1RFJA

Crystal structure of potato calmodulin pcm6
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
148
structure length
148
Chain Sequence
b'MADQLTEDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYDEFVKVMMA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords calmodulin
publication title Structure of potato calmodulin PCM6: the first report of the three-dimensional structure of a plant calmodulin.
pubmed doi rcsb
source organism Solanum tuberosum
molecule tags Metal binding protein
total genus 59
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2003-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1rfjA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1rfjA02
2WCFA 4M2QA 1C07A 5TNCA 1YUUA 3IF7A 3IQQA 1RFJA 4OV2A 2PSRA 2ZN9A 4PDZA 1RK9A 2D8NA 4PCWA 4MVFA 1J1EA 1JWDA 1OMVA 1K9KA 2F8PA 2JTZA 2Q91A 1CDLA 3SJSA 3JTDB 1MXEA 2K7DA 3D0YA 1SNLA 1JFKA 2LMVA 3D0YB 1QX2A 5D7FA 1B7TZ 3EVRA 2OPOA 1DJHA 2JNFA 1B4CA 3TDZA 5GQQC 1EH2A 1U5IB 1XYDA 3SG7A 2PMYA 3PLFB 1JUOA 4OCIA 1QIWA 1LKJA 1ZOTB 2CTNA 2V53A 3SG3A 5HKYA 2BL0B 5JOLA 2OS8C 1K9PA 2JXCA 4MN0A 1GQMA 1PK0D 4A4BA 1CFPA 1JC2A 1B7TY 2TN4A 1TN4A 2KAXA 3AAKA 5AERA 2LNKA 2JRFA 1IGVA 2JZIA 2LVJA 1FW4A 4MRXA 2KI6D 3BUOB 3CZTX 2PASA 1A2XA 1MF8B 2GGZA 2Y1MA 2BE6A 3I5HC 1UHNA 3VRRA 2KFGA 1QX5B 1S1EA 3NXAA 3DF0B 4JQ0D 1FBVA 3LK1A 4HRHA 3KO0A 1XFVO 2EC6C 1M63B 2Y4QA 2K7OA 1TNXA 5DKQA 1KFUL 1SYMA 3NSIA 5BPJA 1S6IA 3I5GB 2KDHA 2BECA 4PHJA 3VRPA 1NYAA 2QPTA 3AKAA 4XYNA 1TTXA 1XO5A 2WORA 1WY9A 1PSBA 1NX0A 2I94A 2LVKA 1XFZO 2EHBA 1WDCB 2KFHA 1MQ1A 1DMOA 4PE4A 4NQGA 3BOWA 2KGRA 1BG1A 4DUQA 4MZKA 4DRWA 4A4CA 4F0ZB 3PN7C 2KOTA 1RROA 1F4QA 1KQMC 1UHJA 3I5IB 1S26D 5FYXA 1XFXO 1BR4B 5B8IB 1NX1A 1KSMA 1DF0B 1M39A 5CSIA 4IL1A 1Y1AA 1L2OC 1UP5A 1DJYA 2I7AA 3TUYB 5KU1A 2DOQA 2MLEC 3I5FC 1IG5A 2MAZA 1QIVA 1KWOB 3C1VA 2L51A 2LANA 3GOFA 2NLNA 4P2YB 5ER5A 1K9UA 1JBAA 1CM4A 2CXJA 2JTTA 1F4OA 3BUNB 1AVSA 4DS7A 1BMOA 1MHOA 1EG3A 4N1GA 2ZRTA 1TOPA 4GGNA 4GNKB 1HT9A 1R6PA 1X02A 5DKNA 1NCXA 2CNPA 4WQ3A 1LXFC 2HQWA 2SASA 3A8RA 1M46A 5CSJA 4PHMA 1GJYA 5IBWA 2KNEA 1DTLA 4FQOA 4MLWA 3WHUB 1CFDA 2H2KA 1KK8C 3LK0A 1QASA 2CT9A 5JJGA 2MJWB 3LLEA 2GV5A 4ORBB 3NSLA 2F2PA 1R2UA 2OTGC 4PE7A 1Y0VH 1B8CA 1PVBA 2HETA 1UHIA 1UWOA 2L2EA 1F71A 1S36A 1QLSA 1W7IB 1J7OA 4AQJA 4CFQA 4QJ3B 2HF5A 4XJKA 4AOMA 1PRWA 3F45A 2I18A 1B1GA 1TRFA 1CTRA 2M3WA 1B47A 1KFXS 1SL8A 4YGCB 4CPVA 5KSZA 3DVKA 1SW8A 3ZWHA 1F8HA 1WLZA 1QVIY 1XVJA 2SCPA 1VRKA 4MEWA 2FCDA 2M97A 4N5XA 2G2BA 1SCMB 4OR9B 1IJ5A 4YBHB 1BODA 2KBIA 1Y6WA 3VROA 2BL0C 4C0LA 1PVAA 1KFUS 1AK8A 5HLOA 1SPYA 2WCEA 1YX8A 2JT3A 2QACA 1B9AA 2H61A 2FCEA 4PE1A 2K61A 2E30A 1IRJA 2M7LA 3VRNA 3EVUA 2LV7A 4PHNA 3AKBA 1OMRA 3SIBA 2EGDA 2K0JA 4GFTA 1ZACA 2JC2A 1S6JA 2E6WA 4MRYA 1KCYA 3E3RA 1AP4A 1KSOA 1UURA 1YRTB 1AUIB 1MWNA 1NX2A 3VRQA 3HCMA 1SK6D 3TS5C 2B1UA 5CPVA 1MXLC 2ZN8A 2F3ZA 1AHRA 1DJGA 1GGWA 1SR6C 1CDMA 1S6CA 3OX6A 2JOJA 3PFVA 3SG6A 2OS8B 1CDNA 1DJWA 1N2DA 2JULA 4BY5A 1YX7A 1IWQA 1N0YA 2Q4UA 1K2HA 1QJTA 1CLMA 4GPLB 1NPQA 4NDDA 2MLFC 1SRAA 1CLBA 1YVLA 1NP8A 5HLVA 1QX7A 2LAPA 1RECA 3SG2A 4E68A 1SY9A 1WRKA 4MZLA 2IS9A 2KYCA 3BOWB 1QXPA 1CB1A 3NSOA 1AJ4A 2L98A 1MUXA 2LUCA 2R2IA 3I5HB 1EL4A 3OHMB 3PALA 4WQ2A 5I2OA 2NXQA 1BJFA 4ORCB 1S5GZ 2MBXA 2NCPA 3LL8B 2CBLA 3EK8A 2EC6B 4HSZA 5AANA 3CTNA 2K7BA 4MZJA 4CFRA 1QV0A 1K94A 1RJVA 2KYFA 2NCOA 3OB2B 3TZ1A 2HQ8A 3CS1A 4DIRA 2O5GA 4ORAB 2AAOA 4YGEB 4NDBA 4AQIA 1YUSA 1HQVA 5K89A 2WOSA 1TNWA 4JPZB 1A75A 1IKUA 1NSHA 1S5GY 1SCVA 2LMTA 2LLUA 2LP2A 2BCAA 1H8BA 1N65A 2LHLA 3CR2A 1ZUZA 4OVNF 1TNPA 2LE9B 1ODBA 3BQ3A 2LCPA 2KBMA 1YUTA 2VRGA 3EKHA 1ZFSA 1CNPA 3PN7B 4GBAA 1BLQA 3JVTC 1OZOA 3AAJA 1TIZA 1SL9A 1UHHA 2KAYA 2K2AA 1M31A 2LHIA 5KTYA 4I5KA 1L2OB 3PM8A 3O2PA 2KI4C 1QLKA 2JWWA 1FI6A 4I5NB 1DJIA 1QS7A 3WHTB 1IH0A 2M1UA 1XA5A 1SMGA 1L7ZA 1UUSA 4M2PA 2ZKMX 1TNQA 1WRLA 1CFCA 1C7WA 1JF2A 3ICBA 2KFFA 2O60A 2M8UA 4I5LB 2MA2A 4C0JA 1CFFA 4YGAA 2BE4A 1ZMZA 1OMDA 4XJKB 1CKKA 3TDIA 1A29A 2ZFDA 4L9MA 1BU3A 2M49B 3M0WA 2COLB 1OQPA 4YGBB 4QJ4B 3WXAA 2WC8A 4C0KA 1KQVA 1ALVA 1YRUB 3CWGA 1C7VA 3JTDC 4GGFC 1KK7Z 1S3PA 1Y1XA 3SG4A 4FTGA 5AFPA 2ZRSA 2L5XB 1J1DA 1KK8B 2PALA 5AXIA 1A03A 4Q04A 4WRIA 1JF0A 2KSPA 3FWCA 3KEVA 1OSAA 2OTGB 4BY4A 2FJUB 4QJ5B 1LA3A 3GK4X 1NIWA 3DVEA 3QRXA 1D1OA 1F54A 1V1FA 2L4HA 4YRUA 5I2QA 2M9GA 1OE9B 3BUWB 1UHKA 2BBNA 5HKZA 1K93D 1M45A 4NDCA 4D1EA 5DKRA 5G08A 1XFUO 3FWBA 1XFYO 5PALA 4YI8A 2LVVA 2L50A 4GGFA 2LP3A 4CIDA 5D69A 1EJ3A 3GK1A 2KHNA 2M0RA 1PULA 2L0PA 1NWDA 2JU0A 2FOTA 1A4PA 2L4IA 3WNXB 2K7CA 2WCBA 1J7RA 1U5IA 2Y5IA 4P5OE 1CMGA 1FI5A 3BUMB 3LCPC 3FIAA 1XFWO 4GAOA 1GGZA 2M29A 2ZNEA 2NZ0A 1RTP1 1LVCD 4YI9A 4YGDB 1FF1A 1EG4A 2Y1NA 3I5GC 2LC5A 3SIAA 3H4SE 3KHEA 1WLMA 1KFXL 4UPGA 2MRDA 3IQOA 2KI6C 1NX3A 1G8IA 3DVMA 3BUXB 2M1KB 1F55A 1WDCC 1CDPA 2KGBC 1PSRA 1WRZA 3BXKA 2PVBA 1PALA 3PATA 2JXLA 4JWQA 1YURA 1BT6A 3DF0A 2AUCA 3EK7A 3I5IC 2K8MB 3RLZA 1DJXA 1H4BA 1EXRA 3KPXA 5AEQA 4GUKA 5F6TA 3TS5B 4ICBA 3TUYC 2JT8A 3OX5A 1QTXA 5I8NA 1DVIA 1LINA 3CR4X 2F33A 2A4JA 4CLNA 3O6BA 1KWOC 4USLA 4U8DA 1SL7A 3O4YA 3ZNIA 1F70A 1E8AA 1DT7B 1SR6B 4HRGA 1K95A 2ZNDA 1BR1B 5J3XA 4R1EA 1CM1A 2BCXA 2I2RE 4PHKA 3EK4A 3NSKA 3MSEB 1A75B 1NUBA 2WNDA 4ZCUA 1IJ6A 2GGMA 1ALWA 2G9BA 2M7NA 1OZSA 2JQ6A 5I2LA 1JSAA 2BBMA 1CMFA 1DF0A 1OOJA 3CLNA 1KQMB 5HKWA 3FS7A 2KQYA 2KAVA 3OB1B 1XK4C 2LM5A 2JNXA 5ER4X 1V1GA 3RM1A 2PRUA 1YR5A 1SBJA 1TCOB 1DJZA 1G4YR 1FPWA 2LVIA 1YVHA 3GK2A 4ETOA 5CSNA 4HREE 1NCYA 1SKTA 3I5FB 3KF9A 2BCBA 3D10A 1JFJA 4I5JA 1RWYA 3VGOA 1Y1UA 4DCKA 3A4UB 1BOCA 1QV1A 1IQ5A 2P6BB 3CGAA 2RGIA 4N1FA 4TNCA 4ZCVA 1NCZA 3BYAA 1CLLA 4PE0A 1K96A 3OP0A 5CSFA 4MSPA 1DGVA 2ISDA 1J7PA 2LLSA 2BKHB 1G33A 2F3YA 3EKJA 3K21A 3JVTB 3EVVA 3PSRA 3HX4A 4PALA 3O78A 2JPTA 2F2OA 4OKHA 2HPSA 4MBEA 1QATA 1XK4A 1B8RA 1SCMC 2K2FA 1K90D 1Q80A 2LMUA 1K8UA 3CR5X 3DD4A 3TDUA 1AJ5A 2KI4B 1YTZC 1J7QA 1W7JB 2AMIA 2MHHA 3SG5A 3DVJA 1TCFA 1QVIZ 2KQ6A 1DGUA 1MR8A 2CCMA 2LUXA 1B8LA 2LLTA 2JT0A 1IQ3A 1J55A 2BKIB 4M2OA 5HYDA 2H61C 1LA0A 1KK7Y 1BF5A
chains in the Genus database with same CATH superfamily
2WCFA 4M2QA 1C07A 4FQTA 1YUUA 3IF7A 5TNCA 1OW4A 3IQQA 1RFJA 4OV2A 2PSRA 2ZN9A 4PDZA 1RK9A 2KPHA 2D8NA 4PCWA 4MVFA 1J1EA 1JWDA 1OMVA 1K9KA 2F8PA 2JTZA 2Q91A 1CDLA 3SJSA 3JTDB 1MXEA 4KYNA 2K7DA 1DEKA 3D0YA 1SNLA 1JFKA 2LMVA 3D0YB 1QX2A 5D7FA 1SSEB 1B7TZ 3EVRA 3L4AA 2OPOA 1DJHA 2JNFA 1B4CA 3TDZA 5GQQC 1EH2A 1U5IB 1XYDA 2WCMA 3SG7A 2PMYA 3PLFB 1JUOA 4OCIA 1QIWA 1LKJA 1ZOTB 3SS5A 2CTNA 1Z4HA 2V53A 3SG3A 3BFBA 3D78A 5HKYA 2BL0B 5JOLA 2OS8C 1K9PA 2JXCA 4MN0A 1GQMA 1PK0D 4A4BA 1CFPA 1JC2A 1B7TY 2TN4A 1TN4A 2KAXA 3AAKA 5AERA 2LNKA 2JRFA 1IGVA 2QEBA 2JZIA 2LVJA 2WC6A 1FW4A 3NHTA 4MRXA 2KI6D 3BUOB 3CZTX 2PASA 2BAPA 1A2XA 1MF8B 2GGZA 2Y1MA 2BE6A 3I5HC 1UHNA 3VRRA 2KFGA 1QX5B 1S1EA 3B6XA 3NXAA 3DF0B 4JQ0D 1FBVA 3LK1A 4HRHA 3KO0A 1XFVO 2EC6C 1M63B 2Y4QA 2QEOA 2K7OA 1TNXA 5DKQA 1KFUL 3B88A 1SYMA 3NSIA 3QMEA 5BPJA 1S6IA 3I5GB 2KDHA 3S0DA 2BECA 4PHJA 3VRPA 1NYAA 2QPTA 3AKAA 4XYNA 1TTXA 1XO5A 2WCKA 2WORA 1WY9A 1PSBA 1NX0A 2I94A 2LVKA 3B86A 1XFZO 2EHBA 1WDCB 2KFHA 1MQ1A 1DMOA 4PE4A 4IJ7A 3BOWA 2KGRA 2ERBA 4NQGA 1BG1A 4DUQA 4MZKA 4DRWA 4A4CA 1QWVA 3PN7C 4F0ZB 2KOTA 1RROA 3BJHA 1F4QA 1KQMC 1UHJA 2QDIA 1S26D 3I5IB 5FYXA 1XFXO 1BR4B 5B8IB 1NX1A 1KSMA 5D3OA 1DF0B 1M39A 5CSIA 4IL1A 1Y1AA 1L2OC 3OGNA 1UP5A 1DJYA 2I7AA 3TUYB 5KU1A 2DOQA 2MLEC 3I5FC 1IG5A 2MAZA 1QIVA 1KWOB 3C1VA 2L51A 2LANA 3GOFA 2NLNA 4P2YB 5ER5A 1K9UA 1JBAA 1CM4A 2CXJA 2JTTA 1F4OA 1OOIX 3BUNB 1AVSA 4DS7A 1BMOA 1MHOA 1EG3A 4N1GA 2ZRTA 1TOPA 4GGNA 4GNKB 1HT9A 3FE6A 1R6PA 1X02A 5DKNA 1NCXA 2CNPA 4WQ3A 1C3YA 1LXFC 2HQWA 2SASA 3A8RA 1M46A 5CSJA 4PHMA 1GJYA 5IBWA 2KNEA 1DTLA 4FQOA 4MLWA 3WHUB 1CFDA 2H2KA 1KK8C 3LK0A 1QASA 2P71A 2CT9A 5JJGA 2MJWB 3LLEA 2GV5A 4ORBB 3NSLA 5HL1A 2F2PA 1R2UA 2OTGC 4PE7A 1Y0VH 1B8CA 1PVBA 3L47A 1T14A 3PJIA 1P28A 1TWOA 2HETA 1UHIA 3K1EA 1UWOA 2L2EA 1F71A 1S36A 3R1PA 1QLSA 1W7IB 1J7OA 4AQJA 4CFQA 4QJ3B 2HF5A 4XJKA 3B7AA 4AOMA 1PRWA 3D74A 3F45A 3DYEA 2I18A 1B1GA 1TRFA 1CTRA 2M3WA 1B47A 1KFXS 1SL8A 1DQEA 3B87A 4YGCB 3DVKA 4CPVA 5KSZA 1IIOA 1SW8A 3CZ2A 3ZWHA 1F8HA 1WLZA 1QVIY 1XVJA 2SCPA 1VRKA 4MEWA 2FCDA 1C3ZA 2M97A 4N5XA 2G2BA 3PM2A 1SCMB 4OR9B 1IJ5A 4YBHB 1BODA 2KBIA 1Y6WA 3VROA 2BL0C 3D76A 4C0LA 3Q8IA 1PVAA 3FE8A 1TUJA 1KFUS 1AK8A 5HLOA 1SPYA 2WCEA 1YX8A 2JT3A 2QACA 1DELA 1B9AA 2H61A 2FCEA 4PE1A 2K61A 2E30A 1IRJA 2L5YA 2M7LA 3VRNA 3EVUA 2LV7A 4PHNA 3AKBA 1OMRA 3SIBA 2EGDA 2K0JA 4JKTA 4GFTA 1ZACA 2JC2A 1S6JA 2E6WA 4MRYA 1KCYA 3BFHA 3E3RA 1AP4A 1KSOA 1UURA 3SS3A 3D73A 1YRTB 1AUIB 1MWNA 1NX2A 3VRQA 3HCMA 1SK6D 3TS5C 2B1UA 5CPVA 1MXLC 2ZN8A 3UNWA 3CYZA 2F3ZA 1AHRA 1DJGA 1GGWA 1SR6C 1CDMA 1S6CA 3OX6A 2H8VA 2JOJA 3PFVA 2OS8B 3SG6A 1CDNA 1DJWA 1N2DA 2JULA 4BY5A 1YX7A 1IWQA 1N0YA 2Q4UA 4JD9A 1K2HA 1QJTA 1CLMA 4GPLB 1NPQA 4NDDA 2MLFC 3V2LA 1SRAA 1CLBA 1YVLA 1NP8A 5HLVA 1QX7A 2LAPA 1RECA 4OZDA 3SG2A 4E68A 1SY9A 1WRKA 4MZLA 2IS9A 1TUZA 2KYCA 3BOWB 1QXPA 1CB1A 2PYQA 3CDNA 3NSOA 1AJ4A 2L2CA 2L98A 1MUXA 2LUCA 2R2IA 3FE9A 1EL4A 3I5HB 3OHMB 3PALA 4WQ2A 5I2OA 2NXQA 1BJFA 3DXLA 4ORCB 3NHIA 1S5GZ 2MBXA 2NCPA 3LL8B 2CBLA 3EK8A 2EC6B 4HSZA 5AANA 3CTNA 2K7BA 4MZJA 4CFRA 1QV0A 1K94A 1RJVA 2KYFA 2NCOA 5I94A 3OB2B 3TZ1A 2HQ8A 3CS1A 4DIRA 5DICA 2O5GA 4ORAB 2AAOA 4YGEB 4NDBA 4AQIA 1YUSA 1HQVA 5K89A 3S0FA 2WOSA 1TNWA 4JPZB 1A75A 1IKUA 1NSHA 1S5GY 1SCVA 2LMTA 2LLUA 2LP2A 2BCAA 1H8BA 1N65A 2LHLA 2QEVA 1ZUZA 3CR2A 1TNPA 2LE9B 1ODBA 3BQ3A 2LCPA 4OVNF 2KBMA 1YUTA 2VRGA 3EKHA 1ZFSA 1CNPA 3PN7B 4GBAA 1BLQA 3JVTC 1OZOA 3UO9A 3AAJA 1TIZA 1SL9A 1UHHA 2P70A 4INXA 2KAYA 2K2AA 1M31A 2KLEA 2LHIA 3S0BA 5KTYA 4I5KA 1L2OB 3PM8A 3O2PA 5FI6A 2KI4C 1QLKA 1Z2CB 2JWWA 1FI6A 4I5NB 4INWA 3L4LA 3O4XA 3VB1A 1DJIA 1QS7A 3WHTB 1IH0A 2GTEA 2M1UA 1XA5A 1SMGA 3R72A 1L7ZA 1UUSA 4M2PA 2ZKMX 1TNQA 1WRLA 1CFCA 1C7WA 1JF2A 3ICBA 2KFFA 2O60A 3CABA 2M8UA 4I5LB 2MA2A 4C0JA 1CFFA 4YGAA 2BE4A 1ZMZA 1OMDA 2WC5A 4XJKB 1CKKA 2FJYA 2PQLA 3TDIA 1A29A 2ZFDA 4L9MA 1BU3A 2JPOA 2M49B 3M0WA 2COLB 1OQPA 4YGBB 4QJ4B 3WXAA 1ORGA 2WC8A 1W9ZA 4C0KA 1KQVA 1ALVA 1YRUB 3CWGA 1C7VA 3JTDC 3S0GA 4GGFC 3SS4A 1KK7Z 1S3PA 1Y1XA 3SG4A 4FTGA 5AFPA 2ZRSA 2L5XB 1J1DA 1KK8B 2PALA 5AXIA 1A03A 4Q04A 4WRIA 1JF0A 2KSPA 3FWCA 3KEVA 4PT1A 1OSAA 4F7FA 2OTGB 4BY4A 2FJUB 4QJ5B 1LA3A 3GK4X 1NIWA 5FI7A 3DVEA 3QRXA 1D1OA 3CZ1A 1F54A 1V1FA 2L4HA 4YRUA 5I2QA 2M9GA 1OE9B 3BUWB 1UHKA 2BBNA 5HKZA 1K93D 1M45A 4NDCA 3NGVA 4D1EA 5DKRA 5G08A 1XFUO 3FWBA 1XFYO 3EG5B 4YI8A 5PALA 2LVVA 2L50A 4GGFA 2LP3A 4CIDA 5D69A 1EJ3A 3GK1A 2KHNA 2M0RA 1PULA 2L0PA 1NWDA 2JU0A 2FOTA 1A4PA 2L4IA 2WCJA 3WNXB 3R1VA 2K7CA 2WCBA 1J7RA 1U5IA 2KLDA 2Y5IA 4P5OE 3S0AA 3BUMB 1CMGA 3LCPC 3D75A 1FI5A 3FIAA 1XFWO 4GAOA 1GGZA 2M29A 2ZNEA 2NZ0A 1RTP1 1LVCD 4YI9A 4YGDB 1FF1A 2QEHA 1EG4A 2Y1NA 3I5GC 2LC5A 3SIAA 1OOGA 3H4SE 3KHEA 1WLMA 1KFXL 4UPGA 2MRDA 3IQOA 2KI6C 1NX3A 1G8IA 3DVMA 3BUXB 2M1KB 1F55A 1WDCC 1CDPA 2KGBC 1PSRA 1WRZA 3BXKA 2PVBA 1PALA 3PATA 2JXLA 4JWQA 3D77A 3DZTA 1YURA 1BT6A 3DF0A 2AUCA 1LS8A 3EK7A 3I5IC 2K8MB 3RLZA 5EL2A 1DJXA 1H4BA 1EXRA 3KPXA 5AEQA 1XFRA 4GUKA 5F6TA 3TS5B 4ICBA 3TUYC 2JT8A 3OX5A 1QTXA 5I8NA 1DVIA 1LINA 3CR4X 2F33A 2A4JA 4CLNA 3O6BA 1KWOC 4USLA 4U8DA 1SL7A 3O4YA 3ZNIA 1F70A 1E8AA 1DT7B 1SR6B 3RZSA 4HRGA 1K95A 2ZNDA 1BR1B 5J3XA 4R1EA 1CM1A 2BCXA 2I2RE 4PHKA 3EK4A 3NSKA 3MSEB 2WCLA 1A75B 1NUBA 2WNDA 4ZCUA 1IJ6A 2GGMA 1ALWA 2G9BA 2M7NA 1OZSA 2JQ6A 5I2LA 1JSAA 2BBMA 1CMFA 3IVTA 3N7HA 2YGUA 1DF0A 1OOJA 3CLNA 1KQMB 5HKWA 3FS7A 2KQYA 2KAVA 3OB1B 1XK4C 2LM5A 2JNXA 5ER4X 1V1GA 2K60A 3RM1A 2PRUA 1YR5A 1SBJA 1OOFA 1TCOB 1DJZA 1G4YR 1FPWA 2LVIA 1YVHA 3GK2A 4ETOA 5CSNA 4HREE 1NCYA 1SKTA 3I5FB 3KF9A 2BCBA 3D10A 1JFJA 4I5JA 1RWYA 3VGOA 1Y1UA 4DCKA 3A4UB 3R1OA 1BOCA 1QV1A 1IQ5A 2P6BB 3CGAA 2RGIA 4N1FA 4TNCA 4ZCVA 1NCZA 3BYAA 1CLLA 2WCHA 1K96A 3DY9A 4PE0A 3OP0A 5CSFA 4MSPA 5FI2A 1DGVA 2ISDA 1J7PA 1DC1A 2LLSA 2BKHB 1G33A 2F3YA 3EKJA 3K21A 3JVTB 3EVVA 3OBVA 3PSRA 3HX4A 4PALA 3O78A 2JPTA 2F2OA 4OKHA 2HPSA 4MBEA 1QATA 1XK4A 3BFAA 1B8RA 1SCMC 2K2FA 1K90D 1Q80A 2LMUA 1K8UA 3CR5X 3DD4A 3TDUA 1AJ5A 2KI4B 1YTZC 1J7QA 3S0EA 1W7JB 2AMIA 2MHHA 3CZ0A 1OOHA 3SG5A 3DVJA 1TCFA 1QVIZ 2KQ6A 1DGUA 1MR8A 2CCMA 2LUXA 1B8LA 2LLTA 2JT0A 1IQ3A 1J55A 2BKIB 4M2OA 5HYDA 1GM0A 2H61C 1LA0A 1KK7Y 1BF5A 2BNXA
chains in the Genus database with same CATH topology
2WCFA 4M2QA 1C07A 5TNCA 1YUUA 3IF7A 3IQQA 1RFJA 4OV2A 2PSRA 2ZN9A 4PDZA 1RK9A 2D8NA 4PCWA 4MVFA 1J1EA 1JWDA 1OMVA 1K9KA 2F8PA 2JTZA 2Q91A 1CDLA 3SJSA 3JTDB 1MXEA 2K7DA 3D0YA 1SNLA 1JFKA 2LMVA 3D0YB 1QX2A 5D7FA 1B7TZ 3EVRA 2OPOA 1DJHA 2JNFA 1B4CA 3TDZA 5GQQC 1EH2A 1U5IB 1XYDA 3SG7A 2PMYA 3PLFB 1JUOA 4OCIA 1QIWA 1LKJA 1ZOTB 2CTNA 2V53A 3SG3A 5HKYA 2BL0B 5JOLA 2OS8C 1K9PA 2JXCA 4MN0A 1GQMA 1PK0D 4A4BA 1CFPA 1JC2A 1B7TY 2TN4A 1TN4A 2KAXA 3AAKA 5AERA 2LNKA 2JRFA 1IGVA 2JZIA 2LVJA 1FW4A 4MRXA 2KI6D 3BUOB 3CZTX 2PASA 1A2XA 1MF8B 2GGZA 2Y1MA 2BE6A 3I5HC 1UHNA 3VRRA 2KFGA 1QX5B 1S1EA 3NXAA 3DF0B 4JQ0D 1FBVA 3LK1A 4HRHA 3KO0A 1XFVO 2EC6C 1M63B 2Y4QA 2K7OA 1TNXA 5DKQA 1KFUL 1SYMA 3NSIA 5BPJA 1S6IA 3I5GB 2KDHA 2BECA 4PHJA 3VRPA 1NYAA 2QPTA 3AKAA 4XYNA 1TTXA 1XO5A 2WORA 1WY9A 1PSBA 1NX0A 2I94A 2LVKA 1XFZO 2EHBA 1WDCB 2KFHA 1MQ1A 1DMOA 4PE4A 4NQGA 3BOWA 2KGRA 1BG1A 4DUQA 4MZKA 4DRWA 4A4CA 4F0ZB 3PN7C 2KOTA 1RROA 1F4QA 1KQMC 1UHJA 3I5IB 1S26D 5FYXA 1XFXO 1BR4B 5B8IB 1NX1A 1KSMA 1DF0B 1M39A 5CSIA 4IL1A 1Y1AA 1L2OC 1UP5A 1DJYA 2I7AA 3TUYB 5KU1A 2DOQA 2MLEC 3I5FC 1IG5A 2MAZA 1QIVA 1KWOB 3C1VA 2L51A 2LANA 3GOFA 2NLNA 4P2YB 5ER5A 1K9UA 1JBAA 1CM4A 2CXJA 2JTTA 1F4OA 3BUNB 1AVSA 4DS7A 1BMOA 1MHOA 1EG3A 4N1GA 2ZRTA 1TOPA 4GGNA 4GNKB 1HT9A 1R6PA 1X02A 5DKNA 1NCXA 2CNPA 4WQ3A 1LXFC 2HQWA 2SASA 3A8RA 1M46A 5CSJA 4PHMA 1GJYA 5IBWA 2KNEA 1DTLA 4FQOA 4MLWA 3WHUB 1CFDA 2H2KA 1KK8C 3LK0A 1QASA 2CT9A 5JJGA 2MJWB 3LLEA 2GV5A 4ORBB 3NSLA 2F2PA 1R2UA 2OTGC 4PE7A 1Y0VH 1B8CA 1PVBA 2HETA 1UHIA 1UWOA 2L2EA 1F71A 1S36A 1QLSA 1W7IB 1J7OA 4AQJA 4CFQA 4QJ3B 2HF5A 4XJKA 4AOMA 1PRWA 3F45A 2I18A 1B1GA 1TRFA 1CTRA 2M3WA 1B47A 1KFXS 1SL8A 4YGCB 4CPVA 5KSZA 3DVKA 1SW8A 3ZWHA 1F8HA 1WLZA 1QVIY 1XVJA 2SCPA 1VRKA 4MEWA 2FCDA 2M97A 4N5XA 2G2BA 1SCMB 4OR9B 1IJ5A 4YBHB 1BODA 2KBIA 1Y6WA 3VROA 2BL0C 4C0LA 1PVAA 1KFUS 1AK8A 5HLOA 1SPYA 2WCEA 1YX8A 2JT3A 2QACA 1B9AA 2H61A 2FCEA 4PE1A 2K61A 2E30A 1IRJA 2M7LA 3VRNA 3EVUA 2LV7A 4PHNA 3AKBA 1OMRA 3SIBA 2EGDA 2K0JA 4GFTA 1ZACA 2JC2A 1S6JA 2E6WA 4MRYA 1KCYA 3E3RA 1AP4A 1KSOA 1UURA 1YRTB 1AUIB 1MWNA 1NX2A 3VRQA 3HCMA 1SK6D 3TS5C 2B1UA 5CPVA 1MXLC 2ZN8A 2F3ZA 1AHRA 1DJGA 1GGWA 1SR6C 1CDMA 1S6CA 3OX6A 2JOJA 3PFVA 3SG6A 2OS8B 1CDNA 1DJWA 1N2DA 2JULA 4BY5A 1YX7A 1IWQA 1N0YA 2Q4UA 1K2HA 1QJTA 1CLMA 4GPLB 1NPQA 4NDDA 2MLFC 1SRAA 1CLBA 1YVLA 1NP8A 5HLVA 1QX7A 2LAPA 1RECA 3SG2A 4E68A 1SY9A 1WRKA 4MZLA 2IS9A 2KYCA 3BOWB 1QXPA 1CB1A 3NSOA 1AJ4A 2L98A 1MUXA 2LUCA 2R2IA 3I5HB 1EL4A 3OHMB 3PALA 4WQ2A 5I2OA 2NXQA 1BJFA 4ORCB 1S5GZ 2MBXA 2NCPA 3LL8B 2CBLA 3EK8A 2EC6B 4HSZA 5AANA 3CTNA 2K7BA 4MZJA 4CFRA 1QV0A 1K94A 1RJVA 2KYFA 2NCOA 3OB2B 3TZ1A 2HQ8A 3CS1A 4DIRA 2O5GA 4ORAB 2AAOA 4YGEB 4NDBA 4AQIA 1YUSA 1HQVA 5K89A 2WOSA 1TNWA 4JPZB 1A75A 1IKUA 1NSHA 1S5GY 1SCVA 2LMTA 2LLUA 2LP2A 2BCAA 1H8BA 1N65A 2LHLA 3CR2A 1ZUZA 4OVNF 1TNPA 2LE9B 1ODBA 3BQ3A 2LCPA 2KBMA 1YUTA 2VRGA 3EKHA 1ZFSA 1CNPA 3PN7B 4GBAA 1BLQA 3JVTC 1OZOA 3AAJA 1TIZA 1SL9A 1UHHA 2KAYA 2K2AA 1M31A 2LHIA 5KTYA 4I5KA 1L2OB 3PM8A 3O2PA 2KI4C 1QLKA 2JWWA 1FI6A 4I5NB 1DJIA 1QS7A 3WHTB 1IH0A 2M1UA 1XA5A 1SMGA 1L7ZA 1UUSA 4M2PA 2ZKMX 1TNQA 1WRLA 1CFCA 1C7WA 1JF2A 3ICBA 2KFFA 2O60A 2M8UA 4I5LB 2MA2A 4C0JA 1CFFA 4YGAA 2BE4A 1ZMZA 1OMDA 4XJKB 1CKKA 3TDIA 1A29A 2ZFDA 4L9MA 1BU3A 2M49B 3M0WA 2COLB 1OQPA 4YGBB 4QJ4B 3WXAA 2WC8A 4C0KA 1KQVA 1ALVA 1YRUB 3CWGA 1C7VA 3JTDC 4GGFC 1KK7Z 1S3PA 1Y1XA 3SG4A 4FTGA 5AFPA 2ZRSA 2L5XB 1J1DA 1KK8B 2PALA 5AXIA 1A03A 4Q04A 4WRIA 1JF0A 2KSPA 3FWCA 3KEVA 1OSAA 2OTGB 4BY4A 2FJUB 4QJ5B 1LA3A 3GK4X 1NIWA 3DVEA 3QRXA 1D1OA 1F54A 1V1FA 2L4HA 4YRUA 5I2QA 2M9GA 1OE9B 3BUWB 1UHKA 2BBNA 5HKZA 1K93D 1M45A 4NDCA 4D1EA 5DKRA 5G08A 1XFUO 3FWBA 1XFYO 5PALA 4YI8A 2LVVA 2L50A 4GGFA 2LP3A 4CIDA 5D69A 1EJ3A 3GK1A 2KHNA 2M0RA 1PULA 2L0PA 1NWDA 2JU0A 2FOTA 1A4PA 2L4IA 3WNXB 2K7CA 2WCBA 1J7RA 1U5IA 2Y5IA 4P5OE 1CMGA 1FI5A 3BUMB 3LCPC 3FIAA 1XFWO 4GAOA 1GGZA 2M29A 2ZNEA 2NZ0A 1RTP1 1LVCD 4YI9A 4YGDB 1FF1A 1EG4A 2Y1NA 3I5GC 2LC5A 3SIAA 3H4SE 3KHEA 1WLMA 1KFXL 4UPGA 2MRDA 3IQOA 2KI6C 1NX3A 1G8IA 3DVMA 3BUXB 2M1KB 1F55A 1WDCC 1CDPA 2KGBC 1PSRA 1WRZA 3BXKA 2PVBA 1PALA 3PATA 2JXLA 4JWQA 1YURA 1BT6A 3DF0A 2AUCA 3EK7A 3I5IC 2K8MB 3RLZA 1DJXA 1H4BA 1EXRA 3KPXA 5AEQA 4GUKA 5F6TA 3TS5B 4ICBA 3TUYC 2JT8A 3OX5A 1QTXA 5I8NA 1DVIA 1LINA 3CR4X 2F33A 2A4JA 4CLNA 3O6BA 1KWOC 4USLA 4U8DA 1SL7A 3O4YA 3ZNIA 1F70A 1E8AA 1DT7B 1SR6B 4HRGA 1K95A 2ZNDA 1BR1B 5J3XA 4R1EA 1CM1A 2BCXA 2I2RE 4PHKA 3EK4A 3NSKA 3MSEB 1A75B 1NUBA 2WNDA 4ZCUA 1IJ6A 2GGMA 1ALWA 2G9BA 2M7NA 1OZSA 2JQ6A 5I2LA 1JSAA 2BBMA 1CMFA 1DF0A 1OOJA 3CLNA 1KQMB 5HKWA 3FS7A 2KQYA 2KAVA 3OB1B 1XK4C 2LM5A 2JNXA 5ER4X 1V1GA 3RM1A 2PRUA 1YR5A 1SBJA 1TCOB 1DJZA 1G4YR 1FPWA 2LVIA 1YVHA 3GK2A 4ETOA 5CSNA 4HREE 1NCYA 1SKTA 3I5FB 3KF9A 2BCBA 3D10A 1JFJA 4I5JA 1RWYA 3VGOA 1Y1UA 4DCKA 3A4UB 1BOCA 1QV1A 1IQ5A 2P6BB 3CGAA 2RGIA 4N1FA 4TNCA 4ZCVA 1NCZA 3BYAA 1CLLA 4PE0A 1K96A 3OP0A 5CSFA 4MSPA 1DGVA 2ISDA 1J7PA 2LLSA 2BKHB 1G33A 2F3YA 3EKJA 3K21A 3JVTB 3EVVA 3PSRA 3HX4A 4PALA 3O78A 2JPTA 2F2OA 4OKHA 2HPSA 4MBEA 1QATA 1XK4A 1B8RA 1SCMC 2K2FA 1K90D 1Q80A 2LMUA 1K8UA 3CR5X 3DD4A 3TDUA 1AJ5A 2KI4B 1YTZC 1J7QA 1W7JB 2AMIA 2MHHA 3SG5A 3DVJA 1TCFA 1QVIZ 2KQ6A 1DGUA 1MR8A 2CCMA 2LUXA 1B8LA 2LLTA 2JT0A 1IQ3A 1J55A 2BKIB 4M2OA 5HYDA 2H61C 1LA0A 1KK7Y 1BF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WCF A;  4M2Q A;  1C07 A;  5TNC A;  1YUU A;  3IF7 A;  3IQQ A;  1RFJ A;  4OV2 A;  2PSR A;  2ZN9 A;  4PDZ A;  1RK9 A;  2D8N A;  4PCW A;  4MVF A;  1J1E A;  1JWD A;  1OMV A;  1K9K A;  2F8P A;  2JTZ A;  2Q91 A;  1CDL A;  3SJS A;  3JTD B;  1MXE A;  2K7D A;  3D0Y A;  1SNL A;  1JFK A;  2LMV A;  3D0Y B;  1QX2 A;  5D7F A;  1B7T Z;  3EVR A;  2OPO A;  1DJH A;  2JNF A;  1B4C A;  3TDZ A;  5GQQ C;  1EH2 A;  1U5I B;  1XYD A;  3SG7 A;  2PMY A;  3PLF B;  1JUO A;  4OCI A;  1QIW A;  1LKJ A;  1ZOT B;  2CTN A;  2V53 A;  3SG3 A;  5HKY A;  2BL0 B;  5JOL A;  2OS8 C;  1K9P A;  2JXC A;  4MN0 A;  1GQM A;  1PK0 D;  4A4B A;  1CFP A;  1JC2 A;  1B7T Y;  2TN4 A;  1TN4 A;  2KAX A;  3AAK A;  5AER A;  2LNK A;  2JRF A;  1IGV A;  2JZI A;  2LVJ A;  1FW4 A;  4MRX A;  2KI6 D;  3BUO B;  3CZT X;  2PAS A;  1A2X A;  1MF8 B;  2GGZ A;  2Y1M A;  2BE6 A;  3I5H C;  1UHN A;  3VRR A;  2KFG A;  1QX5 B;  1S1E A;  3NXA A;  3DF0 B;  4JQ0 D;  1FBV A;  3LK1 A;  4HRH A;  3KO0 A;  1XFV O;  2EC6 C;  1M63 B;  2Y4Q A;  2K7O A;  1TNX A;  5DKQ A;  1KFU L;  1SYM A;  3NSI A;  5BPJ A;  1S6I A;  3I5G B;  2KDH A;  2BEC A;  4PHJ A;  3VRP A;  1NYA A;  2QPT A;  3AKA A;  4XYN A;  1TTX A;  1XO5 A;  2WOR A;  1WY9 A;  1PSB A;  1NX0 A;  2I94 A;  2LVK A;  1XFZ O;  2EHB A;  1WDC B;  2KFH A;  1MQ1 A;  1DMO A;  4PE4 A;  4NQG A;  3BOW A;  2KGR A;  1BG1 A;  4DUQ A;  4MZK A;  4DRW A;  4A4C A;  4F0Z B;  3PN7 C;  2KOT A;  1RRO A;  1F4Q A;  1KQM C;  1UHJ A;  3I5I B;  1S26 D;  5FYX A;  1XFX O;  1BR4 B;  5B8I B;  1NX1 A;  1KSM A;  1DF0 B;  1M39 A;  5CSI A;  4IL1 A;  1Y1A A;  1L2O C;  1UP5 A;  1DJY A;  2I7A A;  3TUY B;  5KU1 A;  2DOQ A;  2MLE C;  3I5F C;  1IG5 A;  2MAZ A;  1QIV A;  1KWO B;  3C1V A;  2L51 A;  2LAN A;  3GOF A;  2NLN A;  4P2Y B;  5ER5 A;  1K9U A;  1JBA A;  1CM4 A;  2CXJ A;  2JTT A;  1F4O A;  3BUN B;  1AVS A;  4DS7 A;  1BMO A;  1MHO A;  1EG3 A;  4N1G A;  2ZRT A;  1TOP A;  4GGN A;  4GNK B;  1HT9 A;  1R6P A;  1X02 A;  5DKN A;  1NCX A;  2CNP A;  4WQ3 A;  1LXF C;  2HQW A;  2SAS A;  3A8R A;  1M46 A;  5CSJ A;  4PHM A;  1GJY A;  5IBW A;  2KNE A;  1DTL A;  4FQO A;  4MLW A;  3WHU B;  1CFD A;  2H2K A;  1KK8 C;  3LK0 A;  1QAS A;  2CT9 A;  5JJG A;  2MJW B;  3LLE A;  2GV5 A;  4ORB B;  3NSL A;  2F2P A;  1R2U A;  2OTG C;  4PE7 A;  1Y0V H;  1B8C A;  1PVB A;  2HET A;  1UHI A;  1UWO A;  2L2E A;  1F71 A;  1S36 A;  1QLS A;  1W7I B;  1J7O A;  4AQJ A;  4CFQ A;  4QJ3 B;  2HF5 A;  4XJK A;  4AOM A;  1PRW A;  3F45 A;  2I18 A;  1B1G A;  1TRF A;  1CTR A;  2M3W A;  1B47 A;  1KFX S;  1SL8 A;  4YGC B;  4CPV A;  5KSZ A;  3DVK A;  1SW8 A;  3ZWH A;  1F8H A;  1WLZ A;  1QVI Y;  1XVJ A;  2SCP A;  1VRK A;  4MEW A;  2FCD A;  2M97 A;  4N5X A;  2G2B A;  1SCM B;  4OR9 B;  1IJ5 A;  4YBH B;  1BOD A;  2KBI A;  1Y6W A;  3VRO A;  2BL0 C;  4C0L A;  1PVA A;  1KFU S;  1AK8 A;  5HLO A;  1SPY A;  2WCE A;  1YX8 A;  2JT3 A;  2QAC A;  1B9A A;  2H61 A;  2FCE A;  4PE1 A;  2K61 A;  2E30 A;  1IRJ A;  2M7L A;  3VRN A;  3EVU A;  2LV7 A;  4PHN A;  3AKB A;  1OMR A;  3SIB A;  2EGD A;  2K0J A;  4GFT A;  1ZAC A;  2JC2 A;  1S6J A;  2E6W A;  4MRY A;  1KCY A;  3E3R A;  1AP4 A;  1KSO A;  1UUR A;  1YRT B;  1AUI B;  1MWN A;  1NX2 A;  3VRQ A;  3HCM A;  1SK6 D;  3TS5 C;  2B1U A;  5CPV A;  1MXL C;  2ZN8 A;  2F3Z A;  1AHR A;  1DJG A;  1GGW A;  1SR6 C;  1CDM A;  1S6C A;  3OX6 A;  2JOJ A;  3PFV A;  3SG6 A;  2OS8 B;  1CDN A;  1DJW A;  1N2D A;  2JUL A;  4BY5 A;  1YX7 A;  1IWQ A;  1N0Y A;  2Q4U A;  1K2H A;  1QJT A;  1CLM A;  4GPL B;  1NPQ A;  4NDD A;  2MLF C;  1SRA A;  1CLB A;  1YVL A;  1NP8 A;  5HLV A;  1QX7 A;  2LAP A;  1REC A;  3SG2 A;  4E68 A;  1SY9 A;  1WRK A;  4MZL A;  2IS9 A;  2KYC A;  3BOW B;  1QXP A;  1CB1 A;  3NSO A;  1AJ4 A;  2L98 A;  1MUX A;  2LUC A;  2R2I A;  3I5H B;  1EL4 A;  3OHM B;  3PAL A;  4WQ2 A;  5I2O A;  2NXQ A;  1BJF A;  4ORC B;  1S5G Z;  2MBX A;  2NCP A;  3LL8 B;  2CBL A;  3EK8 A;  2EC6 B;  4HSZ A;  5AAN A;  3CTN A;  2K7B A;  4MZJ A;  4CFR A;  1QV0 A;  1K94 A;  1RJV A;  2KYF A;  2NCO A;  3OB2 B;  3TZ1 A;  2HQ8 A;  3CS1 A;  4DIR A;  2O5G A;  4ORA B;  2AAO A;  4YGE B;  4NDB A;  4AQI A;  1YUS A;  1HQV A;  5K89 A;  2WOS A;  1TNW A;  4JPZ B;  1A75 A;  1IKU A;  1NSH A;  1S5G Y;  1SCV A;  2LMT A;  2LLU A;  2LP2 A;  2BCA A;  1H8B A;  1N65 A;  2LHL A;  3CR2 A;  1ZUZ A;  4OVN F;  1TNP A;  2LE9 B;  1ODB A;  3BQ3 A;  2LCP A;  2KBM A;  1YUT A;  2VRG A;  3EKH A;  1ZFS A;  1CNP A;  3PN7 B;  4GBA A;  1BLQ A;  3JVT C;  1OZO A;  3AAJ A;  1TIZ A;  1SL9 A;  1UHH A;  2KAY A;  2K2A A;  1M31 A;  2LHI A;  5KTY A;  4I5K A;  1L2O B;  3PM8 A;  3O2P A;  2KI4 C;  1QLK A;  2JWW A;  1FI6 A;  4I5N B;  1DJI A;  1QS7 A;  3WHT B;  1IH0 A;  2M1U A;  1XA5 A;  1SMG A;  1L7Z A;  1UUS A;  4M2P A;  2ZKM X;  1TNQ A;  1WRL A;  1CFC A;  1C7W A;  1JF2 A;  3ICB A;  2KFF A;  2O60 A;  2M8U A;  4I5L B;  2MA2 A;  4C0J A;  1CFF A;  4YGA A;  2BE4 A;  1ZMZ A;  1OMD A;  4XJK B;  1CKK A;  3TDI A;  1A29 A;  2ZFD A;  4L9M A;  1BU3 A;  2M49 B;  3M0W A;  2COL B;  1OQP A;  4YGB B;  4QJ4 B;  3WXA A;  2WC8 A;  4C0K A;  1KQV A;  1ALV A;  1YRU B;  3CWG A;  1C7V A;  3JTD C;  4GGF C;  1KK7 Z;  1S3P A;  1Y1X A;  3SG4 A;  4FTG A;  5AFP A;  2ZRS A;  2L5X B;  1J1D A;  1KK8 B;  2PAL A;  5AXI A;  1A03 A;  4Q04 A;  4WRI A;  1JF0 A;  2KSP A;  3FWC A;  3KEV A;  1OSA A;  2OTG B;  4BY4 A;  2FJU B;  4QJ5 B;  1LA3 A;  3GK4 X;  1NIW A;  3DVE A;  3QRX A;  1D1O A;  1F54 A;  1V1F A;  2L4H A;  4YRU A;  5I2Q A;  2M9G A;  1OE9 B;  3BUW B;  1UHK A;  2BBN A;  5HKZ A;  1K93 D;  1M45 A;  4NDC A;  4D1E A;  5DKR A;  5G08 A;  1XFU O;  3FWB A;  1XFY O;  5PAL A;  4YI8 A;  2LVV A;  2L50 A;  4GGF A;  2LP3 A;  4CID A;  5D69 A;  1EJ3 A;  3GK1 A;  2KHN A;  2M0R A;  1PUL A;  2L0P A;  1NWD A;  2JU0 A;  2FOT A;  1A4P A;  2L4I A;  3WNX B;  2K7C A;  2WCB A;  1J7R A;  1U5I A;  2Y5I A;  4P5O E;  1CMG A;  1FI5 A;  3BUM B;  3LCP C;  3FIA A;  1XFW O;  4GAO A;  1GGZ A;  2M29 A;  2ZNE A;  2NZ0 A;  1RTP 1;  1LVC D;  4YI9 A;  4YGD B;  1FF1 A;  1EG4 A;  2Y1N A;  3I5G C;  2LC5 A;  3SIA A;  3H4S E;  3KHE A;  1WLM A;  1KFX L;  4UPG A;  2MRD A;  3IQO A;  2KI6 C;  1NX3 A;  1G8I A;  3DVM A;  3BUX B;  2M1K B;  1F55 A;  1WDC C;  1CDP A;  2KGB C;  1PSR A;  1WRZ A;  3BXK A;  2PVB A;  1PAL A;  3PAT A;  2JXL A;  4JWQ A;  1YUR A;  1BT6 A;  3DF0 A;  2AUC A;  3EK7 A;  3I5I C;  2K8M B;  3RLZ A;  1DJX A;  1H4B A;  1EXR A;  3KPX A;  5AEQ A;  4GUK A;  5F6T A;  3TS5 B;  4ICB A;  3TUY C;  2JT8 A;  3OX5 A;  1QTX A;  5I8N A;  1DVI A;  1LIN A;  3CR4 X;  2F33 A;  2A4J A;  4CLN A;  3O6B A;  1KWO C;  4USL A;  4U8D A;  1SL7 A;  3O4Y A;  3ZNI A;  1F70 A;  1E8A A;  1DT7 B;  1SR6 B;  4HRG A;  1K95 A;  2ZND A;  1BR1 B;  5J3X A;  4R1E A;  1CM1 A;  2BCX A;  2I2R E;  4PHK A;  3EK4 A;  3NSK A;  3MSE B;  1A75 B;  1NUB A;  2WND A;  4ZCU A;  1IJ6 A;  2GGM A;  1ALW A;  2G9B A;  2M7N A;  1OZS A;  2JQ6 A;  5I2L A;  1JSA A;  2BBM A;  1CMF A;  1DF0 A;  1OOJ A;  3CLN A;  1KQM B;  5HKW A;  3FS7 A;  2KQY A;  2KAV A;  3OB1 B;  1XK4 C;  2LM5 A;  2JNX A;  5ER4 X;  1V1G A;  3RM1 A;  2PRU A;  1YR5 A;  1SBJ A;  1TCO B;  1DJZ A;  1G4Y R;  1FPW A;  2LVI A;  1YVH A;  3GK2 A;  4ETO A;  5CSN A;  4HRE E;  1NCY A;  1SKT A;  3I5F B;  3KF9 A;  2BCB A;  3D10 A;  1JFJ A;  4I5J A;  1RWY A;  3VGO A;  1Y1U A;  4DCK A;  3A4U B;  1BOC A;  1QV1 A;  1IQ5 A;  2P6B B;  3CGA A;  2RGI A;  4N1F A;  4TNC A;  4ZCV A;  1NCZ A;  3BYA A;  1CLL A;  4PE0 A;  1K96 A;  3OP0 A;  5CSF A;  4MSP A;  1DGV A;  2ISD A;  1J7P A;  2LLS A;  2BKH B;  1G33 A;  2F3Y A;  3EKJ A;  3K21 A;  3JVT B;  3EVV A;  3PSR A;  3HX4 A;  4PAL A;  3O78 A;  2JPT A;  2F2O A;  4OKH A;  2HPS A;  4MBE A;  1QAT A;  1XK4 A;  1B8R A;  1SCM C;  2K2F A;  1K90 D;  1Q80 A;  2LMU A;  1K8U A;  3CR5 X;  3DD4 A;  3TDU A;  1AJ5 A;  2KI4 B;  1YTZ C;  1J7Q A;  1W7J B;  2AMI A;  2MHH A;  3SG5 A;  3DVJ A;  1TCF A;  1QVI Z;  2KQ6 A;  1DGU A;  1MR8 A;  2CCM A;  2LUX A;  1B8L A;  2LLT A;  2JT0 A;  1IQ3 A;  1J55 A;  2BKI B;  4M2O A;  5HYD A;  2H61 C;  1LA0 A;  1KK7 Y;  1BF5 A; 
#chains in the Genus database with same CATH topology
 2WCF A;  4M2Q A;  1C07 A;  4FQT A;  1YUU A;  3IF7 A;  5TNC A;  1OW4 A;  3IQQ A;  1RFJ A;  4OV2 A;  2PSR A;  2ZN9 A;  4PDZ A;  1RK9 A;  2KPH A;  2D8N A;  4PCW A;  4MVF A;  1J1E A;  1JWD A;  1OMV A;  1K9K A;  2F8P A;  2JTZ A;  2Q91 A;  1CDL A;  3SJS A;  3JTD B;  1MXE A;  4KYN A;  2K7D A;  1DEK A;  3D0Y A;  1SNL A;  1JFK A;  2LMV A;  3D0Y B;  1QX2 A;  5D7F A;  1SSE B;  1B7T Z;  3EVR A;  3L4A A;  2OPO A;  1DJH A;  2JNF A;  1B4C A;  3TDZ A;  5GQQ C;  1EH2 A;  1U5I B;  1XYD A;  2WCM A;  3SG7 A;  2PMY A;  3PLF B;  1JUO A;  4OCI A;  1QIW A;  1LKJ A;  1ZOT B;  3SS5 A;  2CTN A;  1Z4H A;  2V53 A;  3SG3 A;  3BFB A;  3D78 A;  5HKY A;  2BL0 B;  5JOL A;  2OS8 C;  1K9P A;  2JXC A;  4MN0 A;  1GQM A;  1PK0 D;  4A4B A;  1CFP A;  1JC2 A;  1B7T Y;  2TN4 A;  1TN4 A;  2KAX A;  3AAK A;  5AER A;  2LNK A;  2JRF A;  1IGV A;  2QEB A;  2JZI A;  2LVJ A;  2WC6 A;  1FW4 A;  3NHT A;  4MRX A;  2KI6 D;  3BUO B;  3CZT X;  2PAS A;  2BAP A;  1A2X A;  1MF8 B;  2GGZ A;  2Y1M A;  2BE6 A;  3I5H C;  1UHN A;  3VRR A;  2KFG A;  1QX5 B;  1S1E A;  3B6X A;  3NXA A;  3DF0 B;  4JQ0 D;  1FBV A;  3LK1 A;  4HRH A;  3KO0 A;  1XFV O;  2EC6 C;  1M63 B;  2Y4Q A;  2QEO A;  2K7O A;  1TNX A;  5DKQ A;  1KFU L;  3B88 A;  1SYM A;  3NSI A;  3QME A;  5BPJ A;  1S6I A;  3I5G B;  2KDH A;  3S0D A;  2BEC A;  4PHJ A;  3VRP A;  1NYA A;  2QPT A;  3AKA A;  4XYN A;  1TTX A;  1XO5 A;  2WCK A;  2WOR A;  1WY9 A;  1PSB A;  1NX0 A;  2I94 A;  2LVK A;  3B86 A;  1XFZ O;  2EHB A;  1WDC B;  2KFH A;  1MQ1 A;  1DMO A;  4PE4 A;  4IJ7 A;  3BOW A;  2KGR A;  2ERB A;  4NQG A;  1BG1 A;  4DUQ A;  4MZK A;  4DRW A;  4A4C A;  1QWV A;  3PN7 C;  4F0Z B;  2KOT A;  1RRO A;  3BJH A;  1F4Q A;  1KQM C;  1UHJ A;  2QDI A;  1S26 D;  3I5I B;  5FYX A;  1XFX O;  1BR4 B;  5B8I B;  1NX1 A;  1KSM A;  5D3O A;  1DF0 B;  1M39 A;  5CSI A;  4IL1 A;  1Y1A A;  1L2O C;  3OGN A;  1UP5 A;  1DJY A;  2I7A A;  3TUY B;  5KU1 A;  2DOQ A;  2MLE C;  3I5F C;  1IG5 A;  2MAZ A;  1QIV A;  1KWO B;  3C1V A;  2L51 A;  2LAN A;  3GOF A;  2NLN A;  4P2Y B;  5ER5 A;  1K9U A;  1JBA A;  1CM4 A;  2CXJ A;  2JTT A;  1F4O A;  1OOI X;  3BUN B;  1AVS A;  4DS7 A;  1BMO A;  1MHO A;  1EG3 A;  4N1G A;  2ZRT A;  1TOP A;  4GGN A;  4GNK B;  1HT9 A;  3FE6 A;  1R6P A;  1X02 A;  5DKN A;  1NCX A;  2CNP A;  4WQ3 A;  1C3Y A;  1LXF C;  2HQW A;  2SAS A;  3A8R A;  1M46 A;  5CSJ A;  4PHM A;  1GJY A;  5IBW A;  2KNE A;  1DTL A;  4FQO A;  4MLW A;  3WHU B;  1CFD A;  2H2K A;  1KK8 C;  3LK0 A;  1QAS A;  2P71 A;  2CT9 A;  5JJG A;  2MJW B;  3LLE A;  2GV5 A;  4ORB B;  3NSL A;  5HL1 A;  2F2P A;  1R2U A;  2OTG C;  4PE7 A;  1Y0V H;  1B8C A;  1PVB A;  3L47 A;  1T14 A;  3PJI A;  1P28 A;  1TWO A;  2HET A;  1UHI A;  3K1E A;  1UWO A;  2L2E A;  1F71 A;  1S36 A;  3R1P A;  1QLS A;  1W7I B;  1J7O A;  4AQJ A;  4CFQ A;  4QJ3 B;  2HF5 A;  4XJK A;  3B7A A;  4AOM A;  1PRW A;  3D74 A;  3F45 A;  3DYE A;  2I18 A;  1B1G A;  1TRF A;  1CTR A;  2M3W A;  1B47 A;  1KFX S;  1SL8 A;  1DQE A;  3B87 A;  4YGC B;  3DVK A;  4CPV A;  5KSZ A;  1IIO A;  1SW8 A;  3CZ2 A;  3ZWH A;  1F8H A;  1WLZ A;  1QVI Y;  1XVJ A;  2SCP A;  1VRK A;  4MEW A;  2FCD A;  1C3Z A;  2M97 A;  4N5X A;  2G2B A;  3PM2 A;  1SCM B;  4OR9 B;  1IJ5 A;  4YBH B;  1BOD A;  2KBI A;  1Y6W A;  3VRO A;  2BL0 C;  3D76 A;  4C0L A;  3Q8I A;  1PVA A;  3FE8 A;  1TUJ A;  1KFU S;  1AK8 A;  5HLO A;  1SPY A;  2WCE A;  1YX8 A;  2JT3 A;  2QAC A;  1DEL A;  1B9A A;  2H61 A;  2FCE A;  4PE1 A;  2K61 A;  2E30 A;  1IRJ A;  2L5Y A;  2M7L A;  3VRN A;  3EVU A;  2LV7 A;  4PHN A;  3AKB A;  1OMR A;  3SIB A;  2EGD A;  2K0J A;  4JKT A;  4GFT A;  1ZAC A;  2JC2 A;  1S6J A;  2E6W A;  4MRY A;  1KCY A;  3BFH A;  3E3R A;  1AP4 A;  1KSO A;  1UUR A;  3SS3 A;  3D73 A;  1YRT B;  1AUI B;  1MWN A;  1NX2 A;  3VRQ A;  3HCM A;  1SK6 D;  3TS5 C;  2B1U A;  5CPV A;  1MXL C;  2ZN8 A;  3UNW A;  3CYZ A;  2F3Z A;  1AHR A;  1DJG A;  1GGW A;  1SR6 C;  1CDM A;  1S6C A;  3OX6 A;  2H8V A;  2JOJ A;  3PFV A;  2OS8 B;  3SG6 A;  1CDN A;  1DJW A;  1N2D A;  2JUL A;  4BY5 A;  1YX7 A;  1IWQ A;  1N0Y A;  2Q4U A;  4JD9 A;  1K2H A;  1QJT A;  1CLM A;  4GPL B;  1NPQ A;  4NDD A;  2MLF C;  3V2L A;  1SRA A;  1CLB A;  1YVL A;  1NP8 A;  5HLV A;  1QX7 A;  2LAP A;  1REC A;  4OZD A;  3SG2 A;  4E68 A;  1SY9 A;  1WRK A;  4MZL A;  2IS9 A;  1TUZ A;  2KYC A;  3BOW B;  1QXP A;  1CB1 A;  2PYQ A;  3CDN A;  3NSO A;  1AJ4 A;  2L2C A;  2L98 A;  1MUX A;  2LUC A;  2R2I A;  3FE9 A;  1EL4 A;  3I5H B;  3OHM B;  3PAL A;  4WQ2 A;  5I2O A;  2NXQ A;  1BJF A;  3DXL A;  4ORC B;  3NHI A;  1S5G Z;  2MBX A;  2NCP A;  3LL8 B;  2CBL A;  3EK8 A;  2EC6 B;  4HSZ A;  5AAN A;  3CTN A;  2K7B A;  4MZJ A;  4CFR A;  1QV0 A;  1K94 A;  1RJV A;  2KYF A;  2NCO A;  5I94 A;  3OB2 B;  3TZ1 A;  2HQ8 A;  3CS1 A;  4DIR A;  5DIC A;  2O5G A;  4ORA B;  2AAO A;  4YGE B;  4NDB A;  4AQI A;  1YUS A;  1HQV A;  5K89 A;  3S0F A;  2WOS A;  1TNW A;  4JPZ B;  1A75 A;  1IKU A;  1NSH A;  1S5G Y;  1SCV A;  2LMT A;  2LLU A;  2LP2 A;  2BCA A;  1H8B A;  1N65 A;  2LHL A;  2QEV A;  1ZUZ A;  3CR2 A;  1TNP A;  2LE9 B;  1ODB A;  3BQ3 A;  2LCP A;  4OVN F;  2KBM A;  1YUT A;  2VRG A;  3EKH A;  1ZFS A;  1CNP A;  3PN7 B;  4GBA A;  1BLQ A;  3JVT C;  1OZO A;  3UO9 A;  3AAJ A;  1TIZ A;  1SL9 A;  1UHH A;  2P70 A;  4INX A;  2KAY A;  2K2A A;  1M31 A;  2KLE A;  2LHI A;  3S0B A;  5KTY A;  4I5K A;  1L2O B;  3PM8 A;  3O2P A;  5FI6 A;  2KI4 C;  1QLK A;  1Z2C B;  2JWW A;  1FI6 A;  4I5N B;  4INW A;  3L4L A;  3O4X A;  3VB1 A;  1DJI A;  1QS7 A;  3WHT B;  1IH0 A;  2GTE A;  2M1U A;  1XA5 A;  1SMG A;  3R72 A;  1L7Z A;  1UUS A;  4M2P A;  2ZKM X;  1TNQ A;  1WRL A;  1CFC A;  1C7W A;  1JF2 A;  3ICB A;  2KFF A;  2O60 A;  3CAB A;  2M8U A;  4I5L B;  2MA2 A;  4C0J A;  1CFF A;  4YGA A;  2BE4 A;  1ZMZ A;  1OMD A;  2WC5 A;  4XJK B;  1CKK A;  2FJY A;  2PQL A;  3TDI A;  1A29 A;  2ZFD A;  4L9M A;  1BU3 A;  2JPO A;  2M49 B;  3M0W A;  2COL B;  1OQP A;  4YGB B;  4QJ4 B;  3WXA A;  1ORG A;  2WC8 A;  1W9Z A;  4C0K A;  1KQV A;  1ALV A;  1YRU B;  3CWG A;  1C7V A;  3JTD C;  3S0G A;  4GGF C;  3SS4 A;  1KK7 Z;  1S3P A;  1Y1X A;  3SG4 A;  4FTG A;  5AFP A;  2ZRS A;  2L5X B;  1J1D A;  1KK8 B;  2PAL A;  5AXI A;  1A03 A;  4Q04 A;  4WRI A;  1JF0 A;  2KSP A;  3FWC A;  3KEV A;  4PT1 A;  1OSA A;  4F7F A;  2OTG B;  4BY4 A;  2FJU B;  4QJ5 B;  1LA3 A;  3GK4 X;  1NIW A;  5FI7 A;  3DVE A;  3QRX A;  1D1O A;  3CZ1 A;  1F54 A;  1V1F A;  2L4H A;  4YRU A;  5I2Q A;  2M9G A;  1OE9 B;  3BUW B;  1UHK A;  2BBN A;  5HKZ A;  1K93 D;  1M45 A;  4NDC A;  3NGV A;  4D1E A;  5DKR A;  5G08 A;  1XFU O;  3FWB A;  1XFY O;  3EG5 B;  4YI8 A;  5PAL A;  2LVV A;  2L50 A;  4GGF A;  2LP3 A;  4CID A;  5D69 A;  1EJ3 A;  3GK1 A;  2KHN A;  2M0R A;  1PUL A;  2L0P A;  1NWD A;  2JU0 A;  2FOT A;  1A4P A;  2L4I A;  2WCJ A;  3WNX B;  3R1V A;  2K7C A;  2WCB A;  1J7R A;  1U5I A;  2KLD A;  2Y5I A;  4P5O E;  3S0A A;  3BUM B;  1CMG A;  3LCP C;  3D75 A;  1FI5 A;  3FIA A;  1XFW O;  4GAO A;  1GGZ A;  2M29 A;  2ZNE A;  2NZ0 A;  1RTP 1;  1LVC D;  4YI9 A;  4YGD B;  1FF1 A;  2QEH A;  1EG4 A;  2Y1N A;  3I5G C;  2LC5 A;  3SIA A;  1OOG A;  3H4S E;  3KHE A;  1WLM A;  1KFX L;  4UPG A;  2MRD A;  3IQO A;  2KI6 C;  1NX3 A;  1G8I A;  3DVM A;  3BUX B;  2M1K B;  1F55 A;  1WDC C;  1CDP A;  2KGB C;  1PSR A;  1WRZ A;  3BXK A;  2PVB A;  1PAL A;  3PAT A;  2JXL A;  4JWQ A;  3D77 A;  3DZT A;  1YUR A;  1BT6 A;  3DF0 A;  2AUC A;  1LS8 A;  3EK7 A;  3I5I C;  2K8M B;  3RLZ A;  5EL2 A;  1DJX A;  1H4B A;  1EXR A;  3KPX A;  5AEQ A;  1XFR A;  4GUK A;  5F6T A;  3TS5 B;  4ICB A;  3TUY C;  2JT8 A;  3OX5 A;  1QTX A;  5I8N A;  1DVI A;  1LIN A;  3CR4 X;  2F33 A;  2A4J A;  4CLN A;  3O6B A;  1KWO C;  4USL A;  4U8D A;  1SL7 A;  3O4Y A;  3ZNI A;  1F70 A;  1E8A A;  1DT7 B;  1SR6 B;  3RZS A;  4HRG A;  1K95 A;  2ZND A;  1BR1 B;  5J3X A;  4R1E A;  1CM1 A;  2BCX A;  2I2R E;  4PHK A;  3EK4 A;  3NSK A;  3MSE B;  2WCL A;  1A75 B;  1NUB A;  2WND A;  4ZCU A;  1IJ6 A;  2GGM A;  1ALW A;  2G9B A;  2M7N A;  1OZS A;  2JQ6 A;  5I2L A;  1JSA A;  2BBM A;  1CMF A;  3IVT A;  3N7H A;  2YGU A;  1DF0 A;  1OOJ A;  3CLN A;  1KQM B;  5HKW A;  3FS7 A;  2KQY A;  2KAV A;  3OB1 B;  1XK4 C;  2LM5 A;  2JNX A;  5ER4 X;  1V1G A;  2K60 A;  3RM1 A;  2PRU A;  1YR5 A;  1SBJ A;  1OOF A;  1TCO B;  1DJZ A;  1G4Y R;  1FPW A;  2LVI A;  1YVH A;  3GK2 A;  4ETO A;  5CSN A;  4HRE E;  1NCY A;  1SKT A;  3I5F B;  3KF9 A;  2BCB A;  3D10 A;  1JFJ A;  4I5J A;  1RWY A;  3VGO A;  1Y1U A;  4DCK A;  3A4U B;  3R1O A;  1BOC A;  1QV1 A;  1IQ5 A;  2P6B B;  3CGA A;  2RGI A;  4N1F A;  4TNC A;  4ZCV A;  1NCZ A;  3BYA A;  1CLL A;  2WCH A;  1K96 A;  3DY9 A;  4PE0 A;  3OP0 A;  5CSF A;  4MSP A;  5FI2 A;  1DGV A;  2ISD A;  1J7P A;  1DC1 A;  2LLS A;  2BKH B;  1G33 A;  2F3Y A;  3EKJ A;  3K21 A;  3JVT B;  3EVV A;  3OBV A;  3PSR A;  3HX4 A;  4PAL A;  3O78 A;  2JPT A;  2F2O A;  4OKH A;  2HPS A;  4MBE A;  1QAT A;  1XK4 A;  3BFA A;  1B8R A;  1SCM C;  2K2F A;  1K90 D;  1Q80 A;  2LMU A;  1K8U A;  3CR5 X;  3DD4 A;  3TDU A;  1AJ5 A;  2KI4 B;  1YTZ C;  1J7Q A;  3S0E A;  1W7J B;  2AMI A;  2MHH A;  3CZ0 A;  1OOH A;  3SG5 A;  3DVJ A;  1TCF A;  1QVI Z;  2KQ6 A;  1DGU A;  1MR8 A;  2CCM A;  2LUX A;  1B8L A;  2LLT A;  2JT0 A;  1IQ3 A;  1J55 A;  2BKI B;  4M2O A;  5HYD A;  1GM0 A;  2H61 C;  1LA0 A;  1KK7 Y;  1BF5 A;  2BNX A; 
#chains in the Genus database with same CATH homology
 2WCF A;  4M2Q A;  1C07 A;  5TNC A;  1YUU A;  3IF7 A;  3IQQ A;  1RFJ A;  4OV2 A;  2PSR A;  2ZN9 A;  4PDZ A;  1RK9 A;  2D8N A;  4PCW A;  4MVF A;  1J1E A;  1JWD A;  1OMV A;  1K9K A;  2F8P A;  2JTZ A;  2Q91 A;  1CDL A;  3SJS A;  3JTD B;  1MXE A;  2K7D A;  3D0Y A;  1SNL A;  1JFK A;  2LMV A;  3D0Y B;  1QX2 A;  5D7F A;  1B7T Z;  3EVR A;  2OPO A;  1DJH A;  2JNF A;  1B4C A;  3TDZ A;  5GQQ C;  1EH2 A;  1U5I B;  1XYD A;  3SG7 A;  2PMY A;  3PLF B;  1JUO A;  4OCI A;  1QIW A;  1LKJ A;  1ZOT B;  2CTN A;  2V53 A;  3SG3 A;  5HKY A;  2BL0 B;  5JOL A;  2OS8 C;  1K9P A;  2JXC A;  4MN0 A;  1GQM A;  1PK0 D;  4A4B A;  1CFP A;  1JC2 A;  1B7T Y;  2TN4 A;  1TN4 A;  2KAX A;  3AAK A;  5AER A;  2LNK A;  2JRF A;  1IGV A;  2JZI A;  2LVJ A;  1FW4 A;  4MRX A;  2KI6 D;  3BUO B;  3CZT X;  2PAS A;  1A2X A;  1MF8 B;  2GGZ A;  2Y1M A;  2BE6 A;  3I5H C;  1UHN A;  3VRR A;  2KFG A;  1QX5 B;  1S1E A;  3NXA A;  3DF0 B;  4JQ0 D;  1FBV A;  3LK1 A;  4HRH A;  3KO0 A;  1XFV O;  2EC6 C;  1M63 B;  2Y4Q A;  2K7O A;  1TNX A;  5DKQ A;  1KFU L;  1SYM A;  3NSI A;  5BPJ A;  1S6I A;  3I5G B;  2KDH A;  2BEC A;  4PHJ A;  3VRP A;  1NYA A;  2QPT A;  3AKA A;  4XYN A;  1TTX A;  1XO5 A;  2WOR A;  1WY9 A;  1PSB A;  1NX0 A;  2I94 A;  2LVK A;  1XFZ O;  2EHB A;  1WDC B;  2KFH A;  1MQ1 A;  1DMO A;  4PE4 A;  4NQG A;  3BOW A;  2KGR A;  1BG1 A;  4DUQ A;  4MZK A;  4DRW A;  4A4C A;  4F0Z B;  3PN7 C;  2KOT A;  1RRO A;  1F4Q A;  1KQM C;  1UHJ A;  3I5I B;  1S26 D;  5FYX A;  1XFX O;  1BR4 B;  5B8I B;  1NX1 A;  1KSM A;  1DF0 B;  1M39 A;  5CSI A;  4IL1 A;  1Y1A A;  1L2O C;  1UP5 A;  1DJY A;  2I7A A;  3TUY B;  5KU1 A;  2DOQ A;  2MLE C;  3I5F C;  1IG5 A;  2MAZ A;  1QIV A;  1KWO B;  3C1V A;  2L51 A;  2LAN A;  3GOF A;  2NLN A;  4P2Y B;  5ER5 A;  1K9U A;  1JBA A;  1CM4 A;  2CXJ A;  2JTT A;  1F4O A;  3BUN B;  1AVS A;  4DS7 A;  1BMO A;  1MHO A;  1EG3 A;  4N1G A;  2ZRT A;  1TOP A;  4GGN A;  4GNK B;  1HT9 A;  1R6P A;  1X02 A;  5DKN A;  1NCX A;  2CNP A;  4WQ3 A;  1LXF C;  2HQW A;  2SAS A;  3A8R A;  1M46 A;  5CSJ A;  4PHM A;  1GJY A;  5IBW A;  2KNE A;  1DTL A;  4FQO A;  4MLW A;  3WHU B;  1CFD A;  2H2K A;  1KK8 C;  3LK0 A;  1QAS A;  2CT9 A;  5JJG A;  2MJW B;  3LLE A;  2GV5 A;  4ORB B;  3NSL A;  2F2P A;  1R2U A;  2OTG C;  4PE7 A;  1Y0V H;  1B8C A;  1PVB A;  2HET A;  1UHI A;  1UWO A;  2L2E A;  1F71 A;  1S36 A;  1QLS A;  1W7I B;  1J7O A;  4AQJ A;  4CFQ A;  4QJ3 B;  2HF5 A;  4XJK A;  4AOM A;  1PRW A;  3F45 A;  2I18 A;  1B1G A;  1TRF A;  1CTR A;  2M3W A;  1B47 A;  1KFX S;  1SL8 A;  4YGC B;  4CPV A;  5KSZ A;  3DVK A;  1SW8 A;  3ZWH A;  1F8H A;  1WLZ A;  1QVI Y;  1XVJ A;  2SCP A;  1VRK A;  4MEW A;  2FCD A;  2M97 A;  4N5X A;  2G2B A;  1SCM B;  4OR9 B;  1IJ5 A;  4YBH B;  1BOD A;  2KBI A;  1Y6W A;  3VRO A;  2BL0 C;  4C0L A;  1PVA A;  1KFU S;  1AK8 A;  5HLO A;  1SPY A;  2WCE A;  1YX8 A;  2JT3 A;  2QAC A;  1B9A A;  2H61 A;  2FCE A;  4PE1 A;  2K61 A;  2E30 A;  1IRJ A;  2M7L A;  3VRN A;  3EVU A;  2LV7 A;  4PHN A;  3AKB A;  1OMR A;  3SIB A;  2EGD A;  2K0J A;  4GFT A;  1ZAC A;  2JC2 A;  1S6J A;  2E6W A;  4MRY A;  1KCY A;  3E3R A;  1AP4 A;  1KSO A;  1UUR A;  1YRT B;  1AUI B;  1MWN A;  1NX2 A;  3VRQ A;  3HCM A;  1SK6 D;  3TS5 C;  2B1U A;  5CPV A;  1MXL C;  2ZN8 A;  2F3Z A;  1AHR A;  1DJG A;  1GGW A;  1SR6 C;  1CDM A;  1S6C A;  3OX6 A;  2JOJ A;  3PFV A;  3SG6 A;  2OS8 B;  1CDN A;  1DJW A;  1N2D A;  2JUL A;  4BY5 A;  1YX7 A;  1IWQ A;  1N0Y A;  2Q4U A;  1K2H A;  1QJT A;  1CLM A;  4GPL B;  1NPQ A;  4NDD A;  2MLF C;  1SRA A;  1CLB A;  1YVL A;  1NP8 A;  5HLV A;  1QX7 A;  2LAP A;  1REC A;  3SG2 A;  4E68 A;  1SY9 A;  1WRK A;  4MZL A;  2IS9 A;  2KYC A;  3BOW B;  1QXP A;  1CB1 A;  3NSO A;  1AJ4 A;  2L98 A;  1MUX A;  2LUC A;  2R2I A;  3I5H B;  1EL4 A;  3OHM B;  3PAL A;  4WQ2 A;  5I2O A;  2NXQ A;  1BJF A;  4ORC B;  1S5G Z;  2MBX A;  2NCP A;  3LL8 B;  2CBL A;  3EK8 A;  2EC6 B;  4HSZ A;  5AAN A;  3CTN A;  2K7B A;  4MZJ A;  4CFR A;  1QV0 A;  1K94 A;  1RJV A;  2KYF A;  2NCO A;  3OB2 B;  3TZ1 A;  2HQ8 A;  3CS1 A;  4DIR A;  2O5G A;  4ORA B;  2AAO A;  4YGE B;  4NDB A;  4AQI A;  1YUS A;  1HQV A;  5K89 A;  2WOS A;  1TNW A;  4JPZ B;  1A75 A;  1IKU A;  1NSH A;  1S5G Y;  1SCV A;  2LMT A;  2LLU A;  2LP2 A;  2BCA A;  1H8B A;  1N65 A;  2LHL A;  3CR2 A;  1ZUZ A;  4OVN F;  1TNP A;  2LE9 B;  1ODB A;  3BQ3 A;  2LCP A;  2KBM A;  1YUT A;  2VRG A;  3EKH A;  1ZFS A;  1CNP A;  3PN7 B;  4GBA A;  1BLQ A;  3JVT C;  1OZO A;  3AAJ A;  1TIZ A;  1SL9 A;  1UHH A;  2KAY A;  2K2A A;  1M31 A;  2LHI A;  5KTY A;  4I5K A;  1L2O B;  3PM8 A;  3O2P A;  2KI4 C;  1QLK A;  2JWW A;  1FI6 A;  4I5N B;  1DJI A;  1QS7 A;  3WHT B;  1IH0 A;  2M1U A;  1XA5 A;  1SMG A;  1L7Z A;  1UUS A;  4M2P A;  2ZKM X;  1TNQ A;  1WRL A;  1CFC A;  1C7W A;  1JF2 A;  3ICB A;  2KFF A;  2O60 A;  2M8U A;  4I5L B;  2MA2 A;  4C0J A;  1CFF A;  4YGA A;  2BE4 A;  1ZMZ A;  1OMD A;  4XJK B;  1CKK A;  3TDI A;  1A29 A;  2ZFD A;  4L9M A;  1BU3 A;  2M49 B;  3M0W A;  2COL B;  1OQP A;  4YGB B;  4QJ4 B;  3WXA A;  2WC8 A;  4C0K A;  1KQV A;  1ALV A;  1YRU B;  3CWG A;  1C7V A;  3JTD C;  4GGF C;  1KK7 Z;  1S3P A;  1Y1X A;  3SG4 A;  4FTG A;  5AFP A;  2ZRS A;  2L5X B;  1J1D A;  1KK8 B;  2PAL A;  5AXI A;  1A03 A;  4Q04 A;  4WRI A;  1JF0 A;  2KSP A;  3FWC A;  3KEV A;  1OSA A;  2OTG B;  4BY4 A;  2FJU B;  4QJ5 B;  1LA3 A;  3GK4 X;  1NIW A;  3DVE A;  3QRX A;  1D1O A;  1F54 A;  1V1F A;  2L4H A;  4YRU A;  5I2Q A;  2M9G A;  1OE9 B;  3BUW B;  1UHK A;  2BBN A;  5HKZ A;  1K93 D;  1M45 A;  4NDC A;  4D1E A;  5DKR A;  5G08 A;  1XFU O;  3FWB A;  1XFY O;  5PAL A;  4YI8 A;  2LVV A;  2L50 A;  4GGF A;  2LP3 A;  4CID A;  5D69 A;  1EJ3 A;  3GK1 A;  2KHN A;  2M0R A;  1PUL A;  2L0P A;  1NWD A;  2JU0 A;  2FOT A;  1A4P A;  2L4I A;  3WNX B;  2K7C A;  2WCB A;  1J7R A;  1U5I A;  2Y5I A;  4P5O E;  1CMG A;  1FI5 A;  3BUM B;  3LCP C;  3FIA A;  1XFW O;  4GAO A;  1GGZ A;  2M29 A;  2ZNE A;  2NZ0 A;  1RTP 1;  1LVC D;  4YI9 A;  4YGD B;  1FF1 A;  1EG4 A;  2Y1N A;  3I5G C;  2LC5 A;  3SIA A;  3H4S E;  3KHE A;  1WLM A;  1KFX L;  4UPG A;  2MRD A;  3IQO A;  2KI6 C;  1NX3 A;  1G8I A;  3DVM A;  3BUX B;  2M1K B;  1F55 A;  1WDC C;  1CDP A;  2KGB C;  1PSR A;  1WRZ A;  3BXK A;  2PVB A;  1PAL A;  3PAT A;  2JXL A;  4JWQ A;  1YUR A;  1BT6 A;  3DF0 A;  2AUC A;  3EK7 A;  3I5I C;  2K8M B;  3RLZ A;  1DJX A;  1H4B A;  1EXR A;  3KPX A;  5AEQ A;  4GUK A;  5F6T A;  3TS5 B;  4ICB A;  3TUY C;  2JT8 A;  3OX5 A;  1QTX A;  5I8N A;  1DVI A;  1LIN A;  3CR4 X;  2F33 A;  2A4J A;  4CLN A;  3O6B A;  1KWO C;  4USL A;  4U8D A;  1SL7 A;  3O4Y A;  3ZNI A;  1F70 A;  1E8A A;  1DT7 B;  1SR6 B;  4HRG A;  1K95 A;  2ZND A;  1BR1 B;  5J3X A;  4R1E A;  1CM1 A;  2BCX A;  2I2R E;  4PHK A;  3EK4 A;  3NSK A;  3MSE B;  1A75 B;  1NUB A;  2WND A;  4ZCU A;  1IJ6 A;  2GGM A;  1ALW A;  2G9B A;  2M7N A;  1OZS A;  2JQ6 A;  5I2L A;  1JSA A;  2BBM A;  1CMF A;  1DF0 A;  1OOJ A;  3CLN A;  1KQM B;  5HKW A;  3FS7 A;  2KQY A;  2KAV A;  3OB1 B;  1XK4 C;  2LM5 A;  2JNX A;  5ER4 X;  1V1G A;  3RM1 A;  2PRU A;  1YR5 A;  1SBJ A;  1TCO B;  1DJZ A;  1G4Y R;  1FPW A;  2LVI A;  1YVH A;  3GK2 A;  4ETO A;  5CSN A;  4HRE E;  1NCY A;  1SKT A;  3I5F B;  3KF9 A;  2BCB A;  3D10 A;  1JFJ A;  4I5J A;  1RWY A;  3VGO A;  1Y1U A;  4DCK A;  3A4U B;  1BOC A;  1QV1 A;  1IQ5 A;  2P6B B;  3CGA A;  2RGI A;  4N1F A;  4TNC A;  4ZCV A;  1NCZ A;  3BYA A;  1CLL A;  4PE0 A;  1K96 A;  3OP0 A;  5CSF A;  4MSP A;  1DGV A;  2ISD A;  1J7P A;  2LLS A;  2BKH B;  1G33 A;  2F3Y A;  3EKJ A;  3K21 A;  3JVT B;  3EVV A;  3PSR A;  3HX4 A;  4PAL A;  3O78 A;  2JPT A;  2F2O A;  4OKH A;  2HPS A;  4MBE A;  1QAT A;  1XK4 A;  1B8R A;  1SCM C;  2K2F A;  1K90 D;  1Q80 A;  2LMU A;  1K8U A;  3CR5 X;  3DD4 A;  3TDU A;  1AJ5 A;  2KI4 B;  1YTZ C;  1J7Q A;  1W7J B;  2AMI A;  2MHH A;  3SG5 A;  3DVJ A;  1TCF A;  1QVI Z;  2KQ6 A;  1DGU A;  1MR8 A;  2CCM A;  2LUX A;  1B8L A;  2LLT A;  2JT0 A;  1IQ3 A;  1J55 A;  2BKI B;  4M2O A;  5HYD A;  2H61 C;  1LA0 A;  1KK7 Y;  1BF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...