PK0D 1F54A 2KDHA 2L5XB 3SIBA 4M2OA 1ZUZA 1J1DA 2LMTA 3I5GB 1A75A 1WLMA 3ZNIA 1JF2A 2KYCA 4ZCUA 3DVKA 2BKHB 1UHHA 2EC6C 2MAZA 3FWBA 4GFTA 5DKNA 1PVBA 3VROA 4P5OE 1RFJA 1KFXL 1S26D 1DT7B 3EVVA 3H4SE 2BBNA 3PLFB
chains in the Genus database with same CATH superfamily
4USLA 3BXKA 5FYXA 1BU3A 1XFWO 4DRWA 3VRPA 3BFBA 3DF0B 5CSFA 1FBVA 1YRUB 1J1EA 3KHEA 1KSMA 2WCJA 4GGFC 2LHIA 1RECA 5EL2A 1TNQA 5HKYA 4XJKB 2KBMA 3RLZA 1OMDA 1NSHA 2KBIA 4MZKA 4F7FA 1YUTA 4WRIA 5D69A 3WNXB 1SNLA 3DVMA 1IRJA 3OX6A 1D1OA 2JOJA 3VGOA 1FPWA 1JSAA 1QTXA 4M2QA 3CLNA 3LL8B 3D77A 3HX4A 2KFFA 1CM4A 2LV7A 2WCBA 3I5FB 3VRQA 2OS8B 3KF9A 4WQ3A 2P70A 1N2DA 3R1OA 5ER5A 2OTGB 3UNWA 3K1EA 1ZOTB 4NDDA 5F6TA 1EL4A 1A75B 5G08A 4A4CA 1JFJA 2BBMA 1MXLC 1QLKA 4DCKA 2LMUA 3CR4X 1B7TY 5I94A 5FI2A 1OOJA 1F70A 1JUOA 2GGMA 1YX7A 1Y0VH 2M3WA 1K90D 2K8MB 3M0WA 5CSJA 3TZ1A 2VRGA 3DVEA 1Y1UA 2ZN8A 3PJIA 3FS7A 1UURA 2KI6D 2KQ6A 4ZCUA 2PRUA 1CLMA 2D8NA 2K61A 4OVNF 1GM0A 4FTGA 5FI6A 3VROA 4AOMA 4OCIA 1JF0A 4CFRA 2I94A 3ICBA 2HQWA 1SSEB 3TDIA 2KAVA 1IQ3A 2L2CA 3QRXA 2MLFC 1BJFA 3MSEB 1KK8B 2LE9B 1MQ1A 2M7NA 1QLSA 4PE1A 3NXAA 3E3RA 5AXIA 1NX1A 3CABA 3TDUA 1B8CA 2K60A 2KNEA 1P28A 2NCOA 4ORAB 1KCYA 2EC6B 2FJUB 4PE0A 1L2OB 1AVSA 5I2QA 1RJVA 1QATA 2M49B 1TCFA 1J55A 1UUSA 1C7VA 1S6CA 3AAKA 1KK8C 1R2UA 1H8BA 1G4YR 2BCXA 1G8IA 1K96A 1ZACA 3GK1A 2QEOA 3FWCA 2ZKMX 2HF5A 1DGVA 2LCPA 1OMRA 1S36A 2GGZA 4PHMA 4UPGA 3PN7B 1K9PA 4ZCVA 1IIOA 1K8UA 2K2AA 2KI4B 2OPOA 1BODA 2FJYA 4DUQA 1ODBA 1CDMA 2KI4C 4HRGA 1Y1AA 2I7AA 1B47A 4MSPA 1UHJA 3I5HB 1CNPA 1EH2A 4GNKB 2HETA 3I5FC 4PHKA 5HYDA 2LM5A 2L4HA 1BG1A 1CFFA 2Q4UA 1M31A 1PULA 2LLTA 3B7AA 1X02A 4OZDA 5KTYA 2JPTA 1ZMZA 2WCMA 4BY5A 1NWDA 5B8IB 4PT1A 4C0JA 2KAYA 3CYZA 1JBAA 1Z2CB 4MN0A 2LLSA 3BOWB 5CSNA 3LCPC 1FI6A 3SG5A 3JVTC 3IQOA 2ISDA 2JT0A 3O4YA 5J3XA 2LLUA 2WNDA 3NSOA 4AQIA 3D10A 1XYDA 4FQOA 4YGCB 2PSRA 2M7LA 5I2LA 2JU0A 4P2YB 3NHIA 1SCVA 2BL0B 5HLOA 1QASA 5AFPA 1TNXA 1MUXA 1TRFA 2L50A 2MJWB 4GGNA 4MZJA 4YI8A 4YGBB 4CLNA 1FF1A 4I5JA 1JC2A 2QEVA 4ORCB 2Y1MA 1FW4A 2LC5A 3EK7A 2KHNA 4KYNA 2ZNDA 1CB1A 1NX2A 2MA2A 2JTTA 1CFDA 1ALWA 1MWNA 2DOQA 3EK8A 1NX0A 3L4AA 1QIVA 4JKTA 2A4JA 1QV0A 4YI9A 1QVIZ 4D1EA 2QEBA 3SG3A 3L47A 1DC1A 3VB1A 3CGAA 2F3ZA 1DF0A 3CZ0A 1C07A 4ICBA 3R1VA 4F0ZB 1PSBA 1CFCA 1GQMA 2BKIB 3D0YB 2WCEA 1BF5A 1DJYA 5DICA 2H2KA 1WLZA 2PMYA 3BUMB 3FIAA 4YRUA 3KEVA 3PN7C 4JQ0D 1SRAA 2ZRTA 1CDNA 1EJ3A 2O5GA 1MXEA 1SL9A 3GOFA 1BOCA 1NCXA 1OOGA 2CBLA 2WC6A 4A4BA 1HT9A 2M29A 3IQQA 4ORBB 2GV5A 5IBWA 2CT9A 2CNPA 3AAJA 2BAPA 3B87A 1MHOA 1PRWA 1G33A 3S0AA 3OGNA 4OKHA 4N1GA 3I5IB 5JJGA 1NCYA 1Q80A 1V1GA 3K21A 4CFQA 1A4PA 3I5GC 1U5IB 1LKJA 3NGVA 2H8VA 3BUNB 5HKWA 3SG4A 3BUXB 1KQMB 2JRFA 2JNFA 2WCKA 1CDPA 1J7OA 2KGRA 3KPXA 1OZSA 5CPVA 1XFYO 2BE6A 3DZTA 5FI7A 1K95A 2JT8A 2PQLA 1M45A 1J7PA 4GPLB 1CLLA 1DF0B 2WC5A 3PALA 1SR6C 1YX8A 1B7TZ 1F55A 2JULA 2LNKA 1F4QA 4M2PA 4GUKA 1QWVA 3CDNA 3S0BA 2O60A 2F33A 4PE4A 4OV2A 2NLNA 1VRKA 1SW8A 4JPZB 1YVLA 2YGUA 1MF8B 1DJHA 1YTZC 2PYQA 2HQ8A 4YBHB 3DVJA 2B1UA 2OS8C 2NXQA 1PALA 3CTNA 1N65A 4NDCA 5KU1A 1H4BA 1UP5A 1SCMB 2EGDA 2Y1NA 3FE6A 3D76A 4QJ4B 1QV1A 3O2PA 2K0JA 1XFRA 2F2PA 2ZNEA 4PDZA 3O78A 5PALA 1XFVO 3BOWA 4MRYA 1SL7A 1XFZO 2G9BA 2M1KB 1M63B 1SL8A 4MLWA 1BR1B 1IJ5A 1CM1A 1S3PA 1QJTA 1TNPA 2LANA 3D74A 4DIRA 1LXFC 2KYFA 3HCMA 5HKZA 1A2XA 1K94A 5TNCA 2ZFDA 3CZTX 1L2OC 3S0EA 1NIWA 1RROA 4C0LA 2PASA 2MLEC 4I5LB 2TN4A 3OBVA 1TUZA 1SY9A 1EXRA 2QACA 3BUWB 2PALA 1A29A 2ZN9A 2K7CA 2KAXA 2SCPA 4XJKA 5K89A 2MHHA 4QJ5B 4GBAA 1AUIB 1IG5A 3R1PA 1SMGA 1LVCD 1K9KA 3D78A 2KSPA 1CDLA 4E68A 4NQGA 1Y6WA 1IH0A 3UO9A 3WHUB 2F8PA 2KFHA 2WC8A 2JQ6A 1TOPA 4AQJA 3DY9A 1NP8A 2LMVA 1WY9A 1CLBA 2L4IA 2WORA 1DEKA 2HPSA 5D3OA 1TWOA 2CXJA 3O4XA 3LK0A 2QEHA 4INWA 1KK7Y 1IJ6A 1DMOA 3CR2A 3FE8A 2FCEA 1BT6A 1F4OA 4INXA 1DGUA 3TUYB 4I5KA 4QJ3B 4MEWA 3BJHA 3B6XA 1TUJA 1NX3A 2KQYA 4MBEA 1KWOB 1TNWA 2JPOA 2KLEA 4N5XA 2M97A 3KO0A 2Y4QA 2JZIA 2E6WA 1BR4B 1S5GY 2AUCA 3QMEA 1M39A 1B1GA 3NSLA 3DD4A 5GQQC 2LUXA 1DQEA 3BFHA 3S0DA 2PVBA 1B4CA 3EK4A 2KPHA 1YURA 2CCMA 1Y1XA 2I2RE 1PVAA 3IF7A 1CMFA 2IS9A 3LK1A 3AKBA 2M0RA 2L0PA 2K7DA 1RWYA 2KFGA 3B86A 3SG2A 1GGWA 1K93D 2Y5IA 2K2FA 1LINA 3PATA 3C1VA 5DKRA 1B8RA 3A8RA 3OB2B 1RTP1 1W7JB 4HREE 3SG6A 1PSRA 3D75A 4PE7A 3VRRA 5KSZA 1DJZA 2LVJA 1AK8A 1HQVA 3RM1A 1GGZA 1J7RA 2BNXA 2M1UA 1XK4C 3TS5C 2JXLA 3V2LA 1W9ZA 2LVVA 1AHRA 2H61C 3ZWHA 1B9AA 2OTGC 2CTNA 1LA3A 1SK6D 4YGDB 1XVJA 1BLQA 1U5IA 1LS8A 5BPJA 1BMOA 1QXPA 1KQVA 1MR8A 1JWDA 4HRHA 3EKHA 1TTXA 1YRTB 4JD9A 1QVIY 1LA0A 1GJYA 3TS5B 2L51A 3PSRA 3EKJA 4C0KA 1OMVA 3R72A 1IWQA 3SS5A 4CIDA 3CR5X 1DTLA 2AMIA 4MRXA 1OE9B 1R6PA 3O6BA 1KQMC 3BYAA 3IVTA 3JTDB 1C3YA 1CKKA 1S6JA 3OX5A 2E30A 4JWQA 3Q8IA 3BQ3A 2L2EA 1UHKA 1SKTA 2K7BA 2NZ0A 3JVTB 2JXCA 4GAOA 1WRLA 4IL1A 1K2HA 3SJSA 1OOIX 1DJGA 3NSIA 1IKUA 3A4UB 1WRKA 1KFXS 1TIZA 2BL0C 2M8UA 3I5IC 4U8DA 1EG4A 2JT3A 4TNCA 1J7QA 2JTZA 1DJIA 3JTDC 3LLEA 3PFVA 3S0FA 4CPVA 1DVIA 3L4LA 1OZOA 1SBJA 1T14A 1KWOC 3CWGA 3NSKA 2LHLA 2WOSA 1SPYA 4YGEB 1UHNA 3FE9A 2WCFA 4OR9B 1QX2A 1W7IB 4FQTA 3SIAA 4ETOA 1NUBA 1IQ5A 1OW4A 1KSOA 1V1FA 1WDCC 2LVKA 3D73A 3EVUA 5HLVA 5ER4X 2FCDA 1YVHA 2R2IA 3DXLA 4PALA 2NCPA 1QX5B 1S5GZ 2L98A 1OQPA 1IGVA 1QS7A 1XK4A 3DF0A 1M46A 1DJWA 3F45A 1YUUA 1KFUS 3PM8A 3PM2A 1A03A 1Z4HA 2GTEA 4PHJA 1CFPA 3GK4X 1S1EA 5AEQA 1C7WA 2ERBA 5AERA 1ALVA 1AJ4A 4XYNA 3I5HC 4MVFA 2MBXA 2JNXA 2KOTA 1DELA 1JFKA 4I5NB 2ZRSA 3TDZA 4L9MA 2KLDA 2LUCA 5JOLA 1DJXA 1QIWA 3WXAA 3CZ1A 2P71A 3EVRA 1ORGA 1E8AA 1TCOB 2I18A 3NHTA 2H61A 1YUSA 1K9UA 1YR5A 1N0YA 1EG3A 1B8LA 3VRNA 4PCWA 2MRDA 3AKAA 2P6BB 2F3YA 3BUOB 2G2BA 2F2OA 2QDIA 3OHMB 2KGBC 2QPTA 2BECA 1WRZA 2LP3A 2V53A 4MZLA 1QX7A 1XA5A 4PHNA 4DS7A 1F8HA 5HL1A 4N1FA 4WQ2A 1NPQA 3SG7A 3D0YA 1OSAA 1AP4A 1XO5A 2KI6C 4Q04A 4HSZA 1SYMA 4NDBA 1OOHA 2LP2A 1XFXO 4YGAA 3RZSA 2FOTA 2COLB 1UHIA 1CMGA 3GK2A 3B88A 2WCLA 1RK9A 1CTRA 3WHTB 1UWOA 2BCBA 1FI5A 2SASA 4BY4A 3TUYC 5I2OA 1L7ZA 2M9GA 1F71A 1AJ5A 1NCZA 1TN4A 2JWWA 1KFUL 2LVIA 2LAPA 2WCHA 2AAOA 3DYEA 2BE4A 2RGIA 3CS1A 2EHBA 5CSIA 1ZFSA 1SR6B 1KK7Z 1SCMC 5AANA 3SS3A 5DKQA 1XFUO 3CZ2A 3OB1B 3OP0A 1WDCB 2Q91A 2BCAA 1NYAA 3EG5B 4GGFA 4IJ7A 5D7FA 4R1EA 1S6IA 2K7OA 2JC2A 5I8NA 1PK0D 1F54A 2KDHA 3N7HA 2L5XB 3SIBA 4M2OA 1ZUZA 1J1DA 2LMTA 3I5GB 1A75A 1WLMA 3ZNIA 1C3ZA 1JF2A 2KYCA 3DVKA 2BKHB 1UHHA 2EC6C 2L5YA 2MAZA 3FWBA 4GFTA 1PVBA 5DKNA 1OOFA 4P5OE 1RFJA 1KFXL 3SS4A 1S26D 3BFAA 1DT7B 3EVVA 3H4SE 3S0GA 2BBNA 3PLFB
chains in the Genus database with same CATH topology
4USLA 3BXKA 5FYXA 1BU3A 1XFWO 4DRWA 3VRPA 5CSFA 3DF0B 1FBVA 1YRUB 1J1EA 3KHEA 1KSMA 4GGFC 2LHIA 1RECA 1TNQA 5HKYA 4XJKB 2KBMA 3RLZA 1OMDA 1NSHA 2KBIA 4MZKA 1YUTA 4WRIA 5D69A 3WNXB 1SNLA 3DVMA 1IRJA 3OX6A 1D1OA 2JOJA 3VGOA 1FPWA 1JSAA 1QTXA 4M2QA 3CLNA 3LL8B 3HX4A 2KFFA 1CM4A 2LV7A 2WCBA 3I5FB 3VRQA 2OS8B 3KF9A 4WQ3A 1N2DA 5ER5A 2OTGB 1ZOTB 4NDDA 5F6TA 1EL4A 1A75B 5G08A 4A4CA 1JFJA 2BBMA 1MXLC 1QLKA 4DCKA 2LMUA 3CR4X 1B7TY 1F70A 1OOJA 1JUOA 2GGMA 1YX7A 1Y0VH 2M3WA 1K90D 2K8MB 3M0WA 5CSJA 3TZ1A 2VRGA 3DVEA 1Y1UA 2ZN8A 3FS7A 1UURA 2KI6D 2KQ6A 2PRUA 1CLMA 2D8NA 2K61A 4OVNF 4FTGA 4AOMA 4OCIA 1JF0A 4CFRA 2I94A 3ICBA 2HQWA 3TDIA 2KAVA 1IQ3A 3QRXA 2MLFC 1BJFA 3MSEB 1KK8B 2LE9B 1MQ1A 2M7NA 1QLSA 4PE1A 3NXAA 3E3RA 5AXIA 1NX1A 3TDUA 1B8CA 2KNEA 2NCOA 4ORAB 1KCYA 2EC6B 2FJUB 4PE0A 1L2OB 1AVSA 5I2QA 1RJVA 1QATA 2M49B 1TCFA 1J55A 1UUSA 1C7VA 1S6CA 3AAKA 1KK8C 1R2UA 1H8BA 1G4YR 2BCXA 1G8IA 1K96A 1ZACA 3GK1A 3FWCA 2ZKMX 2HF5A 1DGVA 2LCPA 1OMRA 1S36A 2GGZA 4PHMA 4UPGA 3PN7B 1K9PA 4ZCVA 1K8UA 2K2AA 2KI4B 2OPOA 1BODA 4DUQA 1ODBA 1CDMA 2KI4C 4HRGA 1Y1AA 2I7AA 1B47A 4MSPA 1UHJA 3I5HB 1CNPA 1EH2A 4GNKB 2HETA 3I5FC 4PHKA 5HYDA 2LM5A 2L4HA 1BG1A 1CFFA 2Q4UA 1M31A 1PULA 2LLTA 1X02A 5KTYA 2JPTA 1ZMZA 4BY5A 1NWDA 5B8IB 4C0JA 2KAYA 1JBAA 4MN0A 2LLSA 3BOWB 5CSNA 3LCPC 1FI6A 3SG5A 3JVTC 3IQOA 2ISDA 2JT0A 3O4YA 5J3XA 2LLUA 2WNDA 3NSOA 4AQIA 3D10A 1XYDA 4FQOA 4YGCB 2PSRA 2M7LA 5I2LA 2JU0A 4P2YB 1SCVA 2BL0B 5HLOA 1QASA 5AFPA 1TNXA 1MUXA 1TRFA 2L50A 2MJWB 4GGNA 4MZJA 4YI8A 4YGBB 4CLNA 1FF1A 4I5JA 1JC2A 4ORCB 2Y1MA 1FW4A 2LC5A 3EK7A 2KHNA 1CB1A 2ZNDA 1NX2A 2MA2A 2JTTA 1CFDA 1ALWA 1MWNA 2DOQA 3EK8A 1NX0A 1QIVA 2A4JA 1QV0A 4YI9A 1QVIZ 4D1EA 3SG3A 3CGAA 2F3ZA 1DF0A 1C07A 4ICBA 4F0ZB 1PSBA 1CFCA 1GQMA 2BKIB 3D0YB 2WCEA 1BF5A 1DJYA 2H2KA 1WLZA 2PMYA 3BUMB 3FIAA 4YRUA 3KEVA 3PN7C 4JQ0D 1SRAA 2ZRTA 1CDNA 1EJ3A 2O5GA 1MXEA 1SL9A 3GOFA 1BOCA 1NCXA 2CBLA 4A4BA 1HT9A 2M29A 3IQQA 4ORBB 2GV5A 5IBWA 2CT9A 2CNPA 3AAJA 1MHOA 1PRWA 1G33A 4OKHA 4N1GA 3I5IB 5JJGA 1NCYA 1Q80A 1V1GA 3K21A 4CFQA 1A4PA 3I5GC 1U5IB 1LKJA 3BUNB 5HKWA 3SG4A 3BUXB 1KQMB 2JRFA 2JNFA 1CDPA 1J7OA 2KGRA 3KPXA 1OZSA 5CPVA 1XFYO 2BE6A 1K95A 2JT8A 1J7PA 1M45A 4GPLB 1CLLA 1DF0B 1F55A 3PALA 1SR6C 1B7TZ 1YX8A 2JULA 2LNKA 1F4QA 4M2PA 4GUKA 2O60A 2F33A 4PE4A 4OV2A 2NLNA 1VRKA 1SW8A 4JPZB 1YVLA 1MF8B 1DJHA 1YTZC 2HQ8A 4YBHB 3DVJA 2B1UA 2OS8C 2NXQA 1PALA 3CTNA 1N65A 4NDCA 5KU1A 1H4BA 1UP5A 1SCMB 2EGDA 2Y1NA 4QJ4B 1QV1A 3O2PA 2K0JA 2F2PA 2ZNEA 4PDZA 3O78A 5PALA 1XFVO 3BOWA 4MRYA 1SL7A 1XFZO 2G9BA 2M1KB 1M63B 1SL8A 4MLWA 1BR1B 1IJ5A 1CM1A 1S3PA 1QJTA 1TNPA 2LANA 4DIRA 1LXFC 2KYFA 3HCMA 5HKZA 1A2XA 1K94A 5TNCA 2ZFDA 3CZTX 1L2OC 1NIWA 1RROA 4C0LA 2PASA 2MLEC 4I5LB 2TN4A 1SY9A 1EXRA 2QACA 3BUWB 2PALA 1A29A 2ZN9A 2K7CA 2KAXA 2SCPA 4XJKA 5K89A 2MHHA 4QJ5B 4GBAA 1AUIB 1IG5A 1SMGA 1LVCD 1K9KA 2KSPA 1CDLA 4E68A 4NQGA 1Y6WA 1IH0A 3WHUB 2F8PA 2KFHA 2WC8A 2JQ6A 1TOPA 4AQJA 1NP8A 2LMVA 1WY9A 1CLBA 2L4IA 2WORA 2HPSA 2CXJA 3LK0A 1KK7Y 1IJ6A 1DMOA 3CR2A 2FCEA 1BT6A 1F4OA 1DGUA 3TUYB 4I5KA 4QJ3B 4MEWA 1NX3A 2KQYA 4MBEA 1KWOB 1TNWA 4N5XA 2M97A 3KO0A 2Y4QA 2JZIA 2E6WA 1BR4B 1S5GY 2AUCA 1B1GA 1M39A 3NSLA 3DD4A 5GQQC 2LUXA 2PVBA 1B4CA 3EK4A 1YURA 2CCMA 1Y1XA 2I2RE 1PVAA 3IF7A 1CMFA 2IS9A 3LK1A 3AKBA 2M0RA 2L0PA 2K7DA 1RWYA 2KFGA 3SG2A 1GGWA 1K93D 2Y5IA 2K2FA 1LINA 3PATA 3C1VA 5DKRA 1B8RA 3A8RA 3OB2B 1RTP1 1W7JB 4HREE 3SG6A 1PSRA 4PE7A 3VRRA 5KSZA 1DJZA 2LVJA 1AK8A 1HQVA 3RM1A 1GGZA 1J7RA 2M1UA 1XK4C 3TS5C 2JXLA 2LVVA 1AHRA 2H61C 3ZWHA 1B9AA 2OTGC 2CTNA 1LA3A 1SK6D 4YGDB 1XVJA 1BLQA 1U5IA 5BPJA 1BMOA 1QXPA 1KQVA 1MR8A 1JWDA 4HRHA 3EKHA 1TTXA 1YRTB 1QVIY 1LA0A 1GJYA 3TS5B 2L51A 3PSRA 3EKJA 4C0KA 1OMVA 1IWQA 4CIDA 3CR5X 1DTLA 2AMIA 4MRXA 1OE9B 1R6PA 3O6BA 1KQMC 3BYAA 3JTDB 1CKKA 1S6JA 3OX5A 2E30A 4JWQA 3BQ3A 2L2EA 1UHKA 1SKTA 2K7BA 2NZ0A 3JVTB 2JXCA 4GAOA 1WRLA 4IL1A 1K2HA 3SJSA 1DJGA 3NSIA 1IKUA 3A4UB 1WRKA 1KFXS 1TIZA 2BL0C 2M8UA 3I5IC 4U8DA 1EG4A 2JT3A 4TNCA 1J7QA 2JTZA 1DJIA 3JTDC 3LLEA 3PFVA 4CPVA 1DVIA 1OZOA 1SBJA 1KWOC 3CWGA 3NSKA 2LHLA 2WOSA 1SPYA 4YGEB 1UHNA 2WCFA 4OR9B 1QX2A 1W7IB 3SIAA 4ETOA 1NUBA 1IQ5A 3EVUA 1KSOA 1V1FA 1WDCC 2LVKA 5HLVA 5ER4X 2FCDA 1YVHA 2R2IA 4PALA 2NCPA 1QX5B 1S5GZ 2L98A 1OQPA 1IGVA 1QS7A 1XK4A 3DF0A 1M46A 1DJWA 3F45A 1YUUA 1KFUS 3PM8A 1A03A 4PHJA 1CFPA 3GK4X 1S1EA 5AEQA 1C7WA 5AERA 1ALVA 1AJ4A 4XYNA 3I5HC 4MVFA 2MBXA 2JNXA 2KOTA 1JFKA 4I5NB 2ZRSA 3TDZA 4L9MA 2LUCA 5JOLA 1DJXA 1QIWA 3WXAA 3EVRA 1E8AA 1TCOB 2I18A 2H61A 1YUSA 1K9UA 1YR5A 1N0YA 1EG3A 1B8LA 3VRNA 4PCWA 2MRDA 3AKAA 2P6BB 2F3YA 3BUOB 2G2BA 2F2OA 3OHMB 2KGBC 2QPTA 2BECA 1WRZA 2LP3A 2V53A 4MZLA 1QX7A 1XA5A 4PHNA 4DS7A 1F8HA 4N1FA 4WQ2A 1NPQA 3SG7A 3D0YA 1OSAA 1AP4A 1XO5A 2KI6C 4Q04A 4HSZA 1SYMA 4NDBA 2LP2A 4YGAA 1XFXO 2FOTA 2COLB 1UHIA 1CMGA 3GK2A 1RK9A 1CTRA 3WHTB 1UWOA 2BCBA 1FI5A 2SASA 4BY4A 3TUYC 5I2OA 1L7ZA 2M9GA 1F71A 1AJ5A 1NCZA 1TN4A 2JWWA 1KFUL 2LVIA 2LAPA 2AAOA 2BE4A 2RGIA 3CS1A 2EHBA 5CSIA 1ZFSA 1SR6B 1KK7Z 1SCMC 5AANA 5DKQA 1XFUO 3OB1B 3OP0A 1WDCB 2Q91A 2BCAA 1NYAA 4GGFA 5D7FA 4R1EA 1S6IA 2K7OA 2JC2A 5I8NA 1PK0D 1F54A 2KDHA 2L5XB 3SIBA 4M2OA 1ZUZA 1J1DA 2LMTA 3I5GB 1A75A 1WLMA 3ZNIA 1JF2A 2KYCA 4ZCUA 3DVKA 2BKHB 1UHHA 2EC6C 2MAZA 3FWBA 4GFTA 5DKNA 1PVBA 3VROA 4P5OE 1RFJA 1KFXL 1S26D 1DT7B 3EVVA 3H4SE 2BBNA 3PLFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4USL A;  3BXK A;  5FYX A;  1BU3 A;  1XFW O;  4DRW A;  3VRP A;  5CSF A;  3DF0 B;  1FBV A;  1YRU B;  1J1E A;  3KHE A;  1KSM A;  4GGF C;  2LHI A;  1REC A;  1TNQ A;  5HKY A;  4XJK B;  2KBM A;  3RLZ A;  1OMD A;  1NSH A;  2KBI A;  4MZK A;  1YUT A;  4WRI A;  5D69 A;  3WNX B;  1SNL A;  3DVM A;  1IRJ A;  3OX6 A;  1D1O A;  2JOJ A;  3VGO A;  1FPW A;  1JSA A;  1QTX A;  4M2Q A;  3CLN A;  3LL8 B;  3HX4 A;  2KFF A;  1CM4 A;  2LV7 A;  2WCB A;  3I5F B;  3VRQ A;  2OS8 B;  3KF9 A;  4WQ3 A;  1N2D A;  5ER5 A;  2OTG B;  1ZOT B;  4NDD A;  5F6T A;  1EL4 A;  1A75 B;  5G08 A;  4A4C A;  1JFJ A;  2BBM A;  1MXL C;  1QLK A;  4DCK A;  2LMU A;  3CR4 X;  1B7T Y;  1F70 A;  1OOJ A;  1JUO A;  2GGM A;  1YX7 A;  1Y0V H;  2M3W A;  1K90 D;  2K8M B;  3M0W A;  5CSJ A;  3TZ1 A;  2VRG A;  3DVE A;  1Y1U A;  2ZN8 A;  3FS7 A;  1UUR A;  2KI6 D;  2KQ6 A;  2PRU A;  1CLM A;  2D8N A;  2K61 A;  4OVN F;  4FTG A;  4AOM A;  4OCI A;  1JF0 A;  4CFR A;  2I94 A;  3ICB A;  2HQW A;  3TDI A;  2KAV A;  1IQ3 A;  3QRX A;  2MLF C;  1BJF A;  3MSE B;  1KK8 B;  2LE9 B;  1MQ1 A;  2M7N A;  1QLS A;  4PE1 A;  3NXA A;  3E3R A;  5AXI A;  1NX1 A;  3TDU A;  1B8C A;  2KNE A;  2NCO A;  4ORA B;  1KCY A;  2EC6 B;  2FJU B;  4PE0 A;  1L2O B;  1AVS A;  5I2Q A;  1RJV A;  1QAT A;  2M49 B;  1TCF A;  1J55 A;  1UUS A;  1C7V A;  1S6C A;  3AAK A;  1KK8 C;  1R2U A;  1H8B A;  1G4Y R;  2BCX A;  1G8I A;  1K96 A;  1ZAC A;  3GK1 A;  3FWC A;  2ZKM X;  2HF5 A;  1DGV A;  2LCP A;  1OMR A;  1S36 A;  2GGZ A;  4PHM A;  4UPG A;  3PN7 B;  1K9P A;  4ZCV A;  1K8U A;  2K2A A;  2KI4 B;  2OPO A;  1BOD A;  4DUQ A;  1ODB A;  1CDM A;  2KI4 C;  4HRG A;  1Y1A A;  2I7A A;  1B47 A;  4MSP A;  1UHJ A;  3I5H B;  1CNP A;  1EH2 A;  4GNK B;  2HET A;  3I5F C;  4PHK A;  5HYD A;  2LM5 A;  2L4H A;  1BG1 A;  1CFF A;  2Q4U A;  1M31 A;  1PUL A;  2LLT A;  1X02 A;  5KTY A;  2JPT A;  1ZMZ A;  4BY5 A;  1NWD A;  5B8I B;  4C0J A;  2KAY A;  1JBA A;  4MN0 A;  2LLS A;  3BOW B;  5CSN A;  3LCP C;  1FI6 A;  3SG5 A;  3JVT C;  3IQO A;  2ISD A;  2JT0 A;  3O4Y A;  5J3X A;  2LLU A;  2WND A;  3NSO A;  4AQI A;  3D10 A;  1XYD A;  4FQO A;  4YGC B;  2PSR A;  2M7L A;  5I2L A;  2JU0 A;  4P2Y B;  1SCV A;  2BL0 B;  5HLO A;  1QAS A;  5AFP A;  1TNX A;  1MUX A;  1TRF A;  2L50 A;  2MJW B;  4GGN A;  4MZJ A;  4YI8 A;  4YGB B;  4CLN A;  1FF1 A;  4I5J A;  1JC2 A;  4ORC B;  2Y1M A;  1FW4 A;  2LC5 A;  3EK7 A;  2KHN A;  1CB1 A;  2ZND A;  1NX2 A;  2MA2 A;  2JTT A;  1CFD A;  1ALW A;  1MWN A;  2DOQ A;  3EK8 A;  1NX0 A;  1QIV A;  2A4J A;  1QV0 A;  4YI9 A;  1QVI Z;  4D1E A;  3SG3 A;  3CGA A;  2F3Z A;  1DF0 A;  1C07 A;  4ICB A;  4F0Z B;  1PSB A;  1CFC A;  1GQM A;  2BKI B;  3D0Y B;  2WCE A;  1BF5 A;  1DJY A;  2H2K A;  1WLZ A;  2PMY A;  3BUM B;  3FIA A;  4YRU A;  3KEV A;  3PN7 C;  4JQ0 D;  1SRA A;  2ZRT A;  1CDN A;  1EJ3 A;  2O5G A;  1MXE A;  1SL9 A;  3GOF A;  1BOC A;  1NCX A;  2CBL A;  4A4B A;  1HT9 A;  2M29 A;  3IQQ A;  4ORB B;  2GV5 A;  5IBW A;  2CT9 A;  2CNP A;  3AAJ A;  1MHO A;  1PRW A;  1G33 A;  4OKH A;  4N1G A;  3I5I B;  5JJG A;  1NCY A;  1Q80 A;  1V1G A;  3K21 A;  4CFQ A;  1A4P A;  3I5G C;  1U5I B;  1LKJ A;  3BUN B;  5HKW A;  3SG4 A;  3BUX B;  1KQM B;  2JRF A;  2JNF A;  1CDP A;  1J7O A;  2KGR A;  3KPX A;  1OZS A;  5CPV A;  1XFY O;  2BE6 A;  1K95 A;  2JT8 A;  1J7P A;  1M45 A;  4GPL B;  1CLL A;  1DF0 B;  1F55 A;  3PAL A;  1SR6 C;  1B7T Z;  1YX8 A;  2JUL A;  2LNK A;  1F4Q A;  4M2P A;  4GUK A;  2O60 A;  2F33 A;  4PE4 A;  4OV2 A;  2NLN A;  1VRK A;  1SW8 A;  4JPZ B;  1YVL A;  1MF8 B;  1DJH A;  1YTZ C;  2HQ8 A;  4YBH B;  3DVJ A;  2B1U A;  2OS8 C;  2NXQ A;  1PAL A;  3CTN A;  1N65 A;  4NDC A;  5KU1 A;  1H4B A;  1UP5 A;  1SCM B;  2EGD A;  2Y1N A;  4QJ4 B;  1QV1 A;  3O2P A;  2K0J A;  2F2P A;  2ZNE A;  4PDZ A;  3O78 A;  5PAL A;  1XFV O;  3BOW A;  4MRY A;  1SL7 A;  1XFZ O;  2G9B A;  2M1K B;  1M63 B;  1SL8 A;  4MLW A;  1BR1 B;  1IJ5 A;  1CM1 A;  1S3P A;  1QJT A;  1TNP A;  2LAN A;  4DIR A;  1LXF C;  2KYF A;  3HCM A;  5HKZ A;  1A2X A;  1K94 A;  5TNC A;  2ZFD A;  3CZT X;  1L2O C;  1NIW A;  1RRO A;  4C0L A;  2PAS A;  2MLE C;  4I5L B;  2TN4 A;  1SY9 A;  1EXR A;  2QAC A;  3BUW B;  2PAL A;  1A29 A;  2ZN9 A;  2K7C A;  2KAX A;  2SCP A;  4XJK A;  5K89 A;  2MHH A;  4QJ5 B;  4GBA A;  1AUI B;  1IG5 A;  1SMG A;  1LVC D;  1K9K A;  2KSP A;  1CDL A;  4E68 A;  4NQG A;  1Y6W A;  1IH0 A;  3WHU B;  2F8P A;  2KFH A;  2WC8 A;  2JQ6 A;  1TOP A;  4AQJ A;  1NP8 A;  2LMV A;  1WY9 A;  1CLB A;  2L4I A;  2WOR A;  2HPS A;  2CXJ A;  3LK0 A;  1KK7 Y;  1IJ6 A;  1DMO A;  3CR2 A;  2FCE A;  1BT6 A;  1F4O A;  1DGU A;  3TUY B;  4I5K A;  4QJ3 B;  4MEW A;  1NX3 A;  2KQY A;  4MBE A;  1KWO B;  1TNW A;  4N5X A;  2M97 A;  3KO0 A;  2Y4Q A;  2JZI A;  2E6W A;  1BR4 B;  1S5G Y;  2AUC A;  1B1G A;  1M39 A;  3NSL A;  3DD4 A;  5GQQ C;  2LUX A;  2PVB A;  1B4C A;  3EK4 A;  1YUR A;  2CCM A;  1Y1X A;  2I2R E;  1PVA A;  3IF7 A;  1CMF A;  2IS9 A;  3LK1 A;  3AKB A;  2M0R A;  2L0P A;  2K7D A;  1RWY A;  2KFG A;  3SG2 A;  1GGW A;  1K93 D;  2Y5I A;  2K2F A;  1LIN A;  3PAT A;  3C1V A;  5DKR A;  1B8R A;  3A8R A;  3OB2 B;  1RTP 1;  1W7J B;  4HRE E;  3SG6 A;  1PSR A;  4PE7 A;  3VRR A;  5KSZ A;  1DJZ A;  2LVJ A;  1AK8 A;  1HQV A;  3RM1 A;  1GGZ A;  1J7R A;  2M1U A;  1XK4 C;  3TS5 C;  2JXL A;  2LVV A;  1AHR A;  2H61 C;  3ZWH A;  1B9A A;  2OTG C;  2CTN A;  1LA3 A;  1SK6 D;  4YGD B;  1XVJ A;  1BLQ A;  1U5I A;  5BPJ A;  1BMO A;  1QXP A;  1KQV A;  1MR8 A;  1JWD A;  4HRH A;  3EKH A;  1TTX A;  1YRT B;  1QVI Y;  1LA0 A;  1GJY A;  3TS5 B;  2L51 A;  3PSR A;  3EKJ A;  4C0K A;  1OMV A;  1IWQ A;  4CID A;  3CR5 X;  1DTL A;  2AMI A;  4MRX A;  1OE9 B;  1R6P A;  3O6B A;  1KQM C;  3BYA A;  3JTD B;  1CKK A;  1S6J A;  3OX5 A;  2E30 A;  4JWQ A;  3BQ3 A;  2L2E A;  1UHK A;  1SKT A;  2K7B A;  2NZ0 A;  3JVT B;  2JXC A;  4GAO A;  1WRL A;  4IL1 A;  1K2H A;  3SJS A;  1DJG A;  3NSI A;  1IKU A;  3A4U B;  1WRK A;  1KFX S;  1TIZ A;  2BL0 C;  2M8U A;  3I5I C;  4U8D A;  1EG4 A;  2JT3 A;  4TNC A;  1J7Q A;  2JTZ A;  1DJI A;  3JTD C;  3LLE A;  3PFV A;  4CPV A;  1DVI A;  1OZO A;  1SBJ A;  1KWO C;  3CWG A;  3NSK A;  2LHL A;  2WOS A;  1SPY A;  4YGE B;  1UHN A;  2WCF A;  4OR9 B;  1QX2 A;  1W7I B;  3SIA A;  4ETO A;  1NUB A;  1IQ5 A;  3EVU A;  1KSO A;  1V1F A;  1WDC C;  2LVK A;  5HLV A;  5ER4 X;  2FCD A;  1YVH A;  2R2I A;  4PAL A;  2NCP A;  1QX5 B;  1S5G Z;  2L98 A;  1OQP A;  1IGV A;  1QS7 A;  1XK4 A;  3DF0 A;  1M46 A;  1DJW A;  3F45 A;  1YUU A;  1KFU S;  3PM8 A;  1A03 A;  4PHJ A;  1CFP A;  3GK4 X;  1S1E A;  5AEQ A;  1C7W A;  5AER A;  1ALV A;  1AJ4 A;  4XYN A;  3I5H C;  4MVF A;  2MBX A;  2JNX A;  2KOT A;  1JFK A;  4I5N B;  2ZRS A;  3TDZ A;  4L9M A;  2LUC A;  5JOL A;  1DJX A;  1QIW A;  3WXA A;  3EVR A;  1E8A A;  1TCO B;  2I18 A;  2H61 A;  1YUS A;  1K9U A;  1YR5 A;  1N0Y A;  1EG3 A;  1B8L A;  3VRN A;  4PCW A;  2MRD A;  3AKA A;  2P6B B;  2F3Y A;  3BUO B;  2G2B A;  2F2O A;  3OHM B;  2KGB C;  2QPT A;  2BEC A;  1WRZ A;  2LP3 A;  2V53 A;  4MZL A;  1QX7 A;  1XA5 A;  4PHN A;  4DS7 A;  1F8H A;  4N1F A;  4WQ2 A;  1NPQ A;  3SG7 A;  3D0Y A;  1OSA A;  1AP4 A;  1XO5 A;  2KI6 C;  4Q04 A;  4HSZ A;  1SYM A;  4NDB A;  2LP2 A;  4YGA A;  1XFX O;  2FOT A;  2COL B;  1UHI A;  1CMG A;  3GK2 A;  1RK9 A;  1CTR A;  3WHT B;  1UWO A;  2BCB A;  1FI5 A;  2SAS A;  4BY4 A;  3TUY C;  5I2O A;  1L7Z A;  2M9G A;  1F71 A;  1AJ5 A;  1NCZ A;  1TN4 A;  2JWW A;  1KFU L;  2LVI A;  2LAP A;  2AAO A;  2BE4 A;  2RGI A;  3CS1 A;  2EHB A;  5CSI A;  1ZFS A;  1SR6 B;  1KK7 Z;  1SCM C;  5AAN A;  5DKQ A;  1XFU O;  3OB1 B;  3OP0 A;  1WDC B;  2Q91 A;  2BCA A;  1NYA A;  4GGF A;  5D7F A;  4R1E A;  1S6I A;  2K7O A;  2JC2 A;  5I8N A;  1PK0 D;  1F54 A;  2KDH A;  2L5X B;  3SIB A;  4M2O A;  1ZUZ A;  1J1D A;  2LMT A;  3I5G B;  1A75 A;  1WLM A;  3ZNI A;  1JF2 A;  2KYC A;  4ZCU A;  3DVK A;  2BKH B;  1UHH A;  2EC6 C;  2MAZ A;  3FWB A;  4GFT A;  5DKN A;  1PVB A;  3VRO A;  4P5O E;  1RFJ A;  1KFX L;  1S26 D;  1DT7 B;  3EVV A;  3H4S E;  2BBN A;  3PLF B; 
#chains in the Genus database with same CATH topology
 4USL A;  3BXK A;  5FYX A;  1BU3 A;  1XFW O;  4DRW A;  3VRP A;  3BFB A;  3DF0 B;  5CSF A;  1FBV A;  1YRU B;  1J1E A;  3KHE A;  1KSM A;  2WCJ A;  4GGF C;  2LHI A;  1REC A;  5EL2 A;  1TNQ A;  5HKY A;  4XJK B;  2KBM A;  3RLZ A;  1OMD A;  1NSH A;  2KBI A;  4MZK A;  4F7F A;  1YUT A;  4WRI A;  5D69 A;  3WNX B;  1SNL A;  3DVM A;  1IRJ A;  3OX6 A;  1D1O A;  2JOJ A;  3VGO A;  1FPW A;  1JSA A;  1QTX A;  4M2Q A;  3CLN A;  3LL8 B;  3D77 A;  3HX4 A;  2KFF A;  1CM4 A;  2LV7 A;  2WCB A;  3I5F B;  3VRQ A;  2OS8 B;  3KF9 A;  4WQ3 A;  2P70 A;  1N2D A;  3R1O A;  5ER5 A;  2OTG B;  3UNW A;  3K1E A;  1ZOT B;  4NDD A;  5F6T A;  1EL4 A;  1A75 B;  5G08 A;  4A4C A;  1JFJ A;  2BBM A;  1MXL C;  1QLK A;  4DCK A;  2LMU A;  3CR4 X;  1B7T Y;  5I94 A;  5FI2 A;  1OOJ A;  1F70 A;  1JUO A;  2GGM A;  1YX7 A;  1Y0V H;  2M3W A;  1K90 D;  2K8M B;  3M0W A;  5CSJ A;  3TZ1 A;  2VRG A;  3DVE A;  1Y1U A;  2ZN8 A;  3PJI A;  3FS7 A;  1UUR A;  2KI6 D;  2KQ6 A;  4ZCU A;  2PRU A;  1CLM A;  2D8N A;  2K61 A;  4OVN F;  1GM0 A;  4FTG A;  5FI6 A;  3VRO A;  4AOM A;  4OCI A;  1JF0 A;  4CFR A;  2I94 A;  3ICB A;  2HQW A;  1SSE B;  3TDI A;  2KAV A;  1IQ3 A;  2L2C A;  3QRX A;  2MLF C;  1BJF A;  3MSE B;  1KK8 B;  2LE9 B;  1MQ1 A;  2M7N A;  1QLS A;  4PE1 A;  3NXA A;  3E3R A;  5AXI A;  1NX1 A;  3CAB A;  3TDU A;  1B8C A;  2K60 A;  2KNE A;  1P28 A;  2NCO A;  4ORA B;  1KCY A;  2EC6 B;  2FJU B;  4PE0 A;  1L2O B;  1AVS A;  5I2Q A;  1RJV A;  1QAT A;  2M49 B;  1TCF A;  1J55 A;  1UUS A;  1C7V A;  1S6C A;  3AAK A;  1KK8 C;  1R2U A;  1H8B A;  1G4Y R;  2BCX A;  1G8I A;  1K96 A;  1ZAC A;  3GK1 A;  2QEO A;  3FWC A;  2ZKM X;  2HF5 A;  1DGV A;  2LCP A;  1OMR A;  1S36 A;  2GGZ A;  4PHM A;  4UPG A;  3PN7 B;  1K9P A;  4ZCV A;  1IIO A;  1K8U A;  2K2A A;  2KI4 B;  2OPO A;  1BOD A;  2FJY A;  4DUQ A;  1ODB A;  1CDM A;  2KI4 C;  4HRG A;  1Y1A A;  2I7A A;  1B47 A;  4MSP A;  1UHJ A;  3I5H B;  1CNP A;  1EH2 A;  4GNK B;  2HET A;  3I5F C;  4PHK A;  5HYD A;  2LM5 A;  2L4H A;  1BG1 A;  1CFF A;  2Q4U A;  1M31 A;  1PUL A;  2LLT A;  3B7A A;  1X02 A;  4OZD A;  5KTY A;  2JPT A;  1ZMZ A;  2WCM A;  4BY5 A;  1NWD A;  5B8I B;  4PT1 A;  4C0J A;  2KAY A;  3CYZ A;  1JBA A;  1Z2C B;  4MN0 A;  2LLS A;  3BOW B;  5CSN A;  3LCP C;  1FI6 A;  3SG5 A;  3JVT C;  3IQO A;  2ISD A;  2JT0 A;  3O4Y A;  5J3X A;  2LLU A;  2WND A;  3NSO A;  4AQI A;  3D10 A;  1XYD A;  4FQO A;  4YGC B;  2PSR A;  2M7L A;  5I2L A;  2JU0 A;  4P2Y B;  3NHI A;  1SCV A;  2BL0 B;  5HLO A;  1QAS A;  5AFP A;  1TNX A;  1MUX A;  1TRF A;  2L50 A;  2MJW B;  4GGN A;  4MZJ A;  4YI8 A;  4YGB B;  4CLN A;  1FF1 A;  4I5J A;  1JC2 A;  2QEV A;  4ORC B;  2Y1M A;  1FW4 A;  2LC5 A;  3EK7 A;  2KHN A;  4KYN A;  2ZND A;  1CB1 A;  1NX2 A;  2MA2 A;  2JTT A;  1CFD A;  1ALW A;  1MWN A;  2DOQ A;  3EK8 A;  1NX0 A;  3L4A A;  1QIV A;  4JKT A;  2A4J A;  1QV0 A;  4YI9 A;  1QVI Z;  4D1E A;  2QEB A;  3SG3 A;  3L47 A;  1DC1 A;  3VB1 A;  3CGA A;  2F3Z A;  1DF0 A;  3CZ0 A;  1C07 A;  4ICB A;  3R1V A;  4F0Z B;  1PSB A;  1CFC A;  1GQM A;  2BKI B;  3D0Y B;  2WCE A;  1BF5 A;  1DJY A;  5DIC A;  2H2K A;  1WLZ A;  2PMY A;  3BUM B;  3FIA A;  4YRU A;  3KEV A;  3PN7 C;  4JQ0 D;  1SRA A;  2ZRT A;  1CDN A;  1EJ3 A;  2O5G A;  1MXE A;  1SL9 A;  3GOF A;  1BOC A;  1NCX A;  1OOG A;  2CBL A;  2WC6 A;  4A4B A;  1HT9 A;  2M29 A;  3IQQ A;  4ORB B;  2GV5 A;  5IBW A;  2CT9 A;  2CNP A;  3AAJ A;  2BAP A;  3B87 A;  1MHO A;  1PRW A;  1G33 A;  3S0A A;  3OGN A;  4OKH A;  4N1G A;  3I5I B;  5JJG A;  1NCY A;  1Q80 A;  1V1G A;  3K21 A;  4CFQ A;  1A4P A;  3I5G C;  1U5I B;  1LKJ A;  3NGV A;  2H8V A;  3BUN B;  5HKW A;  3SG4 A;  3BUX B;  1KQM B;  2JRF A;  2JNF A;  2WCK A;  1CDP A;  1J7O A;  2KGR A;  3KPX A;  1OZS A;  5CPV A;  1XFY O;  2BE6 A;  3DZT A;  5FI7 A;  1K95 A;  2JT8 A;  2PQL A;  1M45 A;  1J7P A;  4GPL B;  1CLL A;  1DF0 B;  2WC5 A;  3PAL A;  1SR6 C;  1YX8 A;  1B7T Z;  1F55 A;  2JUL A;  2LNK A;  1F4Q A;  4M2P A;  4GUK A;  1QWV A;  3CDN A;  3S0B A;  2O60 A;  2F33 A;  4PE4 A;  4OV2 A;  2NLN A;  1VRK A;  1SW8 A;  4JPZ B;  1YVL A;  2YGU A;  1MF8 B;  1DJH A;  1YTZ C;  2PYQ A;  2HQ8 A;  4YBH B;  3DVJ A;  2B1U A;  2OS8 C;  2NXQ A;  1PAL A;  3CTN A;  1N65 A;  4NDC A;  5KU1 A;  1H4B A;  1UP5 A;  1SCM B;  2EGD A;  2Y1N A;  3FE6 A;  3D76 A;  4QJ4 B;  1QV1 A;  3O2P A;  2K0J A;  1XFR A;  2F2P A;  2ZNE A;  4PDZ A;  3O78 A;  5PAL A;  1XFV O;  3BOW A;  4MRY A;  1SL7 A;  1XFZ O;  2G9B A;  2M1K B;  1M63 B;  1SL8 A;  4MLW A;  1BR1 B;  1IJ5 A;  1CM1 A;  1S3P A;  1QJT A;  1TNP A;  2LAN A;  3D74 A;  4DIR A;  1LXF C;  2KYF A;  3HCM A;  5HKZ A;  1A2X A;  1K94 A;  5TNC A;  2ZFD A;  3CZT X;  1L2O C;  3S0E A;  1NIW A;  1RRO A;  4C0L A;  2PAS A;  2MLE C;  4I5L B;  2TN4 A;  3OBV A;  1TUZ A;  1SY9 A;  1EXR A;  2QAC A;  3BUW B;  2PAL A;  1A29 A;  2ZN9 A;  2K7C A;  2KAX A;  2SCP A;  4XJK A;  5K89 A;  2MHH A;  4QJ5 B;  4GBA A;  1AUI B;  1IG5 A;  3R1P A;  1SMG A;  1LVC D;  1K9K A;  3D78 A;  2KSP A;  1CDL A;  4E68 A;  4NQG A;  1Y6W A;  1IH0 A;  3UO9 A;  3WHU B;  2F8P A;  2KFH A;  2WC8 A;  2JQ6 A;  1TOP A;  4AQJ A;  3DY9 A;  1NP8 A;  2LMV A;  1WY9 A;  1CLB A;  2L4I A;  2WOR A;  1DEK A;  2HPS A;  5D3O A;  1TWO A;  2CXJ A;  3O4X A;  3LK0 A;  2QEH A;  4INW A;  1KK7 Y;  1IJ6 A;  1DMO A;  3CR2 A;  3FE8 A;  2FCE A;  1BT6 A;  1F4O A;  4INX A;  1DGU A;  3TUY B;  4I5K A;  4QJ3 B;  4MEW A;  3BJH A;  3B6X A;  1TUJ A;  1NX3 A;  2KQY A;  4MBE A;  1KWO B;  1TNW A;  2JPO A;  2KLE A;  4N5X A;  2M97 A;  3KO0 A;  2Y4Q A;  2JZI A;  2E6W A;  1BR4 B;  1S5G Y;  2AUC A;  3QME A;  1M39 A;  1B1G A;  3NSL A;  3DD4 A;  5GQQ C;  2LUX A;  1DQE A;  3BFH A;  3S0D A;  2PVB A;  1B4C A;  3EK4 A;  2KPH A;  1YUR A;  2CCM A;  1Y1X A;  2I2R E;  1PVA A;  3IF7 A;  1CMF A;  2IS9 A;  3LK1 A;  3AKB A;  2M0R A;  2L0P A;  2K7D A;  1RWY A;  2KFG A;  3B86 A;  3SG2 A;  1GGW A;  1K93 D;  2Y5I A;  2K2F A;  1LIN A;  3PAT A;  3C1V A;  5DKR A;  1B8R A;  3A8R A;  3OB2 B;  1RTP 1;  1W7J B;  4HRE E;  3SG6 A;  1PSR A;  3D75 A;  4PE7 A;  3VRR A;  5KSZ A;  1DJZ A;  2LVJ A;  1AK8 A;  1HQV A;  3RM1 A;  1GGZ A;  1J7R A;  2BNX A;  2M1U A;  1XK4 C;  3TS5 C;  2JXL A;  3V2L A;  1W9Z A;  2LVV A;  1AHR A;  2H61 C;  3ZWH A;  1B9A A;  2OTG C;  2CTN A;  1LA3 A;  1SK6 D;  4YGD B;  1XVJ A;  1BLQ A;  1U5I A;  1LS8 A;  5BPJ A;  1BMO A;  1QXP A;  1KQV A;  1MR8 A;  1JWD A;  4HRH A;  3EKH A;  1TTX A;  1YRT B;  4JD9 A;  1QVI Y;  1LA0 A;  1GJY A;  3TS5 B;  2L51 A;  3PSR A;  3EKJ A;  4C0K A;  1OMV A;  3R72 A;  1IWQ A;  3SS5 A;  4CID A;  3CR5 X;  1DTL A;  2AMI A;  4MRX A;  1OE9 B;  1R6P A;  3O6B A;  1KQM C;  3BYA A;  3IVT A;  3JTD B;  1C3Y A;  1CKK A;  1S6J A;  3OX5 A;  2E30 A;  4JWQ A;  3Q8I A;  3BQ3 A;  2L2E A;  1UHK A;  1SKT A;  2K7B A;  2NZ0 A;  3JVT B;  2JXC A;  4GAO A;  1WRL A;  4IL1 A;  1K2H A;  3SJS A;  1OOI X;  1DJG A;  3NSI A;  1IKU A;  3A4U B;  1WRK A;  1KFX S;  1TIZ A;  2BL0 C;  2M8U A;  3I5I C;  4U8D A;  1EG4 A;  2JT3 A;  4TNC A;  1J7Q A;  2JTZ A;  1DJI A;  3JTD C;  3LLE A;  3PFV A;  3S0F A;  4CPV A;  1DVI A;  3L4L A;  1OZO A;  1SBJ A;  1T14 A;  1KWO C;  3CWG A;  3NSK A;  2LHL A;  2WOS A;  1SPY A;  4YGE B;  1UHN A;  3FE9 A;  2WCF A;  4OR9 B;  1QX2 A;  1W7I B;  4FQT A;  3SIA A;  4ETO A;  1NUB A;  1IQ5 A;  1OW4 A;  1KSO A;  1V1F A;  1WDC C;  2LVK A;  3D73 A;  3EVU A;  5HLV A;  5ER4 X;  2FCD A;  1YVH A;  2R2I A;  3DXL A;  4PAL A;  2NCP A;  1QX5 B;  1S5G Z;  2L98 A;  1OQP A;  1IGV A;  1QS7 A;  1XK4 A;  3DF0 A;  1M46 A;  1DJW A;  3F45 A;  1YUU A;  1KFU S;  3PM8 A;  3PM2 A;  1A03 A;  1Z4H A;  2GTE A;  4PHJ A;  1CFP A;  3GK4 X;  1S1E A;  5AEQ A;  1C7W A;  2ERB A;  5AER A;  1ALV A;  1AJ4 A;  4XYN A;  3I5H C;  4MVF A;  2MBX A;  2JNX A;  2KOT A;  1DEL A;  1JFK A;  4I5N B;  2ZRS A;  3TDZ A;  4L9M A;  2KLD A;  2LUC A;  5JOL A;  1DJX A;  1QIW A;  3WXA A;  3CZ1 A;  2P71 A;  3EVR A;  1ORG A;  1E8A A;  1TCO B;  2I18 A;  3NHT A;  2H61 A;  1YUS A;  1K9U A;  1YR5 A;  1N0Y A;  1EG3 A;  1B8L A;  3VRN A;  4PCW A;  2MRD A;  3AKA A;  2P6B B;  2F3Y A;  3BUO B;  2G2B A;  2F2O A;  2QDI A;  3OHM B;  2KGB C;  2QPT A;  2BEC A;  1WRZ A;  2LP3 A;  2V53 A;  4MZL A;  1QX7 A;  1XA5 A;  4PHN A;  4DS7 A;  1F8H A;  5HL1 A;  4N1F A;  4WQ2 A;  1NPQ A;  3SG7 A;  3D0Y A;  1OSA A;  1AP4 A;  1XO5 A;  2KI6 C;  4Q04 A;  4HSZ A;  1SYM A;  4NDB A;  1OOH A;  2LP2 A;  1XFX O;  4YGA A;  3RZS A;  2FOT A;  2COL B;  1UHI A;  1CMG A;  3GK2 A;  3B88 A;  2WCL A;  1RK9 A;  1CTR A;  3WHT B;  1UWO A;  2BCB A;  1FI5 A;  2SAS A;  4BY4 A;  3TUY C;  5I2O A;  1L7Z A;  2M9G A;  1F71 A;  1AJ5 A;  1NCZ A;  1TN4 A;  2JWW A;  1KFU L;  2LVI A;  2LAP A;  2WCH A;  2AAO A;  3DYE A;  2BE4 A;  2RGI A;  3CS1 A;  2EHB A;  5CSI A;  1ZFS A;  1SR6 B;  1KK7 Z;  1SCM C;  5AAN A;  3SS3 A;  5DKQ A;  1XFU O;  3CZ2 A;  3OB1 B;  3OP0 A;  1WDC B;  2Q91 A;  2BCA A;  1NYA A;  3EG5 B;  4GGF A;  4IJ7 A;  5D7F A;  4R1E A;  1S6I A;  2K7O A;  2JC2 A;  5I8N A;  1PK0 D;  1F54 A;  2KDH A;  3N7H A;  2L5X B;  3SIB A;  4M2O A;  1ZUZ A;  1J1D A;  2LMT A;  3I5G B;  1A75 A;  1WLM A;  3ZNI A;  1C3Z A;  1JF2 A;  2KYC A;  3DVK A;  2BKH B;  1UHH A;  2EC6 C;  2L5Y A;  2MAZ A;  3FWB A;  4GFT A;  1PVB A;  5DKN A;  1OOF A;  4P5O E;  1RFJ A;  1KFX L;  3SS4 A;  1S26 D;  3BFA A;  1DT7 B;  3EVV A;  3H4S E;  3S0G A;  2BBN A;  3PLF B; 
#chains in the Genus database with same CATH homology
 4USL A;  3BXK A;  5FYX A;  1BU3 A;  1XFW O;  4DRW A;  3VRP A;  5CSF A;  3DF0 B;  1FBV A;  1YRU B;  1J1E A;  3KHE A;  1KSM A;  4GGF C;  2LHI A;  1REC A;  1TNQ A;  5HKY A;  4XJK B;  2KBM A;  3RLZ A;  1OMD A;  1NSH A;  2KBI A;  4MZK A;  1YUT A;  4WRI A;  5D69 A;  3WNX B;  1SNL A;  3DVM A;  1IRJ A;  3OX6 A;  1D1O A;  2JOJ A;  3VGO A;  1FPW A;  1JSA A;  1QTX A;  4M2Q A;  3CLN A;  3LL8 B;  3HX4 A;  2KFF A;  1CM4 A;  2LV7 A;  2WCB A;  3I5F B;  3VRQ A;  2OS8 B;  3KF9 A;  4WQ3 A;  1N2D A;  5ER5 A;  2OTG B;  1ZOT B;  4NDD A;  5F6T A;  1EL4 A;  1A75 B;  5G08 A;  4A4C A;  1JFJ A;  2BBM A;  1MXL C;  1QLK A;  4DCK A;  2LMU A;  3CR4 X;  1B7T Y;  1F70 A;  1OOJ A;  1JUO A;  2GGM A;  1YX7 A;  1Y0V H;  2M3W A;  1K90 D;  2K8M B;  3M0W A;  5CSJ A;  3TZ1 A;  2VRG A;  3DVE A;  1Y1U A;  2ZN8 A;  3FS7 A;  1UUR A;  2KI6 D;  2KQ6 A;  2PRU A;  1CLM A;  2D8N A;  2K61 A;  4OVN F;  4FTG A;  4AOM A;  4OCI A;  1JF0 A;  4CFR A;  2I94 A;  3ICB A;  2HQW A;  3TDI A;  2KAV A;  1IQ3 A;  3QRX A;  2MLF C;  1BJF A;  3MSE B;  1KK8 B;  2LE9 B;  1MQ1 A;  2M7N A;  1QLS A;  4PE1 A;  3NXA A;  3E3R A;  5AXI A;  1NX1 A;  3TDU A;  1B8C A;  2KNE A;  2NCO A;  4ORA B;  1KCY A;  2EC6 B;  2FJU B;  4PE0 A;  1L2O B;  1AVS A;  5I2Q A;  1RJV A;  1QAT A;  2M49 B;  1TCF A;  1J55 A;  1UUS A;  1C7V A;  1S6C A;  3AAK A;  1KK8 C;  1R2U A;  1H8B A;  1G4Y R;  2BCX A;  1G8I A;  1K96 A;  1ZAC A;  3GK1 A;  3FWC A;  2ZKM X;  2HF5 A;  1DGV A;  2LCP A;  1OMR A;  1S36 A;  2GGZ A;  4PHM A;  4UPG A;  3PN7 B;  1K9P A;  4ZCV A;  1K8U A;  2K2A A;  2KI4 B;  2OPO A;  1BOD A;  4DUQ A;  1ODB A;  1CDM A;  2KI4 C;  4HRG A;  1Y1A A;  2I7A A;  1B47 A;  4MSP A;  1UHJ A;  3I5H B;  1CNP A;  1EH2 A;  4GNK B;  2HET A;  3I5F C;  4PHK A;  5HYD A;  2LM5 A;  2L4H A;  1BG1 A;  1CFF A;  2Q4U A;  1M31 A;  1PUL A;  2LLT A;  1X02 A;  5KTY A;  2JPT A;  1ZMZ A;  4BY5 A;  1NWD A;  5B8I B;  4C0J A;  2KAY A;  1JBA A;  4MN0 A;  2LLS A;  3BOW B;  5CSN A;  3LCP C;  1FI6 A;  3SG5 A;  3JVT C;  3IQO A;  2ISD A;  2JT0 A;  3O4Y A;  5J3X A;  2LLU A;  2WND A;  3NSO A;  4AQI A;  3D10 A;  1XYD A;  4FQO A;  4YGC B;  2PSR A;  2M7L A;  5I2L A;  2JU0 A;  4P2Y B;  1SCV A;  2BL0 B;  5HLO A;  1QAS A;  5AFP A;  1TNX A;  1MUX A;  1TRF A;  2L50 A;  2MJW B;  4GGN A;  4MZJ A;  4YI8 A;  4YGB B;  4CLN A;  1FF1 A;  4I5J A;  1JC2 A;  4ORC B;  2Y1M A;  1FW4 A;  2LC5 A;  3EK7 A;  2KHN A;  1CB1 A;  2ZND A;  1NX2 A;  2MA2 A;  2JTT A;  1CFD A;  1ALW A;  1MWN A;  2DOQ A;  3EK8 A;  1NX0 A;  1QIV A;  2A4J A;  1QV0 A;  4YI9 A;  1QVI Z;  4D1E A;  3SG3 A;  3CGA A;  2F3Z A;  1DF0 A;  1C07 A;  4ICB A;  4F0Z B;  1PSB A;  1CFC A;  1GQM A;  2BKI B;  3D0Y B;  2WCE A;  1BF5 A;  1DJY A;  2H2K A;  1WLZ A;  2PMY A;  3BUM B;  3FIA A;  4YRU A;  3KEV A;  3PN7 C;  4JQ0 D;  1SRA A;  2ZRT A;  1CDN A;  1EJ3 A;  2O5G A;  1MXE A;  1SL9 A;  3GOF A;  1BOC A;  1NCX A;  2CBL A;  4A4B A;  1HT9 A;  2M29 A;  3IQQ A;  4ORB B;  2GV5 A;  5IBW A;  2CT9 A;  2CNP A;  3AAJ A;  1MHO A;  1PRW A;  1G33 A;  4OKH A;  4N1G A;  3I5I B;  5JJG A;  1NCY A;  1Q80 A;  1V1G A;  3K21 A;  4CFQ A;  1A4P A;  3I5G C;  1U5I B;  1LKJ A;  3BUN B;  5HKW A;  3SG4 A;  3BUX B;  1KQM B;  2JRF A;  2JNF A;  1CDP A;  1J7O A;  2KGR A;  3KPX A;  1OZS A;  5CPV A;  1XFY O;  2BE6 A;  1K95 A;  2JT8 A;  1J7P A;  1M45 A;  4GPL B;  1CLL A;  1DF0 B;  1F55 A;  3PAL A;  1SR6 C;  1B7T Z;  1YX8 A;  2JUL A;  2LNK A;  1F4Q A;  4M2P A;  4GUK A;  2O60 A;  2F33 A;  4PE4 A;  4OV2 A;  2NLN A;  1VRK A;  1SW8 A;  4JPZ B;  1YVL A;  1MF8 B;  1DJH A;  1YTZ C;  2HQ8 A;  4YBH B;  3DVJ A;  2B1U A;  2OS8 C;  2NXQ A;  1PAL A;  3CTN A;  1N65 A;  4NDC A;  5KU1 A;  1H4B A;  1UP5 A;  1SCM B;  2EGD A;  2Y1N A;  4QJ4 B;  1QV1 A;  3O2P A;  2K0J A;  2F2P A;  2ZNE A;  4PDZ A;  3O78 A;  5PAL A;  1XFV O;  3BOW A;  4MRY A;  1SL7 A;  1XFZ O;  2G9B A;  2M1K B;  1M63 B;  1SL8 A;  4MLW A;  1BR1 B;  1IJ5 A;  1CM1 A;  1S3P A;  1QJT A;  1TNP A;  2LAN A;  4DIR A;  1LXF C;  2KYF A;  3HCM A;  5HKZ A;  1A2X A;  1K94 A;  5TNC A;  2ZFD A;  3CZT X;  1L2O C;  1NIW A;  1RRO A;  4C0L A;  2PAS A;  2MLE C;  4I5L B;  2TN4 A;  1SY9 A;  1EXR A;  2QAC A;  3BUW B;  2PAL A;  1A29 A;  2ZN9 A;  2K7C A;  2KAX A;  2SCP A;  4XJK A;  5K89 A;  2MHH A;  4QJ5 B;  4GBA A;  1AUI B;  1IG5 A;  1SMG A;  1LVC D;  1K9K A;  2KSP A;  1CDL A;  4E68 A;  4NQG A;  1Y6W A;  1IH0 A;  3WHU B;  2F8P A;  2KFH A;  2WC8 A;  2JQ6 A;  1TOP A;  4AQJ A;  1NP8 A;  2LMV A;  1WY9 A;  1CLB A;  2L4I A;  2WOR A;  2HPS A;  2CXJ A;  3LK0 A;  1KK7 Y;  1IJ6 A;  1DMO A;  3CR2 A;  2FCE A;  1BT6 A;  1F4O A;  1DGU A;  3TUY B;  4I5K A;  4QJ3 B;  4MEW A;  1NX3 A;  2KQY A;  4MBE A;  1KWO B;  1TNW A;  4N5X A;  2M97 A;  3KO0 A;  2Y4Q A;  2JZI A;  2E6W A;  1BR4 B;  1S5G Y;  2AUC A;  1B1G A;  1M39 A;  3NSL A;  3DD4 A;  5GQQ C;  2LUX A;  2PVB A;  1B4C A;  3EK4 A;  1YUR A;  2CCM A;  1Y1X A;  2I2R E;  1PVA A;  3IF7 A;  1CMF A;  2IS9 A;  3LK1 A;  3AKB A;  2M0R A;  2L0P A;  2K7D A;  1RWY A;  2KFG A;  3SG2 A;  1GGW A;  1K93 D;  2Y5I A;  2K2F A;  1LIN A;  3PAT A;  3C1V A;  5DKR A;  1B8R A;  3A8R A;  3OB2 B;  1RTP 1;  1W7J B;  4HRE E;  3SG6 A;  1PSR A;  4PE7 A;  3VRR A;  5KSZ A;  1DJZ A;  2LVJ A;  1AK8 A;  1HQV A;  3RM1 A;  1GGZ A;  1J7R A;  2M1U A;  1XK4 C;  3TS5 C;  2JXL A;  2LVV A;  1AHR A;  2H61 C;  3ZWH A;  1B9A A;  2OTG C;  2CTN A;  1LA3 A;  1SK6 D;  4YGD B;  1XVJ A;  1BLQ A;  1U5I A;  5BPJ A;  1BMO A;  1QXP A;  1KQV A;  1MR8 A;  1JWD A;  4HRH A;  3EKH A;  1TTX A;  1YRT B;  1QVI Y;  1LA0 A;  1GJY A;  3TS5 B;  2L51 A;  3PSR A;  3EKJ A;  4C0K A;  1OMV A;  1IWQ A;  4CID A;  3CR5 X;  1DTL A;  2AMI A;  4MRX A;  1OE9 B;  1R6P A;  3O6B A;  1KQM C;  3BYA A;  3JTD B;  1CKK A;  1S6J A;  3OX5 A;  2E30 A;  4JWQ A;  3BQ3 A;  2L2E A;  1UHK A;  1SKT A;  2K7B A;  2NZ0 A;  3JVT B;  2JXC A;  4GAO A;  1WRL A;  4IL1 A;  1K2H A;  3SJS A;  1DJG A;  3NSI A;  1IKU A;  3A4U B;  1WRK A;  1KFX S;  1TIZ A;  2BL0 C;  2M8U A;  3I5I C;  4U8D A;  1EG4 A;  2JT3 A;  4TNC A;  1J7Q A;  2JTZ A;  1DJI A;  3JTD C;  3LLE A;  3PFV A;  4CPV A;  1DVI A;  1OZO A;  1SBJ A;  1KWO C;  3CWG A;  3NSK A;  2LHL A;  2WOS A;  1SPY A;  4YGE B;  1UHN A;  2WCF A;  4OR9 B;  1QX2 A;  1W7I B;  3SIA A;  4ETO A;  1NUB A;  1IQ5 A;  3EVU A;  1KSO A;  1V1F A;  1WDC C;  2LVK A;  5HLV A;  5ER4 X;  2FCD A;  1YVH A;  2R2I A;  4PAL A;  2NCP A;  1QX5 B;  1S5G Z;  2L98 A;  1OQP A;  1IGV A;  1QS7 A;  1XK4 A;  3DF0 A;  1M46 A;  1DJW A;  3F45 A;  1YUU A;  1KFU S;  3PM8 A;  1A03 A;  4PHJ A;  1CFP A;  3GK4 X;  1S1E A;  5AEQ A;  1C7W A;  5AER A;  1ALV A;  1AJ4 A;  4XYN A;  3I5H C;  4MVF A;  2MBX A;  2JNX A;  2KOT A;  1JFK A;  4I5N B;  2ZRS A;  3TDZ A;  4L9M A;  2LUC A;  5JOL A;  1DJX A;  1QIW A;  3WXA A;  3EVR A;  1E8A A;  1TCO B;  2I18 A;  2H61 A;  1YUS A;  1K9U A;  1YR5 A;  1N0Y A;  1EG3 A;  1B8L A;  3VRN A;  4PCW A;  2MRD A;  3AKA A;  2P6B B;  2F3Y A;  3BUO B;  2G2B A;  2F2O A;  3OHM B;  2KGB C;  2QPT A;  2BEC A;  1WRZ A;  2LP3 A;  2V53 A;  4MZL A;  1QX7 A;  1XA5 A;  4PHN A;  4DS7 A;  1F8H A;  4N1F A;  4WQ2 A;  1NPQ A;  3SG7 A;  3D0Y A;  1OSA A;  1AP4 A;  1XO5 A;  2KI6 C;  4Q04 A;  4HSZ A;  1SYM A;  4NDB A;  2LP2 A;  4YGA A;  1XFX O;  2FOT A;  2COL B;  1UHI A;  1CMG A;  3GK2 A;  1RK9 A;  1CTR A;  3WHT B;  1UWO A;  2BCB A;  1FI5 A;  2SAS A;  4BY4 A;  3TUY C;  5I2O A;  1L7Z A;  2M9G A;  1F71 A;  1AJ5 A;  1NCZ A;  1TN4 A;  2JWW A;  1KFU L;  2LVI A;  2LAP A;  2AAO A;  2BE4 A;  2RGI A;  3CS1 A;  2EHB A;  5CSI A;  1ZFS A;  1SR6 B;  1KK7 Z;  1SCM C;  5AAN A;  5DKQ A;  1XFU O;  3OB1 B;  3OP0 A;  1WDC B;  2Q91 A;  2BCA A;  1NYA A;  4GGF A;  5D7F A;  4R1E A;  1S6I A;  2K7O A;  2JC2 A;  5I8N A;  1PK0 D;  1F54 A;  2KDH A;  2L5X B;  3SIB A;  4M2O A;  1ZUZ A;  1J1D A;  2LMT A;  3I5G B;  1A75 A;  1WLM A;  3ZNI A;  1JF2 A;  2KYC A;  4ZCU A;  3DVK A;  2BKH B;  1UHH A;  2EC6 C;  2MAZ A;  3FWB A;  4GFT A;  5DKN A;  1PVB A;  3VRO A;  4P5O E;  1RFJ A;  1KFX L;  1S26 D;  1DT7 B;  3EVV A;  3H4S E;  2BBN A;  3PLF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...