1J7PA

Solution structure of calcium calmodulin c-terminal domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
67
structure length
67
Chain Sequence
EEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Calmodulin
publication title Solution structure of Ca(2+)-calmodulin reveals flexible hand-like properties of its domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 20
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2001-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1j7pA00
2BE6A 2LC5A 1S26D 3BOWA 1B7TZ 1LA3A 3PSRA 4XJKB 1ODBA 1MR8A 4YGDB 1LVCD 4E68A 1J7RA 1NYAA 2M49B 2ZNDA 1OZSA 1FBVA 1PRWA 1L2OC 1X02A 1Y0VH 4I5KA 4FQOA 3VRRA 2KQYA 2VRGA 4MBEA 1KSMA 4JPZB 4HSZA 3D0YA 3OP0A 1KCYA 4MZKA 1GGWA 4PDZA 1PSRA 2ZN8A 2KFFA 1NP8A 2NCOA 3DVKA 3EK4A 3O4YA 1W7JB 2LHLA 4OCIA 3IQQA 2NXQA 1QLKA 1FPWA 2LMTA 3GK4X 2LLSA 5F6TA 4GBAA 2K7DA 1EL4A 1MHOA 1AP4A 3VRPA 1N0YA 1DGUA 2R2IA 1TRFA 3H4SE 2EC6C 2FCEA 1UHIA 2MRDA 3D0YB 3TUYC 1H8BA 5J3XA 1K96A 1G4YR 2ZN9A 4MZJA 1TTXA 3FIAA 1CMGA 3OB2B 3LK0A 3I5GC 2WNDA 1F4OA 3K21A 1IH0A 4FTGA 1J1EA 1FW4A 2SCPA 2LVVA 5HLVA 1B7TY 1XA5A 2JTZA 4A4CA 3PATA 4GGNA 1JSAA 4CPVA 1BOCA 1PVAA 4MLWA 2BKIB 1A2XA 4N5XA 3SJSA 3VRQA 1WLMA 4MRXA 1GQMA 5HKYA 2KQ6A 2V53A 1NX0A 1YTZC 4I5JA 2HETA 3SIBA 1HQVA 1K93D 2LP2A 2LHIA 1BF5A 1W7IB 1AJ4A 5HKZA 2LAPA 4DS7A 1SR6B 4GFTA 3FWCA 1OMVA 4OR9B 5G08A 1F54A 1U5IA 1XVJA 5I2LA 1OMRA 4YI8A 2JPTA 1QTXA 3PN7C 5KTYA 4DUQA 1CB1A 1J55A 3SG5A 1D1OA 2L50A 1SCMC 1EG3A 2H2KA 4AOMA 3CR2A 4GNKB 3LLEA 1GGZA 4PE4A 1R6PA 1MXEA 1PALA 2FJUB 4ORAB 5HYDA 3A4UB 3LCPC 4I5NB 4JWQA 5CSFA 5HLOA 5HKWA 3TS5B 3NSOA 1WDCC 4PE1A 3SG2A 2LE9B 3PALA 1IJ6A 4P2YB 4D1EA 2WC8A 1FF1A 1B4CA 1QX2A 5KSZA 1A4PA 3I5HC 4PALA 1YVHA 2M1KB 2MJWB 4QJ5B 1IQ3A 1U5IB 1MF8B 1SW8A 2M3WA 2WCEA 2KI4B 2PASA 4U8DA 2E30A 5PALA 2D8NA 2DOQA 4HREE 4QJ4B 5AEQA 1CKKA 1DJWA 3IF7A 2LNKA 2GV5A 2K8MB 2BCXA 4ETOA 1Q80A 1QIWA 2FOTA 2KDHA 4PHKA 3VGOA 1NX1A 1YURA 1JF2A 2M7NA 2NZ0A 1ZFSA 4CFQA 2BBNA 3AKBA 1MWNA 2M97A 1XFYO 2Q91A 3I5IB 4CIDA 1SCMB 2L51A 4YI9A 1RECA 2ZNEA 3BUMB 1XYDA 1SL9A 1AHRA 1BR4B 1NWDA 1XFXO 4PCWA 3WHTB 1YX8A 2OS8B 1A75A 4Q04A 3BUNB 4MRYA 2JTTA 4MVFA 2COLB 3AKAA 3M0WA 2OTGB 1JBAA 1TNXA 1YUSA 2QPTA 1K8UA 4WQ2A 1CFCA 1CFPA 2K7CA 3NXAA 1DJHA 3DVMA 1QATA 4MN0A 1SMGA 1CDPA 3KO0A 1A75B 2EHBA 2KSPA 2NCPA 4JQ0D 5BPJA 1SBJA 1XFVO 2O60A 1B47A 2I94A 2KNEA 1N65A 1OSAA 1KK8B 2IS9A 2I7AA 2JT0A 3GOFA 4NDBA 2L98A 1SPYA 1UHHA 1CTRA 2RGIA 1UUSA 1B9AA 2JZIA 3BOWB 1DTLA 1UURA 3IQOA 2B1UA 1Y1AA 1SR6C 1OE9B 2K0JA 3AAKA 1AUIB 2MLFC 4M2PA 4CFRA 1V1GA 5K89A 5KU1A 1EH2A 1BJFA 2I2RE 2KAXA 2JNFA 1CM4A 2TN4A 3VRNA 2ISDA 1K9PA 2LCPA 4UPGA 4C0LA 3RM1A 1F70A 4USLA 1RROA 2KFGA 3TS5C 1CLMA 4TNCA 1F4QA 1YR5A 2L4IA 2LMVA 4HRHA 2KOTA 1MUXA 4ICBA 1PULA 1DJGA 2LUCA 2KGRA 2G2BA 4ORCB 2LV7A 3JVTC 5CSNA 3PLFB 5JOLA 2Y5IA 5CSIA 2KI4C 2ZRTA 4WRIA 2BL0B 2PVBA 4F0ZB 3FS7A 2LM5A 3HX4A 3DD4A 2PRUA 1UHKA 1KFXS 3CZTX 1QV1A 1ALVA 5DKQA 5AFPA 2JWWA 1H4BA 1K2HA 1KWOB 1IGVA 2PMYA 1RWYA 2GGZA 2PSRA 3EVUA 2WOSA 3BUWB 2KYCA 3EK8A 3KPXA 5DKRA 1NX2A 1DMOA 1EJ3A 2GGMA 4GGFA 4N1GA 1BMOA 4I5LB 1B8RA 3SG7A 2H61A 1DF0A 1LKJA 1MXLC 1QS7A 3BYAA 2M1UA 3FWBA 2Y1NA 2BBMA 3I5IC 1NSHA 3O78A 1NCXA 1SYMA 4C0KA 3GK1A 2L0PA 2F8PA 1WRZA 1IRJA 1QJTA 2OS8C 2G9BA 2ZKMX 5I2QA 2F2PA 2WORA 1QV0A 2AAOA 1UP5A 4MSPA 1TNWA 2OTGC 2F2OA 1CLBA 1KFXL 1M46A 2KHNA 2M0RA 3JVTB 4PHMA 1DF0B 3NSIA 1QASA 2LMUA 4MZLA 1TCOB 3CLNA 2OPOA 1ZUZA 1OOJA 1NUBA 1JFKA 5CPVA 4YGAA 1SK6D 2EGDA 2KGBC 4MEWA 2K7OA 4ZCUA 2JOJA 1LINA 1QVIZ 1CMFA 1CDMA 2L5XB 1BR1B 2O5GA 1TNPA 1IKUA 1S6CA 1KQMB 1KK8C 4GUKA 1YUTA 3WHUB 4YRUA 2KFHA 2LP3A 3HCMA 1IQ5A 3TDIA 4DCKA 1K94A 3KEVA 2LVKA 3PFVA 1S1EA 1YRUB 4N1FA 5D69A 1RFJA 3TZ1A 2L2EA 3CWGA 2M8UA 1A29A 3ZWHA 2KI6C 3CTNA 3I5FB 2LANA 1TCFA 1TNQA 4AQIA 3SG3A 5AERA 3OHMB 1IG5A 1R2UA 2F3YA 2L4HA 1BU3A 1QXPA 4WQ3A 3JTDB 4NDCA 2P6BB 1SKTA 1EXRA 2AMIA 3DF0A 1J7QA 2JXLA 1YVLA 2JU0A 1FI6A 3LL8B 2JT8A 1AVSA 1K9KA 2ZFDA 1CDLA 2HQ8A 1XFWO 1RK9A 1WRKA 1DJIA 1G33A 2BL0C 4ZCVA 1ZACA 2BCBA 3TDUA 1M63B 1QLSA 1F55A 1JC2A 2PALA 3O2PA 1YUUA 3DVJA 3EK7A 2Q4UA 1CFFA 1JWDA 5CSJA 3BUXB 1M45A 1KWOC 4HRGA 1QVIY 1CDNA 1V1FA 2KI6D 3EVRA 3DF0B 1S36A 2JT3A 4C0JA 1ZOTB 3SG6A 1UWOA 4OVNF 1WRLA 3CS1A 2JNXA 1K95A 1QX5B 3SIAA 2LLTA 1SRAA 2MA2A 1M39A 1FI5A 1B8LA 3EKHA 4NQGA 1C07A 1WLZA 1PK0D 2CXJA 1KSOA 4DRWA 1IWQA 1CM1A 2LUXA 1XK4A 2K2FA 1N2DA 3BUOB 1KQVA 4AQJA 2HPSA 3WNXB 2KBMA 4R1EA 5ER4X 1TN4A 1CNPA 1PVBA 1L7ZA 1EG4A 4PE0A 4GGFC 2CT9A 1S5GZ 1Y1XA 2H61C 1DT7B 3EKJA 1ALWA 2CNPA 3OX5A 1K90D 5FYXA 1NCYA 1AJ5A 2CTNA 2M7LA 3WXAA 1TOPA 1XFZO 1GJYA 1KFUS 1SL7A 2K7BA 1Y6WA 1G8IA 5IBWA 2CCMA 1CLLA 4CLNA 1KK7Z 1RTP1 5TNCA 2BKHB 4PHJA 1KQMC 1XO5A 2SASA 2E6WA 1CFDA 1E8AA 1YX7A 3OB1B 3CR4X 3F45A 5GQQC 4P5OE 1F71A 2K2AA 1J7PA 1K9UA 1L2OB 1VRKA 2JQ6A 4M2OA 3KF9A 4YBHB 5DKNA 5B8IB 1S3PA 3RLZA 1SL8A 2BE4A 2FCDA 3BXKA 1UHNA 4ORBB 3QRXA 2MBXA 5JJGA 2HQWA 1JF0A 1S6IA 1DJXA 2ZRSA 2CBLA 3I5FC 3MSEB 2BECA 3ICBA 2KBIA 2LLUA 3ZNIA 3OX6A 1ZMZA 4OV2A 1JFJA 3VROA 1KFUL 4PHNA 3JTDC 5AANA 4QJ3B 3D10A 1UHJA 4M2QA 3NSLA 1OQPA 1DJYA 2I18A 3DVEA 1OZOA 2MAZA 3PM8A 2EC6B 1S5GY 2HF5A 1Y1UA 2Y4QA 4YGCB 4A4BA 1TIZA 1NX3A 3TUYB 2LVIA 4BY4A 1M31A 4OKHA 3CR5X 2M9GA 3LK1A 2JRFA 1J1DA 1NCZA 3I5GB 1QX7A 2BCAA 1DJZA 1LA0A 5I2OA 5I8NA 1F8HA 1KK7Y 2MLEC 2MHHA 1SY9A 1OMDA 3O6BA 4NDDA 4XYNA 2AUCA 2QACA 1BG1A 2NLNA 3EVVA 4IL1A 1B1GA 1RJVA 1LXFC 4YGBB 1WY9A 1NPQA 3AAJA 1SCVA 1BLQA 2A4JA 3SG4A 1YRTB 1HT9A 3BQ3A 1S6JA 4BY5A 1MQ1A 2KAYA 1C7WA 4GAOA 1A03A 3GK2A 1DGVA 1QIVA 2JULA 1BODA 2F33A 3C1VA 1DVIA 1J7OA 4L9MA 3PN7B 5D7FA 2LVJA 1JUOA 1NIWA 4XJKA 3CGAA 1PSBA 5AXIA 1XFUO 2KAVA 4DIRA 2K61A 4YGEB 1IJ5A 3E3RA 2F3ZA 2KYFA 5ER5A 3NSKA 1BT6A 3TDZA 1AK8A 1B8CA 4GPLB 3A8RA 1WDCB 1SNLA 1XK4C 2WCFA 2JXCA 2M29A 2WCBA 3KHEA 4PE7A 1C7VA 2JC2A 3I5HB 2Y1MA
chains in the Genus database with same CATH superfamily
2BE6A 2LC5A 3S0GA 1S26D 3EG5B 3BOWA 1B7TZ 1LA3A 3PSRA 4XJKB 1ODBA 1MR8A 4YGDB 1LVCD 4E68A 1J7RA 1NYAA 2M49B 2ZNDA 1OZSA 1FBVA 1PRWA 1L2OC 1X02A 1Y0VH 4I5KA 4FQOA 3DXLA 3VRRA 2KQYA 2VRGA 4MBEA 1KSMA 4JPZB 4HSZA 3D0YA 3OP0A 1KCYA 4MZKA 1GGWA 4PDZA 1PSRA 2ZN8A 2KFFA 1NP8A 3SS4A 2NCOA 3DVKA 3EK4A 3O4YA 1W7JB 1DELA 3D75A 2LHLA 4OCIA 3IQQA 3R72A 2H8VA 2NXQA 1QLKA 3RZSA 1FPWA 2LMTA 3GK4X 2LLSA 5F6TA 4GBAA 2K7DA 3V2LA 1EL4A 1MHOA 1AP4A 3VRPA 1N0YA 1DGUA 2R2IA 1TRFA 3H4SE 2EC6C 2FCEA 4INXA 1UHIA 2MRDA 3D0YB 3TUYC 1H8BA 5J3XA 1K96A 1G4YR 2ZN9A 4MZJA 1TTXA 3FIAA 1CMGA 3OB2B 3LK0A 3I5GC 4IJ7A 2WNDA 1F4OA 3K21A 1IH0A 4FTGA 1J1EA 1FW4A 2SCPA 2LVVA 4INWA 5HLVA 1B7TY 1XA5A 2JTZA 4A4CA 3PATA 4GGNA 2WC6A 4CPVA 1JSAA 1BOCA 1PVAA 4MLWA 2BKIB 3CZ0A 1A2XA 4N5XA 3SJSA 3VRQA 1WLMA 4MRXA 1GQMA 5HKYA 2KQ6A 2V53A 2K60A 1NX0A 1YTZC 4I5JA 3PJIA 2HETA 3SIBA 1HQVA 1K93D 2LP2A 2LHIA 1BF5A 1W7IB 2QDIA 1AJ4A 3D77A 5HKZA 2LAPA 4DS7A 2WCLA 1SR6B 4GFTA 3FWCA 1OMVA 4OR9B 5G08A 1F54A 1U5IA 1XVJA 5I2LA 1OMRA 4YI8A 2JPTA 3B86A 1QTXA 1QWVA 3PN7C 4DUQA 3D73A 5KTYA 1CB1A 1J55A 2WCKA 3SG5A 1D1OA 2L50A 1SCMC 1EG3A 1Z4HA 2H2KA 4AOMA 3CR2A 4GNKB 3LLEA 1GGZA 4PE4A 1R6PA 1MXEA 1PALA 2FJUB 4ORAB 5HYDA 3A4UB 3LCPC 4I5NB 4JWQA 5CSFA 5HLOA 5HKWA 3TS5B 1XFRA 3NSOA 1WDCC 4PE1A 3SG2A 2LE9B 3PALA 1IJ6A 4P2YB 4D1EA 2WC8A 3S0DA 1FF1A 1B4CA 1QX2A 5KSZA 1A4PA 3I5HC 4PALA 1YVHA 2M1KB 2MJWB 4QJ5B 1IQ3A 1U5IB 1MF8B 1SW8A 2M3WA 2WCEA 2KI4B 2PASA 4U8DA 2E30A 5PALA 2D8NA 2DOQA 4HREE 4QJ4B 5AEQA 1CKKA 1DJWA 3S0FA 3B7AA 2WCHA 3IF7A 2LNKA 2GV5A 5EL2A 3CABA 2K8MB 1TUZA 2BCXA 4ETOA 1Q80A 3B88A 2L5YA 1QIWA 2FOTA 2KDHA 4PHKA 3VGOA 1NX1A 1YURA 1JF2A 2M7NA 2NZ0A 1Z2CB 1ZFSA 3FE9A 2BBNA 4CFQA 3AKBA 1MWNA 2M97A 1XFYO 2Q91A 3I5IB 4CIDA 1SCMB 2L51A 4YI9A 1RECA 2ZNEA 3BUMB 1XYDA 1SL9A 1AHRA 1BR4B 1NWDA 1XFXO 4PCWA 3WHTB 1ORGA 1YX8A 1IIOA 3QMEA 2OS8B 1A75A 1OOFA 4Q04A 1OOIX 3BUNB 4MRYA 2JTTA 3D76A 4MVFA 2COLB 2FJYA 3AKAA 3M0WA 2OTGB 1JBAA 1TNXA 1YUSA 2QPTA 1K8UA 3FE6A 1C3ZA 4WQ2A 1CFCA 3Q8IA 1CFPA 2K7CA 3NXAA 5FI2A 1DJHA 3DVMA 2PYQA 1QATA 4MN0A 1SMGA 3BFAA 2QEOA 2L2CA 2ERBA 3BFBA 1CDPA 3KO0A 3DY9A 1A75B 3O4XA 2EHBA 2KSPA 2NCPA 4JQ0D 3UNWA 5BPJA 1SBJA 1XFVO 3NHTA 2O60A 1B47A 2I94A 2KNEA 1N65A 1OSAA 1KK8B 3OGNA 2IS9A 2I7AA 2JT0A 3GOFA 4NDBA 2L98A 1SPYA 3B87A 1UHHA 1CTRA 2RGIA 1UUSA 1B9AA 2JZIA 3BOWB 3L47A 1DTLA 1UURA 3IQOA 2B1UA 1Y1AA 1SR6C 1OE9B 2K0JA 3AAKA 3CYZA 1AUIB 2MLFC 4M2PA 4CFRA 1V1GA 5K89A 5KU1A 3N7HA 1EH2A 1BJFA 2I2RE 2KAXA 2JNFA 1CM4A 2TN4A 3VRNA 2ISDA 1SSEB 1K9PA 2LCPA 4UPGA 4C0LA 3RM1A 1F70A 4USLA 1RROA 3BJHA 2KFGA 3TS5C 3UO9A 1CLMA 3DYEA 1F4QA 1YR5A 2L4IA 4TNCA 2LMVA 4HRHA 2KOTA 1MUXA 4ICBA 1PULA 1DJGA 2LUCA 2KGRA 2G2BA 4ORCB 2LV7A 3JVTC 5CSNA 3PLFB 5JOLA 1P28A 2Y5IA 2KI4C 2ZRTA 4WRIA 2BL0B 2PVBA 3K1EA 5CSIA 3FS7A 2LM5A 3HX4A 4F0ZB 3DD4A 2PRUA 3B6XA 1UHKA 1KFXS 3CZTX 1QV1A 1ALVA 5DKQA 5AFPA 2JWWA 1H4BA 1K2HA 1KWOB 3BFHA 1IGVA 2PMYA 1RWYA 2GGZA 2PSRA 1LS8A 3EVUA 2WOSA 3BUWB 1OOGA 2KYCA 3EK8A 3KPXA 1NX2A 5DKRA 1EJ3A 2GGMA 1DC1A 1DMOA 4GGFA 4N1GA 1BMOA 4I5LB 1B8RA 3SG7A 2H61A 1DF0A 1LKJA 1MXLC 1QS7A 3BYAA 2M1UA 3FWBA 2Y1NA 2BBMA 3I5IC 1NSHA 3O78A 1NCXA 1SYMA 4C0KA 2QEVA 2KLDA 3GK1A 2L0PA 3FE8A 2F8PA 1WRZA 3S0AA 3D78A 1IRJA 1QJTA 2OS8C 2G9BA 2BAPA 2ZKMX 5I2QA 2F2PA 2WORA 1QV0A 2AAOA 1UP5A 4MSPA 1TNWA 2OTGC 2F2OA 1CLBA 1KFXL 1M46A 2KHNA 2M0RA 3JVTB 3L4AA 4PHMA 1DF0B 3NSIA 1QASA 2LMUA 4MZLA 1TCOB 3CLNA 2OPOA 1ZUZA 2YGUA 1OOJA 1NUBA 1JFKA 5CPVA 4YGAA 1SK6D 2EGDA 2KGBC 4MEWA 2K7OA 2P70A 4ZCUA 1TUJA 2JOJA 1LINA 3R1PA 1QVIZ 1CMFA 1CDMA 2L5XB 1BR1B 2O5GA 1TNPA 1IKUA 1S6CA 1KQMB 2JPOA 1KK8C 4GUKA 1YUTA 3WHUB 4YRUA 2KFHA 2QEHA 2LP3A 3HCMA 1IQ5A 3TDIA 4DCKA 1K94A 3KEVA 2LVKA 1DQEA 3PFVA 1S1EA 1YRUB 1OW4A 4N1FA 5D69A 1RFJA 3TZ1A 2L2EA 5I94A 3CWGA 3S0EA 2M8UA 3DZTA 1A29A 3ZWHA 2KI6C 3CTNA 3I5FB 2LANA 1TCFA 1TNQA 4AQIA 3SG3A 5AERA 3OHMB 1IG5A 1R2UA 2F3YA 3NGVA 2L4HA 1BU3A 1QXPA 4WQ3A 3JTDB 4NDCA 2P6BB 1SKTA 1EXRA 2AMIA 3DF0A 3S0BA 1J7QA 2JXLA 1YVLA 2JU0A 1FI6A 3LL8B 2JT8A 1AVSA 3NHIA 1K9KA 2ZFDA 4FQTA 1CDLA 2HQ8A 5FI6A 4OZDA 1XFWO 1RK9A 1WRKA 1DJIA 1G33A 2BL0C 4ZCVA 3VB1A 3SS3A 1DEKA 1ZACA 2BCBA 3TDUA 1M63B 1QLSA 1F55A 1JC2A 2PALA 3O2PA 1YUUA 3DVJA 3EK7A 2Q4UA 1CFFA 1JWDA 5CSJA 1T14A 3BUXB 1M45A 1KWOC 4HRGA 1QVIY 1CDNA 1V1FA 2KI6D 3EVRA 3DF0B 1S36A 2JT3A 4C0JA 1ZOTB 2BNXA 3SG6A 1UWOA 4OVNF 1WRLA 3CS1A 2JNXA 1K95A 1QX5B 3SIAA 1C3YA 2LLTA 1SRAA 2MA2A 1M39A 1FI5A 1B8LA 4JKTA 3EKHA 4NQGA 1C07A 1WLZA 1PK0D 2CXJA 1KSOA 4DRWA 1IWQA 1CM1A 2LUXA 1XK4A 2K2FA 1N2DA 3BUOB 1KQVA 4AQJA 2HPSA 5HL1A 3WNXB 2KBMA 4R1EA 5ER4X 1TN4A 4PT1A 3D74A 1CNPA 1PVBA 1L7ZA 1EG4A 4PE0A 4GGFC 2CT9A 1S5GZ 1Y1XA 3L4LA 2H61C 1DT7B 3EKJA 1ALWA 2CNPA 3OX5A 1K90D 5FYXA 1NCYA 1AJ5A 2CTNA 2M7LA 3WXAA 1TOPA 1XFZO 1GJYA 1KFUS 1OOHA 1SL7A 2K7BA 1Y6WA 1G8IA 5IBWA 2CCMA 2KPHA 1CLLA 3PM2A 4CLNA 1KK7Z 1RTP1 5TNCA 2BKHB 4PHJA 1KQMC 1XO5A 2SASA 2E6WA 1CFDA 1E8AA 1YX7A 3OB1B 3CR4X 3F45A 5GQQC 4P5OE 1F71A 1GM0A 2WCMA 2K2AA 3R1VA 1J7PA 1K9UA 1L2OB 1VRKA 2JQ6A 4M2OA 3KF9A 4YBHB 5DKNA 5B8IB 1S3PA 3R1OA 3RLZA 1SL8A 2BE4A 2FCDA 2PQLA 3BXKA 1UHNA 4ORBB 3QRXA 2MBXA 5JJGA 2HQWA 1JF0A 1S6IA 1DJXA 2WCJA 2ZRSA 2CBLA 3I5FC 3CZ1A 3MSEB 1TWOA 5D3OA 2BECA 3ICBA 2KBIA 2LLUA 5FI7A 3OX6A 1ZMZA 4OV2A 3ZNIA 1JFJA 3VROA 1KFUL 4PHNA 3JTDC 5AANA 4QJ3B 3D10A 1UHJA 4M2QA 3NSLA 2QEBA 1OQPA 1DJYA 2I18A 3DVEA 1OZOA 2MAZA 3PM8A 2EC6B 1S5GY 2HF5A 1Y1UA 2Y4QA 4YGCB 4A4BA 2GTEA 1TIZA 1NX3A 3TUYB 4JD9A 2WC5A 2LVIA 4BY4A 3OBVA 1M31A 4OKHA 3CR5X 2M9GA 3LK1A 2JRFA 1J1DA 4F7FA 1NCZA 3I5GB 1QX7A 2BCAA 1DJZA 1LA0A 1W9ZA 3CZ2A 5I2OA 5I8NA 1F8HA 1KK7Y 2MLEC 2MHHA 1SY9A 3SS5A 1OMDA 3O6BA 4KYNA 4NDDA 4XYNA 2AUCA 2QACA 1BG1A 2NLNA 3EVVA 4IL1A 1B1GA 1RJVA 1LXFC 3CDNA 4YGBB 1WY9A 1NPQA 3AAJA 3IVTA 1SCVA 1BLQA 2A4JA 3SG4A 1YRTB 1HT9A 3BQ3A 1S6JA 2KLEA 4BY5A 5DICA 1MQ1A 2KAYA 1C7WA 4GAOA 1A03A 3GK2A 1DGVA 1QIVA 2JULA 1BODA 2P71A 2F33A 3C1VA 1DVIA 1J7OA 4L9MA 3PN7B 5D7FA 2LVJA 1JUOA 1NIWA 4XJKA 3CGAA 1PSBA 5AXIA 1XFUO 2KAVA 4DIRA 2K61A 4YGEB 1IJ5A 3E3RA 2F3ZA 2KYFA 5ER5A 3NSKA 1BT6A 3TDZA 1AK8A 1B8CA 4GPLB 3A8RA 1WDCB 1SNLA 1XK4C 2WCFA 2JXCA 2M29A 2WCBA 3KHEA 4PE7A 1C7VA 2JC2A 3I5HB 2Y1MA
chains in the Genus database with same CATH topology
2BE6A 2LC5A 1S26D 3BOWA 1B7TZ 1LA3A 3PSRA 4XJKB 1ODBA 1MR8A 4YGDB 1LVCD 4E68A 1J7RA 1NYAA 2M49B 2ZNDA 1OZSA 1FBVA 1PRWA 1L2OC 1X02A 1Y0VH 4I5KA 4FQOA 3VRRA 2KQYA 2VRGA 4MBEA 1KSMA 4JPZB 4HSZA 3D0YA 3OP0A 1KCYA 4MZKA 1GGWA 4PDZA 1PSRA 2ZN8A 2KFFA 1NP8A 2NCOA 3DVKA 3EK4A 3O4YA 1W7JB 2LHLA 4OCIA 3IQQA 2NXQA 1QLKA 1FPWA 2LMTA 3GK4X 2LLSA 5F6TA 4GBAA 2K7DA 1EL4A 1MHOA 1AP4A 3VRPA 1N0YA 1DGUA 2R2IA 1TRFA 3H4SE 2EC6C 2FCEA 1UHIA 2MRDA 3D0YB 3TUYC 1H8BA 5J3XA 1K96A 1G4YR 2ZN9A 4MZJA 1TTXA 3FIAA 1CMGA 3OB2B 3LK0A 3I5GC 2WNDA 1F4OA 3K21A 1IH0A 4FTGA 1J1EA 1FW4A 2SCPA 2LVVA 5HLVA 1B7TY 1XA5A 2JTZA 4A4CA 3PATA 4GGNA 1JSAA 4CPVA 1BOCA 1PVAA 4MLWA 2BKIB 1A2XA 4N5XA 3SJSA 3VRQA 1WLMA 4MRXA 1GQMA 5HKYA 2KQ6A 2V53A 1NX0A 1YTZC 4I5JA 2HETA 3SIBA 1HQVA 1K93D 2LP2A 2LHIA 1BF5A 1W7IB 1AJ4A 5HKZA 2LAPA 4DS7A 1SR6B 4GFTA 3FWCA 1OMVA 4OR9B 5G08A 1F54A 1U5IA 1XVJA 5I2LA 1OMRA 4YI8A 2JPTA 1QTXA 3PN7C 5KTYA 4DUQA 1CB1A 1J55A 3SG5A 1D1OA 2L50A 1SCMC 1EG3A 2H2KA 4AOMA 3CR2A 4GNKB 3LLEA 1GGZA 4PE4A 1R6PA 1MXEA 1PALA 2FJUB 4ORAB 5HYDA 3A4UB 3LCPC 4I5NB 4JWQA 5CSFA 5HLOA 5HKWA 3TS5B 3NSOA 1WDCC 4PE1A 3SG2A 2LE9B 3PALA 1IJ6A 4P2YB 4D1EA 2WC8A 1FF1A 1B4CA 1QX2A 5KSZA 1A4PA 3I5HC 4PALA 1YVHA 2M1KB 2MJWB 4QJ5B 1IQ3A 1U5IB 1MF8B 1SW8A 2M3WA 2WCEA 2KI4B 2PASA 4U8DA 2E30A 5PALA 2D8NA 2DOQA 4HREE 4QJ4B 5AEQA 1CKKA 1DJWA 3IF7A 2LNKA 2GV5A 2K8MB 2BCXA 4ETOA 1Q80A 1QIWA 2FOTA 2KDHA 4PHKA 3VGOA 1NX1A 1YURA 1JF2A 2M7NA 2NZ0A 1ZFSA 4CFQA 2BBNA 3AKBA 1MWNA 2M97A 1XFYO 2Q91A 3I5IB 4CIDA 1SCMB 2L51A 4YI9A 1RECA 2ZNEA 3BUMB 1XYDA 1SL9A 1AHRA 1BR4B 1NWDA 1XFXO 4PCWA 3WHTB 1YX8A 2OS8B 1A75A 4Q04A 3BUNB 4MRYA 2JTTA 4MVFA 2COLB 3AKAA 3M0WA 2OTGB 1JBAA 1TNXA 1YUSA 2QPTA 1K8UA 4WQ2A 1CFCA 1CFPA 2K7CA 3NXAA 1DJHA 3DVMA 1QATA 4MN0A 1SMGA 1CDPA 3KO0A 1A75B 2EHBA 2KSPA 2NCPA 4JQ0D 5BPJA 1SBJA 1XFVO 2O60A 1B47A 2I94A 2KNEA 1N65A 1OSAA 1KK8B 2IS9A 2I7AA 2JT0A 3GOFA 4NDBA 2L98A 1SPYA 1UHHA 1CTRA 2RGIA 1UUSA 1B9AA 2JZIA 3BOWB 1DTLA 1UURA 3IQOA 2B1UA 1Y1AA 1SR6C 1OE9B 2K0JA 3AAKA 1AUIB 2MLFC 4M2PA 4CFRA 1V1GA 5K89A 5KU1A 1EH2A 1BJFA 2I2RE 2KAXA 2JNFA 1CM4A 2TN4A 3VRNA 2ISDA 1K9PA 2LCPA 4UPGA 4C0LA 3RM1A 1F70A 4USLA 1RROA 2KFGA 3TS5C 1CLMA 4TNCA 1F4QA 1YR5A 2L4IA 2LMVA 4HRHA 2KOTA 1MUXA 4ICBA 1PULA 1DJGA 2LUCA 2KGRA 2G2BA 4ORCB 2LV7A 3JVTC 5CSNA 3PLFB 5JOLA 2Y5IA 5CSIA 2KI4C 2ZRTA 4WRIA 2BL0B 2PVBA 4F0ZB 3FS7A 2LM5A 3HX4A 3DD4A 2PRUA 1UHKA 1KFXS 3CZTX 1QV1A 1ALVA 5DKQA 5AFPA 2JWWA 1H4BA 1K2HA 1KWOB 1IGVA 2PMYA 1RWYA 2GGZA 2PSRA 3EVUA 2WOSA 3BUWB 2KYCA 3EK8A 3KPXA 5DKRA 1NX2A 1DMOA 1EJ3A 2GGMA 4GGFA 4N1GA 1BMOA 4I5LB 1B8RA 3SG7A 2H61A 1DF0A 1LKJA 1MXLC 1QS7A 3BYAA 2M1UA 3FWBA 2Y1NA 2BBMA 3I5IC 1NSHA 3O78A 1NCXA 1SYMA 4C0KA 3GK1A 2L0PA 2F8PA 1WRZA 1IRJA 1QJTA 2OS8C 2G9BA 2ZKMX 5I2QA 2F2PA 2WORA 1QV0A 2AAOA 1UP5A 4MSPA 1TNWA 2OTGC 2F2OA 1CLBA 1KFXL 1M46A 2KHNA 2M0RA 3JVTB 4PHMA 1DF0B 3NSIA 1QASA 2LMUA 4MZLA 1TCOB 3CLNA 2OPOA 1ZUZA 1OOJA 1NUBA 1JFKA 5CPVA 4YGAA 1SK6D 2EGDA 2KGBC 4MEWA 2K7OA 4ZCUA 2JOJA 1LINA 1QVIZ 1CMFA 1CDMA 2L5XB 1BR1B 2O5GA 1TNPA 1IKUA 1S6CA 1KQMB 1KK8C 4GUKA 1YUTA 3WHUB 4YRUA 2KFHA 2LP3A 3HCMA 1IQ5A 3TDIA 4DCKA 1K94A 3KEVA 2LVKA 3PFVA 1S1EA 1YRUB 4N1FA 5D69A 1RFJA 3TZ1A 2L2EA 3CWGA 2M8UA 1A29A 3ZWHA 2KI6C 3CTNA 3I5FB 2LANA 1TCFA 1TNQA 4AQIA 3SG3A 5AERA 3OHMB 1IG5A 1R2UA 2F3YA 2L4HA 1BU3A 1QXPA 4WQ3A 3JTDB 4NDCA 2P6BB 1SKTA 1EXRA 2AMIA 3DF0A 1J7QA 2JXLA 1YVLA 2JU0A 1FI6A 3LL8B 2JT8A 1AVSA 1K9KA 2ZFDA 1CDLA 2HQ8A 1XFWO 1RK9A 1WRKA 1DJIA 1G33A 2BL0C 4ZCVA 1ZACA 2BCBA 3TDUA 1M63B 1QLSA 1F55A 1JC2A 2PALA 3O2PA 1YUUA 3DVJA 3EK7A 2Q4UA 1CFFA 1JWDA 5CSJA 3BUXB 1M45A 1KWOC 4HRGA 1QVIY 1CDNA 1V1FA 2KI6D 3EVRA 3DF0B 1S36A 2JT3A 4C0JA 1ZOTB 3SG6A 1UWOA 4OVNF 1WRLA 3CS1A 2JNXA 1K95A 1QX5B 3SIAA 2LLTA 1SRAA 2MA2A 1M39A 1FI5A 1B8LA 3EKHA 4NQGA 1C07A 1WLZA 1PK0D 2CXJA 1KSOA 4DRWA 1IWQA 1CM1A 2LUXA 1XK4A 2K2FA 1N2DA 3BUOB 1KQVA 4AQJA 2HPSA 3WNXB 2KBMA 4R1EA 5ER4X 1TN4A 1CNPA 1PVBA 1L7ZA 1EG4A 4PE0A 4GGFC 2CT9A 1S5GZ 1Y1XA 2H61C 1DT7B 3EKJA 1ALWA 2CNPA 3OX5A 1K90D 5FYXA 1NCYA 1AJ5A 2CTNA 2M7LA 3WXAA 1TOPA 1XFZO 1GJYA 1KFUS 1SL7A 2K7BA 1Y6WA 1G8IA 5IBWA 2CCMA 1CLLA 4CLNA 1KK7Z 1RTP1 5TNCA 2BKHB 4PHJA 1KQMC 1XO5A 2SASA 2E6WA 1CFDA 1E8AA 1YX7A 3OB1B 3CR4X 3F45A 5GQQC 4P5OE 1F71A 2K2AA 1J7PA 1K9UA 1L2OB 1VRKA 2JQ6A 4M2OA 3KF9A 4YBHB 5DKNA 5B8IB 1S3PA 3RLZA 1SL8A 2BE4A 2FCDA 3BXKA 1UHNA 4ORBB 3QRXA 2MBXA 5JJGA 2HQWA 1JF0A 1S6IA 1DJXA 2ZRSA 2CBLA 3I5FC 3MSEB 2BECA 3ICBA 2KBIA 2LLUA 3ZNIA 3OX6A 1ZMZA 4OV2A 1JFJA 3VROA 1KFUL 4PHNA 3JTDC 5AANA 4QJ3B 3D10A 1UHJA 4M2QA 3NSLA 1OQPA 1DJYA 2I18A 3DVEA 1OZOA 2MAZA 3PM8A 2EC6B 1S5GY 2HF5A 1Y1UA 2Y4QA 4YGCB 4A4BA 1TIZA 1NX3A 3TUYB 2LVIA 4BY4A 1M31A 4OKHA 3CR5X 2M9GA 3LK1A 2JRFA 1J1DA 1NCZA 3I5GB 1QX7A 2BCAA 1DJZA 1LA0A 5I2OA 5I8NA 1F8HA 1KK7Y 2MLEC 2MHHA 1SY9A 1OMDA 3O6BA 4NDDA 4XYNA 2AUCA 2QACA 1BG1A 2NLNA 3EVVA 4IL1A 1B1GA 1RJVA 1LXFC 4YGBB 1WY9A 1NPQA 3AAJA 1SCVA 1BLQA 2A4JA 3SG4A 1YRTB 1HT9A 3BQ3A 1S6JA 4BY5A 1MQ1A 2KAYA 1C7WA 4GAOA 1A03A 3GK2A 1DGVA 1QIVA 2JULA 1BODA 2F33A 3C1VA 1DVIA 1J7OA 4L9MA 3PN7B 5D7FA 2LVJA 1JUOA 1NIWA 4XJKA 3CGAA 1PSBA 5AXIA 1XFUO 2KAVA 4DIRA 2K61A 4YGEB 1IJ5A 3E3RA 2F3ZA 2KYFA 5ER5A 3NSKA 1BT6A 3TDZA 1AK8A 1B8CA 4GPLB 3A8RA 1WDCB 1SNLA 1XK4C 2WCFA 2JXCA 2M29A 2WCBA 3KHEA 4PE7A 1C7VA 2JC2A 3I5HB 2Y1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BE6 A;  2LC5 A;  1S26 D;  3BOW A;  1B7T Z;  1LA3 A;  3PSR A;  4XJK B;  1ODB A;  1MR8 A;  4YGD B;  1LVC D;  4E68 A;  1J7R A;  1NYA A;  2M49 B;  2ZND A;  1OZS A;  1FBV A;  1PRW A;  1L2O C;  1X02 A;  1Y0V H;  4I5K A;  4FQO A;  3VRR A;  2KQY A;  2VRG A;  4MBE A;  1KSM A;  4JPZ B;  4HSZ A;  3D0Y A;  3OP0 A;  1KCY A;  4MZK A;  1GGW A;  4PDZ A;  1PSR A;  2ZN8 A;  2KFF A;  1NP8 A;  2NCO A;  3DVK A;  3EK4 A;  3O4Y A;  1W7J B;  2LHL A;  4OCI A;  3IQQ A;  2NXQ A;  1QLK A;  1FPW A;  2LMT A;  3GK4 X;  2LLS A;  5F6T A;  4GBA A;  2K7D A;  1EL4 A;  1MHO A;  1AP4 A;  3VRP A;  1N0Y A;  1DGU A;  2R2I A;  1TRF A;  3H4S E;  2EC6 C;  2FCE A;  1UHI A;  2MRD A;  3D0Y B;  3TUY C;  1H8B A;  5J3X A;  1K96 A;  1G4Y R;  2ZN9 A;  4MZJ A;  1TTX A;  3FIA A;  1CMG A;  3OB2 B;  3LK0 A;  3I5G C;  2WND A;  1F4O A;  3K21 A;  1IH0 A;  4FTG A;  1J1E A;  1FW4 A;  2SCP A;  2LVV A;  5HLV A;  1B7T Y;  1XA5 A;  2JTZ A;  4A4C A;  3PAT A;  4GGN A;  1JSA A;  4CPV A;  1BOC A;  1PVA A;  4MLW A;  2BKI B;  1A2X A;  4N5X A;  3SJS A;  3VRQ A;  1WLM A;  4MRX A;  1GQM A;  5HKY A;  2KQ6 A;  2V53 A;  1NX0 A;  1YTZ C;  4I5J A;  2HET A;  3SIB A;  1HQV A;  1K93 D;  2LP2 A;  2LHI A;  1BF5 A;  1W7I B;  1AJ4 A;  5HKZ A;  2LAP A;  4DS7 A;  1SR6 B;  4GFT A;  3FWC A;  1OMV A;  4OR9 B;  5G08 A;  1F54 A;  1U5I A;  1XVJ A;  5I2L A;  1OMR A;  4YI8 A;  2JPT A;  1QTX A;  3PN7 C;  5KTY A;  4DUQ A;  1CB1 A;  1J55 A;  3SG5 A;  1D1O A;  2L50 A;  1SCM C;  1EG3 A;  2H2K A;  4AOM A;  3CR2 A;  4GNK B;  3LLE A;  1GGZ A;  4PE4 A;  1R6P A;  1MXE A;  1PAL A;  2FJU B;  4ORA B;  5HYD A;  3A4U B;  3LCP C;  4I5N B;  4JWQ A;  5CSF A;  5HLO A;  5HKW A;  3TS5 B;  3NSO A;  1WDC C;  4PE1 A;  3SG2 A;  2LE9 B;  3PAL A;  1IJ6 A;  4P2Y B;  4D1E A;  2WC8 A;  1FF1 A;  1B4C A;  1QX2 A;  5KSZ A;  1A4P A;  3I5H C;  4PAL A;  1YVH A;  2M1K B;  2MJW B;  4QJ5 B;  1IQ3 A;  1U5I B;  1MF8 B;  1SW8 A;  2M3W A;  2WCE A;  2KI4 B;  2PAS A;  4U8D A;  2E30 A;  5PAL A;  2D8N A;  2DOQ A;  4HRE E;  4QJ4 B;  5AEQ A;  1CKK A;  1DJW A;  3IF7 A;  2LNK A;  2GV5 A;  2K8M B;  2BCX A;  4ETO A;  1Q80 A;  1QIW A;  2FOT A;  2KDH A;  4PHK A;  3VGO A;  1NX1 A;  1YUR A;  1JF2 A;  2M7N A;  2NZ0 A;  1ZFS A;  4CFQ A;  2BBN A;  3AKB A;  1MWN A;  2M97 A;  1XFY O;  2Q91 A;  3I5I B;  4CID A;  1SCM B;  2L51 A;  4YI9 A;  1REC A;  2ZNE A;  3BUM B;  1XYD A;  1SL9 A;  1AHR A;  1BR4 B;  1NWD A;  1XFX O;  4PCW A;  3WHT B;  1YX8 A;  2OS8 B;  1A75 A;  4Q04 A;  3BUN B;  4MRY A;  2JTT A;  4MVF A;  2COL B;  3AKA A;  3M0W A;  2OTG B;  1JBA A;  1TNX A;  1YUS A;  2QPT A;  1K8U A;  4WQ2 A;  1CFC A;  1CFP A;  2K7C A;  3NXA A;  1DJH A;  3DVM A;  1QAT A;  4MN0 A;  1SMG A;  1CDP A;  3KO0 A;  1A75 B;  2EHB A;  2KSP A;  2NCP A;  4JQ0 D;  5BPJ A;  1SBJ A;  1XFV O;  2O60 A;  1B47 A;  2I94 A;  2KNE A;  1N65 A;  1OSA A;  1KK8 B;  2IS9 A;  2I7A A;  2JT0 A;  3GOF A;  4NDB A;  2L98 A;  1SPY A;  1UHH A;  1CTR A;  2RGI A;  1UUS A;  1B9A A;  2JZI A;  3BOW B;  1DTL A;  1UUR A;  3IQO A;  2B1U A;  1Y1A A;  1SR6 C;  1OE9 B;  2K0J A;  3AAK A;  1AUI B;  2MLF C;  4M2P A;  4CFR A;  1V1G A;  5K89 A;  5KU1 A;  1EH2 A;  1BJF A;  2I2R E;  2KAX A;  2JNF A;  1CM4 A;  2TN4 A;  3VRN A;  2ISD A;  1K9P A;  2LCP A;  4UPG A;  4C0L A;  3RM1 A;  1F70 A;  4USL A;  1RRO A;  2KFG A;  3TS5 C;  1CLM A;  4TNC A;  1F4Q A;  1YR5 A;  2L4I A;  2LMV A;  4HRH A;  2KOT A;  1MUX A;  4ICB A;  1PUL A;  1DJG A;  2LUC A;  2KGR A;  2G2B A;  4ORC B;  2LV7 A;  3JVT C;  5CSN A;  3PLF B;  5JOL A;  2Y5I A;  5CSI A;  2KI4 C;  2ZRT A;  4WRI A;  2BL0 B;  2PVB A;  4F0Z B;  3FS7 A;  2LM5 A;  3HX4 A;  3DD4 A;  2PRU A;  1UHK A;  1KFX S;  3CZT X;  1QV1 A;  1ALV A;  5DKQ A;  5AFP A;  2JWW A;  1H4B A;  1K2H A;  1KWO B;  1IGV A;  2PMY A;  1RWY A;  2GGZ A;  2PSR A;  3EVU A;  2WOS A;  3BUW B;  2KYC A;  3EK8 A;  3KPX A;  5DKR A;  1NX2 A;  1DMO A;  1EJ3 A;  2GGM A;  4GGF A;  4N1G A;  1BMO A;  4I5L B;  1B8R A;  3SG7 A;  2H61 A;  1DF0 A;  1LKJ A;  1MXL C;  1QS7 A;  3BYA A;  2M1U A;  3FWB A;  2Y1N A;  2BBM A;  3I5I C;  1NSH A;  3O78 A;  1NCX A;  1SYM A;  4C0K A;  3GK1 A;  2L0P A;  2F8P A;  1WRZ A;  1IRJ A;  1QJT A;  2OS8 C;  2G9B A;  2ZKM X;  5I2Q A;  2F2P A;  2WOR A;  1QV0 A;  2AAO A;  1UP5 A;  4MSP A;  1TNW A;  2OTG C;  2F2O A;  1CLB A;  1KFX L;  1M46 A;  2KHN A;  2M0R A;  3JVT B;  4PHM A;  1DF0 B;  3NSI A;  1QAS A;  2LMU A;  4MZL A;  1TCO B;  3CLN A;  2OPO A;  1ZUZ A;  1OOJ A;  1NUB A;  1JFK A;  5CPV A;  4YGA A;  1SK6 D;  2EGD A;  2KGB C;  4MEW A;  2K7O A;  4ZCU A;  2JOJ A;  1LIN A;  1QVI Z;  1CMF A;  1CDM A;  2L5X B;  1BR1 B;  2O5G A;  1TNP A;  1IKU A;  1S6C A;  1KQM B;  1KK8 C;  4GUK A;  1YUT A;  3WHU B;  4YRU A;  2KFH A;  2LP3 A;  3HCM A;  1IQ5 A;  3TDI A;  4DCK A;  1K94 A;  3KEV A;  2LVK A;  3PFV A;  1S1E A;  1YRU B;  4N1F A;  5D69 A;  1RFJ A;  3TZ1 A;  2L2E A;  3CWG A;  2M8U A;  1A29 A;  3ZWH A;  2KI6 C;  3CTN A;  3I5F B;  2LAN A;  1TCF A;  1TNQ A;  4AQI A;  3SG3 A;  5AER A;  3OHM B;  1IG5 A;  1R2U A;  2F3Y A;  2L4H A;  1BU3 A;  1QXP A;  4WQ3 A;  3JTD B;  4NDC A;  2P6B B;  1SKT A;  1EXR A;  2AMI A;  3DF0 A;  1J7Q A;  2JXL A;  1YVL A;  2JU0 A;  1FI6 A;  3LL8 B;  2JT8 A;  1AVS A;  1K9K A;  2ZFD A;  1CDL A;  2HQ8 A;  1XFW O;  1RK9 A;  1WRK A;  1DJI A;  1G33 A;  2BL0 C;  4ZCV A;  1ZAC A;  2BCB A;  3TDU A;  1M63 B;  1QLS A;  1F55 A;  1JC2 A;  2PAL A;  3O2P A;  1YUU A;  3DVJ A;  3EK7 A;  2Q4U A;  1CFF A;  1JWD A;  5CSJ A;  3BUX B;  1M45 A;  1KWO C;  4HRG A;  1QVI Y;  1CDN A;  1V1F A;  2KI6 D;  3EVR A;  3DF0 B;  1S36 A;  2JT3 A;  4C0J A;  1ZOT B;  3SG6 A;  1UWO A;  4OVN F;  1WRL A;  3CS1 A;  2JNX A;  1K95 A;  1QX5 B;  3SIA A;  2LLT A;  1SRA A;  2MA2 A;  1M39 A;  1FI5 A;  1B8L A;  3EKH A;  4NQG A;  1C07 A;  1WLZ A;  1PK0 D;  2CXJ A;  1KSO A;  4DRW A;  1IWQ A;  1CM1 A;  2LUX A;  1XK4 A;  2K2F A;  1N2D A;  3BUO B;  1KQV A;  4AQJ A;  2HPS A;  3WNX B;  2KBM A;  4R1E A;  5ER4 X;  1TN4 A;  1CNP A;  1PVB A;  1L7Z A;  1EG4 A;  4PE0 A;  4GGF C;  2CT9 A;  1S5G Z;  1Y1X A;  2H61 C;  1DT7 B;  3EKJ A;  1ALW A;  2CNP A;  3OX5 A;  1K90 D;  5FYX A;  1NCY A;  1AJ5 A;  2CTN A;  2M7L A;  3WXA A;  1TOP A;  1XFZ O;  1GJY A;  1KFU S;  1SL7 A;  2K7B A;  1Y6W A;  1G8I A;  5IBW A;  2CCM A;  1CLL A;  4CLN A;  1KK7 Z;  1RTP 1;  5TNC A;  2BKH B;  4PHJ A;  1KQM C;  1XO5 A;  2SAS A;  2E6W A;  1CFD A;  1E8A A;  1YX7 A;  3OB1 B;  3CR4 X;  3F45 A;  5GQQ C;  4P5O E;  1F71 A;  2K2A A;  1J7P A;  1K9U A;  1L2O B;  1VRK A;  2JQ6 A;  4M2O A;  3KF9 A;  4YBH B;  5DKN A;  5B8I B;  1S3P A;  3RLZ A;  1SL8 A;  2BE4 A;  2FCD A;  3BXK A;  1UHN A;  4ORB B;  3QRX A;  2MBX A;  5JJG A;  2HQW A;  1JF0 A;  1S6I A;  1DJX A;  2ZRS A;  2CBL A;  3I5F C;  3MSE B;  2BEC A;  3ICB A;  2KBI A;  2LLU A;  3ZNI A;  3OX6 A;  1ZMZ A;  4OV2 A;  1JFJ A;  3VRO A;  1KFU L;  4PHN A;  3JTD C;  5AAN A;  4QJ3 B;  3D10 A;  1UHJ A;  4M2Q A;  3NSL A;  1OQP A;  1DJY A;  2I18 A;  3DVE A;  1OZO A;  2MAZ A;  3PM8 A;  2EC6 B;  1S5G Y;  2HF5 A;  1Y1U A;  2Y4Q A;  4YGC B;  4A4B A;  1TIZ A;  1NX3 A;  3TUY B;  2LVI A;  4BY4 A;  1M31 A;  4OKH A;  3CR5 X;  2M9G A;  3LK1 A;  2JRF A;  1J1D A;  1NCZ A;  3I5G B;  1QX7 A;  2BCA A;  1DJZ A;  1LA0 A;  5I2O A;  5I8N A;  1F8H A;  1KK7 Y;  2MLE C;  2MHH A;  1SY9 A;  1OMD A;  3O6B A;  4NDD A;  4XYN A;  2AUC A;  2QAC A;  1BG1 A;  2NLN A;  3EVV A;  4IL1 A;  1B1G A;  1RJV A;  1LXF C;  4YGB B;  1WY9 A;  1NPQ A;  3AAJ A;  1SCV A;  1BLQ A;  2A4J A;  3SG4 A;  1YRT B;  1HT9 A;  3BQ3 A;  1S6J A;  4BY5 A;  1MQ1 A;  2KAY A;  1C7W A;  4GAO A;  1A03 A;  3GK2 A;  1DGV A;  1QIV A;  2JUL A;  1BOD A;  2F33 A;  3C1V A;  1DVI A;  1J7O A;  4L9M A;  3PN7 B;  5D7F A;  2LVJ A;  1JUO A;  1NIW A;  4XJK A;  3CGA A;  1PSB A;  5AXI A;  1XFU O;  2KAV A;  4DIR A;  2K61 A;  4YGE B;  1IJ5 A;  3E3R A;  2F3Z A;  2KYF A;  5ER5 A;  3NSK A;  1BT6 A;  3TDZ A;  1AK8 A;  1B8C A;  4GPL B;  3A8R A;  1WDC B;  1SNL A;  1XK4 C;  2WCF A;  2JXC A;  2M29 A;  2WCB A;  3KHE A;  4PE7 A;  1C7V A;  2JC2 A;  3I5H B;  2Y1M A; 
#chains in the Genus database with same CATH topology
 2BE6 A;  2LC5 A;  3S0G A;  1S26 D;  3EG5 B;  3BOW A;  1B7T Z;  1LA3 A;  3PSR A;  4XJK B;  1ODB A;  1MR8 A;  4YGD B;  1LVC D;  4E68 A;  1J7R A;  1NYA A;  2M49 B;  2ZND A;  1OZS A;  1FBV A;  1PRW A;  1L2O C;  1X02 A;  1Y0V H;  4I5K A;  4FQO A;  3DXL A;  3VRR A;  2KQY A;  2VRG A;  4MBE A;  1KSM A;  4JPZ B;  4HSZ A;  3D0Y A;  3OP0 A;  1KCY A;  4MZK A;  1GGW A;  4PDZ A;  1PSR A;  2ZN8 A;  2KFF A;  1NP8 A;  3SS4 A;  2NCO A;  3DVK A;  3EK4 A;  3O4Y A;  1W7J B;  1DEL A;  3D75 A;  2LHL A;  4OCI A;  3IQQ A;  3R72 A;  2H8V A;  2NXQ A;  1QLK A;  3RZS A;  1FPW A;  2LMT A;  3GK4 X;  2LLS A;  5F6T A;  4GBA A;  2K7D A;  3V2L A;  1EL4 A;  1MHO A;  1AP4 A;  3VRP A;  1N0Y A;  1DGU A;  2R2I A;  1TRF A;  3H4S E;  2EC6 C;  2FCE A;  4INX A;  1UHI A;  2MRD A;  3D0Y B;  3TUY C;  1H8B A;  5J3X A;  1K96 A;  1G4Y R;  2ZN9 A;  4MZJ A;  1TTX A;  3FIA A;  1CMG A;  3OB2 B;  3LK0 A;  3I5G C;  4IJ7 A;  2WND A;  1F4O A;  3K21 A;  1IH0 A;  4FTG A;  1J1E A;  1FW4 A;  2SCP A;  2LVV A;  4INW A;  5HLV A;  1B7T Y;  1XA5 A;  2JTZ A;  4A4C A;  3PAT A;  4GGN A;  2WC6 A;  4CPV A;  1JSA A;  1BOC A;  1PVA A;  4MLW A;  2BKI B;  3CZ0 A;  1A2X A;  4N5X A;  3SJS A;  3VRQ A;  1WLM A;  4MRX A;  1GQM A;  5HKY A;  2KQ6 A;  2V53 A;  2K60 A;  1NX0 A;  1YTZ C;  4I5J A;  3PJI A;  2HET A;  3SIB A;  1HQV A;  1K93 D;  2LP2 A;  2LHI A;  1BF5 A;  1W7I B;  2QDI A;  1AJ4 A;  3D77 A;  5HKZ A;  2LAP A;  4DS7 A;  2WCL A;  1SR6 B;  4GFT A;  3FWC A;  1OMV A;  4OR9 B;  5G08 A;  1F54 A;  1U5I A;  1XVJ A;  5I2L A;  1OMR A;  4YI8 A;  2JPT A;  3B86 A;  1QTX A;  1QWV A;  3PN7 C;  4DUQ A;  3D73 A;  5KTY A;  1CB1 A;  1J55 A;  2WCK A;  3SG5 A;  1D1O A;  2L50 A;  1SCM C;  1EG3 A;  1Z4H A;  2H2K A;  4AOM A;  3CR2 A;  4GNK B;  3LLE A;  1GGZ A;  4PE4 A;  1R6P A;  1MXE A;  1PAL A;  2FJU B;  4ORA B;  5HYD A;  3A4U B;  3LCP C;  4I5N B;  4JWQ A;  5CSF A;  5HLO A;  5HKW A;  3TS5 B;  1XFR A;  3NSO A;  1WDC C;  4PE1 A;  3SG2 A;  2LE9 B;  3PAL A;  1IJ6 A;  4P2Y B;  4D1E A;  2WC8 A;  3S0D A;  1FF1 A;  1B4C A;  1QX2 A;  5KSZ A;  1A4P A;  3I5H C;  4PAL A;  1YVH A;  2M1K B;  2MJW B;  4QJ5 B;  1IQ3 A;  1U5I B;  1MF8 B;  1SW8 A;  2M3W A;  2WCE A;  2KI4 B;  2PAS A;  4U8D A;  2E30 A;  5PAL A;  2D8N A;  2DOQ A;  4HRE E;  4QJ4 B;  5AEQ A;  1CKK A;  1DJW A;  3S0F A;  3B7A A;  2WCH A;  3IF7 A;  2LNK A;  2GV5 A;  5EL2 A;  3CAB A;  2K8M B;  1TUZ A;  2BCX A;  4ETO A;  1Q80 A;  3B88 A;  2L5Y A;  1QIW A;  2FOT A;  2KDH A;  4PHK A;  3VGO A;  1NX1 A;  1YUR A;  1JF2 A;  2M7N A;  2NZ0 A;  1Z2C B;  1ZFS A;  3FE9 A;  2BBN A;  4CFQ A;  3AKB A;  1MWN A;  2M97 A;  1XFY O;  2Q91 A;  3I5I B;  4CID A;  1SCM B;  2L51 A;  4YI9 A;  1REC A;  2ZNE A;  3BUM B;  1XYD A;  1SL9 A;  1AHR A;  1BR4 B;  1NWD A;  1XFX O;  4PCW A;  3WHT B;  1ORG A;  1YX8 A;  1IIO A;  3QME A;  2OS8 B;  1A75 A;  1OOF A;  4Q04 A;  1OOI X;  3BUN B;  4MRY A;  2JTT A;  3D76 A;  4MVF A;  2COL B;  2FJY A;  3AKA A;  3M0W A;  2OTG B;  1JBA A;  1TNX A;  1YUS A;  2QPT A;  1K8U A;  3FE6 A;  1C3Z A;  4WQ2 A;  1CFC A;  3Q8I A;  1CFP A;  2K7C A;  3NXA A;  5FI2 A;  1DJH A;  3DVM A;  2PYQ A;  1QAT A;  4MN0 A;  1SMG A;  3BFA A;  2QEO A;  2L2C A;  2ERB A;  3BFB A;  1CDP A;  3KO0 A;  3DY9 A;  1A75 B;  3O4X A;  2EHB A;  2KSP A;  2NCP A;  4JQ0 D;  3UNW A;  5BPJ A;  1SBJ A;  1XFV O;  3NHT A;  2O60 A;  1B47 A;  2I94 A;  2KNE A;  1N65 A;  1OSA A;  1KK8 B;  3OGN A;  2IS9 A;  2I7A A;  2JT0 A;  3GOF A;  4NDB A;  2L98 A;  1SPY A;  3B87 A;  1UHH A;  1CTR A;  2RGI A;  1UUS A;  1B9A A;  2JZI A;  3BOW B;  3L47 A;  1DTL A;  1UUR A;  3IQO A;  2B1U A;  1Y1A A;  1SR6 C;  1OE9 B;  2K0J A;  3AAK A;  3CYZ A;  1AUI B;  2MLF C;  4M2P A;  4CFR A;  1V1G A;  5K89 A;  5KU1 A;  3N7H A;  1EH2 A;  1BJF A;  2I2R E;  2KAX A;  2JNF A;  1CM4 A;  2TN4 A;  3VRN A;  2ISD A;  1SSE B;  1K9P A;  2LCP A;  4UPG A;  4C0L A;  3RM1 A;  1F70 A;  4USL A;  1RRO A;  3BJH A;  2KFG A;  3TS5 C;  3UO9 A;  1CLM A;  3DYE A;  1F4Q A;  1YR5 A;  2L4I A;  4TNC A;  2LMV A;  4HRH A;  2KOT A;  1MUX A;  4ICB A;  1PUL A;  1DJG A;  2LUC A;  2KGR A;  2G2B A;  4ORC B;  2LV7 A;  3JVT C;  5CSN A;  3PLF B;  5JOL A;  1P28 A;  2Y5I A;  2KI4 C;  2ZRT A;  4WRI A;  2BL0 B;  2PVB A;  3K1E A;  5CSI A;  3FS7 A;  2LM5 A;  3HX4 A;  4F0Z B;  3DD4 A;  2PRU A;  3B6X A;  1UHK A;  1KFX S;  3CZT X;  1QV1 A;  1ALV A;  5DKQ A;  5AFP A;  2JWW A;  1H4B A;  1K2H A;  1KWO B;  3BFH A;  1IGV A;  2PMY A;  1RWY A;  2GGZ A;  2PSR A;  1LS8 A;  3EVU A;  2WOS A;  3BUW B;  1OOG A;  2KYC A;  3EK8 A;  3KPX A;  1NX2 A;  5DKR A;  1EJ3 A;  2GGM A;  1DC1 A;  1DMO A;  4GGF A;  4N1G A;  1BMO A;  4I5L B;  1B8R A;  3SG7 A;  2H61 A;  1DF0 A;  1LKJ A;  1MXL C;  1QS7 A;  3BYA A;  2M1U A;  3FWB A;  2Y1N A;  2BBM A;  3I5I C;  1NSH A;  3O78 A;  1NCX A;  1SYM A;  4C0K A;  2QEV A;  2KLD A;  3GK1 A;  2L0P A;  3FE8 A;  2F8P A;  1WRZ A;  3S0A A;  3D78 A;  1IRJ A;  1QJT A;  2OS8 C;  2G9B A;  2BAP A;  2ZKM X;  5I2Q A;  2F2P A;  2WOR A;  1QV0 A;  2AAO A;  1UP5 A;  4MSP A;  1TNW A;  2OTG C;  2F2O A;  1CLB A;  1KFX L;  1M46 A;  2KHN A;  2M0R A;  3JVT B;  3L4A A;  4PHM A;  1DF0 B;  3NSI A;  1QAS A;  2LMU A;  4MZL A;  1TCO B;  3CLN A;  2OPO A;  1ZUZ A;  2YGU A;  1OOJ A;  1NUB A;  1JFK A;  5CPV A;  4YGA A;  1SK6 D;  2EGD A;  2KGB C;  4MEW A;  2K7O A;  2P70 A;  4ZCU A;  1TUJ A;  2JOJ A;  1LIN A;  3R1P A;  1QVI Z;  1CMF A;  1CDM A;  2L5X B;  1BR1 B;  2O5G A;  1TNP A;  1IKU A;  1S6C A;  1KQM B;  2JPO A;  1KK8 C;  4GUK A;  1YUT A;  3WHU B;  4YRU A;  2KFH A;  2QEH A;  2LP3 A;  3HCM A;  1IQ5 A;  3TDI A;  4DCK A;  1K94 A;  3KEV A;  2LVK A;  1DQE A;  3PFV A;  1S1E A;  1YRU B;  1OW4 A;  4N1F A;  5D69 A;  1RFJ A;  3TZ1 A;  2L2E A;  5I94 A;  3CWG A;  3S0E A;  2M8U A;  3DZT A;  1A29 A;  3ZWH A;  2KI6 C;  3CTN A;  3I5F B;  2LAN A;  1TCF A;  1TNQ A;  4AQI A;  3SG3 A;  5AER A;  3OHM B;  1IG5 A;  1R2U A;  2F3Y A;  3NGV A;  2L4H A;  1BU3 A;  1QXP A;  4WQ3 A;  3JTD B;  4NDC A;  2P6B B;  1SKT A;  1EXR A;  2AMI A;  3DF0 A;  3S0B A;  1J7Q A;  2JXL A;  1YVL A;  2JU0 A;  1FI6 A;  3LL8 B;  2JT8 A;  1AVS A;  3NHI A;  1K9K A;  2ZFD A;  4FQT A;  1CDL A;  2HQ8 A;  5FI6 A;  4OZD A;  1XFW O;  1RK9 A;  1WRK A;  1DJI A;  1G33 A;  2BL0 C;  4ZCV A;  3VB1 A;  3SS3 A;  1DEK A;  1ZAC A;  2BCB A;  3TDU A;  1M63 B;  1QLS A;  1F55 A;  1JC2 A;  2PAL A;  3O2P A;  1YUU A;  3DVJ A;  3EK7 A;  2Q4U A;  1CFF A;  1JWD A;  5CSJ A;  1T14 A;  3BUX B;  1M45 A;  1KWO C;  4HRG A;  1QVI Y;  1CDN A;  1V1F A;  2KI6 D;  3EVR A;  3DF0 B;  1S36 A;  2JT3 A;  4C0J A;  1ZOT B;  2BNX A;  3SG6 A;  1UWO A;  4OVN F;  1WRL A;  3CS1 A;  2JNX A;  1K95 A;  1QX5 B;  3SIA A;  1C3Y A;  2LLT A;  1SRA A;  2MA2 A;  1M39 A;  1FI5 A;  1B8L A;  4JKT A;  3EKH A;  4NQG A;  1C07 A;  1WLZ A;  1PK0 D;  2CXJ A;  1KSO A;  4DRW A;  1IWQ A;  1CM1 A;  2LUX A;  1XK4 A;  2K2F A;  1N2D A;  3BUO B;  1KQV A;  4AQJ A;  2HPS A;  5HL1 A;  3WNX B;  2KBM A;  4R1E A;  5ER4 X;  1TN4 A;  4PT1 A;  3D74 A;  1CNP A;  1PVB A;  1L7Z A;  1EG4 A;  4PE0 A;  4GGF C;  2CT9 A;  1S5G Z;  1Y1X A;  3L4L A;  2H61 C;  1DT7 B;  3EKJ A;  1ALW A;  2CNP A;  3OX5 A;  1K90 D;  5FYX A;  1NCY A;  1AJ5 A;  2CTN A;  2M7L A;  3WXA A;  1TOP A;  1XFZ O;  1GJY A;  1KFU S;  1OOH A;  1SL7 A;  2K7B A;  1Y6W A;  1G8I A;  5IBW A;  2CCM A;  2KPH A;  1CLL A;  3PM2 A;  4CLN A;  1KK7 Z;  1RTP 1;  5TNC A;  2BKH B;  4PHJ A;  1KQM C;  1XO5 A;  2SAS A;  2E6W A;  1CFD A;  1E8A A;  1YX7 A;  3OB1 B;  3CR4 X;  3F45 A;  5GQQ C;  4P5O E;  1F71 A;  1GM0 A;  2WCM A;  2K2A A;  3R1V A;  1J7P A;  1K9U A;  1L2O B;  1VRK A;  2JQ6 A;  4M2O A;  3KF9 A;  4YBH B;  5DKN A;  5B8I B;  1S3P A;  3R1O A;  3RLZ A;  1SL8 A;  2BE4 A;  2FCD A;  2PQL A;  3BXK A;  1UHN A;  4ORB B;  3QRX A;  2MBX A;  5JJG A;  2HQW A;  1JF0 A;  1S6I A;  1DJX A;  2WCJ A;  2ZRS A;  2CBL A;  3I5F C;  3CZ1 A;  3MSE B;  1TWO A;  5D3O A;  2BEC A;  3ICB A;  2KBI A;  2LLU A;  5FI7 A;  3OX6 A;  1ZMZ A;  4OV2 A;  3ZNI A;  1JFJ A;  3VRO A;  1KFU L;  4PHN A;  3JTD C;  5AAN A;  4QJ3 B;  3D10 A;  1UHJ A;  4M2Q A;  3NSL A;  2QEB A;  1OQP A;  1DJY A;  2I18 A;  3DVE A;  1OZO A;  2MAZ A;  3PM8 A;  2EC6 B;  1S5G Y;  2HF5 A;  1Y1U A;  2Y4Q A;  4YGC B;  4A4B A;  2GTE A;  1TIZ A;  1NX3 A;  3TUY B;  4JD9 A;  2WC5 A;  2LVI A;  4BY4 A;  3OBV A;  1M31 A;  4OKH A;  3CR5 X;  2M9G A;  3LK1 A;  2JRF A;  1J1D A;  4F7F A;  1NCZ A;  3I5G B;  1QX7 A;  2BCA A;  1DJZ A;  1LA0 A;  1W9Z A;  3CZ2 A;  5I2O A;  5I8N A;  1F8H A;  1KK7 Y;  2MLE C;  2MHH A;  1SY9 A;  3SS5 A;  1OMD A;  3O6B A;  4KYN A;  4NDD A;  4XYN A;  2AUC A;  2QAC A;  1BG1 A;  2NLN A;  3EVV A;  4IL1 A;  1B1G A;  1RJV A;  1LXF C;  3CDN A;  4YGB B;  1WY9 A;  1NPQ A;  3AAJ A;  3IVT A;  1SCV A;  1BLQ A;  2A4J A;  3SG4 A;  1YRT B;  1HT9 A;  3BQ3 A;  1S6J A;  2KLE A;  4BY5 A;  5DIC A;  1MQ1 A;  2KAY A;  1C7W A;  4GAO A;  1A03 A;  3GK2 A;  1DGV A;  1QIV A;  2JUL A;  1BOD A;  2P71 A;  2F33 A;  3C1V A;  1DVI A;  1J7O A;  4L9M A;  3PN7 B;  5D7F A;  2LVJ A;  1JUO A;  1NIW A;  4XJK A;  3CGA A;  1PSB A;  5AXI A;  1XFU O;  2KAV A;  4DIR A;  2K61 A;  4YGE B;  1IJ5 A;  3E3R A;  2F3Z A;  2KYF A;  5ER5 A;  3NSK A;  1BT6 A;  3TDZ A;  1AK8 A;  1B8C A;  4GPL B;  3A8R A;  1WDC B;  1SNL A;  1XK4 C;  2WCF A;  2JXC A;  2M29 A;  2WCB A;  3KHE A;  4PE7 A;  1C7V A;  2JC2 A;  3I5H B;  2Y1M A; 
#chains in the Genus database with same CATH homology
 2BE6 A;  2LC5 A;  1S26 D;  3BOW A;  1B7T Z;  1LA3 A;  3PSR A;  4XJK B;  1ODB A;  1MR8 A;  4YGD B;  1LVC D;  4E68 A;  1J7R A;  1NYA A;  2M49 B;  2ZND A;  1OZS A;  1FBV A;  1PRW A;  1L2O C;  1X02 A;  1Y0V H;  4I5K A;  4FQO A;  3VRR A;  2KQY A;  2VRG A;  4MBE A;  1KSM A;  4JPZ B;  4HSZ A;  3D0Y A;  3OP0 A;  1KCY A;  4MZK A;  1GGW A;  4PDZ A;  1PSR A;  2ZN8 A;  2KFF A;  1NP8 A;  2NCO A;  3DVK A;  3EK4 A;  3O4Y A;  1W7J B;  2LHL A;  4OCI A;  3IQQ A;  2NXQ A;  1QLK A;  1FPW A;  2LMT A;  3GK4 X;  2LLS A;  5F6T A;  4GBA A;  2K7D A;  1EL4 A;  1MHO A;  1AP4 A;  3VRP A;  1N0Y A;  1DGU A;  2R2I A;  1TRF A;  3H4S E;  2EC6 C;  2FCE A;  1UHI A;  2MRD A;  3D0Y B;  3TUY C;  1H8B A;  5J3X A;  1K96 A;  1G4Y R;  2ZN9 A;  4MZJ A;  1TTX A;  3FIA A;  1CMG A;  3OB2 B;  3LK0 A;  3I5G C;  2WND A;  1F4O A;  3K21 A;  1IH0 A;  4FTG A;  1J1E A;  1FW4 A;  2SCP A;  2LVV A;  5HLV A;  1B7T Y;  1XA5 A;  2JTZ A;  4A4C A;  3PAT A;  4GGN A;  1JSA A;  4CPV A;  1BOC A;  1PVA A;  4MLW A;  2BKI B;  1A2X A;  4N5X A;  3SJS A;  3VRQ A;  1WLM A;  4MRX A;  1GQM A;  5HKY A;  2KQ6 A;  2V53 A;  1NX0 A;  1YTZ C;  4I5J A;  2HET A;  3SIB A;  1HQV A;  1K93 D;  2LP2 A;  2LHI A;  1BF5 A;  1W7I B;  1AJ4 A;  5HKZ A;  2LAP A;  4DS7 A;  1SR6 B;  4GFT A;  3FWC A;  1OMV A;  4OR9 B;  5G08 A;  1F54 A;  1U5I A;  1XVJ A;  5I2L A;  1OMR A;  4YI8 A;  2JPT A;  1QTX A;  3PN7 C;  5KTY A;  4DUQ A;  1CB1 A;  1J55 A;  3SG5 A;  1D1O A;  2L50 A;  1SCM C;  1EG3 A;  2H2K A;  4AOM A;  3CR2 A;  4GNK B;  3LLE A;  1GGZ A;  4PE4 A;  1R6P A;  1MXE A;  1PAL A;  2FJU B;  4ORA B;  5HYD A;  3A4U B;  3LCP C;  4I5N B;  4JWQ A;  5CSF A;  5HLO A;  5HKW A;  3TS5 B;  3NSO A;  1WDC C;  4PE1 A;  3SG2 A;  2LE9 B;  3PAL A;  1IJ6 A;  4P2Y B;  4D1E A;  2WC8 A;  1FF1 A;  1B4C A;  1QX2 A;  5KSZ A;  1A4P A;  3I5H C;  4PAL A;  1YVH A;  2M1K B;  2MJW B;  4QJ5 B;  1IQ3 A;  1U5I B;  1MF8 B;  1SW8 A;  2M3W A;  2WCE A;  2KI4 B;  2PAS A;  4U8D A;  2E30 A;  5PAL A;  2D8N A;  2DOQ A;  4HRE E;  4QJ4 B;  5AEQ A;  1CKK A;  1DJW A;  3IF7 A;  2LNK A;  2GV5 A;  2K8M B;  2BCX A;  4ETO A;  1Q80 A;  1QIW A;  2FOT A;  2KDH A;  4PHK A;  3VGO A;  1NX1 A;  1YUR A;  1JF2 A;  2M7N A;  2NZ0 A;  1ZFS A;  4CFQ A;  2BBN A;  3AKB A;  1MWN A;  2M97 A;  1XFY O;  2Q91 A;  3I5I B;  4CID A;  1SCM B;  2L51 A;  4YI9 A;  1REC A;  2ZNE A;  3BUM B;  1XYD A;  1SL9 A;  1AHR A;  1BR4 B;  1NWD A;  1XFX O;  4PCW A;  3WHT B;  1YX8 A;  2OS8 B;  1A75 A;  4Q04 A;  3BUN B;  4MRY A;  2JTT A;  4MVF A;  2COL B;  3AKA A;  3M0W A;  2OTG B;  1JBA A;  1TNX A;  1YUS A;  2QPT A;  1K8U A;  4WQ2 A;  1CFC A;  1CFP A;  2K7C A;  3NXA A;  1DJH A;  3DVM A;  1QAT A;  4MN0 A;  1SMG A;  1CDP A;  3KO0 A;  1A75 B;  2EHB A;  2KSP A;  2NCP A;  4JQ0 D;  5BPJ A;  1SBJ A;  1XFV O;  2O60 A;  1B47 A;  2I94 A;  2KNE A;  1N65 A;  1OSA A;  1KK8 B;  2IS9 A;  2I7A A;  2JT0 A;  3GOF A;  4NDB A;  2L98 A;  1SPY A;  1UHH A;  1CTR A;  2RGI A;  1UUS A;  1B9A A;  2JZI A;  3BOW B;  1DTL A;  1UUR A;  3IQO A;  2B1U A;  1Y1A A;  1SR6 C;  1OE9 B;  2K0J A;  3AAK A;  1AUI B;  2MLF C;  4M2P A;  4CFR A;  1V1G A;  5K89 A;  5KU1 A;  1EH2 A;  1BJF A;  2I2R E;  2KAX A;  2JNF A;  1CM4 A;  2TN4 A;  3VRN A;  2ISD A;  1K9P A;  2LCP A;  4UPG A;  4C0L A;  3RM1 A;  1F70 A;  4USL A;  1RRO A;  2KFG A;  3TS5 C;  1CLM A;  4TNC A;  1F4Q A;  1YR5 A;  2L4I A;  2LMV A;  4HRH A;  2KOT A;  1MUX A;  4ICB A;  1PUL A;  1DJG A;  2LUC A;  2KGR A;  2G2B A;  4ORC B;  2LV7 A;  3JVT C;  5CSN A;  3PLF B;  5JOL A;  2Y5I A;  5CSI A;  2KI4 C;  2ZRT A;  4WRI A;  2BL0 B;  2PVB A;  4F0Z B;  3FS7 A;  2LM5 A;  3HX4 A;  3DD4 A;  2PRU A;  1UHK A;  1KFX S;  3CZT X;  1QV1 A;  1ALV A;  5DKQ A;  5AFP A;  2JWW A;  1H4B A;  1K2H A;  1KWO B;  1IGV A;  2PMY A;  1RWY A;  2GGZ A;  2PSR A;  3EVU A;  2WOS A;  3BUW B;  2KYC A;  3EK8 A;  3KPX A;  5DKR A;  1NX2 A;  1DMO A;  1EJ3 A;  2GGM A;  4GGF A;  4N1G A;  1BMO A;  4I5L B;  1B8R A;  3SG7 A;  2H61 A;  1DF0 A;  1LKJ A;  1MXL C;  1QS7 A;  3BYA A;  2M1U A;  3FWB A;  2Y1N A;  2BBM A;  3I5I C;  1NSH A;  3O78 A;  1NCX A;  1SYM A;  4C0K A;  3GK1 A;  2L0P A;  2F8P A;  1WRZ A;  1IRJ A;  1QJT A;  2OS8 C;  2G9B A;  2ZKM X;  5I2Q A;  2F2P A;  2WOR A;  1QV0 A;  2AAO A;  1UP5 A;  4MSP A;  1TNW A;  2OTG C;  2F2O A;  1CLB A;  1KFX L;  1M46 A;  2KHN A;  2M0R A;  3JVT B;  4PHM A;  1DF0 B;  3NSI A;  1QAS A;  2LMU A;  4MZL A;  1TCO B;  3CLN A;  2OPO A;  1ZUZ A;  1OOJ A;  1NUB A;  1JFK A;  5CPV A;  4YGA A;  1SK6 D;  2EGD A;  2KGB C;  4MEW A;  2K7O A;  4ZCU A;  2JOJ A;  1LIN A;  1QVI Z;  1CMF A;  1CDM A;  2L5X B;  1BR1 B;  2O5G A;  1TNP A;  1IKU A;  1S6C A;  1KQM B;  1KK8 C;  4GUK A;  1YUT A;  3WHU B;  4YRU A;  2KFH A;  2LP3 A;  3HCM A;  1IQ5 A;  3TDI A;  4DCK A;  1K94 A;  3KEV A;  2LVK A;  3PFV A;  1S1E A;  1YRU B;  4N1F A;  5D69 A;  1RFJ A;  3TZ1 A;  2L2E A;  3CWG A;  2M8U A;  1A29 A;  3ZWH A;  2KI6 C;  3CTN A;  3I5F B;  2LAN A;  1TCF A;  1TNQ A;  4AQI A;  3SG3 A;  5AER A;  3OHM B;  1IG5 A;  1R2U A;  2F3Y A;  2L4H A;  1BU3 A;  1QXP A;  4WQ3 A;  3JTD B;  4NDC A;  2P6B B;  1SKT A;  1EXR A;  2AMI A;  3DF0 A;  1J7Q A;  2JXL A;  1YVL A;  2JU0 A;  1FI6 A;  3LL8 B;  2JT8 A;  1AVS A;  1K9K A;  2ZFD A;  1CDL A;  2HQ8 A;  1XFW O;  1RK9 A;  1WRK A;  1DJI A;  1G33 A;  2BL0 C;  4ZCV A;  1ZAC A;  2BCB A;  3TDU A;  1M63 B;  1QLS A;  1F55 A;  1JC2 A;  2PAL A;  3O2P A;  1YUU A;  3DVJ A;  3EK7 A;  2Q4U A;  1CFF A;  1JWD A;  5CSJ A;  3BUX B;  1M45 A;  1KWO C;  4HRG A;  1QVI Y;  1CDN A;  1V1F A;  2KI6 D;  3EVR A;  3DF0 B;  1S36 A;  2JT3 A;  4C0J A;  1ZOT B;  3SG6 A;  1UWO A;  4OVN F;  1WRL A;  3CS1 A;  2JNX A;  1K95 A;  1QX5 B;  3SIA A;  2LLT A;  1SRA A;  2MA2 A;  1M39 A;  1FI5 A;  1B8L A;  3EKH A;  4NQG A;  1C07 A;  1WLZ A;  1PK0 D;  2CXJ A;  1KSO A;  4DRW A;  1IWQ A;  1CM1 A;  2LUX A;  1XK4 A;  2K2F A;  1N2D A;  3BUO B;  1KQV A;  4AQJ A;  2HPS A;  3WNX B;  2KBM A;  4R1E A;  5ER4 X;  1TN4 A;  1CNP A;  1PVB A;  1L7Z A;  1EG4 A;  4PE0 A;  4GGF C;  2CT9 A;  1S5G Z;  1Y1X A;  2H61 C;  1DT7 B;  3EKJ A;  1ALW A;  2CNP A;  3OX5 A;  1K90 D;  5FYX A;  1NCY A;  1AJ5 A;  2CTN A;  2M7L A;  3WXA A;  1TOP A;  1XFZ O;  1GJY A;  1KFU S;  1SL7 A;  2K7B A;  1Y6W A;  1G8I A;  5IBW A;  2CCM A;  1CLL A;  4CLN A;  1KK7 Z;  1RTP 1;  5TNC A;  2BKH B;  4PHJ A;  1KQM C;  1XO5 A;  2SAS A;  2E6W A;  1CFD A;  1E8A A;  1YX7 A;  3OB1 B;  3CR4 X;  3F45 A;  5GQQ C;  4P5O E;  1F71 A;  2K2A A;  1J7P A;  1K9U A;  1L2O B;  1VRK A;  2JQ6 A;  4M2O A;  3KF9 A;  4YBH B;  5DKN A;  5B8I B;  1S3P A;  3RLZ A;  1SL8 A;  2BE4 A;  2FCD A;  3BXK A;  1UHN A;  4ORB B;  3QRX A;  2MBX A;  5JJG A;  2HQW A;  1JF0 A;  1S6I A;  1DJX A;  2ZRS A;  2CBL A;  3I5F C;  3MSE B;  2BEC A;  3ICB A;  2KBI A;  2LLU A;  3ZNI A;  3OX6 A;  1ZMZ A;  4OV2 A;  1JFJ A;  3VRO A;  1KFU L;  4PHN A;  3JTD C;  5AAN A;  4QJ3 B;  3D10 A;  1UHJ A;  4M2Q A;  3NSL A;  1OQP A;  1DJY A;  2I18 A;  3DVE A;  1OZO A;  2MAZ A;  3PM8 A;  2EC6 B;  1S5G Y;  2HF5 A;  1Y1U A;  2Y4Q A;  4YGC B;  4A4B A;  1TIZ A;  1NX3 A;  3TUY B;  2LVI A;  4BY4 A;  1M31 A;  4OKH A;  3CR5 X;  2M9G A;  3LK1 A;  2JRF A;  1J1D A;  1NCZ A;  3I5G B;  1QX7 A;  2BCA A;  1DJZ A;  1LA0 A;  5I2O A;  5I8N A;  1F8H A;  1KK7 Y;  2MLE C;  2MHH A;  1SY9 A;  1OMD A;  3O6B A;  4NDD A;  4XYN A;  2AUC A;  2QAC A;  1BG1 A;  2NLN A;  3EVV A;  4IL1 A;  1B1G A;  1RJV A;  1LXF C;  4YGB B;  1WY9 A;  1NPQ A;  3AAJ A;  1SCV A;  1BLQ A;  2A4J A;  3SG4 A;  1YRT B;  1HT9 A;  3BQ3 A;  1S6J A;  4BY5 A;  1MQ1 A;  2KAY A;  1C7W A;  4GAO A;  1A03 A;  3GK2 A;  1DGV A;  1QIV A;  2JUL A;  1BOD A;  2F33 A;  3C1V A;  1DVI A;  1J7O A;  4L9M A;  3PN7 B;  5D7F A;  2LVJ A;  1JUO A;  1NIW A;  4XJK A;  3CGA A;  1PSB A;  5AXI A;  1XFU O;  2KAV A;  4DIR A;  2K61 A;  4YGE B;  1IJ5 A;  3E3R A;  2F3Z A;  2KYF A;  5ER5 A;  3NSK A;  1BT6 A;  3TDZ A;  1AK8 A;  1B8C A;  4GPL B;  3A8R A;  1WDC B;  1SNL A;  1XK4 C;  2WCF A;  2JXC A;  2M29 A;  2WCB A;  3KHE A;  4PE7 A;  1C7V A;  2JC2 A;  3I5H B;  2Y1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...