1RFJA

Crystal structure of potato calmodulin pcm6
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
148
structure length
148
Chain Sequence
MADQLTEDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYDEFVKVMMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords calmodulin
publication title Structure of potato calmodulin PCM6: the first report of the three-dimensional structure of a plant calmodulin.
pubmed doi rcsb
source organism Solanum tuberosum
total genus 59
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2003-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1rfjA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1rfjA02
1WLZA 4PALA 1SR6C 4XYNA 4ETOA 3TUYB 4XJKA 4YI8A 1SK6D 3GK4X 3RLZA 1KWOC 1A2XA 1DJZA 1MQ1A 3KEVA 1AHRA 3EK4A 1PSBA 2WC8A 3BUXB 2K61A 5CSNA 2HPSA 2M3WA 1JF0A 1NX1A 2FJUB 3DD4A 4YGDB 1C7VA 1HT9A 1S6JA 1FW4A 1TNPA 2BL0B 2MRDA 1NX3A 2QACA 4OVNF 1KSOA 1CFCA 1CM4A 1S6CA 2K7BA 2KI6C 2LVIA 2CT9A 5AERA 1C07A 1J1EA 1J7OA 2HQ8A 4MRXA 3C1VA 2COLB 3I5IB 5FYXA 4MZLA 1TNWA 3BUMB 1A75B 1SYMA 2KFHA 4CFQA 4A4CA 4JPZB 3ZWHA 2LVVA 1M63B 1CLBA 3SG3A 1DT7B 2JXLA 2H2KA 1IG5A 1QIVA 1BOCA 1JC2A 1UHHA 2CCMA 2K7CA 3PFVA 2LUXA 1R6PA 3VGOA 4R1EA 1AUIB 1M46A 1V1GA 1U5IA 2JWWA 4GNKB 2WCEA 2MBXA 1KSMA 5AXIA 1M31A 2M9GA 4YGCB 1B8RA 1QATA 5HKZA 2M29A 1MHOA 1YX8A 2F2PA 2KFGA 2KI4C 2M1KB 3TDIA 2Y1NA 3SIBA 5HLVA 4DUQA 5JOLA 5D69A 2HF5A 2Y5IA 2FOTA 3CGAA 2LP2A 2BCBA 2BKHB 1SKTA 1K94A 2LCPA 3CS1A 3I5HB 2L4HA 2DOQA 1H4BA 1L2OB 1IWQA 1X02A 1S5GZ 2E6WA 1VRKA 2L4IA 2LLSA 3OX5A 2SCPA 1ZUZA 2G9BA 4C0KA 1S26D 2O60A 2G2BA 1QX7A 3LK1A 1R2UA 3DVJA 3JVTC 3BXKA 1YTZC 3D0YA 3BQ3A 2BCXA 5KU1A 1OSAA 2L0PA 3TZ1A 1DJWA 1TIZA 3AKBA 5HYDA 3H4SE 1EG3A 1NYAA 1LA0A 4L9MA 1CMFA 1G4YR 3SIAA 3HX4A 1AJ4A 1W7JB 2K8MB 1WLMA 2LVKA 4MSPA 3I5FB 2F8PA 2NXQA 2JRFA 3PALA 2KGBC 1RROA 2LHIA 1XYDA 1Y6WA 3GK2A 1UHKA 4ZCUA 1OE9B 1QASA 1F4QA 4BY5A 2D8NA 3SG6A 1MWNA 1J7QA 1NIWA 4NDDA 2KNEA 1CMGA 4FTGA 1Y0VH 1W7IB 1N0YA 1WY9A 1BMOA 1K96A 1KQMC 1XA5A 4YBHB 4I5NB 4GGNA 1H8BA 3CR4X 4M2QA 1XO5A 1GJYA 1QVIY 3QRXA 3TUYC 1NUBA 1IQ5A 5I8NA 1ODBA 3OHMB 4PE4A 2VRGA 3A8RA 2MHHA 1ZMZA 2WCBA 1G33A 1Y1UA 5F6TA 3CR5X 3O2PA 1CLMA 2ZRTA 4WRIA 3MSEB 3VRNA 2BL0C 2LLTA 2PRUA 2BKIB 1SBJA 1RWYA 2KSPA 1FBVA 5JJGA 1MR8A 1S6IA 4GUKA 4PHNA 2JTZA 2KQYA 3I5IC 3AKAA 2LUCA 2QPTA 4GBAA 4M2OA 4AQIA 4CLNA 2K7OA 1QJTA 1OZOA 5DKRA 3SJSA 1MXEA 1S3PA 1GGWA 2GGZA 3EKHA 3I5GB 4JWQA 2MAZA 1JUOA 1QV1A 1XK4C 2MLEC 2ZRSA 2F3ZA 1F4OA 3KF9A 3RM1A 4FQOA 1G8IA 1LVCD 2KBMA 1L7ZA 4YRUA 2WOSA 1F55A 3BUNB 2MA2A 4ZCVA 1JBAA 2BECA 3BOWB 1A75A 4GAOA 4DS7A 5B8IB 1TOPA 1WRLA 2LANA 3O78A 3BYAA 1B1GA 2M1UA 2M8UA 1B8LA 1XVJA 2H61C 1EH2A 1KFXS 2LV7A 1XK4A 4YGBB 5AFPA 1Y1AA 4CPVA 3TDZA 3AAKA 1DF0B 1UWOA 4HRGA 2KBIA 1YURA 4NQGA 1A03A 4MVFA 2JULA 2ZNEA 1DJHA 1NCZA 2AUCA 2L98A 1PK0D 1NCXA 1BG1A 1B9AA 3NSLA 1PSRA 4QJ4B 1RK9A 3JTDB 1EL4A 3A4UB 2CBLA 1JSAA 1WDCB 3I5HC 1GQMA 2H61A 2I7AA 1L2OC 2OTGB 3CWGA 1ZOTB 2KAYA 3EK7A 3EKJA 1K90D 5ER5A 5IBWA 5KSZA 2PASA 1RECA 1ALVA 5DKNA 1BU3A 1YR5A 1KK8B 4YGEB 2JC2A 5BPJA 1CDNA 1CM1A 1K93D 1K9PA 1IRJA 2F33A 4GGFC 1CDLA 2AMIA 1AJ5A 4PHMA 1QX2A 2EHBA 2K0JA 1V1FA 2ZN9A 1QX5B 2M97A 5HKWA 4I5KA 5CSJA 2LMUA 3PSRA 3FS7A 2OS8B 3DF0B 3OB1B 4NDCA 2MLFC 1MXLC 5CSFA 2F2OA 4F0ZB 1JF2A 2JT0A 4OCIA 1FI6A 5J3XA 1PRWA 4GGFA 4PE7A 2NZ0A 3I5FC 1IQ3A 3SG2A 1B8CA 2E30A 1LA3A 1N65A 2LVJA 2JU0A 1N2DA 3VRQA 1TCFA 4GPLB 1S5GY 2M7NA 3IF7A 1RJVA 4MZKA 2GV5A 4UPGA 4NDBA 3FIAA 4N1FA 1WRZA 4DRWA 1IKUA 2F3YA 1F71A 2KGRA 4OKHA 3F45A 1SRAA 1PVAA 2L50A 2LMTA 1ZACA 1AK8A 2TN4A 4WQ2A 2K7DA 1BR4B 3AAJA 4QJ5B 2IS9A 1B7TZ 3PN7B 1WRKA 4C0JA 1XFWO 2LAPA 1IJ6A 1XFXO 1RFJA 4Q04A 3VRRA 2MJWB 1XFYO 1F54A 2JNXA 3FWCA 2WORA 1OOJA 2LE9B 4ORCB 1SCVA 5TNCA 5HKYA 2ZNDA 2I94A 1B7TY 4QJ3B 5AEQA 1KFUL 3GK1A 2KI6D 3BUWB 2KQ6A 4D1EA 1Q80A 4OR9B 3K21A 3FWBA 2KOTA 1F70A 1B47A 4GFTA 2O5GA 1M45A 1CB1A 4M2PA 2K2AA 1JWDA 4HREE 1NWDA 1CLLA 4YI9A 5DKQA 1CNPA 2I2RE 3D10A 3I5GC 2KYFA 1CDPA 3SG5A 1OMDA 1YVLA 3EVVA 2ZKMX 2KAVA 4I5JA 4WQ3A 1NPQA 3SG7A 2KAXA 1LXFC 3CR2A 1QXPA 1ZFSA 1K9UA 2BE6A 2JQ6A 1K95A 1GGZA 3O6BA 3TDUA 1E8AA 1J7RA 1J7PA 3DVMA 2KFFA 3M0WA 2JTTA 2P6BB 3EK8A 4MEWA 3TS5B 4MZJA 2RGIA 1NP8A 1Y1XA 4ICBA 4AQJA 1C7WA 1PALA 2LM5A 2M7LA 1SCMB 5I2LA 1BR1B 1UURA 2EC6B 4ORAB 4USLA 1IJ5A 4OV2A 3EVUA 3WNXB 3LCPC 2L51A 3LLEA 2SASA 1A4PA 1S1EA 2Q4UA 2ISDA 4P2YB 2JT8A 1JFKA 2WNDA 1UHIA 2CTNA 1UHNA 2JZIA 1QS7A 3BOWA 4TNCA 1K2HA 3O4YA 1ALWA 1QV0A 2B1UA 3JTDC 2LC5A 4U8DA 4PCWA 1IGVA 4XJKB 1WDCC 1DGVA 1KK7Z 3LL8B 3HCMA 1DGUA 2OTGC 1YUTA 5HLOA 3SG4A 1YRTB 2K2FA 1DJYA 1S36A 4HRHA 1DF0A 4A4BA 4CIDA 4C0LA 1CFFA 2BBNA 1KK8C 1LKJA 2BE4A 1PVBA 3WXAA 2Y1MA 3CTNA 1NX0A 3CLNA 1DJXA 4BY4A 3ICBA 5AANA 1K9KA 1SR6B 1UHJA 3VROA 1KFXL 1KK7Y 1TRFA 3NSOA 1IH0A 2BCAA 1KWOB 1SL8A 5GQQC 1M39A 2LNKA 3OP0A 1K8UA 2FCDA 2PMYA 1CFPA 2AAOA 3NXAA 2L2EA 2OS8C 3WHUB 2BBMA 1TNXA 3KO0A 4CFRA 2NCPA 5KTYA 1KCYA 1SL9A 2HETA 2FCEA 1BODA 1PULA 2M49B 2JT3A 4MRYA 1U5IB 1NSHA 4PHKA 3DF0A 1CFDA 5CSIA 1KQVA 3LK0A 1A29A 1YVHA 1UUSA 1DMOA 3ZNIA 2PSRA 2ZN8A 5ER4X 1AP4A 3GOFA 1BJFA 3DVKA 4N1GA 4ORBB 2Q91A 3PN7C 1SW8A 5D7FA 1OZSA 1SL7A 1OMVA 2LP3A 3CZTX 1BLQA 1FI5A 4DIRA 4MN0A 3IQQA 5PALA 1B4CA 2HQWA 2NLNA 2CNPA 4PE1A 1F8HA 2JNFA 5CPVA 1DJGA 2KI4B 1BF5A 2I18A 1EXRA 4N5XA 4JQ0D 5I2OA 1CKKA 2Y4QA 5K89A 3DVEA 2GGMA 1RTP1 1AVSA 3KPXA 4MLWA 2ZFDA 3D0YB 3KHEA 1J1DA 3OB2B 4YGAA 1D1OA 3E3RA 1YX7A 1NCYA 2LMVA 4PE0A 1SNLA 1EG4A 1TN4A 1CDMA 1SPYA 1DVIA 1FPWA 1QLKA 1UP5A 3NSIA 2CXJA 1XFUO 2KYCA 1OQPA 1JFJA 1LINA 1NX2A 1TTXA 3JVTB 4DCKA 3VRPA 1CTRA 1XFVO 2JXCA 2JOJA 2JPTA 2OPOA 3OX6A 3IQOA 5I2QA 1YUUA 1QIWA 3TS5C 1DTLA 4P5OE 1KFUS 3NSKA 1QVIZ 2LHLA 1SMGA 1DJIA 4PHJA 1J55A 1SCMC 2V53A 3BUOB 1SY9A 2EC6C 1HQVA 4E68A 1TCOB 1MF8B 3PM8A 1EJ3A 3WHTB 3PATA 1BT6A 1MUXA 2A4JA 2NCOA 4PDZA 5G08A 1XFZO 1YUSA 3EVRA 4AOMA 2PALA 1TNQA 2L5XB 1YRUB 4IL1A 4HSZA 2PVBA 2KDHA 1QTXA 3PLFB 4MBEA 2LLUA 2R2IA 2EGDA 1OMRA 1KQMB 1FF1A 4I5LB 2WCFA 1QLSA 2KHNA 2M0RA
chains in the Genus database with same CATH superfamily
1WLZA 4PALA 1SR6C 4XYNA 4ETOA 3TUYB 4XJKA 3D76A 4YI8A 1SK6D 3GK4X 3RLZA 1KWOC 1A2XA 5FI2A 1DJZA 1MQ1A 3KEVA 1AHRA 3EK4A 1PSBA 2WC8A 3BUXB 2K61A 5CSNA 2HPSA 2M3WA 1JF0A 1NX1A 2FJUB 3DD4A 4YGDB 1C7VA 1HT9A 1S6JA 1FW4A 1TNPA 2BL0B 2MRDA 1NX3A 2QACA 3EG5B 1KSOA 1CFCA 1CM4A 1S6CA 1OOHA 2K7BA 2KI6C 2CT9A 2LVIA 2QDIA 1J1EA 5AERA 1C07A 2HQ8A 4MRXA 3C1VA 4OZDA 2COLB 3I5IB 5FYXA 4MZLA 1TNWA 3BUMB 1A75B 1SYMA 2KFHA 4CFQA 2WCLA 4A4CA 4JPZB 3ZWHA 2QEBA 2LVVA 1M63B 1CLBA 3SG3A 1DT7B 2JXLA 1OOGA 1IG5A 2H2KA 1QIVA 1BOCA 1JC2A 3WNXB 1UHHA 2CCMA 1Z2CB 2K7CA 3PFVA 2LUXA 1R6PA 3VGOA 4R1EA 1AUIB 1M46A 1V1GA 1U5IA 2JWWA 4GNKB 2WCEA 2MBXA 1KSMA 5AXIA 1M31A 2M9GA 4YGCB 1B8RA 2QEVA 1QATA 4FQTA 5HKZA 2M29A 1MHOA 3S0EA 1YX8A 2F2PA 2KFGA 2KI4C 2M1KB 3TDIA 1OW4A 2FJYA 2Y1NA 3SIBA 5HLVA 4DUQA 5JOLA 5D69A 2HF5A 2Y5IA 2FOTA 3CGAA 2LP2A 2BCBA 2BKHB 1SKTA 3N7HA 1K94A 2LCPA 3CS1A 5DICA 3I5HB 2L4HA 5FI7A 5FI6A 2DOQA 1H4BA 1L2OB 4PT1A 1IWQA 1X02A 1S5GZ 2E6WA 1VRKA 2L4IA 2LLSA 3OX5A 2SCPA 1ZUZA 2G9BA 4C0KA 1S26D 2O60A 5EL2A 3IVTA 3Q8IA 2G2BA 1QX7A 1TUZA 3LK1A 1R2UA 3DVJA 3JVTC 3BXKA 1YTZC 3D0YA 3BQ3A 1XFRA 2BCXA 5KU1A 1OSAA 4IJ7A 1LS8A 2L0PA 3TZ1A 1DJWA 1TIZA 3AKBA 5HYDA 3H4SE 1EG3A 1NYAA 3B6XA 3BFAA 1LA0A 4L9MA 1CMFA 2ERBA 3S0BA 1G4YR 1GM0A 3SIAA 3HX4A 3PJIA 1AJ4A 1W7JB 2K8MB 1WLMA 2LVKA 4MSPA 3I5FB 2F8PA 2NXQA 2JRFA 3PALA 2KGBC 1RROA 2LHIA 1XYDA 1Y6WA 3DYEA 3GK2A 1UHKA 4ZCUA 5HL1A 1J7OA 1OE9B 1QASA 1F4QA 4BY5A 2D8NA 3SG6A 1MWNA 1J7QA 1NIWA 4NDDA 2KNEA 1CMGA 4FTGA 1Y0VH 1W7IB 2K60A 1N0YA 1WY9A 1BMOA 1K96A 1KQMC 1XA5A 2QEHA 4I5NB 4YBHB 4GGNA 1H8BA 3CR4X 3DZTA 1ORGA 4M2QA 1XO5A 1GJYA 1QVIY 3QRXA 3TUYC 1NUBA 1IQ5A 3O4XA 5I8NA 1ODBA 3OHMB 5I94A 4PE4A 2VRGA 3A8RA 2MHHA 1ZMZA 2WCBA 1G33A 1Y1UA 5F6TA 3UNWA 3CR5X 3O2PA 1CLMA 2ZRTA 4WRIA 3MSEB 3VRNA 2BL0C 2LLTA 2PRUA 2BKIB 3B87A 1SBJA 1RWYA 2KSPA 1FBVA 5JJGA 1MR8A 1S6IA 4GUKA 4PHNA 2JTZA 2KQYA 3I5IC 1OOIX 2QEOA 3AKAA 2LUCA 2QPTA 4GBAA 4M2OA 4AQIA 4CLNA 1DQEA 2K7OA 1QJTA 1OZOA 3B88A 4F7FA 5DKRA 3SJSA 1MXEA 1S3PA 2P71A 1GGWA 2GGZA 3EKHA 3FE8A 4JD9A 3D75A 3I5GB 4JWQA 2MAZA 1JUOA 1QV1A 1XK4C 2MLEC 2ZRSA 2F3ZA 1F4OA 3KF9A 3RM1A 3B7AA 4FQOA 1G8IA 3SS4A 1LVCD 2KBMA 1L7ZA 4YRUA 2WOSA 3OGNA 1F55A 3BUNB 3S0DA 2MA2A 4ZCVA 1JBAA 2BECA 3BOWB 1A75A 4GAOA 4DS7A 3FE9A 5B8IB 1TOPA 1WRLA 2LANA 3O78A 3BYAA 1B1GA 2M1UA 2M8UA 1B8LA 3FE6A 1XVJA 2H61C 1EH2A 1TUJA 1OOFA 1KFXS 2LV7A 1XK4A 4YGBB 5AFPA 1Y1AA 4CPVA 3TDZA 3AAKA 1DF0B 1UWOA 4HRGA 2KBIA 1YURA 4NQGA 1A03A 4MVFA 2JULA 2ZNEA 1DJHA 1NCZA 2AUCA 2L98A 1PK0D 1NCXA 1BG1A 1B9AA 2BNXA 1PSRA 3NSLA 4QJ4B 1RK9A 3JTDB 1EL4A 3A4UB 2CBLA 5D3OA 1JSAA 1WDCB 3I5HC 1GQMA 2H61A 2I7AA 1L2OC 2OTGB 3CWGA 4INXA 1ZOTB 2KAYA 3EK7A 3EKJA 1K90D 5ER5A 5IBWA 5KSZA 2PASA 1RECA 1ALVA 5DKNA 1BU3A 2PYQA 1YR5A 1KK8B 4JKTA 4YGEB 2JC2A 5BPJA 1CDNA 1CM1A 1K93D 1SSEB 1K9PA 1IRJA 2F33A 4GGFC 1CDLA 2AMIA 1AJ5A 4PHMA 4KYNA 1QX2A 2EHBA 2K0JA 1V1FA 2ZN9A 3D74A 2BAPA 1QX5B 2M97A 5HKWA 3OBVA 4I5KA 5CSJA 2LMUA 3PSRA 3FS7A 2OS8B 3DF0B 3OB1B 4NDCA 2MLFC 1MXLC 5CSFA 2F2OA 4F0ZB 1JF2A 3R1VA 2JT0A 4OCIA 1FI6A 2GTEA 5J3XA 3K1EA 1PRWA 3R72A 4GGFA 4PE7A 2NZ0A 3D78A 3I5FC 3S0GA 1IQ3A 3SG2A 1B8CA 2E30A 1LA3A 1N65A 1QWVA 2LVJA 2JU0A 1N2DA 1DELA 3VRQA 1TCFA 4GPLB 1S5GY 2M7NA 3IF7A 1RJVA 4MZKA 2GV5A 4UPGA 4NDBA 3FIAA 4N1FA 1WRZA 4DRWA 1IKUA 2F3YA 1F71A 2KGRA 4OKHA 3F45A 1SRAA 1PVAA 2L50A 2LMTA 1ZACA 2WCMA 1AK8A 2TN4A 4WQ2A 2K7DA 1BR4B 3AAJA 4QJ5B 2IS9A 1B7TZ 3PN7B 1WRKA 3CZ2A 4C0JA 1XFWO 2WCKA 2LAPA 1IJ6A 1XFXO 1RFJA 4Q04A 3VRRA 2MJWB 1XFYO 2L2CA 1F54A 2JNXA 3FWCA 3VB1A 2WORA 1OOJA 2LE9B 4ORCB 1SCVA 5TNCA 5HKYA 2ZNDA 2I94A 1B7TY 4QJ3B 2JPOA 5AEQA 1KFUL 3BFBA 3GK1A 2KI6D 3NGVA 3BUWB 3D77A 2KQ6A 4D1EA 1Q80A 4OR9B 3K21A 3FWBA 2KOTA 3NHIA 1F70A 1B47A 4GFTA 2O5GA 1M45A 3CABA 1CB1A 4M2PA 2K2AA 1JWDA 4HREE 1NWDA 1CLLA 4YI9A 5DKQA 3R1OA 1CNPA 2I2RE 3D10A 3I5GC 2KYFA 1CDPA 3SG5A 1OMDA 1YVLA 3CYZA 2ZKMX 3EVVA 2KAVA 4I5JA 4WQ3A 3B86A 1NPQA 3SG7A 2KAXA 3CZ1A 1LXFC 3CR2A 1QXPA 1ZFSA 1K9UA 2BE6A 2JQ6A 1K95A 1GGZA 3O6BA 3TDUA 1E8AA 1J7RA 1J7PA 3DVMA 2KFFA 3M0WA 3R1PA 2JTTA 2P6BB 3EK8A 4MEWA 3TS5B 4MZJA 2RGIA 1NP8A 1Y1XA 4ICBA 3SS3A 1C7WA 1PALA 2LM5A 2M7LA 4AQJA 1P28A 1SCMB 5I2LA 1BR1B 1UURA 2EC6B 3L4AA 4ORAB 1IJ5A 4OV2A 3EVUA 4USLA 3LCPC 3RZSA 2L51A 1C3YA 3LLEA 2SASA 1A4PA 1S1EA 2Q4UA 2PQLA 3BJHA 3DXLA 2ISDA 4P2YB 2JT8A 1JFKA 2WNDA 1UHIA 2CTNA 1UHNA 2JZIA 1QS7A 3BOWA 4TNCA 1K2HA 3O4YA 1ALWA 1QV0A 2B1UA 4INWA 3JTDC 2LC5A 4U8DA 1Z4HA 4PCWA 1IGVA 4XJKB 1WDCC 1DGVA 1KK7Z 3LL8B 3HCMA 1DGUA 1W9ZA 1YUTA 2OTGC 5HLOA 3SG4A 1YRTB 2K2FA 1DJYA 1S36A 4HRHA 1DF0A 4A4BA 4CIDA 4C0LA 1CFFA 2BBNA 1KK8C 1LKJA 2BE4A 1PVBA 3WXAA 2Y1MA 3CTNA 3DY9A 1NX0A 3CLNA 1DJXA 4BY4A 3ICBA 5AANA 1K9KA 1SR6B 1UHJA 3VROA 1KFXL 1KK7Y 1TRFA 3NSOA 1IH0A 2BCAA 1KWOB 1SL8A 5GQQC 1M39A 2LNKA 2P70A 3OP0A 3BFHA 1K8UA 2FCDA 2PMYA 1CFPA 3D73A 2AAOA 3NXAA 3S0FA 2L2EA 2OS8C 3WHUB 2BBMA 1TNXA 2WC5A 3KO0A 4CFRA 2NCPA 5KTYA 1C3ZA 1KCYA 1SL9A 2HETA 2FCEA 1BODA 1PULA 2M49B 2JT3A 4MRYA 1U5IB 1NSHA 4PHKA 3DF0A 1CFDA 5CSIA 1KQVA 3LK0A 1A29A 1YVHA 1UUSA 1DMOA 3ZNIA 2PSRA 2ZN8A 5ER4X 2WCHA 1AP4A 3GOFA 1BJFA 3DVKA 4N1GA 4ORBB 3SS5A 2Q91A 3PN7C 1SW8A 5D7FA 1OZSA 1SL7A 1OMVA 2LP3A 3CZTX 1BLQA 1FI5A 4DIRA 4MN0A 3IQQA 5PALA 1B4CA 2HQWA 2NLNA 2CNPA 4PE1A 1F8HA 2JNFA 5CPVA 1DJGA 2KI4B 1BF5A 2I18A 3CDNA 1EXRA 3NHTA 4N5XA 2YGUA 4JQ0D 5I2OA 3PM2A 1CKKA 2Y4QA 5K89A 3DVEA 2GGMA 3QMEA 1RTP1 1AVSA 3KPXA 4MLWA 2ZFDA 3D0YB 2H8VA 3KHEA 3L4LA 1J1DA 3OB2B 1T14A 4YGAA 1D1OA 3E3RA 1YX7A 1NCYA 2LMVA 4PE0A 1SNLA 1EG4A 1TN4A 1CDMA 1SPYA 4OVNF 1DVIA 1FPWA 1QLKA 1UP5A 3NSIA 3V2LA 3L47A 2CXJA 1XFUO 2KYCA 1OQPA 3S0AA 1JFJA 1LINA 1NX2A 1TTXA 3JVTB 4DCKA 3VRPA 1CTRA 1XFVO 2JXCA 2JOJA 2JPTA 2OPOA 3OX6A 3IQOA 5I2QA 3UO9A 1YUUA 1QIWA 3TS5C 1DTLA 4P5OE 1KFUS 3NSKA 1QVIZ 2LHLA 1SMGA 1DJIA 4PHJA 1J55A 1SCMC 2V53A 3BUOB 1SY9A 2EC6C 1HQVA 4E68A 1IIOA 1TCOB 2L5YA 1MF8B 3PM8A 1EJ3A 3WHTB 3PATA 1BT6A 1MUXA 2A4JA 2NCOA 4PDZA 5G08A 1XFZO 1YUSA 3EVRA 4AOMA 2PALA 1TNQA 2KPHA 2L5XB 1YRUB 4IL1A 4HSZA 2KLDA 2PVBA 2KDHA 1QTXA 3PLFB 4MBEA 2LLUA 1DEKA 2R2IA 3CZ0A 2KLEA 2EGDA 2WC6A 2WCJA 1OMRA 1KQMB 1FF1A 1TWOA 4I5LB 1DC1A 2WCFA 1QLSA 2KHNA 2M0RA
chains in the Genus database with same CATH topology
1WLZA 4PALA 1SR6C 4XYNA 4ETOA 3TUYB 4XJKA 4YI8A 1SK6D 3GK4X 3RLZA 1KWOC 1A2XA 1DJZA 1MQ1A 3KEVA 1AHRA 3EK4A 1PSBA 2WC8A 3BUXB 2K61A 5CSNA 2HPSA 2M3WA 1JF0A 1NX1A 2FJUB 3DD4A 4YGDB 1C7VA 1HT9A 1S6JA 1FW4A 1TNPA 2BL0B 2MRDA 1NX3A 2QACA 4OVNF 1KSOA 1CFCA 1CM4A 1S6CA 2K7BA 2KI6C 2LVIA 2CT9A 5AERA 1C07A 1J1EA 1J7OA 2HQ8A 4MRXA 3C1VA 2COLB 3I5IB 5FYXA 4MZLA 1TNWA 3BUMB 1A75B 1SYMA 2KFHA 4CFQA 4A4CA 4JPZB 3ZWHA 2LVVA 1M63B 1CLBA 3SG3A 1DT7B 2JXLA 2H2KA 1IG5A 1QIVA 1BOCA 1JC2A 1UHHA 2CCMA 2K7CA 3PFVA 2LUXA 1R6PA 3VGOA 4R1EA 1AUIB 1M46A 1V1GA 1U5IA 2JWWA 4GNKB 2WCEA 2MBXA 1KSMA 5AXIA 1M31A 2M9GA 4YGCB 1B8RA 1QATA 5HKZA 2M29A 1MHOA 1YX8A 2F2PA 2KFGA 2KI4C 2M1KB 3TDIA 2Y1NA 3SIBA 5HLVA 4DUQA 5JOLA 5D69A 2HF5A 2Y5IA 2FOTA 3CGAA 2LP2A 2BCBA 2BKHB 1SKTA 1K94A 2LCPA 3CS1A 3I5HB 2L4HA 2DOQA 1H4BA 1L2OB 1IWQA 1X02A 1S5GZ 2E6WA 1VRKA 2L4IA 2LLSA 3OX5A 2SCPA 1ZUZA 2G9BA 4C0KA 1S26D 2O60A 2G2BA 1QX7A 3LK1A 1R2UA 3DVJA 3JVTC 3BXKA 1YTZC 3D0YA 3BQ3A 2BCXA 5KU1A 1OSAA 2L0PA 3TZ1A 1DJWA 1TIZA 3AKBA 5HYDA 3H4SE 1EG3A 1NYAA 1LA0A 4L9MA 1CMFA 1G4YR 3SIAA 3HX4A 1AJ4A 1W7JB 2K8MB 1WLMA 2LVKA 4MSPA 3I5FB 2F8PA 2NXQA 2JRFA 3PALA 2KGBC 1RROA 2LHIA 1XYDA 1Y6WA 3GK2A 1UHKA 4ZCUA 1OE9B 1QASA 1F4QA 4BY5A 2D8NA 3SG6A 1MWNA 1J7QA 1NIWA 4NDDA 2KNEA 1CMGA 4FTGA 1Y0VH 1W7IB 1N0YA 1WY9A 1BMOA 1K96A 1KQMC 1XA5A 4YBHB 4I5NB 4GGNA 1H8BA 3CR4X 4M2QA 1XO5A 1GJYA 1QVIY 3QRXA 3TUYC 1NUBA 1IQ5A 5I8NA 1ODBA 3OHMB 4PE4A 2VRGA 3A8RA 2MHHA 1ZMZA 2WCBA 1G33A 1Y1UA 5F6TA 3CR5X 3O2PA 1CLMA 2ZRTA 4WRIA 3MSEB 3VRNA 2BL0C 2LLTA 2PRUA 2BKIB 1SBJA 1RWYA 2KSPA 1FBVA 5JJGA 1MR8A 1S6IA 4GUKA 4PHNA 2JTZA 2KQYA 3I5IC 3AKAA 2LUCA 2QPTA 4GBAA 4M2OA 4AQIA 4CLNA 2K7OA 1QJTA 1OZOA 5DKRA 3SJSA 1MXEA 1S3PA 1GGWA 2GGZA 3EKHA 3I5GB 4JWQA 2MAZA 1JUOA 1QV1A 1XK4C 2MLEC 2ZRSA 2F3ZA 1F4OA 3KF9A 3RM1A 4FQOA 1G8IA 1LVCD 2KBMA 1L7ZA 4YRUA 2WOSA 1F55A 3BUNB 2MA2A 4ZCVA 1JBAA 2BECA 3BOWB 1A75A 4GAOA 4DS7A 5B8IB 1TOPA 1WRLA 2LANA 3O78A 3BYAA 1B1GA 2M1UA 2M8UA 1B8LA 1XVJA 2H61C 1EH2A 1KFXS 2LV7A 1XK4A 4YGBB 5AFPA 1Y1AA 4CPVA 3TDZA 3AAKA 1DF0B 1UWOA 4HRGA 2KBIA 1YURA 4NQGA 1A03A 4MVFA 2JULA 2ZNEA 1DJHA 1NCZA 2AUCA 2L98A 1PK0D 1NCXA 1BG1A 1B9AA 3NSLA 1PSRA 4QJ4B 1RK9A 3JTDB 1EL4A 3A4UB 2CBLA 1JSAA 1WDCB 3I5HC 1GQMA 2H61A 2I7AA 1L2OC 2OTGB 3CWGA 1ZOTB 2KAYA 3EK7A 3EKJA 1K90D 5ER5A 5IBWA 5KSZA 2PASA 1RECA 1ALVA 5DKNA 1BU3A 1YR5A 1KK8B 4YGEB 2JC2A 5BPJA 1CDNA 1CM1A 1K93D 1K9PA 1IRJA 2F33A 4GGFC 1CDLA 2AMIA 1AJ5A 4PHMA 1QX2A 2EHBA 2K0JA 1V1FA 2ZN9A 1QX5B 2M97A 5HKWA 4I5KA 5CSJA 2LMUA 3PSRA 3FS7A 2OS8B 3DF0B 3OB1B 4NDCA 2MLFC 1MXLC 5CSFA 2F2OA 4F0ZB 1JF2A 2JT0A 4OCIA 1FI6A 5J3XA 1PRWA 4GGFA 4PE7A 2NZ0A 3I5FC 1IQ3A 3SG2A 1B8CA 2E30A 1LA3A 1N65A 2LVJA 2JU0A 1N2DA 3VRQA 1TCFA 4GPLB 1S5GY 2M7NA 3IF7A 1RJVA 4MZKA 2GV5A 4UPGA 4NDBA 3FIAA 4N1FA 1WRZA 4DRWA 1IKUA 2F3YA 1F71A 2KGRA 4OKHA 3F45A 1SRAA 1PVAA 2L50A 2LMTA 1ZACA 1AK8A 2TN4A 4WQ2A 2K7DA 1BR4B 3AAJA 4QJ5B 2IS9A 1B7TZ 3PN7B 1WRKA 4C0JA 1XFWO 2LAPA 1IJ6A 1XFXO 1RFJA 4Q04A 3VRRA 2MJWB 1XFYO 1F54A 2JNXA 3FWCA 2WORA 1OOJA 2LE9B 4ORCB 1SCVA 5TNCA 5HKYA 2ZNDA 2I94A 1B7TY 4QJ3B 5AEQA 1KFUL 3GK1A 2KI6D 3BUWB 2KQ6A 4D1EA 1Q80A 4OR9B 3K21A 3FWBA 2KOTA 1F70A 1B47A 4GFTA 2O5GA 1M45A 1CB1A 4M2PA 2K2AA 1JWDA 4HREE 1NWDA 1CLLA 4YI9A 5DKQA 1CNPA 2I2RE 3D10A 3I5GC 2KYFA 1CDPA 3SG5A 1OMDA 1YVLA 3EVVA 2ZKMX 2KAVA 4I5JA 4WQ3A 1NPQA 3SG7A 2KAXA 1LXFC 3CR2A 1QXPA 1ZFSA 1K9UA 2BE6A 2JQ6A 1K95A 1GGZA 3O6BA 3TDUA 1E8AA 1J7RA 1J7PA 3DVMA 2KFFA 3M0WA 2JTTA 2P6BB 3EK8A 4MEWA 3TS5B 4MZJA 2RGIA 1NP8A 1Y1XA 4ICBA 4AQJA 1C7WA 1PALA 2LM5A 2M7LA 1SCMB 5I2LA 1BR1B 1UURA 2EC6B 4ORAB 4USLA 1IJ5A 4OV2A 3EVUA 3WNXB 3LCPC 2L51A 3LLEA 2SASA 1A4PA 1S1EA 2Q4UA 2ISDA 4P2YB 2JT8A 1JFKA 2WNDA 1UHIA 2CTNA 1UHNA 2JZIA 1QS7A 3BOWA 4TNCA 1K2HA 3O4YA 1ALWA 1QV0A 2B1UA 3JTDC 2LC5A 4U8DA 4PCWA 1IGVA 4XJKB 1WDCC 1DGVA 1KK7Z 3LL8B 3HCMA 1DGUA 2OTGC 1YUTA 5HLOA 3SG4A 1YRTB 2K2FA 1DJYA 1S36A 4HRHA 1DF0A 4A4BA 4CIDA 4C0LA 1CFFA 2BBNA 1KK8C 1LKJA 2BE4A 1PVBA 3WXAA 2Y1MA 3CTNA 1NX0A 3CLNA 1DJXA 4BY4A 3ICBA 5AANA 1K9KA 1SR6B 1UHJA 3VROA 1KFXL 1KK7Y 1TRFA 3NSOA 1IH0A 2BCAA 1KWOB 1SL8A 5GQQC 1M39A 2LNKA 3OP0A 1K8UA 2FCDA 2PMYA 1CFPA 2AAOA 3NXAA 2L2EA 2OS8C 3WHUB 2BBMA 1TNXA 3KO0A 4CFRA 2NCPA 5KTYA 1KCYA 1SL9A 2HETA 2FCEA 1BODA 1PULA 2M49B 2JT3A 4MRYA 1U5IB 1NSHA 4PHKA 3DF0A 1CFDA 5CSIA 1KQVA 3LK0A 1A29A 1YVHA 1UUSA 1DMOA 3ZNIA 2PSRA 2ZN8A 5ER4X 1AP4A 3GOFA 1BJFA 3DVKA 4N1GA 4ORBB 2Q91A 3PN7C 1SW8A 5D7FA 1OZSA 1SL7A 1OMVA 2LP3A 3CZTX 1BLQA 1FI5A 4DIRA 4MN0A 3IQQA 5PALA 1B4CA 2HQWA 2NLNA 2CNPA 4PE1A 1F8HA 2JNFA 5CPVA 1DJGA 2KI4B 1BF5A 2I18A 1EXRA 4N5XA 4JQ0D 5I2OA 1CKKA 2Y4QA 5K89A 3DVEA 2GGMA 1RTP1 1AVSA 3KPXA 4MLWA 2ZFDA 3D0YB 3KHEA 1J1DA 3OB2B 4YGAA 1D1OA 3E3RA 1YX7A 1NCYA 2LMVA 4PE0A 1SNLA 1EG4A 1TN4A 1CDMA 1SPYA 1DVIA 1FPWA 1QLKA 1UP5A 3NSIA 2CXJA 1XFUO 2KYCA 1OQPA 1JFJA 1LINA 1NX2A 1TTXA 3JVTB 4DCKA 3VRPA 1CTRA 1XFVO 2JXCA 2JOJA 2JPTA 2OPOA 3OX6A 3IQOA 5I2QA 1YUUA 1QIWA 3TS5C 1DTLA 4P5OE 1KFUS 3NSKA 1QVIZ 2LHLA 1SMGA 1DJIA 4PHJA 1J55A 1SCMC 2V53A 3BUOB 1SY9A 2EC6C 1HQVA 4E68A 1TCOB 1MF8B 3PM8A 1EJ3A 3WHTB 3PATA 1BT6A 1MUXA 2A4JA 2NCOA 4PDZA 5G08A 1XFZO 1YUSA 3EVRA 4AOMA 2PALA 1TNQA 2L5XB 1YRUB 4IL1A 4HSZA 2PVBA 2KDHA 1QTXA 3PLFB 4MBEA 2LLUA 2R2IA 2EGDA 1OMRA 1KQMB 1FF1A 4I5LB 2WCFA 1QLSA 2KHNA 2M0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WLZ A;  4PAL A;  1SR6 C;  4XYN A;  4ETO A;  3TUY B;  4XJK A;  4YI8 A;  1SK6 D;  3GK4 X;  3RLZ A;  1KWO C;  1A2X A;  1DJZ A;  1MQ1 A;  3KEV A;  1AHR A;  3EK4 A;  1PSB A;  2WC8 A;  3BUX B;  2K61 A;  5CSN A;  2HPS A;  2M3W A;  1JF0 A;  1NX1 A;  2FJU B;  3DD4 A;  4YGD B;  1C7V A;  1HT9 A;  1S6J A;  1FW4 A;  1TNP A;  2BL0 B;  2MRD A;  1NX3 A;  2QAC A;  4OVN F;  1KSO A;  1CFC A;  1CM4 A;  1S6C A;  2K7B A;  2KI6 C;  2LVI A;  2CT9 A;  5AER A;  1C07 A;  1J1E A;  1J7O A;  2HQ8 A;  4MRX A;  3C1V A;  2COL B;  3I5I B;  5FYX A;  4MZL A;  1TNW A;  3BUM B;  1A75 B;  1SYM A;  2KFH A;  4CFQ A;  4A4C A;  4JPZ B;  3ZWH A;  2LVV A;  1M63 B;  1CLB A;  3SG3 A;  1DT7 B;  2JXL A;  2H2K A;  1IG5 A;  1QIV A;  1BOC A;  1JC2 A;  1UHH A;  2CCM A;  2K7C A;  3PFV A;  2LUX A;  1R6P A;  3VGO A;  4R1E A;  1AUI B;  1M46 A;  1V1G A;  1U5I A;  2JWW A;  4GNK B;  2WCE A;  2MBX A;  1KSM A;  5AXI A;  1M31 A;  2M9G A;  4YGC B;  1B8R A;  1QAT A;  5HKZ A;  2M29 A;  1MHO A;  1YX8 A;  2F2P A;  2KFG A;  2KI4 C;  2M1K B;  3TDI A;  2Y1N A;  3SIB A;  5HLV A;  4DUQ A;  5JOL A;  5D69 A;  2HF5 A;  2Y5I A;  2FOT A;  3CGA A;  2LP2 A;  2BCB A;  2BKH B;  1SKT A;  1K94 A;  2LCP A;  3CS1 A;  3I5H B;  2L4H A;  2DOQ A;  1H4B A;  1L2O B;  1IWQ A;  1X02 A;  1S5G Z;  2E6W A;  1VRK A;  2L4I A;  2LLS A;  3OX5 A;  2SCP A;  1ZUZ A;  2G9B A;  4C0K A;  1S26 D;  2O60 A;  2G2B A;  1QX7 A;  3LK1 A;  1R2U A;  3DVJ A;  3JVT C;  3BXK A;  1YTZ C;  3D0Y A;  3BQ3 A;  2BCX A;  5KU1 A;  1OSA A;  2L0P A;  3TZ1 A;  1DJW A;  1TIZ A;  3AKB A;  5HYD A;  3H4S E;  1EG3 A;  1NYA A;  1LA0 A;  4L9M A;  1CMF A;  1G4Y R;  3SIA A;  3HX4 A;  1AJ4 A;  1W7J B;  2K8M B;  1WLM A;  2LVK A;  4MSP A;  3I5F B;  2F8P A;  2NXQ A;  2JRF A;  3PAL A;  2KGB C;  1RRO A;  2LHI A;  1XYD A;  1Y6W A;  3GK2 A;  1UHK A;  4ZCU A;  1OE9 B;  1QAS A;  1F4Q A;  4BY5 A;  2D8N A;  3SG6 A;  1MWN A;  1J7Q A;  1NIW A;  4NDD A;  2KNE A;  1CMG A;  4FTG A;  1Y0V H;  1W7I B;  1N0Y A;  1WY9 A;  1BMO A;  1K96 A;  1KQM C;  1XA5 A;  4YBH B;  4I5N B;  4GGN A;  1H8B A;  3CR4 X;  4M2Q A;  1XO5 A;  1GJY A;  1QVI Y;  3QRX A;  3TUY C;  1NUB A;  1IQ5 A;  5I8N A;  1ODB A;  3OHM B;  4PE4 A;  2VRG A;  3A8R A;  2MHH A;  1ZMZ A;  2WCB A;  1G33 A;  1Y1U A;  5F6T A;  3CR5 X;  3O2P A;  1CLM A;  2ZRT A;  4WRI A;  3MSE B;  3VRN A;  2BL0 C;  2LLT A;  2PRU A;  2BKI B;  1SBJ A;  1RWY A;  2KSP A;  1FBV A;  5JJG A;  1MR8 A;  1S6I A;  4GUK A;  4PHN A;  2JTZ A;  2KQY A;  3I5I C;  3AKA A;  2LUC A;  2QPT A;  4GBA A;  4M2O A;  4AQI A;  4CLN A;  2K7O A;  1QJT A;  1OZO A;  5DKR A;  3SJS A;  1MXE A;  1S3P A;  1GGW A;  2GGZ A;  3EKH A;  3I5G B;  4JWQ A;  2MAZ A;  1JUO A;  1QV1 A;  1XK4 C;  2MLE C;  2ZRS A;  2F3Z A;  1F4O A;  3KF9 A;  3RM1 A;  4FQO A;  1G8I A;  1LVC D;  2KBM A;  1L7Z A;  4YRU A;  2WOS A;  1F55 A;  3BUN B;  2MA2 A;  4ZCV A;  1JBA A;  2BEC A;  3BOW B;  1A75 A;  4GAO A;  4DS7 A;  5B8I B;  1TOP A;  1WRL A;  2LAN A;  3O78 A;  3BYA A;  1B1G A;  2M1U A;  2M8U A;  1B8L A;  1XVJ A;  2H61 C;  1EH2 A;  1KFX S;  2LV7 A;  1XK4 A;  4YGB B;  5AFP A;  1Y1A A;  4CPV A;  3TDZ A;  3AAK A;  1DF0 B;  1UWO A;  4HRG A;  2KBI A;  1YUR A;  4NQG A;  1A03 A;  4MVF A;  2JUL A;  2ZNE A;  1DJH A;  1NCZ A;  2AUC A;  2L98 A;  1PK0 D;  1NCX A;  1BG1 A;  1B9A A;  3NSL A;  1PSR A;  4QJ4 B;  1RK9 A;  3JTD B;  1EL4 A;  3A4U B;  2CBL A;  1JSA A;  1WDC B;  3I5H C;  1GQM A;  2H61 A;  2I7A A;  1L2O C;  2OTG B;  3CWG A;  1ZOT B;  2KAY A;  3EK7 A;  3EKJ A;  1K90 D;  5ER5 A;  5IBW A;  5KSZ A;  2PAS A;  1REC A;  1ALV A;  5DKN A;  1BU3 A;  1YR5 A;  1KK8 B;  4YGE B;  2JC2 A;  5BPJ A;  1CDN A;  1CM1 A;  1K93 D;  1K9P A;  1IRJ A;  2F33 A;  4GGF C;  1CDL A;  2AMI A;  1AJ5 A;  4PHM A;  1QX2 A;  2EHB A;  2K0J A;  1V1F A;  2ZN9 A;  1QX5 B;  2M97 A;  5HKW A;  4I5K A;  5CSJ A;  2LMU A;  3PSR A;  3FS7 A;  2OS8 B;  3DF0 B;  3OB1 B;  4NDC A;  2MLF C;  1MXL C;  5CSF A;  2F2O A;  4F0Z B;  1JF2 A;  2JT0 A;  4OCI A;  1FI6 A;  5J3X A;  1PRW A;  4GGF A;  4PE7 A;  2NZ0 A;  3I5F C;  1IQ3 A;  3SG2 A;  1B8C A;  2E30 A;  1LA3 A;  1N65 A;  2LVJ A;  2JU0 A;  1N2D A;  3VRQ A;  1TCF A;  4GPL B;  1S5G Y;  2M7N A;  3IF7 A;  1RJV A;  4MZK A;  2GV5 A;  4UPG A;  4NDB A;  3FIA A;  4N1F A;  1WRZ A;  4DRW A;  1IKU A;  2F3Y A;  1F71 A;  2KGR A;  4OKH A;  3F45 A;  1SRA A;  1PVA A;  2L50 A;  2LMT A;  1ZAC A;  1AK8 A;  2TN4 A;  4WQ2 A;  2K7D A;  1BR4 B;  3AAJ A;  4QJ5 B;  2IS9 A;  1B7T Z;  3PN7 B;  1WRK A;  4C0J A;  1XFW O;  2LAP A;  1IJ6 A;  1XFX O;  1RFJ A;  4Q04 A;  3VRR A;  2MJW B;  1XFY O;  1F54 A;  2JNX A;  3FWC A;  2WOR A;  1OOJ A;  2LE9 B;  4ORC B;  1SCV A;  5TNC A;  5HKY A;  2ZND A;  2I94 A;  1B7T Y;  4QJ3 B;  5AEQ A;  1KFU L;  3GK1 A;  2KI6 D;  3BUW B;  2KQ6 A;  4D1E A;  1Q80 A;  4OR9 B;  3K21 A;  3FWB A;  2KOT A;  1F70 A;  1B47 A;  4GFT A;  2O5G A;  1M45 A;  1CB1 A;  4M2P A;  2K2A A;  1JWD A;  4HRE E;  1NWD A;  1CLL A;  4YI9 A;  5DKQ A;  1CNP A;  2I2R E;  3D10 A;  3I5G C;  2KYF A;  1CDP A;  3SG5 A;  1OMD A;  1YVL A;  3EVV A;  2ZKM X;  2KAV A;  4I5J A;  4WQ3 A;  1NPQ A;  3SG7 A;  2KAX A;  1LXF C;  3CR2 A;  1QXP A;  1ZFS A;  1K9U A;  2BE6 A;  2JQ6 A;  1K95 A;  1GGZ A;  3O6B A;  3TDU A;  1E8A A;  1J7R A;  1J7P A;  3DVM A;  2KFF A;  3M0W A;  2JTT A;  2P6B B;  3EK8 A;  4MEW A;  3TS5 B;  4MZJ A;  2RGI A;  1NP8 A;  1Y1X A;  4ICB A;  4AQJ A;  1C7W A;  1PAL A;  2LM5 A;  2M7L A;  1SCM B;  5I2L A;  1BR1 B;  1UUR A;  2EC6 B;  4ORA B;  4USL A;  1IJ5 A;  4OV2 A;  3EVU A;  3WNX B;  3LCP C;  2L51 A;  3LLE A;  2SAS A;  1A4P A;  1S1E A;  2Q4U A;  2ISD A;  4P2Y B;  2JT8 A;  1JFK A;  2WND A;  1UHI A;  2CTN A;  1UHN A;  2JZI A;  1QS7 A;  3BOW A;  4TNC A;  1K2H A;  3O4Y A;  1ALW A;  1QV0 A;  2B1U A;  3JTD C;  2LC5 A;  4U8D A;  4PCW A;  1IGV A;  4XJK B;  1WDC C;  1DGV A;  1KK7 Z;  3LL8 B;  3HCM A;  1DGU A;  2OTG C;  1YUT A;  5HLO A;  3SG4 A;  1YRT B;  2K2F A;  1DJY A;  1S36 A;  4HRH A;  1DF0 A;  4A4B A;  4CID A;  4C0L A;  1CFF A;  2BBN A;  1KK8 C;  1LKJ A;  2BE4 A;  1PVB A;  3WXA A;  2Y1M A;  3CTN A;  1NX0 A;  3CLN A;  1DJX A;  4BY4 A;  3ICB A;  5AAN A;  1K9K A;  1SR6 B;  1UHJ A;  3VRO A;  1KFX L;  1KK7 Y;  1TRF A;  3NSO A;  1IH0 A;  2BCA A;  1KWO B;  1SL8 A;  5GQQ C;  1M39 A;  2LNK A;  3OP0 A;  1K8U A;  2FCD A;  2PMY A;  1CFP A;  2AAO A;  3NXA A;  2L2E A;  2OS8 C;  3WHU B;  2BBM A;  1TNX A;  3KO0 A;  4CFR A;  2NCP A;  5KTY A;  1KCY A;  1SL9 A;  2HET A;  2FCE A;  1BOD A;  1PUL A;  2M49 B;  2JT3 A;  4MRY A;  1U5I B;  1NSH A;  4PHK A;  3DF0 A;  1CFD A;  5CSI A;  1KQV A;  3LK0 A;  1A29 A;  1YVH A;  1UUS A;  1DMO A;  3ZNI A;  2PSR A;  2ZN8 A;  5ER4 X;  1AP4 A;  3GOF A;  1BJF A;  3DVK A;  4N1G A;  4ORB B;  2Q91 A;  3PN7 C;  1SW8 A;  5D7F A;  1OZS A;  1SL7 A;  1OMV A;  2LP3 A;  3CZT X;  1BLQ A;  1FI5 A;  4DIR A;  4MN0 A;  3IQQ A;  5PAL A;  1B4C A;  2HQW A;  2NLN A;  2CNP A;  4PE1 A;  1F8H A;  2JNF A;  5CPV A;  1DJG A;  2KI4 B;  1BF5 A;  2I18 A;  1EXR A;  4N5X A;  4JQ0 D;  5I2O A;  1CKK A;  2Y4Q A;  5K89 A;  3DVE A;  2GGM A;  1RTP 1;  1AVS A;  3KPX A;  4MLW A;  2ZFD A;  3D0Y B;  3KHE A;  1J1D A;  3OB2 B;  4YGA A;  1D1O A;  3E3R A;  1YX7 A;  1NCY A;  2LMV A;  4PE0 A;  1SNL A;  1EG4 A;  1TN4 A;  1CDM A;  1SPY A;  1DVI A;  1FPW A;  1QLK A;  1UP5 A;  3NSI A;  2CXJ A;  1XFU O;  2KYC A;  1OQP A;  1JFJ A;  1LIN A;  1NX2 A;  1TTX A;  3JVT B;  4DCK A;  3VRP A;  1CTR A;  1XFV O;  2JXC A;  2JOJ A;  2JPT A;  2OPO A;  3OX6 A;  3IQO A;  5I2Q A;  1YUU A;  1QIW A;  3TS5 C;  1DTL A;  4P5O E;  1KFU S;  3NSK A;  1QVI Z;  2LHL A;  1SMG A;  1DJI A;  4PHJ A;  1J55 A;  1SCM C;  2V53 A;  3BUO B;  1SY9 A;  2EC6 C;  1HQV A;  4E68 A;  1TCO B;  1MF8 B;  3PM8 A;  1EJ3 A;  3WHT B;  3PAT A;  1BT6 A;  1MUX A;  2A4J A;  2NCO A;  4PDZ A;  5G08 A;  1XFZ O;  1YUS A;  3EVR A;  4AOM A;  2PAL A;  1TNQ A;  2L5X B;  1YRU B;  4IL1 A;  4HSZ A;  2PVB A;  2KDH A;  1QTX A;  3PLF B;  4MBE A;  2LLU A;  2R2I A;  2EGD A;  1OMR A;  1KQM B;  1FF1 A;  4I5L B;  2WCF A;  1QLS A;  2KHN A;  2M0R A; 
#chains in the Genus database with same CATH topology
 1WLZ A;  4PAL A;  1SR6 C;  4XYN A;  4ETO A;  3TUY B;  4XJK A;  3D76 A;  4YI8 A;  1SK6 D;  3GK4 X;  3RLZ A;  1KWO C;  1A2X A;  5FI2 A;  1DJZ A;  1MQ1 A;  3KEV A;  1AHR A;  3EK4 A;  1PSB A;  2WC8 A;  3BUX B;  2K61 A;  5CSN A;  2HPS A;  2M3W A;  1JF0 A;  1NX1 A;  2FJU B;  3DD4 A;  4YGD B;  1C7V A;  1HT9 A;  1S6J A;  1FW4 A;  1TNP A;  2BL0 B;  2MRD A;  1NX3 A;  2QAC A;  3EG5 B;  1KSO A;  1CFC A;  1CM4 A;  1S6C A;  1OOH A;  2K7B A;  2KI6 C;  2CT9 A;  2LVI A;  2QDI A;  1J1E A;  5AER A;  1C07 A;  2HQ8 A;  4MRX A;  3C1V A;  4OZD A;  2COL B;  3I5I B;  5FYX A;  4MZL A;  1TNW A;  3BUM B;  1A75 B;  1SYM A;  2KFH A;  4CFQ A;  2WCL A;  4A4C A;  4JPZ B;  3ZWH A;  2QEB A;  2LVV A;  1M63 B;  1CLB A;  3SG3 A;  1DT7 B;  2JXL A;  1OOG A;  1IG5 A;  2H2K A;  1QIV A;  1BOC A;  1JC2 A;  3WNX B;  1UHH A;  2CCM A;  1Z2C B;  2K7C A;  3PFV A;  2LUX A;  1R6P A;  3VGO A;  4R1E A;  1AUI B;  1M46 A;  1V1G A;  1U5I A;  2JWW A;  4GNK B;  2WCE A;  2MBX A;  1KSM A;  5AXI A;  1M31 A;  2M9G A;  4YGC B;  1B8R A;  2QEV A;  1QAT A;  4FQT A;  5HKZ A;  2M29 A;  1MHO A;  3S0E A;  1YX8 A;  2F2P A;  2KFG A;  2KI4 C;  2M1K B;  3TDI A;  1OW4 A;  2FJY A;  2Y1N A;  3SIB A;  5HLV A;  4DUQ A;  5JOL A;  5D69 A;  2HF5 A;  2Y5I A;  2FOT A;  3CGA A;  2LP2 A;  2BCB A;  2BKH B;  1SKT A;  3N7H A;  1K94 A;  2LCP A;  3CS1 A;  5DIC A;  3I5H B;  2L4H A;  5FI7 A;  5FI6 A;  2DOQ A;  1H4B A;  1L2O B;  4PT1 A;  1IWQ A;  1X02 A;  1S5G Z;  2E6W A;  1VRK A;  2L4I A;  2LLS A;  3OX5 A;  2SCP A;  1ZUZ A;  2G9B A;  4C0K A;  1S26 D;  2O60 A;  5EL2 A;  3IVT A;  3Q8I A;  2G2B A;  1QX7 A;  1TUZ A;  3LK1 A;  1R2U A;  3DVJ A;  3JVT C;  3BXK A;  1YTZ C;  3D0Y A;  3BQ3 A;  1XFR A;  2BCX A;  5KU1 A;  1OSA A;  4IJ7 A;  1LS8 A;  2L0P A;  3TZ1 A;  1DJW A;  1TIZ A;  3AKB A;  5HYD A;  3H4S E;  1EG3 A;  1NYA A;  3B6X A;  3BFA A;  1LA0 A;  4L9M A;  1CMF A;  2ERB A;  3S0B A;  1G4Y R;  1GM0 A;  3SIA A;  3HX4 A;  3PJI A;  1AJ4 A;  1W7J B;  2K8M B;  1WLM A;  2LVK A;  4MSP A;  3I5F B;  2F8P A;  2NXQ A;  2JRF A;  3PAL A;  2KGB C;  1RRO A;  2LHI A;  1XYD A;  1Y6W A;  3DYE A;  3GK2 A;  1UHK A;  4ZCU A;  5HL1 A;  1J7O A;  1OE9 B;  1QAS A;  1F4Q A;  4BY5 A;  2D8N A;  3SG6 A;  1MWN A;  1J7Q A;  1NIW A;  4NDD A;  2KNE A;  1CMG A;  4FTG A;  1Y0V H;  1W7I B;  2K60 A;  1N0Y A;  1WY9 A;  1BMO A;  1K96 A;  1KQM C;  1XA5 A;  2QEH A;  4I5N B;  4YBH B;  4GGN A;  1H8B A;  3CR4 X;  3DZT A;  1ORG A;  4M2Q A;  1XO5 A;  1GJY A;  1QVI Y;  3QRX A;  3TUY C;  1NUB A;  1IQ5 A;  3O4X A;  5I8N A;  1ODB A;  3OHM B;  5I94 A;  4PE4 A;  2VRG A;  3A8R A;  2MHH A;  1ZMZ A;  2WCB A;  1G33 A;  1Y1U A;  5F6T A;  3UNW A;  3CR5 X;  3O2P A;  1CLM A;  2ZRT A;  4WRI A;  3MSE B;  3VRN A;  2BL0 C;  2LLT A;  2PRU A;  2BKI B;  3B87 A;  1SBJ A;  1RWY A;  2KSP A;  1FBV A;  5JJG A;  1MR8 A;  1S6I A;  4GUK A;  4PHN A;  2JTZ A;  2KQY A;  3I5I C;  1OOI X;  2QEO A;  3AKA A;  2LUC A;  2QPT A;  4GBA A;  4M2O A;  4AQI A;  4CLN A;  1DQE A;  2K7O A;  1QJT A;  1OZO A;  3B88 A;  4F7F A;  5DKR A;  3SJS A;  1MXE A;  1S3P A;  2P71 A;  1GGW A;  2GGZ A;  3EKH A;  3FE8 A;  4JD9 A;  3D75 A;  3I5G B;  4JWQ A;  2MAZ A;  1JUO A;  1QV1 A;  1XK4 C;  2MLE C;  2ZRS A;  2F3Z A;  1F4O A;  3KF9 A;  3RM1 A;  3B7A A;  4FQO A;  1G8I A;  3SS4 A;  1LVC D;  2KBM A;  1L7Z A;  4YRU A;  2WOS A;  3OGN A;  1F55 A;  3BUN B;  3S0D A;  2MA2 A;  4ZCV A;  1JBA A;  2BEC A;  3BOW B;  1A75 A;  4GAO A;  4DS7 A;  3FE9 A;  5B8I B;  1TOP A;  1WRL A;  2LAN A;  3O78 A;  3BYA A;  1B1G A;  2M1U A;  2M8U A;  1B8L A;  3FE6 A;  1XVJ A;  2H61 C;  1EH2 A;  1TUJ A;  1OOF A;  1KFX S;  2LV7 A;  1XK4 A;  4YGB B;  5AFP A;  1Y1A A;  4CPV A;  3TDZ A;  3AAK A;  1DF0 B;  1UWO A;  4HRG A;  2KBI A;  1YUR A;  4NQG A;  1A03 A;  4MVF A;  2JUL A;  2ZNE A;  1DJH A;  1NCZ A;  2AUC A;  2L98 A;  1PK0 D;  1NCX A;  1BG1 A;  1B9A A;  2BNX A;  1PSR A;  3NSL A;  4QJ4 B;  1RK9 A;  3JTD B;  1EL4 A;  3A4U B;  2CBL A;  5D3O A;  1JSA A;  1WDC B;  3I5H C;  1GQM A;  2H61 A;  2I7A A;  1L2O C;  2OTG B;  3CWG A;  4INX A;  1ZOT B;  2KAY A;  3EK7 A;  3EKJ A;  1K90 D;  5ER5 A;  5IBW A;  5KSZ A;  2PAS A;  1REC A;  1ALV A;  5DKN A;  1BU3 A;  2PYQ A;  1YR5 A;  1KK8 B;  4JKT A;  4YGE B;  2JC2 A;  5BPJ A;  1CDN A;  1CM1 A;  1K93 D;  1SSE B;  1K9P A;  1IRJ A;  2F33 A;  4GGF C;  1CDL A;  2AMI A;  1AJ5 A;  4PHM A;  4KYN A;  1QX2 A;  2EHB A;  2K0J A;  1V1F A;  2ZN9 A;  3D74 A;  2BAP A;  1QX5 B;  2M97 A;  5HKW A;  3OBV A;  4I5K A;  5CSJ A;  2LMU A;  3PSR A;  3FS7 A;  2OS8 B;  3DF0 B;  3OB1 B;  4NDC A;  2MLF C;  1MXL C;  5CSF A;  2F2O A;  4F0Z B;  1JF2 A;  3R1V A;  2JT0 A;  4OCI A;  1FI6 A;  2GTE A;  5J3X A;  3K1E A;  1PRW A;  3R72 A;  4GGF A;  4PE7 A;  2NZ0 A;  3D78 A;  3I5F C;  3S0G A;  1IQ3 A;  3SG2 A;  1B8C A;  2E30 A;  1LA3 A;  1N65 A;  1QWV A;  2LVJ A;  2JU0 A;  1N2D A;  1DEL A;  3VRQ A;  1TCF A;  4GPL B;  1S5G Y;  2M7N A;  3IF7 A;  1RJV A;  4MZK A;  2GV5 A;  4UPG A;  4NDB A;  3FIA A;  4N1F A;  1WRZ A;  4DRW A;  1IKU A;  2F3Y A;  1F71 A;  2KGR A;  4OKH A;  3F45 A;  1SRA A;  1PVA A;  2L50 A;  2LMT A;  1ZAC A;  2WCM A;  1AK8 A;  2TN4 A;  4WQ2 A;  2K7D A;  1BR4 B;  3AAJ A;  4QJ5 B;  2IS9 A;  1B7T Z;  3PN7 B;  1WRK A;  3CZ2 A;  4C0J A;  1XFW O;  2WCK A;  2LAP A;  1IJ6 A;  1XFX O;  1RFJ A;  4Q04 A;  3VRR A;  2MJW B;  1XFY O;  2L2C A;  1F54 A;  2JNX A;  3FWC A;  3VB1 A;  2WOR A;  1OOJ A;  2LE9 B;  4ORC B;  1SCV A;  5TNC A;  5HKY A;  2ZND A;  2I94 A;  1B7T Y;  4QJ3 B;  2JPO A;  5AEQ A;  1KFU L;  3BFB A;  3GK1 A;  2KI6 D;  3NGV A;  3BUW B;  3D77 A;  2KQ6 A;  4D1E A;  1Q80 A;  4OR9 B;  3K21 A;  3FWB A;  2KOT A;  3NHI A;  1F70 A;  1B47 A;  4GFT A;  2O5G A;  1M45 A;  3CAB A;  1CB1 A;  4M2P A;  2K2A A;  1JWD A;  4HRE E;  1NWD A;  1CLL A;  4YI9 A;  5DKQ A;  3R1O A;  1CNP A;  2I2R E;  3D10 A;  3I5G C;  2KYF A;  1CDP A;  3SG5 A;  1OMD A;  1YVL A;  3CYZ A;  2ZKM X;  3EVV A;  2KAV A;  4I5J A;  4WQ3 A;  3B86 A;  1NPQ A;  3SG7 A;  2KAX A;  3CZ1 A;  1LXF C;  3CR2 A;  1QXP A;  1ZFS A;  1K9U A;  2BE6 A;  2JQ6 A;  1K95 A;  1GGZ A;  3O6B A;  3TDU A;  1E8A A;  1J7R A;  1J7P A;  3DVM A;  2KFF A;  3M0W A;  3R1P A;  2JTT A;  2P6B B;  3EK8 A;  4MEW A;  3TS5 B;  4MZJ A;  2RGI A;  1NP8 A;  1Y1X A;  4ICB A;  3SS3 A;  1C7W A;  1PAL A;  2LM5 A;  2M7L A;  4AQJ A;  1P28 A;  1SCM B;  5I2L A;  1BR1 B;  1UUR A;  2EC6 B;  3L4A A;  4ORA B;  1IJ5 A;  4OV2 A;  3EVU A;  4USL A;  3LCP C;  3RZS A;  2L51 A;  1C3Y A;  3LLE A;  2SAS A;  1A4P A;  1S1E A;  2Q4U A;  2PQL A;  3BJH A;  3DXL A;  2ISD A;  4P2Y B;  2JT8 A;  1JFK A;  2WND A;  1UHI A;  2CTN A;  1UHN A;  2JZI A;  1QS7 A;  3BOW A;  4TNC A;  1K2H A;  3O4Y A;  1ALW A;  1QV0 A;  2B1U A;  4INW A;  3JTD C;  2LC5 A;  4U8D A;  1Z4H A;  4PCW A;  1IGV A;  4XJK B;  1WDC C;  1DGV A;  1KK7 Z;  3LL8 B;  3HCM A;  1DGU A;  1W9Z A;  1YUT A;  2OTG C;  5HLO A;  3SG4 A;  1YRT B;  2K2F A;  1DJY A;  1S36 A;  4HRH A;  1DF0 A;  4A4B A;  4CID A;  4C0L A;  1CFF A;  2BBN A;  1KK8 C;  1LKJ A;  2BE4 A;  1PVB A;  3WXA A;  2Y1M A;  3CTN A;  3DY9 A;  1NX0 A;  3CLN A;  1DJX A;  4BY4 A;  3ICB A;  5AAN A;  1K9K A;  1SR6 B;  1UHJ A;  3VRO A;  1KFX L;  1KK7 Y;  1TRF A;  3NSO A;  1IH0 A;  2BCA A;  1KWO B;  1SL8 A;  5GQQ C;  1M39 A;  2LNK A;  2P70 A;  3OP0 A;  3BFH A;  1K8U A;  2FCD A;  2PMY A;  1CFP A;  3D73 A;  2AAO A;  3NXA A;  3S0F A;  2L2E A;  2OS8 C;  3WHU B;  2BBM A;  1TNX A;  2WC5 A;  3KO0 A;  4CFR A;  2NCP A;  5KTY A;  1C3Z A;  1KCY A;  1SL9 A;  2HET A;  2FCE A;  1BOD A;  1PUL A;  2M49 B;  2JT3 A;  4MRY A;  1U5I B;  1NSH A;  4PHK A;  3DF0 A;  1CFD A;  5CSI A;  1KQV A;  3LK0 A;  1A29 A;  1YVH A;  1UUS A;  1DMO A;  3ZNI A;  2PSR A;  2ZN8 A;  5ER4 X;  2WCH A;  1AP4 A;  3GOF A;  1BJF A;  3DVK A;  4N1G A;  4ORB B;  3SS5 A;  2Q91 A;  3PN7 C;  1SW8 A;  5D7F A;  1OZS A;  1SL7 A;  1OMV A;  2LP3 A;  3CZT X;  1BLQ A;  1FI5 A;  4DIR A;  4MN0 A;  3IQQ A;  5PAL A;  1B4C A;  2HQW A;  2NLN A;  2CNP A;  4PE1 A;  1F8H A;  2JNF A;  5CPV A;  1DJG A;  2KI4 B;  1BF5 A;  2I18 A;  3CDN A;  1EXR A;  3NHT A;  4N5X A;  2YGU A;  4JQ0 D;  5I2O A;  3PM2 A;  1CKK A;  2Y4Q A;  5K89 A;  3DVE A;  2GGM A;  3QME A;  1RTP 1;  1AVS A;  3KPX A;  4MLW A;  2ZFD A;  3D0Y B;  2H8V A;  3KHE A;  3L4L A;  1J1D A;  3OB2 B;  1T14 A;  4YGA A;  1D1O A;  3E3R A;  1YX7 A;  1NCY A;  2LMV A;  4PE0 A;  1SNL A;  1EG4 A;  1TN4 A;  1CDM A;  1SPY A;  4OVN F;  1DVI A;  1FPW A;  1QLK A;  1UP5 A;  3NSI A;  3V2L A;  3L47 A;  2CXJ A;  1XFU O;  2KYC A;  1OQP A;  3S0A A;  1JFJ A;  1LIN A;  1NX2 A;  1TTX A;  3JVT B;  4DCK A;  3VRP A;  1CTR A;  1XFV O;  2JXC A;  2JOJ A;  2JPT A;  2OPO A;  3OX6 A;  3IQO A;  5I2Q A;  3UO9 A;  1YUU A;  1QIW A;  3TS5 C;  1DTL A;  4P5O E;  1KFU S;  3NSK A;  1QVI Z;  2LHL A;  1SMG A;  1DJI A;  4PHJ A;  1J55 A;  1SCM C;  2V53 A;  3BUO B;  1SY9 A;  2EC6 C;  1HQV A;  4E68 A;  1IIO A;  1TCO B;  2L5Y A;  1MF8 B;  3PM8 A;  1EJ3 A;  3WHT B;  3PAT A;  1BT6 A;  1MUX A;  2A4J A;  2NCO A;  4PDZ A;  5G08 A;  1XFZ O;  1YUS A;  3EVR A;  4AOM A;  2PAL A;  1TNQ A;  2KPH A;  2L5X B;  1YRU B;  4IL1 A;  4HSZ A;  2KLD A;  2PVB A;  2KDH A;  1QTX A;  3PLF B;  4MBE A;  2LLU A;  1DEK A;  2R2I A;  3CZ0 A;  2KLE A;  2EGD A;  2WC6 A;  2WCJ A;  1OMR A;  1KQM B;  1FF1 A;  1TWO A;  4I5L B;  1DC1 A;  2WCF A;  1QLS A;  2KHN A;  2M0R A; 
#chains in the Genus database with same CATH homology
 1WLZ A;  4PAL A;  1SR6 C;  4XYN A;  4ETO A;  3TUY B;  4XJK A;  4YI8 A;  1SK6 D;  3GK4 X;  3RLZ A;  1KWO C;  1A2X A;  1DJZ A;  1MQ1 A;  3KEV A;  1AHR A;  3EK4 A;  1PSB A;  2WC8 A;  3BUX B;  2K61 A;  5CSN A;  2HPS A;  2M3W A;  1JF0 A;  1NX1 A;  2FJU B;  3DD4 A;  4YGD B;  1C7V A;  1HT9 A;  1S6J A;  1FW4 A;  1TNP A;  2BL0 B;  2MRD A;  1NX3 A;  2QAC A;  4OVN F;  1KSO A;  1CFC A;  1CM4 A;  1S6C A;  2K7B A;  2KI6 C;  2LVI A;  2CT9 A;  5AER A;  1C07 A;  1J1E A;  1J7O A;  2HQ8 A;  4MRX A;  3C1V A;  2COL B;  3I5I B;  5FYX A;  4MZL A;  1TNW A;  3BUM B;  1A75 B;  1SYM A;  2KFH A;  4CFQ A;  4A4C A;  4JPZ B;  3ZWH A;  2LVV A;  1M63 B;  1CLB A;  3SG3 A;  1DT7 B;  2JXL A;  2H2K A;  1IG5 A;  1QIV A;  1BOC A;  1JC2 A;  1UHH A;  2CCM A;  2K7C A;  3PFV A;  2LUX A;  1R6P A;  3VGO A;  4R1E A;  1AUI B;  1M46 A;  1V1G A;  1U5I A;  2JWW A;  4GNK B;  2WCE A;  2MBX A;  1KSM A;  5AXI A;  1M31 A;  2M9G A;  4YGC B;  1B8R A;  1QAT A;  5HKZ A;  2M29 A;  1MHO A;  1YX8 A;  2F2P A;  2KFG A;  2KI4 C;  2M1K B;  3TDI A;  2Y1N A;  3SIB A;  5HLV A;  4DUQ A;  5JOL A;  5D69 A;  2HF5 A;  2Y5I A;  2FOT A;  3CGA A;  2LP2 A;  2BCB A;  2BKH B;  1SKT A;  1K94 A;  2LCP A;  3CS1 A;  3I5H B;  2L4H A;  2DOQ A;  1H4B A;  1L2O B;  1IWQ A;  1X02 A;  1S5G Z;  2E6W A;  1VRK A;  2L4I A;  2LLS A;  3OX5 A;  2SCP A;  1ZUZ A;  2G9B A;  4C0K A;  1S26 D;  2O60 A;  2G2B A;  1QX7 A;  3LK1 A;  1R2U A;  3DVJ A;  3JVT C;  3BXK A;  1YTZ C;  3D0Y A;  3BQ3 A;  2BCX A;  5KU1 A;  1OSA A;  2L0P A;  3TZ1 A;  1DJW A;  1TIZ A;  3AKB A;  5HYD A;  3H4S E;  1EG3 A;  1NYA A;  1LA0 A;  4L9M A;  1CMF A;  1G4Y R;  3SIA A;  3HX4 A;  1AJ4 A;  1W7J B;  2K8M B;  1WLM A;  2LVK A;  4MSP A;  3I5F B;  2F8P A;  2NXQ A;  2JRF A;  3PAL A;  2KGB C;  1RRO A;  2LHI A;  1XYD A;  1Y6W A;  3GK2 A;  1UHK A;  4ZCU A;  1OE9 B;  1QAS A;  1F4Q A;  4BY5 A;  2D8N A;  3SG6 A;  1MWN A;  1J7Q A;  1NIW A;  4NDD A;  2KNE A;  1CMG A;  4FTG A;  1Y0V H;  1W7I B;  1N0Y A;  1WY9 A;  1BMO A;  1K96 A;  1KQM C;  1XA5 A;  4YBH B;  4I5N B;  4GGN A;  1H8B A;  3CR4 X;  4M2Q A;  1XO5 A;  1GJY A;  1QVI Y;  3QRX A;  3TUY C;  1NUB A;  1IQ5 A;  5I8N A;  1ODB A;  3OHM B;  4PE4 A;  2VRG A;  3A8R A;  2MHH A;  1ZMZ A;  2WCB A;  1G33 A;  1Y1U A;  5F6T A;  3CR5 X;  3O2P A;  1CLM A;  2ZRT A;  4WRI A;  3MSE B;  3VRN A;  2BL0 C;  2LLT A;  2PRU A;  2BKI B;  1SBJ A;  1RWY A;  2KSP A;  1FBV A;  5JJG A;  1MR8 A;  1S6I A;  4GUK A;  4PHN A;  2JTZ A;  2KQY A;  3I5I C;  3AKA A;  2LUC A;  2QPT A;  4GBA A;  4M2O A;  4AQI A;  4CLN A;  2K7O A;  1QJT A;  1OZO A;  5DKR A;  3SJS A;  1MXE A;  1S3P A;  1GGW A;  2GGZ A;  3EKH A;  3I5G B;  4JWQ A;  2MAZ A;  1JUO A;  1QV1 A;  1XK4 C;  2MLE C;  2ZRS A;  2F3Z A;  1F4O A;  3KF9 A;  3RM1 A;  4FQO A;  1G8I A;  1LVC D;  2KBM A;  1L7Z A;  4YRU A;  2WOS A;  1F55 A;  3BUN B;  2MA2 A;  4ZCV A;  1JBA A;  2BEC A;  3BOW B;  1A75 A;  4GAO A;  4DS7 A;  5B8I B;  1TOP A;  1WRL A;  2LAN A;  3O78 A;  3BYA A;  1B1G A;  2M1U A;  2M8U A;  1B8L A;  1XVJ A;  2H61 C;  1EH2 A;  1KFX S;  2LV7 A;  1XK4 A;  4YGB B;  5AFP A;  1Y1A A;  4CPV A;  3TDZ A;  3AAK A;  1DF0 B;  1UWO A;  4HRG A;  2KBI A;  1YUR A;  4NQG A;  1A03 A;  4MVF A;  2JUL A;  2ZNE A;  1DJH A;  1NCZ A;  2AUC A;  2L98 A;  1PK0 D;  1NCX A;  1BG1 A;  1B9A A;  3NSL A;  1PSR A;  4QJ4 B;  1RK9 A;  3JTD B;  1EL4 A;  3A4U B;  2CBL A;  1JSA A;  1WDC B;  3I5H C;  1GQM A;  2H61 A;  2I7A A;  1L2O C;  2OTG B;  3CWG A;  1ZOT B;  2KAY A;  3EK7 A;  3EKJ A;  1K90 D;  5ER5 A;  5IBW A;  5KSZ A;  2PAS A;  1REC A;  1ALV A;  5DKN A;  1BU3 A;  1YR5 A;  1KK8 B;  4YGE B;  2JC2 A;  5BPJ A;  1CDN A;  1CM1 A;  1K93 D;  1K9P A;  1IRJ A;  2F33 A;  4GGF C;  1CDL A;  2AMI A;  1AJ5 A;  4PHM A;  1QX2 A;  2EHB A;  2K0J A;  1V1F A;  2ZN9 A;  1QX5 B;  2M97 A;  5HKW A;  4I5K A;  5CSJ A;  2LMU A;  3PSR A;  3FS7 A;  2OS8 B;  3DF0 B;  3OB1 B;  4NDC A;  2MLF C;  1MXL C;  5CSF A;  2F2O A;  4F0Z B;  1JF2 A;  2JT0 A;  4OCI A;  1FI6 A;  5J3X A;  1PRW A;  4GGF A;  4PE7 A;  2NZ0 A;  3I5F C;  1IQ3 A;  3SG2 A;  1B8C A;  2E30 A;  1LA3 A;  1N65 A;  2LVJ A;  2JU0 A;  1N2D A;  3VRQ A;  1TCF A;  4GPL B;  1S5G Y;  2M7N A;  3IF7 A;  1RJV A;  4MZK A;  2GV5 A;  4UPG A;  4NDB A;  3FIA A;  4N1F A;  1WRZ A;  4DRW A;  1IKU A;  2F3Y A;  1F71 A;  2KGR A;  4OKH A;  3F45 A;  1SRA A;  1PVA A;  2L50 A;  2LMT A;  1ZAC A;  1AK8 A;  2TN4 A;  4WQ2 A;  2K7D A;  1BR4 B;  3AAJ A;  4QJ5 B;  2IS9 A;  1B7T Z;  3PN7 B;  1WRK A;  4C0J A;  1XFW O;  2LAP A;  1IJ6 A;  1XFX O;  1RFJ A;  4Q04 A;  3VRR A;  2MJW B;  1XFY O;  1F54 A;  2JNX A;  3FWC A;  2WOR A;  1OOJ A;  2LE9 B;  4ORC B;  1SCV A;  5TNC A;  5HKY A;  2ZND A;  2I94 A;  1B7T Y;  4QJ3 B;  5AEQ A;  1KFU L;  3GK1 A;  2KI6 D;  3BUW B;  2KQ6 A;  4D1E A;  1Q80 A;  4OR9 B;  3K21 A;  3FWB A;  2KOT A;  1F70 A;  1B47 A;  4GFT A;  2O5G A;  1M45 A;  1CB1 A;  4M2P A;  2K2A A;  1JWD A;  4HRE E;  1NWD A;  1CLL A;  4YI9 A;  5DKQ A;  1CNP A;  2I2R E;  3D10 A;  3I5G C;  2KYF A;  1CDP A;  3SG5 A;  1OMD A;  1YVL A;  3EVV A;  2ZKM X;  2KAV A;  4I5J A;  4WQ3 A;  1NPQ A;  3SG7 A;  2KAX A;  1LXF C;  3CR2 A;  1QXP A;  1ZFS A;  1K9U A;  2BE6 A;  2JQ6 A;  1K95 A;  1GGZ A;  3O6B A;  3TDU A;  1E8A A;  1J7R A;  1J7P A;  3DVM A;  2KFF A;  3M0W A;  2JTT A;  2P6B B;  3EK8 A;  4MEW A;  3TS5 B;  4MZJ A;  2RGI A;  1NP8 A;  1Y1X A;  4ICB A;  4AQJ A;  1C7W A;  1PAL A;  2LM5 A;  2M7L A;  1SCM B;  5I2L A;  1BR1 B;  1UUR A;  2EC6 B;  4ORA B;  4USL A;  1IJ5 A;  4OV2 A;  3EVU A;  3WNX B;  3LCP C;  2L51 A;  3LLE A;  2SAS A;  1A4P A;  1S1E A;  2Q4U A;  2ISD A;  4P2Y B;  2JT8 A;  1JFK A;  2WND A;  1UHI A;  2CTN A;  1UHN A;  2JZI A;  1QS7 A;  3BOW A;  4TNC A;  1K2H A;  3O4Y A;  1ALW A;  1QV0 A;  2B1U A;  3JTD C;  2LC5 A;  4U8D A;  4PCW A;  1IGV A;  4XJK B;  1WDC C;  1DGV A;  1KK7 Z;  3LL8 B;  3HCM A;  1DGU A;  2OTG C;  1YUT A;  5HLO A;  3SG4 A;  1YRT B;  2K2F A;  1DJY A;  1S36 A;  4HRH A;  1DF0 A;  4A4B A;  4CID A;  4C0L A;  1CFF A;  2BBN A;  1KK8 C;  1LKJ A;  2BE4 A;  1PVB A;  3WXA A;  2Y1M A;  3CTN A;  1NX0 A;  3CLN A;  1DJX A;  4BY4 A;  3ICB A;  5AAN A;  1K9K A;  1SR6 B;  1UHJ A;  3VRO A;  1KFX L;  1KK7 Y;  1TRF A;  3NSO A;  1IH0 A;  2BCA A;  1KWO B;  1SL8 A;  5GQQ C;  1M39 A;  2LNK A;  3OP0 A;  1K8U A;  2FCD A;  2PMY A;  1CFP A;  2AAO A;  3NXA A;  2L2E A;  2OS8 C;  3WHU B;  2BBM A;  1TNX A;  3KO0 A;  4CFR A;  2NCP A;  5KTY A;  1KCY A;  1SL9 A;  2HET A;  2FCE A;  1BOD A;  1PUL A;  2M49 B;  2JT3 A;  4MRY A;  1U5I B;  1NSH A;  4PHK A;  3DF0 A;  1CFD A;  5CSI A;  1KQV A;  3LK0 A;  1A29 A;  1YVH A;  1UUS A;  1DMO A;  3ZNI A;  2PSR A;  2ZN8 A;  5ER4 X;  1AP4 A;  3GOF A;  1BJF A;  3DVK A;  4N1G A;  4ORB B;  2Q91 A;  3PN7 C;  1SW8 A;  5D7F A;  1OZS A;  1SL7 A;  1OMV A;  2LP3 A;  3CZT X;  1BLQ A;  1FI5 A;  4DIR A;  4MN0 A;  3IQQ A;  5PAL A;  1B4C A;  2HQW A;  2NLN A;  2CNP A;  4PE1 A;  1F8H A;  2JNF A;  5CPV A;  1DJG A;  2KI4 B;  1BF5 A;  2I18 A;  1EXR A;  4N5X A;  4JQ0 D;  5I2O A;  1CKK A;  2Y4Q A;  5K89 A;  3DVE A;  2GGM A;  1RTP 1;  1AVS A;  3KPX A;  4MLW A;  2ZFD A;  3D0Y B;  3KHE A;  1J1D A;  3OB2 B;  4YGA A;  1D1O A;  3E3R A;  1YX7 A;  1NCY A;  2LMV A;  4PE0 A;  1SNL A;  1EG4 A;  1TN4 A;  1CDM A;  1SPY A;  1DVI A;  1FPW A;  1QLK A;  1UP5 A;  3NSI A;  2CXJ A;  1XFU O;  2KYC A;  1OQP A;  1JFJ A;  1LIN A;  1NX2 A;  1TTX A;  3JVT B;  4DCK A;  3VRP A;  1CTR A;  1XFV O;  2JXC A;  2JOJ A;  2JPT A;  2OPO A;  3OX6 A;  3IQO A;  5I2Q A;  1YUU A;  1QIW A;  3TS5 C;  1DTL A;  4P5O E;  1KFU S;  3NSK A;  1QVI Z;  2LHL A;  1SMG A;  1DJI A;  4PHJ A;  1J55 A;  1SCM C;  2V53 A;  3BUO B;  1SY9 A;  2EC6 C;  1HQV A;  4E68 A;  1TCO B;  1MF8 B;  3PM8 A;  1EJ3 A;  3WHT B;  3PAT A;  1BT6 A;  1MUX A;  2A4J A;  2NCO A;  4PDZ A;  5G08 A;  1XFZ O;  1YUS A;  3EVR A;  4AOM A;  2PAL A;  1TNQ A;  2L5X B;  1YRU B;  4IL1 A;  4HSZ A;  2PVB A;  2KDH A;  1QTX A;  3PLF B;  4MBE A;  2LLU A;  2R2I A;  2EGD A;  1OMR A;  1KQM B;  1FF1 A;  4I5L B;  2WCF A;  1QLS A;  2KHN A;  2M0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...