1J7PA

Solution structure of calcium calmodulin c-terminal domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
67
structure length
67
Chain Sequence
EEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Calmodulin
publication title Solution structure of Ca(2+)-calmodulin reveals flexible hand-like properties of its domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2001-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1j7pA00
3EK7A 2ZN8A 1JC2A 3TDIA 3BUWB 1A75B 1RJVA 1ZOTB 5CSIA 4FTGA 2JWWA 3HCMA 4CFQA 2JTZA 2Y4QA 3O6BA 2PMYA 2Y1NA 3NXAA 2MLFC 4OV2A 1WDCC 1WLMA 1NX3A 5AXIA 1RK9A 2VRGA 2NCOA 3CTNA 3PALA 4GGNA 1EL4A 5CPVA 4JWQA 3BQ3A 2ZNDA 3VGOA 1AJ4A 1A2XA 2HQ8A 1LA3A 3BUXB 1YX8A 1K93D 4DIRA 4MN0A 3BUMB 1WDCB 2NCPA 3I5HC 1K9PA 1J7RA 3OX5A 5DKNA 2PALA 2CCMA 2ZNEA 3A8RA 1Q80A 1JFKA 1B4CA 3VRRA 2LM5A 1OZSA 2L4IA 1DT7B 4NDBA 1M63B 1PVAA 3SG4A 1H4BA 2K8MB 2WNDA 4NDCA 2M7NA 4I5JA 1KK8C 2MHHA 1Y1UA 1B8CA 2F3ZA 3SG7A 3LLEA 5HYDA 4I5KA 3I5HB 1SNLA 2JOJA 1W7JB 1YUTA 1PSRA 2GV5A 2JPTA 2JNFA 3AKAA 5I2OA 1B9AA 4PDZA 5HKYA 2WC8A 1WLZA 3GK2A 3PN7C 4WQ3A 3M0WA 4QJ5B 2Q4UA 1KK8B 4GGFA 1ZMZA 4M2QA 1ALWA 3JVTC 1HQVA 1BLQA 1DTLA 1C07A 1KFUS 3CR2A 4JQ0D 2M8UA 3GOFA 2DOQA 1IQ3A 1F55A 1RWYA 1A03A 1KWOC 1CDMA 2JT8A 1PVBA 2KFGA 3I5GC 3PN7B 1K94A 1B8RA 2K7DA 1DF0A 2LHIA 2FCDA 3JVTB 1N2DA 1G33A 4MLWA 1WRZA 3TUYC 2NXQA 1NX1A 2LP3A 4QJ3B 1WRLA 2OTGC 4DCKA 1JF0A 1KWOB 5KU1A 1BR4B 1MXEA 2CBLA 3I5IC 1OMDA 2JT3A 3IF7A 3F45A 3BXKA 5J3XA 1YUUA 2D8NA 1S5GY 1TCFA 4WQ2A 3OHMB 4YGDB 1RECA 1SCMB 1GGZA 1UP5A 5KTYA 2HETA 1WY9A 1M31A 2LVIA 4QJ4B 1XFUO 2L50A 1G4YR 1K95A 1XVJA 2I18A 2L51A 1RTP1 2B1UA 2OTGB 1Y1AA 3CR4X 5CSJA 1NSHA 3ZWHA 1AJ5A 1J1EA 1IH0A 2KAXA 3O78A 1YRUB 4GFTA 4NDDA 4YGBB 1KQVA 2IS9A 2I94A 4PALA 1QASA 1QV0A 3IQQA 2BL0B 3FIAA 1OOJA 4AQIA 1GGWA 2EGDA 5HKZA 1F8HA 1D1OA 1AUIB 3KF9A 1F4QA 4GUKA 4N1GA 2RGIA 4YI8A 3WNXB 2JU0A 1A4PA 3SIBA 2PRUA 2WCFA 1CM1A 4MVFA 5HLOA 1IJ6A 2HF5A 2LE9B 2K2FA 1S36A 1DVIA 2JRFA 1B47A 1DMOA 3LK0A 3DF0A 3DVEA 3PM8A 1NCXA 1S5GZ 4OVNF 2LUCA 1K90D 1R2UA 2BE4A 4C0KA 4YI9A 3I5FB 1BODA 2H2KA 3TS5B 1KK7Y 1SKTA 3TDZA 1LXFC 2SCPA 2K7BA 4GPLB 1RROA 2GGZA 2E6WA 4MRYA 2MRDA 5JOLA 1CMGA 1CNPA 4NQGA 2LVVA 2LC5A 2JC2A 1SMGA 1V1GA 3LCPC 3DVMA 1QX5B 2BKIB 4HRHA 3SG3A 1SYMA 1BR1B 1CMFA 1QV1A 2LMUA 2M3WA 3CWGA 2F33A 4U8DA 2WOSA 4YBHB 5ER4X 2V53A 2E30A 1BU3A 4HRGA 5AEQA 1CLLA 1OMVA 1K8UA 3VRPA 1F71A 5I8NA 1SR6C 2JQ6A 4PE7A 2KHNA 3D0YA 1QJTA 1TIZA 1DJGA 2KYFA 3VROA 3DVJA 1SPYA 2KQYA 2KOTA 3CGAA 1ZACA 3MSEB 3NSOA 1BG1A 1E8AA 2I7AA 2LVKA 4GGFC 1YTZC 4UPGA 4D1EA 1SR6B 1OQPA 4R1EA 2L0PA 1M46A 3EVVA 1QLKA 3NSLA 2SASA 4MZKA 1FW4A 3NSIA 2BBNA 3GK1A 4DRWA 3EKHA 2KI6C 1MUXA 2TN4A 3EKJA 1DJIA 1K2HA 3BUNB 2KFHA 1UHIA 1IGVA 2NLNA 2LUXA 2O60A 5CSFA 3EK4A 5CSNA 3GK4X 1CFFA 4OCIA 1S6IA 4GBAA 1N0YA 1H8BA 3HX4A 2FOTA 2F3YA 2MJWB 2ZFDA 1XA5A 2K61A 1UURA 2LCPA 4WRIA 2I2RE 2JZIA 3DVKA 4JPZB 1ALVA 1SY9A 4ORBB 1DGUA 3CZTX 1DF0B 5JJGA 2M1UA 1QIWA 2F2PA 1OMRA 3SG6A 1SCMC 4BY5A 3WHUB 1SBJA 5KSZA 3K21A 4CFRA 1CDNA 2MBXA 4AOMA 1XFVO 4PHKA 1TN4A 1J55A 5HLVA 3VRQA 4PCWA 1NYAA 1TNXA 1W7IB 1JUOA 4XJKB 4XJKA 4Q04A 1YRTB 1BT6A 2WORA 3TZ1A 3LL8B 5TNCA 1EG4A 3KPXA 3A4UB 2M1KB 1NIWA 4OKHA 1QATA 1IWQA 1U5IA 5DKRA 1JBAA 2JULA 4ZCVA 2BL0C 4E68A 2AUCA 1SL8A 3PLFB 3OB2B 2LLUA 3SJSA 1YVLA 2BBMA 4USLA 5AANA 1FI6A 2HQWA 1FF1A 2H61A 1QTXA 1CTRA 1LINA 2LLTA 1CFDA 2L98A 3BOWA 1R6PA 1CB1A 4MZLA 3CLNA 2LHLA 1GJYA 1NP8A 1L7ZA 1MF8B 2LMTA 4CPVA 2NZ0A 4OR9B 4YGCB 1XFZO 5FYXA 1UHNA 2LV7A 1G8IA 1SCVA 4ORCB 1ODBA 1C7WA 1UHKA 1S26D 3I5FC 3WXAA 2K0JA 1SK6D 2PASA 4HREE 4M2PA 3CS1A 3TS5C 2F2OA 2L2EA 1TCOB 2L4HA 2R2IA 2ZKMX 3DF0B 4FQOA 2JNXA 2PSRA 1S1EA 2A4JA 4C0JA 2BCAA 5B8IB 2MLEC 1IKUA 4DUQA 2LMVA 2PVBA 2KGRA 4PHMA 2WCEA 1CFPA 2JXLA 2JT0A 1M39A 1S6CA 2JTTA 4ZCUA 1SW8A 1SRAA 3JTDB 1RFJA 4CIDA 3RM1A 2BKHB 2EC6C 5D7FA 4AQJA 2ZRSA 1CLMA 4P5OE 1DJHA 2FJUB 3SG2A 1JWDA 2KBMA 2CT9A 1WRKA 3KO0A 1J7QA 5PALA 4L9MA 3DD4A 1DJXA 1LKJA 1YR5A 2KI6D 4BY4A 1S3PA 2KBIA 1VRKA 3O2PA 4TNCA 2Y1MA 1KFXL 5AFPA 5AERA 1MQ1A 2ISDA 2F8PA 1JSAA 4PE1A 1CKKA 2EC6B 2LVJA 1S6JA 1NCZA 3AAKA 1LA0A 1IG5A 2Y5IA 1GQMA 2JXCA 2M49B 5ER5A 3EK8A 1NPQA 3SIAA 3D0YB 1YUSA 1QS7A 3FWCA 3PSRA 1IQ5A 3C1VA 3PATA 1PRWA 2ZRTA 2K2AA 2QPTA 1A75A 4N1FA 1K96A 1UUSA 3VRNA 1CLBA 2LAPA 3TDUA 1DJYA 1TTXA 1J1DA 1KSOA 4F0ZB 2P6BB 1XYDA 1KK7Z 1XK4A 4GAOA 1F54A 3LK1A 4P2YB 1YVHA 1MHOA 2KSPA 1K9UA 1QLSA 3H4SE 2KQ6A 1Y6WA 2G9BA 1EG3A 2AAOA 2CTNA 3IQOA 4PE0A 2M29A 3NSKA 1NCYA 2GGMA 1BMOA 4ORAB 1NX2A 2MAZA 3AAJA 4PE4A 1BOCA 1FPWA 3OX6A 1NX0A 3PFVA 2Q91A 4PHNA 1EXRA 1CDPA 2BCXA 5F6TA 1J7PA 1V1FA 2KNEA 1LVCD 1TNWA 2K7OA 2BECA 1IJ5A 1QIVA 2CNPA 2OS8C 1N65A 4IL1A 2KAYA 1TNPA 4C0LA 1BF5A 4YGAA 1KQMC 2K7CA 2M97A 3FS7A 1J7OA 5D69A 3EVUA 2KDHA 4HSZA 4ICBA 5GQQC 1AP4A 1C7VA 1XFYO 4I5LB 4M2OA 4YGEB 4A4CA 3D10A 5I2LA 1UWOA 5IBWA 1SL9A 5BPJA 1F70A 1QVIY 1F4OA 2OS8B 1L2OC 1A29A 2KGBC 1CFCA 1KQMB 4ETOA 5DKQA 1MXLC 3QRXA 2FCEA 2H61C 4I5NB 5I2QA 2KAVA 1MWNA 1NUBA 3RLZA 1Y1XA 1PULA 1U5IB 1B7TY 1KFUL 1QX7A 2KYCA 1XFXO 1QX2A 4GNKB 4MBEA 4PHJA 3KEVA 1L2OB 2LLSA 1NWDA 4YRUA 2LP2A 4MZJA 1K9KA 1ZFSA 2OPOA 1DJZA 3AKBA 1OZOA 2WCBA 2LANA 1PK0D 1YURA 3BOWB 1PSBA 4MSPA 1XO5A 4A4BA 3I5GB 3EVRA 2BE6A 4CLNA 5K89A 1UHJA 4DS7A 1ZUZA 2CXJA 1HT9A 2HPSA 1JFJA 5HKWA 1FI5A 1DGVA 1JF2A 2M7LA 3TUYB 1BJFA 5G08A 1Y0VH 1FBVA 1AK8A 2QACA 3BUOB 3CR5X 1TOPA 1QVIZ 2ZN9A 3SG5A 3FWBA 2KFFA 3I5IB 3OP0A 3JTDC 3BYAA 1YX7A 1CDLA 1SL7A 2L5XB 4XYNA 3ZNIA 1AHRA 1B8LA 3ICBA 2LNKA 3OB1B 4MEWA 1IRJA 4N5XA 1B7TZ 1TNQA 3O4YA 1EJ3A 1QXPA 3KHEA 1OE9B 1KFXS 1CM4A 2BCBA 1DJWA 4MRXA 2G2BA 2KI4C 1EH2A 1AVSA 1MR8A 2EHBA 1PALA 1KCYA 2M0RA 1KSMA 3WHTB 2AMIA 1B1GA 1M45A 3E3RA 1OSAA 2O5GA 1TRFA 1X02A 1UHHA 1XFWO 2M9GA 2MA2A 2KI4B 1XK4C 2COLB
chains in the Genus database with same CATH superfamily
3EK7A 2ZN8A 1JC2A 4PT1A 3TDIA 3BUWB 1A75B 1RJVA 1ZOTB 5CSIA 4FTGA 2JWWA 3HCMA 4CFQA 2JTZA 2Y4QA 3O6BA 2PMYA 4OZDA 2Y1NA 3NXAA 1OOHA 2MLFC 4OV2A 1WDCC 1WLMA 1NX3A 5AXIA 1RK9A 2VRGA 5FI7A 2NCOA 3CTNA 3PALA 3L4LA 4GGNA 1EL4A 4INWA 5CPVA 4JWQA 3FE8A 3BQ3A 2ZNDA 3VGOA 1AJ4A 5FI6A 1A2XA 2HQ8A 1LA3A 3BUXB 1YX8A 1K93D 3EG5B 4MN0A 4DIRA 1IIOA 3BUMB 1WDCB 3D77A 2NCPA 5HL1A 3I5HC 1K9PA 1J7RA 3OX5A 5DKNA 2PALA 2CCMA 2WCLA 2ERBA 2ZNEA 3A8RA 1Q80A 1JFKA 1B4CA 3VRRA 2LM5A 1OZSA 2L4IA 3DZTA 1DT7B 4NDBA 1M63B 1PVAA 3SG4A 1H4BA 2K8MB 2WNDA 4NDCA 4FQTA 2M7NA 3DXLA 1KK8C 4I5JA 2MHHA 1Y1UA 1B8CA 2F3ZA 3SG7A 3LLEA 5HYDA 1OOIX 3B87A 4I5KA 3I5HB 1SNLA 2JOJA 1W7JB 1YUTA 1PSRA 2GV5A 2JPTA 2JNFA 3AKAA 5I2OA 1B9AA 4PDZA 5HKYA 2WC8A 1GM0A 3V2LA 1WLZA 3GK2A 3PN7C 4WQ3A 3M0WA 4QJ5B 2Q4UA 1KK8B 4GGFA 1ZMZA 4M2QA 1ALWA 3JVTC 1HQVA 1BLQA 1DTLA 1C07A 1KFUS 3CR2A 3O4XA 4JQ0D 3N7HA 2M8UA 3GOFA 2DOQA 1IQ3A 1F55A 3NHTA 1RWYA 1A03A 1KWOC 1CDMA 2JT8A 1PVBA 2KFGA 3D76A 3I5GC 3PN7B 1K94A 1B8RA 2K7DA 1DF0A 2LHIA 2FCDA 3JVTB 1N2DA 1G33A 4MLWA 1WRZA 3TUYC 2NXQA 3K1EA 1NX1A 2LP3A 4QJ3B 1WRLA 3CYZA 2QDIA 2JPOA 2OTGC 1JF0A 1KWOB 1T14A 4DCKA 5KU1A 1BR4B 1MXEA 1TUJA 2CBLA 3I5IC 1OMDA 2JT3A 3IF7A 3F45A 3BXKA 5J3XA 1YUUA 2D8NA 1S5GY 1TCFA 4WQ2A 3OHMB 4YGDB 1RECA 1SCMB 1GGZA 1UP5A 5KTYA 2HETA 1WY9A 3BFHA 1M31A 2LVIA 4QJ4B 1XFUO 2L50A 1G4YR 1K95A 1XVJA 2I18A 2L51A 2WC6A 1RTP1 2B1UA 2OTGB 1TWOA 1Y1AA 3CR4X 5CSJA 1NSHA 3ZWHA 1AJ5A 1J1EA 1IH0A 2KAXA 3O78A 1YRUB 4GFTA 4NDDA 4YGBB 1KQVA 2WCMA 2IS9A 2WC5A 2I94A 4PALA 2BNXA 1QASA 1QV0A 3IQQA 2BL0B 3FIAA 1OOJA 4AQIA 1GGWA 2EGDA 5HKZA 1F8HA 3CZ2A 3R1VA 1AUIB 1D1OA 3KF9A 1F4QA 4GUKA 4N1GA 2RGIA 2PYQA 4YI8A 3WNXB 2JU0A 1A4PA 1OOFA 3SIBA 2PRUA 2WCFA 1CM1A 4MVFA 5HLOA 1IJ6A 2HF5A 2LE9B 2K2FA 1S36A 1SSEB 2KLDA 1DVIA 2JRFA 1B47A 1P28A 2PQLA 3LK0A 1DMOA 3DF0A 3DVEA 3PM8A 1NCXA 1S5GZ 4OVNF 2LUCA 1K90D 1C3ZA 1R2UA 2BE4A 4C0KA 4YI9A 3I5FB 1BODA 2H2KA 3B7AA 3TS5B 1KK7Y 2KLEA 1SKTA 3TDZA 1LXFC 2SCPA 2K7BA 3PM2A 4GPLB 1RROA 5DICA 2GGZA 2E6WA 4MRYA 2MRDA 5JOLA 1CMGA 1CNPA 4NQGA 2LVVA 2LC5A 2JC2A 1SMGA 1V1GA 3LCPC 1TUZA 3DVMA 1QX5B 3SS5A 2BKIB 4HRHA 4JD9A 1SYMA 1BR1B 3SG3A 1CMFA 1QV1A 1DEKA 2LMUA 2M3WA 2F33A 3CWGA 4U8DA 2WOSA 4YBHB 5ER4X 2V53A 3SS4A 2E30A 2KPHA 1BU3A 4HRGA 5AEQA 1CLLA 1OMVA 1K8UA 3VRPA 1F71A 3DYEA 5I8NA 1SR6C 2JQ6A 4PE7A 2KHNA 3D0YA 4KYNA 1QJTA 1TIZA 5D3OA 1DJGA 2KYFA 3VROA 3DVJA 1SPYA 1Z4HA 2KQYA 2KOTA 3CGAA 1ZACA 3MSEB 3NSOA 1BG1A 1E8AA 2I7AA 2L2CA 2LVKA 4GGFC 1YTZC 4UPGA 4D1EA 1SR6B 1OQPA 4R1EA 2L0PA 3B86A 1M46A 3B6XA 1QLKA 3EVVA 2SASA 3NSLA 4MZKA 1FW4A 3NSIA 2BBNA 3GK1A 4DRWA 2FJYA 3EKHA 2KI6C 1MUXA 2TN4A 3EKJA 1DJIA 1K2HA 1DQEA 3BUNB 2K60A 1UHIA 2KFHA 1IGVA 2NLNA 2LUXA 2O60A 3UO9A 5CSFA 3PJIA 3EK4A 5CSNA 3GK4X 1CFFA 4OCIA 1S6IA 4GBAA 1N0YA 1H8BA 3HX4A 2FOTA 3FE6A 2F3YA 2MJWB 2ZFDA 4F7FA 1XA5A 2K61A 2L5YA 1UURA 2LCPA 4WRIA 2I2RE 2JZIA 3DVKA 4JPZB 1ALVA 1SY9A 4ORBB 2YGUA 1DGUA 3CZTX 4JKTA 1DF0B 5JJGA 2M1UA 1C3YA 1QIWA 2F2PA 1OMRA 3R1PA 2BAPA 2QEHA 3SG6A 3SS3A 1SCMC 4BY5A 3WHUB 1SBJA 5KSZA 3K21A 4CFRA 1CDNA 2MBXA 4AOMA 1XFVO 4PHKA 1TN4A 1J55A 5HLVA 3IVTA 3VRQA 5I94A 4PCWA 1NYAA 1TNXA 1W7IB 1JUOA 4XJKB 4XJKA 1XFRA 4Q04A 1YRTB 1BT6A 2WORA 3TZ1A 3LL8B 5TNCA 1EG4A 3KPXA 3A4UB 2M1KB 1NIWA 4OKHA 1QATA 1IWQA 3DY9A 1U5IA 5DKRA 1JBAA 3CABA 2JULA 4ZCVA 2BL0C 2QEVA 4E68A 2AUCA 1SL8A 3PLFB 3OB2B 2LLUA 3SJSA 1YVLA 1ORGA 5EL2A 2BBMA 4USLA 5AANA 1FI6A 3RZSA 2HQWA 1FF1A 2H61A 1QTXA 1CTRA 1LINA 2LLTA 1CFDA 2L98A 3BOWA 1R6PA 1CB1A 4MZLA 3CLNA 2LHLA 1GJYA 1NP8A 1L7ZA 1MF8B 2LMTA 4CPVA 2NZ0A 4OR9B 4YGCB 1XFZO 5FYXA 1UHNA 2LV7A 1G8IA 1SCVA 4ORCB 1ODBA 1C7WA 1UHKA 3D74A 1S26D 3I5FC 3WXAA 2K0JA 1SK6D 2PASA 4HREE 4IJ7A 3CS1A 4M2PA 1OOGA 2F2OA 5FI2A 3TS5C 2L2EA 1LS8A 3BFAA 1TCOB 2L4HA 2R2IA 2ZKMX 3QMEA 3DF0B 4FQOA 3S0AA 2JNXA 2PSRA 1S1EA 2A4JA 4C0JA 2BCAA 5B8IB 2MLEC 1IKUA 4DUQA 2LMVA 2PVBA 2KGRA 4PHMA 2WCEA 1CFPA 2JXLA 2JT0A 1M39A 1S6CA 2JTTA 4ZCUA 1SW8A 1SRAA 3JTDB 1RFJA 4CIDA 3RM1A 2BKHB 2EC6C 5D7FA 4AQJA 2ZRSA 1CLMA 4P5OE 1DJHA 2FJUB 3S0BA 3SG2A 1JWDA 2KBMA 2CT9A 1WRKA 3KO0A 1DC1A 1J7QA 5PALA 4L9MA 3DD4A 1DJXA 1LKJA 1YR5A 2KI6D 4BY4A 1S3PA 2KBIA 1VRKA 3O2PA 4TNCA 2Y1MA 1KFXL 5AFPA 5AERA 1MQ1A 2ISDA 2F8PA 1JSAA 4PE1A 1CKKA 2EC6B 2LVJA 1S6JA 1NCZA 3AAKA 1LA0A 1IG5A 2Y5IA 1GQMA 2JXCA 2M49B 5ER5A 3EK8A 1NPQA 3SIAA 3D0YB 1YUSA 2WCJA 1QS7A 3FWCA 3PSRA 1IQ5A 3C1VA 3PATA 1PRWA 2ZRTA 2K2AA 2QPTA 1A75A 2QEOA 1K96A 1UUSA 4N1FA 3S0EA 3VRNA 1CLBA 2LAPA 3S0DA 1DJYA 3TDUA 1TTXA 1J1DA 1KSOA 4F0ZB 2P6BB 1XYDA 1KK7Z 3NGVA 1XK4A 3BFBA 4GAOA 1F54A 3LK1A 4P2YB 1YVHA 1MHOA 2KSPA 1K9UA 1QLSA 3H4SE 2KQ6A 1Y6WA 2G9BA 2P71A 1EG3A 2AAOA 2CTNA 3IQOA 4INXA 3UNWA 4PE0A 2M29A 3CZ1A 1NCYA 3L47A 3NSKA 2GGMA 1BMOA 2QEBA 4ORAB 1NX2A 2MAZA 3AAJA 4PE4A 1BOCA 1FPWA 3OX6A 1NX0A 3PFVA 2Q91A 3BJHA 1EXRA 1CDPA 2BCXA 4PHNA 5F6TA 1J7PA 1V1FA 2KNEA 1LVCD 1TNWA 2K7OA 2BECA 1IJ5A 1QIVA 2CNPA 2OS8C 1N65A 4IL1A 2KAYA 1TNPA 4C0LA 1BF5A 4YGAA 1KQMC 3OBVA 2K7CA 2M97A 3FS7A 3Q8IA 1J7OA 5D69A 3EVUA 2KDHA 4HSZA 4ICBA 5GQQC 2P70A 3D73A 1AP4A 1C7VA 1XFYO 4I5LB 4M2OA 4YGEB 4A4CA 3D10A 5I2LA 1UWOA 5IBWA 1SL9A 5BPJA 1F70A 1QVIY 1F4OA 2OS8B 1L2OC 3S0FA 1A29A 2KGBC 3VB1A 1CFCA 3OGNA 1KQMB 4ETOA 5DKQA 1MXLC 3QRXA 2FCEA 2H61C 4I5NB 5I2QA 2KAVA 1MWNA 1NUBA 3RLZA 1Y1XA 1PULA 1U5IB 1B7TY 1KFUL 1QX7A 2KYCA 1XFXO 1QX2A 4GNKB 4MBEA 4PHJA 3KEVA 1L2OB 2LLSA 1NWDA 4YRUA 2LP2A 4MZJA 1K9KA 1ZFSA 2OPOA 1DJZA 3AKBA 1OZOA 2WCBA 2LANA 2WCKA 1PK0D 1YURA 3BOWB 1PSBA 4MSPA 1XO5A 4A4BA 3I5GB 3EVRA 2BE6A 4CLNA 5K89A 3D78A 1UHJA 4DS7A 1ZUZA 2CXJA 1HT9A 2HPSA 3NHIA 1JFJA 5HKWA 1FI5A 1DGVA 1JF2A 2H8VA 2M7LA 3TUYB 1BJFA 5G08A 1Y0VH 1FBVA 3S0GA 1AK8A 2QACA 3BUOB 3CR5X 1TOPA 1QVIZ 1Z2CB 2ZN9A 3SG5A 3FWBA 2KFFA 3I5IB 3OP0A 3JTDC 3BYAA 1YX7A 1CDLA 3R1OA 1SL7A 2L5XB 4XYNA 3ZNIA 1AHRA 1B8LA 3ICBA 2LNKA 3OB1B 4MEWA 1IRJA 4N5XA 1B7TZ 1TNQA 3FE9A 3B88A 3O4YA 1EJ3A 1QXPA 3KHEA 1OE9B 1KFXS 1CM4A 1QWVA 2BCBA 1DJWA 4MRXA 2G2BA 2KI4C 2WCHA 1EH2A 1DELA 3L4AA 3CZ0A 1AVSA 1MR8A 2EHBA 1PALA 1KCYA 2M0RA 1KSMA 1W9ZA 3WHTB 2AMIA 1B1GA 3CDNA 1M45A 2GTEA 3E3RA 1OSAA 2O5GA 1TRFA 1X02A 1UHHA 1XFWO 3R72A 2M9GA 2MA2A 2KI4B 1XK4C 1OW4A 3D75A 2COLB
chains in the Genus database with same CATH topology
3EK7A 2ZN8A 1JC2A 3TDIA 3BUWB 1A75B 1RJVA 1ZOTB 5CSIA 4FTGA 2JWWA 3HCMA 4CFQA 2JTZA 2Y4QA 3O6BA 2PMYA 2Y1NA 3NXAA 2MLFC 4OV2A 1WDCC 1WLMA 1NX3A 5AXIA 1RK9A 2VRGA 2NCOA 3CTNA 3PALA 4GGNA 1EL4A 5CPVA 4JWQA 3BQ3A 2ZNDA 3VGOA 1AJ4A 1A2XA 2HQ8A 1LA3A 3BUXB 1YX8A 1K93D 4DIRA 4MN0A 3BUMB 1WDCB 2NCPA 3I5HC 1K9PA 1J7RA 3OX5A 5DKNA 2PALA 2CCMA 2ZNEA 3A8RA 1Q80A 1JFKA 1B4CA 3VRRA 2LM5A 1OZSA 2L4IA 1DT7B 4NDBA 1M63B 1PVAA 3SG4A 1H4BA 2K8MB 2WNDA 4NDCA 2M7NA 4I5JA 1KK8C 2MHHA 1Y1UA 1B8CA 2F3ZA 3SG7A 3LLEA 5HYDA 4I5KA 3I5HB 1SNLA 2JOJA 1W7JB 1YUTA 1PSRA 2GV5A 2JPTA 2JNFA 3AKAA 5I2OA 1B9AA 4PDZA 5HKYA 2WC8A 1WLZA 3GK2A 3PN7C 4WQ3A 3M0WA 4QJ5B 2Q4UA 1KK8B 4GGFA 1ZMZA 4M2QA 1ALWA 3JVTC 1HQVA 1BLQA 1DTLA 1C07A 1KFUS 3CR2A 4JQ0D 2M8UA 3GOFA 2DOQA 1IQ3A 1F55A 1RWYA 1A03A 1KWOC 1CDMA 2JT8A 1PVBA 2KFGA 3I5GC 3PN7B 1K94A 1B8RA 2K7DA 1DF0A 2LHIA 2FCDA 3JVTB 1N2DA 1G33A 4MLWA 1WRZA 3TUYC 2NXQA 1NX1A 2LP3A 4QJ3B 1WRLA 2OTGC 4DCKA 1JF0A 1KWOB 5KU1A 1BR4B 1MXEA 2CBLA 3I5IC 1OMDA 2JT3A 3IF7A 3F45A 3BXKA 5J3XA 1YUUA 2D8NA 1S5GY 1TCFA 4WQ2A 3OHMB 4YGDB 1RECA 1SCMB 1GGZA 1UP5A 5KTYA 2HETA 1WY9A 1M31A 2LVIA 4QJ4B 1XFUO 2L50A 1G4YR 1K95A 1XVJA 2I18A 2L51A 1RTP1 2B1UA 2OTGB 1Y1AA 3CR4X 5CSJA 1NSHA 3ZWHA 1AJ5A 1J1EA 1IH0A 2KAXA 3O78A 1YRUB 4GFTA 4NDDA 4YGBB 1KQVA 2IS9A 2I94A 4PALA 1QASA 1QV0A 3IQQA 2BL0B 3FIAA 1OOJA 4AQIA 1GGWA 2EGDA 5HKZA 1F8HA 1D1OA 1AUIB 3KF9A 1F4QA 4GUKA 4N1GA 2RGIA 4YI8A 3WNXB 2JU0A 1A4PA 3SIBA 2PRUA 2WCFA 1CM1A 4MVFA 5HLOA 1IJ6A 2HF5A 2LE9B 2K2FA 1S36A 1DVIA 2JRFA 1B47A 1DMOA 3LK0A 3DF0A 3DVEA 3PM8A 1NCXA 1S5GZ 4OVNF 2LUCA 1K90D 1R2UA 2BE4A 4C0KA 4YI9A 3I5FB 1BODA 2H2KA 3TS5B 1KK7Y 1SKTA 3TDZA 1LXFC 2SCPA 2K7BA 4GPLB 1RROA 2GGZA 2E6WA 4MRYA 2MRDA 5JOLA 1CMGA 1CNPA 4NQGA 2LVVA 2LC5A 2JC2A 1SMGA 1V1GA 3LCPC 3DVMA 1QX5B 2BKIB 4HRHA 3SG3A 1SYMA 1BR1B 1CMFA 1QV1A 2LMUA 2M3WA 3CWGA 2F33A 4U8DA 2WOSA 4YBHB 5ER4X 2V53A 2E30A 1BU3A 4HRGA 5AEQA 1CLLA 1OMVA 1K8UA 3VRPA 1F71A 5I8NA 1SR6C 2JQ6A 4PE7A 2KHNA 3D0YA 1QJTA 1TIZA 1DJGA 2KYFA 3VROA 3DVJA 1SPYA 2KQYA 2KOTA 3CGAA 1ZACA 3MSEB 3NSOA 1BG1A 1E8AA 2I7AA 2LVKA 4GGFC 1YTZC 4UPGA 4D1EA 1SR6B 1OQPA 4R1EA 2L0PA 1M46A 3EVVA 1QLKA 3NSLA 2SASA 4MZKA 1FW4A 3NSIA 2BBNA 3GK1A 4DRWA 3EKHA 2KI6C 1MUXA 2TN4A 3EKJA 1DJIA 1K2HA 3BUNB 2KFHA 1UHIA 1IGVA 2NLNA 2LUXA 2O60A 5CSFA 3EK4A 5CSNA 3GK4X 1CFFA 4OCIA 1S6IA 4GBAA 1N0YA 1H8BA 3HX4A 2FOTA 2F3YA 2MJWB 2ZFDA 1XA5A 2K61A 1UURA 2LCPA 4WRIA 2I2RE 2JZIA 3DVKA 4JPZB 1ALVA 1SY9A 4ORBB 1DGUA 3CZTX 1DF0B 5JJGA 2M1UA 1QIWA 2F2PA 1OMRA 3SG6A 1SCMC 4BY5A 3WHUB 1SBJA 5KSZA 3K21A 4CFRA 1CDNA 2MBXA 4AOMA 1XFVO 4PHKA 1TN4A 1J55A 5HLVA 3VRQA 4PCWA 1NYAA 1TNXA 1W7IB 1JUOA 4XJKB 4XJKA 4Q04A 1YRTB 1BT6A 2WORA 3TZ1A 3LL8B 5TNCA 1EG4A 3KPXA 3A4UB 2M1KB 1NIWA 4OKHA 1QATA 1IWQA 1U5IA 5DKRA 1JBAA 2JULA 4ZCVA 2BL0C 4E68A 2AUCA 1SL8A 3PLFB 3OB2B 2LLUA 3SJSA 1YVLA 2BBMA 4USLA 5AANA 1FI6A 2HQWA 1FF1A 2H61A 1QTXA 1CTRA 1LINA 2LLTA 1CFDA 2L98A 3BOWA 1R6PA 1CB1A 4MZLA 3CLNA 2LHLA 1GJYA 1NP8A 1L7ZA 1MF8B 2LMTA 4CPVA 2NZ0A 4OR9B 4YGCB 1XFZO 5FYXA 1UHNA 2LV7A 1G8IA 1SCVA 4ORCB 1ODBA 1C7WA 1UHKA 1S26D 3I5FC 3WXAA 2K0JA 1SK6D 2PASA 4HREE 4M2PA 3CS1A 3TS5C 2F2OA 2L2EA 1TCOB 2L4HA 2R2IA 2ZKMX 3DF0B 4FQOA 2JNXA 2PSRA 1S1EA 2A4JA 4C0JA 2BCAA 5B8IB 2MLEC 1IKUA 4DUQA 2LMVA 2PVBA 2KGRA 4PHMA 2WCEA 1CFPA 2JXLA 2JT0A 1M39A 1S6CA 2JTTA 4ZCUA 1SW8A 1SRAA 3JTDB 1RFJA 4CIDA 3RM1A 2BKHB 2EC6C 5D7FA 4AQJA 2ZRSA 1CLMA 4P5OE 1DJHA 2FJUB 3SG2A 1JWDA 2KBMA 2CT9A 1WRKA 3KO0A 1J7QA 5PALA 4L9MA 3DD4A 1DJXA 1LKJA 1YR5A 2KI6D 4BY4A 1S3PA 2KBIA 1VRKA 3O2PA 4TNCA 2Y1MA 1KFXL 5AFPA 5AERA 1MQ1A 2ISDA 2F8PA 1JSAA 4PE1A 1CKKA 2EC6B 2LVJA 1S6JA 1NCZA 3AAKA 1LA0A 1IG5A 2Y5IA 1GQMA 2JXCA 2M49B 5ER5A 3EK8A 1NPQA 3SIAA 3D0YB 1YUSA 1QS7A 3FWCA 3PSRA 1IQ5A 3C1VA 3PATA 1PRWA 2ZRTA 2K2AA 2QPTA 1A75A 4N1FA 1K96A 1UUSA 3VRNA 1CLBA 2LAPA 3TDUA 1DJYA 1TTXA 1J1DA 1KSOA 4F0ZB 2P6BB 1XYDA 1KK7Z 1XK4A 4GAOA 1F54A 3LK1A 4P2YB 1YVHA 1MHOA 2KSPA 1K9UA 1QLSA 3H4SE 2KQ6A 1Y6WA 2G9BA 1EG3A 2AAOA 2CTNA 3IQOA 4PE0A 2M29A 3NSKA 1NCYA 2GGMA 1BMOA 4ORAB 1NX2A 2MAZA 3AAJA 4PE4A 1BOCA 1FPWA 3OX6A 1NX0A 3PFVA 2Q91A 4PHNA 1EXRA 1CDPA 2BCXA 5F6TA 1J7PA 1V1FA 2KNEA 1LVCD 1TNWA 2K7OA 2BECA 1IJ5A 1QIVA 2CNPA 2OS8C 1N65A 4IL1A 2KAYA 1TNPA 4C0LA 1BF5A 4YGAA 1KQMC 2K7CA 2M97A 3FS7A 1J7OA 5D69A 3EVUA 2KDHA 4HSZA 4ICBA 5GQQC 1AP4A 1C7VA 1XFYO 4I5LB 4M2OA 4YGEB 4A4CA 3D10A 5I2LA 1UWOA 5IBWA 1SL9A 5BPJA 1F70A 1QVIY 1F4OA 2OS8B 1L2OC 1A29A 2KGBC 1CFCA 1KQMB 4ETOA 5DKQA 1MXLC 3QRXA 2FCEA 2H61C 4I5NB 5I2QA 2KAVA 1MWNA 1NUBA 3RLZA 1Y1XA 1PULA 1U5IB 1B7TY 1KFUL 1QX7A 2KYCA 1XFXO 1QX2A 4GNKB 4MBEA 4PHJA 3KEVA 1L2OB 2LLSA 1NWDA 4YRUA 2LP2A 4MZJA 1K9KA 1ZFSA 2OPOA 1DJZA 3AKBA 1OZOA 2WCBA 2LANA 1PK0D 1YURA 3BOWB 1PSBA 4MSPA 1XO5A 4A4BA 3I5GB 3EVRA 2BE6A 4CLNA 5K89A 1UHJA 4DS7A 1ZUZA 2CXJA 1HT9A 2HPSA 1JFJA 5HKWA 1FI5A 1DGVA 1JF2A 2M7LA 3TUYB 1BJFA 5G08A 1Y0VH 1FBVA 1AK8A 2QACA 3BUOB 3CR5X 1TOPA 1QVIZ 2ZN9A 3SG5A 3FWBA 2KFFA 3I5IB 3OP0A 3JTDC 3BYAA 1YX7A 1CDLA 1SL7A 2L5XB 4XYNA 3ZNIA 1AHRA 1B8LA 3ICBA 2LNKA 3OB1B 4MEWA 1IRJA 4N5XA 1B7TZ 1TNQA 3O4YA 1EJ3A 1QXPA 3KHEA 1OE9B 1KFXS 1CM4A 2BCBA 1DJWA 4MRXA 2G2BA 2KI4C 1EH2A 1AVSA 1MR8A 2EHBA 1PALA 1KCYA 2M0RA 1KSMA 3WHTB 2AMIA 1B1GA 1M45A 3E3RA 1OSAA 2O5GA 1TRFA 1X02A 1UHHA 1XFWO 2M9GA 2MA2A 2KI4B 1XK4C 2COLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EK7 A;  2ZN8 A;  1JC2 A;  3TDI A;  3BUW B;  1A75 B;  1RJV A;  1ZOT B;  5CSI A;  4FTG A;  2JWW A;  3HCM A;  4CFQ A;  2JTZ A;  2Y4Q A;  3O6B A;  2PMY A;  2Y1N A;  3NXA A;  2MLF C;  4OV2 A;  1WDC C;  1WLM A;  1NX3 A;  5AXI A;  1RK9 A;  2VRG A;  2NCO A;  3CTN A;  3PAL A;  4GGN A;  1EL4 A;  5CPV A;  4JWQ A;  3BQ3 A;  2ZND A;  3VGO A;  1AJ4 A;  1A2X A;  2HQ8 A;  1LA3 A;  3BUX B;  1YX8 A;  1K93 D;  4DIR A;  4MN0 A;  3BUM B;  1WDC B;  2NCP A;  3I5H C;  1K9P A;  1J7R A;  3OX5 A;  5DKN A;  2PAL A;  2CCM A;  2ZNE A;  3A8R A;  1Q80 A;  1JFK A;  1B4C A;  3VRR A;  2LM5 A;  1OZS A;  2L4I A;  1DT7 B;  4NDB A;  1M63 B;  1PVA A;  3SG4 A;  1H4B A;  2K8M B;  2WND A;  4NDC A;  2M7N A;  4I5J A;  1KK8 C;  2MHH A;  1Y1U A;  1B8C A;  2F3Z A;  3SG7 A;  3LLE A;  5HYD A;  4I5K A;  3I5H B;  1SNL A;  2JOJ A;  1W7J B;  1YUT A;  1PSR A;  2GV5 A;  2JPT A;  2JNF A;  3AKA A;  5I2O A;  1B9A A;  4PDZ A;  5HKY A;  2WC8 A;  1WLZ A;  3GK2 A;  3PN7 C;  4WQ3 A;  3M0W A;  4QJ5 B;  2Q4U A;  1KK8 B;  4GGF A;  1ZMZ A;  4M2Q A;  1ALW A;  3JVT C;  1HQV A;  1BLQ A;  1DTL A;  1C07 A;  1KFU S;  3CR2 A;  4JQ0 D;  2M8U A;  3GOF A;  2DOQ A;  1IQ3 A;  1F55 A;  1RWY A;  1A03 A;  1KWO C;  1CDM A;  2JT8 A;  1PVB A;  2KFG A;  3I5G C;  3PN7 B;  1K94 A;  1B8R A;  2K7D A;  1DF0 A;  2LHI A;  2FCD A;  3JVT B;  1N2D A;  1G33 A;  4MLW A;  1WRZ A;  3TUY C;  2NXQ A;  1NX1 A;  2LP3 A;  4QJ3 B;  1WRL A;  2OTG C;  4DCK A;  1JF0 A;  1KWO B;  5KU1 A;  1BR4 B;  1MXE A;  2CBL A;  3I5I C;  1OMD A;  2JT3 A;  3IF7 A;  3F45 A;  3BXK A;  5J3X A;  1YUU A;  2D8N A;  1S5G Y;  1TCF A;  4WQ2 A;  3OHM B;  4YGD B;  1REC A;  1SCM B;  1GGZ A;  1UP5 A;  5KTY A;  2HET A;  1WY9 A;  1M31 A;  2LVI A;  4QJ4 B;  1XFU O;  2L50 A;  1G4Y R;  1K95 A;  1XVJ A;  2I18 A;  2L51 A;  1RTP 1;  2B1U A;  2OTG B;  1Y1A A;  3CR4 X;  5CSJ A;  1NSH A;  3ZWH A;  1AJ5 A;  1J1E A;  1IH0 A;  2KAX A;  3O78 A;  1YRU B;  4GFT A;  4NDD A;  4YGB B;  1KQV A;  2IS9 A;  2I94 A;  4PAL A;  1QAS A;  1QV0 A;  3IQQ A;  2BL0 B;  3FIA A;  1OOJ A;  4AQI A;  1GGW A;  2EGD A;  5HKZ A;  1F8H A;  1D1O A;  1AUI B;  3KF9 A;  1F4Q A;  4GUK A;  4N1G A;  2RGI A;  4YI8 A;  3WNX B;  2JU0 A;  1A4P A;  3SIB A;  2PRU A;  2WCF A;  1CM1 A;  4MVF A;  5HLO A;  1IJ6 A;  2HF5 A;  2LE9 B;  2K2F A;  1S36 A;  1DVI A;  2JRF A;  1B47 A;  1DMO A;  3LK0 A;  3DF0 A;  3DVE A;  3PM8 A;  1NCX A;  1S5G Z;  4OVN F;  2LUC A;  1K90 D;  1R2U A;  2BE4 A;  4C0K A;  4YI9 A;  3I5F B;  1BOD A;  2H2K A;  3TS5 B;  1KK7 Y;  1SKT A;  3TDZ A;  1LXF C;  2SCP A;  2K7B A;  4GPL B;  1RRO A;  2GGZ A;  2E6W A;  4MRY A;  2MRD A;  5JOL A;  1CMG A;  1CNP A;  4NQG A;  2LVV A;  2LC5 A;  2JC2 A;  1SMG A;  1V1G A;  3LCP C;  3DVM A;  1QX5 B;  2BKI B;  4HRH A;  3SG3 A;  1SYM A;  1BR1 B;  1CMF A;  1QV1 A;  2LMU A;  2M3W A;  3CWG A;  2F33 A;  4U8D A;  2WOS A;  4YBH B;  5ER4 X;  2V53 A;  2E30 A;  1BU3 A;  4HRG A;  5AEQ A;  1CLL A;  1OMV A;  1K8U A;  3VRP A;  1F71 A;  5I8N A;  1SR6 C;  2JQ6 A;  4PE7 A;  2KHN A;  3D0Y A;  1QJT A;  1TIZ A;  1DJG A;  2KYF A;  3VRO A;  3DVJ A;  1SPY A;  2KQY A;  2KOT A;  3CGA A;  1ZAC A;  3MSE B;  3NSO A;  1BG1 A;  1E8A A;  2I7A A;  2LVK A;  4GGF C;  1YTZ C;  4UPG A;  4D1E A;  1SR6 B;  1OQP A;  4R1E A;  2L0P A;  1M46 A;  3EVV A;  1QLK A;  3NSL A;  2SAS A;  4MZK A;  1FW4 A;  3NSI A;  2BBN A;  3GK1 A;  4DRW A;  3EKH A;  2KI6 C;  1MUX A;  2TN4 A;  3EKJ A;  1DJI A;  1K2H A;  3BUN B;  2KFH A;  1UHI A;  1IGV A;  2NLN A;  2LUX A;  2O60 A;  5CSF A;  3EK4 A;  5CSN A;  3GK4 X;  1CFF A;  4OCI A;  1S6I A;  4GBA A;  1N0Y A;  1H8B A;  3HX4 A;  2FOT A;  2F3Y A;  2MJW B;  2ZFD A;  1XA5 A;  2K61 A;  1UUR A;  2LCP A;  4WRI A;  2I2R E;  2JZI A;  3DVK A;  4JPZ B;  1ALV A;  1SY9 A;  4ORB B;  1DGU A;  3CZT X;  1DF0 B;  5JJG A;  2M1U A;  1QIW A;  2F2P A;  1OMR A;  3SG6 A;  1SCM C;  4BY5 A;  3WHU B;  1SBJ A;  5KSZ A;  3K21 A;  4CFR A;  1CDN A;  2MBX A;  4AOM A;  1XFV O;  4PHK A;  1TN4 A;  1J55 A;  5HLV A;  3VRQ A;  4PCW A;  1NYA A;  1TNX A;  1W7I B;  1JUO A;  4XJK B;  4XJK A;  4Q04 A;  1YRT B;  1BT6 A;  2WOR A;  3TZ1 A;  3LL8 B;  5TNC A;  1EG4 A;  3KPX A;  3A4U B;  2M1K B;  1NIW A;  4OKH A;  1QAT A;  1IWQ A;  1U5I A;  5DKR A;  1JBA A;  2JUL A;  4ZCV A;  2BL0 C;  4E68 A;  2AUC A;  1SL8 A;  3PLF B;  3OB2 B;  2LLU A;  3SJS A;  1YVL A;  2BBM A;  4USL A;  5AAN A;  1FI6 A;  2HQW A;  1FF1 A;  2H61 A;  1QTX A;  1CTR A;  1LIN A;  2LLT A;  1CFD A;  2L98 A;  3BOW A;  1R6P A;  1CB1 A;  4MZL A;  3CLN A;  2LHL A;  1GJY A;  1NP8 A;  1L7Z A;  1MF8 B;  2LMT A;  4CPV A;  2NZ0 A;  4OR9 B;  4YGC B;  1XFZ O;  5FYX A;  1UHN A;  2LV7 A;  1G8I A;  1SCV A;  4ORC B;  1ODB A;  1C7W A;  1UHK A;  1S26 D;  3I5F C;  3WXA A;  2K0J A;  1SK6 D;  2PAS A;  4HRE E;  4M2P A;  3CS1 A;  3TS5 C;  2F2O A;  2L2E A;  1TCO B;  2L4H A;  2R2I A;  2ZKM X;  3DF0 B;  4FQO A;  2JNX A;  2PSR A;  1S1E A;  2A4J A;  4C0J A;  2BCA A;  5B8I B;  2MLE C;  1IKU A;  4DUQ A;  2LMV A;  2PVB A;  2KGR A;  4PHM A;  2WCE A;  1CFP A;  2JXL A;  2JT0 A;  1M39 A;  1S6C A;  2JTT A;  4ZCU A;  1SW8 A;  1SRA A;  3JTD B;  1RFJ A;  4CID A;  3RM1 A;  2BKH B;  2EC6 C;  5D7F A;  4AQJ A;  2ZRS A;  1CLM A;  4P5O E;  1DJH A;  2FJU B;  3SG2 A;  1JWD A;  2KBM A;  2CT9 A;  1WRK A;  3KO0 A;  1J7Q A;  5PAL A;  4L9M A;  3DD4 A;  1DJX A;  1LKJ A;  1YR5 A;  2KI6 D;  4BY4 A;  1S3P A;  2KBI A;  1VRK A;  3O2P A;  4TNC A;  2Y1M A;  1KFX L;  5AFP A;  5AER A;  1MQ1 A;  2ISD A;  2F8P A;  1JSA A;  4PE1 A;  1CKK A;  2EC6 B;  2LVJ A;  1S6J A;  1NCZ A;  3AAK A;  1LA0 A;  1IG5 A;  2Y5I A;  1GQM A;  2JXC A;  2M49 B;  5ER5 A;  3EK8 A;  1NPQ A;  3SIA A;  3D0Y B;  1YUS A;  1QS7 A;  3FWC A;  3PSR A;  1IQ5 A;  3C1V A;  3PAT A;  1PRW A;  2ZRT A;  2K2A A;  2QPT A;  1A75 A;  4N1F A;  1K96 A;  1UUS A;  3VRN A;  1CLB A;  2LAP A;  3TDU A;  1DJY A;  1TTX A;  1J1D A;  1KSO A;  4F0Z B;  2P6B B;  1XYD A;  1KK7 Z;  1XK4 A;  4GAO A;  1F54 A;  3LK1 A;  4P2Y B;  1YVH A;  1MHO A;  2KSP A;  1K9U A;  1QLS A;  3H4S E;  2KQ6 A;  1Y6W A;  2G9B A;  1EG3 A;  2AAO A;  2CTN A;  3IQO A;  4PE0 A;  2M29 A;  3NSK A;  1NCY A;  2GGM A;  1BMO A;  4ORA B;  1NX2 A;  2MAZ A;  3AAJ A;  4PE4 A;  1BOC A;  1FPW A;  3OX6 A;  1NX0 A;  3PFV A;  2Q91 A;  4PHN A;  1EXR A;  1CDP A;  2BCX A;  5F6T A;  1J7P A;  1V1F A;  2KNE A;  1LVC D;  1TNW A;  2K7O A;  2BEC A;  1IJ5 A;  1QIV A;  2CNP A;  2OS8 C;  1N65 A;  4IL1 A;  2KAY A;  1TNP A;  4C0L A;  1BF5 A;  4YGA A;  1KQM C;  2K7C A;  2M97 A;  3FS7 A;  1J7O A;  5D69 A;  3EVU A;  2KDH A;  4HSZ A;  4ICB A;  5GQQ C;  1AP4 A;  1C7V A;  1XFY O;  4I5L B;  4M2O A;  4YGE B;  4A4C A;  3D10 A;  5I2L A;  1UWO A;  5IBW A;  1SL9 A;  5BPJ A;  1F70 A;  1QVI Y;  1F4O A;  2OS8 B;  1L2O C;  1A29 A;  2KGB C;  1CFC A;  1KQM B;  4ETO A;  5DKQ A;  1MXL C;  3QRX A;  2FCE A;  2H61 C;  4I5N B;  5I2Q A;  2KAV A;  1MWN A;  1NUB A;  3RLZ A;  1Y1X A;  1PUL A;  1U5I B;  1B7T Y;  1KFU L;  1QX7 A;  2KYC A;  1XFX O;  1QX2 A;  4GNK B;  4MBE A;  4PHJ A;  3KEV A;  1L2O B;  2LLS A;  1NWD A;  4YRU A;  2LP2 A;  4MZJ A;  1K9K A;  1ZFS A;  2OPO A;  1DJZ A;  3AKB A;  1OZO A;  2WCB A;  2LAN A;  1PK0 D;  1YUR A;  3BOW B;  1PSB A;  4MSP A;  1XO5 A;  4A4B A;  3I5G B;  3EVR A;  2BE6 A;  4CLN A;  5K89 A;  1UHJ A;  4DS7 A;  1ZUZ A;  2CXJ A;  1HT9 A;  2HPS A;  1JFJ A;  5HKW A;  1FI5 A;  1DGV A;  1JF2 A;  2M7L A;  3TUY B;  1BJF A;  5G08 A;  1Y0V H;  1FBV A;  1AK8 A;  2QAC A;  3BUO B;  3CR5 X;  1TOP A;  1QVI Z;  2ZN9 A;  3SG5 A;  3FWB A;  2KFF A;  3I5I B;  3OP0 A;  3JTD C;  3BYA A;  1YX7 A;  1CDL A;  1SL7 A;  2L5X B;  4XYN A;  3ZNI A;  1AHR A;  1B8L A;  3ICB A;  2LNK A;  3OB1 B;  4MEW A;  1IRJ A;  4N5X A;  1B7T Z;  1TNQ A;  3O4Y A;  1EJ3 A;  1QXP A;  3KHE A;  1OE9 B;  1KFX S;  1CM4 A;  2BCB A;  1DJW A;  4MRX A;  2G2B A;  2KI4 C;  1EH2 A;  1AVS A;  1MR8 A;  2EHB A;  1PAL A;  1KCY A;  2M0R A;  1KSM A;  3WHT B;  2AMI A;  1B1G A;  1M45 A;  3E3R A;  1OSA A;  2O5G A;  1TRF A;  1X02 A;  1UHH A;  1XFW O;  2M9G A;  2MA2 A;  2KI4 B;  1XK4 C;  2COL B; 
#chains in the Genus database with same CATH topology
 3EK7 A;  2ZN8 A;  1JC2 A;  4PT1 A;  3TDI A;  3BUW B;  1A75 B;  1RJV A;  1ZOT B;  5CSI A;  4FTG A;  2JWW A;  3HCM A;  4CFQ A;  2JTZ A;  2Y4Q A;  3O6B A;  2PMY A;  4OZD A;  2Y1N A;  3NXA A;  1OOH A;  2MLF C;  4OV2 A;  1WDC C;  1WLM A;  1NX3 A;  5AXI A;  1RK9 A;  2VRG A;  5FI7 A;  2NCO A;  3CTN A;  3PAL A;  3L4L A;  4GGN A;  1EL4 A;  4INW A;  5CPV A;  4JWQ A;  3FE8 A;  3BQ3 A;  2ZND A;  3VGO A;  1AJ4 A;  5FI6 A;  1A2X A;  2HQ8 A;  1LA3 A;  3BUX B;  1YX8 A;  1K93 D;  3EG5 B;  4MN0 A;  4DIR A;  1IIO A;  3BUM B;  1WDC B;  3D77 A;  2NCP A;  5HL1 A;  3I5H C;  1K9P A;  1J7R A;  3OX5 A;  5DKN A;  2PAL A;  2CCM A;  2WCL A;  2ERB A;  2ZNE A;  3A8R A;  1Q80 A;  1JFK A;  1B4C A;  3VRR A;  2LM5 A;  1OZS A;  2L4I A;  3DZT A;  1DT7 B;  4NDB A;  1M63 B;  1PVA A;  3SG4 A;  1H4B A;  2K8M B;  2WND A;  4NDC A;  4FQT A;  2M7N A;  3DXL A;  1KK8 C;  4I5J A;  2MHH A;  1Y1U A;  1B8C A;  2F3Z A;  3SG7 A;  3LLE A;  5HYD A;  1OOI X;  3B87 A;  4I5K A;  3I5H B;  1SNL A;  2JOJ A;  1W7J B;  1YUT A;  1PSR A;  2GV5 A;  2JPT A;  2JNF A;  3AKA A;  5I2O A;  1B9A A;  4PDZ A;  5HKY A;  2WC8 A;  1GM0 A;  3V2L A;  1WLZ A;  3GK2 A;  3PN7 C;  4WQ3 A;  3M0W A;  4QJ5 B;  2Q4U A;  1KK8 B;  4GGF A;  1ZMZ A;  4M2Q A;  1ALW A;  3JVT C;  1HQV A;  1BLQ A;  1DTL A;  1C07 A;  1KFU S;  3CR2 A;  3O4X A;  4JQ0 D;  3N7H A;  2M8U A;  3GOF A;  2DOQ A;  1IQ3 A;  1F55 A;  3NHT A;  1RWY A;  1A03 A;  1KWO C;  1CDM A;  2JT8 A;  1PVB A;  2KFG A;  3D76 A;  3I5G C;  3PN7 B;  1K94 A;  1B8R A;  2K7D A;  1DF0 A;  2LHI A;  2FCD A;  3JVT B;  1N2D A;  1G33 A;  4MLW A;  1WRZ A;  3TUY C;  2NXQ A;  3K1E A;  1NX1 A;  2LP3 A;  4QJ3 B;  1WRL A;  3CYZ A;  2QDI A;  2JPO A;  2OTG C;  1JF0 A;  1KWO B;  1T14 A;  4DCK A;  5KU1 A;  1BR4 B;  1MXE A;  1TUJ A;  2CBL A;  3I5I C;  1OMD A;  2JT3 A;  3IF7 A;  3F45 A;  3BXK A;  5J3X A;  1YUU A;  2D8N A;  1S5G Y;  1TCF A;  4WQ2 A;  3OHM B;  4YGD B;  1REC A;  1SCM B;  1GGZ A;  1UP5 A;  5KTY A;  2HET A;  1WY9 A;  3BFH A;  1M31 A;  2LVI A;  4QJ4 B;  1XFU O;  2L50 A;  1G4Y R;  1K95 A;  1XVJ A;  2I18 A;  2L51 A;  2WC6 A;  1RTP 1;  2B1U A;  2OTG B;  1TWO A;  1Y1A A;  3CR4 X;  5CSJ A;  1NSH A;  3ZWH A;  1AJ5 A;  1J1E A;  1IH0 A;  2KAX A;  3O78 A;  1YRU B;  4GFT A;  4NDD A;  4YGB B;  1KQV A;  2WCM A;  2IS9 A;  2WC5 A;  2I94 A;  4PAL A;  2BNX A;  1QAS A;  1QV0 A;  3IQQ A;  2BL0 B;  3FIA A;  1OOJ A;  4AQI A;  1GGW A;  2EGD A;  5HKZ A;  1F8H A;  3CZ2 A;  3R1V A;  1AUI B;  1D1O A;  3KF9 A;  1F4Q A;  4GUK A;  4N1G A;  2RGI A;  2PYQ A;  4YI8 A;  3WNX B;  2JU0 A;  1A4P A;  1OOF A;  3SIB A;  2PRU A;  2WCF A;  1CM1 A;  4MVF A;  5HLO A;  1IJ6 A;  2HF5 A;  2LE9 B;  2K2F A;  1S36 A;  1SSE B;  2KLD A;  1DVI A;  2JRF A;  1B47 A;  1P28 A;  2PQL A;  3LK0 A;  1DMO A;  3DF0 A;  3DVE A;  3PM8 A;  1NCX A;  1S5G Z;  4OVN F;  2LUC A;  1K90 D;  1C3Z A;  1R2U A;  2BE4 A;  4C0K A;  4YI9 A;  3I5F B;  1BOD A;  2H2K A;  3B7A A;  3TS5 B;  1KK7 Y;  2KLE A;  1SKT A;  3TDZ A;  1LXF C;  2SCP A;  2K7B A;  3PM2 A;  4GPL B;  1RRO A;  5DIC A;  2GGZ A;  2E6W A;  4MRY A;  2MRD A;  5JOL A;  1CMG A;  1CNP A;  4NQG A;  2LVV A;  2LC5 A;  2JC2 A;  1SMG A;  1V1G A;  3LCP C;  1TUZ A;  3DVM A;  1QX5 B;  3SS5 A;  2BKI B;  4HRH A;  4JD9 A;  1SYM A;  1BR1 B;  3SG3 A;  1CMF A;  1QV1 A;  1DEK A;  2LMU A;  2M3W A;  2F33 A;  3CWG A;  4U8D A;  2WOS A;  4YBH B;  5ER4 X;  2V53 A;  3SS4 A;  2E30 A;  2KPH A;  1BU3 A;  4HRG A;  5AEQ A;  1CLL A;  1OMV A;  1K8U A;  3VRP A;  1F71 A;  3DYE A;  5I8N A;  1SR6 C;  2JQ6 A;  4PE7 A;  2KHN A;  3D0Y A;  4KYN A;  1QJT A;  1TIZ A;  5D3O A;  1DJG A;  2KYF A;  3VRO A;  3DVJ A;  1SPY A;  1Z4H A;  2KQY A;  2KOT A;  3CGA A;  1ZAC A;  3MSE B;  3NSO A;  1BG1 A;  1E8A A;  2I7A A;  2L2C A;  2LVK A;  4GGF C;  1YTZ C;  4UPG A;  4D1E A;  1SR6 B;  1OQP A;  4R1E A;  2L0P A;  3B86 A;  1M46 A;  3B6X A;  1QLK A;  3EVV A;  2SAS A;  3NSL A;  4MZK A;  1FW4 A;  3NSI A;  2BBN A;  3GK1 A;  4DRW A;  2FJY A;  3EKH A;  2KI6 C;  1MUX A;  2TN4 A;  3EKJ A;  1DJI A;  1K2H A;  1DQE A;  3BUN B;  2K60 A;  1UHI A;  2KFH A;  1IGV A;  2NLN A;  2LUX A;  2O60 A;  3UO9 A;  5CSF A;  3PJI A;  3EK4 A;  5CSN A;  3GK4 X;  1CFF A;  4OCI A;  1S6I A;  4GBA A;  1N0Y A;  1H8B A;  3HX4 A;  2FOT A;  3FE6 A;  2F3Y A;  2MJW B;  2ZFD A;  4F7F A;  1XA5 A;  2K61 A;  2L5Y A;  1UUR A;  2LCP A;  4WRI A;  2I2R E;  2JZI A;  3DVK A;  4JPZ B;  1ALV A;  1SY9 A;  4ORB B;  2YGU A;  1DGU A;  3CZT X;  4JKT A;  1DF0 B;  5JJG A;  2M1U A;  1C3Y A;  1QIW A;  2F2P A;  1OMR A;  3R1P A;  2BAP A;  2QEH A;  3SG6 A;  3SS3 A;  1SCM C;  4BY5 A;  3WHU B;  1SBJ A;  5KSZ A;  3K21 A;  4CFR A;  1CDN A;  2MBX A;  4AOM A;  1XFV O;  4PHK A;  1TN4 A;  1J55 A;  5HLV A;  3IVT A;  3VRQ A;  5I94 A;  4PCW A;  1NYA A;  1TNX A;  1W7I B;  1JUO A;  4XJK B;  4XJK A;  1XFR A;  4Q04 A;  1YRT B;  1BT6 A;  2WOR A;  3TZ1 A;  3LL8 B;  5TNC A;  1EG4 A;  3KPX A;  3A4U B;  2M1K B;  1NIW A;  4OKH A;  1QAT A;  1IWQ A;  3DY9 A;  1U5I A;  5DKR A;  1JBA A;  3CAB A;  2JUL A;  4ZCV A;  2BL0 C;  2QEV A;  4E68 A;  2AUC A;  1SL8 A;  3PLF B;  3OB2 B;  2LLU A;  3SJS A;  1YVL A;  1ORG A;  5EL2 A;  2BBM A;  4USL A;  5AAN A;  1FI6 A;  3RZS A;  2HQW A;  1FF1 A;  2H61 A;  1QTX A;  1CTR A;  1LIN A;  2LLT A;  1CFD A;  2L98 A;  3BOW A;  1R6P A;  1CB1 A;  4MZL A;  3CLN A;  2LHL A;  1GJY A;  1NP8 A;  1L7Z A;  1MF8 B;  2LMT A;  4CPV A;  2NZ0 A;  4OR9 B;  4YGC B;  1XFZ O;  5FYX A;  1UHN A;  2LV7 A;  1G8I A;  1SCV A;  4ORC B;  1ODB A;  1C7W A;  1UHK A;  3D74 A;  1S26 D;  3I5F C;  3WXA A;  2K0J A;  1SK6 D;  2PAS A;  4HRE E;  4IJ7 A;  3CS1 A;  4M2P A;  1OOG A;  2F2O A;  5FI2 A;  3TS5 C;  2L2E A;  1LS8 A;  3BFA A;  1TCO B;  2L4H A;  2R2I A;  2ZKM X;  3QME A;  3DF0 B;  4FQO A;  3S0A A;  2JNX A;  2PSR A;  1S1E A;  2A4J A;  4C0J A;  2BCA A;  5B8I B;  2MLE C;  1IKU A;  4DUQ A;  2LMV A;  2PVB A;  2KGR A;  4PHM A;  2WCE A;  1CFP A;  2JXL A;  2JT0 A;  1M39 A;  1S6C A;  2JTT A;  4ZCU A;  1SW8 A;  1SRA A;  3JTD B;  1RFJ A;  4CID A;  3RM1 A;  2BKH B;  2EC6 C;  5D7F A;  4AQJ A;  2ZRS A;  1CLM A;  4P5O E;  1DJH A;  2FJU B;  3S0B A;  3SG2 A;  1JWD A;  2KBM A;  2CT9 A;  1WRK A;  3KO0 A;  1DC1 A;  1J7Q A;  5PAL A;  4L9M A;  3DD4 A;  1DJX A;  1LKJ A;  1YR5 A;  2KI6 D;  4BY4 A;  1S3P A;  2KBI A;  1VRK A;  3O2P A;  4TNC A;  2Y1M A;  1KFX L;  5AFP A;  5AER A;  1MQ1 A;  2ISD A;  2F8P A;  1JSA A;  4PE1 A;  1CKK A;  2EC6 B;  2LVJ A;  1S6J A;  1NCZ A;  3AAK A;  1LA0 A;  1IG5 A;  2Y5I A;  1GQM A;  2JXC A;  2M49 B;  5ER5 A;  3EK8 A;  1NPQ A;  3SIA A;  3D0Y B;  1YUS A;  2WCJ A;  1QS7 A;  3FWC A;  3PSR A;  1IQ5 A;  3C1V A;  3PAT A;  1PRW A;  2ZRT A;  2K2A A;  2QPT A;  1A75 A;  2QEO A;  1K96 A;  1UUS A;  4N1F A;  3S0E A;  3VRN A;  1CLB A;  2LAP A;  3S0D A;  1DJY A;  3TDU A;  1TTX A;  1J1D A;  1KSO A;  4F0Z B;  2P6B B;  1XYD A;  1KK7 Z;  3NGV A;  1XK4 A;  3BFB A;  4GAO A;  1F54 A;  3LK1 A;  4P2Y B;  1YVH A;  1MHO A;  2KSP A;  1K9U A;  1QLS A;  3H4S E;  2KQ6 A;  1Y6W A;  2G9B A;  2P71 A;  1EG3 A;  2AAO A;  2CTN A;  3IQO A;  4INX A;  3UNW A;  4PE0 A;  2M29 A;  3CZ1 A;  1NCY A;  3L47 A;  3NSK A;  2GGM A;  1BMO A;  2QEB A;  4ORA B;  1NX2 A;  2MAZ A;  3AAJ A;  4PE4 A;  1BOC A;  1FPW A;  3OX6 A;  1NX0 A;  3PFV A;  2Q91 A;  3BJH A;  1EXR A;  1CDP A;  2BCX A;  4PHN A;  5F6T A;  1J7P A;  1V1F A;  2KNE A;  1LVC D;  1TNW A;  2K7O A;  2BEC A;  1IJ5 A;  1QIV A;  2CNP A;  2OS8 C;  1N65 A;  4IL1 A;  2KAY A;  1TNP A;  4C0L A;  1BF5 A;  4YGA A;  1KQM C;  3OBV A;  2K7C A;  2M97 A;  3FS7 A;  3Q8I A;  1J7O A;  5D69 A;  3EVU A;  2KDH A;  4HSZ A;  4ICB A;  5GQQ C;  2P70 A;  3D73 A;  1AP4 A;  1C7V A;  1XFY O;  4I5L B;  4M2O A;  4YGE B;  4A4C A;  3D10 A;  5I2L A;  1UWO A;  5IBW A;  1SL9 A;  5BPJ A;  1F70 A;  1QVI Y;  1F4O A;  2OS8 B;  1L2O C;  3S0F A;  1A29 A;  2KGB C;  3VB1 A;  1CFC A;  3OGN A;  1KQM B;  4ETO A;  5DKQ A;  1MXL C;  3QRX A;  2FCE A;  2H61 C;  4I5N B;  5I2Q A;  2KAV A;  1MWN A;  1NUB A;  3RLZ A;  1Y1X A;  1PUL A;  1U5I B;  1B7T Y;  1KFU L;  1QX7 A;  2KYC A;  1XFX O;  1QX2 A;  4GNK B;  4MBE A;  4PHJ A;  3KEV A;  1L2O B;  2LLS A;  1NWD A;  4YRU A;  2LP2 A;  4MZJ A;  1K9K A;  1ZFS A;  2OPO A;  1DJZ A;  3AKB A;  1OZO A;  2WCB A;  2LAN A;  2WCK A;  1PK0 D;  1YUR A;  3BOW B;  1PSB A;  4MSP A;  1XO5 A;  4A4B A;  3I5G B;  3EVR A;  2BE6 A;  4CLN A;  5K89 A;  3D78 A;  1UHJ A;  4DS7 A;  1ZUZ A;  2CXJ A;  1HT9 A;  2HPS A;  3NHI A;  1JFJ A;  5HKW A;  1FI5 A;  1DGV A;  1JF2 A;  2H8V A;  2M7L A;  3TUY B;  1BJF A;  5G08 A;  1Y0V H;  1FBV A;  3S0G A;  1AK8 A;  2QAC A;  3BUO B;  3CR5 X;  1TOP A;  1QVI Z;  1Z2C B;  2ZN9 A;  3SG5 A;  3FWB A;  2KFF A;  3I5I B;  3OP0 A;  3JTD C;  3BYA A;  1YX7 A;  1CDL A;  3R1O A;  1SL7 A;  2L5X B;  4XYN A;  3ZNI A;  1AHR A;  1B8L A;  3ICB A;  2LNK A;  3OB1 B;  4MEW A;  1IRJ A;  4N5X A;  1B7T Z;  1TNQ A;  3FE9 A;  3B88 A;  3O4Y A;  1EJ3 A;  1QXP A;  3KHE A;  1OE9 B;  1KFX S;  1CM4 A;  1QWV A;  2BCB A;  1DJW A;  4MRX A;  2G2B A;  2KI4 C;  2WCH A;  1EH2 A;  1DEL A;  3L4A A;  3CZ0 A;  1AVS A;  1MR8 A;  2EHB A;  1PAL A;  1KCY A;  2M0R A;  1KSM A;  1W9Z A;  3WHT B;  2AMI A;  1B1G A;  3CDN A;  1M45 A;  2GTE A;  3E3R A;  1OSA A;  2O5G A;  1TRF A;  1X02 A;  1UHH A;  1XFW O;  3R72 A;  2M9G A;  2MA2 A;  2KI4 B;  1XK4 C;  1OW4 A;  3D75 A;  2COL B; 
#chains in the Genus database with same CATH homology
 3EK7 A;  2ZN8 A;  1JC2 A;  3TDI A;  3BUW B;  1A75 B;  1RJV A;  1ZOT B;  5CSI A;  4FTG A;  2JWW A;  3HCM A;  4CFQ A;  2JTZ A;  2Y4Q A;  3O6B A;  2PMY A;  2Y1N A;  3NXA A;  2MLF C;  4OV2 A;  1WDC C;  1WLM A;  1NX3 A;  5AXI A;  1RK9 A;  2VRG A;  2NCO A;  3CTN A;  3PAL A;  4GGN A;  1EL4 A;  5CPV A;  4JWQ A;  3BQ3 A;  2ZND A;  3VGO A;  1AJ4 A;  1A2X A;  2HQ8 A;  1LA3 A;  3BUX B;  1YX8 A;  1K93 D;  4DIR A;  4MN0 A;  3BUM B;  1WDC B;  2NCP A;  3I5H C;  1K9P A;  1J7R A;  3OX5 A;  5DKN A;  2PAL A;  2CCM A;  2ZNE A;  3A8R A;  1Q80 A;  1JFK A;  1B4C A;  3VRR A;  2LM5 A;  1OZS A;  2L4I A;  1DT7 B;  4NDB A;  1M63 B;  1PVA A;  3SG4 A;  1H4B A;  2K8M B;  2WND A;  4NDC A;  2M7N A;  4I5J A;  1KK8 C;  2MHH A;  1Y1U A;  1B8C A;  2F3Z A;  3SG7 A;  3LLE A;  5HYD A;  4I5K A;  3I5H B;  1SNL A;  2JOJ A;  1W7J B;  1YUT A;  1PSR A;  2GV5 A;  2JPT A;  2JNF A;  3AKA A;  5I2O A;  1B9A A;  4PDZ A;  5HKY A;  2WC8 A;  1WLZ A;  3GK2 A;  3PN7 C;  4WQ3 A;  3M0W A;  4QJ5 B;  2Q4U A;  1KK8 B;  4GGF A;  1ZMZ A;  4M2Q A;  1ALW A;  3JVT C;  1HQV A;  1BLQ A;  1DTL A;  1C07 A;  1KFU S;  3CR2 A;  4JQ0 D;  2M8U A;  3GOF A;  2DOQ A;  1IQ3 A;  1F55 A;  1RWY A;  1A03 A;  1KWO C;  1CDM A;  2JT8 A;  1PVB A;  2KFG A;  3I5G C;  3PN7 B;  1K94 A;  1B8R A;  2K7D A;  1DF0 A;  2LHI A;  2FCD A;  3JVT B;  1N2D A;  1G33 A;  4MLW A;  1WRZ A;  3TUY C;  2NXQ A;  1NX1 A;  2LP3 A;  4QJ3 B;  1WRL A;  2OTG C;  4DCK A;  1JF0 A;  1KWO B;  5KU1 A;  1BR4 B;  1MXE A;  2CBL A;  3I5I C;  1OMD A;  2JT3 A;  3IF7 A;  3F45 A;  3BXK A;  5J3X A;  1YUU A;  2D8N A;  1S5G Y;  1TCF A;  4WQ2 A;  3OHM B;  4YGD B;  1REC A;  1SCM B;  1GGZ A;  1UP5 A;  5KTY A;  2HET A;  1WY9 A;  1M31 A;  2LVI A;  4QJ4 B;  1XFU O;  2L50 A;  1G4Y R;  1K95 A;  1XVJ A;  2I18 A;  2L51 A;  1RTP 1;  2B1U A;  2OTG B;  1Y1A A;  3CR4 X;  5CSJ A;  1NSH A;  3ZWH A;  1AJ5 A;  1J1E A;  1IH0 A;  2KAX A;  3O78 A;  1YRU B;  4GFT A;  4NDD A;  4YGB B;  1KQV A;  2IS9 A;  2I94 A;  4PAL A;  1QAS A;  1QV0 A;  3IQQ A;  2BL0 B;  3FIA A;  1OOJ A;  4AQI A;  1GGW A;  2EGD A;  5HKZ A;  1F8H A;  1D1O A;  1AUI B;  3KF9 A;  1F4Q A;  4GUK A;  4N1G A;  2RGI A;  4YI8 A;  3WNX B;  2JU0 A;  1A4P A;  3SIB A;  2PRU A;  2WCF A;  1CM1 A;  4MVF A;  5HLO A;  1IJ6 A;  2HF5 A;  2LE9 B;  2K2F A;  1S36 A;  1DVI A;  2JRF A;  1B47 A;  1DMO A;  3LK0 A;  3DF0 A;  3DVE A;  3PM8 A;  1NCX A;  1S5G Z;  4OVN F;  2LUC A;  1K90 D;  1R2U A;  2BE4 A;  4C0K A;  4YI9 A;  3I5F B;  1BOD A;  2H2K A;  3TS5 B;  1KK7 Y;  1SKT A;  3TDZ A;  1LXF C;  2SCP A;  2K7B A;  4GPL B;  1RRO A;  2GGZ A;  2E6W A;  4MRY A;  2MRD A;  5JOL A;  1CMG A;  1CNP A;  4NQG A;  2LVV A;  2LC5 A;  2JC2 A;  1SMG A;  1V1G A;  3LCP C;  3DVM A;  1QX5 B;  2BKI B;  4HRH A;  3SG3 A;  1SYM A;  1BR1 B;  1CMF A;  1QV1 A;  2LMU A;  2M3W A;  3CWG A;  2F33 A;  4U8D A;  2WOS A;  4YBH B;  5ER4 X;  2V53 A;  2E30 A;  1BU3 A;  4HRG A;  5AEQ A;  1CLL A;  1OMV A;  1K8U A;  3VRP A;  1F71 A;  5I8N A;  1SR6 C;  2JQ6 A;  4PE7 A;  2KHN A;  3D0Y A;  1QJT A;  1TIZ A;  1DJG A;  2KYF A;  3VRO A;  3DVJ A;  1SPY A;  2KQY A;  2KOT A;  3CGA A;  1ZAC A;  3MSE B;  3NSO A;  1BG1 A;  1E8A A;  2I7A A;  2LVK A;  4GGF C;  1YTZ C;  4UPG A;  4D1E A;  1SR6 B;  1OQP A;  4R1E A;  2L0P A;  1M46 A;  3EVV A;  1QLK A;  3NSL A;  2SAS A;  4MZK A;  1FW4 A;  3NSI A;  2BBN A;  3GK1 A;  4DRW A;  3EKH A;  2KI6 C;  1MUX A;  2TN4 A;  3EKJ A;  1DJI A;  1K2H A;  3BUN B;  2KFH A;  1UHI A;  1IGV A;  2NLN A;  2LUX A;  2O60 A;  5CSF A;  3EK4 A;  5CSN A;  3GK4 X;  1CFF A;  4OCI A;  1S6I A;  4GBA A;  1N0Y A;  1H8B A;  3HX4 A;  2FOT A;  2F3Y A;  2MJW B;  2ZFD A;  1XA5 A;  2K61 A;  1UUR A;  2LCP A;  4WRI A;  2I2R E;  2JZI A;  3DVK A;  4JPZ B;  1ALV A;  1SY9 A;  4ORB B;  1DGU A;  3CZT X;  1DF0 B;  5JJG A;  2M1U A;  1QIW A;  2F2P A;  1OMR A;  3SG6 A;  1SCM C;  4BY5 A;  3WHU B;  1SBJ A;  5KSZ A;  3K21 A;  4CFR A;  1CDN A;  2MBX A;  4AOM A;  1XFV O;  4PHK A;  1TN4 A;  1J55 A;  5HLV A;  3VRQ A;  4PCW A;  1NYA A;  1TNX A;  1W7I B;  1JUO A;  4XJK B;  4XJK A;  4Q04 A;  1YRT B;  1BT6 A;  2WOR A;  3TZ1 A;  3LL8 B;  5TNC A;  1EG4 A;  3KPX A;  3A4U B;  2M1K B;  1NIW A;  4OKH A;  1QAT A;  1IWQ A;  1U5I A;  5DKR A;  1JBA A;  2JUL A;  4ZCV A;  2BL0 C;  4E68 A;  2AUC A;  1SL8 A;  3PLF B;  3OB2 B;  2LLU A;  3SJS A;  1YVL A;  2BBM A;  4USL A;  5AAN A;  1FI6 A;  2HQW A;  1FF1 A;  2H61 A;  1QTX A;  1CTR A;  1LIN A;  2LLT A;  1CFD A;  2L98 A;  3BOW A;  1R6P A;  1CB1 A;  4MZL A;  3CLN A;  2LHL A;  1GJY A;  1NP8 A;  1L7Z A;  1MF8 B;  2LMT A;  4CPV A;  2NZ0 A;  4OR9 B;  4YGC B;  1XFZ O;  5FYX A;  1UHN A;  2LV7 A;  1G8I A;  1SCV A;  4ORC B;  1ODB A;  1C7W A;  1UHK A;  1S26 D;  3I5F C;  3WXA A;  2K0J A;  1SK6 D;  2PAS A;  4HRE E;  4M2P A;  3CS1 A;  3TS5 C;  2F2O A;  2L2E A;  1TCO B;  2L4H A;  2R2I A;  2ZKM X;  3DF0 B;  4FQO A;  2JNX A;  2PSR A;  1S1E A;  2A4J A;  4C0J A;  2BCA A;  5B8I B;  2MLE C;  1IKU A;  4DUQ A;  2LMV A;  2PVB A;  2KGR A;  4PHM A;  2WCE A;  1CFP A;  2JXL A;  2JT0 A;  1M39 A;  1S6C A;  2JTT A;  4ZCU A;  1SW8 A;  1SRA A;  3JTD B;  1RFJ A;  4CID A;  3RM1 A;  2BKH B;  2EC6 C;  5D7F A;  4AQJ A;  2ZRS A;  1CLM A;  4P5O E;  1DJH A;  2FJU B;  3SG2 A;  1JWD A;  2KBM A;  2CT9 A;  1WRK A;  3KO0 A;  1J7Q A;  5PAL A;  4L9M A;  3DD4 A;  1DJX A;  1LKJ A;  1YR5 A;  2KI6 D;  4BY4 A;  1S3P A;  2KBI A;  1VRK A;  3O2P A;  4TNC A;  2Y1M A;  1KFX L;  5AFP A;  5AER A;  1MQ1 A;  2ISD A;  2F8P A;  1JSA A;  4PE1 A;  1CKK A;  2EC6 B;  2LVJ A;  1S6J A;  1NCZ A;  3AAK A;  1LA0 A;  1IG5 A;  2Y5I A;  1GQM A;  2JXC A;  2M49 B;  5ER5 A;  3EK8 A;  1NPQ A;  3SIA A;  3D0Y B;  1YUS A;  1QS7 A;  3FWC A;  3PSR A;  1IQ5 A;  3C1V A;  3PAT A;  1PRW A;  2ZRT A;  2K2A A;  2QPT A;  1A75 A;  4N1F A;  1K96 A;  1UUS A;  3VRN A;  1CLB A;  2LAP A;  3TDU A;  1DJY A;  1TTX A;  1J1D A;  1KSO A;  4F0Z B;  2P6B B;  1XYD A;  1KK7 Z;  1XK4 A;  4GAO A;  1F54 A;  3LK1 A;  4P2Y B;  1YVH A;  1MHO A;  2KSP A;  1K9U A;  1QLS A;  3H4S E;  2KQ6 A;  1Y6W A;  2G9B A;  1EG3 A;  2AAO A;  2CTN A;  3IQO A;  4PE0 A;  2M29 A;  3NSK A;  1NCY A;  2GGM A;  1BMO A;  4ORA B;  1NX2 A;  2MAZ A;  3AAJ A;  4PE4 A;  1BOC A;  1FPW A;  3OX6 A;  1NX0 A;  3PFV A;  2Q91 A;  4PHN A;  1EXR A;  1CDP A;  2BCX A;  5F6T A;  1J7P A;  1V1F A;  2KNE A;  1LVC D;  1TNW A;  2K7O A;  2BEC A;  1IJ5 A;  1QIV A;  2CNP A;  2OS8 C;  1N65 A;  4IL1 A;  2KAY A;  1TNP A;  4C0L A;  1BF5 A;  4YGA A;  1KQM C;  2K7C A;  2M97 A;  3FS7 A;  1J7O A;  5D69 A;  3EVU A;  2KDH A;  4HSZ A;  4ICB A;  5GQQ C;  1AP4 A;  1C7V A;  1XFY O;  4I5L B;  4M2O A;  4YGE B;  4A4C A;  3D10 A;  5I2L A;  1UWO A;  5IBW A;  1SL9 A;  5BPJ A;  1F70 A;  1QVI Y;  1F4O A;  2OS8 B;  1L2O C;  1A29 A;  2KGB C;  1CFC A;  1KQM B;  4ETO A;  5DKQ A;  1MXL C;  3QRX A;  2FCE A;  2H61 C;  4I5N B;  5I2Q A;  2KAV A;  1MWN A;  1NUB A;  3RLZ A;  1Y1X A;  1PUL A;  1U5I B;  1B7T Y;  1KFU L;  1QX7 A;  2KYC A;  1XFX O;  1QX2 A;  4GNK B;  4MBE A;  4PHJ A;  3KEV A;  1L2O B;  2LLS A;  1NWD A;  4YRU A;  2LP2 A;  4MZJ A;  1K9K A;  1ZFS A;  2OPO A;  1DJZ A;  3AKB A;  1OZO A;  2WCB A;  2LAN A;  1PK0 D;  1YUR A;  3BOW B;  1PSB A;  4MSP A;  1XO5 A;  4A4B A;  3I5G B;  3EVR A;  2BE6 A;  4CLN A;  5K89 A;  1UHJ A;  4DS7 A;  1ZUZ A;  2CXJ A;  1HT9 A;  2HPS A;  1JFJ A;  5HKW A;  1FI5 A;  1DGV A;  1JF2 A;  2M7L A;  3TUY B;  1BJF A;  5G08 A;  1Y0V H;  1FBV A;  1AK8 A;  2QAC A;  3BUO B;  3CR5 X;  1TOP A;  1QVI Z;  2ZN9 A;  3SG5 A;  3FWB A;  2KFF A;  3I5I B;  3OP0 A;  3JTD C;  3BYA A;  1YX7 A;  1CDL A;  1SL7 A;  2L5X B;  4XYN A;  3ZNI A;  1AHR A;  1B8L A;  3ICB A;  2LNK A;  3OB1 B;  4MEW A;  1IRJ A;  4N5X A;  1B7T Z;  1TNQ A;  3O4Y A;  1EJ3 A;  1QXP A;  3KHE A;  1OE9 B;  1KFX S;  1CM4 A;  2BCB A;  1DJW A;  4MRX A;  2G2B A;  2KI4 C;  1EH2 A;  1AVS A;  1MR8 A;  2EHB A;  1PAL A;  1KCY A;  2M0R A;  1KSM A;  3WHT B;  2AMI A;  1B1G A;  1M45 A;  3E3R A;  1OSA A;  2O5G A;  1TRF A;  1X02 A;  1UHH A;  1XFW O;  2M9G A;  2MA2 A;  2KI4 B;  1XK4 C;  2COL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...