2JXLA

Solution structure of cardiac n-domain troponin c mutant f77w-v82a
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
89
structure length
89
Chain Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEWLVMMARCMKDDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title Tryptophan Mutants of Cardiac Troponin C: 3D Structure, Troponin I Affinity, and in Situ Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 20
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2007-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jxlA00
1KFUL 1XYDA 2JC2A 1DTLA 1LA3A 3EKJA 1R2UA 4GGFA 4I5NB 2NLNA 3NSOA 5D69A 1PVAA 1RK9A 1IG5A 4Q04A 1JF0A 4PHNA 5DKRA 1CDMA 1J7OA 3PALA 1CFFA 3CLNA 4GAOA 1RTP1 1N0YA 4CFRA 4FTGA 3WXAA 2LP3A 1MHOA 4R1EA 2TN4A 2LC5A 1BLQA 2K7BA 2LMTA 4E68A 2BKHB 3EK4A 3O4YA 2BKIB 2BE4A 4CFQA 4XYNA 2H2KA 1XFWO 1BG1A 1VRKA 4MLWA 3WHUB 1K90D 2KHNA 1UHNA 3TDUA 1CKKA 1A4PA 3JVTB 1B8LA 3GOFA 2ZN9A 2KBIA 1F4OA 2OS8B 2KI4B 1K95A 1ALVA 1C7WA 1CLLA 3BUNB 1DJIA 1SYMA 3LL8B 1BJFA 2BL0B 1TCOB 4MZJA 3WHTB 1H4BA 1XO5A 2CT9A 3BOWB 1DGVA 4GGFC 4IL1A 1LVCD 1TOPA 1C7VA 1YR5A 2AAOA 5HLVA 3TS5B 4QJ5B 2LUXA 1OOJA 4PE4A 1F70A 1KFUS 1K94A 1A75A 1NX3A 1DF0B 1LKJA 1D1OA 5I2LA 4N5XA 4MZLA 1DMOA 1XK4C 4USLA 3HCMA 2D8NA 2F3ZA 2R2IA 2KQ6A 2E30A 1QVIY 3BUXB 3F45A 1AK8A 1F4QA 3AAJA 2JU0A 1H8BA 1IGVA 4F0ZB 2Y1MA 3KF9A 4P5OE 1TIZA 2LHIA 4YGEB 1XFVO 5CSNA 3SG2A 2MJWB 5F6TA 4HRHA 4YI9A 1DT7B 1V1FA 1A03A 1SRAA 2M3WA 1QLKA 1BT6A 3PLFB 1BODA 1B9AA 4JPZB 1KSOA 2KAVA 5JOLA 2MAZA 2Y5IA 3DD4A 4WQ2A 2SCPA 1EG3A 4GPLB 1QVIZ 3SG7A 4OCIA 1M31A 2JULA 2BE6A 4PHKA 1KFXL 1AUIB 1ZFSA 2CTNA 2I18A 2ZNEA 4YGCB 1NCZA 1YURA 1SMGA 3NSKA 2LM5A 5HYDA 1IH0A 1RFJA 2NZ0A 2PMYA 2WORA 5J3XA 1ALWA 3JVTC 1PSRA 2M97A 1RJVA 1M39A 2VRGA 5B8IB 2K8MB 2OS8C 1B8RA 4PE0A 2JNFA 2O60A 1E8AA 4ZCUA 3DVEA 1CMFA 4HRGA 3CWGA 5AERA 1AP4A 5PALA 1YUUA 4GNKB 1KSMA 1MXLC 2GGZA 2CNPA 3CGAA 2JTZA 1S1EA 3LK0A 4XJKA 3TS5C 5AEQA 1L7ZA 1UHIA 2GV5A 1NCXA 3KHEA 1C07A 2KQYA 2HPSA 1TRFA 1NWDA 2LMUA 2G2BA 3SIBA 1ZACA 2FJUB 2L0PA 2KNEA 1B8CA 3KEVA 3O2PA 4NDBA 2M7NA 2Q91A 5JJGA 2JTTA 3SG3A 1EL4A 1EXRA 3GK2A 2MLEC 4YGDB 4CPVA 2DOQA 2GGMA 1G4YR 1MR8A 1KFXS 1XVJA 1IJ6A 2NCOA 2I2RE 1J1DA 4N1GA 1QV1A 2JT8A 2LVKA 2F33A 3O78A 2FOTA 4OKHA 1K9KA 1MUXA 4C0JA 4MRYA 2WOSA 3FS7A 3PM8A 3VGOA 1A75B 1QJTA 5AANA 2F8PA 1Y0VH 1KQMC 4MEWA 4ORAB 1EG4A 1HT9A 1UHKA 1B7TZ 2KFGA 2L50A 4YGAA 3TUYB 1CM4A 1K93D 1CTRA 3PSRA 3DVJA 5K89A 1AVSA 2KGBC 4NDCA 3AKBA 2KSPA 3KPXA 5G08A 2LLSA 1BF5A 1JFJA 2ZKMX 1QS7A 5HLOA 1F54A 3OP0A 3JTDC 2KGRA 4PALA 2JRFA 3SG5A 1QIVA 2L4HA 1OMVA 2KFHA 5KSZA 1YRTB 1Y6WA 1F55A 3VRRA 1QX5B 2O5GA 4M2PA 4MN0A 2LMVA 2WCFA 3I5FC 3GK1A 4CLNA 3DVKA 1YX7A 3M0WA 2CCMA 2MA2A 4PHMA 1SL8A 4A4BA 3GK4X 2JOJA 5ER4X 1Y1UA 4DIRA 1OZSA 1JUOA 3EVRA 1SKTA 1YVLA 1B47A 2Y4QA 1K9UA 1PALA 2PASA 1A29A 3I5IC 5CPVA 3K21A 2MLFC 2KAXA 2K61A 2BECA 4PE1A 1QXPA 4PHJA 3HX4A 1SY9A 2K7OA 3CS1A 1CLBA 1UHJA 1JC2A 1YUSA 3FWBA 1RWYA 2KBMA 1XFZO 1UP5A 1IRJA 1SCMB 2LCPA 3ICBA 4YBHB 3BXKA 1OSAA 2K2AA 2LVIA 2Q4UA 3RLZA 3O6BA 1KQMB 3OB1B 1KK8C 4BY5A 1OZOA 1JWDA 4MBEA 4BY4A 2M49B 3ZWHA 4XJKB 1OMDA 2PVBA 3BYAA 1WRKA 4AQJA 2K0JA 1J1EA 1NCYA 1FBVA 3IQOA 3D0YA 3LCPC 2QPTA 1TNPA 2BCBA 1B1GA 1DJXA 2EHBA 4P2YB 2ZN8A 1K9PA 1OMRA 2WNDA 3OHMB 5I2QA 3JTDB 1NPQA 1LXFC 3TUYC 2LANA 2F2PA 1SCVA 3VROA 4AOMA 1SL7A 1WLZA 2LE9B 1BU3A 1TNXA 1S5GY 1S6CA 1YTZC 1J55A 3DF0A 1ZOTB 1JSAA 1K2HA 5KU1A 1G33A 3I5FB 1EH2A 3OX6A 1DJGA 1CDNA 2KAYA 2KOTA 2JQ6A 1CM1A 4JWQA 1V1GA 4GGNA 1J7PA 3TZ1A 4PE7A 1AJ5A 3I5GC 4QJ4B 3PFVA 4ORCB 1OE9B 3SG6A 3I5IB 2JXLA 2LLUA 2CBLA 2ZRSA 1LINA 2ZRTA 1SK6D 2QACA 1CFCA 4TNCA 1CNPA 1PULA 1S5GZ 1PSBA 4ICBA 4MVFA 4NQGA 1K8UA 1KK7Y 1KCYA 1GJYA 2BBNA 2IS9A 5HKZA 5HKWA 1IQ5A 1K96A 2M1KB 2ZNDA 4I5JA 5ER5A 5CSJA 3SJSA 4I5KA 1SNLA 1WRZA 2LP2A 1YVHA 2HF5A 1CB1A 1RECA 2K7CA 4JQ0D 1NX2A 2LUCA 1KK8B 1X02A 2L98A 2LAPA 1FI5A 1SCMC 1IWQA 1R6PA 1SR6B 2WCBA 3VRNA 1FF1A 1TN4A 3EVUA 1ZMZA 4ORBB 1PK0D 1S6JA 1KWOC 1DJWA 3CZTX 2K2FA 4U8DA 1UUSA 2L51A 3CR5X 1N2DA 4GUKA 2M29A 2M9GA 1U5IA 2OPOA 4M2QA 2WCEA 2AMIA 2LHLA 1DJHA 1WRLA 3A4UB 1IKUA 1YRUB 2M1UA 2LV7A 1QASA 2MRDA 1MXEA 2H61A 4DS7A 1S3PA 1CMGA 1AJ4A 1EJ3A 2LLTA 5TNCA 1MF8B 5AXIA 1WY9A 2B1UA 5GQQC 1XK4A 3I5HB 2G9BA 3KO0A 1PVBA 1GQMA 1SBJA 1CFDA 3BUMB 1L2OC 1QV0A 1TTXA 5BPJA 3I5GB 2JT3A 4OVNF 4UPGA 3EKHA 1WLMA 2LVVA 2SASA 1DVIA 1Y1AA 1HQVA 1G8IA 2M0RA 2PRUA 1IJ5A 2EC6B 3LLEA 4WRIA 1SL9A 4HSZA 5DKNA 1BR4B 1MWNA 2KI6C 2OTGB 3CR4X 1M63B 3D0YB 4QJ3B 1N65A 3TDZA 1WDCC 2ZFDA 1XA5A 3OX5A 1QLSA 2L5XB 1QATA 2KFFA 3EVVA 1NP8A 2F3YA 3TDIA 1TNQA 2EGDA 2LVJA 2F2OA 4DUQA 5D7FA 4AQIA 1JFKA 3PN7B 1B4CA 1J7QA 1JBAA 1DJZA 1FW4A 2WC8A 3DF0B 4N1FA 2H61C 4GBAA 2Y1NA 3AAKA 1LA0A 1Q80A 4C0KA 1NUBA 1NYAA 3A8RA 1KWOB 4D1EA 2RGIA 2FCEA 1A2XA 4I5LB 2ISDA 1UURA 3FWCA 4WQ3A 5CSFA 2JPTA 1QIWA 1M45A 1SR6C 2M8UA 3ZNIA 3CR2A 1XFYO 3MSEB 1NSHA 4NDDA 1S26D 3H4SE 3DVMA 4HREE 4FQOA 1CLMA 3QRXA 2KDHA 4DCKA 1BMOA 2NXQA 2NCPA 1Y1XA 1QX2A 1YUTA 1NX0A 3BOWA 2V53A 3RM1A 1RROA 5HKYA 1CDPA 3IQQA 1YX8A 1QX7A 4ETOA 2FCDA 3EK8A 1L2OB 3PATA 3LK1A 4YI8A 3OB2B 2M7LA 1TNWA 3WNXB 3E3RA 3D10A 1NX1A 1FPWA 2BBMA 1M46A 5I2OA 1IQ3A 1DF0A 1CFPA 5CSIA 2JZIA 1BOCA 1QTXA 3I5HC 1ZUZA 1XFUO 2L4IA 5AFPA 1AHRA 2JT0A 4MZKA 1MQ1A 2LNKA 2I94A 4YRUA 5FYXA 2KYFA 3SIAA 3VRPA 2HQ8A 1UWOA 2MBXA 3BQ3A 1OQPA 2CXJA 2COLB 3NXAA 1WDCB 5DKQA 1DGUA 4C0LA 2E6WA 3VRQA 3CTNA 1BR1B 1U5IB 2EC6C 4M2OA 4CIDA 3SG4A 4PDZA 2KI6D 4YGBB 2P6BB 1F8HA 2OTGC 3AKAA 1S36A 2K7DA 1TCFA 2BCAA 1JF2A 1W7JB 2KI4C 1UHHA 2BCXA 2I7AA 4PCWA 3IF7A 2BL0C 1ODBA 3BUOB 4A4CA 1SW8A 2JXCA 4DRWA 5IBWA 2HQWA 1GGZA 1DJYA 1PRWA 2KYCA 4L9MA 1NIWA 1FI6A 3NSLA 3C1VA 2PALA 3PN7C 1S6IA 2L2EA 1XFXO 2JNXA 1KQVA 5I8NA 2AUCA 3NSIA 1SPYA 4GFTA 4OV2A 1GGWA 4ZCVA 3BUWB 4OR9B 1F71A 3EK7A 2A4JA 1B7TY 1CDLA 1W7IB 4MRXA 4MSPA 5KTYA 1J7RA 2JWWA 2MHHA 2PSRA 3FIAA 2HETA 1KK7Z
chains in the Genus database with same CATH superfamily
1KFUL 1XYDA 2JC2A 1DTLA 1LA3A 3EKJA 1R2UA 2WCHA 4GGFA 4I5NB 2NLNA 3NSOA 5D69A 1PVAA 1RK9A 1IG5A 4Q04A 1JF0A 1W9ZA 4PHNA 3QMEA 1CDMA 1TUZA 5DKRA 1J7OA 3PALA 2WCKA 1CFFA 3CLNA 1QWVA 4GAOA 1RTP1 1N0YA 4CFRA 4FTGA 3WXAA 2LP3A 1MHOA 4R1EA 2TN4A 2LC5A 1BLQA 2K7BA 2LMTA 4E68A 2BKHB 3EK4A 3O4YA 2BKIB 3BFBA 2BE4A 4CFQA 4XYNA 2H2KA 1XFWO 1BG1A 1VRKA 4JKTA 4MLWA 3WHUB 2BAPA 2QEBA 3CABA 1K90D 2KHNA 1UHNA 1DELA 3CDNA 3TDUA 1IIOA 1CKKA 1A4PA 3JVTB 5FI2A 1DEKA 1B8LA 3GOFA 2ZN9A 2KBIA 1F4OA 2OS8B 2KI4B 1K95A 1ALVA 1C7WA 1CLLA 3BUNB 1DJIA 1SYMA 3LL8B 1BJFA 2BL0B 1TCOB 2L2CA 3B88A 4MZJA 3WHTB 1H4BA 3Q8IA 1XO5A 1P28A 2CT9A 3BOWB 1DGVA 4GGFC 4IL1A 1LVCD 1TOPA 1C7VA 1YR5A 2AAOA 5HLVA 3TS5B 3VB1A 4QJ5B 2LUXA 1OOJA 4PE4A 1F70A 1KFUS 1K94A 1A75A 1NX3A 1DF0B 1LKJA 1D1OA 5I2LA 4N5XA 4MZLA 1DMOA 1XK4C 4USLA 3HCMA 2D8NA 2F3ZA 2R2IA 2KQ6A 2E30A 1OOIX 1QVIY 3BUXB 3F45A 1C3ZA 1AK8A 1F4QA 3UNWA 3AAJA 2JU0A 1H8BA 1IGVA 4F0ZB 2Y1MA 3KF9A 4P5OE 1TIZA 2LHIA 4YGEB 1XFVO 5CSNA 3DXLA 3SG2A 2MJWB 5F6TA 4HRHA 4YI9A 1DT7B 1V1FA 3D76A 3IVTA 1A03A 1C3YA 1SRAA 2M3WA 1QLKA 3R1OA 1BT6A 3PLFB 1BODA 1B9AA 4JPZB 1KSOA 1GM0A 2KAVA 5EL2A 5JOLA 2MAZA 2Y5IA 3DD4A 4WQ2A 2SCPA 1EG3A 4GPLB 1QVIZ 3SG7A 4OCIA 1M31A 2JULA 2BE6A 2FJYA 4PHKA 1KFXL 1AUIB 1ZFSA 2CTNA 2I18A 2ZNEA 4YGCB 1NCZA 1YURA 1SMGA 3NSKA 1SSEB 2LM5A 2WC6A 5HYDA 1IH0A 1TWOA 1RFJA 2NZ0A 2PMYA 2WORA 5J3XA 2L5YA 1ALWA 3S0FA 3JVTC 1PSRA 2M97A 1RJVA 1M39A 2VRGA 5B8IB 2K8MB 2OS8C 1B8RA 3DY9A 4PE0A 2H8VA 3R1VA 2JNFA 2O60A 1E8AA 4ZCUA 3DVEA 1CMFA 4HRGA 3SS4A 3CWGA 5AERA 2P70A 1AP4A 5PALA 1YUUA 1XFRA 2PYQA 4GNKB 1KSMA 1MXLC 2GGZA 2CNPA 3CGAA 2JTZA 1S1EA 3LK0A 4XJKA 3TS5C 5AEQA 1L7ZA 1UHIA 2GV5A 1NCXA 3KHEA 1C07A 2KQYA 2HPSA 1TRFA 1NWDA 2LMUA 2G2BA 3SIBA 1ZACA 2FJUB 2L0PA 2KNEA 1B8CA 3KEVA 3O2PA 4NDBA 2M7NA 2Q91A 5JJGA 2JTTA 3SG3A 1EL4A 1EXRA 3GK2A 2MLEC 4YGDB 4CPVA 1DC1A 2DOQA 5HL1A 3DZTA 2GGMA 1XVJA 1G4YR 1KFXS 1MR8A 1IJ6A 2BNXA 2NCOA 2I2RE 1J1DA 4N1GA 1QV1A 2JT8A 2QEHA 2LVKA 2F33A 3L47A 3O78A 2FOTA 4OKHA 3S0AA 1K9KA 1MUXA 3K1EA 2WCJA 4C0JA 2QEVA 4MRYA 2WOSA 3FS7A 3PM8A 3VGOA 1A75B 1QJTA 5AANA 2F8PA 1Y0VH 1KQMC 4MEWA 4ORAB 1EG4A 1HT9A 1UHKA 1B7TZ 1OOFA 2KFGA 2L50A 4YGAA 3TUYB 1CM4A 1K93D 1CTRA 3PSRA 3DVJA 5K89A 1AVSA 2KGBC 2QEOA 3AKBA 4NDCA 2KSPA 3S0EA 3KPXA 5G08A 2LLSA 1BF5A 1JFJA 2ZKMX 3CZ2A 1QS7A 5HLOA 1F54A 3OP0A 3JTDC 2KGRA 4PALA 2JRFA 3SG5A 1QIVA 3D73A 2L4HA 1OMVA 2KFHA 5KSZA 1YRTB 4JD9A 1Y6WA 1F55A 3O4XA 3UO9A 3VRRA 5FI6A 1QX5B 2O5GA 4M2PA 4MN0A 2LMVA 2WCFA 3I5FC 3GK1A 4CLNA 3OBVA 3DVKA 3S0DA 1TUJA 1YX7A 2KLDA 3M0WA 2CCMA 2MA2A 4PHMA 1SL8A 4A4BA 3GK4X 2JOJA 5ER4X 1Y1UA 3BFAA 1OZSA 1JUOA 3EVRA 3L4AA 1SKTA 4DIRA 1YVLA 1B47A 2Y4QA 1K9UA 1PALA 2PASA 1A29A 3I5IC 5CPVA 3K21A 2MLFC 2KAXA 2K61A 2BECA 1T14A 4PE1A 1QXPA 4PHJA 3HX4A 1SY9A 2K7OA 3CS1A 3PJIA 3BFHA 1CLBA 1UHJA 1JC2A 4INWA 1YUSA 3FWBA 1RWYA 2KBMA 1XFZO 2KPHA 1UP5A 1IRJA 1SCMB 2LCPA 3B6XA 3ICBA 4YBHB 2PQLA 2QDIA 3BXKA 1OSAA 2K2AA 2LVIA 2Q4UA 2WC5A 3RLZA 3O6BA 1KQMB 3OB1B 1KK8C 4BY5A 1OZOA 1JWDA 4MBEA 4INXA 4BY4A 3S0GA 2M49B 3ZWHA 4XJKB 1OMDA 2PVBA 3BYAA 1WRKA 4AQJA 2K0JA 1J1EA 1NCYA 1FBVA 3IQOA 3D0YA 3LCPC 2QPTA 1TNPA 2BCBA 1B1GA 1DJXA 2EHBA 4P2YB 2ZN8A 3FE9A 1K9PA 1OMRA 2WNDA 3FE8A 3OHMB 5I2QA 3JTDB 4F7FA 1NPQA 1LXFC 3TUYC 2LANA 2F2PA 1SCVA 3VROA 4AOMA 1SL7A 1WLZA 2LE9B 1BU3A 1TNXA 1S5GY 1S6CA 1YTZC 1J55A 3DF0A 1ZOTB 1JSAA 1K2HA 5KU1A 1G33A 3I5FB 1EH2A 3OX6A 1DJGA 1CDNA 2KAYA 2KOTA 2JQ6A 1CM1A 4JWQA 1V1GA 4GGNA 1J7PA 3TZ1A 4PE7A 1AJ5A 3I5GC 4QJ4B 3NHIA 3PFVA 1OE9B 4ORCB 3SG6A 3I5IB 2JXLA 2LLUA 2CBLA 3B87A 4PT1A 2ZRSA 1LINA 2ZRTA 1SK6D 2QACA 1CFCA 4TNCA 1CNPA 1PULA 1S5GZ 1PSBA 4ICBA 4MVFA 3PM2A 4NQGA 3D78A 1K8UA 1KK7Y 1KCYA 1GJYA 2BBNA 5D3OA 2IS9A 5HKZA 2K60A 1IQ5A 5HKWA 3V2LA 1K96A 2M1KB 2ZNDA 4I5JA 5ER5A 5CSJA 3SJSA 4I5KA 1SNLA 1WRZA 2LP2A 1YVHA 2HF5A 1CB1A 1RECA 2K7CA 4JQ0D 1NX2A 2LUCA 1KK8B 1X02A 2L98A 2LAPA 1FI5A 1SCMC 1IWQA 1R6PA 1SR6B 2WCBA 2GTEA 3VRNA 1FF1A 1TN4A 3EVUA 1ZMZA 3OGNA 1PK0D 1S6JA 1KWOC 4ORBB 1DJWA 3FE6A 3CZTX 2K2FA 3D74A 4U8DA 1UUSA 2L51A 3CR5X 1N2DA 3NHTA 2M29A 4GUKA 2M9GA 1U5IA 3SS5A 2OPOA 4M2QA 1OW4A 2WCEA 2AMIA 2LHLA 3R1PA 1DJHA 1WRLA 3A4UB 1IKUA 1YRUB 2M1UA 2LV7A 1QASA 2MRDA 3BJHA 1MXEA 2YGUA 2H61A 4DS7A 1S3PA 1CMGA 1AJ4A 1EJ3A 2LLTA 5TNCA 1MF8B 5AXIA 1WY9A 2B1UA 3CZ0A 1XK4A 5GQQC 3I5HB 2G9BA 3KO0A 3L4LA 1PVBA 5I94A 1GQMA 1SBJA 1CFDA 3BUMB 1L2OC 1QV0A 1TTXA 5BPJA 3I5GB 2JT3A 4OVNF 4UPGA 3EKHA 2WCLA 1WLMA 2LVVA 2SASA 1DVIA 1Y1AA 1HQVA 1G8IA 4KYNA 2M0RA 2PRUA 1IJ5A 1DQEA 2EC6B 3B7AA 3LLEA 1SL9A 4WRIA 4HSZA 5DKNA 3CYZA 1BR4B 1MWNA 2KI6C 2OTGB 3CR4X 1M63B 3D0YB 4QJ3B 1N65A 3TDZA 1WDCC 2JPOA 2ZFDA 1XA5A 3OX5A 1QLSA 2L5XB 1QATA 2KFFA 3EVVA 1NP8A 2F3YA 3TDIA 1TNQA 2EGDA 2LVJA 2F2OA 4DUQA 5D7FA 4AQIA 1JFKA 3PN7B 1B4CA 1J7QA 1JBAA 1DJZA 1FW4A 2WC8A 3DF0B 4N1FA 2H61C 4GBAA 2Y1NA 3AAKA 1LA0A 1Q80A 4C0KA 1NUBA 1NYAA 3A8RA 1KWOB 4D1EA 2RGIA 2FCEA 1A2XA 4I5LB 2ISDA 1UURA 3FWCA 4WQ3A 5CSFA 3S0BA 2JPTA 1QIWA 1M45A 1Z4HA 1SR6C 2M8UA 5FI7A 3ZNIA 3CR2A 1XFYO 3MSEB 1NSHA 4NDDA 1S26D 3H4SE 3DVMA 4HREE 4FQOA 1CLMA 3QRXA 2KDHA 4DCKA 1BMOA 2NXQA 2NCPA 1Y1XA 3D75A 1QX2A 2KLEA 1YUTA 1NX0A 3BOWA 2V53A 3RM1A 1RROA 5HKYA 1CDPA 1ORGA 3B86A 4OZDA 3IQQA 1YX8A 1QX7A 3N7HA 4ETOA 2FCDA 3EK8A 1L2OB 3PATA 1OOGA 3LK1A 5DICA 4YI8A 3OB2B 2M7LA 1TNWA 3WNXB 1LS8A 3E3RA 3D10A 4FQTA 1NX1A 1FPWA 2BBMA 1M46A 5I2OA 1IQ3A 1DF0A 1CFPA 5CSIA 2JZIA 3D77A 1BOCA 1QTXA 3I5HC 1ZUZA 1XFUO 2ERBA 2L4IA 5AFPA 1AHRA 2JT0A 4MZKA 3R72A 1MQ1A 2LNKA 2I94A 4YRUA 5FYXA 2KYFA 3SIAA 3VRPA 2HQ8A 1UWOA 2MBXA 3BQ3A 1OQPA 2CXJA 2COLB 3NXAA 1WDCB 3EG5B 5DKQA 1DGUA 4C0LA 2E6WA 3VRQA 3CTNA 1BR1B 1U5IB 2EC6C 2P71A 4M2OA 4CIDA 3SG4A 4PDZA 2KI6D 4YGBB 2P6BB 1Z2CB 2OTGC 3AKAA 1S36A 2K7DA 2WCMA 1F8HA 1TCFA 2BCAA 1JF2A 1W7JB 2KI4C 1UHHA 2BCXA 2I7AA 4PCWA 3IF7A 2BL0C 1ODBA 3BUOB 4A4CA 1SW8A 2JXCA 4DRWA 5IBWA 2HQWA 1GGZA 1DJYA 1PRWA 2KYCA 4L9MA 1NIWA 1FI6A 3NSLA 3C1VA 2PALA 3PN7C 1S6IA 2L2EA 3NGVA 1XFXO 3SS3A 2JNXA 1KQVA 5I8NA 2AUCA 3DYEA 1OOHA 3NSIA 1SPYA 4IJ7A 4GFTA 4OV2A 1GGWA 3CZ1A 4ZCVA 3BUWB 4OR9B 1F71A 3RZSA 3EK7A 2A4JA 1B7TY 1CDLA 1W7IB 4MRXA 4MSPA 5KTYA 1J7RA 2JWWA 2MHHA 2PSRA 3FIAA 2HETA 1KK7Z
chains in the Genus database with same CATH topology
1KFUL 1XYDA 2JC2A 1DTLA 1LA3A 3EKJA 1R2UA 4GGFA 4I5NB 2NLNA 3NSOA 5D69A 1PVAA 1RK9A 1IG5A 4Q04A 1JF0A 4PHNA 5DKRA 1CDMA 1J7OA 3PALA 1CFFA 3CLNA 4GAOA 1RTP1 1N0YA 4CFRA 4FTGA 3WXAA 2LP3A 1MHOA 4R1EA 2TN4A 2LC5A 1BLQA 2K7BA 2LMTA 4E68A 2BKHB 3EK4A 3O4YA 2BKIB 2BE4A 4CFQA 4XYNA 2H2KA 1XFWO 1BG1A 1VRKA 4MLWA 3WHUB 1K90D 2KHNA 1UHNA 3TDUA 1CKKA 1A4PA 3JVTB 1B8LA 3GOFA 2ZN9A 2KBIA 1F4OA 2OS8B 2KI4B 1K95A 1ALVA 1C7WA 1CLLA 3BUNB 1DJIA 1SYMA 3LL8B 1BJFA 2BL0B 1TCOB 4MZJA 3WHTB 1H4BA 1XO5A 2CT9A 3BOWB 1DGVA 4GGFC 4IL1A 1LVCD 1TOPA 1C7VA 1YR5A 2AAOA 5HLVA 3TS5B 4QJ5B 2LUXA 1OOJA 4PE4A 1F70A 1KFUS 1K94A 1A75A 1NX3A 1DF0B 1LKJA 1D1OA 5I2LA 4N5XA 4MZLA 1DMOA 1XK4C 4USLA 3HCMA 2D8NA 2F3ZA 2R2IA 2KQ6A 2E30A 1QVIY 3BUXB 3F45A 1AK8A 1F4QA 3AAJA 2JU0A 1H8BA 1IGVA 4F0ZB 2Y1MA 3KF9A 4P5OE 1TIZA 2LHIA 4YGEB 1XFVO 5CSNA 3SG2A 2MJWB 5F6TA 4HRHA 4YI9A 1DT7B 1V1FA 1A03A 1SRAA 2M3WA 1QLKA 1BT6A 3PLFB 1BODA 1B9AA 4JPZB 1KSOA 2KAVA 5JOLA 2MAZA 2Y5IA 3DD4A 4WQ2A 2SCPA 1EG3A 4GPLB 1QVIZ 3SG7A 4OCIA 1M31A 2JULA 2BE6A 4PHKA 1KFXL 1AUIB 1ZFSA 2CTNA 2I18A 2ZNEA 4YGCB 1NCZA 1YURA 1SMGA 3NSKA 2LM5A 5HYDA 1IH0A 1RFJA 2NZ0A 2PMYA 2WORA 5J3XA 1ALWA 3JVTC 1PSRA 2M97A 1RJVA 1M39A 2VRGA 5B8IB 2K8MB 2OS8C 1B8RA 4PE0A 2JNFA 2O60A 1E8AA 4ZCUA 3DVEA 1CMFA 4HRGA 3CWGA 5AERA 1AP4A 5PALA 1YUUA 4GNKB 1KSMA 1MXLC 2GGZA 2CNPA 3CGAA 2JTZA 1S1EA 3LK0A 4XJKA 3TS5C 5AEQA 1L7ZA 1UHIA 2GV5A 1NCXA 3KHEA 1C07A 2KQYA 2HPSA 1TRFA 1NWDA 2LMUA 2G2BA 3SIBA 1ZACA 2FJUB 2L0PA 2KNEA 1B8CA 3KEVA 3O2PA 4NDBA 2M7NA 2Q91A 5JJGA 2JTTA 3SG3A 1EL4A 1EXRA 3GK2A 2MLEC 4YGDB 4CPVA 2DOQA 2GGMA 1G4YR 1MR8A 1KFXS 1XVJA 1IJ6A 2NCOA 2I2RE 1J1DA 4N1GA 1QV1A 2JT8A 2LVKA 2F33A 3O78A 2FOTA 4OKHA 1K9KA 1MUXA 4C0JA 4MRYA 2WOSA 3FS7A 3PM8A 3VGOA 1A75B 1QJTA 5AANA 2F8PA 1Y0VH 1KQMC 4MEWA 4ORAB 1EG4A 1HT9A 1UHKA 1B7TZ 2KFGA 2L50A 4YGAA 3TUYB 1CM4A 1K93D 1CTRA 3PSRA 3DVJA 5K89A 1AVSA 2KGBC 4NDCA 3AKBA 2KSPA 3KPXA 5G08A 2LLSA 1BF5A 1JFJA 2ZKMX 1QS7A 5HLOA 1F54A 3OP0A 3JTDC 2KGRA 4PALA 2JRFA 3SG5A 1QIVA 2L4HA 1OMVA 2KFHA 5KSZA 1YRTB 1Y6WA 1F55A 3VRRA 1QX5B 2O5GA 4M2PA 4MN0A 2LMVA 2WCFA 3I5FC 3GK1A 4CLNA 3DVKA 1YX7A 3M0WA 2CCMA 2MA2A 4PHMA 1SL8A 4A4BA 3GK4X 2JOJA 5ER4X 1Y1UA 4DIRA 1OZSA 1JUOA 3EVRA 1SKTA 1YVLA 1B47A 2Y4QA 1K9UA 1PALA 2PASA 1A29A 3I5IC 5CPVA 3K21A 2MLFC 2KAXA 2K61A 2BECA 4PE1A 1QXPA 4PHJA 3HX4A 1SY9A 2K7OA 3CS1A 1CLBA 1UHJA 1JC2A 1YUSA 3FWBA 1RWYA 2KBMA 1XFZO 1UP5A 1IRJA 1SCMB 2LCPA 3ICBA 4YBHB 3BXKA 1OSAA 2K2AA 2LVIA 2Q4UA 3RLZA 3O6BA 1KQMB 3OB1B 1KK8C 4BY5A 1OZOA 1JWDA 4MBEA 4BY4A 2M49B 3ZWHA 4XJKB 1OMDA 2PVBA 3BYAA 1WRKA 4AQJA 2K0JA 1J1EA 1NCYA 1FBVA 3IQOA 3D0YA 3LCPC 2QPTA 1TNPA 2BCBA 1B1GA 1DJXA 2EHBA 4P2YB 2ZN8A 1K9PA 1OMRA 2WNDA 3OHMB 5I2QA 3JTDB 1NPQA 1LXFC 3TUYC 2LANA 2F2PA 1SCVA 3VROA 4AOMA 1SL7A 1WLZA 2LE9B 1BU3A 1TNXA 1S5GY 1S6CA 1YTZC 1J55A 3DF0A 1ZOTB 1JSAA 1K2HA 5KU1A 1G33A 3I5FB 1EH2A 3OX6A 1DJGA 1CDNA 2KAYA 2KOTA 2JQ6A 1CM1A 4JWQA 1V1GA 4GGNA 1J7PA 3TZ1A 4PE7A 1AJ5A 3I5GC 4QJ4B 3PFVA 4ORCB 1OE9B 3SG6A 3I5IB 2JXLA 2LLUA 2CBLA 2ZRSA 1LINA 2ZRTA 1SK6D 2QACA 1CFCA 4TNCA 1CNPA 1PULA 1S5GZ 1PSBA 4ICBA 4MVFA 4NQGA 1K8UA 1KK7Y 1KCYA 1GJYA 2BBNA 2IS9A 5HKZA 5HKWA 1IQ5A 1K96A 2M1KB 2ZNDA 4I5JA 5ER5A 5CSJA 3SJSA 4I5KA 1SNLA 1WRZA 2LP2A 1YVHA 2HF5A 1CB1A 1RECA 2K7CA 4JQ0D 1NX2A 2LUCA 1KK8B 1X02A 2L98A 2LAPA 1FI5A 1SCMC 1IWQA 1R6PA 1SR6B 2WCBA 3VRNA 1FF1A 1TN4A 3EVUA 1ZMZA 4ORBB 1PK0D 1S6JA 1KWOC 1DJWA 3CZTX 2K2FA 4U8DA 1UUSA 2L51A 3CR5X 1N2DA 4GUKA 2M29A 2M9GA 1U5IA 2OPOA 4M2QA 2WCEA 2AMIA 2LHLA 1DJHA 1WRLA 3A4UB 1IKUA 1YRUB 2M1UA 2LV7A 1QASA 2MRDA 1MXEA 2H61A 4DS7A 1S3PA 1CMGA 1AJ4A 1EJ3A 2LLTA 5TNCA 1MF8B 5AXIA 1WY9A 2B1UA 5GQQC 1XK4A 3I5HB 2G9BA 3KO0A 1PVBA 1GQMA 1SBJA 1CFDA 3BUMB 1L2OC 1QV0A 1TTXA 5BPJA 3I5GB 2JT3A 4OVNF 4UPGA 3EKHA 1WLMA 2LVVA 2SASA 1DVIA 1Y1AA 1HQVA 1G8IA 2M0RA 2PRUA 1IJ5A 2EC6B 3LLEA 4WRIA 1SL9A 4HSZA 5DKNA 1BR4B 1MWNA 2KI6C 2OTGB 3CR4X 1M63B 3D0YB 4QJ3B 1N65A 3TDZA 1WDCC 2ZFDA 1XA5A 3OX5A 1QLSA 2L5XB 1QATA 2KFFA 3EVVA 1NP8A 2F3YA 3TDIA 1TNQA 2EGDA 2LVJA 2F2OA 4DUQA 5D7FA 4AQIA 1JFKA 3PN7B 1B4CA 1J7QA 1JBAA 1DJZA 1FW4A 2WC8A 3DF0B 4N1FA 2H61C 4GBAA 2Y1NA 3AAKA 1LA0A 1Q80A 4C0KA 1NUBA 1NYAA 3A8RA 1KWOB 4D1EA 2RGIA 2FCEA 1A2XA 4I5LB 2ISDA 1UURA 3FWCA 4WQ3A 5CSFA 2JPTA 1QIWA 1M45A 1SR6C 2M8UA 3ZNIA 3CR2A 1XFYO 3MSEB 1NSHA 4NDDA 1S26D 3H4SE 3DVMA 4HREE 4FQOA 1CLMA 3QRXA 2KDHA 4DCKA 1BMOA 2NXQA 2NCPA 1Y1XA 1QX2A 1YUTA 1NX0A 3BOWA 2V53A 3RM1A 1RROA 5HKYA 1CDPA 3IQQA 1YX8A 1QX7A 4ETOA 2FCDA 3EK8A 1L2OB 3PATA 3LK1A 4YI8A 3OB2B 2M7LA 1TNWA 3WNXB 3E3RA 3D10A 1NX1A 1FPWA 2BBMA 1M46A 5I2OA 1IQ3A 1DF0A 1CFPA 5CSIA 2JZIA 1BOCA 1QTXA 3I5HC 1ZUZA 1XFUO 2L4IA 5AFPA 1AHRA 2JT0A 4MZKA 1MQ1A 2LNKA 2I94A 4YRUA 5FYXA 2KYFA 3SIAA 3VRPA 2HQ8A 1UWOA 2MBXA 3BQ3A 1OQPA 2CXJA 2COLB 3NXAA 1WDCB 5DKQA 1DGUA 4C0LA 2E6WA 3VRQA 3CTNA 1BR1B 1U5IB 2EC6C 4M2OA 4CIDA 3SG4A 4PDZA 2KI6D 4YGBB 2P6BB 1F8HA 2OTGC 3AKAA 1S36A 2K7DA 1TCFA 2BCAA 1JF2A 1W7JB 2KI4C 1UHHA 2BCXA 2I7AA 4PCWA 3IF7A 2BL0C 1ODBA 3BUOB 4A4CA 1SW8A 2JXCA 4DRWA 5IBWA 2HQWA 1GGZA 1DJYA 1PRWA 2KYCA 4L9MA 1NIWA 1FI6A 3NSLA 3C1VA 2PALA 3PN7C 1S6IA 2L2EA 1XFXO 2JNXA 1KQVA 5I8NA 2AUCA 3NSIA 1SPYA 4GFTA 4OV2A 1GGWA 4ZCVA 3BUWB 4OR9B 1F71A 3EK7A 2A4JA 1B7TY 1CDLA 1W7IB 4MRXA 4MSPA 5KTYA 1J7RA 2JWWA 2MHHA 2PSRA 3FIAA 2HETA 1KK7Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KFU L;  1XYD A;  2JC2 A;  1DTL A;  1LA3 A;  3EKJ A;  1R2U A;  4GGF A;  4I5N B;  2NLN A;  3NSO A;  5D69 A;  1PVA A;  1RK9 A;  1IG5 A;  4Q04 A;  1JF0 A;  4PHN A;  5DKR A;  1CDM A;  1J7O A;  3PAL A;  1CFF A;  3CLN A;  4GAO A;  1RTP 1;  1N0Y A;  4CFR A;  4FTG A;  3WXA A;  2LP3 A;  1MHO A;  4R1E A;  2TN4 A;  2LC5 A;  1BLQ A;  2K7B A;  2LMT A;  4E68 A;  2BKH B;  3EK4 A;  3O4Y A;  2BKI B;  2BE4 A;  4CFQ A;  4XYN A;  2H2K A;  1XFW O;  1BG1 A;  1VRK A;  4MLW A;  3WHU B;  1K90 D;  2KHN A;  1UHN A;  3TDU A;  1CKK A;  1A4P A;  3JVT B;  1B8L A;  3GOF A;  2ZN9 A;  2KBI A;  1F4O A;  2OS8 B;  2KI4 B;  1K95 A;  1ALV A;  1C7W A;  1CLL A;  3BUN B;  1DJI A;  1SYM A;  3LL8 B;  1BJF A;  2BL0 B;  1TCO B;  4MZJ A;  3WHT B;  1H4B A;  1XO5 A;  2CT9 A;  3BOW B;  1DGV A;  4GGF C;  4IL1 A;  1LVC D;  1TOP A;  1C7V A;  1YR5 A;  2AAO A;  5HLV A;  3TS5 B;  4QJ5 B;  2LUX A;  1OOJ A;  4PE4 A;  1F70 A;  1KFU S;  1K94 A;  1A75 A;  1NX3 A;  1DF0 B;  1LKJ A;  1D1O A;  5I2L A;  4N5X A;  4MZL A;  1DMO A;  1XK4 C;  4USL A;  3HCM A;  2D8N A;  2F3Z A;  2R2I A;  2KQ6 A;  2E30 A;  1QVI Y;  3BUX B;  3F45 A;  1AK8 A;  1F4Q A;  3AAJ A;  2JU0 A;  1H8B A;  1IGV A;  4F0Z B;  2Y1M A;  3KF9 A;  4P5O E;  1TIZ A;  2LHI A;  4YGE B;  1XFV O;  5CSN A;  3SG2 A;  2MJW B;  5F6T A;  4HRH A;  4YI9 A;  1DT7 B;  1V1F A;  1A03 A;  1SRA A;  2M3W A;  1QLK A;  1BT6 A;  3PLF B;  1BOD A;  1B9A A;  4JPZ B;  1KSO A;  2KAV A;  5JOL A;  2MAZ A;  2Y5I A;  3DD4 A;  4WQ2 A;  2SCP A;  1EG3 A;  4GPL B;  1QVI Z;  3SG7 A;  4OCI A;  1M31 A;  2JUL A;  2BE6 A;  4PHK A;  1KFX L;  1AUI B;  1ZFS A;  2CTN A;  2I18 A;  2ZNE A;  4YGC B;  1NCZ A;  1YUR A;  1SMG A;  3NSK A;  2LM5 A;  5HYD A;  1IH0 A;  1RFJ A;  2NZ0 A;  2PMY A;  2WOR A;  5J3X A;  1ALW A;  3JVT C;  1PSR A;  2M97 A;  1RJV A;  1M39 A;  2VRG A;  5B8I B;  2K8M B;  2OS8 C;  1B8R A;  4PE0 A;  2JNF A;  2O60 A;  1E8A A;  4ZCU A;  3DVE A;  1CMF A;  4HRG A;  3CWG A;  5AER A;  1AP4 A;  5PAL A;  1YUU A;  4GNK B;  1KSM A;  1MXL C;  2GGZ A;  2CNP A;  3CGA A;  2JTZ A;  1S1E A;  3LK0 A;  4XJK A;  3TS5 C;  5AEQ A;  1L7Z A;  1UHI A;  2GV5 A;  1NCX A;  3KHE A;  1C07 A;  2KQY A;  2HPS A;  1TRF A;  1NWD A;  2LMU A;  2G2B A;  3SIB A;  1ZAC A;  2FJU B;  2L0P A;  2KNE A;  1B8C A;  3KEV A;  3O2P A;  4NDB A;  2M7N A;  2Q91 A;  5JJG A;  2JTT A;  3SG3 A;  1EL4 A;  1EXR A;  3GK2 A;  2MLE C;  4YGD B;  4CPV A;  2DOQ A;  2GGM A;  1G4Y R;  1MR8 A;  1KFX S;  1XVJ A;  1IJ6 A;  2NCO A;  2I2R E;  1J1D A;  4N1G A;  1QV1 A;  2JT8 A;  2LVK A;  2F33 A;  3O78 A;  2FOT A;  4OKH A;  1K9K A;  1MUX A;  4C0J A;  4MRY A;  2WOS A;  3FS7 A;  3PM8 A;  3VGO A;  1A75 B;  1QJT A;  5AAN A;  2F8P A;  1Y0V H;  1KQM C;  4MEW A;  4ORA B;  1EG4 A;  1HT9 A;  1UHK A;  1B7T Z;  2KFG A;  2L50 A;  4YGA A;  3TUY B;  1CM4 A;  1K93 D;  1CTR A;  3PSR A;  3DVJ A;  5K89 A;  1AVS A;  2KGB C;  4NDC A;  3AKB A;  2KSP A;  3KPX A;  5G08 A;  2LLS A;  1BF5 A;  1JFJ A;  2ZKM X;  1QS7 A;  5HLO A;  1F54 A;  3OP0 A;  3JTD C;  2KGR A;  4PAL A;  2JRF A;  3SG5 A;  1QIV A;  2L4H A;  1OMV A;  2KFH A;  5KSZ A;  1YRT B;  1Y6W A;  1F55 A;  3VRR A;  1QX5 B;  2O5G A;  4M2P A;  4MN0 A;  2LMV A;  2WCF A;  3I5F C;  3GK1 A;  4CLN A;  3DVK A;  1YX7 A;  3M0W A;  2CCM A;  2MA2 A;  4PHM A;  1SL8 A;  4A4B A;  3GK4 X;  2JOJ A;  5ER4 X;  1Y1U A;  4DIR A;  1OZS A;  1JUO A;  3EVR A;  1SKT A;  1YVL A;  1B47 A;  2Y4Q A;  1K9U A;  1PAL A;  2PAS A;  1A29 A;  3I5I C;  5CPV A;  3K21 A;  2MLF C;  2KAX A;  2K61 A;  2BEC A;  4PE1 A;  1QXP A;  4PHJ A;  3HX4 A;  1SY9 A;  2K7O A;  3CS1 A;  1CLB A;  1UHJ A;  1JC2 A;  1YUS A;  3FWB A;  1RWY A;  2KBM A;  1XFZ O;  1UP5 A;  1IRJ A;  1SCM B;  2LCP A;  3ICB A;  4YBH B;  3BXK A;  1OSA A;  2K2A A;  2LVI A;  2Q4U A;  3RLZ A;  3O6B A;  1KQM B;  3OB1 B;  1KK8 C;  4BY5 A;  1OZO A;  1JWD A;  4MBE A;  4BY4 A;  2M49 B;  3ZWH A;  4XJK B;  1OMD A;  2PVB A;  3BYA A;  1WRK A;  4AQJ A;  2K0J A;  1J1E A;  1NCY A;  1FBV A;  3IQO A;  3D0Y A;  3LCP C;  2QPT A;  1TNP A;  2BCB A;  1B1G A;  1DJX A;  2EHB A;  4P2Y B;  2ZN8 A;  1K9P A;  1OMR A;  2WND A;  3OHM B;  5I2Q A;  3JTD B;  1NPQ A;  1LXF C;  3TUY C;  2LAN A;  2F2P A;  1SCV A;  3VRO A;  4AOM A;  1SL7 A;  1WLZ A;  2LE9 B;  1BU3 A;  1TNX A;  1S5G Y;  1S6C A;  1YTZ C;  1J55 A;  3DF0 A;  1ZOT B;  1JSA A;  1K2H A;  5KU1 A;  1G33 A;  3I5F B;  1EH2 A;  3OX6 A;  1DJG A;  1CDN A;  2KAY A;  2KOT A;  2JQ6 A;  1CM1 A;  4JWQ A;  1V1G A;  4GGN A;  1J7P A;  3TZ1 A;  4PE7 A;  1AJ5 A;  3I5G C;  4QJ4 B;  3PFV A;  4ORC B;  1OE9 B;  3SG6 A;  3I5I B;  2JXL A;  2LLU A;  2CBL A;  2ZRS A;  1LIN A;  2ZRT A;  1SK6 D;  2QAC A;  1CFC A;  4TNC A;  1CNP A;  1PUL A;  1S5G Z;  1PSB A;  4ICB A;  4MVF A;  4NQG A;  1K8U A;  1KK7 Y;  1KCY A;  1GJY A;  2BBN A;  2IS9 A;  5HKZ A;  5HKW A;  1IQ5 A;  1K96 A;  2M1K B;  2ZND A;  4I5J A;  5ER5 A;  5CSJ A;  3SJS A;  4I5K A;  1SNL A;  1WRZ A;  2LP2 A;  1YVH A;  2HF5 A;  1CB1 A;  1REC A;  2K7C A;  4JQ0 D;  1NX2 A;  2LUC A;  1KK8 B;  1X02 A;  2L98 A;  2LAP A;  1FI5 A;  1SCM C;  1IWQ A;  1R6P A;  1SR6 B;  2WCB A;  3VRN A;  1FF1 A;  1TN4 A;  3EVU A;  1ZMZ A;  4ORB B;  1PK0 D;  1S6J A;  1KWO C;  1DJW A;  3CZT X;  2K2F A;  4U8D A;  1UUS A;  2L51 A;  3CR5 X;  1N2D A;  4GUK A;  2M29 A;  2M9G A;  1U5I A;  2OPO A;  4M2Q A;  2WCE A;  2AMI A;  2LHL A;  1DJH A;  1WRL A;  3A4U B;  1IKU A;  1YRU B;  2M1U A;  2LV7 A;  1QAS A;  2MRD A;  1MXE A;  2H61 A;  4DS7 A;  1S3P A;  1CMG A;  1AJ4 A;  1EJ3 A;  2LLT A;  5TNC A;  1MF8 B;  5AXI A;  1WY9 A;  2B1U A;  5GQQ C;  1XK4 A;  3I5H B;  2G9B A;  3KO0 A;  1PVB A;  1GQM A;  1SBJ A;  1CFD A;  3BUM B;  1L2O C;  1QV0 A;  1TTX A;  5BPJ A;  3I5G B;  2JT3 A;  4OVN F;  4UPG A;  3EKH A;  1WLM A;  2LVV A;  2SAS A;  1DVI A;  1Y1A A;  1HQV A;  1G8I A;  2M0R A;  2PRU A;  1IJ5 A;  2EC6 B;  3LLE A;  4WRI A;  1SL9 A;  4HSZ A;  5DKN A;  1BR4 B;  1MWN A;  2KI6 C;  2OTG B;  3CR4 X;  1M63 B;  3D0Y B;  4QJ3 B;  1N65 A;  3TDZ A;  1WDC C;  2ZFD A;  1XA5 A;  3OX5 A;  1QLS A;  2L5X B;  1QAT A;  2KFF A;  3EVV A;  1NP8 A;  2F3Y A;  3TDI A;  1TNQ A;  2EGD A;  2LVJ A;  2F2O A;  4DUQ A;  5D7F A;  4AQI A;  1JFK A;  3PN7 B;  1B4C A;  1J7Q A;  1JBA A;  1DJZ A;  1FW4 A;  2WC8 A;  3DF0 B;  4N1F A;  2H61 C;  4GBA A;  2Y1N A;  3AAK A;  1LA0 A;  1Q80 A;  4C0K A;  1NUB A;  1NYA A;  3A8R A;  1KWO B;  4D1E A;  2RGI A;  2FCE A;  1A2X A;  4I5L B;  2ISD A;  1UUR A;  3FWC A;  4WQ3 A;  5CSF A;  2JPT A;  1QIW A;  1M45 A;  1SR6 C;  2M8U A;  3ZNI A;  3CR2 A;  1XFY O;  3MSE B;  1NSH A;  4NDD A;  1S26 D;  3H4S E;  3DVM A;  4HRE E;  4FQO A;  1CLM A;  3QRX A;  2KDH A;  4DCK A;  1BMO A;  2NXQ A;  2NCP A;  1Y1X A;  1QX2 A;  1YUT A;  1NX0 A;  3BOW A;  2V53 A;  3RM1 A;  1RRO A;  5HKY A;  1CDP A;  3IQQ A;  1YX8 A;  1QX7 A;  4ETO A;  2FCD A;  3EK8 A;  1L2O B;  3PAT A;  3LK1 A;  4YI8 A;  3OB2 B;  2M7L A;  1TNW A;  3WNX B;  3E3R A;  3D10 A;  1NX1 A;  1FPW A;  2BBM A;  1M46 A;  5I2O A;  1IQ3 A;  1DF0 A;  1CFP A;  5CSI A;  2JZI A;  1BOC A;  1QTX A;  3I5H C;  1ZUZ A;  1XFU O;  2L4I A;  5AFP A;  1AHR A;  2JT0 A;  4MZK A;  1MQ1 A;  2LNK A;  2I94 A;  4YRU A;  5FYX A;  2KYF A;  3SIA A;  3VRP A;  2HQ8 A;  1UWO A;  2MBX A;  3BQ3 A;  1OQP A;  2CXJ A;  2COL B;  3NXA A;  1WDC B;  5DKQ A;  1DGU A;  4C0L A;  2E6W A;  3VRQ A;  3CTN A;  1BR1 B;  1U5I B;  2EC6 C;  4M2O A;  4CID A;  3SG4 A;  4PDZ A;  2KI6 D;  4YGB B;  2P6B B;  1F8H A;  2OTG C;  3AKA A;  1S36 A;  2K7D A;  1TCF A;  2BCA A;  1JF2 A;  1W7J B;  2KI4 C;  1UHH A;  2BCX A;  2I7A A;  4PCW A;  3IF7 A;  2BL0 C;  1ODB A;  3BUO B;  4A4C A;  1SW8 A;  2JXC A;  4DRW A;  5IBW A;  2HQW A;  1GGZ A;  1DJY A;  1PRW A;  2KYC A;  4L9M A;  1NIW A;  1FI6 A;  3NSL A;  3C1V A;  2PAL A;  3PN7 C;  1S6I A;  2L2E A;  1XFX O;  2JNX A;  1KQV A;  5I8N A;  2AUC A;  3NSI A;  1SPY A;  4GFT A;  4OV2 A;  1GGW A;  4ZCV A;  3BUW B;  4OR9 B;  1F71 A;  3EK7 A;  2A4J A;  1B7T Y;  1CDL A;  1W7I B;  4MRX A;  4MSP A;  5KTY A;  1J7R A;  2JWW A;  2MHH A;  2PSR A;  3FIA A;  2HET A;  1KK7 Z; 
#chains in the Genus database with same CATH topology
 1KFU L;  1XYD A;  2JC2 A;  1DTL A;  1LA3 A;  3EKJ A;  1R2U A;  2WCH A;  4GGF A;  4I5N B;  2NLN A;  3NSO A;  5D69 A;  1PVA A;  1RK9 A;  1IG5 A;  4Q04 A;  1JF0 A;  1W9Z A;  4PHN A;  3QME A;  1CDM A;  1TUZ A;  5DKR A;  1J7O A;  3PAL A;  2WCK A;  1CFF A;  3CLN A;  1QWV A;  4GAO A;  1RTP 1;  1N0Y A;  4CFR A;  4FTG A;  3WXA A;  2LP3 A;  1MHO A;  4R1E A;  2TN4 A;  2LC5 A;  1BLQ A;  2K7B A;  2LMT A;  4E68 A;  2BKH B;  3EK4 A;  3O4Y A;  2BKI B;  3BFB A;  2BE4 A;  4CFQ A;  4XYN A;  2H2K A;  1XFW O;  1BG1 A;  1VRK A;  4JKT A;  4MLW A;  3WHU B;  2BAP A;  2QEB A;  3CAB A;  1K90 D;  2KHN A;  1UHN A;  1DEL A;  3CDN A;  3TDU A;  1IIO A;  1CKK A;  1A4P A;  3JVT B;  5FI2 A;  1DEK A;  1B8L A;  3GOF A;  2ZN9 A;  2KBI A;  1F4O A;  2OS8 B;  2KI4 B;  1K95 A;  1ALV A;  1C7W A;  1CLL A;  3BUN B;  1DJI A;  1SYM A;  3LL8 B;  1BJF A;  2BL0 B;  1TCO B;  2L2C A;  3B88 A;  4MZJ A;  3WHT B;  1H4B A;  3Q8I A;  1XO5 A;  1P28 A;  2CT9 A;  3BOW B;  1DGV A;  4GGF C;  4IL1 A;  1LVC D;  1TOP A;  1C7V A;  1YR5 A;  2AAO A;  5HLV A;  3TS5 B;  3VB1 A;  4QJ5 B;  2LUX A;  1OOJ A;  4PE4 A;  1F70 A;  1KFU S;  1K94 A;  1A75 A;  1NX3 A;  1DF0 B;  1LKJ A;  1D1O A;  5I2L A;  4N5X A;  4MZL A;  1DMO A;  1XK4 C;  4USL A;  3HCM A;  2D8N A;  2F3Z A;  2R2I A;  2KQ6 A;  2E30 A;  1OOI X;  1QVI Y;  3BUX B;  3F45 A;  1C3Z A;  1AK8 A;  1F4Q A;  3UNW A;  3AAJ A;  2JU0 A;  1H8B A;  1IGV A;  4F0Z B;  2Y1M A;  3KF9 A;  4P5O E;  1TIZ A;  2LHI A;  4YGE B;  1XFV O;  5CSN A;  3DXL A;  3SG2 A;  2MJW B;  5F6T A;  4HRH A;  4YI9 A;  1DT7 B;  1V1F A;  3D76 A;  3IVT A;  1A03 A;  1C3Y A;  1SRA A;  2M3W A;  1QLK A;  3R1O A;  1BT6 A;  3PLF B;  1BOD A;  1B9A A;  4JPZ B;  1KSO A;  1GM0 A;  2KAV A;  5EL2 A;  5JOL A;  2MAZ A;  2Y5I A;  3DD4 A;  4WQ2 A;  2SCP A;  1EG3 A;  4GPL B;  1QVI Z;  3SG7 A;  4OCI A;  1M31 A;  2JUL A;  2BE6 A;  2FJY A;  4PHK A;  1KFX L;  1AUI B;  1ZFS A;  2CTN A;  2I18 A;  2ZNE A;  4YGC B;  1NCZ A;  1YUR A;  1SMG A;  3NSK A;  1SSE B;  2LM5 A;  2WC6 A;  5HYD A;  1IH0 A;  1TWO A;  1RFJ A;  2NZ0 A;  2PMY A;  2WOR A;  5J3X A;  2L5Y A;  1ALW A;  3S0F A;  3JVT C;  1PSR A;  2M97 A;  1RJV A;  1M39 A;  2VRG A;  5B8I B;  2K8M B;  2OS8 C;  1B8R A;  3DY9 A;  4PE0 A;  2H8V A;  3R1V A;  2JNF A;  2O60 A;  1E8A A;  4ZCU A;  3DVE A;  1CMF A;  4HRG A;  3SS4 A;  3CWG A;  5AER A;  2P70 A;  1AP4 A;  5PAL A;  1YUU A;  1XFR A;  2PYQ A;  4GNK B;  1KSM A;  1MXL C;  2GGZ A;  2CNP A;  3CGA A;  2JTZ A;  1S1E A;  3LK0 A;  4XJK A;  3TS5 C;  5AEQ A;  1L7Z A;  1UHI A;  2GV5 A;  1NCX A;  3KHE A;  1C07 A;  2KQY A;  2HPS A;  1TRF A;  1NWD A;  2LMU A;  2G2B A;  3SIB A;  1ZAC A;  2FJU B;  2L0P A;  2KNE A;  1B8C A;  3KEV A;  3O2P A;  4NDB A;  2M7N A;  2Q91 A;  5JJG A;  2JTT A;  3SG3 A;  1EL4 A;  1EXR A;  3GK2 A;  2MLE C;  4YGD B;  4CPV A;  1DC1 A;  2DOQ A;  5HL1 A;  3DZT A;  2GGM A;  1XVJ A;  1G4Y R;  1KFX S;  1MR8 A;  1IJ6 A;  2BNX A;  2NCO A;  2I2R E;  1J1D A;  4N1G A;  1QV1 A;  2JT8 A;  2QEH A;  2LVK A;  2F33 A;  3L47 A;  3O78 A;  2FOT A;  4OKH A;  3S0A A;  1K9K A;  1MUX A;  3K1E A;  2WCJ A;  4C0J A;  2QEV A;  4MRY A;  2WOS A;  3FS7 A;  3PM8 A;  3VGO A;  1A75 B;  1QJT A;  5AAN A;  2F8P A;  1Y0V H;  1KQM C;  4MEW A;  4ORA B;  1EG4 A;  1HT9 A;  1UHK A;  1B7T Z;  1OOF A;  2KFG A;  2L50 A;  4YGA A;  3TUY B;  1CM4 A;  1K93 D;  1CTR A;  3PSR A;  3DVJ A;  5K89 A;  1AVS A;  2KGB C;  2QEO A;  3AKB A;  4NDC A;  2KSP A;  3S0E A;  3KPX A;  5G08 A;  2LLS A;  1BF5 A;  1JFJ A;  2ZKM X;  3CZ2 A;  1QS7 A;  5HLO A;  1F54 A;  3OP0 A;  3JTD C;  2KGR A;  4PAL A;  2JRF A;  3SG5 A;  1QIV A;  3D73 A;  2L4H A;  1OMV A;  2KFH A;  5KSZ A;  1YRT B;  4JD9 A;  1Y6W A;  1F55 A;  3O4X A;  3UO9 A;  3VRR A;  5FI6 A;  1QX5 B;  2O5G A;  4M2P A;  4MN0 A;  2LMV A;  2WCF A;  3I5F C;  3GK1 A;  4CLN A;  3OBV A;  3DVK A;  3S0D A;  1TUJ A;  1YX7 A;  2KLD A;  3M0W A;  2CCM A;  2MA2 A;  4PHM A;  1SL8 A;  4A4B A;  3GK4 X;  2JOJ A;  5ER4 X;  1Y1U A;  3BFA A;  1OZS A;  1JUO A;  3EVR A;  3L4A A;  1SKT A;  4DIR A;  1YVL A;  1B47 A;  2Y4Q A;  1K9U A;  1PAL A;  2PAS A;  1A29 A;  3I5I C;  5CPV A;  3K21 A;  2MLF C;  2KAX A;  2K61 A;  2BEC A;  1T14 A;  4PE1 A;  1QXP A;  4PHJ A;  3HX4 A;  1SY9 A;  2K7O A;  3CS1 A;  3PJI A;  3BFH A;  1CLB A;  1UHJ A;  1JC2 A;  4INW A;  1YUS A;  3FWB A;  1RWY A;  2KBM A;  1XFZ O;  2KPH A;  1UP5 A;  1IRJ A;  1SCM B;  2LCP A;  3B6X A;  3ICB A;  4YBH B;  2PQL A;  2QDI A;  3BXK A;  1OSA A;  2K2A A;  2LVI A;  2Q4U A;  2WC5 A;  3RLZ A;  3O6B A;  1KQM B;  3OB1 B;  1KK8 C;  4BY5 A;  1OZO A;  1JWD A;  4MBE A;  4INX A;  4BY4 A;  3S0G A;  2M49 B;  3ZWH A;  4XJK B;  1OMD A;  2PVB A;  3BYA A;  1WRK A;  4AQJ A;  2K0J A;  1J1E A;  1NCY A;  1FBV A;  3IQO A;  3D0Y A;  3LCP C;  2QPT A;  1TNP A;  2BCB A;  1B1G A;  1DJX A;  2EHB A;  4P2Y B;  2ZN8 A;  3FE9 A;  1K9P A;  1OMR A;  2WND A;  3FE8 A;  3OHM B;  5I2Q A;  3JTD B;  4F7F A;  1NPQ A;  1LXF C;  3TUY C;  2LAN A;  2F2P A;  1SCV A;  3VRO A;  4AOM A;  1SL7 A;  1WLZ A;  2LE9 B;  1BU3 A;  1TNX A;  1S5G Y;  1S6C A;  1YTZ C;  1J55 A;  3DF0 A;  1ZOT B;  1JSA A;  1K2H A;  5KU1 A;  1G33 A;  3I5F B;  1EH2 A;  3OX6 A;  1DJG A;  1CDN A;  2KAY A;  2KOT A;  2JQ6 A;  1CM1 A;  4JWQ A;  1V1G A;  4GGN A;  1J7P A;  3TZ1 A;  4PE7 A;  1AJ5 A;  3I5G C;  4QJ4 B;  3NHI A;  3PFV A;  1OE9 B;  4ORC B;  3SG6 A;  3I5I B;  2JXL A;  2LLU A;  2CBL A;  3B87 A;  4PT1 A;  2ZRS A;  1LIN A;  2ZRT A;  1SK6 D;  2QAC A;  1CFC A;  4TNC A;  1CNP A;  1PUL A;  1S5G Z;  1PSB A;  4ICB A;  4MVF A;  3PM2 A;  4NQG A;  3D78 A;  1K8U A;  1KK7 Y;  1KCY A;  1GJY A;  2BBN A;  5D3O A;  2IS9 A;  5HKZ A;  2K60 A;  1IQ5 A;  5HKW A;  3V2L A;  1K96 A;  2M1K B;  2ZND A;  4I5J A;  5ER5 A;  5CSJ A;  3SJS A;  4I5K A;  1SNL A;  1WRZ A;  2LP2 A;  1YVH A;  2HF5 A;  1CB1 A;  1REC A;  2K7C A;  4JQ0 D;  1NX2 A;  2LUC A;  1KK8 B;  1X02 A;  2L98 A;  2LAP A;  1FI5 A;  1SCM C;  1IWQ A;  1R6P A;  1SR6 B;  2WCB A;  2GTE A;  3VRN A;  1FF1 A;  1TN4 A;  3EVU A;  1ZMZ A;  3OGN A;  1PK0 D;  1S6J A;  1KWO C;  4ORB B;  1DJW A;  3FE6 A;  3CZT X;  2K2F A;  3D74 A;  4U8D A;  1UUS A;  2L51 A;  3CR5 X;  1N2D A;  3NHT A;  2M29 A;  4GUK A;  2M9G A;  1U5I A;  3SS5 A;  2OPO A;  4M2Q A;  1OW4 A;  2WCE A;  2AMI A;  2LHL A;  3R1P A;  1DJH A;  1WRL A;  3A4U B;  1IKU A;  1YRU B;  2M1U A;  2LV7 A;  1QAS A;  2MRD A;  3BJH A;  1MXE A;  2YGU A;  2H61 A;  4DS7 A;  1S3P A;  1CMG A;  1AJ4 A;  1EJ3 A;  2LLT A;  5TNC A;  1MF8 B;  5AXI A;  1WY9 A;  2B1U A;  3CZ0 A;  1XK4 A;  5GQQ C;  3I5H B;  2G9B A;  3KO0 A;  3L4L A;  1PVB A;  5I94 A;  1GQM A;  1SBJ A;  1CFD A;  3BUM B;  1L2O C;  1QV0 A;  1TTX A;  5BPJ A;  3I5G B;  2JT3 A;  4OVN F;  4UPG A;  3EKH A;  2WCL A;  1WLM A;  2LVV A;  2SAS A;  1DVI A;  1Y1A A;  1HQV A;  1G8I A;  4KYN A;  2M0R A;  2PRU A;  1IJ5 A;  1DQE A;  2EC6 B;  3B7A A;  3LLE A;  1SL9 A;  4WRI A;  4HSZ A;  5DKN A;  3CYZ A;  1BR4 B;  1MWN A;  2KI6 C;  2OTG B;  3CR4 X;  1M63 B;  3D0Y B;  4QJ3 B;  1N65 A;  3TDZ A;  1WDC C;  2JPO A;  2ZFD A;  1XA5 A;  3OX5 A;  1QLS A;  2L5X B;  1QAT A;  2KFF A;  3EVV A;  1NP8 A;  2F3Y A;  3TDI A;  1TNQ A;  2EGD A;  2LVJ A;  2F2O A;  4DUQ A;  5D7F A;  4AQI A;  1JFK A;  3PN7 B;  1B4C A;  1J7Q A;  1JBA A;  1DJZ A;  1FW4 A;  2WC8 A;  3DF0 B;  4N1F A;  2H61 C;  4GBA A;  2Y1N A;  3AAK A;  1LA0 A;  1Q80 A;  4C0K A;  1NUB A;  1NYA A;  3A8R A;  1KWO B;  4D1E A;  2RGI A;  2FCE A;  1A2X A;  4I5L B;  2ISD A;  1UUR A;  3FWC A;  4WQ3 A;  5CSF A;  3S0B A;  2JPT A;  1QIW A;  1M45 A;  1Z4H A;  1SR6 C;  2M8U A;  5FI7 A;  3ZNI A;  3CR2 A;  1XFY O;  3MSE B;  1NSH A;  4NDD A;  1S26 D;  3H4S E;  3DVM A;  4HRE E;  4FQO A;  1CLM A;  3QRX A;  2KDH A;  4DCK A;  1BMO A;  2NXQ A;  2NCP A;  1Y1X A;  3D75 A;  1QX2 A;  2KLE A;  1YUT A;  1NX0 A;  3BOW A;  2V53 A;  3RM1 A;  1RRO A;  5HKY A;  1CDP A;  1ORG A;  3B86 A;  4OZD A;  3IQQ A;  1YX8 A;  1QX7 A;  3N7H A;  4ETO A;  2FCD A;  3EK8 A;  1L2O B;  3PAT A;  1OOG A;  3LK1 A;  5DIC A;  4YI8 A;  3OB2 B;  2M7L A;  1TNW A;  3WNX B;  1LS8 A;  3E3R A;  3D10 A;  4FQT A;  1NX1 A;  1FPW A;  2BBM A;  1M46 A;  5I2O A;  1IQ3 A;  1DF0 A;  1CFP A;  5CSI A;  2JZI A;  3D77 A;  1BOC A;  1QTX A;  3I5H C;  1ZUZ A;  1XFU O;  2ERB A;  2L4I A;  5AFP A;  1AHR A;  2JT0 A;  4MZK A;  3R72 A;  1MQ1 A;  2LNK A;  2I94 A;  4YRU A;  5FYX A;  2KYF A;  3SIA A;  3VRP A;  2HQ8 A;  1UWO A;  2MBX A;  3BQ3 A;  1OQP A;  2CXJ A;  2COL B;  3NXA A;  1WDC B;  3EG5 B;  5DKQ A;  1DGU A;  4C0L A;  2E6W A;  3VRQ A;  3CTN A;  1BR1 B;  1U5I B;  2EC6 C;  2P71 A;  4M2O A;  4CID A;  3SG4 A;  4PDZ A;  2KI6 D;  4YGB B;  2P6B B;  1Z2C B;  2OTG C;  3AKA A;  1S36 A;  2K7D A;  2WCM A;  1F8H A;  1TCF A;  2BCA A;  1JF2 A;  1W7J B;  2KI4 C;  1UHH A;  2BCX A;  2I7A A;  4PCW A;  3IF7 A;  2BL0 C;  1ODB A;  3BUO B;  4A4C A;  1SW8 A;  2JXC A;  4DRW A;  5IBW A;  2HQW A;  1GGZ A;  1DJY A;  1PRW A;  2KYC A;  4L9M A;  1NIW A;  1FI6 A;  3NSL A;  3C1V A;  2PAL A;  3PN7 C;  1S6I A;  2L2E A;  3NGV A;  1XFX O;  3SS3 A;  2JNX A;  1KQV A;  5I8N A;  2AUC A;  3DYE A;  1OOH A;  3NSI A;  1SPY A;  4IJ7 A;  4GFT A;  4OV2 A;  1GGW A;  3CZ1 A;  4ZCV A;  3BUW B;  4OR9 B;  1F71 A;  3RZS A;  3EK7 A;  2A4J A;  1B7T Y;  1CDL A;  1W7I B;  4MRX A;  4MSP A;  5KTY A;  1J7R A;  2JWW A;  2MHH A;  2PSR A;  3FIA A;  2HET A;  1KK7 Z; 
#chains in the Genus database with same CATH homology
 1KFU L;  1XYD A;  2JC2 A;  1DTL A;  1LA3 A;  3EKJ A;  1R2U A;  4GGF A;  4I5N B;  2NLN A;  3NSO A;  5D69 A;  1PVA A;  1RK9 A;  1IG5 A;  4Q04 A;  1JF0 A;  4PHN A;  5DKR A;  1CDM A;  1J7O A;  3PAL A;  1CFF A;  3CLN A;  4GAO A;  1RTP 1;  1N0Y A;  4CFR A;  4FTG A;  3WXA A;  2LP3 A;  1MHO A;  4R1E A;  2TN4 A;  2LC5 A;  1BLQ A;  2K7B A;  2LMT A;  4E68 A;  2BKH B;  3EK4 A;  3O4Y A;  2BKI B;  2BE4 A;  4CFQ A;  4XYN A;  2H2K A;  1XFW O;  1BG1 A;  1VRK A;  4MLW A;  3WHU B;  1K90 D;  2KHN A;  1UHN A;  3TDU A;  1CKK A;  1A4P A;  3JVT B;  1B8L A;  3GOF A;  2ZN9 A;  2KBI A;  1F4O A;  2OS8 B;  2KI4 B;  1K95 A;  1ALV A;  1C7W A;  1CLL A;  3BUN B;  1DJI A;  1SYM A;  3LL8 B;  1BJF A;  2BL0 B;  1TCO B;  4MZJ A;  3WHT B;  1H4B A;  1XO5 A;  2CT9 A;  3BOW B;  1DGV A;  4GGF C;  4IL1 A;  1LVC D;  1TOP A;  1C7V A;  1YR5 A;  2AAO A;  5HLV A;  3TS5 B;  4QJ5 B;  2LUX A;  1OOJ A;  4PE4 A;  1F70 A;  1KFU S;  1K94 A;  1A75 A;  1NX3 A;  1DF0 B;  1LKJ A;  1D1O A;  5I2L A;  4N5X A;  4MZL A;  1DMO A;  1XK4 C;  4USL A;  3HCM A;  2D8N A;  2F3Z A;  2R2I A;  2KQ6 A;  2E30 A;  1QVI Y;  3BUX B;  3F45 A;  1AK8 A;  1F4Q A;  3AAJ A;  2JU0 A;  1H8B A;  1IGV A;  4F0Z B;  2Y1M A;  3KF9 A;  4P5O E;  1TIZ A;  2LHI A;  4YGE B;  1XFV O;  5CSN A;  3SG2 A;  2MJW B;  5F6T A;  4HRH A;  4YI9 A;  1DT7 B;  1V1F A;  1A03 A;  1SRA A;  2M3W A;  1QLK A;  1BT6 A;  3PLF B;  1BOD A;  1B9A A;  4JPZ B;  1KSO A;  2KAV A;  5JOL A;  2MAZ A;  2Y5I A;  3DD4 A;  4WQ2 A;  2SCP A;  1EG3 A;  4GPL B;  1QVI Z;  3SG7 A;  4OCI A;  1M31 A;  2JUL A;  2BE6 A;  4PHK A;  1KFX L;  1AUI B;  1ZFS A;  2CTN A;  2I18 A;  2ZNE A;  4YGC B;  1NCZ A;  1YUR A;  1SMG A;  3NSK A;  2LM5 A;  5HYD A;  1IH0 A;  1RFJ A;  2NZ0 A;  2PMY A;  2WOR A;  5J3X A;  1ALW A;  3JVT C;  1PSR A;  2M97 A;  1RJV A;  1M39 A;  2VRG A;  5B8I B;  2K8M B;  2OS8 C;  1B8R A;  4PE0 A;  2JNF A;  2O60 A;  1E8A A;  4ZCU A;  3DVE A;  1CMF A;  4HRG A;  3CWG A;  5AER A;  1AP4 A;  5PAL A;  1YUU A;  4GNK B;  1KSM A;  1MXL C;  2GGZ A;  2CNP A;  3CGA A;  2JTZ A;  1S1E A;  3LK0 A;  4XJK A;  3TS5 C;  5AEQ A;  1L7Z A;  1UHI A;  2GV5 A;  1NCX A;  3KHE A;  1C07 A;  2KQY A;  2HPS A;  1TRF A;  1NWD A;  2LMU A;  2G2B A;  3SIB A;  1ZAC A;  2FJU B;  2L0P A;  2KNE A;  1B8C A;  3KEV A;  3O2P A;  4NDB A;  2M7N A;  2Q91 A;  5JJG A;  2JTT A;  3SG3 A;  1EL4 A;  1EXR A;  3GK2 A;  2MLE C;  4YGD B;  4CPV A;  2DOQ A;  2GGM A;  1G4Y R;  1MR8 A;  1KFX S;  1XVJ A;  1IJ6 A;  2NCO A;  2I2R E;  1J1D A;  4N1G A;  1QV1 A;  2JT8 A;  2LVK A;  2F33 A;  3O78 A;  2FOT A;  4OKH A;  1K9K A;  1MUX A;  4C0J A;  4MRY A;  2WOS A;  3FS7 A;  3PM8 A;  3VGO A;  1A75 B;  1QJT A;  5AAN A;  2F8P A;  1Y0V H;  1KQM C;  4MEW A;  4ORA B;  1EG4 A;  1HT9 A;  1UHK A;  1B7T Z;  2KFG A;  2L50 A;  4YGA A;  3TUY B;  1CM4 A;  1K93 D;  1CTR A;  3PSR A;  3DVJ A;  5K89 A;  1AVS A;  2KGB C;  4NDC A;  3AKB A;  2KSP A;  3KPX A;  5G08 A;  2LLS A;  1BF5 A;  1JFJ A;  2ZKM X;  1QS7 A;  5HLO A;  1F54 A;  3OP0 A;  3JTD C;  2KGR A;  4PAL A;  2JRF A;  3SG5 A;  1QIV A;  2L4H A;  1OMV A;  2KFH A;  5KSZ A;  1YRT B;  1Y6W A;  1F55 A;  3VRR A;  1QX5 B;  2O5G A;  4M2P A;  4MN0 A;  2LMV A;  2WCF A;  3I5F C;  3GK1 A;  4CLN A;  3DVK A;  1YX7 A;  3M0W A;  2CCM A;  2MA2 A;  4PHM A;  1SL8 A;  4A4B A;  3GK4 X;  2JOJ A;  5ER4 X;  1Y1U A;  4DIR A;  1OZS A;  1JUO A;  3EVR A;  1SKT A;  1YVL A;  1B47 A;  2Y4Q A;  1K9U A;  1PAL A;  2PAS A;  1A29 A;  3I5I C;  5CPV A;  3K21 A;  2MLF C;  2KAX A;  2K61 A;  2BEC A;  4PE1 A;  1QXP A;  4PHJ A;  3HX4 A;  1SY9 A;  2K7O A;  3CS1 A;  1CLB A;  1UHJ A;  1JC2 A;  1YUS A;  3FWB A;  1RWY A;  2KBM A;  1XFZ O;  1UP5 A;  1IRJ A;  1SCM B;  2LCP A;  3ICB A;  4YBH B;  3BXK A;  1OSA A;  2K2A A;  2LVI A;  2Q4U A;  3RLZ A;  3O6B A;  1KQM B;  3OB1 B;  1KK8 C;  4BY5 A;  1OZO A;  1JWD A;  4MBE A;  4BY4 A;  2M49 B;  3ZWH A;  4XJK B;  1OMD A;  2PVB A;  3BYA A;  1WRK A;  4AQJ A;  2K0J A;  1J1E A;  1NCY A;  1FBV A;  3IQO A;  3D0Y A;  3LCP C;  2QPT A;  1TNP A;  2BCB A;  1B1G A;  1DJX A;  2EHB A;  4P2Y B;  2ZN8 A;  1K9P A;  1OMR A;  2WND A;  3OHM B;  5I2Q A;  3JTD B;  1NPQ A;  1LXF C;  3TUY C;  2LAN A;  2F2P A;  1SCV A;  3VRO A;  4AOM A;  1SL7 A;  1WLZ A;  2LE9 B;  1BU3 A;  1TNX A;  1S5G Y;  1S6C A;  1YTZ C;  1J55 A;  3DF0 A;  1ZOT B;  1JSA A;  1K2H A;  5KU1 A;  1G33 A;  3I5F B;  1EH2 A;  3OX6 A;  1DJG A;  1CDN A;  2KAY A;  2KOT A;  2JQ6 A;  1CM1 A;  4JWQ A;  1V1G A;  4GGN A;  1J7P A;  3TZ1 A;  4PE7 A;  1AJ5 A;  3I5G C;  4QJ4 B;  3PFV A;  4ORC B;  1OE9 B;  3SG6 A;  3I5I B;  2JXL A;  2LLU A;  2CBL A;  2ZRS A;  1LIN A;  2ZRT A;  1SK6 D;  2QAC A;  1CFC A;  4TNC A;  1CNP A;  1PUL A;  1S5G Z;  1PSB A;  4ICB A;  4MVF A;  4NQG A;  1K8U A;  1KK7 Y;  1KCY A;  1GJY A;  2BBN A;  2IS9 A;  5HKZ A;  5HKW A;  1IQ5 A;  1K96 A;  2M1K B;  2ZND A;  4I5J A;  5ER5 A;  5CSJ A;  3SJS A;  4I5K A;  1SNL A;  1WRZ A;  2LP2 A;  1YVH A;  2HF5 A;  1CB1 A;  1REC A;  2K7C A;  4JQ0 D;  1NX2 A;  2LUC A;  1KK8 B;  1X02 A;  2L98 A;  2LAP A;  1FI5 A;  1SCM C;  1IWQ A;  1R6P A;  1SR6 B;  2WCB A;  3VRN A;  1FF1 A;  1TN4 A;  3EVU A;  1ZMZ A;  4ORB B;  1PK0 D;  1S6J A;  1KWO C;  1DJW A;  3CZT X;  2K2F A;  4U8D A;  1UUS A;  2L51 A;  3CR5 X;  1N2D A;  4GUK A;  2M29 A;  2M9G A;  1U5I A;  2OPO A;  4M2Q A;  2WCE A;  2AMI A;  2LHL A;  1DJH A;  1WRL A;  3A4U B;  1IKU A;  1YRU B;  2M1U A;  2LV7 A;  1QAS A;  2MRD A;  1MXE A;  2H61 A;  4DS7 A;  1S3P A;  1CMG A;  1AJ4 A;  1EJ3 A;  2LLT A;  5TNC A;  1MF8 B;  5AXI A;  1WY9 A;  2B1U A;  5GQQ C;  1XK4 A;  3I5H B;  2G9B A;  3KO0 A;  1PVB A;  1GQM A;  1SBJ A;  1CFD A;  3BUM B;  1L2O C;  1QV0 A;  1TTX A;  5BPJ A;  3I5G B;  2JT3 A;  4OVN F;  4UPG A;  3EKH A;  1WLM A;  2LVV A;  2SAS A;  1DVI A;  1Y1A A;  1HQV A;  1G8I A;  2M0R A;  2PRU A;  1IJ5 A;  2EC6 B;  3LLE A;  4WRI A;  1SL9 A;  4HSZ A;  5DKN A;  1BR4 B;  1MWN A;  2KI6 C;  2OTG B;  3CR4 X;  1M63 B;  3D0Y B;  4QJ3 B;  1N65 A;  3TDZ A;  1WDC C;  2ZFD A;  1XA5 A;  3OX5 A;  1QLS A;  2L5X B;  1QAT A;  2KFF A;  3EVV A;  1NP8 A;  2F3Y A;  3TDI A;  1TNQ A;  2EGD A;  2LVJ A;  2F2O A;  4DUQ A;  5D7F A;  4AQI A;  1JFK A;  3PN7 B;  1B4C A;  1J7Q A;  1JBA A;  1DJZ A;  1FW4 A;  2WC8 A;  3DF0 B;  4N1F A;  2H61 C;  4GBA A;  2Y1N A;  3AAK A;  1LA0 A;  1Q80 A;  4C0K A;  1NUB A;  1NYA A;  3A8R A;  1KWO B;  4D1E A;  2RGI A;  2FCE A;  1A2X A;  4I5L B;  2ISD A;  1UUR A;  3FWC A;  4WQ3 A;  5CSF A;  2JPT A;  1QIW A;  1M45 A;  1SR6 C;  2M8U A;  3ZNI A;  3CR2 A;  1XFY O;  3MSE B;  1NSH A;  4NDD A;  1S26 D;  3H4S E;  3DVM A;  4HRE E;  4FQO A;  1CLM A;  3QRX A;  2KDH A;  4DCK A;  1BMO A;  2NXQ A;  2NCP A;  1Y1X A;  1QX2 A;  1YUT A;  1NX0 A;  3BOW A;  2V53 A;  3RM1 A;  1RRO A;  5HKY A;  1CDP A;  3IQQ A;  1YX8 A;  1QX7 A;  4ETO A;  2FCD A;  3EK8 A;  1L2O B;  3PAT A;  3LK1 A;  4YI8 A;  3OB2 B;  2M7L A;  1TNW A;  3WNX B;  3E3R A;  3D10 A;  1NX1 A;  1FPW A;  2BBM A;  1M46 A;  5I2O A;  1IQ3 A;  1DF0 A;  1CFP A;  5CSI A;  2JZI A;  1BOC A;  1QTX A;  3I5H C;  1ZUZ A;  1XFU O;  2L4I A;  5AFP A;  1AHR A;  2JT0 A;  4MZK A;  1MQ1 A;  2LNK A;  2I94 A;  4YRU A;  5FYX A;  2KYF A;  3SIA A;  3VRP A;  2HQ8 A;  1UWO A;  2MBX A;  3BQ3 A;  1OQP A;  2CXJ A;  2COL B;  3NXA A;  1WDC B;  5DKQ A;  1DGU A;  4C0L A;  2E6W A;  3VRQ A;  3CTN A;  1BR1 B;  1U5I B;  2EC6 C;  4M2O A;  4CID A;  3SG4 A;  4PDZ A;  2KI6 D;  4YGB B;  2P6B B;  1F8H A;  2OTG C;  3AKA A;  1S36 A;  2K7D A;  1TCF A;  2BCA A;  1JF2 A;  1W7J B;  2KI4 C;  1UHH A;  2BCX A;  2I7A A;  4PCW A;  3IF7 A;  2BL0 C;  1ODB A;  3BUO B;  4A4C A;  1SW8 A;  2JXC A;  4DRW A;  5IBW A;  2HQW A;  1GGZ A;  1DJY A;  1PRW A;  2KYC A;  4L9M A;  1NIW A;  1FI6 A;  3NSL A;  3C1V A;  2PAL A;  3PN7 C;  1S6I A;  2L2E A;  1XFX O;  2JNX A;  1KQV A;  5I8N A;  2AUC A;  3NSI A;  1SPY A;  4GFT A;  4OV2 A;  1GGW A;  4ZCV A;  3BUW B;  4OR9 B;  1F71 A;  3EK7 A;  2A4J A;  1B7T Y;  1CDL A;  1W7I B;  4MRX A;  4MSP A;  5KTY A;  1J7R A;  2JWW A;  2MHH A;  2PSR A;  3FIA A;  2HET A;  1KK7 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...