1B7TY

Myosin digested by papain
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
138
structure length
138
Chain Sequence
b'PQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYOSIN HEAVY CHAIN
publication title Atomic structure of scallop myosin subfragment S1 complexed with MgADP: a novel conformation of the myosin head.
pubmed doi rcsb
molecule tags Myosin
total genus 39
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 1999-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1b7tY01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1b7tY02
1CMGA 1ZUZA 5F6TA 1F71A 1K9PA 2LVIA 2Y5IA 1K2HA 1CB1A 1ODBA 2KYCA 3I5FB 3OP0A 3TZ1A 1R2UA 1V1GA 2GGZA 2LMVA 2KFHA 3AAJA 4PE4A 3I5GC 1JF2A 2F8PA 4MVFA 2LM5A 2BKIB 3CWGA 4NDDA 4DRWA 1K96A 3D0YA 1B4CA 3TS5C 2ZN8A 2BE6A 3OX6A 2B1UA 3RLZA 1OMDA 1S6IA 4ZCVA 1UHNA 1XYDA 2PVBA 1VRKA 4WQ3A 5CSNA 3IQQA 1SCVA 3C1VA 3JVTB 2BL0B 2H61A 3EKHA 1DF0B 5G08A 1RECA 4PALA 1UP5A 3ZWHA 4AQIA 1KK7Y 2L98A 1UHHA 2V53A 2CBLA 2BCAA 1K8UA 4I5KA 5ER4X 5B8IB 1YTZC 2FCDA 2KQYA 1IJ6A 1A75A 2L2EA 3CS1A 4NDCA 2M0RA 1EG4A 2WCFA 4I5JA 1Y6WA 1DTLA 2H61C 2ISDA 1YURA 2AUCA 3VROA 3PN7C 4ZCUA 3BOWA 3KPXA 1J55A 1L2OB 3CR4X 4CLNA 3KF9A 3EK4A 5DKRA 3EK8A 4OVNF 1CFDA 2KAVA 1AHRA 2LUCA 2HQWA 2NCPA 3LL8B 1MF8B 2JTZA 2LMTA 4PE7A 1AJ5A 2LMUA 3GK4X 1XO5A 5D7FA 1YVLA 2LC5A 4UPGA 2OS8B 4ORBB 4HSZA 1F4QA 2ZRTA 3ICBA 3SG3A 1CDNA 2M7NA 3EK7A 1KQMB 1TN4A 2JT3A 1K90D 1BU3A 4MSPA 2PSRA 2M3WA 3EVUA 4HRGA 1G33A 2KOTA 4DS7A 1C7WA 2JPTA 3D10A 3VRQA 5PALA 1DVIA 2KI4C 2O5GA 1YUUA 1EH2A 1AUIB 1S6CA 1SKTA 1UHKA 3A8RA 1FI6A 4MZJA 2RGIA 2FCEA 4MN0A 2FOTA 1FI5A 4QJ3B 1QLSA 2OTGB 3I5GB 1MWNA 1G4YR 3TUYC 2G2BA 2JULA 5HLOA 1AK8A 4GGNA 2BE4A 4R1EA 3SG2A 2CCMA 3VGOA 2EGDA 1NCXA 3BYAA 1BT6A 2L5XB 3NSOA 1EL4A 1AVSA 1JFKA 1KQVA 1YRTB 4DCKA 2BCXA 3PFVA 1DGUA 5DKQA 4YGDB 1QX5B 5HKWA 3PALA 3PATA 1B47A 2K8MB 2BCBA 1ZACA 3GK1A 4P5OE 1LA3A 2LANA 2ZRSA 4PHNA 1YX8A 2CXJA 2LLSA 3VRNA 2ZFDA 1NPQA 2M8UA 4PE1A 2LAPA 1NSHA 2I18A 2LCPA 3NSIA 5HKYA 2F33A 1SR6C 3SG7A 3TDIA 4GPLB 2K7DA 2M97A 1SY9A 1IGVA 1MHOA 2ZKMX 1QJTA 2LHIA 1SBJA 1LKJA 2F2PA 4OKHA 4E68A 2JNFA 1NX3A 2CT9A 4YRUA 1BLQA 1ZMZA 5FYXA 1QXPA 1PVBA 1BR1B 1TNWA 2MA2A 4CIDA 5BPJA 2HPSA 1QATA 3I5IB 1J1EA 1XFWO 2L0PA 2R2IA 1S26D 2BBMA 2JOJA 2GGMA 2WCEA 3JTDC 1FPWA 1C7VA 1QV0A 1QS7A 2BBNA 2LUXA 2K61A 3MSEB 1Y1XA 1K93D 1CKKA 2I94A 1MR8A 1MXLC 2QPTA 1F8HA 4QJ5B 3EVVA 5TNCA 2I2RE 1KSMA 1QTXA 4N1GA 1F70A 2BKHB 1XVJA 1ALVA 4XJKB 1J7RA 3SG5A 5HYDA 3O6BA 3SG6A 1KSOA 2P6BB 2SCPA 1IH0A 4N1FA 1QLKA 3LK0A 2WORA 3DVEA 4D1EA 1SCMB 1RK9A 2H2KA 1NP8A 1YUTA 4I5NB 4MBEA 4YGBB 1IKUA 1DJGA 3LCPC 1JC2A 2M29A 3AKBA 3OB2B 3I5HB 3WHUB 1BOCA 1L7ZA 3HX4A 1A03A 4JWQA 1XK4A 3VRRA 3DF0B 1YX7A 1QIWA 5AEQA 3WXAA 1BR4B 4MLWA 3M0WA 5I2OA 3A4UB 4GUKA 4TNCA 2JT0A 1TCFA 5K89A 1OMRA 1Y1AA 1XFXO 3NSLA 3IQOA 3SJSA 1CM4A 1PULA 3IF7A 2WCBA 3OHMB 1LINA 2FJUB 2NLNA 2VRGA 2JT8A 1KK8B 1UWOA 1QVIZ 1XK4C 2LLUA 4C0JA 1OSAA 4DIRA 3FS7A 1SMGA 1NX1A 2EHBA 1KFUL 2K7OA 2LNKA 1H8BA 1TRFA 4YI9A 1RROA 1TOPA 2L4HA 3BUOB 4YGEB 1MXEA 1QASA 5AFPA 3QRXA 1CM1A 2KGRA 4AOMA 2A4JA 2ZNDA 1JWDA 1K9UA 1F55A 3SIBA 3FWBA 1N65A 1LXFC 1NCZA 1WDCC 1B7TZ 2NZ0A 5HKZA 1HQVA 3OX5A 2JQ6A 3K21A 1BODA 1TNQA 2MRDA 5KU1A 3DD4A 2JTTA 4L9MA 1KWOC 1HT9A 3DVKA 1DMOA 1H4BA 2D8NA 1EG3A 3H4SE 1IQ3A 1RJVA 1C07A 3TDUA 3I5FC 3PLFB 1PSBA 1MQ1A 3NSKA 2M7LA 3O2PA 2MBXA 3SG4A 1SW8A 2KGBC 1M63B 2LLTA 5ER5A 5CSJA 1NUBA 2KAYA 1B8LA 1OZSA 1DF0A 3TS5B 1ALWA 1CDPA 2JU0A 4USLA 1CFFA 4GBAA 1QVIY 3KHEA 4Q04A 5CSFA 1UHIA 1DGVA 2WOSA 3CGAA 1FF1A 3FWCA 4MEWA 2JWWA 1U5IB 1CLLA 2LE9B 1OE9B 2K7BA 2PALA 4FQOA 4PHKA 4ETOA 1WRLA 2KBMA 2LHLA 1TNPA 2EC6C 2F2OA 4N5XA 1QX7A 2L51A 1XA5A 3BQ3A 2BL0C 3JVTC 1JF0A 4PE0A 4BY4A 1YR5A 1B7TY 1GJYA 2Q4UA 2KHNA 1JBAA 3FIAA 2K7CA 4AQJA 1M46A 3BUMB 1SPYA 2KQ6A 1JUOA 1CFPA 2KSPA 2L50A 4F0ZB 1SYMA 1MUXA 2LVVA 4OV2A 2HQ8A 4FTGA 3EVRA 3PN7B 1CTRA 1UUSA 3HCMA 1DJXA 4WRIA 2G9BA 1CNPA 2HETA 1B8CA 3O78A 3F45A 5HLVA 1L2OC 1Y0VH 4NDBA 1BG1A 5I2QA 4GGFA 4P2YB 1K94A 1S5GZ 3KEVA 1A75B 2L4IA 4BY5A 1DJIA 2KDHA 5JJGA 2E6WA 1W7IB 1KFUS 1A4PA 1CLBA 3BOWB 1SL8A 1IJ5A 2K2AA 1KQMC 1S1EA 4MRXA 4A4CA 1WLMA 1B9AA 1KFXL 1UURA 2JNXA 3PM8A 5I8NA 1OZOA 2KI4B 2KFGA 4GGFC 1B8RA 2F3YA 4JQ0D 4MZKA 1KWOB 2E30A 4C0LA 1AJ4A 1R6PA 1CDLA 1IRJA 2M1KB 3BUNB 2PMYA 3KO0A 2KAXA 2LV7A 1FBVA 2SASA 3CZTX 1BF5A 1PVAA 1FW4A 4CFRA 2WNDA 4DUQA 2CNPA 4JPZB 1N2DA 4ORCB 4OCIA 3TUYB 5CPVA 2OTGC 1U5IA 2LVKA 5KTYA 1CLMA 3AAKA 4CPVA 4GNKB 1M45A 4GFTA 2KI6C 2Y1MA 4ICBA 2O60A 2MLFC 1NWDA 3DVJA 1CDMA 1NX0A 2KI6D 1DJYA 2MLEC 1SRAA 1RFJA 2Q91A 4PCWA 2Y4QA 1M39A 1WRZA 2KYFA 1S5GY 5CSIA 4U8DA 4OR9B 3SIAA 1EJ3A 2EC6B 1PK0D 2K2FA 5J3XA 3ZNIA 1Y1UA 2JRFA 3BXKA 1PSRA 4YGAA 1SK6D 3CTNA 1CMFA 2JC2A 1K95A 4C0KA 3GOFA 1SR6B 1V1FA 1ZFSA 3O4YA 4ORAB 1BJFA 2JXCA 4YBHB 1YRUB 1XFYO 3LK1A 3GK2A 4GAOA 2F3ZA 1TNXA 1ZOTB 1M31A 1QX2A 1F4OA 5JOLA 1IQ5A 1XFZO 4HREE 2PASA 1B1GA 1GGWA 2WC8A 1A29A 4PDZA 4M2PA 1N0YA 1NX2A 1NYAA 4XJKA 1DT7B 2LP3A 4M2OA 1GQMA 3I5IC 1J1DA 2I7AA 3OB1B 3JTDB 1XFUO 2ZNEA 1D1OA 1OQPA 3CR5X 2ZN9A 1SNLA 1RWYA 3BUWB 3VRPA 2HF5A 3TDZA 5I2LA 1QV1A 2JZIA 2KBIA 3CLNA 1J7OA 1IWQA 1E8AA 1RTP1 2CTNA 1SL7A 1LA0A 3LLEA 4CFQA 1WRKA 2NCOA 1DJHA 1G8IA 4YI8A 1DJZA 1Q80A 2M9GA 1UHJA 1W7JB 3RM1A 3DF0A 2GV5A 1KFXS 1BMOA 2BECA 3WHTB 1WY9A 2OPOA 2MAZA 3CR2A 4IL1A 1YVHA 1SCMC 3DVMA 1F54A 2KFFA 3E3RA 3D0YB 1SL9A 1CFCA 1X02A 1AP4A 2PRUA 5D69A 1OMVA 1KCYA 2DOQA 3I5HC 1JFJA 4HRHA 1TCOB 2KNEA 4MRYA 5IBWA 1GGZA 2AMIA 1DJWA 1NCYA 2NXQA 1YUSA 3NXAA 1TTXA 2MJWB 1K9KA 4XYNA 5AERA 1IG5A 1PRWA 2LVJA 2M49B 2JXLA 2TN4A 1S36A 4M2QA 1TIZA 4YGCB 1S3PA 5AANA 1KK8C 3EKJA 1S6JA 4MZLA 1EXRA 1J7PA 1OOJA 1A2XA 2LP2A 2QACA 1NIWA 1XFVO 2MHHA 4PHMA 5AXIA 2OS8C 4WQ2A 4I5LB 4A4BA 2COLB 1LVCD 1WDCB 2K0JA 5DKNA 4PHJA 4NQGA 1KK7Z 3PSRA 2Y1NA 3BUXB 1QIVA 5KSZA 3AKAA 4QJ4B 2AAOA 3WNXB 1J7QA 5GQQC 1PALA 2M1UA 2IS9A 1WLZA 1JSAA
chains in the Genus database with same CATH superfamily
1CMGA 1ZUZA 5F6TA 1F71A 1K9PA 2LVIA 2Y5IA 1K2HA 1CB1A 1ODBA 2KYCA 3I5FB 3OP0A 3TZ1A 1R2UA 1V1GA 2GGZA 2LMVA 2KFHA 3AAJA 4PE4A 3I5GC 1OW4A 1JF2A 2F8PA 4MVFA 2LM5A 3Q8IA 2BKIB 3CWGA 4NDDA 4DRWA 1K96A 3D0YA 1B4CA 3TS5C 3CABA 1DELA 2ZN8A 2BE6A 3OX6A 2B1UA 3RLZA 1OMDA 1S6IA 4ZCVA 1UHNA 1XYDA 2PVBA 1VRKA 2FJYA 4WQ3A 5CSNA 3IQQA 1SCVA 3C1VA 3JVTB 3S0BA 2BL0B 2H61A 3EKHA 1DF0B 3S0AA 5G08A 1RECA 4PALA 1UP5A 3ZWHA 3K1EA 4AQIA 1KK7Y 2L98A 1UHHA 2V53A 2CBLA 4OZDA 2BCAA 1K8UA 2H8VA 4I5KA 5ER4X 5B8IB 1YTZC 2FCDA 2KQYA 1IJ6A 5D3OA 1A75A 2L2EA 3CS1A 4NDCA 2M0RA 1EG4A 2WCFA 3BJHA 2PQLA 4I5JA 1Y6WA 1DTLA 2H61C 2ISDA 1YURA 5I94A 2AUCA 3VROA 3PN7C 4ZCUA 3BOWA 3KPXA 1J55A 1L2OB 3CR4X 2WCMA 4CLNA 3KF9A 3RZSA 3EK4A 5DKRA 3EK8A 3DZTA 4OVNF 1CFDA 2KAVA 1AHRA 2LUCA 2HQWA 2NCPA 3LL8B 3SS5A 1MF8B 2JTZA 2LMTA 4PE7A 1AJ5A 2LMUA 3GK4X 1XO5A 5D7FA 1YVLA 2LC5A 3L4AA 4UPGA 2OS8B 4ORBB 4HSZA 1F4QA 2ZRTA 3ICBA 3SG3A 1CDNA 3SS3A 2M7NA 3EK7A 1KQMB 1TN4A 2JT3A 1K90D 1BU3A 4MSPA 2PSRA 2M3WA 3EVUA 4HRGA 1G33A 2KOTA 3N7HA 1C7WA 2JPTA 3D10A 3VRQA 4DS7A 5PALA 4INXA 1DVIA 2KI4C 2O5GA 1YUUA 1EH2A 1AUIB 1S6CA 1SKTA 1UHKA 3A8RA 1FI6A 5FI2A 4MZJA 2RGIA 2FCEA 4MN0A 2FOTA 1FI5A 4QJ3B 1QLSA 2OTGB 3I5GB 1MWNA 1G4YR 3TUYC 2G2BA 2JULA 5HLOA 1AK8A 4GGNA 2BE4A 4R1EA 3SG2A 2CCMA 3R72A 5I2OA 3VGOA 2EGDA 1NCXA 2KLDA 3BYAA 1BT6A 2L5XB 3NSOA 3IVTA 1EL4A 1AVSA 1JFKA 1KQVA 1YRTB 4DCKA 2BCXA 3PFVA 1DGUA 5DKQA 4YGDB 3CDNA 1QX5B 5HKWA 3PALA 3PATA 1B47A 2K8MB 2BCBA 1ZACA 3GK1A 4P5OE 1LA3A 2LANA 2ZRSA 4PHNA 1YX8A 2CXJA 2LLSA 3VRNA 2ZFDA 3BFBA 1NPQA 2M8UA 4PE1A 2LAPA 1DC1A 1NSHA 2I18A 2LCPA 3NSIA 5HKYA 2F33A 1SR6C 3SG7A 3TDIA 5FI6A 1Z2CB 2K7DA 4GPLB 2M97A 1SY9A 3L47A 1IGVA 1MHOA 2ZKMX 1QJTA 2LHIA 3S0DA 1SBJA 1C3YA 1LKJA 2F2PA 4OKHA 4E68A 2JNFA 1NX3A 2CT9A 4YRUA 1BLQA 1ZMZA 5FYXA 3DY9A 1QXPA 1PVBA 1BR1B 1TNWA 2MA2A 4CIDA 5BPJA 2HPSA 1QATA 3I5IB 1J1EA 1XFWO 2L0PA 2L2CA 1Z4HA 2R2IA 2GTEA 1S26D 2BBMA 1ORGA 2JOJA 2GGMA 2WCEA 3JTDC 1FPWA 1C7VA 1QV0A 1QS7A 2BBNA 2LUXA 2K61A 3MSEB 1Y1XA 1K93D 1CKKA 2I94A 1MR8A 1MXLC 2QPTA 1F8HA 1OOFA 1SSEB 4QJ5B 3EVVA 3FE9A 5TNCA 2I2RE 1KSMA 1QTXA 3OBVA 4N1GA 1F70A 2BKHB 1XVJA 1ALVA 4XJKB 3NHIA 3BFHA 1J7RA 3SG5A 5HYDA 3O6BA 3SG6A 2BNXA 1KSOA 2P6BB 2SCPA 1IH0A 4N1FA 5FI7A 2L5YA 1QLKA 2PYQA 3LK0A 2WORA 3DVEA 3BFAA 4D1EA 1SCMB 1RK9A 2H2KA 1NP8A 1YUTA 4I5NB 4MBEA 4YGBB 1IKUA 1DJGA 3LCPC 1JC2A 2M29A 3AKBA 3OB2B 3I5HB 3WHUB 1BOCA 1L7ZA 3HX4A 1A03A 4JWQA 1XK4A 3VRRA 3EG5B 3DF0B 3QMEA 1YX7A 1QIWA 5AEQA 3WXAA 1BR4B 4MLWA 3B6XA 2WCKA 3A4UB 3M0WA 4GUKA 4TNCA 2JT0A 1TCFA 5EL2A 1OMRA 5K89A 1Y1AA 1XFXO 3NSLA 3IQOA 3SJSA 1CM4A 1PULA 3IF7A 3FE8A 3PJIA 2WCBA 3OHMB 1LINA 2FJUB 3O4XA 3UO9A 2NLNA 2VRGA 2JT8A 3CZ2A 1KK8B 1P28A 1UWOA 1QVIZ 1XK4C 2LLUA 4C0JA 1OSAA 4DIRA 3FS7A 1SMGA 1NX1A 2EHBA 1KFUL 2K7OA 2LNKA 3CZ1A 1H8BA 1TRFA 4YI9A 1RROA 1TOPA 2L4HA 3BUOB 1QWVA 4YGEB 1MXEA 1QASA 5AFPA 3QRXA 1XFRA 1CM1A 2KGRA 4AOMA 2A4JA 2P70A 2ZNDA 1K9UA 1JWDA 1F55A 2WCHA 3SIBA 3FWBA 1N65A 1LXFC 1NCZA 1WDCC 1B7TZ 1LS8A 2NZ0A 2ERBA 2P71A 1HQVA 5HKZA 3OX5A 2JQ6A 3K21A 1BODA 1TNQA 2MRDA 5KU1A 3DD4A 2JTTA 4L9MA 1KWOC 1HT9A 3DVKA 4JD9A 1DMOA 1H4BA 2D8NA 1EG3A 3H4SE 1IQ3A 4JKTA 1RJVA 1C07A 3TDUA 3I5FC 3PLFB 1C3ZA 1PSBA 1MQ1A 3NSKA 3FE6A 2M7LA 3O2PA 2MBXA 3SG4A 1SW8A 2QEBA 2KGBC 4F7FA 1M63B 2LLTA 5ER5A 5CSJA 1NUBA 2KAYA 2JPOA 1B8LA 1OZSA 1DF0A 3TS5B 3DXLA 1ALWA 1CDPA 3R1OA 2JU0A 4USLA 1CFFA 4GBAA 1QVIY 3KHEA 4Q04A 5CSFA 1UHIA 1DGVA 2WOSA 3B87A 3CGAA 4FQTA 1FF1A 3FWCA 4MEWA 2JWWA 1U5IB 1CLLA 2WC6A 2LE9B 1OE9B 2K7BA 2PALA 4FQOA 4PHKA 4ETOA 1WRLA 2KBMA 2LHLA 1TNPA 2EC6C 2F2OA 4N5XA 1QX7A 2L51A 1XA5A 3B88A 2BL0C 3BQ3A 1JF0A 3JVTC 1DQEA 4PE0A 4BY4A 1YR5A 1B7TY 1GJYA 2Q4UA 2KHNA 1JBAA 3FIAA 2K7CA 4AQJA 1M46A 3BUMB 1SPYA 2KQ6A 1JUOA 1CFPA 5HL1A 2KSPA 2L50A 4F0ZB 1SYMA 1MUXA 2QEOA 2LVVA 4OV2A 2HQ8A 2QEVA 4FTGA 3EVRA 3V2LA 3PN7B 1CTRA 1UUSA 3HCMA 1DJXA 4WRIA 2G9BA 1CNPA 2HETA 1B8CA 3CYZA 3O78A 3F45A 1W9ZA 1L2OC 1Y0VH 4NDBA 5HLVA 1BG1A 3PM2A 5I2QA 4GGFA 4P2YB 1K94A 1S5GZ 3KEVA 1A75B 2L4IA 4BY5A 1DJIA 1OOGA 2KDHA 5JJGA 2E6WA 1W7IB 1KFUS 3D73A 1A4PA 1CLBA 3BOWB 3UNWA 1SL8A 1IJ5A 2K2AA 1KQMC 1S1EA 3D75A 4MRXA 4A4CA 1WLMA 1B9AA 1KFXL 2KPHA 1UURA 2JNXA 3PM8A 5I8NA 1OZOA 2KI4B 2KFGA 4GGFC 1B8RA 2F3YA 4JQ0D 4MZKA 1KWOB 2E30A 3B7AA 3VB1A 1AJ4A 1R6PA 1CDLA 1IRJA 2M1KB 3BUNB 2PMYA 3KO0A 2KAXA 2LV7A 1FBVA 2SASA 3CZTX 1BF5A 3NGVA 1PVAA 1FW4A 2WCJA 4CFRA 2WNDA 4DUQA 2CNPA 4JPZB 1N2DA 4ORCB 4OCIA 3TUYB 5CPVA 2OTGC 1U5IA 2LVKA 5KTYA 1CLMA 3AAKA 4CPVA 1OOIX 4INWA 4GNKB 1M45A 4GFTA 3S0GA 4KYNA 2KI6C 2Y1MA 4ICBA 2O60A 2MLFC 1NWDA 3DVJA 1CDMA 1NX0A 2KI6D 4PT1A 1DJYA 2MLEC 1SRAA 1DEKA 1RFJA 2Q91A 3DYEA 2Y4QA 4IJ7A 1M39A 1WRZA 4PCWA 2KYFA 1S5GY 5CSIA 2K60A 4U8DA 4OR9B 3SIAA 1EJ3A 2EC6B 1PK0D 3D78A 2K2FA 5J3XA 2QDIA 1Y1UA 3ZNIA 2JRFA 3BXKA 1PSRA 4YGAA 1SK6D 3CTNA 1CMFA 1TWOA 2JC2A 1K95A 4C0KA 3GOFA 1SR6B 1V1FA 1ZFSA 3O4YA 4ORAB 1BJFA 2BAPA 2JXCA 4YBHB 1YRUB 1XFYO 3LK1A 3GK2A 4GAOA 2F3ZA 1TNXA 1ZOTB 1M31A 3R1PA 1QX2A 1F4OA 5JOLA 1IQ5A 1XFZO 3D76A 4HREE 2PASA 1B1GA 1GGWA 2WC8A 1A29A 4PDZA 4M2PA 1N0YA 1NX2A 1NYAA 4XJKA 1DT7B 2LP3A 4M2OA 1GQMA 3I5IC 1J1DA 2I7AA 3OB1B 1T14A 3JTDB 1XFUO 2ZNEA 1D1OA 1OQPA 3CR5X 2ZN9A 1SNLA 1RWYA 3BUWB 3VRPA 2HF5A 3TDZA 5I2LA 1QV1A 2JZIA 2KBIA 3CLNA 1J7OA 3NHTA 1IWQA 1E8AA 1RTP1 2CTNA 1SL7A 1LA0A 3LLEA 4CFQA 1WRKA 2NCOA 1DJHA 1G8IA 4YI8A 1DJZA 1Q80A 2KLEA 2M9GA 1UHJA 1W7JB 3RM1A 3DF0A 2GV5A 1KFXS 1BMOA 2BECA 3WHTB 1IIOA 1WY9A 2OPOA 2MAZA 3CR2A 3L4LA 4IL1A 2WCLA 1TUJA 1YVHA 1SCMC 3DVMA 1F54A 2KFFA 3E3RA 3D0YB 1SL9A 1CFCA 1X02A 1AP4A 2PRUA 5D69A 1OMVA 1KCYA 2DOQA 3I5HC 1JFJA 4HRHA 1TCOB 2KNEA 4MRYA 5IBWA 1GGZA 2AMIA 1DJWA 1NCYA 2NXQA 1YUSA 1GM0A 3CZ0A 3NXAA 5DICA 1TTXA 2MJWB 3D77A 2YGUA 1K9KA 2WC5A 3B86A 4XYNA 5AERA 1IG5A 1PRWA 2LVJA 2M49B 2JXLA 2TN4A 3SS4A 1S36A 4M2QA 3D74A 1TIZA 4YGCB 3R1VA 3S0FA 1S3PA 5AANA 1KK8C 3EKJA 1S6JA 4MZLA 1EXRA 1J7PA 1OOJA 1A2XA 4C0LA 3S0EA 2LP2A 2QACA 1NIWA 1XFVO 2MHHA 4PHMA 5AXIA 2OS8C 4WQ2A 4I5LB 4A4BA 2QEHA 2COLB 1LVCD 1WDCB 2K0JA 5DKNA 1OOHA 4PHJA 4NQGA 1KK7Z 3PSRA 2Y1NA 3OGNA 3BUXB 1QIVA 5KSZA 3AKAA 1TUZA 4QJ4B 2AAOA 3WNXB 1J7QA 5GQQC 1PALA 2M1UA 2IS9A 1WLZA 1JSAA
chains in the Genus database with same CATH topology
1CMGA 1ZUZA 5F6TA 1F71A 1K9PA 2LVIA 2Y5IA 1K2HA 1CB1A 1ODBA 2KYCA 3I5FB 3OP0A 3TZ1A 1R2UA 1V1GA 2GGZA 2LMVA 2KFHA 3AAJA 4PE4A 3I5GC 1JF2A 2F8PA 4MVFA 2LM5A 2BKIB 3CWGA 4NDDA 4DRWA 1K96A 3D0YA 1B4CA 3TS5C 2ZN8A 2BE6A 3OX6A 2B1UA 3RLZA 1OMDA 1S6IA 4ZCVA 1UHNA 1XYDA 2PVBA 1VRKA 4WQ3A 5CSNA 3IQQA 1SCVA 3C1VA 3JVTB 2BL0B 2H61A 3EKHA 1DF0B 5G08A 1RECA 4PALA 1UP5A 3ZWHA 4AQIA 1KK7Y 2L98A 1UHHA 2V53A 2CBLA 2BCAA 1K8UA 4I5KA 5ER4X 5B8IB 1YTZC 2FCDA 2KQYA 1IJ6A 1A75A 2L2EA 3CS1A 4NDCA 2M0RA 1EG4A 2WCFA 4I5JA 1Y6WA 1DTLA 2H61C 2ISDA 1YURA 2AUCA 3VROA 3PN7C 4ZCUA 3BOWA 3KPXA 1J55A 1L2OB 3CR4X 4CLNA 3KF9A 3EK4A 5DKRA 3EK8A 4OVNF 1CFDA 2KAVA 1AHRA 2LUCA 2HQWA 2NCPA 3LL8B 1MF8B 2JTZA 2LMTA 4PE7A 1AJ5A 2LMUA 3GK4X 1XO5A 5D7FA 1YVLA 2LC5A 4UPGA 2OS8B 4ORBB 4HSZA 1F4QA 2ZRTA 3ICBA 3SG3A 1CDNA 2M7NA 3EK7A 1KQMB 1TN4A 2JT3A 1K90D 1BU3A 4MSPA 2PSRA 2M3WA 3EVUA 4HRGA 1G33A 2KOTA 4DS7A 1C7WA 2JPTA 3D10A 3VRQA 5PALA 1DVIA 2KI4C 2O5GA 1YUUA 1EH2A 1AUIB 1S6CA 1SKTA 1UHKA 3A8RA 1FI6A 4MZJA 2RGIA 2FCEA 4MN0A 2FOTA 1FI5A 4QJ3B 1QLSA 2OTGB 3I5GB 1MWNA 1G4YR 3TUYC 2G2BA 2JULA 5HLOA 1AK8A 4GGNA 2BE4A 4R1EA 3SG2A 2CCMA 3VGOA 2EGDA 1NCXA 3BYAA 1BT6A 2L5XB 3NSOA 1EL4A 1AVSA 1JFKA 1KQVA 1YRTB 4DCKA 2BCXA 3PFVA 1DGUA 5DKQA 4YGDB 1QX5B 5HKWA 3PALA 3PATA 1B47A 2K8MB 2BCBA 1ZACA 3GK1A 4P5OE 1LA3A 2LANA 2ZRSA 4PHNA 1YX8A 2CXJA 2LLSA 3VRNA 2ZFDA 1NPQA 2M8UA 4PE1A 2LAPA 1NSHA 2I18A 2LCPA 3NSIA 5HKYA 2F33A 1SR6C 3SG7A 3TDIA 4GPLB 2K7DA 2M97A 1SY9A 1IGVA 1MHOA 2ZKMX 1QJTA 2LHIA 1SBJA 1LKJA 2F2PA 4OKHA 4E68A 2JNFA 1NX3A 2CT9A 4YRUA 1BLQA 1ZMZA 5FYXA 1QXPA 1PVBA 1BR1B 1TNWA 2MA2A 4CIDA 5BPJA 2HPSA 1QATA 3I5IB 1J1EA 1XFWO 2L0PA 2R2IA 1S26D 2BBMA 2JOJA 2GGMA 2WCEA 3JTDC 1FPWA 1C7VA 1QV0A 1QS7A 2BBNA 2LUXA 2K61A 3MSEB 1Y1XA 1K93D 1CKKA 2I94A 1MR8A 1MXLC 2QPTA 1F8HA 4QJ5B 3EVVA 5TNCA 2I2RE 1KSMA 1QTXA 4N1GA 1F70A 2BKHB 1XVJA 1ALVA 4XJKB 1J7RA 3SG5A 5HYDA 3O6BA 3SG6A 1KSOA 2P6BB 2SCPA 1IH0A 4N1FA 1QLKA 3LK0A 2WORA 3DVEA 4D1EA 1SCMB 1RK9A 2H2KA 1NP8A 1YUTA 4I5NB 4MBEA 4YGBB 1IKUA 1DJGA 3LCPC 1JC2A 2M29A 3AKBA 3OB2B 3I5HB 3WHUB 1BOCA 1L7ZA 3HX4A 1A03A 4JWQA 1XK4A 3VRRA 3DF0B 1YX7A 1QIWA 5AEQA 3WXAA 1BR4B 4MLWA 3M0WA 5I2OA 3A4UB 4GUKA 4TNCA 2JT0A 1TCFA 5K89A 1OMRA 1Y1AA 1XFXO 3NSLA 3IQOA 3SJSA 1CM4A 1PULA 3IF7A 2WCBA 3OHMB 1LINA 2FJUB 2NLNA 2VRGA 2JT8A 1KK8B 1UWOA 1QVIZ 1XK4C 2LLUA 4C0JA 1OSAA 4DIRA 3FS7A 1SMGA 1NX1A 2EHBA 1KFUL 2K7OA 2LNKA 1H8BA 1TRFA 4YI9A 1RROA 1TOPA 2L4HA 3BUOB 4YGEB 1MXEA 1QASA 5AFPA 3QRXA 1CM1A 2KGRA 4AOMA 2A4JA 2ZNDA 1JWDA 1K9UA 1F55A 3SIBA 3FWBA 1N65A 1LXFC 1NCZA 1WDCC 1B7TZ 2NZ0A 5HKZA 1HQVA 3OX5A 2JQ6A 3K21A 1BODA 1TNQA 2MRDA 5KU1A 3DD4A 2JTTA 4L9MA 1KWOC 1HT9A 3DVKA 1DMOA 1H4BA 2D8NA 1EG3A 3H4SE 1IQ3A 1RJVA 1C07A 3TDUA 3I5FC 3PLFB 1PSBA 1MQ1A 3NSKA 2M7LA 3O2PA 2MBXA 3SG4A 1SW8A 2KGBC 1M63B 2LLTA 5ER5A 5CSJA 1NUBA 2KAYA 1B8LA 1OZSA 1DF0A 3TS5B 1ALWA 1CDPA 2JU0A 4USLA 1CFFA 4GBAA 1QVIY 3KHEA 4Q04A 5CSFA 1UHIA 1DGVA 2WOSA 3CGAA 1FF1A 3FWCA 4MEWA 2JWWA 1U5IB 1CLLA 2LE9B 1OE9B 2K7BA 2PALA 4FQOA 4PHKA 4ETOA 1WRLA 2KBMA 2LHLA 1TNPA 2EC6C 2F2OA 4N5XA 1QX7A 2L51A 1XA5A 3BQ3A 2BL0C 3JVTC 1JF0A 4PE0A 4BY4A 1YR5A 1B7TY 1GJYA 2Q4UA 2KHNA 1JBAA 3FIAA 2K7CA 4AQJA 1M46A 3BUMB 1SPYA 2KQ6A 1JUOA 1CFPA 2KSPA 2L50A 4F0ZB 1SYMA 1MUXA 2LVVA 4OV2A 2HQ8A 4FTGA 3EVRA 3PN7B 1CTRA 1UUSA 3HCMA 1DJXA 4WRIA 2G9BA 1CNPA 2HETA 1B8CA 3O78A 3F45A 5HLVA 1L2OC 1Y0VH 4NDBA 1BG1A 5I2QA 4GGFA 4P2YB 1K94A 1S5GZ 3KEVA 1A75B 2L4IA 4BY5A 1DJIA 2KDHA 5JJGA 2E6WA 1W7IB 1KFUS 1A4PA 1CLBA 3BOWB 1SL8A 1IJ5A 2K2AA 1KQMC 1S1EA 4MRXA 4A4CA 1WLMA 1B9AA 1KFXL 1UURA 2JNXA 3PM8A 5I8NA 1OZOA 2KI4B 2KFGA 4GGFC 1B8RA 2F3YA 4JQ0D 4MZKA 1KWOB 2E30A 4C0LA 1AJ4A 1R6PA 1CDLA 1IRJA 2M1KB 3BUNB 2PMYA 3KO0A 2KAXA 2LV7A 1FBVA 2SASA 3CZTX 1BF5A 1PVAA 1FW4A 4CFRA 2WNDA 4DUQA 2CNPA 4JPZB 1N2DA 4ORCB 4OCIA 3TUYB 5CPVA 2OTGC 1U5IA 2LVKA 5KTYA 1CLMA 3AAKA 4CPVA 4GNKB 1M45A 4GFTA 2KI6C 2Y1MA 4ICBA 2O60A 2MLFC 1NWDA 3DVJA 1CDMA 1NX0A 2KI6D 1DJYA 2MLEC 1SRAA 1RFJA 2Q91A 4PCWA 2Y4QA 1M39A 1WRZA 2KYFA 1S5GY 5CSIA 4U8DA 4OR9B 3SIAA 1EJ3A 2EC6B 1PK0D 2K2FA 5J3XA 3ZNIA 1Y1UA 2JRFA 3BXKA 1PSRA 4YGAA 1SK6D 3CTNA 1CMFA 2JC2A 1K95A 4C0KA 3GOFA 1SR6B 1V1FA 1ZFSA 3O4YA 4ORAB 1BJFA 2JXCA 4YBHB 1YRUB 1XFYO 3LK1A 3GK2A 4GAOA 2F3ZA 1TNXA 1ZOTB 1M31A 1QX2A 1F4OA 5JOLA 1IQ5A 1XFZO 4HREE 2PASA 1B1GA 1GGWA 2WC8A 1A29A 4PDZA 4M2PA 1N0YA 1NX2A 1NYAA 4XJKA 1DT7B 2LP3A 4M2OA 1GQMA 3I5IC 1J1DA 2I7AA 3OB1B 3JTDB 1XFUO 2ZNEA 1D1OA 1OQPA 3CR5X 2ZN9A 1SNLA 1RWYA 3BUWB 3VRPA 2HF5A 3TDZA 5I2LA 1QV1A 2JZIA 2KBIA 3CLNA 1J7OA 1IWQA 1E8AA 1RTP1 2CTNA 1SL7A 1LA0A 3LLEA 4CFQA 1WRKA 2NCOA 1DJHA 1G8IA 4YI8A 1DJZA 1Q80A 2M9GA 1UHJA 1W7JB 3RM1A 3DF0A 2GV5A 1KFXS 1BMOA 2BECA 3WHTB 1WY9A 2OPOA 2MAZA 3CR2A 4IL1A 1YVHA 1SCMC 3DVMA 1F54A 2KFFA 3E3RA 3D0YB 1SL9A 1CFCA 1X02A 1AP4A 2PRUA 5D69A 1OMVA 1KCYA 2DOQA 3I5HC 1JFJA 4HRHA 1TCOB 2KNEA 4MRYA 5IBWA 1GGZA 2AMIA 1DJWA 1NCYA 2NXQA 1YUSA 3NXAA 1TTXA 2MJWB 1K9KA 4XYNA 5AERA 1IG5A 1PRWA 2LVJA 2M49B 2JXLA 2TN4A 1S36A 4M2QA 1TIZA 4YGCB 1S3PA 5AANA 1KK8C 3EKJA 1S6JA 4MZLA 1EXRA 1J7PA 1OOJA 1A2XA 2LP2A 2QACA 1NIWA 1XFVO 2MHHA 4PHMA 5AXIA 2OS8C 4WQ2A 4I5LB 4A4BA 2COLB 1LVCD 1WDCB 2K0JA 5DKNA 4PHJA 4NQGA 1KK7Z 3PSRA 2Y1NA 3BUXB 1QIVA 5KSZA 3AKAA 4QJ4B 2AAOA 3WNXB 1J7QA 5GQQC 1PALA 2M1UA 2IS9A 1WLZA 1JSAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CMG A;  1ZUZ A;  5F6T A;  1F71 A;  1K9P A;  2LVI A;  2Y5I A;  1K2H A;  1CB1 A;  1ODB A;  2KYC A;  3I5F B;  3OP0 A;  3TZ1 A;  1R2U A;  1V1G A;  2GGZ A;  2LMV A;  2KFH A;  3AAJ A;  4PE4 A;  3I5G C;  1JF2 A;  2F8P A;  4MVF A;  2LM5 A;  2BKI B;  3CWG A;  4NDD A;  4DRW A;  1K96 A;  3D0Y A;  1B4C A;  3TS5 C;  2ZN8 A;  2BE6 A;  3OX6 A;  2B1U A;  3RLZ A;  1OMD A;  1S6I A;  4ZCV A;  1UHN A;  1XYD A;  2PVB A;  1VRK A;  4WQ3 A;  5CSN A;  3IQQ A;  1SCV A;  3C1V A;  3JVT B;  2BL0 B;  2H61 A;  3EKH A;  1DF0 B;  5G08 A;  1REC A;  4PAL A;  1UP5 A;  3ZWH A;  4AQI A;  1KK7 Y;  2L98 A;  1UHH A;  2V53 A;  2CBL A;  2BCA A;  1K8U A;  4I5K A;  5ER4 X;  5B8I B;  1YTZ C;  2FCD A;  2KQY A;  1IJ6 A;  1A75 A;  2L2E A;  3CS1 A;  4NDC A;  2M0R A;  1EG4 A;  2WCF A;  4I5J A;  1Y6W A;  1DTL A;  2H61 C;  2ISD A;  1YUR A;  2AUC A;  3VRO A;  3PN7 C;  4ZCU A;  3BOW A;  3KPX A;  1J55 A;  1L2O B;  3CR4 X;  4CLN A;  3KF9 A;  3EK4 A;  5DKR A;  3EK8 A;  4OVN F;  1CFD A;  2KAV A;  1AHR A;  2LUC A;  2HQW A;  2NCP A;  3LL8 B;  1MF8 B;  2JTZ A;  2LMT A;  4PE7 A;  1AJ5 A;  2LMU A;  3GK4 X;  1XO5 A;  5D7F A;  1YVL A;  2LC5 A;  4UPG A;  2OS8 B;  4ORB B;  4HSZ A;  1F4Q A;  2ZRT A;  3ICB A;  3SG3 A;  1CDN A;  2M7N A;  3EK7 A;  1KQM B;  1TN4 A;  2JT3 A;  1K90 D;  1BU3 A;  4MSP A;  2PSR A;  2M3W A;  3EVU A;  4HRG A;  1G33 A;  2KOT A;  4DS7 A;  1C7W A;  2JPT A;  3D10 A;  3VRQ A;  5PAL A;  1DVI A;  2KI4 C;  2O5G A;  1YUU A;  1EH2 A;  1AUI B;  1S6C A;  1SKT A;  1UHK A;  3A8R A;  1FI6 A;  4MZJ A;  2RGI A;  2FCE A;  4MN0 A;  2FOT A;  1FI5 A;  4QJ3 B;  1QLS A;  2OTG B;  3I5G B;  1MWN A;  1G4Y R;  3TUY C;  2G2B A;  2JUL A;  5HLO A;  1AK8 A;  4GGN A;  2BE4 A;  4R1E A;  3SG2 A;  2CCM A;  3VGO A;  2EGD A;  1NCX A;  3BYA A;  1BT6 A;  2L5X B;  3NSO A;  1EL4 A;  1AVS A;  1JFK A;  1KQV A;  1YRT B;  4DCK A;  2BCX A;  3PFV A;  1DGU A;  5DKQ A;  4YGD B;  1QX5 B;  5HKW A;  3PAL A;  3PAT A;  1B47 A;  2K8M B;  2BCB A;  1ZAC A;  3GK1 A;  4P5O E;  1LA3 A;  2LAN A;  2ZRS A;  4PHN A;  1YX8 A;  2CXJ A;  2LLS A;  3VRN A;  2ZFD A;  1NPQ A;  2M8U A;  4PE1 A;  2LAP A;  1NSH A;  2I18 A;  2LCP A;  3NSI A;  5HKY A;  2F33 A;  1SR6 C;  3SG7 A;  3TDI A;  4GPL B;  2K7D A;  2M97 A;  1SY9 A;  1IGV A;  1MHO A;  2ZKM X;  1QJT A;  2LHI A;  1SBJ A;  1LKJ A;  2F2P A;  4OKH A;  4E68 A;  2JNF A;  1NX3 A;  2CT9 A;  4YRU A;  1BLQ A;  1ZMZ A;  5FYX A;  1QXP A;  1PVB A;  1BR1 B;  1TNW A;  2MA2 A;  4CID A;  5BPJ A;  2HPS A;  1QAT A;  3I5I B;  1J1E A;  1XFW O;  2L0P A;  2R2I A;  1S26 D;  2BBM A;  2JOJ A;  2GGM A;  2WCE A;  3JTD C;  1FPW A;  1C7V A;  1QV0 A;  1QS7 A;  2BBN A;  2LUX A;  2K61 A;  3MSE B;  1Y1X A;  1K93 D;  1CKK A;  2I94 A;  1MR8 A;  1MXL C;  2QPT A;  1F8H A;  4QJ5 B;  3EVV A;  5TNC A;  2I2R E;  1KSM A;  1QTX A;  4N1G A;  1F70 A;  2BKH B;  1XVJ A;  1ALV A;  4XJK B;  1J7R A;  3SG5 A;  5HYD A;  3O6B A;  3SG6 A;  1KSO A;  2P6B B;  2SCP A;  1IH0 A;  4N1F A;  1QLK A;  3LK0 A;  2WOR A;  3DVE A;  4D1E A;  1SCM B;  1RK9 A;  2H2K A;  1NP8 A;  1YUT A;  4I5N B;  4MBE A;  4YGB B;  1IKU A;  1DJG A;  3LCP C;  1JC2 A;  2M29 A;  3AKB A;  3OB2 B;  3I5H B;  3WHU B;  1BOC A;  1L7Z A;  3HX4 A;  1A03 A;  4JWQ A;  1XK4 A;  3VRR A;  3DF0 B;  1YX7 A;  1QIW A;  5AEQ A;  3WXA A;  1BR4 B;  4MLW A;  3M0W A;  5I2O A;  3A4U B;  4GUK A;  4TNC A;  2JT0 A;  1TCF A;  5K89 A;  1OMR A;  1Y1A A;  1XFX O;  3NSL A;  3IQO A;  3SJS A;  1CM4 A;  1PUL A;  3IF7 A;  2WCB A;  3OHM B;  1LIN A;  2FJU B;  2NLN A;  2VRG A;  2JT8 A;  1KK8 B;  1UWO A;  1QVI Z;  1XK4 C;  2LLU A;  4C0J A;  1OSA A;  4DIR A;  3FS7 A;  1SMG A;  1NX1 A;  2EHB A;  1KFU L;  2K7O A;  2LNK A;  1H8B A;  1TRF A;  4YI9 A;  1RRO A;  1TOP A;  2L4H A;  3BUO B;  4YGE B;  1MXE A;  1QAS A;  5AFP A;  3QRX A;  1CM1 A;  2KGR A;  4AOM A;  2A4J A;  2ZND A;  1JWD A;  1K9U A;  1F55 A;  3SIB A;  3FWB A;  1N65 A;  1LXF C;  1NCZ A;  1WDC C;  1B7T Z;  2NZ0 A;  5HKZ A;  1HQV A;  3OX5 A;  2JQ6 A;  3K21 A;  1BOD A;  1TNQ A;  2MRD A;  5KU1 A;  3DD4 A;  2JTT A;  4L9M A;  1KWO C;  1HT9 A;  3DVK A;  1DMO A;  1H4B A;  2D8N A;  1EG3 A;  3H4S E;  1IQ3 A;  1RJV A;  1C07 A;  3TDU A;  3I5F C;  3PLF B;  1PSB A;  1MQ1 A;  3NSK A;  2M7L A;  3O2P A;  2MBX A;  3SG4 A;  1SW8 A;  2KGB C;  1M63 B;  2LLT A;  5ER5 A;  5CSJ A;  1NUB A;  2KAY A;  1B8L A;  1OZS A;  1DF0 A;  3TS5 B;  1ALW A;  1CDP A;  2JU0 A;  4USL A;  1CFF A;  4GBA A;  1QVI Y;  3KHE A;  4Q04 A;  5CSF A;  1UHI A;  1DGV A;  2WOS A;  3CGA A;  1FF1 A;  3FWC A;  4MEW A;  2JWW A;  1U5I B;  1CLL A;  2LE9 B;  1OE9 B;  2K7B A;  2PAL A;  4FQO A;  4PHK A;  4ETO A;  1WRL A;  2KBM A;  2LHL A;  1TNP A;  2EC6 C;  2F2O A;  4N5X A;  1QX7 A;  2L51 A;  1XA5 A;  3BQ3 A;  2BL0 C;  3JVT C;  1JF0 A;  4PE0 A;  4BY4 A;  1YR5 A;  1B7T Y;  1GJY A;  2Q4U A;  2KHN A;  1JBA A;  3FIA A;  2K7C A;  4AQJ A;  1M46 A;  3BUM B;  1SPY A;  2KQ6 A;  1JUO A;  1CFP A;  2KSP A;  2L50 A;  4F0Z B;  1SYM A;  1MUX A;  2LVV A;  4OV2 A;  2HQ8 A;  4FTG A;  3EVR A;  3PN7 B;  1CTR A;  1UUS A;  3HCM A;  1DJX A;  4WRI A;  2G9B A;  1CNP A;  2HET A;  1B8C A;  3O78 A;  3F45 A;  5HLV A;  1L2O C;  1Y0V H;  4NDB A;  1BG1 A;  5I2Q A;  4GGF A;  4P2Y B;  1K94 A;  1S5G Z;  3KEV A;  1A75 B;  2L4I A;  4BY5 A;  1DJI A;  2KDH A;  5JJG A;  2E6W A;  1W7I B;  1KFU S;  1A4P A;  1CLB A;  3BOW B;  1SL8 A;  1IJ5 A;  2K2A A;  1KQM C;  1S1E A;  4MRX A;  4A4C A;  1WLM A;  1B9A A;  1KFX L;  1UUR A;  2JNX A;  3PM8 A;  5I8N A;  1OZO A;  2KI4 B;  2KFG A;  4GGF C;  1B8R A;  2F3Y A;  4JQ0 D;  4MZK A;  1KWO B;  2E30 A;  4C0L A;  1AJ4 A;  1R6P A;  1CDL A;  1IRJ A;  2M1K B;  3BUN B;  2PMY A;  3KO0 A;  2KAX A;  2LV7 A;  1FBV A;  2SAS A;  3CZT X;  1BF5 A;  1PVA A;  1FW4 A;  4CFR A;  2WND A;  4DUQ A;  2CNP A;  4JPZ B;  1N2D A;  4ORC B;  4OCI A;  3TUY B;  5CPV A;  2OTG C;  1U5I A;  2LVK A;  5KTY A;  1CLM A;  3AAK A;  4CPV A;  4GNK B;  1M45 A;  4GFT A;  2KI6 C;  2Y1M A;  4ICB A;  2O60 A;  2MLF C;  1NWD A;  3DVJ A;  1CDM A;  1NX0 A;  2KI6 D;  1DJY A;  2MLE C;  1SRA A;  1RFJ A;  2Q91 A;  4PCW A;  2Y4Q A;  1M39 A;  1WRZ A;  2KYF A;  1S5G Y;  5CSI A;  4U8D A;  4OR9 B;  3SIA A;  1EJ3 A;  2EC6 B;  1PK0 D;  2K2F A;  5J3X A;  3ZNI A;  1Y1U A;  2JRF A;  3BXK A;  1PSR A;  4YGA A;  1SK6 D;  3CTN A;  1CMF A;  2JC2 A;  1K95 A;  4C0K A;  3GOF A;  1SR6 B;  1V1F A;  1ZFS A;  3O4Y A;  4ORA B;  1BJF A;  2JXC A;  4YBH B;  1YRU B;  1XFY O;  3LK1 A;  3GK2 A;  4GAO A;  2F3Z A;  1TNX A;  1ZOT B;  1M31 A;  1QX2 A;  1F4O A;  5JOL A;  1IQ5 A;  1XFZ O;  4HRE E;  2PAS A;  1B1G A;  1GGW A;  2WC8 A;  1A29 A;  4PDZ A;  4M2P A;  1N0Y A;  1NX2 A;  1NYA A;  4XJK A;  1DT7 B;  2LP3 A;  4M2O A;  1GQM A;  3I5I C;  1J1D A;  2I7A A;  3OB1 B;  3JTD B;  1XFU O;  2ZNE A;  1D1O A;  1OQP A;  3CR5 X;  2ZN9 A;  1SNL A;  1RWY A;  3BUW B;  3VRP A;  2HF5 A;  3TDZ A;  5I2L A;  1QV1 A;  2JZI A;  2KBI A;  3CLN A;  1J7O A;  1IWQ A;  1E8A A;  1RTP 1;  2CTN A;  1SL7 A;  1LA0 A;  3LLE A;  4CFQ A;  1WRK A;  2NCO A;  1DJH A;  1G8I A;  4YI8 A;  1DJZ A;  1Q80 A;  2M9G A;  1UHJ A;  1W7J B;  3RM1 A;  3DF0 A;  2GV5 A;  1KFX S;  1BMO A;  2BEC A;  3WHT B;  1WY9 A;  2OPO A;  2MAZ A;  3CR2 A;  4IL1 A;  1YVH A;  1SCM C;  3DVM A;  1F54 A;  2KFF A;  3E3R A;  3D0Y B;  1SL9 A;  1CFC A;  1X02 A;  1AP4 A;  2PRU A;  5D69 A;  1OMV A;  1KCY A;  2DOQ A;  3I5H C;  1JFJ A;  4HRH A;  1TCO B;  2KNE A;  4MRY A;  5IBW A;  1GGZ A;  2AMI A;  1DJW A;  1NCY A;  2NXQ A;  1YUS A;  3NXA A;  1TTX A;  2MJW B;  1K9K A;  4XYN A;  5AER A;  1IG5 A;  1PRW A;  2LVJ A;  2M49 B;  2JXL A;  2TN4 A;  1S36 A;  4M2Q A;  1TIZ A;  4YGC B;  1S3P A;  5AAN A;  1KK8 C;  3EKJ A;  1S6J A;  4MZL A;  1EXR A;  1J7P A;  1OOJ A;  1A2X A;  2LP2 A;  2QAC A;  1NIW A;  1XFV O;  2MHH A;  4PHM A;  5AXI A;  2OS8 C;  4WQ2 A;  4I5L B;  4A4B A;  2COL B;  1LVC D;  1WDC B;  2K0J A;  5DKN A;  4PHJ A;  4NQG A;  1KK7 Z;  3PSR A;  2Y1N A;  3BUX B;  1QIV A;  5KSZ A;  3AKA A;  4QJ4 B;  2AAO A;  3WNX B;  1J7Q A;  5GQQ C;  1PAL A;  2M1U A;  2IS9 A;  1WLZ A;  1JSA A; 
#chains in the Genus database with same CATH topology
 1CMG A;  1ZUZ A;  5F6T A;  1F71 A;  1K9P A;  2LVI A;  2Y5I A;  1K2H A;  1CB1 A;  1ODB A;  2KYC A;  3I5F B;  3OP0 A;  3TZ1 A;  1R2U A;  1V1G A;  2GGZ A;  2LMV A;  2KFH A;  3AAJ A;  4PE4 A;  3I5G C;  1OW4 A;  1JF2 A;  2F8P A;  4MVF A;  2LM5 A;  3Q8I A;  2BKI B;  3CWG A;  4NDD A;  4DRW A;  1K96 A;  3D0Y A;  1B4C A;  3TS5 C;  3CAB A;  1DEL A;  2ZN8 A;  2BE6 A;  3OX6 A;  2B1U A;  3RLZ A;  1OMD A;  1S6I A;  4ZCV A;  1UHN A;  1XYD A;  2PVB A;  1VRK A;  2FJY A;  4WQ3 A;  5CSN A;  3IQQ A;  1SCV A;  3C1V A;  3JVT B;  3S0B A;  2BL0 B;  2H61 A;  3EKH A;  1DF0 B;  3S0A A;  5G08 A;  1REC A;  4PAL A;  1UP5 A;  3ZWH A;  3K1E A;  4AQI A;  1KK7 Y;  2L98 A;  1UHH A;  2V53 A;  2CBL A;  4OZD A;  2BCA A;  1K8U A;  2H8V A;  4I5K A;  5ER4 X;  5B8I B;  1YTZ C;  2FCD A;  2KQY A;  1IJ6 A;  5D3O A;  1A75 A;  2L2E A;  3CS1 A;  4NDC A;  2M0R A;  1EG4 A;  2WCF A;  3BJH A;  2PQL A;  4I5J A;  1Y6W A;  1DTL A;  2H61 C;  2ISD A;  1YUR A;  5I94 A;  2AUC A;  3VRO A;  3PN7 C;  4ZCU A;  3BOW A;  3KPX A;  1J55 A;  1L2O B;  3CR4 X;  2WCM A;  4CLN A;  3KF9 A;  3RZS A;  3EK4 A;  5DKR A;  3EK8 A;  3DZT A;  4OVN F;  1CFD A;  2KAV A;  1AHR A;  2LUC A;  2HQW A;  2NCP A;  3LL8 B;  3SS5 A;  1MF8 B;  2JTZ A;  2LMT A;  4PE7 A;  1AJ5 A;  2LMU A;  3GK4 X;  1XO5 A;  5D7F A;  1YVL A;  2LC5 A;  3L4A A;  4UPG A;  2OS8 B;  4ORB B;  4HSZ A;  1F4Q A;  2ZRT A;  3ICB A;  3SG3 A;  1CDN A;  3SS3 A;  2M7N A;  3EK7 A;  1KQM B;  1TN4 A;  2JT3 A;  1K90 D;  1BU3 A;  4MSP A;  2PSR A;  2M3W A;  3EVU A;  4HRG A;  1G33 A;  2KOT A;  3N7H A;  1C7W A;  2JPT A;  3D10 A;  3VRQ A;  4DS7 A;  5PAL A;  4INX A;  1DVI A;  2KI4 C;  2O5G A;  1YUU A;  1EH2 A;  1AUI B;  1S6C A;  1SKT A;  1UHK A;  3A8R A;  1FI6 A;  5FI2 A;  4MZJ A;  2RGI A;  2FCE A;  4MN0 A;  2FOT A;  1FI5 A;  4QJ3 B;  1QLS A;  2OTG B;  3I5G B;  1MWN A;  1G4Y R;  3TUY C;  2G2B A;  2JUL A;  5HLO A;  1AK8 A;  4GGN A;  2BE4 A;  4R1E A;  3SG2 A;  2CCM A;  3R72 A;  5I2O A;  3VGO A;  2EGD A;  1NCX A;  2KLD A;  3BYA A;  1BT6 A;  2L5X B;  3NSO A;  3IVT A;  1EL4 A;  1AVS A;  1JFK A;  1KQV A;  1YRT B;  4DCK A;  2BCX A;  3PFV A;  1DGU A;  5DKQ A;  4YGD B;  3CDN A;  1QX5 B;  5HKW A;  3PAL A;  3PAT A;  1B47 A;  2K8M B;  2BCB A;  1ZAC A;  3GK1 A;  4P5O E;  1LA3 A;  2LAN A;  2ZRS A;  4PHN A;  1YX8 A;  2CXJ A;  2LLS A;  3VRN A;  2ZFD A;  3BFB A;  1NPQ A;  2M8U A;  4PE1 A;  2LAP A;  1DC1 A;  1NSH A;  2I18 A;  2LCP A;  3NSI A;  5HKY A;  2F33 A;  1SR6 C;  3SG7 A;  3TDI A;  5FI6 A;  1Z2C B;  2K7D A;  4GPL B;  2M97 A;  1SY9 A;  3L47 A;  1IGV A;  1MHO A;  2ZKM X;  1QJT A;  2LHI A;  3S0D A;  1SBJ A;  1C3Y A;  1LKJ A;  2F2P A;  4OKH A;  4E68 A;  2JNF A;  1NX3 A;  2CT9 A;  4YRU A;  1BLQ A;  1ZMZ A;  5FYX A;  3DY9 A;  1QXP A;  1PVB A;  1BR1 B;  1TNW A;  2MA2 A;  4CID A;  5BPJ A;  2HPS A;  1QAT A;  3I5I B;  1J1E A;  1XFW O;  2L0P A;  2L2C A;  1Z4H A;  2R2I A;  2GTE A;  1S26 D;  2BBM A;  1ORG A;  2JOJ A;  2GGM A;  2WCE A;  3JTD C;  1FPW A;  1C7V A;  1QV0 A;  1QS7 A;  2BBN A;  2LUX A;  2K61 A;  3MSE B;  1Y1X A;  1K93 D;  1CKK A;  2I94 A;  1MR8 A;  1MXL C;  2QPT A;  1F8H A;  1OOF A;  1SSE B;  4QJ5 B;  3EVV A;  3FE9 A;  5TNC A;  2I2R E;  1KSM A;  1QTX A;  3OBV A;  4N1G A;  1F70 A;  2BKH B;  1XVJ A;  1ALV A;  4XJK B;  3NHI A;  3BFH A;  1J7R A;  3SG5 A;  5HYD A;  3O6B A;  3SG6 A;  2BNX A;  1KSO A;  2P6B B;  2SCP A;  1IH0 A;  4N1F A;  5FI7 A;  2L5Y A;  1QLK A;  2PYQ A;  3LK0 A;  2WOR A;  3DVE A;  3BFA A;  4D1E A;  1SCM B;  1RK9 A;  2H2K A;  1NP8 A;  1YUT A;  4I5N B;  4MBE A;  4YGB B;  1IKU A;  1DJG A;  3LCP C;  1JC2 A;  2M29 A;  3AKB A;  3OB2 B;  3I5H B;  3WHU B;  1BOC A;  1L7Z A;  3HX4 A;  1A03 A;  4JWQ A;  1XK4 A;  3VRR A;  3EG5 B;  3DF0 B;  3QME A;  1YX7 A;  1QIW A;  5AEQ A;  3WXA A;  1BR4 B;  4MLW A;  3B6X A;  2WCK A;  3A4U B;  3M0W A;  4GUK A;  4TNC A;  2JT0 A;  1TCF A;  5EL2 A;  1OMR A;  5K89 A;  1Y1A A;  1XFX O;  3NSL A;  3IQO A;  3SJS A;  1CM4 A;  1PUL A;  3IF7 A;  3FE8 A;  3PJI A;  2WCB A;  3OHM B;  1LIN A;  2FJU B;  3O4X A;  3UO9 A;  2NLN A;  2VRG A;  2JT8 A;  3CZ2 A;  1KK8 B;  1P28 A;  1UWO A;  1QVI Z;  1XK4 C;  2LLU A;  4C0J A;  1OSA A;  4DIR A;  3FS7 A;  1SMG A;  1NX1 A;  2EHB A;  1KFU L;  2K7O A;  2LNK A;  3CZ1 A;  1H8B A;  1TRF A;  4YI9 A;  1RRO A;  1TOP A;  2L4H A;  3BUO B;  1QWV A;  4YGE B;  1MXE A;  1QAS A;  5AFP A;  3QRX A;  1XFR A;  1CM1 A;  2KGR A;  4AOM A;  2A4J A;  2P70 A;  2ZND A;  1K9U A;  1JWD A;  1F55 A;  2WCH A;  3SIB A;  3FWB A;  1N65 A;  1LXF C;  1NCZ A;  1WDC C;  1B7T Z;  1LS8 A;  2NZ0 A;  2ERB A;  2P71 A;  1HQV A;  5HKZ A;  3OX5 A;  2JQ6 A;  3K21 A;  1BOD A;  1TNQ A;  2MRD A;  5KU1 A;  3DD4 A;  2JTT A;  4L9M A;  1KWO C;  1HT9 A;  3DVK A;  4JD9 A;  1DMO A;  1H4B A;  2D8N A;  1EG3 A;  3H4S E;  1IQ3 A;  4JKT A;  1RJV A;  1C07 A;  3TDU A;  3I5F C;  3PLF B;  1C3Z A;  1PSB A;  1MQ1 A;  3NSK A;  3FE6 A;  2M7L A;  3O2P A;  2MBX A;  3SG4 A;  1SW8 A;  2QEB A;  2KGB C;  4F7F A;  1M63 B;  2LLT A;  5ER5 A;  5CSJ A;  1NUB A;  2KAY A;  2JPO A;  1B8L A;  1OZS A;  1DF0 A;  3TS5 B;  3DXL A;  1ALW A;  1CDP A;  3R1O A;  2JU0 A;  4USL A;  1CFF A;  4GBA A;  1QVI Y;  3KHE A;  4Q04 A;  5CSF A;  1UHI A;  1DGV A;  2WOS A;  3B87 A;  3CGA A;  4FQT A;  1FF1 A;  3FWC A;  4MEW A;  2JWW A;  1U5I B;  1CLL A;  2WC6 A;  2LE9 B;  1OE9 B;  2K7B A;  2PAL A;  4FQO A;  4PHK A;  4ETO A;  1WRL A;  2KBM A;  2LHL A;  1TNP A;  2EC6 C;  2F2O A;  4N5X A;  1QX7 A;  2L51 A;  1XA5 A;  3B88 A;  2BL0 C;  3BQ3 A;  1JF0 A;  3JVT C;  1DQE A;  4PE0 A;  4BY4 A;  1YR5 A;  1B7T Y;  1GJY A;  2Q4U A;  2KHN A;  1JBA A;  3FIA A;  2K7C A;  4AQJ A;  1M46 A;  3BUM B;  1SPY A;  2KQ6 A;  1JUO A;  1CFP A;  5HL1 A;  2KSP A;  2L50 A;  4F0Z B;  1SYM A;  1MUX A;  2QEO A;  2LVV A;  4OV2 A;  2HQ8 A;  2QEV A;  4FTG A;  3EVR A;  3V2L A;  3PN7 B;  1CTR A;  1UUS A;  3HCM A;  1DJX A;  4WRI A;  2G9B A;  1CNP A;  2HET A;  1B8C A;  3CYZ A;  3O78 A;  3F45 A;  1W9Z A;  1L2O C;  1Y0V H;  4NDB A;  5HLV A;  1BG1 A;  3PM2 A;  5I2Q A;  4GGF A;  4P2Y B;  1K94 A;  1S5G Z;  3KEV A;  1A75 B;  2L4I A;  4BY5 A;  1DJI A;  1OOG A;  2KDH A;  5JJG A;  2E6W A;  1W7I B;  1KFU S;  3D73 A;  1A4P A;  1CLB A;  3BOW B;  3UNW A;  1SL8 A;  1IJ5 A;  2K2A A;  1KQM C;  1S1E A;  3D75 A;  4MRX A;  4A4C A;  1WLM A;  1B9A A;  1KFX L;  2KPH A;  1UUR A;  2JNX A;  3PM8 A;  5I8N A;  1OZO A;  2KI4 B;  2KFG A;  4GGF C;  1B8R A;  2F3Y A;  4JQ0 D;  4MZK A;  1KWO B;  2E30 A;  3B7A A;  3VB1 A;  1AJ4 A;  1R6P A;  1CDL A;  1IRJ A;  2M1K B;  3BUN B;  2PMY A;  3KO0 A;  2KAX A;  2LV7 A;  1FBV A;  2SAS A;  3CZT X;  1BF5 A;  3NGV A;  1PVA A;  1FW4 A;  2WCJ A;  4CFR A;  2WND A;  4DUQ A;  2CNP A;  4JPZ B;  1N2D A;  4ORC B;  4OCI A;  3TUY B;  5CPV A;  2OTG C;  1U5I A;  2LVK A;  5KTY A;  1CLM A;  3AAK A;  4CPV A;  1OOI X;  4INW A;  4GNK B;  1M45 A;  4GFT A;  3S0G A;  4KYN A;  2KI6 C;  2Y1M A;  4ICB A;  2O60 A;  2MLF C;  1NWD A;  3DVJ A;  1CDM A;  1NX0 A;  2KI6 D;  4PT1 A;  1DJY A;  2MLE C;  1SRA A;  1DEK A;  1RFJ A;  2Q91 A;  3DYE A;  2Y4Q A;  4IJ7 A;  1M39 A;  1WRZ A;  4PCW A;  2KYF A;  1S5G Y;  5CSI A;  2K60 A;  4U8D A;  4OR9 B;  3SIA A;  1EJ3 A;  2EC6 B;  1PK0 D;  3D78 A;  2K2F A;  5J3X A;  2QDI A;  1Y1U A;  3ZNI A;  2JRF A;  3BXK A;  1PSR A;  4YGA A;  1SK6 D;  3CTN A;  1CMF A;  1TWO A;  2JC2 A;  1K95 A;  4C0K A;  3GOF A;  1SR6 B;  1V1F A;  1ZFS A;  3O4Y A;  4ORA B;  1BJF A;  2BAP A;  2JXC A;  4YBH B;  1YRU B;  1XFY O;  3LK1 A;  3GK2 A;  4GAO A;  2F3Z A;  1TNX A;  1ZOT B;  1M31 A;  3R1P A;  1QX2 A;  1F4O A;  5JOL A;  1IQ5 A;  1XFZ O;  3D76 A;  4HRE E;  2PAS A;  1B1G A;  1GGW A;  2WC8 A;  1A29 A;  4PDZ A;  4M2P A;  1N0Y A;  1NX2 A;  1NYA A;  4XJK A;  1DT7 B;  2LP3 A;  4M2O A;  1GQM A;  3I5I C;  1J1D A;  2I7A A;  3OB1 B;  1T14 A;  3JTD B;  1XFU O;  2ZNE A;  1D1O A;  1OQP A;  3CR5 X;  2ZN9 A;  1SNL A;  1RWY A;  3BUW B;  3VRP A;  2HF5 A;  3TDZ A;  5I2L A;  1QV1 A;  2JZI A;  2KBI A;  3CLN A;  1J7O A;  3NHT A;  1IWQ A;  1E8A A;  1RTP 1;  2CTN A;  1SL7 A;  1LA0 A;  3LLE A;  4CFQ A;  1WRK A;  2NCO A;  1DJH A;  1G8I A;  4YI8 A;  1DJZ A;  1Q80 A;  2KLE A;  2M9G A;  1UHJ A;  1W7J B;  3RM1 A;  3DF0 A;  2GV5 A;  1KFX S;  1BMO A;  2BEC A;  3WHT B;  1IIO A;  1WY9 A;  2OPO A;  2MAZ A;  3CR2 A;  3L4L A;  4IL1 A;  2WCL A;  1TUJ A;  1YVH A;  1SCM C;  3DVM A;  1F54 A;  2KFF A;  3E3R A;  3D0Y B;  1SL9 A;  1CFC A;  1X02 A;  1AP4 A;  2PRU A;  5D69 A;  1OMV A;  1KCY A;  2DOQ A;  3I5H C;  1JFJ A;  4HRH A;  1TCO B;  2KNE A;  4MRY A;  5IBW A;  1GGZ A;  2AMI A;  1DJW A;  1NCY A;  2NXQ A;  1YUS A;  1GM0 A;  3CZ0 A;  3NXA A;  5DIC A;  1TTX A;  2MJW B;  3D77 A;  2YGU A;  1K9K A;  2WC5 A;  3B86 A;  4XYN A;  5AER A;  1IG5 A;  1PRW A;  2LVJ A;  2M49 B;  2JXL A;  2TN4 A;  3SS4 A;  1S36 A;  4M2Q A;  3D74 A;  1TIZ A;  4YGC B;  3R1V A;  3S0F A;  1S3P A;  5AAN A;  1KK8 C;  3EKJ A;  1S6J A;  4MZL A;  1EXR A;  1J7P A;  1OOJ A;  1A2X A;  4C0L A;  3S0E A;  2LP2 A;  2QAC A;  1NIW A;  1XFV O;  2MHH A;  4PHM A;  5AXI A;  2OS8 C;  4WQ2 A;  4I5L B;  4A4B A;  2QEH A;  2COL B;  1LVC D;  1WDC B;  2K0J A;  5DKN A;  1OOH A;  4PHJ A;  4NQG A;  1KK7 Z;  3PSR A;  2Y1N A;  3OGN A;  3BUX B;  1QIV A;  5KSZ A;  3AKA A;  1TUZ A;  4QJ4 B;  2AAO A;  3WNX B;  1J7Q A;  5GQQ C;  1PAL A;  2M1U A;  2IS9 A;  1WLZ A;  1JSA A; 
#chains in the Genus database with same CATH homology
 1CMG A;  1ZUZ A;  5F6T A;  1F71 A;  1K9P A;  2LVI A;  2Y5I A;  1K2H A;  1CB1 A;  1ODB A;  2KYC A;  3I5F B;  3OP0 A;  3TZ1 A;  1R2U A;  1V1G A;  2GGZ A;  2LMV A;  2KFH A;  3AAJ A;  4PE4 A;  3I5G C;  1JF2 A;  2F8P A;  4MVF A;  2LM5 A;  2BKI B;  3CWG A;  4NDD A;  4DRW A;  1K96 A;  3D0Y A;  1B4C A;  3TS5 C;  2ZN8 A;  2BE6 A;  3OX6 A;  2B1U A;  3RLZ A;  1OMD A;  1S6I A;  4ZCV A;  1UHN A;  1XYD A;  2PVB A;  1VRK A;  4WQ3 A;  5CSN A;  3IQQ A;  1SCV A;  3C1V A;  3JVT B;  2BL0 B;  2H61 A;  3EKH A;  1DF0 B;  5G08 A;  1REC A;  4PAL A;  1UP5 A;  3ZWH A;  4AQI A;  1KK7 Y;  2L98 A;  1UHH A;  2V53 A;  2CBL A;  2BCA A;  1K8U A;  4I5K A;  5ER4 X;  5B8I B;  1YTZ C;  2FCD A;  2KQY A;  1IJ6 A;  1A75 A;  2L2E A;  3CS1 A;  4NDC A;  2M0R A;  1EG4 A;  2WCF A;  4I5J A;  1Y6W A;  1DTL A;  2H61 C;  2ISD A;  1YUR A;  2AUC A;  3VRO A;  3PN7 C;  4ZCU A;  3BOW A;  3KPX A;  1J55 A;  1L2O B;  3CR4 X;  4CLN A;  3KF9 A;  3EK4 A;  5DKR A;  3EK8 A;  4OVN F;  1CFD A;  2KAV A;  1AHR A;  2LUC A;  2HQW A;  2NCP A;  3LL8 B;  1MF8 B;  2JTZ A;  2LMT A;  4PE7 A;  1AJ5 A;  2LMU A;  3GK4 X;  1XO5 A;  5D7F A;  1YVL A;  2LC5 A;  4UPG A;  2OS8 B;  4ORB B;  4HSZ A;  1F4Q A;  2ZRT A;  3ICB A;  3SG3 A;  1CDN A;  2M7N A;  3EK7 A;  1KQM B;  1TN4 A;  2JT3 A;  1K90 D;  1BU3 A;  4MSP A;  2PSR A;  2M3W A;  3EVU A;  4HRG A;  1G33 A;  2KOT A;  4DS7 A;  1C7W A;  2JPT A;  3D10 A;  3VRQ A;  5PAL A;  1DVI A;  2KI4 C;  2O5G A;  1YUU A;  1EH2 A;  1AUI B;  1S6C A;  1SKT A;  1UHK A;  3A8R A;  1FI6 A;  4MZJ A;  2RGI A;  2FCE A;  4MN0 A;  2FOT A;  1FI5 A;  4QJ3 B;  1QLS A;  2OTG B;  3I5G B;  1MWN A;  1G4Y R;  3TUY C;  2G2B A;  2JUL A;  5HLO A;  1AK8 A;  4GGN A;  2BE4 A;  4R1E A;  3SG2 A;  2CCM A;  3VGO A;  2EGD A;  1NCX A;  3BYA A;  1BT6 A;  2L5X B;  3NSO A;  1EL4 A;  1AVS A;  1JFK A;  1KQV A;  1YRT B;  4DCK A;  2BCX A;  3PFV A;  1DGU A;  5DKQ A;  4YGD B;  1QX5 B;  5HKW A;  3PAL A;  3PAT A;  1B47 A;  2K8M B;  2BCB A;  1ZAC A;  3GK1 A;  4P5O E;  1LA3 A;  2LAN A;  2ZRS A;  4PHN A;  1YX8 A;  2CXJ A;  2LLS A;  3VRN A;  2ZFD A;  1NPQ A;  2M8U A;  4PE1 A;  2LAP A;  1NSH A;  2I18 A;  2LCP A;  3NSI A;  5HKY A;  2F33 A;  1SR6 C;  3SG7 A;  3TDI A;  4GPL B;  2K7D A;  2M97 A;  1SY9 A;  1IGV A;  1MHO A;  2ZKM X;  1QJT A;  2LHI A;  1SBJ A;  1LKJ A;  2F2P A;  4OKH A;  4E68 A;  2JNF A;  1NX3 A;  2CT9 A;  4YRU A;  1BLQ A;  1ZMZ A;  5FYX A;  1QXP A;  1PVB A;  1BR1 B;  1TNW A;  2MA2 A;  4CID A;  5BPJ A;  2HPS A;  1QAT A;  3I5I B;  1J1E A;  1XFW O;  2L0P A;  2R2I A;  1S26 D;  2BBM A;  2JOJ A;  2GGM A;  2WCE A;  3JTD C;  1FPW A;  1C7V A;  1QV0 A;  1QS7 A;  2BBN A;  2LUX A;  2K61 A;  3MSE B;  1Y1X A;  1K93 D;  1CKK A;  2I94 A;  1MR8 A;  1MXL C;  2QPT A;  1F8H A;  4QJ5 B;  3EVV A;  5TNC A;  2I2R E;  1KSM A;  1QTX A;  4N1G A;  1F70 A;  2BKH B;  1XVJ A;  1ALV A;  4XJK B;  1J7R A;  3SG5 A;  5HYD A;  3O6B A;  3SG6 A;  1KSO A;  2P6B B;  2SCP A;  1IH0 A;  4N1F A;  1QLK A;  3LK0 A;  2WOR A;  3DVE A;  4D1E A;  1SCM B;  1RK9 A;  2H2K A;  1NP8 A;  1YUT A;  4I5N B;  4MBE A;  4YGB B;  1IKU A;  1DJG A;  3LCP C;  1JC2 A;  2M29 A;  3AKB A;  3OB2 B;  3I5H B;  3WHU B;  1BOC A;  1L7Z A;  3HX4 A;  1A03 A;  4JWQ A;  1XK4 A;  3VRR A;  3DF0 B;  1YX7 A;  1QIW A;  5AEQ A;  3WXA A;  1BR4 B;  4MLW A;  3M0W A;  5I2O A;  3A4U B;  4GUK A;  4TNC A;  2JT0 A;  1TCF A;  5K89 A;  1OMR A;  1Y1A A;  1XFX O;  3NSL A;  3IQO A;  3SJS A;  1CM4 A;  1PUL A;  3IF7 A;  2WCB A;  3OHM B;  1LIN A;  2FJU B;  2NLN A;  2VRG A;  2JT8 A;  1KK8 B;  1UWO A;  1QVI Z;  1XK4 C;  2LLU A;  4C0J A;  1OSA A;  4DIR A;  3FS7 A;  1SMG A;  1NX1 A;  2EHB A;  1KFU L;  2K7O A;  2LNK A;  1H8B A;  1TRF A;  4YI9 A;  1RRO A;  1TOP A;  2L4H A;  3BUO B;  4YGE B;  1MXE A;  1QAS A;  5AFP A;  3QRX A;  1CM1 A;  2KGR A;  4AOM A;  2A4J A;  2ZND A;  1JWD A;  1K9U A;  1F55 A;  3SIB A;  3FWB A;  1N65 A;  1LXF C;  1NCZ A;  1WDC C;  1B7T Z;  2NZ0 A;  5HKZ A;  1HQV A;  3OX5 A;  2JQ6 A;  3K21 A;  1BOD A;  1TNQ A;  2MRD A;  5KU1 A;  3DD4 A;  2JTT A;  4L9M A;  1KWO C;  1HT9 A;  3DVK A;  1DMO A;  1H4B A;  2D8N A;  1EG3 A;  3H4S E;  1IQ3 A;  1RJV A;  1C07 A;  3TDU A;  3I5F C;  3PLF B;  1PSB A;  1MQ1 A;  3NSK A;  2M7L A;  3O2P A;  2MBX A;  3SG4 A;  1SW8 A;  2KGB C;  1M63 B;  2LLT A;  5ER5 A;  5CSJ A;  1NUB A;  2KAY A;  1B8L A;  1OZS A;  1DF0 A;  3TS5 B;  1ALW A;  1CDP A;  2JU0 A;  4USL A;  1CFF A;  4GBA A;  1QVI Y;  3KHE A;  4Q04 A;  5CSF A;  1UHI A;  1DGV A;  2WOS A;  3CGA A;  1FF1 A;  3FWC A;  4MEW A;  2JWW A;  1U5I B;  1CLL A;  2LE9 B;  1OE9 B;  2K7B A;  2PAL A;  4FQO A;  4PHK A;  4ETO A;  1WRL A;  2KBM A;  2LHL A;  1TNP A;  2EC6 C;  2F2O A;  4N5X A;  1QX7 A;  2L51 A;  1XA5 A;  3BQ3 A;  2BL0 C;  3JVT C;  1JF0 A;  4PE0 A;  4BY4 A;  1YR5 A;  1B7T Y;  1GJY A;  2Q4U A;  2KHN A;  1JBA A;  3FIA A;  2K7C A;  4AQJ A;  1M46 A;  3BUM B;  1SPY A;  2KQ6 A;  1JUO A;  1CFP A;  2KSP A;  2L50 A;  4F0Z B;  1SYM A;  1MUX A;  2LVV A;  4OV2 A;  2HQ8 A;  4FTG A;  3EVR A;  3PN7 B;  1CTR A;  1UUS A;  3HCM A;  1DJX A;  4WRI A;  2G9B A;  1CNP A;  2HET A;  1B8C A;  3O78 A;  3F45 A;  5HLV A;  1L2O C;  1Y0V H;  4NDB A;  1BG1 A;  5I2Q A;  4GGF A;  4P2Y B;  1K94 A;  1S5G Z;  3KEV A;  1A75 B;  2L4I A;  4BY5 A;  1DJI A;  2KDH A;  5JJG A;  2E6W A;  1W7I B;  1KFU S;  1A4P A;  1CLB A;  3BOW B;  1SL8 A;  1IJ5 A;  2K2A A;  1KQM C;  1S1E A;  4MRX A;  4A4C A;  1WLM A;  1B9A A;  1KFX L;  1UUR A;  2JNX A;  3PM8 A;  5I8N A;  1OZO A;  2KI4 B;  2KFG A;  4GGF C;  1B8R A;  2F3Y A;  4JQ0 D;  4MZK A;  1KWO B;  2E30 A;  4C0L A;  1AJ4 A;  1R6P A;  1CDL A;  1IRJ A;  2M1K B;  3BUN B;  2PMY A;  3KO0 A;  2KAX A;  2LV7 A;  1FBV A;  2SAS A;  3CZT X;  1BF5 A;  1PVA A;  1FW4 A;  4CFR A;  2WND A;  4DUQ A;  2CNP A;  4JPZ B;  1N2D A;  4ORC B;  4OCI A;  3TUY B;  5CPV A;  2OTG C;  1U5I A;  2LVK A;  5KTY A;  1CLM A;  3AAK A;  4CPV A;  4GNK B;  1M45 A;  4GFT A;  2KI6 C;  2Y1M A;  4ICB A;  2O60 A;  2MLF C;  1NWD A;  3DVJ A;  1CDM A;  1NX0 A;  2KI6 D;  1DJY A;  2MLE C;  1SRA A;  1RFJ A;  2Q91 A;  4PCW A;  2Y4Q A;  1M39 A;  1WRZ A;  2KYF A;  1S5G Y;  5CSI A;  4U8D A;  4OR9 B;  3SIA A;  1EJ3 A;  2EC6 B;  1PK0 D;  2K2F A;  5J3X A;  3ZNI A;  1Y1U A;  2JRF A;  3BXK A;  1PSR A;  4YGA A;  1SK6 D;  3CTN A;  1CMF A;  2JC2 A;  1K95 A;  4C0K A;  3GOF A;  1SR6 B;  1V1F A;  1ZFS A;  3O4Y A;  4ORA B;  1BJF A;  2JXC A;  4YBH B;  1YRU B;  1XFY O;  3LK1 A;  3GK2 A;  4GAO A;  2F3Z A;  1TNX A;  1ZOT B;  1M31 A;  1QX2 A;  1F4O A;  5JOL A;  1IQ5 A;  1XFZ O;  4HRE E;  2PAS A;  1B1G A;  1GGW A;  2WC8 A;  1A29 A;  4PDZ A;  4M2P A;  1N0Y A;  1NX2 A;  1NYA A;  4XJK A;  1DT7 B;  2LP3 A;  4M2O A;  1GQM A;  3I5I C;  1J1D A;  2I7A A;  3OB1 B;  3JTD B;  1XFU O;  2ZNE A;  1D1O A;  1OQP A;  3CR5 X;  2ZN9 A;  1SNL A;  1RWY A;  3BUW B;  3VRP A;  2HF5 A;  3TDZ A;  5I2L A;  1QV1 A;  2JZI A;  2KBI A;  3CLN A;  1J7O A;  1IWQ A;  1E8A A;  1RTP 1;  2CTN A;  1SL7 A;  1LA0 A;  3LLE A;  4CFQ A;  1WRK A;  2NCO A;  1DJH A;  1G8I A;  4YI8 A;  1DJZ A;  1Q80 A;  2M9G A;  1UHJ A;  1W7J B;  3RM1 A;  3DF0 A;  2GV5 A;  1KFX S;  1BMO A;  2BEC A;  3WHT B;  1WY9 A;  2OPO A;  2MAZ A;  3CR2 A;  4IL1 A;  1YVH A;  1SCM C;  3DVM A;  1F54 A;  2KFF A;  3E3R A;  3D0Y B;  1SL9 A;  1CFC A;  1X02 A;  1AP4 A;  2PRU A;  5D69 A;  1OMV A;  1KCY A;  2DOQ A;  3I5H C;  1JFJ A;  4HRH A;  1TCO B;  2KNE A;  4MRY A;  5IBW A;  1GGZ A;  2AMI A;  1DJW A;  1NCY A;  2NXQ A;  1YUS A;  3NXA A;  1TTX A;  2MJW B;  1K9K A;  4XYN A;  5AER A;  1IG5 A;  1PRW A;  2LVJ A;  2M49 B;  2JXL A;  2TN4 A;  1S36 A;  4M2Q A;  1TIZ A;  4YGC B;  1S3P A;  5AAN A;  1KK8 C;  3EKJ A;  1S6J A;  4MZL A;  1EXR A;  1J7P A;  1OOJ A;  1A2X A;  2LP2 A;  2QAC A;  1NIW A;  1XFV O;  2MHH A;  4PHM A;  5AXI A;  2OS8 C;  4WQ2 A;  4I5L B;  4A4B A;  2COL B;  1LVC D;  1WDC B;  2K0J A;  5DKN A;  4PHJ A;  4NQG A;  1KK7 Z;  3PSR A;  2Y1N A;  3BUX B;  1QIV A;  5KSZ A;  3AKA A;  4QJ4 B;  2AAO A;  3WNX B;  1J7Q A;  5GQQ C;  1PAL A;  2M1U A;  2IS9 A;  1WLZ A;  1JSA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...