1RFJA

Crystal structure of potato calmodulin pcm6
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
148
structure length
148
Chain Sequence
MADQLTEDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYDEFVKVMMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords calmodulin
publication title Structure of potato calmodulin PCM6: the first report of the three-dimensional structure of a plant calmodulin.
pubmed doi rcsb
source organism Solanum tuberosum
molecule tags Metal binding protein
total genus 59
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2003-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1rfjA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1rfjA02
2BKIB 2COLB 3EKJA 4MRYA 2JNXA 4P5OE 1OZSA 3RM1A 4M2QA 4MZLA 3A4UB 3E3RA 2I18A 1DJWA 2EHBA 2Y1MA 1A03A 1J7RA 1Y6WA 3O6BA 1CMFA 2K8MB 1KK8B 4C0KA 1TOPA 2M1KB 2M7LA 3I5FB 1NX0A 2JOJA 1CDMA 1EG4A 1K9KA 2WCFA 3DF0A 1HT9A 2H61C 3D10A 1KQVA 1XFZO 1RWYA 3SG5A 2M49B 1JSAA 2KGRA 4D1EA 2WORA 3NSLA 1UUSA 1WY9A 4MBEA 2JNFA 4OVNF 1ALVA 1QXPA 1SBJA 2OTGC 1IQ5A 4JWQA 5G08A 4MSPA 4WQ3A 1SYMA 5CPVA 3O78A 1L2OC 3SIBA 3I5HC 1DF0B 1UHJA 4NQGA 3ZWHA 4P2YB 1TIZA 4PHKA 2GGZA 4PALA 1UP5A 3EVVA 1WLMA 2CCMA 1PSBA 3BUNB 1YUSA 1F8HA 2HQWA 2KYFA 1V1GA 1WRZA 1LA0A 2MA2A 2SCPA 1NWDA 2WCEA 4MZJA 1E8AA 1IQ3A 1D1OA 2KFGA 1IGVA 1K95A 4MRXA 1H4BA 1QV0A 2KI6D 1H8BA 3CS1A 1MQ1A 3CLNA 3BYAA 2FCEA 2FCDA 5KSZA 1XFXO 1JF2A 1K9UA 1KFUS 4PE4A 2KNEA 5I8NA 3GK1A 3FIAA 2NCPA 4DS7A 1S5GZ 2OS8C 1BT6A 1QTXA 1A75B 4OKHA 2Y5IA 5AXIA 4PHNA 1LKJA 3KPXA 1AK8A 3RLZA 3FWBA 1KFXS 2MBXA 2K0JA 3SG7A 1MF8B 4GBAA 2LMTA 1XVJA 2MAZA 2F33A 1DMOA 1NX1A 1OSAA 2MLFC 3EKHA 2L4IA 3SIAA 4NDCA 1YVLA 2M7NA 1YUTA 2KSPA 2KHNA 4M2OA 4UPGA 3K21A 2L51A 5GQQC 2G9BA 1K96A 4XJKB 2M29A 4PE1A 1QVIY 1SR6C 1XO5A 4JPZB 1CTRA 2L4HA 5PALA 1JFKA 3CR5X 4YBHB 1SL7A 5I2QA 3BQ3A 1CLBA 4ZCVA 2M3WA 5JJGA 2R2IA 2L5XB 2K61A 1TN4A 1RK9A 1B4CA 5I2LA 3OHMB 3CWGA 1KSOA 2BL0C 4OR9B 3IQOA 4BY5A 5B8IB 2QACA 1S6IA 3OX5A 1C7VA 1OZOA 2A4JA 1XFUO 1BR1B 4MVFA 2TN4A 2LNKA 2BE6A 1M45A 3SG6A 3CGAA 2KAXA 3LK1A 4DIRA 1CLLA 3TS5B 1B8RA 1QATA 1B7TY 1BODA 1MHOA 3TUYC 2L0PA 1Y1XA 4GGFA 5AEQA 3SG2A 1UHNA 2ZFDA 3AKAA 4GNKB 3AAKA 1CDPA 1NSHA 2BCAA 4CLNA 1QX5B 3BXKA 3OB1B 2LM5A 5TNCA 1G8IA 1SMGA 2JXCA 2LCPA 2WNDA 3NSIA 2LV7A 1U5IB 2WOSA 3KO0A 3O2PA 1QJTA 2ZNEA 2KAVA 3LCPC 1YX7A 1Y0VH 2BECA 2E6WA 1IWQA 4Q04A 2PSRA 1DT7B 1KWOB 1C07A 2MRDA 2B1UA 3HX4A 1FI5A 3BUMB 2JQ6A 4I5LB 1KFUL 2CTNA 2JT3A 3VRRA 3OB2B 3QRXA 4GPLB 3WXAA 1B8CA 1NCZA 1IJ5A 2LVJA 2OTGB 2LLSA 1J7OA 2PVBA 1J1DA 1UHHA 1YRTB 3FWCA 1BU3A 2JRFA 3DVKA 4BY4A 1G4YR 1L2OB 1S3PA 1SY9A 5ER4X 1F4QA 1S36A 1WRKA 1KFXL 1M31A 2M9GA 3DVJA 2ZRTA 2LVKA 1PRWA 2KQ6A 2PRUA 2LP2A 1XFWO 3CR2A 3GOFA 5HLOA 1OQPA 3BUXB 1JFJA 4GGFC 4CFQA 1UURA 5F6TA 3VRPA 2HF5A 3PN7B 1EL4A 2K7BA 1WRLA 2PASA 2ZNDA 5KTYA 1K90D 1JC2A 1SCMC 1TCOB 1FBVA 1MXLC 4PE0A 2KYCA 1AHRA 5I2OA 2EC6C 3NSOA 3NSKA 2LMUA 4PHJA 2ZN8A 1R2UA 4YGDB 2V53A 2OS8B 4HRHA 1DF0A 2CXJA 1IH0A 4USLA 1F55A 1OE9B 2DOQA 1BMOA 1K93D 2MHHA 3O4YA 2BKHB 2ISDA 4ORAB 1NPQA 1IRJA 2BBMA 3C1VA 2F3YA 1RJVA 3I5GB 1TNWA 2GV5A 1N0YA 5D7FA 1S6CA 1QLSA 4DCKA 4YGCB 1BJFA 1K94A 2JPTA 3PALA 1JF0A 1XA5A 2M8UA 3OX6A 3VRQA 4A4CA 5BPJA 3BOWB 1AUIB 3KF9A 4QJ4B 2KFHA 5DKQA 1WDCC 1CDNA 2KI4C 1FI6A 5JOLA 4ORCB 1B9AA 1A4PA 1SW8A 4WRIA 1L7ZA 1XK4A 1W7JB 1LXFC 1A2XA 2HPSA 1S6JA 3EK4A 4N5XA 2BL0B 3TZ1A 1XFYO 3EK7A 3NXAA 2O60A 2CT9A 4NDDA 1EJ3A 2JTTA 1TCFA 2BCXA 2WC8A 1K8UA 1K9PA 3PFVA 3TDZA 2AMIA 3PM8A 4YI8A 1N65A 3JTDC 1KQMB 4AQJA 2L50A 2JC2A 1DGUA 2JT8A 3TDUA 1ZUZA 5IBWA 3IF7A 1BG1A 1RROA 1SPYA 2HQ8A 2KI6C 3EVRA 1QIVA 1CB1A 1OMDA 2LE9B 3PSRA 1BF5A 2M1UA 4GAOA 1W7IB 1UHIA 2WCBA 3JVTB 2Y4QA 3KEVA 1B1GA 4GGNA 1CMGA 3M0WA 4GFTA 3D0YB 3PLFB 3BUOB 1YTZC 2AUCA 5DKRA 1UWOA 2LLUA 1TTXA 1KK7Y 2ZKMX 4M2PA 1SRAA 1B7TZ 2I2RE 1GJYA 2K7CA 1XK4C 2VRGA 3CTNA 2BCBA 1AVSA 1MUXA 2Y1NA 2M0RA 3SJSA 2AAOA 4MZKA 1JUOA 3EVUA 1RTP1 1CDLA 1IG5A 3OP0A 1FPWA 4CFRA 3DVMA 2FJUB 1BLQA 5ER5A 1X02A 1ZOTB 5HKYA 2MLEC 1AJ4A 1QV1A 2K2AA 3LLEA 1A29A 1QASA 2JULA 2NZ0A 4CPVA 1U5IA 2NXQA 1NYAA 1YX8A 4NDBA 5CSJA 1G33A 5CSIA 4FTGA 1ZMZA 1DJXA 5AANA 1YURA 4QJ5B 2JZIA 2D8NA 1NCXA 1EG3A 3I5IC 1M39A 2NLNA 4ETOA 1ZACA 1FW4A 4U8DA 3ICBA 1N2DA 5J3XA 2F2OA 1SL8A 4ICBA 1ODBA 1J7PA 1EH2A 2EC6B 4FQOA 4YGAA 2BE4A 3I5HB 4YGEB 2M97A 1K2HA 2PMYA 2O5GA 2QPTA 2KGBC 1YVHA 1ZFSA 1OOJA 2KFFA 5CSNA 4PE7A 3TS5C 2P6BB 1R6PA 2G2BA 4PDZA 3LK0A 1F54A 1M46A 1BOCA 1PULA 2CBLA 1SNLA 1AJ5A 2I7AA 1DVIA 4IL1A 3PATA 3WNXB 5FYXA 3IQQA 1RFJA 1V1FA 3CR4X 3DF0B 3WHUB 2KBIA 3DVEA 1F4OA 2GGMA 3TDIA 1DJIA 4MEWA 1KWOC 2LUCA 5DKNA 2OPOA 4AOMA 1WDCB 1OMVA 1DGVA 2KI4B 2L98A 1RECA 1TRFA 3WHTB 1SCVA 1DTLA 2SASA 2LANA 2LLTA 2LMVA 3SG4A 4XYNA 2H2KA 2LC5A 1Q80A 1PK0D 3H4SE 1S1EA 2LVIA 3HCMA 4PHMA 1KK8C 1NIWA 2LHLA 4AQIA 1QX7A 1VRKA 1XFVO 1Y1AA 1MWNA 3FS7A 3CZTX 2JU0A 3I5FC 3VGOA 3F45A 1LA3A 1QX2A 2LUXA 1IJ6A 3GK2A 1CFFA 1YUUA 1QLKA 4HREE 1GGWA 4A4BA 3JTDB 1SR6B 2K7DA 1Y1UA 1DJYA 4OV2A 1A75A 3DD4A 1CFDA 1B47A 1HQVA 1NX2A 2LVVA 3BOWA 1SL9A 4TNCA 1J7QA 2KOTA 1CLMA 2NCOA 1S26D 3PN7C 2PALA 1EXRA 1JBAA 1J1EA 4YRUA 4DUQA 1SK6D 1PVBA 3EK8A 3SG3A 3VRNA 2ZRSA 1J55A 2HETA 1TNPA 4F0ZB 2K2FA 1NCYA 2F3ZA 1GGZA 1S5GY 1QVIZ 1MXEA 1IKUA 4XJKA 4ORBB 1YR5A 2EGDA 1PSRA 3A8RA 2RGIA 4I5NB 3TUYB 5D69A 4PCWA 4HSZA 1NUBA 3I5GC 1PVAA 1KCYA 4YGBB 2KBMA 1LVCD 5AFPA 2JT0A 4JQ0D 4L9MA 4OCIA 4E68A 5HLVA 1BR4B 1WLZA 2JXLA 4C0JA 5AERA 1SKTA 4QJ3B 2KDHA 4R1EA 1M63B 1KK7Z 2JWWA 3D0YA 1UHKA 4YI9A 1LINA 4MN0A 1YRUB 3LL8B 1QIWA 1CM4A 1TNXA 3AKBA 3I5IB 3ZNIA 4DRWA 1C7WA 4MLWA 1F71A 2E30A 5K89A 2ZN9A 3BUWB 4N1GA 1OMRA 1XYDA 3MSEB 4C0LA 2L2EA 4GUKA 2KQYA 2LP3A 2JTZA 4ZCUA 2BBNA 2LHIA 2Q4UA 1B8LA 2KAYA 2FOTA 3VROA 1AP4A 1DJHA 1GQMA 5KU1A 1CFCA 1CNPA 1NP8A 2K7OA 4I5JA 1KQMC 4WQ2A 2CNPA 4CIDA 1MR8A 2H61A 3KHEA 2I94A 2F8PA 2IS9A 2Q91A 5CSFA 1CM1A 4N1FA 1SCMB 1DJZA 5HKWA 3GK4X 3JVTC 4HRGA 3AAJA 1F70A 1CFPA 1FF1A 1TNQA 1ALWA 2F2PA 1KSMA 2MJWB 5HKZA 4I5KA 1NX3A 1JWDA 5HYDA 1CKKA 1PALA 1QS7A 2LAPA 1DJGA
chains in the Genus database with same CATH superfamily
2BKIB 2COLB 3EKJA 4MRYA 2JNXA 4P5OE 1OZSA 3RM1A 4M2QA 1Z2CB 4MZLA 3A4UB 3E3RA 2I18A 1DJWA 2EHBA 1DELA 4F7FA 2Y1MA 1A03A 1J7RA 1Y6WA 3O6BA 3R1VA 1CMFA 2K8MB 1KK8B 1GM0A 3BFAA 4C0KA 1TOPA 2M1KB 2M7LA 3I5FB 3SS5A 3DY9A 1NX0A 2JOJA 3O4XA 1CDMA 1EG4A 1K9KA 2WCFA 3DF0A 1HT9A 2H61C 3D10A 1KQVA 1XFZO 1RWYA 3SG5A 2M49B 1JSAA 2KGRA 3B87A 4D1EA 2WORA 3NSLA 1UUSA 1WY9A 4MBEA 3BFHA 2JNFA 4OVNF 1ALVA 1QXPA 1SBJA 2OTGC 1IQ5A 4JWQA 5G08A 4FQTA 4MSPA 1SYMA 4WQ3A 3O78A 1L2OC 5CPVA 3S0DA 3SIBA 3DYEA 3I5HC 1DF0B 1UHJA 4NQGA 3QMEA 3ZWHA 4P2YB 1TIZA 4PHKA 3FE6A 2GGZA 4PALA 1UP5A 3EVVA 1WLMA 2CCMA 1PSBA 3BUNB 3CZ0A 1YUSA 3NHTA 1F8HA 2HQWA 2KYFA 1V1GA 1WRZA 1LA0A 2MA2A 2SCPA 1NWDA 2WCEA 3DZTA 2KLEA 4MZJA 1E8AA 3S0FA 1IQ3A 2KFGA 1IGVA 1K95A 1D1OA 4MRXA 1H4BA 1QV0A 2KI6D 1H8BA 3CS1A 1MQ1A 3CLNA 3BYAA 2FCEA 2FCDA 5KSZA 1XFXO 1JF2A 1K9UA 1KFUS 4PE4A 2KNEA 5I8NA 3GK1A 3FIAA 2NCPA 4DS7A 1S5GZ 2OS8C 1BT6A 1QTXA 1A75B 4OKHA 2Y5IA 5AXIA 4PHNA 1LKJA 3KPXA 1AK8A 3RLZA 3FWBA 3L47A 1KFXS 2MBXA 2K0JA 3SG7A 4PT1A 1MF8B 4GBAA 2LMTA 1XVJA 2MAZA 2F33A 1DMOA 1NX1A 2K60A 1OSAA 2MLFC 3EKHA 2L4IA 3L4LA 3SIAA 3CZ2A 4NDCA 1YVLA 2M7NA 1YUTA 2KSPA 3UO9A 2KHNA 4INWA 3NHIA 4M2OA 4UPGA 3K21A 3NGVA 5FI7A 2L51A 5GQQC 2FJYA 3DXLA 2G9BA 1K96A 4XJKB 2M29A 4PE1A 3VB1A 1QVIY 1SR6C 1XO5A 4JPZB 1CTRA 2L4HA 1DEKA 5PALA 1JFKA 3CR5X 4YBHB 1SL7A 5I2QA 3BQ3A 1CLBA 4ZCVA 2M3WA 5JJGA 2R2IA 2L5XB 2K61A 1TN4A 1RK9A 1B4CA 5I2LA 3OHMB 4OZDA 3CWGA 1KSOA 2BL0C 4OR9B 3IQOA 4BY5A 5B8IB 2QACA 1S6IA 3OX5A 1C7VA 1OZOA 2A4JA 1XFUO 1BR1B 4MVFA 2TN4A 3CABA 2LNKA 2BE6A 1LS8A 1M45A 3SG6A 3CGAA 3S0BA 2KAXA 3LK1A 4DIRA 1CLLA 3TS5B 1B8RA 5DICA 1QATA 1B7TY 1BODA 3R1OA 2P71A 1MHOA 3TUYC 2L0PA 1Y1XA 2P70A 4GGFA 1IIOA 5AEQA 3SG2A 1UHNA 2ZFDA 2BAPA 3AKAA 4GNKB 3AAKA 1CDPA 1NSHA 2BCAA 2H8VA 4CLNA 1QX5B 2PYQA 3BXKA 3OB1B 2LM5A 5TNCA 1G8IA 1SMGA 2JXCA 2LCPA 2WNDA 3NSIA 1Z4HA 2LV7A 1U5IB 2WOSA 3KO0A 3O2PA 1QJTA 2ZNEA 2KAVA 3LCPC 1YX7A 1Y0VH 2BECA 2E6WA 1IWQA 4Q04A 2PSRA 1DT7B 1KWOB 1C07A 3CZ1A 2MRDA 2B1UA 3HX4A 1FI5A 3BUMB 2JQ6A 4I5LB 1KFUL 2CTNA 2JT3A 3VRRA 3OB2B 3QRXA 4GPLB 3WXAA 1B8CA 1NCZA 1IJ5A 2LVJA 2OTGB 5HL1A 2LLSA 1J7OA 1C3ZA 2PVBA 1J1DA 1UHHA 1YRTB 3FWCA 1BU3A 2JRFA 2QDIA 3DVKA 1G4YR 1L2OB 1S3PA 2ERBA 1SY9A 3D76A 5ER4X 1F4QA 1S36A 1WRKA 3UNWA 1KFXL 1M31A 2M9GA 3DVJA 2ZRTA 2LVKA 1PRWA 2KQ6A 2PRUA 2LP2A 1XFWO 2QEOA 3CR2A 3GOFA 5HLOA 3S0GA 1OQPA 3BUXB 3D75A 1JFJA 4GGFC 4CFQA 1UURA 5F6TA 3VRPA 2HF5A 3PN7B 2YGUA 1EL4A 2K7BA 1WRLA 2PASA 2ZNDA 5KTYA 1K90D 1JC2A 1SCMC 1TCOB 1FBVA 1MXLC 4PE0A 2KYCA 1AHRA 2QEVA 2EC6C 5I2OA 3NSOA 3NSKA 1OW4A 2LMUA 3IVTA 2ZN8A 1R2UA 4PHJA 4YGDB 2V53A 2OS8B 4HRHA 1DF0A 2CXJA 1IH0A 4USLA 1F55A 3D78A 1OE9B 2DOQA 1BMOA 3S0EA 1K93D 2MHHA 3O4YA 2BKHB 2ISDA 4ORAB 1NPQA 1IRJA 2BBMA 3C1VA 2F3YA 1RJVA 3I5GB 1TNWA 2GV5A 1N0YA 2PQLA 5D7FA 1S6CA 1QLSA 4DCKA 4YGCB 4JD9A 1BJFA 1K94A 2JPTA 3PALA 1JF0A 1XA5A 2M8UA 3OX6A 5I94A 3VRQA 4A4CA 5BPJA 3BOWB 2WCHA 1AUIB 3KF9A 4QJ4B 2KFHA 5DKQA 1WDCC 2BNXA 1CDNA 2KI4C 3SS3A 1FI6A 5JOLA 4ORCB 1OOHA 1B9AA 1A4PA 1SW8A 3OBVA 4WRIA 1L7ZA 1XK4A 1W7JB 1LXFC 1A2XA 2HPSA 1S6JA 3EK4A 3OGNA 4N5XA 2BL0B 3TZ1A 1XFYO 3EK7A 3NXAA 2O60A 2CT9A 4NDDA 1EJ3A 2JTTA 1TCFA 2BCXA 2WC8A 3R1PA 1K8UA 4IJ7A 1K9PA 3PFVA 3TDZA 2AMIA 3PM8A 3PM2A 4YI8A 1N65A 3JTDC 1KQMB 4AQJA 2L50A 2JC2A 2QEBA 1DGUA 2JT8A 3TDUA 1ZUZA 5IBWA 3IF7A 1BG1A 1RROA 1SPYA 2HQ8A 2KI6C 3D77A 3EVRA 1QIVA 1CB1A 1OMDA 2LE9B 3PSRA 1BF5A 2M1UA 3D74A 4GAOA 1W7IB 4JKTA 1UHIA 2WCBA 3JVTB 2Y4QA 3KEVA 1B1GA 4GGNA 3FE8A 3Q8IA 5FI2A 1CMGA 3M0WA 4GFTA 3D0YB 3PLFB 3L4AA 3BUOB 1YTZC 2AUCA 5DKRA 3B7AA 1UWOA 2LLUA 1TTXA 1KK7Y 1XFRA 2ZKMX 4M2PA 3N7HA 1SRAA 3B86A 1B7TZ 2I2RE 1GJYA 2K7CA 3BFBA 1XK4C 2VRGA 3CTNA 2BCBA 1AVSA 1MUXA 2Y1NA 2M0RA 3SJSA 2AAOA 4MZKA 1JUOA 3EVUA 3BJHA 1RTP1 1CDLA 1IG5A 3OP0A 1FPWA 4CFRA 3DVMA 2FJUB 1BLQA 5ER5A 1X02A 1ZOTB 5HKYA 2MLEC 1AJ4A 1QV1A 2K2AA 3LLEA 1A29A 1QASA 2JULA 2NZ0A 4CPVA 1U5IA 2NXQA 1NYAA 1YX8A 4NDBA 5CSJA 1G33A 5CSIA 4FTGA 1ZMZA 1DJXA 5AANA 1YURA 4QJ5B 2JZIA 2D8NA 1NCXA 1EG3A 3I5IC 1M39A 2NLNA 4ETOA 1ZACA 3V2LA 1FW4A 4U8DA 3ICBA 1N2DA 5J3XA 2F2OA 1SL8A 4ICBA 1ODBA 1J7PA 1EH2A 2EC6B 3EG5B 4FQOA 4YGAA 2BE4A 3I5HB 4YGEB 1W9ZA 2M97A 3B88A 1K2HA 2PMYA 2WCLA 2O5GA 2QPTA 2KGBC 1YVHA 1ZFSA 1OOJA 2KFFA 2WC6A 4PE7A 5CSNA 2P6BB 2WCKA 1R6PA 3FE9A 3TS5C 2G2BA 4PDZA 3LK0A 1F54A 1M46A 1BOCA 1PULA 2CBLA 1SNLA 1AJ5A 2I7AA 1DVIA 4IL1A 3PATA 3WNXB 1T14A 5FYXA 3IQQA 1RFJA 1V1FA 3CR4X 3DF0B 3WHUB 1P28A 3K1EA 2KBIA 3DVEA 1F4OA 1C3YA 2GGMA 3TDIA 1DJIA 4MEWA 1KWOC 1TWOA 2LUCA 5DKNA 2OPOA 4AOMA 1WDCB 3RZSA 1OMVA 1DGVA 2KI4B 2L98A 1RECA 1TRFA 3WHTB 1SCVA 1DTLA 2SASA 2LANA 2LLTA 2LMVA 3SG4A 4XYNA 2H2KA 2L2CA 1Q80A 1PK0D 2LC5A 3H4SE 1S1EA 1DQEA 2LVIA 3HCMA 4PHMA 1KK8C 1NIWA 2LHLA 2WCJA 4AQIA 1QX7A 1VRKA 1XFVO 4KYNA 1Y1AA 1MWNA 3FS7A 3CZTX 2JU0A 3I5FC 3VGOA 3F45A 1LA3A 1QX2A 2LUXA 1IJ6A 3GK2A 1CFFA 1YUUA 1QLKA 4HREE 5FI6A 4A4BA 3JTDB 1GGWA 1SR6B 2K7DA 1Y1UA 1DJYA 3B6XA 4OV2A 1A75A 3DD4A 1CFDA 1B47A 1HQVA 1NX2A 2LVVA 3BOWA 1SL9A 4TNCA 1J7QA 2KOTA 1CLMA 1TUJA 2NCOA 1S26D 3PN7C 2PALA 1EXRA 1JBAA 1QWVA 1J1EA 4YRUA 4DUQA 1SK6D 1PVBA 3EK8A 3SG3A 3VRNA 2ZRSA 1J55A 3R72A 2HETA 5EL2A 1TNPA 4F0ZB 2K2FA 1NCYA 2F3ZA 3D73A 1GGZA 1S5GY 1QVIZ 1TUZA 1MXEA 2KPHA 1IKUA 4XJKA 4ORBB 1YR5A 2EGDA 1PSRA 3A8RA 2RGIA 4I5NB 3TUYB 5D69A 4PCWA 2JPOA 4HSZA 1NUBA 3I5GC 1PVAA 1KCYA 4YGBB 2KBMA 1LVCD 5AFPA 2JT0A 4JQ0D 4L9MA 3CDNA 4OCIA 4E68A 5HLVA 1BR4B 1WLZA 1DC1A 2JXLA 4C0JA 5AERA 1SKTA 4QJ3B 2KDHA 3S0AA 3PJIA 4R1EA 1M63B 1KK7Z 2JWWA 3D0YA 1UHKA 4YI9A 1LINA 4MN0A 1YRUB 3LL8B 1ORGA 1QIWA 1CM4A 1TNXA 3AKBA 3I5IB 3ZNIA 4DRWA 1C7WA 4MLWA 1F71A 2E30A 5K89A 2ZN9A 3BUWB 4INXA 4N1GA 1OMRA 1XYDA 3MSEB 4C0LA 2L2EA 4GUKA 2KQYA 2LP3A 2JTZA 2KLDA 4ZCUA 3CYZA 3SS4A 2BBNA 2LHIA 2Q4UA 1B8LA 2KAYA 2FOTA 3VROA 1AP4A 1DJHA 1OOGA 1GQMA 5KU1A 1CFCA 1CNPA 1NP8A 2K7OA 4I5JA 1KQMC 4WQ2A 2CNPA 4CIDA 1MR8A 2H61A 3KHEA 2I94A 2F8PA 2IS9A 2Q91A 5CSFA 5D3OA 1CM1A 4BY4A 4N1FA 2QEHA 1SCMB 1DJZA 5HKWA 3GK4X 3JVTC 4HRGA 3AAJA 1F70A 1SSEB 1CFPA 1FF1A 2WC5A 1OOIX 1TNQA 1OOFA 1ALWA 2F2PA 1KSMA 2MJWB 5HKZA 2GTEA 1NX3A 4I5KA 2WCMA 5HYDA 1CKKA 1JWDA 1PALA 1QS7A 2LAPA 2L5YA 1DJGA
chains in the Genus database with same CATH topology
2BKIB 2COLB 3EKJA 4MRYA 2JNXA 4P5OE 1OZSA 3RM1A 4M2QA 4MZLA 3A4UB 3E3RA 2I18A 1DJWA 2EHBA 2Y1MA 1A03A 1J7RA 1Y6WA 3O6BA 1CMFA 2K8MB 1KK8B 4C0KA 1TOPA 2M1KB 2M7LA 3I5FB 1NX0A 2JOJA 1CDMA 1EG4A 1K9KA 2WCFA 3DF0A 1HT9A 2H61C 3D10A 1KQVA 1XFZO 1RWYA 3SG5A 2M49B 1JSAA 2KGRA 4D1EA 2WORA 3NSLA 1UUSA 1WY9A 4MBEA 2JNFA 4OVNF 1ALVA 1QXPA 1SBJA 2OTGC 1IQ5A 4JWQA 5G08A 4MSPA 4WQ3A 1SYMA 5CPVA 3O78A 1L2OC 3SIBA 3I5HC 1DF0B 1UHJA 4NQGA 3ZWHA 4P2YB 1TIZA 4PHKA 2GGZA 4PALA 1UP5A 3EVVA 1WLMA 2CCMA 1PSBA 3BUNB 1YUSA 1F8HA 2HQWA 2KYFA 1V1GA 1WRZA 1LA0A 2MA2A 2SCPA 1NWDA 2WCEA 4MZJA 1E8AA 1IQ3A 1D1OA 2KFGA 1IGVA 1K95A 4MRXA 1H4BA 1QV0A 2KI6D 1H8BA 3CS1A 1MQ1A 3CLNA 3BYAA 2FCEA 2FCDA 5KSZA 1XFXO 1JF2A 1K9UA 1KFUS 4PE4A 2KNEA 5I8NA 3GK1A 3FIAA 2NCPA 4DS7A 1S5GZ 2OS8C 1BT6A 1QTXA 1A75B 4OKHA 2Y5IA 5AXIA 4PHNA 1LKJA 3KPXA 1AK8A 3RLZA 3FWBA 1KFXS 2MBXA 2K0JA 3SG7A 1MF8B 4GBAA 2LMTA 1XVJA 2MAZA 2F33A 1DMOA 1NX1A 1OSAA 2MLFC 3EKHA 2L4IA 3SIAA 4NDCA 1YVLA 2M7NA 1YUTA 2KSPA 2KHNA 4M2OA 4UPGA 3K21A 2L51A 5GQQC 2G9BA 1K96A 4XJKB 2M29A 4PE1A 1QVIY 1SR6C 1XO5A 4JPZB 1CTRA 2L4HA 5PALA 1JFKA 3CR5X 4YBHB 1SL7A 5I2QA 3BQ3A 1CLBA 4ZCVA 2M3WA 5JJGA 2R2IA 2L5XB 2K61A 1TN4A 1RK9A 1B4CA 5I2LA 3OHMB 3CWGA 1KSOA 2BL0C 4OR9B 3IQOA 4BY5A 5B8IB 2QACA 1S6IA 3OX5A 1C7VA 1OZOA 2A4JA 1XFUO 1BR1B 4MVFA 2TN4A 2LNKA 2BE6A 1M45A 3SG6A 3CGAA 2KAXA 3LK1A 4DIRA 1CLLA 3TS5B 1B8RA 1QATA 1B7TY 1BODA 1MHOA 3TUYC 2L0PA 1Y1XA 4GGFA 5AEQA 3SG2A 1UHNA 2ZFDA 3AKAA 4GNKB 3AAKA 1CDPA 1NSHA 2BCAA 4CLNA 1QX5B 3BXKA 3OB1B 2LM5A 5TNCA 1G8IA 1SMGA 2JXCA 2LCPA 2WNDA 3NSIA 2LV7A 1U5IB 2WOSA 3KO0A 3O2PA 1QJTA 2ZNEA 2KAVA 3LCPC 1YX7A 1Y0VH 2BECA 2E6WA 1IWQA 4Q04A 2PSRA 1DT7B 1KWOB 1C07A 2MRDA 2B1UA 3HX4A 1FI5A 3BUMB 2JQ6A 4I5LB 1KFUL 2CTNA 2JT3A 3VRRA 3OB2B 3QRXA 4GPLB 3WXAA 1B8CA 1NCZA 1IJ5A 2LVJA 2OTGB 2LLSA 1J7OA 2PVBA 1J1DA 1UHHA 1YRTB 3FWCA 1BU3A 2JRFA 3DVKA 4BY4A 1G4YR 1L2OB 1S3PA 1SY9A 5ER4X 1F4QA 1S36A 1WRKA 1KFXL 1M31A 2M9GA 3DVJA 2ZRTA 2LVKA 1PRWA 2KQ6A 2PRUA 2LP2A 1XFWO 3CR2A 3GOFA 5HLOA 1OQPA 3BUXB 1JFJA 4GGFC 4CFQA 1UURA 5F6TA 3VRPA 2HF5A 3PN7B 1EL4A 2K7BA 1WRLA 2PASA 2ZNDA 5KTYA 1K90D 1JC2A 1SCMC 1TCOB 1FBVA 1MXLC 4PE0A 2KYCA 1AHRA 5I2OA 2EC6C 3NSOA 3NSKA 2LMUA 4PHJA 2ZN8A 1R2UA 4YGDB 2V53A 2OS8B 4HRHA 1DF0A 2CXJA 1IH0A 4USLA 1F55A 1OE9B 2DOQA 1BMOA 1K93D 2MHHA 3O4YA 2BKHB 2ISDA 4ORAB 1NPQA 1IRJA 2BBMA 3C1VA 2F3YA 1RJVA 3I5GB 1TNWA 2GV5A 1N0YA 5D7FA 1S6CA 1QLSA 4DCKA 4YGCB 1BJFA 1K94A 2JPTA 3PALA 1JF0A 1XA5A 2M8UA 3OX6A 3VRQA 4A4CA 5BPJA 3BOWB 1AUIB 3KF9A 4QJ4B 2KFHA 5DKQA 1WDCC 1CDNA 2KI4C 1FI6A 5JOLA 4ORCB 1B9AA 1A4PA 1SW8A 4WRIA 1L7ZA 1XK4A 1W7JB 1LXFC 1A2XA 2HPSA 1S6JA 3EK4A 4N5XA 2BL0B 3TZ1A 1XFYO 3EK7A 3NXAA 2O60A 2CT9A 4NDDA 1EJ3A 2JTTA 1TCFA 2BCXA 2WC8A 1K8UA 1K9PA 3PFVA 3TDZA 2AMIA 3PM8A 4YI8A 1N65A 3JTDC 1KQMB 4AQJA 2L50A 2JC2A 1DGUA 2JT8A 3TDUA 1ZUZA 5IBWA 3IF7A 1BG1A 1RROA 1SPYA 2HQ8A 2KI6C 3EVRA 1QIVA 1CB1A 1OMDA 2LE9B 3PSRA 1BF5A 2M1UA 4GAOA 1W7IB 1UHIA 2WCBA 3JVTB 2Y4QA 3KEVA 1B1GA 4GGNA 1CMGA 3M0WA 4GFTA 3D0YB 3PLFB 3BUOB 1YTZC 2AUCA 5DKRA 1UWOA 2LLUA 1TTXA 1KK7Y 2ZKMX 4M2PA 1SRAA 1B7TZ 2I2RE 1GJYA 2K7CA 1XK4C 2VRGA 3CTNA 2BCBA 1AVSA 1MUXA 2Y1NA 2M0RA 3SJSA 2AAOA 4MZKA 1JUOA 3EVUA 1RTP1 1CDLA 1IG5A 3OP0A 1FPWA 4CFRA 3DVMA 2FJUB 1BLQA 5ER5A 1X02A 1ZOTB 5HKYA 2MLEC 1AJ4A 1QV1A 2K2AA 3LLEA 1A29A 1QASA 2JULA 2NZ0A 4CPVA 1U5IA 2NXQA 1NYAA 1YX8A 4NDBA 5CSJA 1G33A 5CSIA 4FTGA 1ZMZA 1DJXA 5AANA 1YURA 4QJ5B 2JZIA 2D8NA 1NCXA 1EG3A 3I5IC 1M39A 2NLNA 4ETOA 1ZACA 1FW4A 4U8DA 3ICBA 1N2DA 5J3XA 2F2OA 1SL8A 4ICBA 1ODBA 1J7PA 1EH2A 2EC6B 4FQOA 4YGAA 2BE4A 3I5HB 4YGEB 2M97A 1K2HA 2PMYA 2O5GA 2QPTA 2KGBC 1YVHA 1ZFSA 1OOJA 2KFFA 5CSNA 4PE7A 3TS5C 2P6BB 1R6PA 2G2BA 4PDZA 3LK0A 1F54A 1M46A 1BOCA 1PULA 2CBLA 1SNLA 1AJ5A 2I7AA 1DVIA 4IL1A 3PATA 3WNXB 5FYXA 3IQQA 1RFJA 1V1FA 3CR4X 3DF0B 3WHUB 2KBIA 3DVEA 1F4OA 2GGMA 3TDIA 1DJIA 4MEWA 1KWOC 2LUCA 5DKNA 2OPOA 4AOMA 1WDCB 1OMVA 1DGVA 2KI4B 2L98A 1RECA 1TRFA 3WHTB 1SCVA 1DTLA 2SASA 2LANA 2LLTA 2LMVA 3SG4A 4XYNA 2H2KA 2LC5A 1Q80A 1PK0D 3H4SE 1S1EA 2LVIA 3HCMA 4PHMA 1KK8C 1NIWA 2LHLA 4AQIA 1QX7A 1VRKA 1XFVO 1Y1AA 1MWNA 3FS7A 3CZTX 2JU0A 3I5FC 3VGOA 3F45A 1LA3A 1QX2A 2LUXA 1IJ6A 3GK2A 1CFFA 1YUUA 1QLKA 4HREE 1GGWA 4A4BA 3JTDB 1SR6B 2K7DA 1Y1UA 1DJYA 4OV2A 1A75A 3DD4A 1CFDA 1B47A 1HQVA 1NX2A 2LVVA 3BOWA 1SL9A 4TNCA 1J7QA 2KOTA 1CLMA 2NCOA 1S26D 3PN7C 2PALA 1EXRA 1JBAA 1J1EA 4YRUA 4DUQA 1SK6D 1PVBA 3EK8A 3SG3A 3VRNA 2ZRSA 1J55A 2HETA 1TNPA 4F0ZB 2K2FA 1NCYA 2F3ZA 1GGZA 1S5GY 1QVIZ 1MXEA 1IKUA 4XJKA 4ORBB 1YR5A 2EGDA 1PSRA 3A8RA 2RGIA 4I5NB 3TUYB 5D69A 4PCWA 4HSZA 1NUBA 3I5GC 1PVAA 1KCYA 4YGBB 2KBMA 1LVCD 5AFPA 2JT0A 4JQ0D 4L9MA 4OCIA 4E68A 5HLVA 1BR4B 1WLZA 2JXLA 4C0JA 5AERA 1SKTA 4QJ3B 2KDHA 4R1EA 1M63B 1KK7Z 2JWWA 3D0YA 1UHKA 4YI9A 1LINA 4MN0A 1YRUB 3LL8B 1QIWA 1CM4A 1TNXA 3AKBA 3I5IB 3ZNIA 4DRWA 1C7WA 4MLWA 1F71A 2E30A 5K89A 2ZN9A 3BUWB 4N1GA 1OMRA 1XYDA 3MSEB 4C0LA 2L2EA 4GUKA 2KQYA 2LP3A 2JTZA 4ZCUA 2BBNA 2LHIA 2Q4UA 1B8LA 2KAYA 2FOTA 3VROA 1AP4A 1DJHA 1GQMA 5KU1A 1CFCA 1CNPA 1NP8A 2K7OA 4I5JA 1KQMC 4WQ2A 2CNPA 4CIDA 1MR8A 2H61A 3KHEA 2I94A 2F8PA 2IS9A 2Q91A 5CSFA 1CM1A 4N1FA 1SCMB 1DJZA 5HKWA 3GK4X 3JVTC 4HRGA 3AAJA 1F70A 1CFPA 1FF1A 1TNQA 1ALWA 2F2PA 1KSMA 2MJWB 5HKZA 4I5KA 1NX3A 1JWDA 5HYDA 1CKKA 1PALA 1QS7A 2LAPA 1DJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BKI B;  2COL B;  3EKJ A;  4MRY A;  2JNX A;  4P5O E;  1OZS A;  3RM1 A;  4M2Q A;  4MZL A;  3A4U B;  3E3R A;  2I18 A;  1DJW A;  2EHB A;  2Y1M A;  1A03 A;  1J7R A;  1Y6W A;  3O6B A;  1CMF A;  2K8M B;  1KK8 B;  4C0K A;  1TOP A;  2M1K B;  2M7L A;  3I5F B;  1NX0 A;  2JOJ A;  1CDM A;  1EG4 A;  1K9K A;  2WCF A;  3DF0 A;  1HT9 A;  2H61 C;  3D10 A;  1KQV A;  1XFZ O;  1RWY A;  3SG5 A;  2M49 B;  1JSA A;  2KGR A;  4D1E A;  2WOR A;  3NSL A;  1UUS A;  1WY9 A;  4MBE A;  2JNF A;  4OVN F;  1ALV A;  1QXP A;  1SBJ A;  2OTG C;  1IQ5 A;  4JWQ A;  5G08 A;  4MSP A;  4WQ3 A;  1SYM A;  5CPV A;  3O78 A;  1L2O C;  3SIB A;  3I5H C;  1DF0 B;  1UHJ A;  4NQG A;  3ZWH A;  4P2Y B;  1TIZ A;  4PHK A;  2GGZ A;  4PAL A;  1UP5 A;  3EVV A;  1WLM A;  2CCM A;  1PSB A;  3BUN B;  1YUS A;  1F8H A;  2HQW A;  2KYF A;  1V1G A;  1WRZ A;  1LA0 A;  2MA2 A;  2SCP A;  1NWD A;  2WCE A;  4MZJ A;  1E8A A;  1IQ3 A;  1D1O A;  2KFG A;  1IGV A;  1K95 A;  4MRX A;  1H4B A;  1QV0 A;  2KI6 D;  1H8B A;  3CS1 A;  1MQ1 A;  3CLN A;  3BYA A;  2FCE A;  2FCD A;  5KSZ A;  1XFX O;  1JF2 A;  1K9U A;  1KFU S;  4PE4 A;  2KNE A;  5I8N A;  3GK1 A;  3FIA A;  2NCP A;  4DS7 A;  1S5G Z;  2OS8 C;  1BT6 A;  1QTX A;  1A75 B;  4OKH A;  2Y5I A;  5AXI A;  4PHN A;  1LKJ A;  3KPX A;  1AK8 A;  3RLZ A;  3FWB A;  1KFX S;  2MBX A;  2K0J A;  3SG7 A;  1MF8 B;  4GBA A;  2LMT A;  1XVJ A;  2MAZ A;  2F33 A;  1DMO A;  1NX1 A;  1OSA A;  2MLF C;  3EKH A;  2L4I A;  3SIA A;  4NDC A;  1YVL A;  2M7N A;  1YUT A;  2KSP A;  2KHN A;  4M2O A;  4UPG A;  3K21 A;  2L51 A;  5GQQ C;  2G9B A;  1K96 A;  4XJK B;  2M29 A;  4PE1 A;  1QVI Y;  1SR6 C;  1XO5 A;  4JPZ B;  1CTR A;  2L4H A;  5PAL A;  1JFK A;  3CR5 X;  4YBH B;  1SL7 A;  5I2Q A;  3BQ3 A;  1CLB A;  4ZCV A;  2M3W A;  5JJG A;  2R2I A;  2L5X B;  2K61 A;  1TN4 A;  1RK9 A;  1B4C A;  5I2L A;  3OHM B;  3CWG A;  1KSO A;  2BL0 C;  4OR9 B;  3IQO A;  4BY5 A;  5B8I B;  2QAC A;  1S6I A;  3OX5 A;  1C7V A;  1OZO A;  2A4J A;  1XFU O;  1BR1 B;  4MVF A;  2TN4 A;  2LNK A;  2BE6 A;  1M45 A;  3SG6 A;  3CGA A;  2KAX A;  3LK1 A;  4DIR A;  1CLL A;  3TS5 B;  1B8R A;  1QAT A;  1B7T Y;  1BOD A;  1MHO A;  3TUY C;  2L0P A;  1Y1X A;  4GGF A;  5AEQ A;  3SG2 A;  1UHN A;  2ZFD A;  3AKA A;  4GNK B;  3AAK A;  1CDP A;  1NSH A;  2BCA A;  4CLN A;  1QX5 B;  3BXK A;  3OB1 B;  2LM5 A;  5TNC A;  1G8I A;  1SMG A;  2JXC A;  2LCP A;  2WND A;  3NSI A;  2LV7 A;  1U5I B;  2WOS A;  3KO0 A;  3O2P A;  1QJT A;  2ZNE A;  2KAV A;  3LCP C;  1YX7 A;  1Y0V H;  2BEC A;  2E6W A;  1IWQ A;  4Q04 A;  2PSR A;  1DT7 B;  1KWO B;  1C07 A;  2MRD A;  2B1U A;  3HX4 A;  1FI5 A;  3BUM B;  2JQ6 A;  4I5L B;  1KFU L;  2CTN A;  2JT3 A;  3VRR A;  3OB2 B;  3QRX A;  4GPL B;  3WXA A;  1B8C A;  1NCZ A;  1IJ5 A;  2LVJ A;  2OTG B;  2LLS A;  1J7O A;  2PVB A;  1J1D A;  1UHH A;  1YRT B;  3FWC A;  1BU3 A;  2JRF A;  3DVK A;  4BY4 A;  1G4Y R;  1L2O B;  1S3P A;  1SY9 A;  5ER4 X;  1F4Q A;  1S36 A;  1WRK A;  1KFX L;  1M31 A;  2M9G A;  3DVJ A;  2ZRT A;  2LVK A;  1PRW A;  2KQ6 A;  2PRU A;  2LP2 A;  1XFW O;  3CR2 A;  3GOF A;  5HLO A;  1OQP A;  3BUX B;  1JFJ A;  4GGF C;  4CFQ A;  1UUR A;  5F6T A;  3VRP A;  2HF5 A;  3PN7 B;  1EL4 A;  2K7B A;  1WRL A;  2PAS A;  2ZND A;  5KTY A;  1K90 D;  1JC2 A;  1SCM C;  1TCO B;  1FBV A;  1MXL C;  4PE0 A;  2KYC A;  1AHR A;  5I2O A;  2EC6 C;  3NSO A;  3NSK A;  2LMU A;  4PHJ A;  2ZN8 A;  1R2U A;  4YGD B;  2V53 A;  2OS8 B;  4HRH A;  1DF0 A;  2CXJ A;  1IH0 A;  4USL A;  1F55 A;  1OE9 B;  2DOQ A;  1BMO A;  1K93 D;  2MHH A;  3O4Y A;  2BKH B;  2ISD A;  4ORA B;  1NPQ A;  1IRJ A;  2BBM A;  3C1V A;  2F3Y A;  1RJV A;  3I5G B;  1TNW A;  2GV5 A;  1N0Y A;  5D7F A;  1S6C A;  1QLS A;  4DCK A;  4YGC B;  1BJF A;  1K94 A;  2JPT A;  3PAL A;  1JF0 A;  1XA5 A;  2M8U A;  3OX6 A;  3VRQ A;  4A4C A;  5BPJ A;  3BOW B;  1AUI B;  3KF9 A;  4QJ4 B;  2KFH A;  5DKQ A;  1WDC C;  1CDN A;  2KI4 C;  1FI6 A;  5JOL A;  4ORC B;  1B9A A;  1A4P A;  1SW8 A;  4WRI A;  1L7Z A;  1XK4 A;  1W7J B;  1LXF C;  1A2X A;  2HPS A;  1S6J A;  3EK4 A;  4N5X A;  2BL0 B;  3TZ1 A;  1XFY O;  3EK7 A;  3NXA A;  2O60 A;  2CT9 A;  4NDD A;  1EJ3 A;  2JTT A;  1TCF A;  2BCX A;  2WC8 A;  1K8U A;  1K9P A;  3PFV A;  3TDZ A;  2AMI A;  3PM8 A;  4YI8 A;  1N65 A;  3JTD C;  1KQM B;  4AQJ A;  2L50 A;  2JC2 A;  1DGU A;  2JT8 A;  3TDU A;  1ZUZ A;  5IBW A;  3IF7 A;  1BG1 A;  1RRO A;  1SPY A;  2HQ8 A;  2KI6 C;  3EVR A;  1QIV A;  1CB1 A;  1OMD A;  2LE9 B;  3PSR A;  1BF5 A;  2M1U A;  4GAO A;  1W7I B;  1UHI A;  2WCB A;  3JVT B;  2Y4Q A;  3KEV A;  1B1G A;  4GGN A;  1CMG A;  3M0W A;  4GFT A;  3D0Y B;  3PLF B;  3BUO B;  1YTZ C;  2AUC A;  5DKR A;  1UWO A;  2LLU A;  1TTX A;  1KK7 Y;  2ZKM X;  4M2P A;  1SRA A;  1B7T Z;  2I2R E;  1GJY A;  2K7C A;  1XK4 C;  2VRG A;  3CTN A;  2BCB A;  1AVS A;  1MUX A;  2Y1N A;  2M0R A;  3SJS A;  2AAO A;  4MZK A;  1JUO A;  3EVU A;  1RTP 1;  1CDL A;  1IG5 A;  3OP0 A;  1FPW A;  4CFR A;  3DVM A;  2FJU B;  1BLQ A;  5ER5 A;  1X02 A;  1ZOT B;  5HKY A;  2MLE C;  1AJ4 A;  1QV1 A;  2K2A A;  3LLE A;  1A29 A;  1QAS A;  2JUL A;  2NZ0 A;  4CPV A;  1U5I A;  2NXQ A;  1NYA A;  1YX8 A;  4NDB A;  5CSJ A;  1G33 A;  5CSI A;  4FTG A;  1ZMZ A;  1DJX A;  5AAN A;  1YUR A;  4QJ5 B;  2JZI A;  2D8N A;  1NCX A;  1EG3 A;  3I5I C;  1M39 A;  2NLN A;  4ETO A;  1ZAC A;  1FW4 A;  4U8D A;  3ICB A;  1N2D A;  5J3X A;  2F2O A;  1SL8 A;  4ICB A;  1ODB A;  1J7P A;  1EH2 A;  2EC6 B;  4FQO A;  4YGA A;  2BE4 A;  3I5H B;  4YGE B;  2M97 A;  1K2H A;  2PMY A;  2O5G A;  2QPT A;  2KGB C;  1YVH A;  1ZFS A;  1OOJ A;  2KFF A;  5CSN A;  4PE7 A;  3TS5 C;  2P6B B;  1R6P A;  2G2B A;  4PDZ A;  3LK0 A;  1F54 A;  1M46 A;  1BOC A;  1PUL A;  2CBL A;  1SNL A;  1AJ5 A;  2I7A A;  1DVI A;  4IL1 A;  3PAT A;  3WNX B;  5FYX A;  3IQQ A;  1RFJ A;  1V1F A;  3CR4 X;  3DF0 B;  3WHU B;  2KBI A;  3DVE A;  1F4O A;  2GGM A;  3TDI A;  1DJI A;  4MEW A;  1KWO C;  2LUC A;  5DKN A;  2OPO A;  4AOM A;  1WDC B;  1OMV A;  1DGV A;  2KI4 B;  2L98 A;  1REC A;  1TRF A;  3WHT B;  1SCV A;  1DTL A;  2SAS A;  2LAN A;  2LLT A;  2LMV A;  3SG4 A;  4XYN A;  2H2K A;  2LC5 A;  1Q80 A;  1PK0 D;  3H4S E;  1S1E A;  2LVI A;  3HCM A;  4PHM A;  1KK8 C;  1NIW A;  2LHL A;  4AQI A;  1QX7 A;  1VRK A;  1XFV O;  1Y1A A;  1MWN A;  3FS7 A;  3CZT X;  2JU0 A;  3I5F C;  3VGO A;  3F45 A;  1LA3 A;  1QX2 A;  2LUX A;  1IJ6 A;  3GK2 A;  1CFF A;  1YUU A;  1QLK A;  4HRE E;  1GGW A;  4A4B A;  3JTD B;  1SR6 B;  2K7D A;  1Y1U A;  1DJY A;  4OV2 A;  1A75 A;  3DD4 A;  1CFD A;  1B47 A;  1HQV A;  1NX2 A;  2LVV A;  3BOW A;  1SL9 A;  4TNC A;  1J7Q A;  2KOT A;  1CLM A;  2NCO A;  1S26 D;  3PN7 C;  2PAL A;  1EXR A;  1JBA A;  1J1E A;  4YRU A;  4DUQ A;  1SK6 D;  1PVB A;  3EK8 A;  3SG3 A;  3VRN A;  2ZRS A;  1J55 A;  2HET A;  1TNP A;  4F0Z B;  2K2F A;  1NCY A;  2F3Z A;  1GGZ A;  1S5G Y;  1QVI Z;  1MXE A;  1IKU A;  4XJK A;  4ORB B;  1YR5 A;  2EGD A;  1PSR A;  3A8R A;  2RGI A;  4I5N B;  3TUY B;  5D69 A;  4PCW A;  4HSZ A;  1NUB A;  3I5G C;  1PVA A;  1KCY A;  4YGB B;  2KBM A;  1LVC D;  5AFP A;  2JT0 A;  4JQ0 D;  4L9M A;  4OCI A;  4E68 A;  5HLV A;  1BR4 B;  1WLZ A;  2JXL A;  4C0J A;  5AER A;  1SKT A;  4QJ3 B;  2KDH A;  4R1E A;  1M63 B;  1KK7 Z;  2JWW A;  3D0Y A;  1UHK A;  4YI9 A;  1LIN A;  4MN0 A;  1YRU B;  3LL8 B;  1QIW A;  1CM4 A;  1TNX A;  3AKB A;  3I5I B;  3ZNI A;  4DRW A;  1C7W A;  4MLW A;  1F71 A;  2E30 A;  5K89 A;  2ZN9 A;  3BUW B;  4N1G A;  1OMR A;  1XYD A;  3MSE B;  4C0L A;  2L2E A;  4GUK A;  2KQY A;  2LP3 A;  2JTZ A;  4ZCU A;  2BBN A;  2LHI A;  2Q4U A;  1B8L A;  2KAY A;  2FOT A;  3VRO A;  1AP4 A;  1DJH A;  1GQM A;  5KU1 A;  1CFC A;  1CNP A;  1NP8 A;  2K7O A;  4I5J A;  1KQM C;  4WQ2 A;  2CNP A;  4CID A;  1MR8 A;  2H61 A;  3KHE A;  2I94 A;  2F8P A;  2IS9 A;  2Q91 A;  5CSF A;  1CM1 A;  4N1F A;  1SCM B;  1DJZ A;  5HKW A;  3GK4 X;  3JVT C;  4HRG A;  3AAJ A;  1F70 A;  1CFP A;  1FF1 A;  1TNQ A;  1ALW A;  2F2P A;  1KSM A;  2MJW B;  5HKZ A;  4I5K A;  1NX3 A;  1JWD A;  5HYD A;  1CKK A;  1PAL A;  1QS7 A;  2LAP A;  1DJG A; 
#chains in the Genus database with same CATH topology
 2BKI B;  2COL B;  3EKJ A;  4MRY A;  2JNX A;  4P5O E;  1OZS A;  3RM1 A;  4M2Q A;  1Z2C B;  4MZL A;  3A4U B;  3E3R A;  2I18 A;  1DJW A;  2EHB A;  1DEL A;  4F7F A;  2Y1M A;  1A03 A;  1J7R A;  1Y6W A;  3O6B A;  3R1V A;  1CMF A;  2K8M B;  1KK8 B;  1GM0 A;  3BFA A;  4C0K A;  1TOP A;  2M1K B;  2M7L A;  3I5F B;  3SS5 A;  3DY9 A;  1NX0 A;  2JOJ A;  3O4X A;  1CDM A;  1EG4 A;  1K9K A;  2WCF A;  3DF0 A;  1HT9 A;  2H61 C;  3D10 A;  1KQV A;  1XFZ O;  1RWY A;  3SG5 A;  2M49 B;  1JSA A;  2KGR A;  3B87 A;  4D1E A;  2WOR A;  3NSL A;  1UUS A;  1WY9 A;  4MBE A;  3BFH A;  2JNF A;  4OVN F;  1ALV A;  1QXP A;  1SBJ A;  2OTG C;  1IQ5 A;  4JWQ A;  5G08 A;  4FQT A;  4MSP A;  1SYM A;  4WQ3 A;  3O78 A;  1L2O C;  5CPV A;  3S0D A;  3SIB A;  3DYE A;  3I5H C;  1DF0 B;  1UHJ A;  4NQG A;  3QME A;  3ZWH A;  4P2Y B;  1TIZ A;  4PHK A;  3FE6 A;  2GGZ A;  4PAL A;  1UP5 A;  3EVV A;  1WLM A;  2CCM A;  1PSB A;  3BUN B;  3CZ0 A;  1YUS A;  3NHT A;  1F8H A;  2HQW A;  2KYF A;  1V1G A;  1WRZ A;  1LA0 A;  2MA2 A;  2SCP A;  1NWD A;  2WCE A;  3DZT A;  2KLE A;  4MZJ A;  1E8A A;  3S0F A;  1IQ3 A;  2KFG A;  1IGV A;  1K95 A;  1D1O A;  4MRX A;  1H4B A;  1QV0 A;  2KI6 D;  1H8B A;  3CS1 A;  1MQ1 A;  3CLN A;  3BYA A;  2FCE A;  2FCD A;  5KSZ A;  1XFX O;  1JF2 A;  1K9U A;  1KFU S;  4PE4 A;  2KNE A;  5I8N A;  3GK1 A;  3FIA A;  2NCP A;  4DS7 A;  1S5G Z;  2OS8 C;  1BT6 A;  1QTX A;  1A75 B;  4OKH A;  2Y5I A;  5AXI A;  4PHN A;  1LKJ A;  3KPX A;  1AK8 A;  3RLZ A;  3FWB A;  3L47 A;  1KFX S;  2MBX A;  2K0J A;  3SG7 A;  4PT1 A;  1MF8 B;  4GBA A;  2LMT A;  1XVJ A;  2MAZ A;  2F33 A;  1DMO A;  1NX1 A;  2K60 A;  1OSA A;  2MLF C;  3EKH A;  2L4I A;  3L4L A;  3SIA A;  3CZ2 A;  4NDC A;  1YVL A;  2M7N A;  1YUT A;  2KSP A;  3UO9 A;  2KHN A;  4INW A;  3NHI A;  4M2O A;  4UPG A;  3K21 A;  3NGV A;  5FI7 A;  2L51 A;  5GQQ C;  2FJY A;  3DXL A;  2G9B A;  1K96 A;  4XJK B;  2M29 A;  4PE1 A;  3VB1 A;  1QVI Y;  1SR6 C;  1XO5 A;  4JPZ B;  1CTR A;  2L4H A;  1DEK A;  5PAL A;  1JFK A;  3CR5 X;  4YBH B;  1SL7 A;  5I2Q A;  3BQ3 A;  1CLB A;  4ZCV A;  2M3W A;  5JJG A;  2R2I A;  2L5X B;  2K61 A;  1TN4 A;  1RK9 A;  1B4C A;  5I2L A;  3OHM B;  4OZD A;  3CWG A;  1KSO A;  2BL0 C;  4OR9 B;  3IQO A;  4BY5 A;  5B8I B;  2QAC A;  1S6I A;  3OX5 A;  1C7V A;  1OZO A;  2A4J A;  1XFU O;  1BR1 B;  4MVF A;  2TN4 A;  3CAB A;  2LNK A;  2BE6 A;  1LS8 A;  1M45 A;  3SG6 A;  3CGA A;  3S0B A;  2KAX A;  3LK1 A;  4DIR A;  1CLL A;  3TS5 B;  1B8R A;  5DIC A;  1QAT A;  1B7T Y;  1BOD A;  3R1O A;  2P71 A;  1MHO A;  3TUY C;  2L0P A;  1Y1X A;  2P70 A;  4GGF A;  1IIO A;  5AEQ A;  3SG2 A;  1UHN A;  2ZFD A;  2BAP A;  3AKA A;  4GNK B;  3AAK A;  1CDP A;  1NSH A;  2BCA A;  2H8V A;  4CLN A;  1QX5 B;  2PYQ A;  3BXK A;  3OB1 B;  2LM5 A;  5TNC A;  1G8I A;  1SMG A;  2JXC A;  2LCP A;  2WND A;  3NSI A;  1Z4H A;  2LV7 A;  1U5I B;  2WOS A;  3KO0 A;  3O2P A;  1QJT A;  2ZNE A;  2KAV A;  3LCP C;  1YX7 A;  1Y0V H;  2BEC A;  2E6W A;  1IWQ A;  4Q04 A;  2PSR A;  1DT7 B;  1KWO B;  1C07 A;  3CZ1 A;  2MRD A;  2B1U A;  3HX4 A;  1FI5 A;  3BUM B;  2JQ6 A;  4I5L B;  1KFU L;  2CTN A;  2JT3 A;  3VRR A;  3OB2 B;  3QRX A;  4GPL B;  3WXA A;  1B8C A;  1NCZ A;  1IJ5 A;  2LVJ A;  2OTG B;  5HL1 A;  2LLS A;  1J7O A;  1C3Z A;  2PVB A;  1J1D A;  1UHH A;  1YRT B;  3FWC A;  1BU3 A;  2JRF A;  2QDI A;  3DVK A;  1G4Y R;  1L2O B;  1S3P A;  2ERB A;  1SY9 A;  3D76 A;  5ER4 X;  1F4Q A;  1S36 A;  1WRK A;  3UNW A;  1KFX L;  1M31 A;  2M9G A;  3DVJ A;  2ZRT A;  2LVK A;  1PRW A;  2KQ6 A;  2PRU A;  2LP2 A;  1XFW O;  2QEO A;  3CR2 A;  3GOF A;  5HLO A;  3S0G A;  1OQP A;  3BUX B;  3D75 A;  1JFJ A;  4GGF C;  4CFQ A;  1UUR A;  5F6T A;  3VRP A;  2HF5 A;  3PN7 B;  2YGU A;  1EL4 A;  2K7B A;  1WRL A;  2PAS A;  2ZND A;  5KTY A;  1K90 D;  1JC2 A;  1SCM C;  1TCO B;  1FBV A;  1MXL C;  4PE0 A;  2KYC A;  1AHR A;  2QEV A;  2EC6 C;  5I2O A;  3NSO A;  3NSK A;  1OW4 A;  2LMU A;  3IVT A;  2ZN8 A;  1R2U A;  4PHJ A;  4YGD B;  2V53 A;  2OS8 B;  4HRH A;  1DF0 A;  2CXJ A;  1IH0 A;  4USL A;  1F55 A;  3D78 A;  1OE9 B;  2DOQ A;  1BMO A;  3S0E A;  1K93 D;  2MHH A;  3O4Y A;  2BKH B;  2ISD A;  4ORA B;  1NPQ A;  1IRJ A;  2BBM A;  3C1V A;  2F3Y A;  1RJV A;  3I5G B;  1TNW A;  2GV5 A;  1N0Y A;  2PQL A;  5D7F A;  1S6C A;  1QLS A;  4DCK A;  4YGC B;  4JD9 A;  1BJF A;  1K94 A;  2JPT A;  3PAL A;  1JF0 A;  1XA5 A;  2M8U A;  3OX6 A;  5I94 A;  3VRQ A;  4A4C A;  5BPJ A;  3BOW B;  2WCH A;  1AUI B;  3KF9 A;  4QJ4 B;  2KFH A;  5DKQ A;  1WDC C;  2BNX A;  1CDN A;  2KI4 C;  3SS3 A;  1FI6 A;  5JOL A;  4ORC B;  1OOH A;  1B9A A;  1A4P A;  1SW8 A;  3OBV A;  4WRI A;  1L7Z A;  1XK4 A;  1W7J B;  1LXF C;  1A2X A;  2HPS A;  1S6J A;  3EK4 A;  3OGN A;  4N5X A;  2BL0 B;  3TZ1 A;  1XFY O;  3EK7 A;  3NXA A;  2O60 A;  2CT9 A;  4NDD A;  1EJ3 A;  2JTT A;  1TCF A;  2BCX A;  2WC8 A;  3R1P A;  1K8U A;  4IJ7 A;  1K9P A;  3PFV A;  3TDZ A;  2AMI A;  3PM8 A;  3PM2 A;  4YI8 A;  1N65 A;  3JTD C;  1KQM B;  4AQJ A;  2L50 A;  2JC2 A;  2QEB A;  1DGU A;  2JT8 A;  3TDU A;  1ZUZ A;  5IBW A;  3IF7 A;  1BG1 A;  1RRO A;  1SPY A;  2HQ8 A;  2KI6 C;  3D77 A;  3EVR A;  1QIV A;  1CB1 A;  1OMD A;  2LE9 B;  3PSR A;  1BF5 A;  2M1U A;  3D74 A;  4GAO A;  1W7I B;  4JKT A;  1UHI A;  2WCB A;  3JVT B;  2Y4Q A;  3KEV A;  1B1G A;  4GGN A;  3FE8 A;  3Q8I A;  5FI2 A;  1CMG A;  3M0W A;  4GFT A;  3D0Y B;  3PLF B;  3L4A A;  3BUO B;  1YTZ C;  2AUC A;  5DKR A;  3B7A A;  1UWO A;  2LLU A;  1TTX A;  1KK7 Y;  1XFR A;  2ZKM X;  4M2P A;  3N7H A;  1SRA A;  3B86 A;  1B7T Z;  2I2R E;  1GJY A;  2K7C A;  3BFB A;  1XK4 C;  2VRG A;  3CTN A;  2BCB A;  1AVS A;  1MUX A;  2Y1N A;  2M0R A;  3SJS A;  2AAO A;  4MZK A;  1JUO A;  3EVU A;  3BJH A;  1RTP 1;  1CDL A;  1IG5 A;  3OP0 A;  1FPW A;  4CFR A;  3DVM A;  2FJU B;  1BLQ A;  5ER5 A;  1X02 A;  1ZOT B;  5HKY A;  2MLE C;  1AJ4 A;  1QV1 A;  2K2A A;  3LLE A;  1A29 A;  1QAS A;  2JUL A;  2NZ0 A;  4CPV A;  1U5I A;  2NXQ A;  1NYA A;  1YX8 A;  4NDB A;  5CSJ A;  1G33 A;  5CSI A;  4FTG A;  1ZMZ A;  1DJX A;  5AAN A;  1YUR A;  4QJ5 B;  2JZI A;  2D8N A;  1NCX A;  1EG3 A;  3I5I C;  1M39 A;  2NLN A;  4ETO A;  1ZAC A;  3V2L A;  1FW4 A;  4U8D A;  3ICB A;  1N2D A;  5J3X A;  2F2O A;  1SL8 A;  4ICB A;  1ODB A;  1J7P A;  1EH2 A;  2EC6 B;  3EG5 B;  4FQO A;  4YGA A;  2BE4 A;  3I5H B;  4YGE B;  1W9Z A;  2M97 A;  3B88 A;  1K2H A;  2PMY A;  2WCL A;  2O5G A;  2QPT A;  2KGB C;  1YVH A;  1ZFS A;  1OOJ A;  2KFF A;  2WC6 A;  4PE7 A;  5CSN A;  2P6B B;  2WCK A;  1R6P A;  3FE9 A;  3TS5 C;  2G2B A;  4PDZ A;  3LK0 A;  1F54 A;  1M46 A;  1BOC A;  1PUL A;  2CBL A;  1SNL A;  1AJ5 A;  2I7A A;  1DVI A;  4IL1 A;  3PAT A;  3WNX B;  1T14 A;  5FYX A;  3IQQ A;  1RFJ A;  1V1F A;  3CR4 X;  3DF0 B;  3WHU B;  1P28 A;  3K1E A;  2KBI A;  3DVE A;  1F4O A;  1C3Y A;  2GGM A;  3TDI A;  1DJI A;  4MEW A;  1KWO C;  1TWO A;  2LUC A;  5DKN A;  2OPO A;  4AOM A;  1WDC B;  3RZS A;  1OMV A;  1DGV A;  2KI4 B;  2L98 A;  1REC A;  1TRF A;  3WHT B;  1SCV A;  1DTL A;  2SAS A;  2LAN A;  2LLT A;  2LMV A;  3SG4 A;  4XYN A;  2H2K A;  2L2C A;  1Q80 A;  1PK0 D;  2LC5 A;  3H4S E;  1S1E A;  1DQE A;  2LVI A;  3HCM A;  4PHM A;  1KK8 C;  1NIW A;  2LHL A;  2WCJ A;  4AQI A;  1QX7 A;  1VRK A;  1XFV O;  4KYN A;  1Y1A A;  1MWN A;  3FS7 A;  3CZT X;  2JU0 A;  3I5F C;  3VGO A;  3F45 A;  1LA3 A;  1QX2 A;  2LUX A;  1IJ6 A;  3GK2 A;  1CFF A;  1YUU A;  1QLK A;  4HRE E;  5FI6 A;  4A4B A;  3JTD B;  1GGW A;  1SR6 B;  2K7D A;  1Y1U A;  1DJY A;  3B6X A;  4OV2 A;  1A75 A;  3DD4 A;  1CFD A;  1B47 A;  1HQV A;  1NX2 A;  2LVV A;  3BOW A;  1SL9 A;  4TNC A;  1J7Q A;  2KOT A;  1CLM A;  1TUJ A;  2NCO A;  1S26 D;  3PN7 C;  2PAL A;  1EXR A;  1JBA A;  1QWV A;  1J1E A;  4YRU A;  4DUQ A;  1SK6 D;  1PVB A;  3EK8 A;  3SG3 A;  3VRN A;  2ZRS A;  1J55 A;  3R72 A;  2HET A;  5EL2 A;  1TNP A;  4F0Z B;  2K2F A;  1NCY A;  2F3Z A;  3D73 A;  1GGZ A;  1S5G Y;  1QVI Z;  1TUZ A;  1MXE A;  2KPH A;  1IKU A;  4XJK A;  4ORB B;  1YR5 A;  2EGD A;  1PSR A;  3A8R A;  2RGI A;  4I5N B;  3TUY B;  5D69 A;  4PCW A;  2JPO A;  4HSZ A;  1NUB A;  3I5G C;  1PVA A;  1KCY A;  4YGB B;  2KBM A;  1LVC D;  5AFP A;  2JT0 A;  4JQ0 D;  4L9M A;  3CDN A;  4OCI A;  4E68 A;  5HLV A;  1BR4 B;  1WLZ A;  1DC1 A;  2JXL A;  4C0J A;  5AER A;  1SKT A;  4QJ3 B;  2KDH A;  3S0A A;  3PJI A;  4R1E A;  1M63 B;  1KK7 Z;  2JWW A;  3D0Y A;  1UHK A;  4YI9 A;  1LIN A;  4MN0 A;  1YRU B;  3LL8 B;  1ORG A;  1QIW A;  1CM4 A;  1TNX A;  3AKB A;  3I5I B;  3ZNI A;  4DRW A;  1C7W A;  4MLW A;  1F71 A;  2E30 A;  5K89 A;  2ZN9 A;  3BUW B;  4INX A;  4N1G A;  1OMR A;  1XYD A;  3MSE B;  4C0L A;  2L2E A;  4GUK A;  2KQY A;  2LP3 A;  2JTZ A;  2KLD A;  4ZCU A;  3CYZ A;  3SS4 A;  2BBN A;  2LHI A;  2Q4U A;  1B8L A;  2KAY A;  2FOT A;  3VRO A;  1AP4 A;  1DJH A;  1OOG A;  1GQM A;  5KU1 A;  1CFC A;  1CNP A;  1NP8 A;  2K7O A;  4I5J A;  1KQM C;  4WQ2 A;  2CNP A;  4CID A;  1MR8 A;  2H61 A;  3KHE A;  2I94 A;  2F8P A;  2IS9 A;  2Q91 A;  5CSF A;  5D3O A;  1CM1 A;  4BY4 A;  4N1F A;  2QEH A;  1SCM B;  1DJZ A;  5HKW A;  3GK4 X;  3JVT C;  4HRG A;  3AAJ A;  1F70 A;  1SSE B;  1CFP A;  1FF1 A;  2WC5 A;  1OOI X;  1TNQ A;  1OOF A;  1ALW A;  2F2P A;  1KSM A;  2MJW B;  5HKZ A;  2GTE A;  1NX3 A;  4I5K A;  2WCM A;  5HYD A;  1CKK A;  1JWD A;  1PAL A;  1QS7 A;  2LAP A;  2L5Y A;  1DJG A; 
#chains in the Genus database with same CATH homology
 2BKI B;  2COL B;  3EKJ A;  4MRY A;  2JNX A;  4P5O E;  1OZS A;  3RM1 A;  4M2Q A;  4MZL A;  3A4U B;  3E3R A;  2I18 A;  1DJW A;  2EHB A;  2Y1M A;  1A03 A;  1J7R A;  1Y6W A;  3O6B A;  1CMF A;  2K8M B;  1KK8 B;  4C0K A;  1TOP A;  2M1K B;  2M7L A;  3I5F B;  1NX0 A;  2JOJ A;  1CDM A;  1EG4 A;  1K9K A;  2WCF A;  3DF0 A;  1HT9 A;  2H61 C;  3D10 A;  1KQV A;  1XFZ O;  1RWY A;  3SG5 A;  2M49 B;  1JSA A;  2KGR A;  4D1E A;  2WOR A;  3NSL A;  1UUS A;  1WY9 A;  4MBE A;  2JNF A;  4OVN F;  1ALV A;  1QXP A;  1SBJ A;  2OTG C;  1IQ5 A;  4JWQ A;  5G08 A;  4MSP A;  4WQ3 A;  1SYM A;  5CPV A;  3O78 A;  1L2O C;  3SIB A;  3I5H C;  1DF0 B;  1UHJ A;  4NQG A;  3ZWH A;  4P2Y B;  1TIZ A;  4PHK A;  2GGZ A;  4PAL A;  1UP5 A;  3EVV A;  1WLM A;  2CCM A;  1PSB A;  3BUN B;  1YUS A;  1F8H A;  2HQW A;  2KYF A;  1V1G A;  1WRZ A;  1LA0 A;  2MA2 A;  2SCP A;  1NWD A;  2WCE A;  4MZJ A;  1E8A A;  1IQ3 A;  1D1O A;  2KFG A;  1IGV A;  1K95 A;  4MRX A;  1H4B A;  1QV0 A;  2KI6 D;  1H8B A;  3CS1 A;  1MQ1 A;  3CLN A;  3BYA A;  2FCE A;  2FCD A;  5KSZ A;  1XFX O;  1JF2 A;  1K9U A;  1KFU S;  4PE4 A;  2KNE A;  5I8N A;  3GK1 A;  3FIA A;  2NCP A;  4DS7 A;  1S5G Z;  2OS8 C;  1BT6 A;  1QTX A;  1A75 B;  4OKH A;  2Y5I A;  5AXI A;  4PHN A;  1LKJ A;  3KPX A;  1AK8 A;  3RLZ A;  3FWB A;  1KFX S;  2MBX A;  2K0J A;  3SG7 A;  1MF8 B;  4GBA A;  2LMT A;  1XVJ A;  2MAZ A;  2F33 A;  1DMO A;  1NX1 A;  1OSA A;  2MLF C;  3EKH A;  2L4I A;  3SIA A;  4NDC A;  1YVL A;  2M7N A;  1YUT A;  2KSP A;  2KHN A;  4M2O A;  4UPG A;  3K21 A;  2L51 A;  5GQQ C;  2G9B A;  1K96 A;  4XJK B;  2M29 A;  4PE1 A;  1QVI Y;  1SR6 C;  1XO5 A;  4JPZ B;  1CTR A;  2L4H A;  5PAL A;  1JFK A;  3CR5 X;  4YBH B;  1SL7 A;  5I2Q A;  3BQ3 A;  1CLB A;  4ZCV A;  2M3W A;  5JJG A;  2R2I A;  2L5X B;  2K61 A;  1TN4 A;  1RK9 A;  1B4C A;  5I2L A;  3OHM B;  3CWG A;  1KSO A;  2BL0 C;  4OR9 B;  3IQO A;  4BY5 A;  5B8I B;  2QAC A;  1S6I A;  3OX5 A;  1C7V A;  1OZO A;  2A4J A;  1XFU O;  1BR1 B;  4MVF A;  2TN4 A;  2LNK A;  2BE6 A;  1M45 A;  3SG6 A;  3CGA A;  2KAX A;  3LK1 A;  4DIR A;  1CLL A;  3TS5 B;  1B8R A;  1QAT A;  1B7T Y;  1BOD A;  1MHO A;  3TUY C;  2L0P A;  1Y1X A;  4GGF A;  5AEQ A;  3SG2 A;  1UHN A;  2ZFD A;  3AKA A;  4GNK B;  3AAK A;  1CDP A;  1NSH A;  2BCA A;  4CLN A;  1QX5 B;  3BXK A;  3OB1 B;  2LM5 A;  5TNC A;  1G8I A;  1SMG A;  2JXC A;  2LCP A;  2WND A;  3NSI A;  2LV7 A;  1U5I B;  2WOS A;  3KO0 A;  3O2P A;  1QJT A;  2ZNE A;  2KAV A;  3LCP C;  1YX7 A;  1Y0V H;  2BEC A;  2E6W A;  1IWQ A;  4Q04 A;  2PSR A;  1DT7 B;  1KWO B;  1C07 A;  2MRD A;  2B1U A;  3HX4 A;  1FI5 A;  3BUM B;  2JQ6 A;  4I5L B;  1KFU L;  2CTN A;  2JT3 A;  3VRR A;  3OB2 B;  3QRX A;  4GPL B;  3WXA A;  1B8C A;  1NCZ A;  1IJ5 A;  2LVJ A;  2OTG B;  2LLS A;  1J7O A;  2PVB A;  1J1D A;  1UHH A;  1YRT B;  3FWC A;  1BU3 A;  2JRF A;  3DVK A;  4BY4 A;  1G4Y R;  1L2O B;  1S3P A;  1SY9 A;  5ER4 X;  1F4Q A;  1S36 A;  1WRK A;  1KFX L;  1M31 A;  2M9G A;  3DVJ A;  2ZRT A;  2LVK A;  1PRW A;  2KQ6 A;  2PRU A;  2LP2 A;  1XFW O;  3CR2 A;  3GOF A;  5HLO A;  1OQP A;  3BUX B;  1JFJ A;  4GGF C;  4CFQ A;  1UUR A;  5F6T A;  3VRP A;  2HF5 A;  3PN7 B;  1EL4 A;  2K7B A;  1WRL A;  2PAS A;  2ZND A;  5KTY A;  1K90 D;  1JC2 A;  1SCM C;  1TCO B;  1FBV A;  1MXL C;  4PE0 A;  2KYC A;  1AHR A;  5I2O A;  2EC6 C;  3NSO A;  3NSK A;  2LMU A;  4PHJ A;  2ZN8 A;  1R2U A;  4YGD B;  2V53 A;  2OS8 B;  4HRH A;  1DF0 A;  2CXJ A;  1IH0 A;  4USL A;  1F55 A;  1OE9 B;  2DOQ A;  1BMO A;  1K93 D;  2MHH A;  3O4Y A;  2BKH B;  2ISD A;  4ORA B;  1NPQ A;  1IRJ A;  2BBM A;  3C1V A;  2F3Y A;  1RJV A;  3I5G B;  1TNW A;  2GV5 A;  1N0Y A;  5D7F A;  1S6C A;  1QLS A;  4DCK A;  4YGC B;  1BJF A;  1K94 A;  2JPT A;  3PAL A;  1JF0 A;  1XA5 A;  2M8U A;  3OX6 A;  3VRQ A;  4A4C A;  5BPJ A;  3BOW B;  1AUI B;  3KF9 A;  4QJ4 B;  2KFH A;  5DKQ A;  1WDC C;  1CDN A;  2KI4 C;  1FI6 A;  5JOL A;  4ORC B;  1B9A A;  1A4P A;  1SW8 A;  4WRI A;  1L7Z A;  1XK4 A;  1W7J B;  1LXF C;  1A2X A;  2HPS A;  1S6J A;  3EK4 A;  4N5X A;  2BL0 B;  3TZ1 A;  1XFY O;  3EK7 A;  3NXA A;  2O60 A;  2CT9 A;  4NDD A;  1EJ3 A;  2JTT A;  1TCF A;  2BCX A;  2WC8 A;  1K8U A;  1K9P A;  3PFV A;  3TDZ A;  2AMI A;  3PM8 A;  4YI8 A;  1N65 A;  3JTD C;  1KQM B;  4AQJ A;  2L50 A;  2JC2 A;  1DGU A;  2JT8 A;  3TDU A;  1ZUZ A;  5IBW A;  3IF7 A;  1BG1 A;  1RRO A;  1SPY A;  2HQ8 A;  2KI6 C;  3EVR A;  1QIV A;  1CB1 A;  1OMD A;  2LE9 B;  3PSR A;  1BF5 A;  2M1U A;  4GAO A;  1W7I B;  1UHI A;  2WCB A;  3JVT B;  2Y4Q A;  3KEV A;  1B1G A;  4GGN A;  1CMG A;  3M0W A;  4GFT A;  3D0Y B;  3PLF B;  3BUO B;  1YTZ C;  2AUC A;  5DKR A;  1UWO A;  2LLU A;  1TTX A;  1KK7 Y;  2ZKM X;  4M2P A;  1SRA A;  1B7T Z;  2I2R E;  1GJY A;  2K7C A;  1XK4 C;  2VRG A;  3CTN A;  2BCB A;  1AVS A;  1MUX A;  2Y1N A;  2M0R A;  3SJS A;  2AAO A;  4MZK A;  1JUO A;  3EVU A;  1RTP 1;  1CDL A;  1IG5 A;  3OP0 A;  1FPW A;  4CFR A;  3DVM A;  2FJU B;  1BLQ A;  5ER5 A;  1X02 A;  1ZOT B;  5HKY A;  2MLE C;  1AJ4 A;  1QV1 A;  2K2A A;  3LLE A;  1A29 A;  1QAS A;  2JUL A;  2NZ0 A;  4CPV A;  1U5I A;  2NXQ A;  1NYA A;  1YX8 A;  4NDB A;  5CSJ A;  1G33 A;  5CSI A;  4FTG A;  1ZMZ A;  1DJX A;  5AAN A;  1YUR A;  4QJ5 B;  2JZI A;  2D8N A;  1NCX A;  1EG3 A;  3I5I C;  1M39 A;  2NLN A;  4ETO A;  1ZAC A;  1FW4 A;  4U8D A;  3ICB A;  1N2D A;  5J3X A;  2F2O A;  1SL8 A;  4ICB A;  1ODB A;  1J7P A;  1EH2 A;  2EC6 B;  4FQO A;  4YGA A;  2BE4 A;  3I5H B;  4YGE B;  2M97 A;  1K2H A;  2PMY A;  2O5G A;  2QPT A;  2KGB C;  1YVH A;  1ZFS A;  1OOJ A;  2KFF A;  5CSN A;  4PE7 A;  3TS5 C;  2P6B B;  1R6P A;  2G2B A;  4PDZ A;  3LK0 A;  1F54 A;  1M46 A;  1BOC A;  1PUL A;  2CBL A;  1SNL A;  1AJ5 A;  2I7A A;  1DVI A;  4IL1 A;  3PAT A;  3WNX B;  5FYX A;  3IQQ A;  1RFJ A;  1V1F A;  3CR4 X;  3DF0 B;  3WHU B;  2KBI A;  3DVE A;  1F4O A;  2GGM A;  3TDI A;  1DJI A;  4MEW A;  1KWO C;  2LUC A;  5DKN A;  2OPO A;  4AOM A;  1WDC B;  1OMV A;  1DGV A;  2KI4 B;  2L98 A;  1REC A;  1TRF A;  3WHT B;  1SCV A;  1DTL A;  2SAS A;  2LAN A;  2LLT A;  2LMV A;  3SG4 A;  4XYN A;  2H2K A;  2LC5 A;  1Q80 A;  1PK0 D;  3H4S E;  1S1E A;  2LVI A;  3HCM A;  4PHM A;  1KK8 C;  1NIW A;  2LHL A;  4AQI A;  1QX7 A;  1VRK A;  1XFV O;  1Y1A A;  1MWN A;  3FS7 A;  3CZT X;  2JU0 A;  3I5F C;  3VGO A;  3F45 A;  1LA3 A;  1QX2 A;  2LUX A;  1IJ6 A;  3GK2 A;  1CFF A;  1YUU A;  1QLK A;  4HRE E;  1GGW A;  4A4B A;  3JTD B;  1SR6 B;  2K7D A;  1Y1U A;  1DJY A;  4OV2 A;  1A75 A;  3DD4 A;  1CFD A;  1B47 A;  1HQV A;  1NX2 A;  2LVV A;  3BOW A;  1SL9 A;  4TNC A;  1J7Q A;  2KOT A;  1CLM A;  2NCO A;  1S26 D;  3PN7 C;  2PAL A;  1EXR A;  1JBA A;  1J1E A;  4YRU A;  4DUQ A;  1SK6 D;  1PVB A;  3EK8 A;  3SG3 A;  3VRN A;  2ZRS A;  1J55 A;  2HET A;  1TNP A;  4F0Z B;  2K2F A;  1NCY A;  2F3Z A;  1GGZ A;  1S5G Y;  1QVI Z;  1MXE A;  1IKU A;  4XJK A;  4ORB B;  1YR5 A;  2EGD A;  1PSR A;  3A8R A;  2RGI A;  4I5N B;  3TUY B;  5D69 A;  4PCW A;  4HSZ A;  1NUB A;  3I5G C;  1PVA A;  1KCY A;  4YGB B;  2KBM A;  1LVC D;  5AFP A;  2JT0 A;  4JQ0 D;  4L9M A;  4OCI A;  4E68 A;  5HLV A;  1BR4 B;  1WLZ A;  2JXL A;  4C0J A;  5AER A;  1SKT A;  4QJ3 B;  2KDH A;  4R1E A;  1M63 B;  1KK7 Z;  2JWW A;  3D0Y A;  1UHK A;  4YI9 A;  1LIN A;  4MN0 A;  1YRU B;  3LL8 B;  1QIW A;  1CM4 A;  1TNX A;  3AKB A;  3I5I B;  3ZNI A;  4DRW A;  1C7W A;  4MLW A;  1F71 A;  2E30 A;  5K89 A;  2ZN9 A;  3BUW B;  4N1G A;  1OMR A;  1XYD A;  3MSE B;  4C0L A;  2L2E A;  4GUK A;  2KQY A;  2LP3 A;  2JTZ A;  4ZCU A;  2BBN A;  2LHI A;  2Q4U A;  1B8L A;  2KAY A;  2FOT A;  3VRO A;  1AP4 A;  1DJH A;  1GQM A;  5KU1 A;  1CFC A;  1CNP A;  1NP8 A;  2K7O A;  4I5J A;  1KQM C;  4WQ2 A;  2CNP A;  4CID A;  1MR8 A;  2H61 A;  3KHE A;  2I94 A;  2F8P A;  2IS9 A;  2Q91 A;  5CSF A;  1CM1 A;  4N1F A;  1SCM B;  1DJZ A;  5HKW A;  3GK4 X;  3JVT C;  4HRG A;  3AAJ A;  1F70 A;  1CFP A;  1FF1 A;  1TNQ A;  1ALW A;  2F2P A;  1KSM A;  2MJW B;  5HKZ A;  4I5K A;  1NX3 A;  1JWD A;  5HYD A;  1CKK A;  1PAL A;  1QS7 A;  2LAP A;  1DJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...