2JXLA

Solution structure of cardiac n-domain troponin c mutant f77w-v82a
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
89
structure length
89
Chain Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEWLVMMARCMKDDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title Tryptophan Mutants of Cardiac Troponin C: 3D Structure, Troponin I Affinity, and in Situ Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 20
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2007-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jxlA00
2I7AA 2KYFA 2FCEA 1DTLA 1AJ4A 2BE6A 2RGIA 3I5FB 2QACA 4YGDB 5KTYA 2MA2A 2EC6C 1YURA 4DIRA 3BOWA 2L51A 1V1FA 2BBMA 2ZRTA 4HRGA 1OQPA 2CTNA 3OP0A 2DOQA 2L4HA 4ORBB 1F71A 3ZNIA 4PCWA 2JZIA 1NIWA 3E3RA 1QX7A 3O6BA 5HKWA 1MWNA 2M97A 4GPLB 1ALVA 5BPJA 3GK2A 4GNKB 1WDCC 1YUUA 2ZFDA 2H61A 2COLB 5KSZA 4QJ3B 2ZN9A 3I5IC 2BCAA 4XJKA 2K0JA 4DS7A 2JC2A 1CLLA 5G08A 1KCYA 3LK0A 3AKBA 1EXRA 1GGWA 1B8CA 1FF1A 2LM5A 4ETOA 2NXQA 1UHJA 3LK1A 2KI4C 1CDMA 3PFVA 5AXIA 4C0JA 3FIAA 3PATA 3TUYC 3KEVA 1DF0A 4GBAA 2LUXA 1BT6A 1F4OA 1J7OA 2KGBC 1SY9A 1PSRA 2M8UA 2IS9A 1UUSA 1K90D 1KSOA 4A4CA 2L5XB 3DF0A 4AQJA 2R2IA 2KFGA 2JOJA 3EVVA 1IRJA 1KK7Z 1OMVA 4YRUA 2NZ0A 1XVJA 4FQOA 3OB1B 4GGFC 1S36A 2ZN8A 4NDCA 1F8HA 1GGZA 3A8RA 3O4YA 2BCBA 1QV1A 1WLZA 2M29A 2KFHA 3BXKA 3JTDC 5K89A 1J7PA 1QJTA 4USLA 4MZKA 3GK1A 2Y4QA 1BR1B 1MHOA 3IQOA 3I5HC 2HPSA 5DKNA 1B9AA 1S26D 1TOPA 1QV0A 1DJGA 5JOLA 4A4BA 2PSRA 4L9MA 5CSIA 1LKJA 3BUOB 2K7OA 2KBMA 1IKUA 2OS8B 3RM1A 1QVIY 1SL9A 1SKTA 4YI9A 1TRFA 1J55A 1XFZO 1IQ5A 2GGMA 1A2XA 4YGEB 2JULA 4ORAB 3O2PA 1FBVA 1YX7A 1K8UA 3SJSA 1SCVA 1YUSA 1NCZA 1JUOA 4MEWA 1RFJA 1CTRA 2Q91A 1OMRA 1WLMA 3PN7C 4I5KA 1C7VA 1K93D 1KWOC 1SL8A 5HYDA 4F0ZB 1K2HA 4JPZB 3SG2A 1TNXA 2MLEC 2WNDA 1CDLA 3GOFA 1QASA 1UP5A 1K96A 2WORA 1UHHA 2KFFA 1K94A 5KU1A 2M1KB 1FI5A 1QLSA 2JXLA 2LNKA 3OB2B 5CSJA 3TS5B 1ZUZA 1SNLA 1KK8B 2H2KA 4BY5A 1XFVO 1PRWA 1JBAA 2KI6C 1Y0VH 2MLFC 1XO5A 3CGAA 4AQIA 1NCXA 3DVMA 2ZNDA 2QPTA 1MUXA 1BLQA 1JFKA 1G33A 3FWCA 3TDUA 3ICBA 4NDBA 1SL7A 2M49B 3EK7A 4OR9B 2LUCA 3CLNA 2Y5IA 2PALA 4PDZA 2AAOA 4HREE 5HKYA 5F6TA 1C07A 5HLOA 1JF2A 1YRUB 4GAOA 4ZCVA 5D69A 2ZRSA 4ZCUA 4D1EA 1KQMC 1WRLA 4NQGA 3I5FC 1WRKA 3FWBA 3RLZA 2KOTA 1RROA 2F8PA 1BJFA 2I94A 3I5GB 1YRTB 4OCIA 4YI8A 1F54A 3SIBA 3KF9A 5I2OA 2AUCA 1SBJA 1WY9A 4N1FA 2BL0C 2KAXA 1S3PA 1DGVA 4AOMA 3TZ1A 4P5OE 2CNPA 2JXCA 4MSPA 2GV5A 1K9KA 2CXJA 4PHNA 5ER4X 1AK8A 1TCOB 3CR4X 1MF8B 1OZOA 1CKKA 1MXEA 1B47A 1TNPA 1CMFA 2I18A 2MAZA 1KFUS 2EC6B 1IWQA 3HX4A 1B8LA 4P2YB 1SW8A 4WRIA 1ZMZA 2D8NA 2CCMA 3DVEA 4C0LA 3BOWB 1NP8A 2F2PA 4JQ0D 1IG5A 1S1EA 4WQ3A 4CPVA 1CM1A 1SCMB 3O78A 2LHIA 4JWQA 4PHMA 3CR2A 3SG5A 4HSZA 4DUQA 3EKHA 1Y6WA 3WXAA 3IF7A 2MBXA 1V1GA 2NLNA 4M2OA 1CFPA 1QIVA 3NSOA 1S5GZ 3I5IB 4E68A 4MLWA 4PE0A 5J3XA 1YTZC 4GGFA 2JT0A 2FOTA 1JC2A 2MHHA 2NCOA 4QJ5B 1BU3A 2KQYA 2E6WA 3NSLA 1AHRA 4XJKB 3BQ3A 3CTNA 2LC5A 3WNXB 1XFYO 3TDIA 1NX2A 5PALA 3TUYB 1BODA 2VRGA 3D10A 1G8IA 1F70A 2KAYA 1BOCA 2LLTA 1GQMA 3PSRA 4TNCA 4BY4A 2O60A 3TDZA 1KFXL 1DF0B 1YR5A 1YVHA 2JTZA 2L4IA 2I2RE 3OHMB 3EVUA 1N2DA 3LL8B 3WHTB 2BKHB 1Y1UA 3DF0B 1GJYA 3M0WA 1J1DA 1DT7B 1YX8A 4M2QA 2KNEA 1RTP1 3D0YA 4MZLA 2BKIB 2M3WA 2LE9B 4GGNA 3JTDB 3EK8A 4GUKA 2PVBA 2K8MB 2M9GA 2Y1NA 3SG4A 4DRWA 1CFCA 2G9BA 2K7BA 3I5HB 1W7IB 2KGRA 3PLFB 1TNWA 2OTGC 2OPOA 2M7NA 1RECA 4MRXA 1HT9A 1L2OB 1DJZA 1F4QA 1RWYA 1SR6C 5FYXA 2LVJA 2KSPA 1JSAA 2PRUA 1HQVA 5AERA 1YVLA 5CSFA 3AAJA 1QX5B 4ICBA 1BR4B 1ODBA 3MSEB 1X02A 1JWDA 4OVNF 1DJXA 3HCMA 1FPWA 2JNFA 1K9PA 3LCPC 3NSIA 4OV2A 1A75A 2LVVA 5D7FA 4CIDA 1BF5A 3TS5C 5DKQA 4CLNA 3OX6A 1QLKA 1KK8C 1CLMA 2HETA 1EJ3A 1LINA 2HQ8A 2JTTA 2MJWB 1JF0A 3PN7B 4MBEA 1KWOB 1N65A 2HF5A 2MRDA 3SG3A 3BYAA 1EG4A 2JT3A 4U8DA 1J7RA 3QRXA 2AMIA 1NYAA 2KQ6A 3JVTC 1NX1A 2L50A 5CPVA 1CNPA 2K2FA 2WCEA 1CLBA 1XFWO 2LP2A 4OKHA 1B1GA 1FI6A 3KHEA 1KFXS 3PALA 4PHJA 1SK6D 1QTXA 4PALA 4DCKA 1LXFC 5TNCA 1TTXA 1FW4A 4PE1A 1B7TZ 3SG6A 1KK7Y 2SCPA 1H8BA 2SASA 1Y1AA 4GFTA 1LA3A 1TNQA 1OMDA 2PMYA 1PALA 1NX3A 4PHKA 2WOSA 1ZACA 3VRPA 2LMVA 4CFQA 3AAKA 2CT9A 4WQ2A 2O5GA 2F2OA 1JFJA 2M1UA 3A4UB 3K21A 1TIZA 1KSMA 1G4YR 1XK4C 3IQQA 1QVIZ 2V53A 1VRKA 1KQVA 1EG3A 1KQMB 1MXLC 1XFUO 1UURA 2LLSA 1NX0A 3BUNB 1SPYA 2HQWA 4MN0A 1PK0D 1IH0A 3AKAA 2F3YA 5IBWA 1CDPA 3BUXB 1AUIB 1DJYA 2EGDA 2JT8A 1IJ5A 4HRHA 3EK4A 1EL4A 1R6PA 3FS7A 1QS7A 1TN4A 2BL0B 2LP3A 2KI6D 2LCPA 2LLUA 2BE4A 1PVAA 4M2PA 3SIAA 1K95A 3PM8A 1PVBA 3VRNA 2LVKA 2Q4UA 3NXAA 1UHKA 1SCMC 2ZKMX 2GGZA 1D1OA 1WDCB 5AFPA 2A4JA 5JJGA 1IQ3A 2LVIA 1LA0A 1DJHA 1AP4A 4R1EA 2LV7A 4MVFA 5AEQA 1BMOA 1ZFSA 1TCFA 2WCFA 2BBNA 1NUBA 1XA5A 2H61C 1SYMA 2JRFA 1PULA 1NSHA 2ISDA 3VRQA 5B8IB 2G2BA 1Y1XA 2KI4B 1ZOTB 3GK4X 3VRRA 1U5IA 3BUMB 2L2EA 1N0YA 4ORCB 5GQQC 1M39A 1WRZA 1CFDA 1NCYA 2E30A 1M31A 4QJ4B 1XFXO 5CSNA 4PE7A 2KHNA 4FTGA 1SMGA 2NCPA 1PSBA 1CMGA 3DVKA 5ER5A 1W7JB 2K61A 1NPQA 4YGAA 1EH2A 1B4CA 1UHNA 1CM4A 3CWGA 2KYCA 2K2AA 5AANA 1L7ZA 1YUTA 2TN4A 3CR5X 1J7QA 1F55A 1UHIA 2EHBA 3OX5A 1DGUA 1OE9B 2OS8C 2JU0A 3EKJA 1B7TY 1QIWA 3ZWHA 1XYDA 1AJ5A 1U5IB 2F33A 5HKZA 3CS1A 1SRAA 1CDNA 2JNXA 1BG1A 2JPTA 2K7DA 1C7WA 3LLEA 1S6IA 2F3ZA 4IL1A 4CFRA 4N1GA 2JWWA 2M7LA 3H4SE 3DD4A 1MQ1A 2L98A 5HLVA 1L2OC 1CB1A 1K9UA 1QX2A 1J1EA 4YBHB 5DKRA 4YGBB 1A29A 2WC8A 1MR8A 1M63B 3C1VA 5I8NA 2FCDA 1NWDA 5I2QA 2JQ6A 4N5XA 1UWOA 3NSKA 1DVIA 1OSAA 3D0YB 1QATA 4I5JA 2KDHA 3F45A 2KBIA 2PASA 2OTGB 2CBLA 3BUWB 1OZSA 3SG7A 4UPGA 1M46A 2LMUA 1CFFA 2P6BB 2ZNEA 4I5NB 1SR6B 2L0PA 1DMOA 1A4PA 4XYNA 1E8AA 1KFUL 2Y1MA 4I5LB 3KO0A 4Q04A 1Q80A 1LVCD 2LANA 2BCXA 1RK9A 3DVJA 1DJIA 1B8RA 1DJWA 2K7CA 2M0RA 2BECA 3VROA 5I2LA 1S5GY 2KAVA 3KPXA 1ALWA 1AVSA 2LMTA 2B1UA 1OOJA 1M45A 4NDDA 2WCBA 3CZTX 4PE4A 1RJVA 1A75B 1IGVA 4MZJA 1QXPA 3WHUB 2LHLA 3VGOA 4YGCB 4MRYA 1H4BA 3EVRA 1IJ6A 1S6CA 1R2UA 1S6JA 3JVTB 3I5GC 1XK4A 1A03A 2FJUB 4C0KA 2LAPA
chains in the Genus database with same CATH superfamily
2I7AA 2KYFA 2FCEA 1DTLA 3SS5A 1AJ4A 2BE6A 2RGIA 3I5FB 2QACA 4YGDB 5KTYA 2MA2A 2EC6C 1YURA 2JPOA 4DIRA 3BOWA 2L51A 1V1FA 2BBMA 2ZRTA 4HRGA 1OQPA 2CTNA 3OP0A 2DOQA 2L4HA 4ORBB 1F71A 3ZNIA 4PCWA 2JZIA 1NIWA 3E3RA 1QX7A 3O6BA 5HKWA 1MWNA 3K1EA 2M97A 4GPLB 1ALVA 5BPJA 3GK2A 1OOHA 4GNKB 3NGVA 1WDCC 1YUUA 2PQLA 2QDIA 2ZFDA 2H61A 2COLB 5KSZA 3R1VA 2ZN9A 4QJ3B 3I5IC 2BCAA 4XJKA 2K0JA 4DS7A 2JC2A 1CLLA 1XFRA 5G08A 1KCYA 3LK0A 2QEHA 3AKBA 1EXRA 3VB1A 1GGWA 1B8CA 1FF1A 2LM5A 4ETOA 2NXQA 1UHJA 3LK1A 2KI4C 1CDMA 3PFVA 5AXIA 4C0JA 3V2LA 3FIAA 3PATA 3TUYC 3KEVA 1DF0A 4GBAA 2LUXA 1BT6A 1F4OA 2BAPA 1J7OA 1P28A 2KGBC 1SY9A 1PSRA 2M8UA 2IS9A 1UUSA 1K90D 1KSOA 4A4CA 2L5XB 3DF0A 4AQJA 5FI7A 2R2IA 5EL2A 2KFGA 4IJ7A 2JOJA 3FE6A 3EVVA 1IRJA 1KK7Z 1OMVA 4YRUA 2NZ0A 1XVJA 1TWOA 4FQOA 3OB1B 4GGFC 1S36A 2ZN8A 4FQTA 3BJHA 4NDCA 2WCKA 2QEBA 1F8HA 1GGZA 3A8RA 3O4YA 2BCBA 3D74A 2KPHA 1QV1A 1WLZA 2M29A 2KFHA 3BXKA 3JTDC 5K89A 1J7PA 1QJTA 4USLA 4MZKA 3GK1A 2Y4QA 1BR1B 1MHOA 3IQOA 3I5HC 2HPSA 5DKNA 1B9AA 1S26D 1TOPA 1QV0A 1DJGA 5JOLA 4A4BA 2PSRA 4L9MA 3R1OA 5CSIA 1LKJA 3BUOB 3RZSA 3D73A 4F7FA 2K7OA 1DEKA 2KBMA 1IKUA 3UO9A 2OS8B 3RM1A 1QVIY 1SL9A 1SKTA 4YI9A 1TRFA 3DXLA 1J55A 1XFZO 1IQ5A 2GGMA 1A2XA 4YGEB 2JULA 4ORAB 3O2PA 1FBVA 1YX7A 3L4AA 1K8UA 3CYZA 1SCVA 1YUSA 3D78A 3IVTA 1NCZA 1JUOA 4MEWA 3SJSA 1RFJA 1CTRA 2Q91A 1OMRA 1WLMA 3PN7C 1Z4HA 4I5KA 1C7VA 1K93D 1KWOC 1SL8A 5HYDA 4F0ZB 1K2HA 4JPZB 2KLEA 3SG2A 1TNXA 2MLEC 2WNDA 1CDLA 3S0BA 3GOFA 1QASA 1UP5A 1K96A 2WORA 1UHHA 2KFFA 1K94A 5FI2A 2M1KB 5KU1A 1FI5A 1QLSA 2JXLA 2LNKA 3OB2B 3S0EA 5CSJA 3TS5B 1ZUZA 1SNLA 1KK8B 2H2KA 3B87A 4BY5A 1XFVO 1PRWA 1JBAA 3L47A 2KI6C 1Y0VH 2MLFC 1XO5A 3CGAA 4AQIA 1NCXA 3B7AA 3DVMA 2ZNDA 2QPTA 3S0DA 1C3YA 1MUXA 1BLQA 1JFKA 1G33A 3FWCA 3TDUA 3ICBA 4JD9A 4NDBA 1SL7A 3S0GA 2M49B 3EK7A 4OR9B 3DYEA 2LUCA 2WCHA 3CLNA 2Y5IA 2L2CA 2PALA 3B6XA 4PDZA 2AAOA 4HREE 5HKYA 5F6TA 1C07A 5HLOA 1JF2A 1YRUB 4GAOA 4ZCVA 3NHTA 3NHIA 2WCLA 5D69A 2ZRSA 4ZCUA 4D1EA 1KQMC 1WRLA 4NQGA 3I5FC 1WRKA 3FWBA 3RLZA 2KOTA 1RROA 2F8PA 1BJFA 2I94A 3I5GB 1YRTB 4OCIA 4YI8A 1F54A 3OBVA 3SIBA 3KF9A 5I2OA 2AUCA 1SBJA 1WY9A 4N1FA 2BL0C 2KAXA 2GTEA 1S3PA 1DGVA 4AOMA 3TZ1A 4P5OE 2CNPA 2JXCA 4MSPA 2GV5A 1K9KA 2CXJA 4PHNA 5ER4X 1AK8A 1TCOB 3CR4X 3S0FA 1MF8B 1OZOA 1CKKA 2P71A 1MXEA 1B47A 1TNPA 1CMFA 2I18A 2MAZA 1KFUS 2EC6B 1IWQA 2QEOA 3HX4A 1B8LA 4P2YB 1SW8A 4WRIA 1ZMZA 2D8NA 2CCMA 1DELA 3DVEA 3PM2A 4C0LA 3BOWB 1NP8A 2F2PA 4JQ0D 1IG5A 1S1EA 4WQ3A 4CPVA 1CM1A 1GM0A 2WCMA 1SCMB 3O78A 2LHIA 4JWQA 4PHMA 3CR2A 3SG5A 4HSZA 4DUQA 3EKHA 1Y6WA 3WXAA 3IF7A 2MBXA 1V1GA 2NLNA 4M2OA 1CFPA 1QIVA 3NSOA 1S5GZ 3I5IB 4E68A 4MLWA 4PE0A 5J3XA 1YTZC 4GGFA 3EG5B 2JT0A 2FOTA 3O4XA 1JC2A 2MHHA 2NCOA 1C3ZA 1BU3A 3CZ1A 4QJ5B 2KQYA 2FJYA 2E6WA 3NSLA 3OGNA 1AHRA 4XJKB 3BQ3A 3CTNA 2LC5A 3WNXB 1XFYO 3TDIA 1NX2A 3Q8IA 5PALA 3TUYB 1BODA 5D3OA 2VRGA 3D10A 1G8IA 1F70A 2KAYA 3B88A 2LLTA 1BOCA 1GQMA 4JKTA 3PSRA 4TNCA 4BY4A 1OOGA 2O60A 3TDZA 1KFXL 1DF0B 1YR5A 1YVHA 2JTZA 2L4IA 2I2RE 3OHMB 3EVUA 1N2DA 3LL8B 3WHTB 2BKHB 1Y1UA 3DF0B 1GJYA 3M0WA 1J1DA 1DT7B 1YX8A 4M2QA 2KNEA 1RTP1 1SSEB 3D0YA 4MZLA 2BKIB 2M3WA 2LE9B 4GGNA 3JTDB 3EK8A 4GUKA 4OZDA 2PVBA 2K8MB 2M9GA 2Y1NA 3SG4A 4DRWA 1CFCA 2G9BA 2K7BA 3I5HB 1W7IB 2KGRA 3PLFB 1TNWA 2OTGC 2OPOA 3CZ0A 3SS4A 2M7NA 1RECA 4MRXA 1HT9A 1L2OB 1TUJA 1DJZA 1F4QA 1RWYA 1SR6C 5FYXA 2LVJA 2KSPA 1JSAA 2PRUA 1HQVA 5AERA 1YVLA 2ERBA 5CSFA 3AAJA 1QX5B 4ICBA 1BR4B 1ODBA 3MSEB 1X02A 1JWDA 4OVNF 4INWA 1DJXA 3HCMA 1FPWA 2JNFA 1K9PA 3LCPC 3NSIA 4OV2A 1A75A 2LVVA 5D7FA 4CIDA 1BF5A 3TS5C 5DKQA 4CLNA 3OX6A 3SS3A 1QLKA 1KK8C 1CLMA 2HETA 1EJ3A 1LINA 1ORGA 2HQ8A 1T14A 1JF0A 2JTTA 2MJWB 3PN7B 4MBEA 1KWOB 1N65A 2HF5A 2MRDA 3DZTA 3SG3A 3BYAA 1EG4A 2JT3A 4U8DA 1J7RA 3QRXA 2AMIA 3FE8A 1NYAA 2KQ6A 3JVTC 1NX1A 2L50A 5CPVA 1CNPA 2K2FA 2WCEA 1CLBA 1XFWO 2LP2A 2YGUA 4OKHA 1B1GA 1FI6A 3KHEA 1KFXS 3PALA 4PHJA 1SK6D 1QTXA 4PALA 4DCKA 1LXFC 5TNCA 1TTXA 1FW4A 4PE1A 1B7TZ 3SG6A 1KK7Y 2SCPA 1H8BA 2SASA 1Y1AA 4GFTA 1LA3A 1TNQA 1OMDA 2PMYA 1PALA 1NX3A 4PHKA 2WOSA 1ZACA 3VRPA 2LMVA 4CFQA 3AAKA 2CT9A 4WQ2A 2O5GA 3D77A 1DC1A 2F2OA 1JFJA 2M1UA 3A4UB 3K21A 3B86A 1OOFA 1TIZA 1KSMA 1G4YR 1XK4C 1QWVA 5I94A 3IQQA 1QVIZ 2V53A 1VRKA 1KQVA 1EG3A 1KQMB 1MXLC 1XFUO 1UURA 2LLSA 1NX0A 3BUNB 1SPYA 2HQWA 4MN0A 1PK0D 1IH0A 3AKAA 2F3YA 5HL1A 5IBWA 1CDPA 3BUXB 1AUIB 1DJYA 2EGDA 2JT8A 1IJ5A 4HRHA 2K60A 3EK4A 1EL4A 1R6PA 3FS7A 1QS7A 1TN4A 2BL0B 3BFAA 2LP3A 2KI6D 2LCPA 2LLUA 2BE4A 1PVAA 4M2PA 3QMEA 1K95A 1DQEA 2H8VA 1PVBA 3PM8A 5FI6A 3SIAA 2LVKA 3VRNA 2Q4UA 3NXAA 1UHKA 1SCMC 2ZKMX 2GGZA 1D1OA 1WDCB 5AFPA 2A4JA 5JJGA 1IQ3A 2LVIA 2WC5A 1LA0A 1DJHA 1AP4A 4R1EA 3CZ2A 2LV7A 4MVFA 5AEQA 1BMOA 1ZFSA 1TCFA 2WCFA 2BBNA 1NUBA 1XA5A 2H61C 1SYMA 2JRFA 1PULA 1NSHA 2ISDA 3VRQA 5B8IB 2G2BA 3CDNA 1Y1XA 2KI4B 1ZOTB 3GK4X 3VRRA 1U5IA 3BUMB 2L2EA 1N0YA 2QEVA 4ORCB 3L4LA 5GQQC 1M39A 1W9ZA 1WRZA 1CFDA 1NCYA 2E30A 1M31A 4QJ4B 3UNWA 1XFXO 5CSNA 3BFBA 4PE7A 2KHNA 4FTGA 1SMGA 2NCPA 1PSBA 1CMGA 2P70A 3DVKA 5ER5A 1W7JB 2K61A 1NPQA 3BFHA 4YGAA 1B4CA 1EH2A 1UHNA 1CM4A 3CWGA 2KYCA 3N7HA 2K2AA 5AANA 1L7ZA 1YUTA 2TN4A 3CR5X 4KYNA 1J7QA 1F55A 1UHIA 4PT1A 2EHBA 3CABA 3OX5A 1DGUA 1OE9B 2OS8C 2JU0A 3EKJA 1B7TY 1QIWA 3ZWHA 1XYDA 1AJ5A 1U5IB 2F33A 5HKZA 3CS1A 1SRAA 1CDNA 2JNXA 1BG1A 2JPTA 2K7DA 1C7WA 3LLEA 1S6IA 2F3ZA 4IL1A 4CFRA 4N1GA 2JWWA 3PJIA 2M7LA 3H4SE 1LS8A 3DD4A 1MQ1A 2L98A 5HLVA 1L2OC 1CB1A 1K9UA 1QX2A 1J1EA 4YBHB 5DKRA 3R72A 3D75A 4YGBB 1A29A 2WC8A 1MR8A 1M63B 3C1VA 5I8NA 2PYQA 2FCDA 1NWDA 5I2QA 2JQ6A 4N5XA 1UWOA 3NSKA 1DVIA 1OSAA 2BNXA 3D0YB 4INXA 1QATA 4I5JA 2KDHA 3F45A 2KBIA 2PASA 2OTGB 2CBLA 3BUWB 1OZSA 3SG7A 4UPGA 1M46A 2LMUA 1CFFA 2P6BB 1OW4A 2ZNEA 4I5NB 1SR6B 2L0PA 5DICA 1DMOA 1A4PA 4XYNA 1E8AA 1KFUL 3D76A 2Y1MA 4I5LB 1TUZA 3KO0A 4Q04A 1Q80A 3DY9A 1LVCD 2LANA 2BCXA 3R1PA 1RK9A 3DVJA 1DJIA 1B8RA 1DJWA 2K7CA 2M0RA 2BECA 3VROA 5I2LA 1S5GY 2KAVA 3KPXA 1ALWA 2L5YA 1AVSA 2WC6A 2WCJA 1IIOA 2LMTA 2B1UA 1OOJA 2KLDA 1M45A 4NDDA 2WCBA 3CZTX 4PE4A 1RJVA 1OOIX 1A75B 1IGVA 4MZJA 1QXPA 3WHUB 2LHLA 3VGOA 4YGCB 4MRYA 1H4BA 3EVRA 1IJ6A 1S6CA 1R2UA 1S6JA 3JVTB 3I5GC 3S0AA 1XK4A 1A03A 2FJUB 1Z2CB 4C0KA 2LAPA 3FE9A
chains in the Genus database with same CATH topology
2I7AA 2KYFA 2FCEA 1DTLA 1AJ4A 2BE6A 2RGIA 3I5FB 2QACA 4YGDB 5KTYA 2MA2A 2EC6C 1YURA 4DIRA 3BOWA 2L51A 1V1FA 2BBMA 2ZRTA 4HRGA 1OQPA 2CTNA 3OP0A 2DOQA 2L4HA 4ORBB 1F71A 3ZNIA 4PCWA 2JZIA 1NIWA 3E3RA 1QX7A 3O6BA 5HKWA 1MWNA 2M97A 4GPLB 1ALVA 5BPJA 3GK2A 4GNKB 1WDCC 1YUUA 2ZFDA 2H61A 2COLB 5KSZA 4QJ3B 2ZN9A 3I5IC 2BCAA 4XJKA 2K0JA 4DS7A 2JC2A 1CLLA 5G08A 1KCYA 3LK0A 3AKBA 1EXRA 1GGWA 1B8CA 1FF1A 2LM5A 4ETOA 2NXQA 1UHJA 3LK1A 2KI4C 1CDMA 3PFVA 5AXIA 4C0JA 3FIAA 3PATA 3TUYC 3KEVA 1DF0A 4GBAA 2LUXA 1BT6A 1F4OA 1J7OA 2KGBC 1SY9A 1PSRA 2M8UA 2IS9A 1UUSA 1K90D 1KSOA 4A4CA 2L5XB 3DF0A 4AQJA 2R2IA 2KFGA 2JOJA 3EVVA 1IRJA 1KK7Z 1OMVA 4YRUA 2NZ0A 1XVJA 4FQOA 3OB1B 4GGFC 1S36A 2ZN8A 4NDCA 1F8HA 1GGZA 3A8RA 3O4YA 2BCBA 1QV1A 1WLZA 2M29A 2KFHA 3BXKA 3JTDC 5K89A 1J7PA 1QJTA 4USLA 4MZKA 3GK1A 2Y4QA 1BR1B 1MHOA 3IQOA 3I5HC 2HPSA 5DKNA 1B9AA 1S26D 1TOPA 1QV0A 1DJGA 5JOLA 4A4BA 2PSRA 4L9MA 5CSIA 1LKJA 3BUOB 2K7OA 2KBMA 1IKUA 2OS8B 3RM1A 1QVIY 1SL9A 1SKTA 4YI9A 1TRFA 1J55A 1XFZO 1IQ5A 2GGMA 1A2XA 4YGEB 2JULA 4ORAB 3O2PA 1FBVA 1YX7A 1K8UA 3SJSA 1SCVA 1YUSA 1NCZA 1JUOA 4MEWA 1RFJA 1CTRA 2Q91A 1OMRA 1WLMA 3PN7C 4I5KA 1C7VA 1K93D 1KWOC 1SL8A 5HYDA 4F0ZB 1K2HA 4JPZB 3SG2A 1TNXA 2MLEC 2WNDA 1CDLA 3GOFA 1QASA 1UP5A 1K96A 2WORA 1UHHA 2KFFA 1K94A 5KU1A 2M1KB 1FI5A 1QLSA 2JXLA 2LNKA 3OB2B 5CSJA 3TS5B 1ZUZA 1SNLA 1KK8B 2H2KA 4BY5A 1XFVO 1PRWA 1JBAA 2KI6C 1Y0VH 2MLFC 1XO5A 3CGAA 4AQIA 1NCXA 3DVMA 2ZNDA 2QPTA 1MUXA 1BLQA 1JFKA 1G33A 3FWCA 3TDUA 3ICBA 4NDBA 1SL7A 2M49B 3EK7A 4OR9B 2LUCA 3CLNA 2Y5IA 2PALA 4PDZA 2AAOA 4HREE 5HKYA 5F6TA 1C07A 5HLOA 1JF2A 1YRUB 4GAOA 4ZCVA 5D69A 2ZRSA 4ZCUA 4D1EA 1KQMC 1WRLA 4NQGA 3I5FC 1WRKA 3FWBA 3RLZA 2KOTA 1RROA 2F8PA 1BJFA 2I94A 3I5GB 1YRTB 4OCIA 4YI8A 1F54A 3SIBA 3KF9A 5I2OA 2AUCA 1SBJA 1WY9A 4N1FA 2BL0C 2KAXA 1S3PA 1DGVA 4AOMA 3TZ1A 4P5OE 2CNPA 2JXCA 4MSPA 2GV5A 1K9KA 2CXJA 4PHNA 5ER4X 1AK8A 1TCOB 3CR4X 1MF8B 1OZOA 1CKKA 1MXEA 1B47A 1TNPA 1CMFA 2I18A 2MAZA 1KFUS 2EC6B 1IWQA 3HX4A 1B8LA 4P2YB 1SW8A 4WRIA 1ZMZA 2D8NA 2CCMA 3DVEA 4C0LA 3BOWB 1NP8A 2F2PA 4JQ0D 1IG5A 1S1EA 4WQ3A 4CPVA 1CM1A 1SCMB 3O78A 2LHIA 4JWQA 4PHMA 3CR2A 3SG5A 4HSZA 4DUQA 3EKHA 1Y6WA 3WXAA 3IF7A 2MBXA 1V1GA 2NLNA 4M2OA 1CFPA 1QIVA 3NSOA 1S5GZ 3I5IB 4E68A 4MLWA 4PE0A 5J3XA 1YTZC 4GGFA 2JT0A 2FOTA 1JC2A 2MHHA 2NCOA 4QJ5B 1BU3A 2KQYA 2E6WA 3NSLA 1AHRA 4XJKB 3BQ3A 3CTNA 2LC5A 3WNXB 1XFYO 3TDIA 1NX2A 5PALA 3TUYB 1BODA 2VRGA 3D10A 1G8IA 1F70A 2KAYA 1BOCA 2LLTA 1GQMA 3PSRA 4TNCA 4BY4A 2O60A 3TDZA 1KFXL 1DF0B 1YR5A 1YVHA 2JTZA 2L4IA 2I2RE 3OHMB 3EVUA 1N2DA 3LL8B 3WHTB 2BKHB 1Y1UA 3DF0B 1GJYA 3M0WA 1J1DA 1DT7B 1YX8A 4M2QA 2KNEA 1RTP1 3D0YA 4MZLA 2BKIB 2M3WA 2LE9B 4GGNA 3JTDB 3EK8A 4GUKA 2PVBA 2K8MB 2M9GA 2Y1NA 3SG4A 4DRWA 1CFCA 2G9BA 2K7BA 3I5HB 1W7IB 2KGRA 3PLFB 1TNWA 2OTGC 2OPOA 2M7NA 1RECA 4MRXA 1HT9A 1L2OB 1DJZA 1F4QA 1RWYA 1SR6C 5FYXA 2LVJA 2KSPA 1JSAA 2PRUA 1HQVA 5AERA 1YVLA 5CSFA 3AAJA 1QX5B 4ICBA 1BR4B 1ODBA 3MSEB 1X02A 1JWDA 4OVNF 1DJXA 3HCMA 1FPWA 2JNFA 1K9PA 3LCPC 3NSIA 4OV2A 1A75A 2LVVA 5D7FA 4CIDA 1BF5A 3TS5C 5DKQA 4CLNA 3OX6A 1QLKA 1KK8C 1CLMA 2HETA 1EJ3A 1LINA 2HQ8A 2JTTA 2MJWB 1JF0A 3PN7B 4MBEA 1KWOB 1N65A 2HF5A 2MRDA 3SG3A 3BYAA 1EG4A 2JT3A 4U8DA 1J7RA 3QRXA 2AMIA 1NYAA 2KQ6A 3JVTC 1NX1A 2L50A 5CPVA 1CNPA 2K2FA 2WCEA 1CLBA 1XFWO 2LP2A 4OKHA 1B1GA 1FI6A 3KHEA 1KFXS 3PALA 4PHJA 1SK6D 1QTXA 4PALA 4DCKA 1LXFC 5TNCA 1TTXA 1FW4A 4PE1A 1B7TZ 3SG6A 1KK7Y 2SCPA 1H8BA 2SASA 1Y1AA 4GFTA 1LA3A 1TNQA 1OMDA 2PMYA 1PALA 1NX3A 4PHKA 2WOSA 1ZACA 3VRPA 2LMVA 4CFQA 3AAKA 2CT9A 4WQ2A 2O5GA 2F2OA 1JFJA 2M1UA 3A4UB 3K21A 1TIZA 1KSMA 1G4YR 1XK4C 3IQQA 1QVIZ 2V53A 1VRKA 1KQVA 1EG3A 1KQMB 1MXLC 1XFUO 1UURA 2LLSA 1NX0A 3BUNB 1SPYA 2HQWA 4MN0A 1PK0D 1IH0A 3AKAA 2F3YA 5IBWA 1CDPA 3BUXB 1AUIB 1DJYA 2EGDA 2JT8A 1IJ5A 4HRHA 3EK4A 1EL4A 1R6PA 3FS7A 1QS7A 1TN4A 2BL0B 2LP3A 2KI6D 2LCPA 2LLUA 2BE4A 1PVAA 4M2PA 3SIAA 1K95A 3PM8A 1PVBA 3VRNA 2LVKA 2Q4UA 3NXAA 1UHKA 1SCMC 2ZKMX 2GGZA 1D1OA 1WDCB 5AFPA 2A4JA 5JJGA 1IQ3A 2LVIA 1LA0A 1DJHA 1AP4A 4R1EA 2LV7A 4MVFA 5AEQA 1BMOA 1ZFSA 1TCFA 2WCFA 2BBNA 1NUBA 1XA5A 2H61C 1SYMA 2JRFA 1PULA 1NSHA 2ISDA 3VRQA 5B8IB 2G2BA 1Y1XA 2KI4B 1ZOTB 3GK4X 3VRRA 1U5IA 3BUMB 2L2EA 1N0YA 4ORCB 5GQQC 1M39A 1WRZA 1CFDA 1NCYA 2E30A 1M31A 4QJ4B 1XFXO 5CSNA 4PE7A 2KHNA 4FTGA 1SMGA 2NCPA 1PSBA 1CMGA 3DVKA 5ER5A 1W7JB 2K61A 1NPQA 4YGAA 1EH2A 1B4CA 1UHNA 1CM4A 3CWGA 2KYCA 2K2AA 5AANA 1L7ZA 1YUTA 2TN4A 3CR5X 1J7QA 1F55A 1UHIA 2EHBA 3OX5A 1DGUA 1OE9B 2OS8C 2JU0A 3EKJA 1B7TY 1QIWA 3ZWHA 1XYDA 1AJ5A 1U5IB 2F33A 5HKZA 3CS1A 1SRAA 1CDNA 2JNXA 1BG1A 2JPTA 2K7DA 1C7WA 3LLEA 1S6IA 2F3ZA 4IL1A 4CFRA 4N1GA 2JWWA 2M7LA 3H4SE 3DD4A 1MQ1A 2L98A 5HLVA 1L2OC 1CB1A 1K9UA 1QX2A 1J1EA 4YBHB 5DKRA 4YGBB 1A29A 2WC8A 1MR8A 1M63B 3C1VA 5I8NA 2FCDA 1NWDA 5I2QA 2JQ6A 4N5XA 1UWOA 3NSKA 1DVIA 1OSAA 3D0YB 1QATA 4I5JA 2KDHA 3F45A 2KBIA 2PASA 2OTGB 2CBLA 3BUWB 1OZSA 3SG7A 4UPGA 1M46A 2LMUA 1CFFA 2P6BB 2ZNEA 4I5NB 1SR6B 2L0PA 1DMOA 1A4PA 4XYNA 1E8AA 1KFUL 2Y1MA 4I5LB 3KO0A 4Q04A 1Q80A 1LVCD 2LANA 2BCXA 1RK9A 3DVJA 1DJIA 1B8RA 1DJWA 2K7CA 2M0RA 2BECA 3VROA 5I2LA 1S5GY 2KAVA 3KPXA 1ALWA 1AVSA 2LMTA 2B1UA 1OOJA 1M45A 4NDDA 2WCBA 3CZTX 4PE4A 1RJVA 1A75B 1IGVA 4MZJA 1QXPA 3WHUB 2LHLA 3VGOA 4YGCB 4MRYA 1H4BA 3EVRA 1IJ6A 1S6CA 1R2UA 1S6JA 3JVTB 3I5GC 1XK4A 1A03A 2FJUB 4C0KA 2LAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I7A A;  2KYF A;  2FCE A;  1DTL A;  1AJ4 A;  2BE6 A;  2RGI A;  3I5F B;  2QAC A;  4YGD B;  5KTY A;  2MA2 A;  2EC6 C;  1YUR A;  4DIR A;  3BOW A;  2L51 A;  1V1F A;  2BBM A;  2ZRT A;  4HRG A;  1OQP A;  2CTN A;  3OP0 A;  2DOQ A;  2L4H A;  4ORB B;  1F71 A;  3ZNI A;  4PCW A;  2JZI A;  1NIW A;  3E3R A;  1QX7 A;  3O6B A;  5HKW A;  1MWN A;  2M97 A;  4GPL B;  1ALV A;  5BPJ A;  3GK2 A;  4GNK B;  1WDC C;  1YUU A;  2ZFD A;  2H61 A;  2COL B;  5KSZ A;  4QJ3 B;  2ZN9 A;  3I5I C;  2BCA A;  4XJK A;  2K0J A;  4DS7 A;  2JC2 A;  1CLL A;  5G08 A;  1KCY A;  3LK0 A;  3AKB A;  1EXR A;  1GGW A;  1B8C A;  1FF1 A;  2LM5 A;  4ETO A;  2NXQ A;  1UHJ A;  3LK1 A;  2KI4 C;  1CDM A;  3PFV A;  5AXI A;  4C0J A;  3FIA A;  3PAT A;  3TUY C;  3KEV A;  1DF0 A;  4GBA A;  2LUX A;  1BT6 A;  1F4O A;  1J7O A;  2KGB C;  1SY9 A;  1PSR A;  2M8U A;  2IS9 A;  1UUS A;  1K90 D;  1KSO A;  4A4C A;  2L5X B;  3DF0 A;  4AQJ A;  2R2I A;  2KFG A;  2JOJ A;  3EVV A;  1IRJ A;  1KK7 Z;  1OMV A;  4YRU A;  2NZ0 A;  1XVJ A;  4FQO A;  3OB1 B;  4GGF C;  1S36 A;  2ZN8 A;  4NDC A;  1F8H A;  1GGZ A;  3A8R A;  3O4Y A;  2BCB A;  1QV1 A;  1WLZ A;  2M29 A;  2KFH A;  3BXK A;  3JTD C;  5K89 A;  1J7P A;  1QJT A;  4USL A;  4MZK A;  3GK1 A;  2Y4Q A;  1BR1 B;  1MHO A;  3IQO A;  3I5H C;  2HPS A;  5DKN A;  1B9A A;  1S26 D;  1TOP A;  1QV0 A;  1DJG A;  5JOL A;  4A4B A;  2PSR A;  4L9M A;  5CSI A;  1LKJ A;  3BUO B;  2K7O A;  2KBM A;  1IKU A;  2OS8 B;  3RM1 A;  1QVI Y;  1SL9 A;  1SKT A;  4YI9 A;  1TRF A;  1J55 A;  1XFZ O;  1IQ5 A;  2GGM A;  1A2X A;  4YGE B;  2JUL A;  4ORA B;  3O2P A;  1FBV A;  1YX7 A;  1K8U A;  3SJS A;  1SCV A;  1YUS A;  1NCZ A;  1JUO A;  4MEW A;  1RFJ A;  1CTR A;  2Q91 A;  1OMR A;  1WLM A;  3PN7 C;  4I5K A;  1C7V A;  1K93 D;  1KWO C;  1SL8 A;  5HYD A;  4F0Z B;  1K2H A;  4JPZ B;  3SG2 A;  1TNX A;  2MLE C;  2WND A;  1CDL A;  3GOF A;  1QAS A;  1UP5 A;  1K96 A;  2WOR A;  1UHH A;  2KFF A;  1K94 A;  5KU1 A;  2M1K B;  1FI5 A;  1QLS A;  2JXL A;  2LNK A;  3OB2 B;  5CSJ A;  3TS5 B;  1ZUZ A;  1SNL A;  1KK8 B;  2H2K A;  4BY5 A;  1XFV O;  1PRW A;  1JBA A;  2KI6 C;  1Y0V H;  2MLF C;  1XO5 A;  3CGA A;  4AQI A;  1NCX A;  3DVM A;  2ZND A;  2QPT A;  1MUX A;  1BLQ A;  1JFK A;  1G33 A;  3FWC A;  3TDU A;  3ICB A;  4NDB A;  1SL7 A;  2M49 B;  3EK7 A;  4OR9 B;  2LUC A;  3CLN A;  2Y5I A;  2PAL A;  4PDZ A;  2AAO A;  4HRE E;  5HKY A;  5F6T A;  1C07 A;  5HLO A;  1JF2 A;  1YRU B;  4GAO A;  4ZCV A;  5D69 A;  2ZRS A;  4ZCU A;  4D1E A;  1KQM C;  1WRL A;  4NQG A;  3I5F C;  1WRK A;  3FWB A;  3RLZ A;  2KOT A;  1RRO A;  2F8P A;  1BJF A;  2I94 A;  3I5G B;  1YRT B;  4OCI A;  4YI8 A;  1F54 A;  3SIB A;  3KF9 A;  5I2O A;  2AUC A;  1SBJ A;  1WY9 A;  4N1F A;  2BL0 C;  2KAX A;  1S3P A;  1DGV A;  4AOM A;  3TZ1 A;  4P5O E;  2CNP A;  2JXC A;  4MSP A;  2GV5 A;  1K9K A;  2CXJ A;  4PHN A;  5ER4 X;  1AK8 A;  1TCO B;  3CR4 X;  1MF8 B;  1OZO A;  1CKK A;  1MXE A;  1B47 A;  1TNP A;  1CMF A;  2I18 A;  2MAZ A;  1KFU S;  2EC6 B;  1IWQ A;  3HX4 A;  1B8L A;  4P2Y B;  1SW8 A;  4WRI A;  1ZMZ A;  2D8N A;  2CCM A;  3DVE A;  4C0L A;  3BOW B;  1NP8 A;  2F2P A;  4JQ0 D;  1IG5 A;  1S1E A;  4WQ3 A;  4CPV A;  1CM1 A;  1SCM B;  3O78 A;  2LHI A;  4JWQ A;  4PHM A;  3CR2 A;  3SG5 A;  4HSZ A;  4DUQ A;  3EKH A;  1Y6W A;  3WXA A;  3IF7 A;  2MBX A;  1V1G A;  2NLN A;  4M2O A;  1CFP A;  1QIV A;  3NSO A;  1S5G Z;  3I5I B;  4E68 A;  4MLW A;  4PE0 A;  5J3X A;  1YTZ C;  4GGF A;  2JT0 A;  2FOT A;  1JC2 A;  2MHH A;  2NCO A;  4QJ5 B;  1BU3 A;  2KQY A;  2E6W A;  3NSL A;  1AHR A;  4XJK B;  3BQ3 A;  3CTN A;  2LC5 A;  3WNX B;  1XFY O;  3TDI A;  1NX2 A;  5PAL A;  3TUY B;  1BOD A;  2VRG A;  3D10 A;  1G8I A;  1F70 A;  2KAY A;  1BOC A;  2LLT A;  1GQM A;  3PSR A;  4TNC A;  4BY4 A;  2O60 A;  3TDZ A;  1KFX L;  1DF0 B;  1YR5 A;  1YVH A;  2JTZ A;  2L4I A;  2I2R E;  3OHM B;  3EVU A;  1N2D A;  3LL8 B;  3WHT B;  2BKH B;  1Y1U A;  3DF0 B;  1GJY A;  3M0W A;  1J1D A;  1DT7 B;  1YX8 A;  4M2Q A;  2KNE A;  1RTP 1;  3D0Y A;  4MZL A;  2BKI B;  2M3W A;  2LE9 B;  4GGN A;  3JTD B;  3EK8 A;  4GUK A;  2PVB A;  2K8M B;  2M9G A;  2Y1N A;  3SG4 A;  4DRW A;  1CFC A;  2G9B A;  2K7B A;  3I5H B;  1W7I B;  2KGR A;  3PLF B;  1TNW A;  2OTG C;  2OPO A;  2M7N A;  1REC A;  4MRX A;  1HT9 A;  1L2O B;  1DJZ A;  1F4Q A;  1RWY A;  1SR6 C;  5FYX A;  2LVJ A;  2KSP A;  1JSA A;  2PRU A;  1HQV A;  5AER A;  1YVL A;  5CSF A;  3AAJ A;  1QX5 B;  4ICB A;  1BR4 B;  1ODB A;  3MSE B;  1X02 A;  1JWD A;  4OVN F;  1DJX A;  3HCM A;  1FPW A;  2JNF A;  1K9P A;  3LCP C;  3NSI A;  4OV2 A;  1A75 A;  2LVV A;  5D7F A;  4CID A;  1BF5 A;  3TS5 C;  5DKQ A;  4CLN A;  3OX6 A;  1QLK A;  1KK8 C;  1CLM A;  2HET A;  1EJ3 A;  1LIN A;  2HQ8 A;  2JTT A;  2MJW B;  1JF0 A;  3PN7 B;  4MBE A;  1KWO B;  1N65 A;  2HF5 A;  2MRD A;  3SG3 A;  3BYA A;  1EG4 A;  2JT3 A;  4U8D A;  1J7R A;  3QRX A;  2AMI A;  1NYA A;  2KQ6 A;  3JVT C;  1NX1 A;  2L50 A;  5CPV A;  1CNP A;  2K2F A;  2WCE A;  1CLB A;  1XFW O;  2LP2 A;  4OKH A;  1B1G A;  1FI6 A;  3KHE A;  1KFX S;  3PAL A;  4PHJ A;  1SK6 D;  1QTX A;  4PAL A;  4DCK A;  1LXF C;  5TNC A;  1TTX A;  1FW4 A;  4PE1 A;  1B7T Z;  3SG6 A;  1KK7 Y;  2SCP A;  1H8B A;  2SAS A;  1Y1A A;  4GFT A;  1LA3 A;  1TNQ A;  1OMD A;  2PMY A;  1PAL A;  1NX3 A;  4PHK A;  2WOS A;  1ZAC A;  3VRP A;  2LMV A;  4CFQ A;  3AAK A;  2CT9 A;  4WQ2 A;  2O5G A;  2F2O A;  1JFJ A;  2M1U A;  3A4U B;  3K21 A;  1TIZ A;  1KSM A;  1G4Y R;  1XK4 C;  3IQQ A;  1QVI Z;  2V53 A;  1VRK A;  1KQV A;  1EG3 A;  1KQM B;  1MXL C;  1XFU O;  1UUR A;  2LLS A;  1NX0 A;  3BUN B;  1SPY A;  2HQW A;  4MN0 A;  1PK0 D;  1IH0 A;  3AKA A;  2F3Y A;  5IBW A;  1CDP A;  3BUX B;  1AUI B;  1DJY A;  2EGD A;  2JT8 A;  1IJ5 A;  4HRH A;  3EK4 A;  1EL4 A;  1R6P A;  3FS7 A;  1QS7 A;  1TN4 A;  2BL0 B;  2LP3 A;  2KI6 D;  2LCP A;  2LLU A;  2BE4 A;  1PVA A;  4M2P A;  3SIA A;  1K95 A;  3PM8 A;  1PVB A;  3VRN A;  2LVK A;  2Q4U A;  3NXA A;  1UHK A;  1SCM C;  2ZKM X;  2GGZ A;  1D1O A;  1WDC B;  5AFP A;  2A4J A;  5JJG A;  1IQ3 A;  2LVI A;  1LA0 A;  1DJH A;  1AP4 A;  4R1E A;  2LV7 A;  4MVF A;  5AEQ A;  1BMO A;  1ZFS A;  1TCF A;  2WCF A;  2BBN A;  1NUB A;  1XA5 A;  2H61 C;  1SYM A;  2JRF A;  1PUL A;  1NSH A;  2ISD A;  3VRQ A;  5B8I B;  2G2B A;  1Y1X A;  2KI4 B;  1ZOT B;  3GK4 X;  3VRR A;  1U5I A;  3BUM B;  2L2E A;  1N0Y A;  4ORC B;  5GQQ C;  1M39 A;  1WRZ A;  1CFD A;  1NCY A;  2E30 A;  1M31 A;  4QJ4 B;  1XFX O;  5CSN A;  4PE7 A;  2KHN A;  4FTG A;  1SMG A;  2NCP A;  1PSB A;  1CMG A;  3DVK A;  5ER5 A;  1W7J B;  2K61 A;  1NPQ A;  4YGA A;  1EH2 A;  1B4C A;  1UHN A;  1CM4 A;  3CWG A;  2KYC A;  2K2A A;  5AAN A;  1L7Z A;  1YUT A;  2TN4 A;  3CR5 X;  1J7Q A;  1F55 A;  1UHI A;  2EHB A;  3OX5 A;  1DGU A;  1OE9 B;  2OS8 C;  2JU0 A;  3EKJ A;  1B7T Y;  1QIW A;  3ZWH A;  1XYD A;  1AJ5 A;  1U5I B;  2F33 A;  5HKZ A;  3CS1 A;  1SRA A;  1CDN A;  2JNX A;  1BG1 A;  2JPT A;  2K7D A;  1C7W A;  3LLE A;  1S6I A;  2F3Z A;  4IL1 A;  4CFR A;  4N1G A;  2JWW A;  2M7L A;  3H4S E;  3DD4 A;  1MQ1 A;  2L98 A;  5HLV A;  1L2O C;  1CB1 A;  1K9U A;  1QX2 A;  1J1E A;  4YBH B;  5DKR A;  4YGB B;  1A29 A;  2WC8 A;  1MR8 A;  1M63 B;  3C1V A;  5I8N A;  2FCD A;  1NWD A;  5I2Q A;  2JQ6 A;  4N5X A;  1UWO A;  3NSK A;  1DVI A;  1OSA A;  3D0Y B;  1QAT A;  4I5J A;  2KDH A;  3F45 A;  2KBI A;  2PAS A;  2OTG B;  2CBL A;  3BUW B;  1OZS A;  3SG7 A;  4UPG A;  1M46 A;  2LMU A;  1CFF A;  2P6B B;  2ZNE A;  4I5N B;  1SR6 B;  2L0P A;  1DMO A;  1A4P A;  4XYN A;  1E8A A;  1KFU L;  2Y1M A;  4I5L B;  3KO0 A;  4Q04 A;  1Q80 A;  1LVC D;  2LAN A;  2BCX A;  1RK9 A;  3DVJ A;  1DJI A;  1B8R A;  1DJW A;  2K7C A;  2M0R A;  2BEC A;  3VRO A;  5I2L A;  1S5G Y;  2KAV A;  3KPX A;  1ALW A;  1AVS A;  2LMT A;  2B1U A;  1OOJ A;  1M45 A;  4NDD A;  2WCB A;  3CZT X;  4PE4 A;  1RJV A;  1A75 B;  1IGV A;  4MZJ A;  1QXP A;  3WHU B;  2LHL A;  3VGO A;  4YGC B;  4MRY A;  1H4B A;  3EVR A;  1IJ6 A;  1S6C A;  1R2U A;  1S6J A;  3JVT B;  3I5G C;  1XK4 A;  1A03 A;  2FJU B;  4C0K A;  2LAP A; 
#chains in the Genus database with same CATH topology
 2I7A A;  2KYF A;  2FCE A;  1DTL A;  3SS5 A;  1AJ4 A;  2BE6 A;  2RGI A;  3I5F B;  2QAC A;  4YGD B;  5KTY A;  2MA2 A;  2EC6 C;  1YUR A;  2JPO A;  4DIR A;  3BOW A;  2L51 A;  1V1F A;  2BBM A;  2ZRT A;  4HRG A;  1OQP A;  2CTN A;  3OP0 A;  2DOQ A;  2L4H A;  4ORB B;  1F71 A;  3ZNI A;  4PCW A;  2JZI A;  1NIW A;  3E3R A;  1QX7 A;  3O6B A;  5HKW A;  1MWN A;  3K1E A;  2M97 A;  4GPL B;  1ALV A;  5BPJ A;  3GK2 A;  1OOH A;  4GNK B;  3NGV A;  1WDC C;  1YUU A;  2PQL A;  2QDI A;  2ZFD A;  2H61 A;  2COL B;  5KSZ A;  3R1V A;  2ZN9 A;  4QJ3 B;  3I5I C;  2BCA A;  4XJK A;  2K0J A;  4DS7 A;  2JC2 A;  1CLL A;  1XFR A;  5G08 A;  1KCY A;  3LK0 A;  2QEH A;  3AKB A;  1EXR A;  3VB1 A;  1GGW A;  1B8C A;  1FF1 A;  2LM5 A;  4ETO A;  2NXQ A;  1UHJ A;  3LK1 A;  2KI4 C;  1CDM A;  3PFV A;  5AXI A;  4C0J A;  3V2L A;  3FIA A;  3PAT A;  3TUY C;  3KEV A;  1DF0 A;  4GBA A;  2LUX A;  1BT6 A;  1F4O A;  2BAP A;  1J7O A;  1P28 A;  2KGB C;  1SY9 A;  1PSR A;  2M8U A;  2IS9 A;  1UUS A;  1K90 D;  1KSO A;  4A4C A;  2L5X B;  3DF0 A;  4AQJ A;  5FI7 A;  2R2I A;  5EL2 A;  2KFG A;  4IJ7 A;  2JOJ A;  3FE6 A;  3EVV A;  1IRJ A;  1KK7 Z;  1OMV A;  4YRU A;  2NZ0 A;  1XVJ A;  1TWO A;  4FQO A;  3OB1 B;  4GGF C;  1S36 A;  2ZN8 A;  4FQT A;  3BJH A;  4NDC A;  2WCK A;  2QEB A;  1F8H A;  1GGZ A;  3A8R A;  3O4Y A;  2BCB A;  3D74 A;  2KPH A;  1QV1 A;  1WLZ A;  2M29 A;  2KFH A;  3BXK A;  3JTD C;  5K89 A;  1J7P A;  1QJT A;  4USL A;  4MZK A;  3GK1 A;  2Y4Q A;  1BR1 B;  1MHO A;  3IQO A;  3I5H C;  2HPS A;  5DKN A;  1B9A A;  1S26 D;  1TOP A;  1QV0 A;  1DJG A;  5JOL A;  4A4B A;  2PSR A;  4L9M A;  3R1O A;  5CSI A;  1LKJ A;  3BUO B;  3RZS A;  3D73 A;  4F7F A;  2K7O A;  1DEK A;  2KBM A;  1IKU A;  3UO9 A;  2OS8 B;  3RM1 A;  1QVI Y;  1SL9 A;  1SKT A;  4YI9 A;  1TRF A;  3DXL A;  1J55 A;  1XFZ O;  1IQ5 A;  2GGM A;  1A2X A;  4YGE B;  2JUL A;  4ORA B;  3O2P A;  1FBV A;  1YX7 A;  3L4A A;  1K8U A;  3CYZ A;  1SCV A;  1YUS A;  3D78 A;  3IVT A;  1NCZ A;  1JUO A;  4MEW A;  3SJS A;  1RFJ A;  1CTR A;  2Q91 A;  1OMR A;  1WLM A;  3PN7 C;  1Z4H A;  4I5K A;  1C7V A;  1K93 D;  1KWO C;  1SL8 A;  5HYD A;  4F0Z B;  1K2H A;  4JPZ B;  2KLE A;  3SG2 A;  1TNX A;  2MLE C;  2WND A;  1CDL A;  3S0B A;  3GOF A;  1QAS A;  1UP5 A;  1K96 A;  2WOR A;  1UHH A;  2KFF A;  1K94 A;  5FI2 A;  2M1K B;  5KU1 A;  1FI5 A;  1QLS A;  2JXL A;  2LNK A;  3OB2 B;  3S0E A;  5CSJ A;  3TS5 B;  1ZUZ A;  1SNL A;  1KK8 B;  2H2K A;  3B87 A;  4BY5 A;  1XFV O;  1PRW A;  1JBA A;  3L47 A;  2KI6 C;  1Y0V H;  2MLF C;  1XO5 A;  3CGA A;  4AQI A;  1NCX A;  3B7A A;  3DVM A;  2ZND A;  2QPT A;  3S0D A;  1C3Y A;  1MUX A;  1BLQ A;  1JFK A;  1G33 A;  3FWC A;  3TDU A;  3ICB A;  4JD9 A;  4NDB A;  1SL7 A;  3S0G A;  2M49 B;  3EK7 A;  4OR9 B;  3DYE A;  2LUC A;  2WCH A;  3CLN A;  2Y5I A;  2L2C A;  2PAL A;  3B6X A;  4PDZ A;  2AAO A;  4HRE E;  5HKY A;  5F6T A;  1C07 A;  5HLO A;  1JF2 A;  1YRU B;  4GAO A;  4ZCV A;  3NHT A;  3NHI A;  2WCL A;  5D69 A;  2ZRS A;  4ZCU A;  4D1E A;  1KQM C;  1WRL A;  4NQG A;  3I5F C;  1WRK A;  3FWB A;  3RLZ A;  2KOT A;  1RRO A;  2F8P A;  1BJF A;  2I94 A;  3I5G B;  1YRT B;  4OCI A;  4YI8 A;  1F54 A;  3OBV A;  3SIB A;  3KF9 A;  5I2O A;  2AUC A;  1SBJ A;  1WY9 A;  4N1F A;  2BL0 C;  2KAX A;  2GTE A;  1S3P A;  1DGV A;  4AOM A;  3TZ1 A;  4P5O E;  2CNP A;  2JXC A;  4MSP A;  2GV5 A;  1K9K A;  2CXJ A;  4PHN A;  5ER4 X;  1AK8 A;  1TCO B;  3CR4 X;  3S0F A;  1MF8 B;  1OZO A;  1CKK A;  2P71 A;  1MXE A;  1B47 A;  1TNP A;  1CMF A;  2I18 A;  2MAZ A;  1KFU S;  2EC6 B;  1IWQ A;  2QEO A;  3HX4 A;  1B8L A;  4P2Y B;  1SW8 A;  4WRI A;  1ZMZ A;  2D8N A;  2CCM A;  1DEL A;  3DVE A;  3PM2 A;  4C0L A;  3BOW B;  1NP8 A;  2F2P A;  4JQ0 D;  1IG5 A;  1S1E A;  4WQ3 A;  4CPV A;  1CM1 A;  1GM0 A;  2WCM A;  1SCM B;  3O78 A;  2LHI A;  4JWQ A;  4PHM A;  3CR2 A;  3SG5 A;  4HSZ A;  4DUQ A;  3EKH A;  1Y6W A;  3WXA A;  3IF7 A;  2MBX A;  1V1G A;  2NLN A;  4M2O A;  1CFP A;  1QIV A;  3NSO A;  1S5G Z;  3I5I B;  4E68 A;  4MLW A;  4PE0 A;  5J3X A;  1YTZ C;  4GGF A;  3EG5 B;  2JT0 A;  2FOT A;  3O4X A;  1JC2 A;  2MHH A;  2NCO A;  1C3Z A;  1BU3 A;  3CZ1 A;  4QJ5 B;  2KQY A;  2FJY A;  2E6W A;  3NSL A;  3OGN A;  1AHR A;  4XJK B;  3BQ3 A;  3CTN A;  2LC5 A;  3WNX B;  1XFY O;  3TDI A;  1NX2 A;  3Q8I A;  5PAL A;  3TUY B;  1BOD A;  5D3O A;  2VRG A;  3D10 A;  1G8I A;  1F70 A;  2KAY A;  3B88 A;  2LLT A;  1BOC A;  1GQM A;  4JKT A;  3PSR A;  4TNC A;  4BY4 A;  1OOG A;  2O60 A;  3TDZ A;  1KFX L;  1DF0 B;  1YR5 A;  1YVH A;  2JTZ A;  2L4I A;  2I2R E;  3OHM B;  3EVU A;  1N2D A;  3LL8 B;  3WHT B;  2BKH B;  1Y1U A;  3DF0 B;  1GJY A;  3M0W A;  1J1D A;  1DT7 B;  1YX8 A;  4M2Q A;  2KNE A;  1RTP 1;  1SSE B;  3D0Y A;  4MZL A;  2BKI B;  2M3W A;  2LE9 B;  4GGN A;  3JTD B;  3EK8 A;  4GUK A;  4OZD A;  2PVB A;  2K8M B;  2M9G A;  2Y1N A;  3SG4 A;  4DRW A;  1CFC A;  2G9B A;  2K7B A;  3I5H B;  1W7I B;  2KGR A;  3PLF B;  1TNW A;  2OTG C;  2OPO A;  3CZ0 A;  3SS4 A;  2M7N A;  1REC A;  4MRX A;  1HT9 A;  1L2O B;  1TUJ A;  1DJZ A;  1F4Q A;  1RWY A;  1SR6 C;  5FYX A;  2LVJ A;  2KSP A;  1JSA A;  2PRU A;  1HQV A;  5AER A;  1YVL A;  2ERB A;  5CSF A;  3AAJ A;  1QX5 B;  4ICB A;  1BR4 B;  1ODB A;  3MSE B;  1X02 A;  1JWD A;  4OVN F;  4INW A;  1DJX A;  3HCM A;  1FPW A;  2JNF A;  1K9P A;  3LCP C;  3NSI A;  4OV2 A;  1A75 A;  2LVV A;  5D7F A;  4CID A;  1BF5 A;  3TS5 C;  5DKQ A;  4CLN A;  3OX6 A;  3SS3 A;  1QLK A;  1KK8 C;  1CLM A;  2HET A;  1EJ3 A;  1LIN A;  1ORG A;  2HQ8 A;  1T14 A;  1JF0 A;  2JTT A;  2MJW B;  3PN7 B;  4MBE A;  1KWO B;  1N65 A;  2HF5 A;  2MRD A;  3DZT A;  3SG3 A;  3BYA A;  1EG4 A;  2JT3 A;  4U8D A;  1J7R A;  3QRX A;  2AMI A;  3FE8 A;  1NYA A;  2KQ6 A;  3JVT C;  1NX1 A;  2L50 A;  5CPV A;  1CNP A;  2K2F A;  2WCE A;  1CLB A;  1XFW O;  2LP2 A;  2YGU A;  4OKH A;  1B1G A;  1FI6 A;  3KHE A;  1KFX S;  3PAL A;  4PHJ A;  1SK6 D;  1QTX A;  4PAL A;  4DCK A;  1LXF C;  5TNC A;  1TTX A;  1FW4 A;  4PE1 A;  1B7T Z;  3SG6 A;  1KK7 Y;  2SCP A;  1H8B A;  2SAS A;  1Y1A A;  4GFT A;  1LA3 A;  1TNQ A;  1OMD A;  2PMY A;  1PAL A;  1NX3 A;  4PHK A;  2WOS A;  1ZAC A;  3VRP A;  2LMV A;  4CFQ A;  3AAK A;  2CT9 A;  4WQ2 A;  2O5G A;  3D77 A;  1DC1 A;  2F2O A;  1JFJ A;  2M1U A;  3A4U B;  3K21 A;  3B86 A;  1OOF A;  1TIZ A;  1KSM A;  1G4Y R;  1XK4 C;  1QWV A;  5I94 A;  3IQQ A;  1QVI Z;  2V53 A;  1VRK A;  1KQV A;  1EG3 A;  1KQM B;  1MXL C;  1XFU O;  1UUR A;  2LLS A;  1NX0 A;  3BUN B;  1SPY A;  2HQW A;  4MN0 A;  1PK0 D;  1IH0 A;  3AKA A;  2F3Y A;  5HL1 A;  5IBW A;  1CDP A;  3BUX B;  1AUI B;  1DJY A;  2EGD A;  2JT8 A;  1IJ5 A;  4HRH A;  2K60 A;  3EK4 A;  1EL4 A;  1R6P A;  3FS7 A;  1QS7 A;  1TN4 A;  2BL0 B;  3BFA A;  2LP3 A;  2KI6 D;  2LCP A;  2LLU A;  2BE4 A;  1PVA A;  4M2P A;  3QME A;  1K95 A;  1DQE A;  2H8V A;  1PVB A;  3PM8 A;  5FI6 A;  3SIA A;  2LVK A;  3VRN A;  2Q4U A;  3NXA A;  1UHK A;  1SCM C;  2ZKM X;  2GGZ A;  1D1O A;  1WDC B;  5AFP A;  2A4J A;  5JJG A;  1IQ3 A;  2LVI A;  2WC5 A;  1LA0 A;  1DJH A;  1AP4 A;  4R1E A;  3CZ2 A;  2LV7 A;  4MVF A;  5AEQ A;  1BMO A;  1ZFS A;  1TCF A;  2WCF A;  2BBN A;  1NUB A;  1XA5 A;  2H61 C;  1SYM A;  2JRF A;  1PUL A;  1NSH A;  2ISD A;  3VRQ A;  5B8I B;  2G2B A;  3CDN A;  1Y1X A;  2KI4 B;  1ZOT B;  3GK4 X;  3VRR A;  1U5I A;  3BUM B;  2L2E A;  1N0Y A;  2QEV A;  4ORC B;  3L4L A;  5GQQ C;  1M39 A;  1W9Z A;  1WRZ A;  1CFD A;  1NCY A;  2E30 A;  1M31 A;  4QJ4 B;  3UNW A;  1XFX O;  5CSN A;  3BFB A;  4PE7 A;  2KHN A;  4FTG A;  1SMG A;  2NCP A;  1PSB A;  1CMG A;  2P70 A;  3DVK A;  5ER5 A;  1W7J B;  2K61 A;  1NPQ A;  3BFH A;  4YGA A;  1B4C A;  1EH2 A;  1UHN A;  1CM4 A;  3CWG A;  2KYC A;  3N7H A;  2K2A A;  5AAN A;  1L7Z A;  1YUT A;  2TN4 A;  3CR5 X;  4KYN A;  1J7Q A;  1F55 A;  1UHI A;  4PT1 A;  2EHB A;  3CAB A;  3OX5 A;  1DGU A;  1OE9 B;  2OS8 C;  2JU0 A;  3EKJ A;  1B7T Y;  1QIW A;  3ZWH A;  1XYD A;  1AJ5 A;  1U5I B;  2F33 A;  5HKZ A;  3CS1 A;  1SRA A;  1CDN A;  2JNX A;  1BG1 A;  2JPT A;  2K7D A;  1C7W A;  3LLE A;  1S6I A;  2F3Z A;  4IL1 A;  4CFR A;  4N1G A;  2JWW A;  3PJI A;  2M7L A;  3H4S E;  1LS8 A;  3DD4 A;  1MQ1 A;  2L98 A;  5HLV A;  1L2O C;  1CB1 A;  1K9U A;  1QX2 A;  1J1E A;  4YBH B;  5DKR A;  3R72 A;  3D75 A;  4YGB B;  1A29 A;  2WC8 A;  1MR8 A;  1M63 B;  3C1V A;  5I8N A;  2PYQ A;  2FCD A;  1NWD A;  5I2Q A;  2JQ6 A;  4N5X A;  1UWO A;  3NSK A;  1DVI A;  1OSA A;  2BNX A;  3D0Y B;  4INX A;  1QAT A;  4I5J A;  2KDH A;  3F45 A;  2KBI A;  2PAS A;  2OTG B;  2CBL A;  3BUW B;  1OZS A;  3SG7 A;  4UPG A;  1M46 A;  2LMU A;  1CFF A;  2P6B B;  1OW4 A;  2ZNE A;  4I5N B;  1SR6 B;  2L0P A;  5DIC A;  1DMO A;  1A4P A;  4XYN A;  1E8A A;  1KFU L;  3D76 A;  2Y1M A;  4I5L B;  1TUZ A;  3KO0 A;  4Q04 A;  1Q80 A;  3DY9 A;  1LVC D;  2LAN A;  2BCX A;  3R1P A;  1RK9 A;  3DVJ A;  1DJI A;  1B8R A;  1DJW A;  2K7C A;  2M0R A;  2BEC A;  3VRO A;  5I2L A;  1S5G Y;  2KAV A;  3KPX A;  1ALW A;  2L5Y A;  1AVS A;  2WC6 A;  2WCJ A;  1IIO A;  2LMT A;  2B1U A;  1OOJ A;  2KLD A;  1M45 A;  4NDD A;  2WCB A;  3CZT X;  4PE4 A;  1RJV A;  1OOI X;  1A75 B;  1IGV A;  4MZJ A;  1QXP A;  3WHU B;  2LHL A;  3VGO A;  4YGC B;  4MRY A;  1H4B A;  3EVR A;  1IJ6 A;  1S6C A;  1R2U A;  1S6J A;  3JVT B;  3I5G C;  3S0A A;  1XK4 A;  1A03 A;  2FJU B;  1Z2C B;  4C0K A;  2LAP A;  3FE9 A; 
#chains in the Genus database with same CATH homology
 2I7A A;  2KYF A;  2FCE A;  1DTL A;  1AJ4 A;  2BE6 A;  2RGI A;  3I5F B;  2QAC A;  4YGD B;  5KTY A;  2MA2 A;  2EC6 C;  1YUR A;  4DIR A;  3BOW A;  2L51 A;  1V1F A;  2BBM A;  2ZRT A;  4HRG A;  1OQP A;  2CTN A;  3OP0 A;  2DOQ A;  2L4H A;  4ORB B;  1F71 A;  3ZNI A;  4PCW A;  2JZI A;  1NIW A;  3E3R A;  1QX7 A;  3O6B A;  5HKW A;  1MWN A;  2M97 A;  4GPL B;  1ALV A;  5BPJ A;  3GK2 A;  4GNK B;  1WDC C;  1YUU A;  2ZFD A;  2H61 A;  2COL B;  5KSZ A;  4QJ3 B;  2ZN9 A;  3I5I C;  2BCA A;  4XJK A;  2K0J A;  4DS7 A;  2JC2 A;  1CLL A;  5G08 A;  1KCY A;  3LK0 A;  3AKB A;  1EXR A;  1GGW A;  1B8C A;  1FF1 A;  2LM5 A;  4ETO A;  2NXQ A;  1UHJ A;  3LK1 A;  2KI4 C;  1CDM A;  3PFV A;  5AXI A;  4C0J A;  3FIA A;  3PAT A;  3TUY C;  3KEV A;  1DF0 A;  4GBA A;  2LUX A;  1BT6 A;  1F4O A;  1J7O A;  2KGB C;  1SY9 A;  1PSR A;  2M8U A;  2IS9 A;  1UUS A;  1K90 D;  1KSO A;  4A4C A;  2L5X B;  3DF0 A;  4AQJ A;  2R2I A;  2KFG A;  2JOJ A;  3EVV A;  1IRJ A;  1KK7 Z;  1OMV A;  4YRU A;  2NZ0 A;  1XVJ A;  4FQO A;  3OB1 B;  4GGF C;  1S36 A;  2ZN8 A;  4NDC A;  1F8H A;  1GGZ A;  3A8R A;  3O4Y A;  2BCB A;  1QV1 A;  1WLZ A;  2M29 A;  2KFH A;  3BXK A;  3JTD C;  5K89 A;  1J7P A;  1QJT A;  4USL A;  4MZK A;  3GK1 A;  2Y4Q A;  1BR1 B;  1MHO A;  3IQO A;  3I5H C;  2HPS A;  5DKN A;  1B9A A;  1S26 D;  1TOP A;  1QV0 A;  1DJG A;  5JOL A;  4A4B A;  2PSR A;  4L9M A;  5CSI A;  1LKJ A;  3BUO B;  2K7O A;  2KBM A;  1IKU A;  2OS8 B;  3RM1 A;  1QVI Y;  1SL9 A;  1SKT A;  4YI9 A;  1TRF A;  1J55 A;  1XFZ O;  1IQ5 A;  2GGM A;  1A2X A;  4YGE B;  2JUL A;  4ORA B;  3O2P A;  1FBV A;  1YX7 A;  1K8U A;  3SJS A;  1SCV A;  1YUS A;  1NCZ A;  1JUO A;  4MEW A;  1RFJ A;  1CTR A;  2Q91 A;  1OMR A;  1WLM A;  3PN7 C;  4I5K A;  1C7V A;  1K93 D;  1KWO C;  1SL8 A;  5HYD A;  4F0Z B;  1K2H A;  4JPZ B;  3SG2 A;  1TNX A;  2MLE C;  2WND A;  1CDL A;  3GOF A;  1QAS A;  1UP5 A;  1K96 A;  2WOR A;  1UHH A;  2KFF A;  1K94 A;  5KU1 A;  2M1K B;  1FI5 A;  1QLS A;  2JXL A;  2LNK A;  3OB2 B;  5CSJ A;  3TS5 B;  1ZUZ A;  1SNL A;  1KK8 B;  2H2K A;  4BY5 A;  1XFV O;  1PRW A;  1JBA A;  2KI6 C;  1Y0V H;  2MLF C;  1XO5 A;  3CGA A;  4AQI A;  1NCX A;  3DVM A;  2ZND A;  2QPT A;  1MUX A;  1BLQ A;  1JFK A;  1G33 A;  3FWC A;  3TDU A;  3ICB A;  4NDB A;  1SL7 A;  2M49 B;  3EK7 A;  4OR9 B;  2LUC A;  3CLN A;  2Y5I A;  2PAL A;  4PDZ A;  2AAO A;  4HRE E;  5HKY A;  5F6T A;  1C07 A;  5HLO A;  1JF2 A;  1YRU B;  4GAO A;  4ZCV A;  5D69 A;  2ZRS A;  4ZCU A;  4D1E A;  1KQM C;  1WRL A;  4NQG A;  3I5F C;  1WRK A;  3FWB A;  3RLZ A;  2KOT A;  1RRO A;  2F8P A;  1BJF A;  2I94 A;  3I5G B;  1YRT B;  4OCI A;  4YI8 A;  1F54 A;  3SIB A;  3KF9 A;  5I2O A;  2AUC A;  1SBJ A;  1WY9 A;  4N1F A;  2BL0 C;  2KAX A;  1S3P A;  1DGV A;  4AOM A;  3TZ1 A;  4P5O E;  2CNP A;  2JXC A;  4MSP A;  2GV5 A;  1K9K A;  2CXJ A;  4PHN A;  5ER4 X;  1AK8 A;  1TCO B;  3CR4 X;  1MF8 B;  1OZO A;  1CKK A;  1MXE A;  1B47 A;  1TNP A;  1CMF A;  2I18 A;  2MAZ A;  1KFU S;  2EC6 B;  1IWQ A;  3HX4 A;  1B8L A;  4P2Y B;  1SW8 A;  4WRI A;  1ZMZ A;  2D8N A;  2CCM A;  3DVE A;  4C0L A;  3BOW B;  1NP8 A;  2F2P A;  4JQ0 D;  1IG5 A;  1S1E A;  4WQ3 A;  4CPV A;  1CM1 A;  1SCM B;  3O78 A;  2LHI A;  4JWQ A;  4PHM A;  3CR2 A;  3SG5 A;  4HSZ A;  4DUQ A;  3EKH A;  1Y6W A;  3WXA A;  3IF7 A;  2MBX A;  1V1G A;  2NLN A;  4M2O A;  1CFP A;  1QIV A;  3NSO A;  1S5G Z;  3I5I B;  4E68 A;  4MLW A;  4PE0 A;  5J3X A;  1YTZ C;  4GGF A;  2JT0 A;  2FOT A;  1JC2 A;  2MHH A;  2NCO A;  4QJ5 B;  1BU3 A;  2KQY A;  2E6W A;  3NSL A;  1AHR A;  4XJK B;  3BQ3 A;  3CTN A;  2LC5 A;  3WNX B;  1XFY O;  3TDI A;  1NX2 A;  5PAL A;  3TUY B;  1BOD A;  2VRG A;  3D10 A;  1G8I A;  1F70 A;  2KAY A;  1BOC A;  2LLT A;  1GQM A;  3PSR A;  4TNC A;  4BY4 A;  2O60 A;  3TDZ A;  1KFX L;  1DF0 B;  1YR5 A;  1YVH A;  2JTZ A;  2L4I A;  2I2R E;  3OHM B;  3EVU A;  1N2D A;  3LL8 B;  3WHT B;  2BKH B;  1Y1U A;  3DF0 B;  1GJY A;  3M0W A;  1J1D A;  1DT7 B;  1YX8 A;  4M2Q A;  2KNE A;  1RTP 1;  3D0Y A;  4MZL A;  2BKI B;  2M3W A;  2LE9 B;  4GGN A;  3JTD B;  3EK8 A;  4GUK A;  2PVB A;  2K8M B;  2M9G A;  2Y1N A;  3SG4 A;  4DRW A;  1CFC A;  2G9B A;  2K7B A;  3I5H B;  1W7I B;  2KGR A;  3PLF B;  1TNW A;  2OTG C;  2OPO A;  2M7N A;  1REC A;  4MRX A;  1HT9 A;  1L2O B;  1DJZ A;  1F4Q A;  1RWY A;  1SR6 C;  5FYX A;  2LVJ A;  2KSP A;  1JSA A;  2PRU A;  1HQV A;  5AER A;  1YVL A;  5CSF A;  3AAJ A;  1QX5 B;  4ICB A;  1BR4 B;  1ODB A;  3MSE B;  1X02 A;  1JWD A;  4OVN F;  1DJX A;  3HCM A;  1FPW A;  2JNF A;  1K9P A;  3LCP C;  3NSI A;  4OV2 A;  1A75 A;  2LVV A;  5D7F A;  4CID A;  1BF5 A;  3TS5 C;  5DKQ A;  4CLN A;  3OX6 A;  1QLK A;  1KK8 C;  1CLM A;  2HET A;  1EJ3 A;  1LIN A;  2HQ8 A;  2JTT A;  2MJW B;  1JF0 A;  3PN7 B;  4MBE A;  1KWO B;  1N65 A;  2HF5 A;  2MRD A;  3SG3 A;  3BYA A;  1EG4 A;  2JT3 A;  4U8D A;  1J7R A;  3QRX A;  2AMI A;  1NYA A;  2KQ6 A;  3JVT C;  1NX1 A;  2L50 A;  5CPV A;  1CNP A;  2K2F A;  2WCE A;  1CLB A;  1XFW O;  2LP2 A;  4OKH A;  1B1G A;  1FI6 A;  3KHE A;  1KFX S;  3PAL A;  4PHJ A;  1SK6 D;  1QTX A;  4PAL A;  4DCK A;  1LXF C;  5TNC A;  1TTX A;  1FW4 A;  4PE1 A;  1B7T Z;  3SG6 A;  1KK7 Y;  2SCP A;  1H8B A;  2SAS A;  1Y1A A;  4GFT A;  1LA3 A;  1TNQ A;  1OMD A;  2PMY A;  1PAL A;  1NX3 A;  4PHK A;  2WOS A;  1ZAC A;  3VRP A;  2LMV A;  4CFQ A;  3AAK A;  2CT9 A;  4WQ2 A;  2O5G A;  2F2O A;  1JFJ A;  2M1U A;  3A4U B;  3K21 A;  1TIZ A;  1KSM A;  1G4Y R;  1XK4 C;  3IQQ A;  1QVI Z;  2V53 A;  1VRK A;  1KQV A;  1EG3 A;  1KQM B;  1MXL C;  1XFU O;  1UUR A;  2LLS A;  1NX0 A;  3BUN B;  1SPY A;  2HQW A;  4MN0 A;  1PK0 D;  1IH0 A;  3AKA A;  2F3Y A;  5IBW A;  1CDP A;  3BUX B;  1AUI B;  1DJY A;  2EGD A;  2JT8 A;  1IJ5 A;  4HRH A;  3EK4 A;  1EL4 A;  1R6P A;  3FS7 A;  1QS7 A;  1TN4 A;  2BL0 B;  2LP3 A;  2KI6 D;  2LCP A;  2LLU A;  2BE4 A;  1PVA A;  4M2P A;  3SIA A;  1K95 A;  3PM8 A;  1PVB A;  3VRN A;  2LVK A;  2Q4U A;  3NXA A;  1UHK A;  1SCM C;  2ZKM X;  2GGZ A;  1D1O A;  1WDC B;  5AFP A;  2A4J A;  5JJG A;  1IQ3 A;  2LVI A;  1LA0 A;  1DJH A;  1AP4 A;  4R1E A;  2LV7 A;  4MVF A;  5AEQ A;  1BMO A;  1ZFS A;  1TCF A;  2WCF A;  2BBN A;  1NUB A;  1XA5 A;  2H61 C;  1SYM A;  2JRF A;  1PUL A;  1NSH A;  2ISD A;  3VRQ A;  5B8I B;  2G2B A;  1Y1X A;  2KI4 B;  1ZOT B;  3GK4 X;  3VRR A;  1U5I A;  3BUM B;  2L2E A;  1N0Y A;  4ORC B;  5GQQ C;  1M39 A;  1WRZ A;  1CFD A;  1NCY A;  2E30 A;  1M31 A;  4QJ4 B;  1XFX O;  5CSN A;  4PE7 A;  2KHN A;  4FTG A;  1SMG A;  2NCP A;  1PSB A;  1CMG A;  3DVK A;  5ER5 A;  1W7J B;  2K61 A;  1NPQ A;  4YGA A;  1EH2 A;  1B4C A;  1UHN A;  1CM4 A;  3CWG A;  2KYC A;  2K2A A;  5AAN A;  1L7Z A;  1YUT A;  2TN4 A;  3CR5 X;  1J7Q A;  1F55 A;  1UHI A;  2EHB A;  3OX5 A;  1DGU A;  1OE9 B;  2OS8 C;  2JU0 A;  3EKJ A;  1B7T Y;  1QIW A;  3ZWH A;  1XYD A;  1AJ5 A;  1U5I B;  2F33 A;  5HKZ A;  3CS1 A;  1SRA A;  1CDN A;  2JNX A;  1BG1 A;  2JPT A;  2K7D A;  1C7W A;  3LLE A;  1S6I A;  2F3Z A;  4IL1 A;  4CFR A;  4N1G A;  2JWW A;  2M7L A;  3H4S E;  3DD4 A;  1MQ1 A;  2L98 A;  5HLV A;  1L2O C;  1CB1 A;  1K9U A;  1QX2 A;  1J1E A;  4YBH B;  5DKR A;  4YGB B;  1A29 A;  2WC8 A;  1MR8 A;  1M63 B;  3C1V A;  5I8N A;  2FCD A;  1NWD A;  5I2Q A;  2JQ6 A;  4N5X A;  1UWO A;  3NSK A;  1DVI A;  1OSA A;  3D0Y B;  1QAT A;  4I5J A;  2KDH A;  3F45 A;  2KBI A;  2PAS A;  2OTG B;  2CBL A;  3BUW B;  1OZS A;  3SG7 A;  4UPG A;  1M46 A;  2LMU A;  1CFF A;  2P6B B;  2ZNE A;  4I5N B;  1SR6 B;  2L0P A;  1DMO A;  1A4P A;  4XYN A;  1E8A A;  1KFU L;  2Y1M A;  4I5L B;  3KO0 A;  4Q04 A;  1Q80 A;  1LVC D;  2LAN A;  2BCX A;  1RK9 A;  3DVJ A;  1DJI A;  1B8R A;  1DJW A;  2K7C A;  2M0R A;  2BEC A;  3VRO A;  5I2L A;  1S5G Y;  2KAV A;  3KPX A;  1ALW A;  1AVS A;  2LMT A;  2B1U A;  1OOJ A;  1M45 A;  4NDD A;  2WCB A;  3CZT X;  4PE4 A;  1RJV A;  1A75 B;  1IGV A;  4MZJ A;  1QXP A;  3WHU B;  2LHL A;  3VGO A;  4YGC B;  4MRY A;  1H4B A;  3EVR A;  1IJ6 A;  1S6C A;  1R2U A;  1S6J A;  3JVT B;  3I5G C;  1XK4 A;  1A03 A;  2FJU B;  4C0K A;  2LAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...