2JXLA

Solution structure of cardiac n-domain troponin c mutant f77w-v82a
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
89
structure length
89
Chain Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEWLVMMARCMKDDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title Tryptophan Mutants of Cardiac Troponin C: 3D Structure, Troponin I Affinity, and in Situ Activity.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2007-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jxlA00
2PASA 3OB1B 1S6IA 3GK1A 4YI8A 2KFHA 4L9MA 1U5IB 1A75A 1TNXA 2LLSA 4ORCB 4WRIA 5FYXA 2OPOA 4NDDA 3K21A 2MBXA 1BR1B 1H4BA 1OMRA 1S6JA 2JC2A 4FQOA 2M8UA 2KDHA 1AP4A 1M46A 2BE4A 4ZCVA 4DCKA 1XK4A 3FWBA 1DT7B 2NXQA 3TZ1A 1SCMB 2LVJA 2QACA 1CLMA 1OOJA 1B1GA 1AUIB 1EXRA 1NX2A 4MN0A 1TNQA 3I5IC 2K2AA 2G2BA 1PALA 3CR4X 4PHJA 1ODBA 2NZ0A 1LVCD 1WY9A 5KTYA 2KI6D 5PALA 4CIDA 1PRWA 3DF0A 4NQGA 3JVTB 1GJYA 3DF0B 1KCYA 3DVEA 4WQ3A 4DUQA 1M39A 4A4CA 1R6PA 5I8NA 1KQVA 1LXFC 5HKYA 3OHMB 1XFVO 4M2OA 1CDLA 2FJUB 4U8DA 1BOCA 1OQPA 2VRGA 1F71A 1K96A 2LVIA 1F55A 1QX5B 3VRPA 5ER5A 4ICBA 3RLZA 3LLEA 2JWWA 1SNLA 2LV7A 2FOTA 3D10A 4NDBA 2LNKA 4OCIA 1OSAA 2ZN9A 5IBWA 1SL8A 1XFWO 1W7JB 5HKWA 5JJGA 4QJ3B 1IGVA 2EGDA 1YUUA 4XJKA 4GPLB 5BPJA 1CKKA 1NX1A 1UWOA 4XJKB 1KFXS 1S26D 3CWGA 2KSPA 5ER4X 4QJ4B 2H61A 2NLNA 1SMGA 5I2LA 1NX0A 2B1UA 4MZKA 2KFGA 1LINA 1SL9A 4OVNF 1XA5A 3E3RA 3I5HC 1V1FA 1NCYA 4HSZA 1OE9B 1UHIA 3TDZA 3WHTB 1TCFA 4P5OE 1Y1UA 2BL0C 2KI4B 3VROA 2L50A 1MWNA 2ZNEA 1PK0D 1CMGA 1L2OC 1QTXA 1ALWA 1CTRA 1J7PA 1SK6D 3JTDB 4CFRA 1OZOA 2D8NA 1A29A 1J55A 3I5GB 3GK4X 1ZACA 3PM8A 1MR8A 4GGFA 3DVKA 3O6BA 1XFUO 1KFUS 1PULA 1DGUA 3ICBA 4GUKA 1KK8B 1YRTB 3EK7A 3BOWB 3IQQA 2GV5A 1RECA 1Y0VH 4I5JA 2KNEA 4I5LB 2M49B 1XFYO 2HPSA 2SCPA 1Y1AA 1XO5A 1J7QA 1PVAA 2M7NA 3TUYB 3D0YB 3WNXB 1GGZA 1N2DA 3BUXB 4MBEA 1BMOA 1KSMA 5GQQC 3PALA 4JQ0D 3OX6A 1DJGA 1QATA 1RJVA 2NCOA 2ZFDA 4PE7A 5HLOA 1IWQA 1MXEA 2AUCA 2ZRTA 3HX4A 4C0KA 4F0ZB 3TS5B 3NSKA 1FI5A 4YGEB 2JTTA 3GOFA 4MRYA 2CBLA 2M1UA 2SASA 3PN7C 3SG3A 1YVHA 4M2PA 4UPGA 1IQ3A 1KWOB 2MLFC 1S36A 1L7ZA 3SG2A 3EVVA 3PSRA 2LMTA 2K61A 2CTNA 1F4QA 1CFFA 1MUXA 3LK1A 2M7LA 4YGCB 2M3WA 4GBAA 1U5IA 1N0YA 1NP8A 2JOJA 1J1DA 2F2OA 1IG5A 1FBVA 3DVJA 5HKZA 5K89A 2L4HA 2LE9B 4PHNA 2LP3A 3CR5X 3BUNB 1OZSA 1SKTA 3O4YA 3BQ3A 5DKQA 1XK4C 1BT6A 1LA0A 1K2HA 3A8RA 1Y6WA 2LHLA 2F33A 3OX5A 1WRZA 2M29A 2LM5A 4R1EA 1A03A 1WDCB 2JULA 1ALVA 2L4IA 1IQ5A 2M97A 1A2XA 1IKUA 4JPZB 2K8MB 1MXLC 1HQVA 1F70A 1K9UA 2Y5IA 4BY4A 5D7FA 1E8AA 2FCDA 2GGZA 1AHRA 1YRUB 3I5FC 4ORBB 4I5KA 3AAKA 1OMVA 4MLWA 4HRGA 2EC6C 2DOQA 2OTGB 1DJZA 1JF0A 4MEWA 2Q91A 1DTLA 1K93D 2A4JA 1C07A 2CNPA 3NSIA 1Y1XA 2BKHB 1EG3A 2KI6C 5KU1A 3I5IB 3NSLA 2JZIA 1PSBA 4N1GA 1B9AA 2BKIB 3OB2B 2KQ6A 4P2YB 1CMFA 1TIZA 2PSRA 2JT0A 4MZLA 1JSAA 1UHNA 3GK2A 1TTXA 1JWDA 1N65A 1B47A 2JT8A 1SRAA 3ZWHA 3QRXA 3BUWB 1JFKA 2HQ8A 2COLB 1SW8A 2L2EA 2PMYA 1S5GY 2IS9A 1LA3A 1NUBA 1EJ3A 1EG4A 1AK8A 3EVUA 1BR4B 1BJFA 1RROA 1QLSA 1QV1A 2LP2A 3CTNA 3BUOB 1RTP1 1DJWA 1K90D 1ZFSA 2EHBA 3DD4A 5F6TA 1KFUL 3SIAA 1TNPA 3VRQA 1SPYA 4PDZA 2KYCA 2KHNA 4N1FA 1CLBA 1NWDA 1C7WA 3IQOA 1KQMC 1Q80A 1H8BA 3AKAA 1TRFA 2K7DA 2PALA 1NX3A 2KAYA 2TN4A 1WRLA 4PALA 1JFJA 1FW4A 4D1EA 1KK7Y 3MSEB 4GGFC 2ZN8A 5CSJA 1KK8C 3BXKA 3CLNA 1YR5A 2KYFA 1A4PA 4AQJA 1CLLA 1XFZO 1MHOA 3BYAA 1K8UA 2I18A 2ZKMX 3BOWA 3I5HB 4MSPA 1R2UA 2JRFA 4C0LA 1K9KA 1MQ1A 3A4UB 2BBNA 1JC2A 4PE4A 2L5XB 1GGWA 1QX2A 3TUYC 4C0JA 3O2PA 1IH0A 1MF8B 4WQ2A 1B7TY 2BBMA 2E6WA 3BUMB 4IL1A 1L2OB 3D0YA 1CFCA 4CFQA 1QXPA 1CDNA 2GGMA 1XYDA 2LC5A 5B8IB 4N5XA 2F8PA 1YX7A 2JT3A 2RGIA 2OS8B 3C1VA 5HLVA 3KPXA 1YURA 2JXLA 1QV0A 1S5GZ 1B8RA 3LCPC 3VRRA 4TNCA 1LKJA 1ZMZA 4PHMA 1DF0A 2BCXA 1DF0B 4YGAA 4ZCUA 1IRJA 2F3YA 5AANA 4DS7A 2F3ZA 1UURA 3VGOA 1G8IA 2HETA 1EH2A 1TN4A 1PVBA 1SR6B 2LMVA 1DMOA 4BY5A 2LUXA 2PRUA 2O60A 1V1GA 1J7OA 3LK0A 1FF1A 1IJ6A 1S6CA 1TCOB 1VRKA 4MVFA 4AQIA 2M9GA 1CDMA 1DGVA 1K9PA 2K7OA 1KK7Z 2PVBA 2BECA 4JWQA 1SCMC 1M31A 2M0RA 1WDCC 1K94A 1UHKA 1CFDA 1TNWA 1DJHA 1NPQA 1YVLA 3AAJA 3EK4A 3EK8A 1QX7A 4A4BA 1S3PA 3PN7B 1SCVA 2WC8A 5CPVA 4CLNA 1SYMA 4ETOA 3H4SE 1YX8A 1DJIA 3HCMA 3JVTC 2MLEC 1B7TZ 3DVMA 2E30A 1JUOA 1ZOTB 4OV2A 2JXCA 3PLFB 1A75B 1QIWA 2CXJA 4I5NB 1F54A 2KGBC 2AAOA 2BCBA 2OTGC 3KHEA 5CSIA 1XVJA 3NSOA 1CDPA 2WCEA 5JOLA 4USLA 2WNDA 3WHUB 4YGDB 2MJWB 2LLTA 4ORAB 2K2FA 2LVKA 1KFXL 5KSZA 1CB1A 2L98A 1D1OA 2LMUA 1RWYA 1UUSA 3RM1A 3F45A 2MAZA 5DKNA 3CZTX 2H2KA 2I94A 1YUSA 2BE6A 2NCPA 2AMIA 1S1EA 1QVIY 2HQWA 2O5GA 2MRDA 2WCBA 3WXAA 1UHHA 2LAPA 4DIRA 3SJSA 2H61C 2LLUA 2F2PA 3AKBA 3I5FB 1UHJA 2HF5A 3PATA 1YTZC 2EC6B 4NDCA 1JF2A 1QIVA 3FWCA 1EL4A 2Y1NA 1NYAA 2ZRSA 2Y1MA 1RK9A 2ISDA 2I7AA 3EVRA 2LHIA 3KO0A 1NIWA 4M2QA 2KI4C 4OKHA 4OR9B 2Q4UA 3IF7A 1F8HA 1F4OA 2JU0A 1PSRA 3EKJA 3ZNIA 2L51A 3JTDC 4DRWA 3I5GC 5J3XA 3TDUA 1J1EA 4PHKA 2JPTA 1CM1A 4GFTA 3M0WA 2G9BA 1AVSA 3EKHA 2K0JA 2KBIA 1B8CA 4HREE 2JQ6A 2FCEA 1QLKA 3CS1A 3SG5A 1RFJA 1SBJA 2WORA 3SIBA 4E68A 2KOTA 4PE1A 4FTGA 3SG4A 4QJ5B 1BG1A 3KEVA 1JBAA 1DVIA 1QS7A 1WRKA 1GQMA 3FS7A 3KF9A 2JTZA 2WOSA 1IJ5A 1ZUZA 3TDIA 1BU3A 1CM4A 2BL0B 2ZNDA 1BF5A 1UP5A 2LUCA 1K95A 2QPTA 4PE0A 4YGBB 1W7IB 2CCMA 2JNXA 2LANA 4GGNA 5D69A 1BODA 1KQMB 1QVIZ 1HT9A 1TOPA 1QJTA 3PFVA 3SG6A 5CSNA 2CT9A 1CFPA 2KAVA 2OS8C 2V53A 1M45A 1SL7A 2MHHA 2KGRA 1M63B 2M1KB 3CR2A 3TS5C 4CPVA 5I2OA 1DJXA 4GNKB 5AEQA 4YRUA 1NCXA 2KBMA 2Y4QA 3O78A 3NXAA 1G4YR 5AXIA 2P6BB 2K7BA 1AJ4A 5G08A 1KWOC 1FI6A 1J7RA 2R2IA 4HRHA 5TNCA 1SR6C 3VRNA 5AFPA 1B4CA 1B8LA 4MRXA 1WLMA 4MZJA 1G33A 2LCPA 2I2RE 3OP0A 4PCWA 3SG7A 1CNPA 2KAXA 4XYNA 1KSOA 1NCZA 1C7VA 5DKRA 4AOMA 1WLZA 1SY9A 3CGAA 1XFXO 1NSHA 2MA2A 2KFFA 1DJYA 1OMDA 3LL8B 2WCFA 1FPWA 2BCAA 2KQYA 4Q04A 4YBHB 1BLQA 1AJ5A 2LVVA 2K7CA 4GAOA 1QASA 5I2QA 5AERA 5HYDA 4YI9A 5CSFA 1YUTA 3FIAA 1X02A 2L0PA 2JNFA
chains in the Genus database with same CATH superfamily
2PASA 3OB1B 1S6IA 3GK1A 4YI8A 2KFHA 1Z4HA 4L9MA 1U5IB 5D3OA 1A75A 1TNXA 2LLSA 4ORCB 4WRIA 5FYXA 2OPOA 2WC5A 4NDDA 3K21A 2MBXA 1BR1B 1H4BA 1OMRA 1S6JA 2JC2A 4FQOA 2M8UA 2KDHA 1AP4A 1M46A 2BE4A 4ZCVA 4DCKA 1XK4A 3FWBA 1DT7B 2NXQA 3TZ1A 1SCMB 2LVJA 2QACA 1CLMA 1OOJA 1B1GA 1AUIB 1EXRA 1NX2A 3N7HA 1TNQA 4MN0A 3I5IC 2K2AA 2G2BA 1PALA 3CR4X 4PHJA 1ODBA 2NZ0A 3R1PA 1LVCD 1WY9A 5KTYA 2KI6D 5PALA 4CIDA 1PRWA 3DF0A 4NQGA 3JVTB 1GJYA 3DF0B 1KCYA 4JD9A 3DVEA 4WQ3A 4DUQA 1M39A 4INWA 4A4CA 1R6PA 5I8NA 1KQVA 1LXFC 5HKYA 3OHMB 1XFVO 4M2OA 1CDLA 2FJUB 4U8DA 1BOCA 1OQPA 2VRGA 4KYNA 1F71A 1K96A 2LVIA 1F55A 1QX5B 3VRPA 5ER5A 4ICBA 3RLZA 3LLEA 2JWWA 1SNLA 3DY9A 2LV7A 3EK4A 2FOTA 3D10A 4NDBA 1SSEB 1OOHA 2QDIA 2LNKA 4OCIA 1OSAA 2ZN9A 5IBWA 1SL8A 1XFWO 3S0FA 1W7JB 5HKWA 5JJGA 4QJ3B 1IGVA 2EGDA 1YUUA 4XJKA 4GPLB 5BPJA 1CKKA 1NX1A 1UWOA 4XJKB 1KFXS 5EL2A 1S26D 3CWGA 2KSPA 5ER4X 4QJ4B 2H61A 2NLNA 1SMGA 5I2LA 1NX0A 3RZSA 2B1UA 4MZKA 2KFGA 1LINA 1SL9A 4OVNF 1XA5A 3E3RA 3I5HC 1V1FA 1NCYA 4HSZA 1OE9B 3V2LA 1UHIA 3TDZA 3WHTB 1OOGA 1TCFA 3B87A 4P5OE 1TUJA 1Y1UA 2BL0C 2KI4B 3OBVA 3VROA 2L50A 1MWNA 2ZNEA 1PK0D 1CMGA 1L2OC 1QTXA 1ALWA 2PYQA 1CTRA 3PJIA 1J7PA 1SK6D 3JTDB 4CFRA 1OZOA 2D8NA 1A29A 4INXA 1J55A 3I5GB 3D77A 3GK4X 1ZACA 3PM8A 1C3ZA 1MR8A 4GGFA 3DVKA 3O6BA 1XFUO 1KFUS 1PULA 1DGUA 3ICBA 4GUKA 3UNWA 1KK8B 1YRTB 3EK7A 2L5YA 3Q8IA 3BOWB 3IQQA 3NHIA 2GV5A 2ERBA 1RECA 1Y0VH 4I5JA 2KNEA 4I5LB 2M49B 3R1OA 1XFYO 2HPSA 2SCPA 1Y1AA 1XO5A 1J7QA 1PVAA 2M7NA 3TUYB 3D0YB 3WNXB 1GGZA 1N2DA 3BUXB 4MBEA 1BMOA 1KSMA 5GQQC 3PALA 4JQ0D 3OX6A 1DJGA 1QATA 2QEHA 1RJVA 2NCOA 2ZFDA 4FQTA 4PE7A 1IWQA 1MXEA 2AUCA 2ZRTA 3HX4A 4C0KA 4F0ZB 3TS5B 3NSKA 1FI5A 4YGEB 2JTTA 5DICA 3GOFA 4MRYA 3B7AA 2CBLA 2M1UA 2SASA 3PN7C 3SG3A 1YVHA 4M2PA 4UPGA 2P71A 1KWOB 2MLFC 1S36A 1L7ZA 1P28A 3SG2A 1IQ3A 3EVVA 3PSRA 2LMTA 3NHTA 2K61A 2CTNA 1F4QA 1CFFA 1MUXA 3LK1A 2M7LA 4YGCB 2M3WA 4GBAA 1U5IA 1N0YA 1NP8A 2FJYA 2JOJA 1J1DA 3L4LA 2F2OA 1IG5A 1FBVA 3DVJA 4IJ7A 5HKZA 5K89A 2L4HA 2LE9B 4PHNA 2LP3A 3CR5X 3BUNB 1OZSA 1SKTA 3O4YA 3BQ3A 2WCKA 2WCJA 5DKQA 1XK4C 1BT6A 1LA0A 1K2HA 3A8RA 1OOFA 3D74A 1Y6WA 2LHLA 2F33A 3OX5A 1Z2CB 1WRZA 2M29A 3CYZA 2LM5A 4R1EA 1A03A 1WDCB 2JULA 1ALVA 2L4IA 1IQ5A 2WCHA 2M97A 1A2XA 3CDNA 1IKUA 4JPZB 2K8MB 1MXLC 1OOIX 1HQVA 1F70A 1ORGA 1K9UA 2Y5IA 4BY4A 2GTEA 1E8AA 5D7FA 2FCDA 2GGZA 1AHRA 1YRUB 3I5FC 4ORBB 4I5KA 3AAKA 1OMVA 4MLWA 4HRGA 2BNXA 2DOQA 2EC6C 2OTGB 1TWOA 3B88A 1DJZA 1T14A 1JF0A 4MEWA 2Q91A 1DTLA 1K93D 2A4JA 1C07A 2CNPA 3NSIA 1Y1XA 2BKHB 1EG3A 2KI6C 2YGUA 5KU1A 3I5IB 3NSLA 2JZIA 1PSBA 4N1GA 1B9AA 2BKIB 3OB2B 2KQ6A 4P2YB 3B86A 1CMFA 1TIZA 2PSRA 2JT0A 4MZLA 1JSAA 1UHNA 3GK2A 1TTXA 5FI7A 1JWDA 1N65A 1B47A 2JT8A 1SRAA 3ZWHA 3QRXA 1DELA 3BUWB 1JFKA 2HQ8A 2COLB 1SW8A 2L2EA 2PMYA 1S5GY 3PM2A 2IS9A 1LA3A 1NUBA 1EJ3A 1EG4A 1AK8A 2QEOA 1BR4B 1BJFA 3EVUA 1IIOA 1RROA 1QLSA 1QV1A 2LP2A 3CTNA 3BUOB 1RTP1 1OW4A 1DC1A 1DJWA 1K90D 1ZFSA 2EHBA 3DD4A 5F6TA 1KFUL 3SIAA 1TNPA 3VRQA 1SPYA 4PDZA 2KYCA 2KHNA 4N1FA 1CLBA 1W9ZA 1NWDA 1C7WA 3IQOA 1KQMC 1Q80A 3OGNA 1H8BA 3AKAA 1TRFA 2H8VA 2K7DA 2PALA 1NX3A 2KAYA 2TN4A 3BFBA 1WRLA 4PALA 1JFJA 1FW4A 1XFRA 4D1EA 1KK7Y 3MSEB 4GGFC 2ZN8A 5CSJA 1KK8C 3BXKA 3CLNA 1YR5A 2KYFA 1A4PA 5FI2A 4AQJA 1CLLA 1XFZO 1MHOA 3BYAA 1K8UA 2I18A 2ZKMX 3BOWA 3I5HB 4MSPA 1R2UA 2JRFA 4JKTA 2BAPA 4C0LA 1K9KA 1MQ1A 3A4UB 2BBNA 1JC2A 4PE4A 2L5XB 3S0BA 1QX2A 3TUYC 1GGWA 4C0JA 4PT1A 3O2PA 1IH0A 1MF8B 4WQ2A 1B7TY 2BBMA 2E6WA 3BUMB 4IL1A 1L2OB 3D0YA 1CFCA 4CFQA 1QXPA 1CDNA 2GGMA 1XYDA 2LC5A 5B8IB 4N5XA 2F8PA 5HLOA 1YX7A 2JT3A 2RGIA 3R72A 2OS8B 2WCLA 3FE8A 3C1VA 5HLVA 3KPXA 1YURA 2JXLA 1QV0A 1S5GZ 1B8RA 3LCPC 3DYEA 3VRRA 4TNCA 1LKJA 1ZMZA 4PHMA 3SS4A 1DF0A 2BCXA 1DF0B 4YGAA 4ZCUA 1IRJA 2F3YA 5AANA 4DS7A 2F3ZA 1UURA 3VGOA 1G8IA 2HETA 1EH2A 3S0EA 1TN4A 1PVBA 1SR6B 2LMVA 1DMOA 5HL1A 4BY5A 2QEVA 2LUXA 2PRUA 2O60A 1V1GA 1J7OA 3LK0A 1FF1A 1IJ6A 1S6CA 2PQLA 1TCOB 1VRKA 4MVFA 4AQIA 2M9GA 1CDMA 3S0AA 1GM0A 1DGVA 1K9PA 2K7OA 1KK7Z 2PVBA 2BECA 3IVTA 4JWQA 1SCMC 1M31A 2M0RA 1WDCC 1K94A 1CFDA 1UHKA 1TNWA 1DJHA 1NPQA 1YVLA 2WC6A 3AAJA 3CZ0A 3EK8A 3K1EA 1QX7A 3R1VA 3DZTA 4A4BA 1S3PA 3PN7B 1SCVA 2WC8A 5CPVA 3QMEA 4CLNA 1SYMA 4OZDA 4ETOA 3H4SE 1YX8A 1DJIA 3HCMA 3JVTC 2MLEC 1B7TZ 3DVMA 2E30A 1JUOA 1ZOTB 3D73A 4OV2A 2JXCA 3PLFB 1A75B 1QIWA 2CXJA 4I5NB 1F54A 2KGBC 2AAOA 2BCBA 2OTGC 3KHEA 5CSIA 1XVJA 1QWVA 1CDPA 2WCEA 3NSOA 5JOLA 4USLA 2WNDA 3WHUB 4YGDB 2MJWB 2LLTA 3NGVA 4ORAB 2K2FA 2LVKA 1KFXL 5KSZA 1CB1A 3B6XA 2L98A 1D1OA 2KLEA 1RWYA 1UUSA 2LMUA 3CZ1A 3F45A 3RM1A 2MAZA 5DKNA 3CZTX 2H2KA 3CZ2A 2JPOA 2I94A 1YUSA 2BE6A 2NCPA 2AMIA 1S1EA 1QVIY 2HQWA 2O5GA 2MRDA 2WCBA 3D76A 1UHHA 2LAPA 3WXAA 4DIRA 3SJSA 1DEKA 2H61C 2LLUA 2F2PA 3AKBA 3I5FB 1UHJA 2HF5A 3PATA 1YTZC 2EC6B 1C3YA 3D75A 4NDCA 1JF2A 1QIVA 3FWCA 1EL4A 2Y1NA 1NYAA 2L2CA 2ZRSA 3BFAA 2Y1MA 1RK9A 2K60A 2ISDA 5I94A 2I7AA 3EVRA 2LHIA 3KO0A 1NIWA 4M2QA 2KI4C 4OKHA 4OR9B 2Q4UA 3IF7A 1F8HA 2WCMA 1F4OA 2P70A 3BFHA 2JU0A 1PSRA 3EKJA 3ZNIA 2L51A 3JTDC 3EG5B 4DRWA 3UO9A 3I5GC 5J3XA 3TDUA 1J1EA 4PHKA 2JPTA 3L47A 1CM1A 4GFTA 3M0WA 2G9BA 1AVSA 3EKHA 2K0JA 2KBIA 1B8CA 4HREE 2JQ6A 2FCEA 1QLKA 3CS1A 3SG5A 1RFJA 1SBJA 2WORA 3D78A 3SIBA 4E68A 3DXLA 2KOTA 4PE1A 4FTGA 3SG4A 4QJ5B 1BG1A 3KEVA 1JBAA 1DVIA 1QS7A 3CABA 1WRKA 1GQMA 3FS7A 3KF9A 2JTZA 2WOSA 3SS3A 1IJ5A 1ZUZA 3TDIA 1BU3A 3S0GA 1CM4A 2BL0B 2ZNDA 1BF5A 1UP5A 2LUCA 1K95A 2QPTA 4PE0A 4YGBB 1W7IB 2CCMA 2JNXA 2LANA 4GGNA 5D69A 1BODA 1KQMB 1QVIZ 1HT9A 1TOPA 1QJTA 3PFVA 3SG6A 5CSNA 2CT9A 1CFPA 2KAVA 2OS8C 2V53A 1M45A 1SL7A 2MHHA 2KGRA 1M63B 2M1KB 3CR2A 3O4XA 3TS5C 4CPVA 5I2OA 1DJXA 4GNKB 5AEQA 4YRUA 1DQEA 1NCXA 2QEBA 2KBMA 2Y4QA 3O78A 3NXAA 1G4YR 3BJHA 5AXIA 2P6BB 3VB1A 2K7BA 1AJ4A 5G08A 1KWOC 1LS8A 1J7RA 2R2IA 1FI6A 4HRHA 2KPHA 5TNCA 1SR6C 1TUZA 3S0DA 3VRNA 5AFPA 1B4CA 1B8LA 4MRXA 1WLMA 4MZJA 1G33A 2LCPA 2I2RE 3OP0A 4PCWA 3SG7A 3SS5A 1CNPA 2KAXA 4XYNA 1KSOA 1NCZA 1C7VA 3FE9A 3L4AA 5DKRA 2KLDA 4AOMA 1WLZA 1SY9A 3CGAA 1XFXO 1NSHA 2MA2A 3FE6A 2KFFA 1DJYA 1OMDA 3LL8B 4F7FA 2WCFA 1FPWA 2BCAA 2KQYA 4Q04A 4YBHB 1BLQA 1AJ5A 2LVVA 2K7CA 4GAOA 1QASA 5I2QA 5AERA 5HYDA 4YI9A 5CSFA 1YUTA 3FIAA 5FI6A 1X02A 2L0PA 2JNFA
chains in the Genus database with same CATH topology
2PASA 3OB1B 1S6IA 3GK1A 4YI8A 2KFHA 4L9MA 1U5IB 1A75A 1TNXA 2LLSA 4ORCB 4WRIA 5FYXA 2OPOA 4NDDA 3K21A 2MBXA 1BR1B 1H4BA 1OMRA 1S6JA 2JC2A 4FQOA 2M8UA 2KDHA 1AP4A 1M46A 2BE4A 4ZCVA 4DCKA 1XK4A 3FWBA 1DT7B 2NXQA 3TZ1A 1SCMB 2LVJA 2QACA 1CLMA 1OOJA 1B1GA 1AUIB 1EXRA 1NX2A 4MN0A 1TNQA 3I5IC 2K2AA 2G2BA 1PALA 3CR4X 4PHJA 1ODBA 2NZ0A 1LVCD 1WY9A 5KTYA 2KI6D 5PALA 4CIDA 1PRWA 3DF0A 4NQGA 3JVTB 1GJYA 3DF0B 1KCYA 3DVEA 4WQ3A 4DUQA 1M39A 4A4CA 1R6PA 5I8NA 1KQVA 1LXFC 5HKYA 3OHMB 1XFVO 4M2OA 1CDLA 2FJUB 4U8DA 1BOCA 1OQPA 2VRGA 1F71A 1K96A 2LVIA 1F55A 1QX5B 3VRPA 5ER5A 4ICBA 3RLZA 3LLEA 2JWWA 1SNLA 2LV7A 2FOTA 3D10A 4NDBA 2LNKA 4OCIA 1OSAA 2ZN9A 5IBWA 1SL8A 1XFWO 1W7JB 5HKWA 5JJGA 4QJ3B 1IGVA 2EGDA 1YUUA 4XJKA 4GPLB 5BPJA 1CKKA 1NX1A 1UWOA 4XJKB 1KFXS 1S26D 3CWGA 2KSPA 5ER4X 4QJ4B 2H61A 2NLNA 1SMGA 5I2LA 1NX0A 2B1UA 4MZKA 2KFGA 1LINA 1SL9A 4OVNF 1XA5A 3E3RA 3I5HC 1V1FA 1NCYA 4HSZA 1OE9B 1UHIA 3TDZA 3WHTB 1TCFA 4P5OE 1Y1UA 2BL0C 2KI4B 3VROA 2L50A 1MWNA 2ZNEA 1PK0D 1CMGA 1L2OC 1QTXA 1ALWA 1CTRA 1J7PA 1SK6D 3JTDB 4CFRA 1OZOA 2D8NA 1A29A 1J55A 3I5GB 3GK4X 1ZACA 3PM8A 1MR8A 4GGFA 3DVKA 3O6BA 1XFUO 1KFUS 1PULA 1DGUA 3ICBA 4GUKA 1KK8B 1YRTB 3EK7A 3BOWB 3IQQA 2GV5A 1RECA 1Y0VH 4I5JA 2KNEA 4I5LB 2M49B 1XFYO 2HPSA 2SCPA 1Y1AA 1XO5A 1J7QA 1PVAA 2M7NA 3TUYB 3D0YB 3WNXB 1GGZA 1N2DA 3BUXB 4MBEA 1BMOA 1KSMA 5GQQC 3PALA 4JQ0D 3OX6A 1DJGA 1QATA 1RJVA 2NCOA 2ZFDA 4PE7A 5HLOA 1IWQA 1MXEA 2AUCA 2ZRTA 3HX4A 4C0KA 4F0ZB 3TS5B 3NSKA 1FI5A 4YGEB 2JTTA 3GOFA 4MRYA 2CBLA 2M1UA 2SASA 3PN7C 3SG3A 1YVHA 4M2PA 4UPGA 1IQ3A 1KWOB 2MLFC 1S36A 1L7ZA 3SG2A 3EVVA 3PSRA 2LMTA 2K61A 2CTNA 1F4QA 1CFFA 1MUXA 3LK1A 2M7LA 4YGCB 2M3WA 4GBAA 1U5IA 1N0YA 1NP8A 2JOJA 1J1DA 2F2OA 1IG5A 1FBVA 3DVJA 5HKZA 5K89A 2L4HA 2LE9B 4PHNA 2LP3A 3CR5X 3BUNB 1OZSA 1SKTA 3O4YA 3BQ3A 5DKQA 1XK4C 1BT6A 1LA0A 1K2HA 3A8RA 1Y6WA 2LHLA 2F33A 3OX5A 1WRZA 2M29A 2LM5A 4R1EA 1A03A 1WDCB 2JULA 1ALVA 2L4IA 1IQ5A 2M97A 1A2XA 1IKUA 4JPZB 2K8MB 1MXLC 1HQVA 1F70A 1K9UA 2Y5IA 4BY4A 5D7FA 1E8AA 2FCDA 2GGZA 1AHRA 1YRUB 3I5FC 4ORBB 4I5KA 3AAKA 1OMVA 4MLWA 4HRGA 2EC6C 2DOQA 2OTGB 1DJZA 1JF0A 4MEWA 2Q91A 1DTLA 1K93D 2A4JA 1C07A 2CNPA 3NSIA 1Y1XA 2BKHB 1EG3A 2KI6C 5KU1A 3I5IB 3NSLA 2JZIA 1PSBA 4N1GA 1B9AA 2BKIB 3OB2B 2KQ6A 4P2YB 1CMFA 1TIZA 2PSRA 2JT0A 4MZLA 1JSAA 1UHNA 3GK2A 1TTXA 1JWDA 1N65A 1B47A 2JT8A 1SRAA 3ZWHA 3QRXA 3BUWB 1JFKA 2HQ8A 2COLB 1SW8A 2L2EA 2PMYA 1S5GY 2IS9A 1LA3A 1NUBA 1EJ3A 1EG4A 1AK8A 3EVUA 1BR4B 1BJFA 1RROA 1QLSA 1QV1A 2LP2A 3CTNA 3BUOB 1RTP1 1DJWA 1K90D 1ZFSA 2EHBA 3DD4A 5F6TA 1KFUL 3SIAA 1TNPA 3VRQA 1SPYA 4PDZA 2KYCA 2KHNA 4N1FA 1CLBA 1NWDA 1C7WA 3IQOA 1KQMC 1Q80A 1H8BA 3AKAA 1TRFA 2K7DA 2PALA 1NX3A 2KAYA 2TN4A 1WRLA 4PALA 1JFJA 1FW4A 4D1EA 1KK7Y 3MSEB 4GGFC 2ZN8A 5CSJA 1KK8C 3BXKA 3CLNA 1YR5A 2KYFA 1A4PA 4AQJA 1CLLA 1XFZO 1MHOA 3BYAA 1K8UA 2I18A 2ZKMX 3BOWA 3I5HB 4MSPA 1R2UA 2JRFA 4C0LA 1K9KA 1MQ1A 3A4UB 2BBNA 1JC2A 4PE4A 2L5XB 1GGWA 1QX2A 3TUYC 4C0JA 3O2PA 1IH0A 1MF8B 4WQ2A 1B7TY 2BBMA 2E6WA 3BUMB 4IL1A 1L2OB 3D0YA 1CFCA 4CFQA 1QXPA 1CDNA 2GGMA 1XYDA 2LC5A 5B8IB 4N5XA 2F8PA 1YX7A 2JT3A 2RGIA 2OS8B 3C1VA 5HLVA 3KPXA 1YURA 2JXLA 1QV0A 1S5GZ 1B8RA 3LCPC 3VRRA 4TNCA 1LKJA 1ZMZA 4PHMA 1DF0A 2BCXA 1DF0B 4YGAA 4ZCUA 1IRJA 2F3YA 5AANA 4DS7A 2F3ZA 1UURA 3VGOA 1G8IA 2HETA 1EH2A 1TN4A 1PVBA 1SR6B 2LMVA 1DMOA 4BY5A 2LUXA 2PRUA 2O60A 1V1GA 1J7OA 3LK0A 1FF1A 1IJ6A 1S6CA 1TCOB 1VRKA 4MVFA 4AQIA 2M9GA 1CDMA 1DGVA 1K9PA 2K7OA 1KK7Z 2PVBA 2BECA 4JWQA 1SCMC 1M31A 2M0RA 1WDCC 1K94A 1UHKA 1CFDA 1TNWA 1DJHA 1NPQA 1YVLA 3AAJA 3EK4A 3EK8A 1QX7A 4A4BA 1S3PA 3PN7B 1SCVA 2WC8A 5CPVA 4CLNA 1SYMA 4ETOA 3H4SE 1YX8A 1DJIA 3HCMA 3JVTC 2MLEC 1B7TZ 3DVMA 2E30A 1JUOA 1ZOTB 4OV2A 2JXCA 3PLFB 1A75B 1QIWA 2CXJA 4I5NB 1F54A 2KGBC 2AAOA 2BCBA 2OTGC 3KHEA 5CSIA 1XVJA 3NSOA 1CDPA 2WCEA 5JOLA 4USLA 2WNDA 3WHUB 4YGDB 2MJWB 2LLTA 4ORAB 2K2FA 2LVKA 1KFXL 5KSZA 1CB1A 2L98A 1D1OA 2LMUA 1RWYA 1UUSA 3RM1A 3F45A 2MAZA 5DKNA 3CZTX 2H2KA 2I94A 1YUSA 2BE6A 2NCPA 2AMIA 1S1EA 1QVIY 2HQWA 2O5GA 2MRDA 2WCBA 3WXAA 1UHHA 2LAPA 4DIRA 3SJSA 2H61C 2LLUA 2F2PA 3AKBA 3I5FB 1UHJA 2HF5A 3PATA 1YTZC 2EC6B 4NDCA 1JF2A 1QIVA 3FWCA 1EL4A 2Y1NA 1NYAA 2ZRSA 2Y1MA 1RK9A 2ISDA 2I7AA 3EVRA 2LHIA 3KO0A 1NIWA 4M2QA 2KI4C 4OKHA 4OR9B 2Q4UA 3IF7A 1F8HA 1F4OA 2JU0A 1PSRA 3EKJA 3ZNIA 2L51A 3JTDC 4DRWA 3I5GC 5J3XA 3TDUA 1J1EA 4PHKA 2JPTA 1CM1A 4GFTA 3M0WA 2G9BA 1AVSA 3EKHA 2K0JA 2KBIA 1B8CA 4HREE 2JQ6A 2FCEA 1QLKA 3CS1A 3SG5A 1RFJA 1SBJA 2WORA 3SIBA 4E68A 2KOTA 4PE1A 4FTGA 3SG4A 4QJ5B 1BG1A 3KEVA 1JBAA 1DVIA 1QS7A 1WRKA 1GQMA 3FS7A 3KF9A 2JTZA 2WOSA 1IJ5A 1ZUZA 3TDIA 1BU3A 1CM4A 2BL0B 2ZNDA 1BF5A 1UP5A 2LUCA 1K95A 2QPTA 4PE0A 4YGBB 1W7IB 2CCMA 2JNXA 2LANA 4GGNA 5D69A 1BODA 1KQMB 1QVIZ 1HT9A 1TOPA 1QJTA 3PFVA 3SG6A 5CSNA 2CT9A 1CFPA 2KAVA 2OS8C 2V53A 1M45A 1SL7A 2MHHA 2KGRA 1M63B 2M1KB 3CR2A 3TS5C 4CPVA 5I2OA 1DJXA 4GNKB 5AEQA 4YRUA 1NCXA 2KBMA 2Y4QA 3O78A 3NXAA 1G4YR 5AXIA 2P6BB 2K7BA 1AJ4A 5G08A 1KWOC 1FI6A 1J7RA 2R2IA 4HRHA 5TNCA 1SR6C 3VRNA 5AFPA 1B4CA 1B8LA 4MRXA 1WLMA 4MZJA 1G33A 2LCPA 2I2RE 3OP0A 4PCWA 3SG7A 1CNPA 2KAXA 4XYNA 1KSOA 1NCZA 1C7VA 5DKRA 4AOMA 1WLZA 1SY9A 3CGAA 1XFXO 1NSHA 2MA2A 2KFFA 1DJYA 1OMDA 3LL8B 2WCFA 1FPWA 2BCAA 2KQYA 4Q04A 4YBHB 1BLQA 1AJ5A 2LVVA 2K7CA 4GAOA 1QASA 5I2QA 5AERA 5HYDA 4YI9A 5CSFA 1YUTA 3FIAA 1X02A 2L0PA 2JNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PAS A;  3OB1 B;  1S6I A;  3GK1 A;  4YI8 A;  2KFH A;  4L9M A;  1U5I B;  1A75 A;  1TNX A;  2LLS A;  4ORC B;  4WRI A;  5FYX A;  2OPO A;  4NDD A;  3K21 A;  2MBX A;  1BR1 B;  1H4B A;  1OMR A;  1S6J A;  2JC2 A;  4FQO A;  2M8U A;  2KDH A;  1AP4 A;  1M46 A;  2BE4 A;  4ZCV A;  4DCK A;  1XK4 A;  3FWB A;  1DT7 B;  2NXQ A;  3TZ1 A;  1SCM B;  2LVJ A;  2QAC A;  1CLM A;  1OOJ A;  1B1G A;  1AUI B;  1EXR A;  1NX2 A;  4MN0 A;  1TNQ A;  3I5I C;  2K2A A;  2G2B A;  1PAL A;  3CR4 X;  4PHJ A;  1ODB A;  2NZ0 A;  1LVC D;  1WY9 A;  5KTY A;  2KI6 D;  5PAL A;  4CID A;  1PRW A;  3DF0 A;  4NQG A;  3JVT B;  1GJY A;  3DF0 B;  1KCY A;  3DVE A;  4WQ3 A;  4DUQ A;  1M39 A;  4A4C A;  1R6P A;  5I8N A;  1KQV A;  1LXF C;  5HKY A;  3OHM B;  1XFV O;  4M2O A;  1CDL A;  2FJU B;  4U8D A;  1BOC A;  1OQP A;  2VRG A;  1F71 A;  1K96 A;  2LVI A;  1F55 A;  1QX5 B;  3VRP A;  5ER5 A;  4ICB A;  3RLZ A;  3LLE A;  2JWW A;  1SNL A;  2LV7 A;  2FOT A;  3D10 A;  4NDB A;  2LNK A;  4OCI A;  1OSA A;  2ZN9 A;  5IBW A;  1SL8 A;  1XFW O;  1W7J B;  5HKW A;  5JJG A;  4QJ3 B;  1IGV A;  2EGD A;  1YUU A;  4XJK A;  4GPL B;  5BPJ A;  1CKK A;  1NX1 A;  1UWO A;  4XJK B;  1KFX S;  1S26 D;  3CWG A;  2KSP A;  5ER4 X;  4QJ4 B;  2H61 A;  2NLN A;  1SMG A;  5I2L A;  1NX0 A;  2B1U A;  4MZK A;  2KFG A;  1LIN A;  1SL9 A;  4OVN F;  1XA5 A;  3E3R A;  3I5H C;  1V1F A;  1NCY A;  4HSZ A;  1OE9 B;  1UHI A;  3TDZ A;  3WHT B;  1TCF A;  4P5O E;  1Y1U A;  2BL0 C;  2KI4 B;  3VRO A;  2L50 A;  1MWN A;  2ZNE A;  1PK0 D;  1CMG A;  1L2O C;  1QTX A;  1ALW A;  1CTR A;  1J7P A;  1SK6 D;  3JTD B;  4CFR A;  1OZO A;  2D8N A;  1A29 A;  1J55 A;  3I5G B;  3GK4 X;  1ZAC A;  3PM8 A;  1MR8 A;  4GGF A;  3DVK A;  3O6B A;  1XFU O;  1KFU S;  1PUL A;  1DGU A;  3ICB A;  4GUK A;  1KK8 B;  1YRT B;  3EK7 A;  3BOW B;  3IQQ A;  2GV5 A;  1REC A;  1Y0V H;  4I5J A;  2KNE A;  4I5L B;  2M49 B;  1XFY O;  2HPS A;  2SCP A;  1Y1A A;  1XO5 A;  1J7Q A;  1PVA A;  2M7N A;  3TUY B;  3D0Y B;  3WNX B;  1GGZ A;  1N2D A;  3BUX B;  4MBE A;  1BMO A;  1KSM A;  5GQQ C;  3PAL A;  4JQ0 D;  3OX6 A;  1DJG A;  1QAT A;  1RJV A;  2NCO A;  2ZFD A;  4PE7 A;  5HLO A;  1IWQ A;  1MXE A;  2AUC A;  2ZRT A;  3HX4 A;  4C0K A;  4F0Z B;  3TS5 B;  3NSK A;  1FI5 A;  4YGE B;  2JTT A;  3GOF A;  4MRY A;  2CBL A;  2M1U A;  2SAS A;  3PN7 C;  3SG3 A;  1YVH A;  4M2P A;  4UPG A;  1IQ3 A;  1KWO B;  2MLF C;  1S36 A;  1L7Z A;  3SG2 A;  3EVV A;  3PSR A;  2LMT A;  2K61 A;  2CTN A;  1F4Q A;  1CFF A;  1MUX A;  3LK1 A;  2M7L A;  4YGC B;  2M3W A;  4GBA A;  1U5I A;  1N0Y A;  1NP8 A;  2JOJ A;  1J1D A;  2F2O A;  1IG5 A;  1FBV A;  3DVJ A;  5HKZ A;  5K89 A;  2L4H A;  2LE9 B;  4PHN A;  2LP3 A;  3CR5 X;  3BUN B;  1OZS A;  1SKT A;  3O4Y A;  3BQ3 A;  5DKQ A;  1XK4 C;  1BT6 A;  1LA0 A;  1K2H A;  3A8R A;  1Y6W A;  2LHL A;  2F33 A;  3OX5 A;  1WRZ A;  2M29 A;  2LM5 A;  4R1E A;  1A03 A;  1WDC B;  2JUL A;  1ALV A;  2L4I A;  1IQ5 A;  2M97 A;  1A2X A;  1IKU A;  4JPZ B;  2K8M B;  1MXL C;  1HQV A;  1F70 A;  1K9U A;  2Y5I A;  4BY4 A;  5D7F A;  1E8A A;  2FCD A;  2GGZ A;  1AHR A;  1YRU B;  3I5F C;  4ORB B;  4I5K A;  3AAK A;  1OMV A;  4MLW A;  4HRG A;  2EC6 C;  2DOQ A;  2OTG B;  1DJZ A;  1JF0 A;  4MEW A;  2Q91 A;  1DTL A;  1K93 D;  2A4J A;  1C07 A;  2CNP A;  3NSI A;  1Y1X A;  2BKH B;  1EG3 A;  2KI6 C;  5KU1 A;  3I5I B;  3NSL A;  2JZI A;  1PSB A;  4N1G A;  1B9A A;  2BKI B;  3OB2 B;  2KQ6 A;  4P2Y B;  1CMF A;  1TIZ A;  2PSR A;  2JT0 A;  4MZL A;  1JSA A;  1UHN A;  3GK2 A;  1TTX A;  1JWD A;  1N65 A;  1B47 A;  2JT8 A;  1SRA A;  3ZWH A;  3QRX A;  3BUW B;  1JFK A;  2HQ8 A;  2COL B;  1SW8 A;  2L2E A;  2PMY A;  1S5G Y;  2IS9 A;  1LA3 A;  1NUB A;  1EJ3 A;  1EG4 A;  1AK8 A;  3EVU A;  1BR4 B;  1BJF A;  1RRO A;  1QLS A;  1QV1 A;  2LP2 A;  3CTN A;  3BUO B;  1RTP 1;  1DJW A;  1K90 D;  1ZFS A;  2EHB A;  3DD4 A;  5F6T A;  1KFU L;  3SIA A;  1TNP A;  3VRQ A;  1SPY A;  4PDZ A;  2KYC A;  2KHN A;  4N1F A;  1CLB A;  1NWD A;  1C7W A;  3IQO A;  1KQM C;  1Q80 A;  1H8B A;  3AKA A;  1TRF A;  2K7D A;  2PAL A;  1NX3 A;  2KAY A;  2TN4 A;  1WRL A;  4PAL A;  1JFJ A;  1FW4 A;  4D1E A;  1KK7 Y;  3MSE B;  4GGF C;  2ZN8 A;  5CSJ A;  1KK8 C;  3BXK A;  3CLN A;  1YR5 A;  2KYF A;  1A4P A;  4AQJ A;  1CLL A;  1XFZ O;  1MHO A;  3BYA A;  1K8U A;  2I18 A;  2ZKM X;  3BOW A;  3I5H B;  4MSP A;  1R2U A;  2JRF A;  4C0L A;  1K9K A;  1MQ1 A;  3A4U B;  2BBN A;  1JC2 A;  4PE4 A;  2L5X B;  1GGW A;  1QX2 A;  3TUY C;  4C0J A;  3O2P A;  1IH0 A;  1MF8 B;  4WQ2 A;  1B7T Y;  2BBM A;  2E6W A;  3BUM B;  4IL1 A;  1L2O B;  3D0Y A;  1CFC A;  4CFQ A;  1QXP A;  1CDN A;  2GGM A;  1XYD A;  2LC5 A;  5B8I B;  4N5X A;  2F8P A;  1YX7 A;  2JT3 A;  2RGI A;  2OS8 B;  3C1V A;  5HLV A;  3KPX A;  1YUR A;  2JXL A;  1QV0 A;  1S5G Z;  1B8R A;  3LCP C;  3VRR A;  4TNC A;  1LKJ A;  1ZMZ A;  4PHM A;  1DF0 A;  2BCX A;  1DF0 B;  4YGA A;  4ZCU A;  1IRJ A;  2F3Y A;  5AAN A;  4DS7 A;  2F3Z A;  1UUR A;  3VGO A;  1G8I A;  2HET A;  1EH2 A;  1TN4 A;  1PVB A;  1SR6 B;  2LMV A;  1DMO A;  4BY5 A;  2LUX A;  2PRU A;  2O60 A;  1V1G A;  1J7O A;  3LK0 A;  1FF1 A;  1IJ6 A;  1S6C A;  1TCO B;  1VRK A;  4MVF A;  4AQI A;  2M9G A;  1CDM A;  1DGV A;  1K9P A;  2K7O A;  1KK7 Z;  2PVB A;  2BEC A;  4JWQ A;  1SCM C;  1M31 A;  2M0R A;  1WDC C;  1K94 A;  1UHK A;  1CFD A;  1TNW A;  1DJH A;  1NPQ A;  1YVL A;  3AAJ A;  3EK4 A;  3EK8 A;  1QX7 A;  4A4B A;  1S3P A;  3PN7 B;  1SCV A;  2WC8 A;  5CPV A;  4CLN A;  1SYM A;  4ETO A;  3H4S E;  1YX8 A;  1DJI A;  3HCM A;  3JVT C;  2MLE C;  1B7T Z;  3DVM A;  2E30 A;  1JUO A;  1ZOT B;  4OV2 A;  2JXC A;  3PLF B;  1A75 B;  1QIW A;  2CXJ A;  4I5N B;  1F54 A;  2KGB C;  2AAO A;  2BCB A;  2OTG C;  3KHE A;  5CSI A;  1XVJ A;  3NSO A;  1CDP A;  2WCE A;  5JOL A;  4USL A;  2WND A;  3WHU B;  4YGD B;  2MJW B;  2LLT A;  4ORA B;  2K2F A;  2LVK A;  1KFX L;  5KSZ A;  1CB1 A;  2L98 A;  1D1O A;  2LMU A;  1RWY A;  1UUS A;  3RM1 A;  3F45 A;  2MAZ A;  5DKN A;  3CZT X;  2H2K A;  2I94 A;  1YUS A;  2BE6 A;  2NCP A;  2AMI A;  1S1E A;  1QVI Y;  2HQW A;  2O5G A;  2MRD A;  2WCB A;  3WXA A;  1UHH A;  2LAP A;  4DIR A;  3SJS A;  2H61 C;  2LLU A;  2F2P A;  3AKB A;  3I5F B;  1UHJ A;  2HF5 A;  3PAT A;  1YTZ C;  2EC6 B;  4NDC A;  1JF2 A;  1QIV A;  3FWC A;  1EL4 A;  2Y1N A;  1NYA A;  2ZRS A;  2Y1M A;  1RK9 A;  2ISD A;  2I7A A;  3EVR A;  2LHI A;  3KO0 A;  1NIW A;  4M2Q A;  2KI4 C;  4OKH A;  4OR9 B;  2Q4U A;  3IF7 A;  1F8H A;  1F4O A;  2JU0 A;  1PSR A;  3EKJ A;  3ZNI A;  2L51 A;  3JTD C;  4DRW A;  3I5G C;  5J3X A;  3TDU A;  1J1E A;  4PHK A;  2JPT A;  1CM1 A;  4GFT A;  3M0W A;  2G9B A;  1AVS A;  3EKH A;  2K0J A;  2KBI A;  1B8C A;  4HRE E;  2JQ6 A;  2FCE A;  1QLK A;  3CS1 A;  3SG5 A;  1RFJ A;  1SBJ A;  2WOR A;  3SIB A;  4E68 A;  2KOT A;  4PE1 A;  4FTG A;  3SG4 A;  4QJ5 B;  1BG1 A;  3KEV A;  1JBA A;  1DVI A;  1QS7 A;  1WRK A;  1GQM A;  3FS7 A;  3KF9 A;  2JTZ A;  2WOS A;  1IJ5 A;  1ZUZ A;  3TDI A;  1BU3 A;  1CM4 A;  2BL0 B;  2ZND A;  1BF5 A;  1UP5 A;  2LUC A;  1K95 A;  2QPT A;  4PE0 A;  4YGB B;  1W7I B;  2CCM A;  2JNX A;  2LAN A;  4GGN A;  5D69 A;  1BOD A;  1KQM B;  1QVI Z;  1HT9 A;  1TOP A;  1QJT A;  3PFV A;  3SG6 A;  5CSN A;  2CT9 A;  1CFP A;  2KAV A;  2OS8 C;  2V53 A;  1M45 A;  1SL7 A;  2MHH A;  2KGR A;  1M63 B;  2M1K B;  3CR2 A;  3TS5 C;  4CPV A;  5I2O A;  1DJX A;  4GNK B;  5AEQ A;  4YRU A;  1NCX A;  2KBM A;  2Y4Q A;  3O78 A;  3NXA A;  1G4Y R;  5AXI A;  2P6B B;  2K7B A;  1AJ4 A;  5G08 A;  1KWO C;  1FI6 A;  1J7R A;  2R2I A;  4HRH A;  5TNC A;  1SR6 C;  3VRN A;  5AFP A;  1B4C A;  1B8L A;  4MRX A;  1WLM A;  4MZJ A;  1G33 A;  2LCP A;  2I2R E;  3OP0 A;  4PCW A;  3SG7 A;  1CNP A;  2KAX A;  4XYN A;  1KSO A;  1NCZ A;  1C7V A;  5DKR A;  4AOM A;  1WLZ A;  1SY9 A;  3CGA A;  1XFX O;  1NSH A;  2MA2 A;  2KFF A;  1DJY A;  1OMD A;  3LL8 B;  2WCF A;  1FPW A;  2BCA A;  2KQY A;  4Q04 A;  4YBH B;  1BLQ A;  1AJ5 A;  2LVV A;  2K7C A;  4GAO A;  1QAS A;  5I2Q A;  5AER A;  5HYD A;  4YI9 A;  5CSF A;  1YUT A;  3FIA A;  1X02 A;  2L0P A;  2JNF A; 
#chains in the Genus database with same CATH topology
 2PAS A;  3OB1 B;  1S6I A;  3GK1 A;  4YI8 A;  2KFH A;  1Z4H A;  4L9M A;  1U5I B;  5D3O A;  1A75 A;  1TNX A;  2LLS A;  4ORC B;  4WRI A;  5FYX A;  2OPO A;  2WC5 A;  4NDD A;  3K21 A;  2MBX A;  1BR1 B;  1H4B A;  1OMR A;  1S6J A;  2JC2 A;  4FQO A;  2M8U A;  2KDH A;  1AP4 A;  1M46 A;  2BE4 A;  4ZCV A;  4DCK A;  1XK4 A;  3FWB A;  1DT7 B;  2NXQ A;  3TZ1 A;  1SCM B;  2LVJ A;  2QAC A;  1CLM A;  1OOJ A;  1B1G A;  1AUI B;  1EXR A;  1NX2 A;  3N7H A;  1TNQ A;  4MN0 A;  3I5I C;  2K2A A;  2G2B A;  1PAL A;  3CR4 X;  4PHJ A;  1ODB A;  2NZ0 A;  3R1P A;  1LVC D;  1WY9 A;  5KTY A;  2KI6 D;  5PAL A;  4CID A;  1PRW A;  3DF0 A;  4NQG A;  3JVT B;  1GJY A;  3DF0 B;  1KCY A;  4JD9 A;  3DVE A;  4WQ3 A;  4DUQ A;  1M39 A;  4INW A;  4A4C A;  1R6P A;  5I8N A;  1KQV A;  1LXF C;  5HKY A;  3OHM B;  1XFV O;  4M2O A;  1CDL A;  2FJU B;  4U8D A;  1BOC A;  1OQP A;  2VRG A;  4KYN A;  1F71 A;  1K96 A;  2LVI A;  1F55 A;  1QX5 B;  3VRP A;  5ER5 A;  4ICB A;  3RLZ A;  3LLE A;  2JWW A;  1SNL A;  3DY9 A;  2LV7 A;  3EK4 A;  2FOT A;  3D10 A;  4NDB A;  1SSE B;  1OOH A;  2QDI A;  2LNK A;  4OCI A;  1OSA A;  2ZN9 A;  5IBW A;  1SL8 A;  1XFW O;  3S0F A;  1W7J B;  5HKW A;  5JJG A;  4QJ3 B;  1IGV A;  2EGD A;  1YUU A;  4XJK A;  4GPL B;  5BPJ A;  1CKK A;  1NX1 A;  1UWO A;  4XJK B;  1KFX S;  5EL2 A;  1S26 D;  3CWG A;  2KSP A;  5ER4 X;  4QJ4 B;  2H61 A;  2NLN A;  1SMG A;  5I2L A;  1NX0 A;  3RZS A;  2B1U A;  4MZK A;  2KFG A;  1LIN A;  1SL9 A;  4OVN F;  1XA5 A;  3E3R A;  3I5H C;  1V1F A;  1NCY A;  4HSZ A;  1OE9 B;  3V2L A;  1UHI A;  3TDZ A;  3WHT B;  1OOG A;  1TCF A;  3B87 A;  4P5O E;  1TUJ A;  1Y1U A;  2BL0 C;  2KI4 B;  3OBV A;  3VRO A;  2L50 A;  1MWN A;  2ZNE A;  1PK0 D;  1CMG A;  1L2O C;  1QTX A;  1ALW A;  2PYQ A;  1CTR A;  3PJI A;  1J7P A;  1SK6 D;  3JTD B;  4CFR A;  1OZO A;  2D8N A;  1A29 A;  4INX A;  1J55 A;  3I5G B;  3D77 A;  3GK4 X;  1ZAC A;  3PM8 A;  1C3Z A;  1MR8 A;  4GGF A;  3DVK A;  3O6B A;  1XFU O;  1KFU S;  1PUL A;  1DGU A;  3ICB A;  4GUK A;  3UNW A;  1KK8 B;  1YRT B;  3EK7 A;  2L5Y A;  3Q8I A;  3BOW B;  3IQQ A;  3NHI A;  2GV5 A;  2ERB A;  1REC A;  1Y0V H;  4I5J A;  2KNE A;  4I5L B;  2M49 B;  3R1O A;  1XFY O;  2HPS A;  2SCP A;  1Y1A A;  1XO5 A;  1J7Q A;  1PVA A;  2M7N A;  3TUY B;  3D0Y B;  3WNX B;  1GGZ A;  1N2D A;  3BUX B;  4MBE A;  1BMO A;  1KSM A;  5GQQ C;  3PAL A;  4JQ0 D;  3OX6 A;  1DJG A;  1QAT A;  2QEH A;  1RJV A;  2NCO A;  2ZFD A;  4FQT A;  4PE7 A;  1IWQ A;  1MXE A;  2AUC A;  2ZRT A;  3HX4 A;  4C0K A;  4F0Z B;  3TS5 B;  3NSK A;  1FI5 A;  4YGE B;  2JTT A;  5DIC A;  3GOF A;  4MRY A;  3B7A A;  2CBL A;  2M1U A;  2SAS A;  3PN7 C;  3SG3 A;  1YVH A;  4M2P A;  4UPG A;  2P71 A;  1KWO B;  2MLF C;  1S36 A;  1L7Z A;  1P28 A;  3SG2 A;  1IQ3 A;  3EVV A;  3PSR A;  2LMT A;  3NHT A;  2K61 A;  2CTN A;  1F4Q A;  1CFF A;  1MUX A;  3LK1 A;  2M7L A;  4YGC B;  2M3W A;  4GBA A;  1U5I A;  1N0Y A;  1NP8 A;  2FJY A;  2JOJ A;  1J1D A;  3L4L A;  2F2O A;  1IG5 A;  1FBV A;  3DVJ A;  4IJ7 A;  5HKZ A;  5K89 A;  2L4H A;  2LE9 B;  4PHN A;  2LP3 A;  3CR5 X;  3BUN B;  1OZS A;  1SKT A;  3O4Y A;  3BQ3 A;  2WCK A;  2WCJ A;  5DKQ A;  1XK4 C;  1BT6 A;  1LA0 A;  1K2H A;  3A8R A;  1OOF A;  3D74 A;  1Y6W A;  2LHL A;  2F33 A;  3OX5 A;  1Z2C B;  1WRZ A;  2M29 A;  3CYZ A;  2LM5 A;  4R1E A;  1A03 A;  1WDC B;  2JUL A;  1ALV A;  2L4I A;  1IQ5 A;  2WCH A;  2M97 A;  1A2X A;  3CDN A;  1IKU A;  4JPZ B;  2K8M B;  1MXL C;  1OOI X;  1HQV A;  1F70 A;  1ORG A;  1K9U A;  2Y5I A;  4BY4 A;  2GTE A;  1E8A A;  5D7F A;  2FCD A;  2GGZ A;  1AHR A;  1YRU B;  3I5F C;  4ORB B;  4I5K A;  3AAK A;  1OMV A;  4MLW A;  4HRG A;  2BNX A;  2DOQ A;  2EC6 C;  2OTG B;  1TWO A;  3B88 A;  1DJZ A;  1T14 A;  1JF0 A;  4MEW A;  2Q91 A;  1DTL A;  1K93 D;  2A4J A;  1C07 A;  2CNP A;  3NSI A;  1Y1X A;  2BKH B;  1EG3 A;  2KI6 C;  2YGU A;  5KU1 A;  3I5I B;  3NSL A;  2JZI A;  1PSB A;  4N1G A;  1B9A A;  2BKI B;  3OB2 B;  2KQ6 A;  4P2Y B;  3B86 A;  1CMF A;  1TIZ A;  2PSR A;  2JT0 A;  4MZL A;  1JSA A;  1UHN A;  3GK2 A;  1TTX A;  5FI7 A;  1JWD A;  1N65 A;  1B47 A;  2JT8 A;  1SRA A;  3ZWH A;  3QRX A;  1DEL A;  3BUW B;  1JFK A;  2HQ8 A;  2COL B;  1SW8 A;  2L2E A;  2PMY A;  1S5G Y;  3PM2 A;  2IS9 A;  1LA3 A;  1NUB A;  1EJ3 A;  1EG4 A;  1AK8 A;  2QEO A;  1BR4 B;  1BJF A;  3EVU A;  1IIO A;  1RRO A;  1QLS A;  1QV1 A;  2LP2 A;  3CTN A;  3BUO B;  1RTP 1;  1OW4 A;  1DC1 A;  1DJW A;  1K90 D;  1ZFS A;  2EHB A;  3DD4 A;  5F6T A;  1KFU L;  3SIA A;  1TNP A;  3VRQ A;  1SPY A;  4PDZ A;  2KYC A;  2KHN A;  4N1F A;  1CLB A;  1W9Z A;  1NWD A;  1C7W A;  3IQO A;  1KQM C;  1Q80 A;  3OGN A;  1H8B A;  3AKA A;  1TRF A;  2H8V A;  2K7D A;  2PAL A;  1NX3 A;  2KAY A;  2TN4 A;  3BFB A;  1WRL A;  4PAL A;  1JFJ A;  1FW4 A;  1XFR A;  4D1E A;  1KK7 Y;  3MSE B;  4GGF C;  2ZN8 A;  5CSJ A;  1KK8 C;  3BXK A;  3CLN A;  1YR5 A;  2KYF A;  1A4P A;  5FI2 A;  4AQJ A;  1CLL A;  1XFZ O;  1MHO A;  3BYA A;  1K8U A;  2I18 A;  2ZKM X;  3BOW A;  3I5H B;  4MSP A;  1R2U A;  2JRF A;  4JKT A;  2BAP A;  4C0L A;  1K9K A;  1MQ1 A;  3A4U B;  2BBN A;  1JC2 A;  4PE4 A;  2L5X B;  3S0B A;  1QX2 A;  3TUY C;  1GGW A;  4C0J A;  4PT1 A;  3O2P A;  1IH0 A;  1MF8 B;  4WQ2 A;  1B7T Y;  2BBM A;  2E6W A;  3BUM B;  4IL1 A;  1L2O B;  3D0Y A;  1CFC A;  4CFQ A;  1QXP A;  1CDN A;  2GGM A;  1XYD A;  2LC5 A;  5B8I B;  4N5X A;  2F8P A;  5HLO A;  1YX7 A;  2JT3 A;  2RGI A;  3R72 A;  2OS8 B;  2WCL A;  3FE8 A;  3C1V A;  5HLV A;  3KPX A;  1YUR A;  2JXL A;  1QV0 A;  1S5G Z;  1B8R A;  3LCP C;  3DYE A;  3VRR A;  4TNC A;  1LKJ A;  1ZMZ A;  4PHM A;  3SS4 A;  1DF0 A;  2BCX A;  1DF0 B;  4YGA A;  4ZCU A;  1IRJ A;  2F3Y A;  5AAN A;  4DS7 A;  2F3Z A;  1UUR A;  3VGO A;  1G8I A;  2HET A;  1EH2 A;  3S0E A;  1TN4 A;  1PVB A;  1SR6 B;  2LMV A;  1DMO A;  5HL1 A;  4BY5 A;  2QEV A;  2LUX A;  2PRU A;  2O60 A;  1V1G A;  1J7O A;  3LK0 A;  1FF1 A;  1IJ6 A;  1S6C A;  2PQL A;  1TCO B;  1VRK A;  4MVF A;  4AQI A;  2M9G A;  1CDM A;  3S0A A;  1GM0 A;  1DGV A;  1K9P A;  2K7O A;  1KK7 Z;  2PVB A;  2BEC A;  3IVT A;  4JWQ A;  1SCM C;  1M31 A;  2M0R A;  1WDC C;  1K94 A;  1CFD A;  1UHK A;  1TNW A;  1DJH A;  1NPQ A;  1YVL A;  2WC6 A;  3AAJ A;  3CZ0 A;  3EK8 A;  3K1E A;  1QX7 A;  3R1V A;  3DZT A;  4A4B A;  1S3P A;  3PN7 B;  1SCV A;  2WC8 A;  5CPV A;  3QME A;  4CLN A;  1SYM A;  4OZD A;  4ETO A;  3H4S E;  1YX8 A;  1DJI A;  3HCM A;  3JVT C;  2MLE C;  1B7T Z;  3DVM A;  2E30 A;  1JUO A;  1ZOT B;  3D73 A;  4OV2 A;  2JXC A;  3PLF B;  1A75 B;  1QIW A;  2CXJ A;  4I5N B;  1F54 A;  2KGB C;  2AAO A;  2BCB A;  2OTG C;  3KHE A;  5CSI A;  1XVJ A;  1QWV A;  1CDP A;  2WCE A;  3NSO A;  5JOL A;  4USL A;  2WND A;  3WHU B;  4YGD B;  2MJW B;  2LLT A;  3NGV A;  4ORA B;  2K2F A;  2LVK A;  1KFX L;  5KSZ A;  1CB1 A;  3B6X A;  2L98 A;  1D1O A;  2KLE A;  1RWY A;  1UUS A;  2LMU A;  3CZ1 A;  3F45 A;  3RM1 A;  2MAZ A;  5DKN A;  3CZT X;  2H2K A;  3CZ2 A;  2JPO A;  2I94 A;  1YUS A;  2BE6 A;  2NCP A;  2AMI A;  1S1E A;  1QVI Y;  2HQW A;  2O5G A;  2MRD A;  2WCB A;  3D76 A;  1UHH A;  2LAP A;  3WXA A;  4DIR A;  3SJS A;  1DEK A;  2H61 C;  2LLU A;  2F2P A;  3AKB A;  3I5F B;  1UHJ A;  2HF5 A;  3PAT A;  1YTZ C;  2EC6 B;  1C3Y A;  3D75 A;  4NDC A;  1JF2 A;  1QIV A;  3FWC A;  1EL4 A;  2Y1N A;  1NYA A;  2L2C A;  2ZRS A;  3BFA A;  2Y1M A;  1RK9 A;  2K60 A;  2ISD A;  5I94 A;  2I7A A;  3EVR A;  2LHI A;  3KO0 A;  1NIW A;  4M2Q A;  2KI4 C;  4OKH A;  4OR9 B;  2Q4U A;  3IF7 A;  1F8H A;  2WCM A;  1F4O A;  2P70 A;  3BFH A;  2JU0 A;  1PSR A;  3EKJ A;  3ZNI A;  2L51 A;  3JTD C;  3EG5 B;  4DRW A;  3UO9 A;  3I5G C;  5J3X A;  3TDU A;  1J1E A;  4PHK A;  2JPT A;  3L47 A;  1CM1 A;  4GFT A;  3M0W A;  2G9B A;  1AVS A;  3EKH A;  2K0J A;  2KBI A;  1B8C A;  4HRE E;  2JQ6 A;  2FCE A;  1QLK A;  3CS1 A;  3SG5 A;  1RFJ A;  1SBJ A;  2WOR A;  3D78 A;  3SIB A;  4E68 A;  3DXL A;  2KOT A;  4PE1 A;  4FTG A;  3SG4 A;  4QJ5 B;  1BG1 A;  3KEV A;  1JBA A;  1DVI A;  1QS7 A;  3CAB A;  1WRK A;  1GQM A;  3FS7 A;  3KF9 A;  2JTZ A;  2WOS A;  3SS3 A;  1IJ5 A;  1ZUZ A;  3TDI A;  1BU3 A;  3S0G A;  1CM4 A;  2BL0 B;  2ZND A;  1BF5 A;  1UP5 A;  2LUC A;  1K95 A;  2QPT A;  4PE0 A;  4YGB B;  1W7I B;  2CCM A;  2JNX A;  2LAN A;  4GGN A;  5D69 A;  1BOD A;  1KQM B;  1QVI Z;  1HT9 A;  1TOP A;  1QJT A;  3PFV A;  3SG6 A;  5CSN A;  2CT9 A;  1CFP A;  2KAV A;  2OS8 C;  2V53 A;  1M45 A;  1SL7 A;  2MHH A;  2KGR A;  1M63 B;  2M1K B;  3CR2 A;  3O4X A;  3TS5 C;  4CPV A;  5I2O A;  1DJX A;  4GNK B;  5AEQ A;  4YRU A;  1DQE A;  1NCX A;  2QEB A;  2KBM A;  2Y4Q A;  3O78 A;  3NXA A;  1G4Y R;  3BJH A;  5AXI A;  2P6B B;  3VB1 A;  2K7B A;  1AJ4 A;  5G08 A;  1KWO C;  1LS8 A;  1J7R A;  2R2I A;  1FI6 A;  4HRH A;  2KPH A;  5TNC A;  1SR6 C;  1TUZ A;  3S0D A;  3VRN A;  5AFP A;  1B4C A;  1B8L A;  4MRX A;  1WLM A;  4MZJ A;  1G33 A;  2LCP A;  2I2R E;  3OP0 A;  4PCW A;  3SG7 A;  3SS5 A;  1CNP A;  2KAX A;  4XYN A;  1KSO A;  1NCZ A;  1C7V A;  3FE9 A;  3L4A A;  5DKR A;  2KLD A;  4AOM A;  1WLZ A;  1SY9 A;  3CGA A;  1XFX O;  1NSH A;  2MA2 A;  3FE6 A;  2KFF A;  1DJY A;  1OMD A;  3LL8 B;  4F7F A;  2WCF A;  1FPW A;  2BCA A;  2KQY A;  4Q04 A;  4YBH B;  1BLQ A;  1AJ5 A;  2LVV A;  2K7C A;  4GAO A;  1QAS A;  5I2Q A;  5AER A;  5HYD A;  4YI9 A;  5CSF A;  1YUT A;  3FIA A;  5FI6 A;  1X02 A;  2L0P A;  2JNF A; 
#chains in the Genus database with same CATH homology
 2PAS A;  3OB1 B;  1S6I A;  3GK1 A;  4YI8 A;  2KFH A;  4L9M A;  1U5I B;  1A75 A;  1TNX A;  2LLS A;  4ORC B;  4WRI A;  5FYX A;  2OPO A;  4NDD A;  3K21 A;  2MBX A;  1BR1 B;  1H4B A;  1OMR A;  1S6J A;  2JC2 A;  4FQO A;  2M8U A;  2KDH A;  1AP4 A;  1M46 A;  2BE4 A;  4ZCV A;  4DCK A;  1XK4 A;  3FWB A;  1DT7 B;  2NXQ A;  3TZ1 A;  1SCM B;  2LVJ A;  2QAC A;  1CLM A;  1OOJ A;  1B1G A;  1AUI B;  1EXR A;  1NX2 A;  4MN0 A;  1TNQ A;  3I5I C;  2K2A A;  2G2B A;  1PAL A;  3CR4 X;  4PHJ A;  1ODB A;  2NZ0 A;  1LVC D;  1WY9 A;  5KTY A;  2KI6 D;  5PAL A;  4CID A;  1PRW A;  3DF0 A;  4NQG A;  3JVT B;  1GJY A;  3DF0 B;  1KCY A;  3DVE A;  4WQ3 A;  4DUQ A;  1M39 A;  4A4C A;  1R6P A;  5I8N A;  1KQV A;  1LXF C;  5HKY A;  3OHM B;  1XFV O;  4M2O A;  1CDL A;  2FJU B;  4U8D A;  1BOC A;  1OQP A;  2VRG A;  1F71 A;  1K96 A;  2LVI A;  1F55 A;  1QX5 B;  3VRP A;  5ER5 A;  4ICB A;  3RLZ A;  3LLE A;  2JWW A;  1SNL A;  2LV7 A;  2FOT A;  3D10 A;  4NDB A;  2LNK A;  4OCI A;  1OSA A;  2ZN9 A;  5IBW A;  1SL8 A;  1XFW O;  1W7J B;  5HKW A;  5JJG A;  4QJ3 B;  1IGV A;  2EGD A;  1YUU A;  4XJK A;  4GPL B;  5BPJ A;  1CKK A;  1NX1 A;  1UWO A;  4XJK B;  1KFX S;  1S26 D;  3CWG A;  2KSP A;  5ER4 X;  4QJ4 B;  2H61 A;  2NLN A;  1SMG A;  5I2L A;  1NX0 A;  2B1U A;  4MZK A;  2KFG A;  1LIN A;  1SL9 A;  4OVN F;  1XA5 A;  3E3R A;  3I5H C;  1V1F A;  1NCY A;  4HSZ A;  1OE9 B;  1UHI A;  3TDZ A;  3WHT B;  1TCF A;  4P5O E;  1Y1U A;  2BL0 C;  2KI4 B;  3VRO A;  2L50 A;  1MWN A;  2ZNE A;  1PK0 D;  1CMG A;  1L2O C;  1QTX A;  1ALW A;  1CTR A;  1J7P A;  1SK6 D;  3JTD B;  4CFR A;  1OZO A;  2D8N A;  1A29 A;  1J55 A;  3I5G B;  3GK4 X;  1ZAC A;  3PM8 A;  1MR8 A;  4GGF A;  3DVK A;  3O6B A;  1XFU O;  1KFU S;  1PUL A;  1DGU A;  3ICB A;  4GUK A;  1KK8 B;  1YRT B;  3EK7 A;  3BOW B;  3IQQ A;  2GV5 A;  1REC A;  1Y0V H;  4I5J A;  2KNE A;  4I5L B;  2M49 B;  1XFY O;  2HPS A;  2SCP A;  1Y1A A;  1XO5 A;  1J7Q A;  1PVA A;  2M7N A;  3TUY B;  3D0Y B;  3WNX B;  1GGZ A;  1N2D A;  3BUX B;  4MBE A;  1BMO A;  1KSM A;  5GQQ C;  3PAL A;  4JQ0 D;  3OX6 A;  1DJG A;  1QAT A;  1RJV A;  2NCO A;  2ZFD A;  4PE7 A;  5HLO A;  1IWQ A;  1MXE A;  2AUC A;  2ZRT A;  3HX4 A;  4C0K A;  4F0Z B;  3TS5 B;  3NSK A;  1FI5 A;  4YGE B;  2JTT A;  3GOF A;  4MRY A;  2CBL A;  2M1U A;  2SAS A;  3PN7 C;  3SG3 A;  1YVH A;  4M2P A;  4UPG A;  1IQ3 A;  1KWO B;  2MLF C;  1S36 A;  1L7Z A;  3SG2 A;  3EVV A;  3PSR A;  2LMT A;  2K61 A;  2CTN A;  1F4Q A;  1CFF A;  1MUX A;  3LK1 A;  2M7L A;  4YGC B;  2M3W A;  4GBA A;  1U5I A;  1N0Y A;  1NP8 A;  2JOJ A;  1J1D A;  2F2O A;  1IG5 A;  1FBV A;  3DVJ A;  5HKZ A;  5K89 A;  2L4H A;  2LE9 B;  4PHN A;  2LP3 A;  3CR5 X;  3BUN B;  1OZS A;  1SKT A;  3O4Y A;  3BQ3 A;  5DKQ A;  1XK4 C;  1BT6 A;  1LA0 A;  1K2H A;  3A8R A;  1Y6W A;  2LHL A;  2F33 A;  3OX5 A;  1WRZ A;  2M29 A;  2LM5 A;  4R1E A;  1A03 A;  1WDC B;  2JUL A;  1ALV A;  2L4I A;  1IQ5 A;  2M97 A;  1A2X A;  1IKU A;  4JPZ B;  2K8M B;  1MXL C;  1HQV A;  1F70 A;  1K9U A;  2Y5I A;  4BY4 A;  5D7F A;  1E8A A;  2FCD A;  2GGZ A;  1AHR A;  1YRU B;  3I5F C;  4ORB B;  4I5K A;  3AAK A;  1OMV A;  4MLW A;  4HRG A;  2EC6 C;  2DOQ A;  2OTG B;  1DJZ A;  1JF0 A;  4MEW A;  2Q91 A;  1DTL A;  1K93 D;  2A4J A;  1C07 A;  2CNP A;  3NSI A;  1Y1X A;  2BKH B;  1EG3 A;  2KI6 C;  5KU1 A;  3I5I B;  3NSL A;  2JZI A;  1PSB A;  4N1G A;  1B9A A;  2BKI B;  3OB2 B;  2KQ6 A;  4P2Y B;  1CMF A;  1TIZ A;  2PSR A;  2JT0 A;  4MZL A;  1JSA A;  1UHN A;  3GK2 A;  1TTX A;  1JWD A;  1N65 A;  1B47 A;  2JT8 A;  1SRA A;  3ZWH A;  3QRX A;  3BUW B;  1JFK A;  2HQ8 A;  2COL B;  1SW8 A;  2L2E A;  2PMY A;  1S5G Y;  2IS9 A;  1LA3 A;  1NUB A;  1EJ3 A;  1EG4 A;  1AK8 A;  3EVU A;  1BR4 B;  1BJF A;  1RRO A;  1QLS A;  1QV1 A;  2LP2 A;  3CTN A;  3BUO B;  1RTP 1;  1DJW A;  1K90 D;  1ZFS A;  2EHB A;  3DD4 A;  5F6T A;  1KFU L;  3SIA A;  1TNP A;  3VRQ A;  1SPY A;  4PDZ A;  2KYC A;  2KHN A;  4N1F A;  1CLB A;  1NWD A;  1C7W A;  3IQO A;  1KQM C;  1Q80 A;  1H8B A;  3AKA A;  1TRF A;  2K7D A;  2PAL A;  1NX3 A;  2KAY A;  2TN4 A;  1WRL A;  4PAL A;  1JFJ A;  1FW4 A;  4D1E A;  1KK7 Y;  3MSE B;  4GGF C;  2ZN8 A;  5CSJ A;  1KK8 C;  3BXK A;  3CLN A;  1YR5 A;  2KYF A;  1A4P A;  4AQJ A;  1CLL A;  1XFZ O;  1MHO A;  3BYA A;  1K8U A;  2I18 A;  2ZKM X;  3BOW A;  3I5H B;  4MSP A;  1R2U A;  2JRF A;  4C0L A;  1K9K A;  1MQ1 A;  3A4U B;  2BBN A;  1JC2 A;  4PE4 A;  2L5X B;  1GGW A;  1QX2 A;  3TUY C;  4C0J A;  3O2P A;  1IH0 A;  1MF8 B;  4WQ2 A;  1B7T Y;  2BBM A;  2E6W A;  3BUM B;  4IL1 A;  1L2O B;  3D0Y A;  1CFC A;  4CFQ A;  1QXP A;  1CDN A;  2GGM A;  1XYD A;  2LC5 A;  5B8I B;  4N5X A;  2F8P A;  1YX7 A;  2JT3 A;  2RGI A;  2OS8 B;  3C1V A;  5HLV A;  3KPX A;  1YUR A;  2JXL A;  1QV0 A;  1S5G Z;  1B8R A;  3LCP C;  3VRR A;  4TNC A;  1LKJ A;  1ZMZ A;  4PHM A;  1DF0 A;  2BCX A;  1DF0 B;  4YGA A;  4ZCU A;  1IRJ A;  2F3Y A;  5AAN A;  4DS7 A;  2F3Z A;  1UUR A;  3VGO A;  1G8I A;  2HET A;  1EH2 A;  1TN4 A;  1PVB A;  1SR6 B;  2LMV A;  1DMO A;  4BY5 A;  2LUX A;  2PRU A;  2O60 A;  1V1G A;  1J7O A;  3LK0 A;  1FF1 A;  1IJ6 A;  1S6C A;  1TCO B;  1VRK A;  4MVF A;  4AQI A;  2M9G A;  1CDM A;  1DGV A;  1K9P A;  2K7O A;  1KK7 Z;  2PVB A;  2BEC A;  4JWQ A;  1SCM C;  1M31 A;  2M0R A;  1WDC C;  1K94 A;  1UHK A;  1CFD A;  1TNW A;  1DJH A;  1NPQ A;  1YVL A;  3AAJ A;  3EK4 A;  3EK8 A;  1QX7 A;  4A4B A;  1S3P A;  3PN7 B;  1SCV A;  2WC8 A;  5CPV A;  4CLN A;  1SYM A;  4ETO A;  3H4S E;  1YX8 A;  1DJI A;  3HCM A;  3JVT C;  2MLE C;  1B7T Z;  3DVM A;  2E30 A;  1JUO A;  1ZOT B;  4OV2 A;  2JXC A;  3PLF B;  1A75 B;  1QIW A;  2CXJ A;  4I5N B;  1F54 A;  2KGB C;  2AAO A;  2BCB A;  2OTG C;  3KHE A;  5CSI A;  1XVJ A;  3NSO A;  1CDP A;  2WCE A;  5JOL A;  4USL A;  2WND A;  3WHU B;  4YGD B;  2MJW B;  2LLT A;  4ORA B;  2K2F A;  2LVK A;  1KFX L;  5KSZ A;  1CB1 A;  2L98 A;  1D1O A;  2LMU A;  1RWY A;  1UUS A;  3RM1 A;  3F45 A;  2MAZ A;  5DKN A;  3CZT X;  2H2K A;  2I94 A;  1YUS A;  2BE6 A;  2NCP A;  2AMI A;  1S1E A;  1QVI Y;  2HQW A;  2O5G A;  2MRD A;  2WCB A;  3WXA A;  1UHH A;  2LAP A;  4DIR A;  3SJS A;  2H61 C;  2LLU A;  2F2P A;  3AKB A;  3I5F B;  1UHJ A;  2HF5 A;  3PAT A;  1YTZ C;  2EC6 B;  4NDC A;  1JF2 A;  1QIV A;  3FWC A;  1EL4 A;  2Y1N A;  1NYA A;  2ZRS A;  2Y1M A;  1RK9 A;  2ISD A;  2I7A A;  3EVR A;  2LHI A;  3KO0 A;  1NIW A;  4M2Q A;  2KI4 C;  4OKH A;  4OR9 B;  2Q4U A;  3IF7 A;  1F8H A;  1F4O A;  2JU0 A;  1PSR A;  3EKJ A;  3ZNI A;  2L51 A;  3JTD C;  4DRW A;  3I5G C;  5J3X A;  3TDU A;  1J1E A;  4PHK A;  2JPT A;  1CM1 A;  4GFT A;  3M0W A;  2G9B A;  1AVS A;  3EKH A;  2K0J A;  2KBI A;  1B8C A;  4HRE E;  2JQ6 A;  2FCE A;  1QLK A;  3CS1 A;  3SG5 A;  1RFJ A;  1SBJ A;  2WOR A;  3SIB A;  4E68 A;  2KOT A;  4PE1 A;  4FTG A;  3SG4 A;  4QJ5 B;  1BG1 A;  3KEV A;  1JBA A;  1DVI A;  1QS7 A;  1WRK A;  1GQM A;  3FS7 A;  3KF9 A;  2JTZ A;  2WOS A;  1IJ5 A;  1ZUZ A;  3TDI A;  1BU3 A;  1CM4 A;  2BL0 B;  2ZND A;  1BF5 A;  1UP5 A;  2LUC A;  1K95 A;  2QPT A;  4PE0 A;  4YGB B;  1W7I B;  2CCM A;  2JNX A;  2LAN A;  4GGN A;  5D69 A;  1BOD A;  1KQM B;  1QVI Z;  1HT9 A;  1TOP A;  1QJT A;  3PFV A;  3SG6 A;  5CSN A;  2CT9 A;  1CFP A;  2KAV A;  2OS8 C;  2V53 A;  1M45 A;  1SL7 A;  2MHH A;  2KGR A;  1M63 B;  2M1K B;  3CR2 A;  3TS5 C;  4CPV A;  5I2O A;  1DJX A;  4GNK B;  5AEQ A;  4YRU A;  1NCX A;  2KBM A;  2Y4Q A;  3O78 A;  3NXA A;  1G4Y R;  5AXI A;  2P6B B;  2K7B A;  1AJ4 A;  5G08 A;  1KWO C;  1FI6 A;  1J7R A;  2R2I A;  4HRH A;  5TNC A;  1SR6 C;  3VRN A;  5AFP A;  1B4C A;  1B8L A;  4MRX A;  1WLM A;  4MZJ A;  1G33 A;  2LCP A;  2I2R E;  3OP0 A;  4PCW A;  3SG7 A;  1CNP A;  2KAX A;  4XYN A;  1KSO A;  1NCZ A;  1C7V A;  5DKR A;  4AOM A;  1WLZ A;  1SY9 A;  3CGA A;  1XFX O;  1NSH A;  2MA2 A;  2KFF A;  1DJY A;  1OMD A;  3LL8 B;  2WCF A;  1FPW A;  2BCA A;  2KQY A;  4Q04 A;  4YBH B;  1BLQ A;  1AJ5 A;  2LVV A;  2K7C A;  4GAO A;  1QAS A;  5I2Q A;  5AER A;  5HYD A;  4YI9 A;  5CSF A;  1YUT A;  3FIA A;  1X02 A;  2L0P A;  2JNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...