2JXLA

Solution structure of cardiac n-domain troponin c mutant f77w-v82a
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
89
structure length
89
Chain Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEWLVMMARCMKDDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tryptophan Mutants of Cardiac Troponin C: 3D Structure, Troponin I Affinity, and in Situ Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Troponin C, slow skeletal and cardiac muscles
total genus 20
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2007-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jxlA00
1QATA 5AERA 3BYAA 2I2RE 2CCMA 5JOLA 2DOQA 1OOJA 1CFFA 1SCMC 5D69A 1CB1A 3KO0A 4P5OE 1E8AA 3OX6A 1TRFA 1MHOA 2K7BA 4CPVA 5HKZA 1K95A 1DGVA 4PE7A 1UHKA 2GGZA 2K7DA 1LA0A 3O2PA 1IH0A 1EXRA 2K2AA 4MRXA 1TNPA 4CLNA 2CNPA 1TCOB 1CM1A 1GQMA 1YR5A 2M0RA 1H4BA 1AHRA 2LUXA 2LVKA 3KHEA 1FBVA 2ZKMX 1B4CA 3GK2A 4ICBA 1OMDA 2BCBA 2G2BA 1F71A 1JFKA 2L2EA 1RJVA 1R2UA 1NPQA 2L4IA 4E68A 3VROA 1NCXA 1SCMB 1EL4A 1TCFA 4QJ5B 2R2IA 1YRTB 1YUSA 5I2LA 2JNXA 5TNCA 1BG1A 1MWNA 1PRWA 3KPXA 2BKIB 4CFRA 1KFXL 1CFDA 1KWOC 1QIWA 2KAXA 4HRHA 3TDZA 4GFTA 3BXKA 2EC6B 2JXLA 4PCWA 1B7TZ 1QJTA 2PSRA 4P2YB 1PK0D 1XFXO 3DVKA 4MN0A 1GGZA 4A4CA 3D0YA 1RFJA 1EG4A 2KSPA 1QASA 1NX3A 2LVVA 4ZCVA 4QJ3B 2QACA 1OE9B 4ORCB 1J1EA 2F2OA 1ZACA 1XO5A 4YI9A 4GPLB 1MQ1A 4BY4A 3BOWB 1M63B 4MBEA 1QX7A 1CDMA 5JJGA 1SBJA 1B1GA 3CR2A 3EKHA 1FI5A 1BMOA 1RECA 1KK8B 1K90D 1H8BA 1WRZA 4GBAA 3LK0A 1BU3A 5DKQA 3IQOA 2JXCA 3I5IB 2WCFA 2LVIA 4ETOA 1BLQA 4Q04A 1NP8A 3FS7A 2O60A 2CT9A 1DVIA 3GK1A 1B7TY 1SR6B 2BKHB 3TS5B 2SCPA 2K7CA 2KFGA 1BR1B 3PSRA 1KCYA 2LMVA 3EVRA 2JT3A 2KQYA 4TNCA 1EG3A 2LNKA 1TIZA 2K0JA 1A75A 3LCPC 4I5LB 1SL8A 2D8NA 2I94A 1UP5A 2WNDA 3DVMA 4XJKA 1JC2A 5CSFA 4PE0A 5AXIA 1OZOA 2PVBA 2A4JA 1M39A 2PALA 2LMUA 1DJHA 1AP4A 1CDNA 2MJWB 2M7LA 1YRUB 2LE9B 1SL9A 2JRFA 1G8IA 3I5IC 3HX4A 4C0LA 4JQ0D 1F4OA 1KFUS 1L2OB 2MBXA 4DRWA 1KQMB 3VRNA 2KOTA 5AANA 2KNEA 5HLVA 1QX5B 4MZLA 2KAYA 3VRRA 3AAKA 2ZFDA 1IGVA 3F45A 5AEQA 4MRYA 1S5GZ 1YURA 4U8DA 1D1OA 3E3RA 1FI6A 4AOMA 5F6TA 1TN4A 2L5XB 1J7RA 1Q80A 1A4PA 2P6BB 4CFQA 2NCOA 3PLFB 1XFUO 1JBAA 1XFYO 1QLSA 1IKUA 2KGBC 1NWDA 1A75B 3BUXB 1S26D 1Y6WA 1WRLA 1CDPA 2SASA 2AUCA 2NLNA 4YGEB 1LXFC 1DJGA 2KYFA 1QIVA 3NSIA 3NSKA 1M31A 2BL0C 1M46A 2MLFC 1WDCB 2F3YA 2OTGC 1JUOA 2KFHA 4PHNA 3TZ1A 2JOJA 2OPOA 5HKWA 1MUXA 2LAPA 4AQJA 2KI4B 1TOPA 1DJIA 1S36A 1SKTA 2LLTA 2LMTA 1IG5A 3AKAA 3CWGA 4HRGA 1MXEA 2K61A 2Y1MA 1J55A 3EKJA 3BUNB 1KFXS 2LP2A 2LM5A 2KHNA 1C7VA 2L51A 4PHKA 2LUCA 3I5HB 1UURA 1XFVO 2BECA 3DF0B 3I5FB 1XVJA 1SW8A 1B8CA 5CSNA 1FPWA 1V1FA 5G08A 1JF2A 1GJYA 2AAOA 4I5KA 2KYCA 1IQ3A 1LKJA 2HF5A 1NCZA 3CLNA 1R6PA 3KF9A 3WHUB 4D1EA 5I2OA 1DF0A 1PVBA 1WY9A 3TDUA 1QVIZ 3CR4X 2JT0A 4M2QA 5HKYA 1MR8A 2FOTA 2F33A 2CTNA 2KI6D 2ISDA 1IWQA 1V1GA 4WQ2A 3DVJA 5FYXA 2QPTA 3BUMB 1J7OA 3K21A 4MZJA 1UHJA 1QTXA 1Y1XA 3WHTB 1U5IA 1CLBA 1CTRA 4MLWA 1J7QA 4ORAB 4XJKB 2EC6C 2K2FA 3SIBA 4GUKA 2KFFA 4NQGA 1BT6A 2MAZA 1SYMA 1B8LA 2KBIA 2F8PA 2MHHA 3D0YB 3JTDB 4I5NB 4NDCA 3VRQA 3OX5A 5B8IB 2M29A 1AVSA 1TNWA 2JTZA 2L4HA 3GK4X 4GGFC 4L9MA 3RM1A 3SJSA 1F55A 1DMOA 2OS8C 3BQ3A 1W7JB 3BUOB 3NSLA 2L98A 3PFVA 4HSZA 4M2PA 2K7OA 1CMGA 1CFPA 2WOSA 2BBNA 2WORA 4OVNF 3PN7C 2AMIA 3CZTX 3SIAA 1N2DA 5DKRA 3TS5C 1K9KA 1KK8C 4N5XA 3RLZA 1CMFA 3SG2A 3AAJA 3DF0A 1TNQA 2Y1NA 4YRUA 2E6WA 2M97A 1C7WA 1NSHA 2NCPA 1RK9A 1F54A 4AQIA 1KQVA 3EK7A 3FIAA 3TUYC 1KK7Z 4MVFA 5KU1A 1WLZA 1HT9A 1QV0A 3JTDC 2NXQA 4GNKB 5J3XA 3QRXA 2CXJA 4NDDA 4GGNA 2EHBA 2KDHA 2LC5A 2CBLA 5AFPA 1NYAA 3EVUA 1S1EA 3A4UB 4FQOA 1LVCD 1SL7A 2M1UA 3C1VA 2JZIA 3I5GC 5HYDA 1A2XA 4C0JA 2I7AA 2LP3A 1NX2A 1XYDA 4YGBB 5KSZA 1JWDA 4PDZA 1KSOA 1RROA 2BCAA 2KQ6A 2VRGA 1C07A 4QJ4B 3EK8A 1AJ5A 1KK7Y 5HLOA 4MEWA 1BJFA 3IQQA 1IJ6A 1Y0VH 2WCEA 2JQ6A 1Y1AA 2MRDA 3D10A 3M0WA 1FW4A 3CS1A 3TUYB 1TNXA 4PALA 2FJUB 4DIRA 1J1DA 5CSJA 3LLEA 1UHNA 4GAOA 3SG7A 4HREE 2E30A 4F0ZB 4MZKA 2MA2A 1U5IB 1OSAA 3H4SE 2JWWA 3FWBA 1L7ZA 4ORBB 2LANA 2BE6A 2LLUA 1RTP1 1SRAA 1S6JA 1PVAA 4USLA 1J7PA 1Y1UA 1YUUA 1JF0A 1F70A 2OTGB 2ZN9A 1DJWA 1YX7A 1QS7A 2TN4A 1B9AA 2H61C 4FTGA 1XK4A 1SNLA 1XFZO 3EVVA 3JVTC 4WQ3A 4C0KA 1ODBA 1PULA 2FCDA 1SR6C 4N1GA 4YGCB 3VGOA 4YBHB 1S5GY 3SG3A 1PSBA 1M45A 2G9BA 2KI4C 1KFUL 5CSIA 3BUWB 1BR4B 2V53A 1G4YR 1QLKA 1DJXA 1XFWO 1DGUA 3I5HC 2BCXA 2LCPA 1S6IA 3SG4A 1K2HA 1F8HA 2B1UA 2LVJA 3GOFA 1SY9A 2KGRA 1NX1A 1K93D 1SCVA 3O78A 5PALA 4MSPA 1SK6D 3O4YA 4YGAA 1DT7B 2F3ZA 2RGIA 1PALA 2COLB 1UHIA 1UUSA 4PE4A 2H2KA 3PM8A 5ER5A 3DVEA 3HCMA 4NDBA 1OZSA 3OB1B 3LL8B 4JWQA 4IL1A 4CIDA 2HQ8A 1CKKA 3OP0A 1CM4A 2MLEC 2LV7A 3BOWA 1YX8A 5DKNA 1GGWA 5K89A 1QXPA 4ZCUA 2Y4QA 2ZNEA 1S6CA 1OQPA 3O6BA 1ALVA 2BE4A 3NSOA 5GQQC 3A8RA 1K96A 2K8MB 2KBMA 2L50A 1QV1A 1AK8A 2LHIA 1VRKA 2IS9A 3EK4A 1SMGA 4PHMA 1X02A 1IJ5A 1ZFSA 2GGMA 1KWOB 2FCEA 2Y5IA 1LINA 2Q4UA 4UPGA 3ZWHA 1LA3A 1EH2A 1DF0B 2PRUA 1K9UA 3VRPA 3WXAA 2LLSA 1B47A 1W7IB 4XYNA 4R1EA 1DJZA 1K8UA 1AUIB 2Q91A 2M7NA 4BY5A 5I2QA 5KTYA 1NX0A 3PATA 3ZNIA 1YUTA 2M1KB 1XK4C 3CR5X 4DS7A 3LK1A 3DD4A 1F4QA 1TTXA 2M49B 1A03A 2WCBA 5IBWA 1N0YA 1YVHA 2JNFA 1PSRA 1WLMA 1ZMZA 4OCIA 5ER4X 3I5GB 1DTLA 4OV2A 2I18A 2JTTA 3CGAA 2L0PA 1AJ4A 1CDLA 4JPZB 2GV5A 2HETA 2EGDA 4PE1A 1CNPA 1MF8B 5D7FA 1IQ5A 2JT8A 1NUBA 1XA5A 1K9PA 2WC8A 1ALWA 2JU0A 1UHHA 2BL0B 3IF7A 2KI6C 1WDCC 1SPYA 3NXAA 4I5JA 2JC2A 3AKBA 1FF1A 3FWCA 1S3PA 1DJYA 1IRJA 1ZOTB 2F2PA 3PALA 2LHLA 5I8NA 3SG5A 2ZRTA 3TDIA 1JFJA 1YVLA 4M2OA 2JPTA 1MXLC 1CFCA 4YGDB 3I5FC 4DUQA 1WRKA 1BODA 1QVIY 1K94A 2OS8B 1JSAA 3OB2B 1NIWA 4OR9B 1YTZC 4WRIA 2M9GA 1L2OC 1G33A 3JVTB 3OHMB 2M8UA 1KQMC 2NZ0A 1RWYA 3CTNA 3PN7B 1OMRA 1CLLA 3WNXB 2HPSA 1QX2A 2JULA 5CPVA 3SG6A 1BF5A 1UWOA 1BOCA 4OKHA 2H61A 4YI8A 5BPJA 1CLMA 1N65A 2ZNDA 2BBMA 1B8RA 3ICBA 3MSEB 1OMVA 2M3WA 1A29A 1KSMA 2ZRSA 1HQVA 4PHJA 1EJ3A 1ZUZA 2HQWA 2KAVA 2O5GA 2ZN8A 4DCKA 2PASA 4GGFA 4N1FA 2PMYA 4A4BA 1NCYA 3KEVA
chains in the Genus database with same CATH superfamily
1QATA 5AERA 3BYAA 2I2RE 2CCMA 3DY9A 5JOLA 1OOFA 2DOQA 1OOJA 1CFFA 1SCMC 5D69A 1CB1A 3KO0A 4P5OE 1E8AA 3OX6A 3VB1A 1TRFA 1MHOA 2WCJA 2K7BA 4F7FA 4CPVA 5I94A 5HKZA 1K95A 1DGVA 4PE7A 1UHKA 1LS8A 2P71A 2GGZA 2K7DA 1LA0A 3O2PA 4IJ7A 1IH0A 1EXRA 2K2AA 4MRXA 1TNPA 4CLNA 2CNPA 1TCOB 1CM1A 1GQMA 1YR5A 2M0RA 1H4BA 1AHRA 2LUXA 2LVKA 3KHEA 1FBVA 2L5YA 2ZKMX 3UNWA 1B4CA 3GK2A 3IVTA 4ICBA 1OMDA 2BCBA 2G2BA 1F71A 1JFKA 2BAPA 2L2EA 1RJVA 1R2UA 1NPQA 2L4IA 4E68A 3VROA 1NCXA 1SCMB 2L2CA 1EL4A 1TCFA 4QJ5B 2R2IA 1YRTB 1YUSA 5I2LA 2JNXA 5TNCA 1BG1A 1MWNA 1PRWA 3FE6A 2BKIB 3KPXA 4CFRA 1KFXL 1CFDA 1KWOC 1ORGA 1QIWA 2KAXA 3D76A 4HRHA 3TDZA 4GFTA 3BXKA 2EC6B 2JXLA 4PCWA 1B7TZ 1QJTA 2PSRA 1DQEA 4P2YB 1PK0D 1XFXO 3DVKA 4MN0A 1GGZA 4A4CA 3D0YA 1RFJA 1EG4A 2KSPA 1GM0A 1QASA 1NX3A 2LVVA 4ZCVA 4QJ3B 2QACA 1OE9B 4ORCB 1J1EA 2F2OA 1ZACA 1XO5A 4YI9A 4GPLB 1MQ1A 4BY4A 3FE9A 3BOWB 1M63B 4MBEA 1QX7A 1CDMA 5JJGA 1SBJA 3PJIA 1OW4A 1B1GA 3CR2A 3EKHA 1FI5A 1BMOA 1RECA 1KK8B 1K90D 1H8BA 1WRZA 4GBAA 3LK0A 1BU3A 5DKQA 3IQOA 2JXCA 3I5IB 2WCFA 2LVIA 3OBVA 4ETOA 1DEKA 4Q04A 2WCMA 1NP8A 3FS7A 1BLQA 1C3ZA 2O60A 2CT9A 2QEHA 1DVIA 2QEOA 1B7TY 1SR6B 2BKHB 3GK1A 3TS5B 1SSEB 2SCPA 2K7CA 2KFGA 1BR1B 2K60A 3PSRA 2LMVA 3EVRA 1XFRA 1KCYA 2JT3A 3S0AA 2KQYA 4TNCA 1EG3A 2LNKA 1TIZA 2K0JA 1A75A 3LCPC 4I5LB 1SL8A 2D8NA 2I94A 3CZ2A 1UP5A 2WNDA 3DVMA 4XJKA 1JC2A 5CSFA 4PE0A 1P28A 5AXIA 1Z2CB 3SS4A 1OZOA 2PVBA 3SS5A 2A4JA 1M39A 2PALA 2LMUA 1DJHA 1AP4A 1CDNA 2MJWB 2M7LA 1YRUB 2LE9B 1SL9A 2JRFA 4FQTA 5DICA 1G8IA 3I5IC 3HX4A 4C0LA 4JQ0D 1F4OA 1KFUS 1L2OB 2MBXA 4DRWA 1KQMB 3VRNA 3S0EA 1QWVA 2KOTA 5AANA 3R1OA 2KNEA 5HLVA 1QX5B 4MZLA 2KAYA 3VRRA 3AAKA 2ZFDA 1IGVA 3F45A 5AEQA 4MRYA 1S5GZ 3B7AA 1YURA 4U8DA 1D1OA 3E3RA 1FI6A 4AOMA 5F6TA 1TN4A 2L5XB 1J7RA 1Q80A 1A4PA 2P6BB 4CFQA 3L4AA 2NCOA 3PLFB 1XFUO 1JBAA 1XFYO 1QLSA 1IKUA 2KGBC 1NWDA 1A75B 3BUXB 3BJHA 1S26D 1Y6WA 1WRLA 1CDPA 2SASA 2AUCA 2NLNA 4YGEB 1LXFC 1DJGA 2KYFA 1QIVA 3NSIA 4INWA 3NSKA 1M31A 2BL0C 1M46A 2MLFC 1WDCB 2F3YA 2OTGC 1JUOA 2KFHA 4PHNA 3TZ1A 3B6XA 2JOJA 2OPOA 5HKWA 1MUXA 2LAPA 4AQJA 2KI4B 1TOPA 1DJIA 1S36A 1SKTA 2LLTA 2LMTA 1IG5A 3AKAA 3CWGA 2YGUA 1MXEA 4HRGA 4PT1A 2K61A 2Y1MA 1J55A 3EKJA 3BUNB 1KFXS 2LP2A 2LM5A 2KHNA 1C7VA 2L51A 3CABA 2LUCA 3I5HB 3L47A 1UURA 1XFVO 2BECA 4PHKA 3DF0B 3I5FB 1XVJA 1SW8A 1IIOA 1B8CA 5CSNA 1FPWA 1V1FA 5G08A 1JF2A 1GJYA 2AAOA 4I5KA 2KYCA 1IQ3A 1LKJA 2HF5A 1NCZA 1C3YA 3CLNA 1R6PA 3KF9A 3WHUB 4D1EA 3CYZA 1DF0A 1PVBA 5I2OA 1WY9A 3TDUA 1QVIZ 3CR4X 2QDIA 2JT0A 4M2QA 5HKYA 1MR8A 2FOTA 2F33A 2CTNA 2KI6D 2ISDA 1IWQA 1V1GA 4WQ2A 3DVJA 5FYXA 2QPTA 3D74A 3BUMB 1J7OA 3K21A 4MZJA 1UHJA 1QTXA 1Y1XA 3WHTB 1U5IA 1CLBA 1CTRA 1W9ZA 4MLWA 1J7QA 4ORAB 4XJKB 2EC6C 2K2FA 3SIBA 4GUKA 2KFFA 3DZTA 4NQGA 1BT6A 2MAZA 1SYMA 1B8LA 2KBIA 2F8PA 2MHHA 3D0YB 3JTDB 4I5NB 4NDCA 3VRQA 3OX5A 2PYQA 5B8IB 2M29A 1AVSA 1TNWA 2JTZA 2L4HA 3GK4X 2KPHA 4GGFC 4L9MA 5FI6A 3RM1A 3SJSA 1F55A 2WCHA 1DMOA 2GTEA 2OS8C 3BQ3A 1W7JB 3BUOB 3NSLA 2L98A 3PFVA 4HSZA 4M2PA 2K7OA 1CMGA 1CFPA 2WOSA 3S0FA 3O4XA 2BBNA 2WORA 4OVNF 3PN7C 2AMIA 4INXA 3CZTX 3SIAA 1N2DA 3EG5B 5DKRA 3TS5C 3SS3A 1K9KA 1KK8C 4N5XA 3RLZA 1CMFA 3SG2A 3S0GA 3AAJA 3DF0A 1TNQA 2Y1NA 4YRUA 2E6WA 2M97A 1C7WA 1NSHA 2NCPA 1RK9A 1F54A 4AQIA 1KQVA 3RZSA 3EK7A 4OZDA 3FIAA 3TUYC 1KK7Z 1OOIX 4MVFA 5KU1A 3NHTA 1WLZA 1HT9A 1QV0A 3JTDC 2NXQA 4GNKB 5J3XA 3QRXA 2CXJA 4NDDA 4GGNA 2EHBA 2KDHA 2QEVA 3R1VA 2LC5A 2CBLA 3BFHA 5AFPA 1NYAA 3EVUA 1S1EA 3A4UB 4FQOA 1LVCD 1SL7A 2M1UA 3C1VA 2JZIA 3I5GC 5HYDA 1A2XA 4C0JA 2I7AA 3CDNA 2LP3A 1NX2A 1XYDA 4YGBB 5KSZA 1JWDA 4PDZA 1KSOA 1RROA 2BCAA 2KQ6A 3D77A 2VRGA 2ERBA 1C07A 4QJ4B 3EK8A 1AJ5A 1KK7Y 5HLOA 4MEWA 1BJFA 3IQQA 1IJ6A 1Y0VH 2WCEA 2JQ6A 1Y1AA 2MRDA 3D10A 3M0WA 1FW4A 3CS1A 3TUYB 1TNXA 3BFBA 4PALA 2FJUB 4DIRA 1J1DA 5CSJA 3LLEA 1UHNA 4GAOA 3SG7A 4HREE 2E30A 4F0ZB 4MZKA 2MA2A 1U5IB 3B88A 1OSAA 3DYEA 2JWWA 3H4SE 3FWBA 1L7ZA 4ORBB 2LANA 2BE6A 3QMEA 2LLUA 1RTP1 1SRAA 1S6JA 1PVAA 4USLA 1J7PA 1Y1UA 2BNXA 1YUUA 1JF0A 1F70A 2OTGB 2ZN9A 1DJWA 1YX7A 1QS7A 2WC5A 2TN4A 1B9AA 2H61C 4FTGA 1XK4A 1SNLA 1XFZO 3EVVA 3JVTC 4WQ3A 4C0KA 1ODBA 1PULA 2FCDA 1SR6C 4N1GA 4YGCB 3VGOA 2PQLA 4YBHB 1S5GY 3SG3A 1PSBA 1M45A 2G9BA 2KI4C 1OOGA 1KFUL 5CSIA 3BUWB 1BR4B 2V53A 1G4YR 1QLKA 1DJXA 1XFWO 1DGUA 3L4LA 3I5HC 2BCXA 2LCPA 1S6IA 3SG4A 1Z4HA 1F8HA 2B1UA 2LVJA 1K2HA 3GOFA 1SY9A 2KGRA 1NX1A 1K93D 1SCVA 3O78A 5PALA 3NHIA 4MSPA 1SK6D 3O4YA 4YGAA 1OOHA 2KLDA 1DT7B 2F3ZA 2RGIA 1PALA 2COLB 1UHIA 1UUSA 4PE4A 4KYNA 2H2KA 3PM8A 3R72A 5ER5A 3DVEA 3B86A 3HCMA 4NDBA 3UO9A 3K1EA 1OZSA 3R1PA 2FJYA 3OB1B 3LL8B 4JWQA 4IL1A 4CIDA 2JPOA 2HQ8A 1CKKA 3OP0A 1CM4A 2MLEC 2LV7A 3BOWA 1YX8A 5DKNA 2WC6A 1GGWA 5K89A 1QXPA 4ZCUA 2Y4QA 2ZNEA 1S6CA 1OQPA 3O6BA 1ALVA 2BE4A 3NSOA 5GQQC 3A8RA 1K96A 3CZ1A 2K8MB 2KBMA 2L50A 1QV1A 1AK8A 2LHIA 1VRKA 2IS9A 1DC1A 3EK4A 3CZ0A 5D3OA 1SMGA 4PHMA 1X02A 1IJ5A 1ZFSA 2GGMA 1KWOB 2FCEA 2Y5IA 1LINA 2Q4UA 4UPGA 3ZWHA 1LA3A 2P70A 1EH2A 1DF0B 2PRUA 1K9UA 3VRPA 3WXAA 2LLSA 1B47A 1W7IB 4XYNA 4R1EA 1DJZA 1K8UA 1AUIB 2Q91A 2M7NA 4BY5A 5I2QA 5KTYA 1NX0A 3PATA 3ZNIA 1YUTA 2M1KB 3B87A 1XK4C 3CR5X 4DS7A 2WCLA 3LK1A 3DD4A 1F4QA 1TTXA 2M49B 1A03A 2WCBA 5IBWA 2QEBA 1N0YA 1YVHA 2JNFA 1PSRA 1WLMA 1ZMZA 4OCIA 5ER4X 3I5GB 1DTLA 4OV2A 2I18A 2JTTA 3CGAA 5EL2A 2L0PA 1AJ4A 1CDLA 3BFAA 2GV5A 2HETA 4JPZB 2EGDA 4PE1A 1CNPA 1MF8B 3D75A 5D7FA 1IQ5A 2WCKA 2JT8A 1NUBA 1XA5A 1DELA 1K9PA 2WC8A 1ALWA 3D78A 2JU0A 1UHHA 5FI2A 2BL0B 3IF7A 2KI6C 1WDCC 1SPYA 3D73A 3NXAA 2JC2A 3AKBA 4I5JA 3FWCA 1S3PA 1FF1A 1DJYA 1IRJA 1ZOTB 2F2PA 4JD9A 5FI7A 3S0DA 3PALA 2LHLA 3S0BA 5HL1A 5I8NA 3Q8IA 3SG5A 2ZRTA 3TDIA 3FE8A 1YVLA 4M2OA 1JFJA 2JPTA 1MXLC 2KLEA 3OGNA 1CFCA 4YGDB 3I5FC 4DUQA 1WRKA 1TWOA 1BODA 1QVIY 1K94A 2OS8B 1JSAA 3OB2B 3N7HA 1NIWA 3NGVA 4OR9B 1YTZC 4WRIA 2M9GA 1L2OC 1G33A 3JVTB 3OHMB 2M8UA 1KQMC 2NZ0A 1RWYA 3CTNA 3PN7B 1T14A 1OMRA 1CLLA 3WNXB 2HPSA 1QX2A 2JULA 5CPVA 3SG6A 1BF5A 1UWOA 1BOCA 4OKHA 2H61A 4YI8A 3DXLA 3PM2A 5BPJA 1CLMA 1N65A 2ZNDA 2BBMA 1B8RA 3ICBA 3MSEB 1OMVA 2M3WA 1A29A 1KSMA 4JKTA 2ZRSA 1HQVA 4PHJA 1EJ3A 1ZUZA 2HQWA 1TUJA 3V2LA 1TUZA 2KAVA 2O5GA 2ZN8A 4DCKA 2PASA 4GGFA 4N1FA 2H8VA 2PMYA 4A4BA 1NCYA 3KEVA
chains in the Genus database with same CATH topology
1QATA 5AERA 3BYAA 2I2RE 2CCMA 5JOLA 2DOQA 1OOJA 1CFFA 1SCMC 5D69A 1CB1A 3KO0A 4P5OE 1E8AA 3OX6A 1TRFA 1MHOA 2K7BA 4CPVA 5HKZA 1K95A 1DGVA 4PE7A 1UHKA 2GGZA 2K7DA 1LA0A 3O2PA 1IH0A 1EXRA 2K2AA 4MRXA 1TNPA 4CLNA 2CNPA 1TCOB 1CM1A 1GQMA 1YR5A 2M0RA 1H4BA 1AHRA 2LUXA 2LVKA 3KHEA 1FBVA 2ZKMX 1B4CA 3GK2A 4ICBA 1OMDA 2BCBA 2G2BA 1F71A 1JFKA 2L2EA 1RJVA 1R2UA 1NPQA 2L4IA 4E68A 3VROA 1NCXA 1SCMB 1EL4A 1TCFA 4QJ5B 2R2IA 1YRTB 1YUSA 5I2LA 2JNXA 5TNCA 1BG1A 1MWNA 1PRWA 3KPXA 2BKIB 4CFRA 1KFXL 1CFDA 1KWOC 1QIWA 2KAXA 4HRHA 3TDZA 4GFTA 3BXKA 2EC6B 2JXLA 4PCWA 1B7TZ 1QJTA 2PSRA 4P2YB 1PK0D 1XFXO 3DVKA 4MN0A 1GGZA 4A4CA 3D0YA 1RFJA 1EG4A 2KSPA 1QASA 1NX3A 2LVVA 4ZCVA 4QJ3B 2QACA 1OE9B 4ORCB 1J1EA 2F2OA 1ZACA 1XO5A 4YI9A 4GPLB 1MQ1A 4BY4A 3BOWB 1M63B 4MBEA 1QX7A 1CDMA 5JJGA 1SBJA 1B1GA 3CR2A 3EKHA 1FI5A 1BMOA 1RECA 1KK8B 1K90D 1H8BA 1WRZA 4GBAA 3LK0A 1BU3A 5DKQA 3IQOA 2JXCA 3I5IB 2WCFA 2LVIA 4ETOA 1BLQA 4Q04A 1NP8A 3FS7A 2O60A 2CT9A 1DVIA 3GK1A 1B7TY 1SR6B 2BKHB 3TS5B 2SCPA 2K7CA 2KFGA 1BR1B 3PSRA 1KCYA 2LMVA 3EVRA 2JT3A 2KQYA 4TNCA 1EG3A 2LNKA 1TIZA 2K0JA 1A75A 3LCPC 4I5LB 1SL8A 2D8NA 2I94A 1UP5A 2WNDA 3DVMA 4XJKA 1JC2A 5CSFA 4PE0A 5AXIA 1OZOA 2PVBA 2A4JA 1M39A 2PALA 2LMUA 1DJHA 1AP4A 1CDNA 2MJWB 2M7LA 1YRUB 2LE9B 1SL9A 2JRFA 1G8IA 3I5IC 3HX4A 4C0LA 4JQ0D 1F4OA 1KFUS 1L2OB 2MBXA 4DRWA 1KQMB 3VRNA 2KOTA 5AANA 2KNEA 5HLVA 1QX5B 4MZLA 2KAYA 3VRRA 3AAKA 2ZFDA 1IGVA 3F45A 5AEQA 4MRYA 1S5GZ 1YURA 4U8DA 1D1OA 3E3RA 1FI6A 4AOMA 5F6TA 1TN4A 2L5XB 1J7RA 1Q80A 1A4PA 2P6BB 4CFQA 2NCOA 3PLFB 1XFUO 1JBAA 1XFYO 1QLSA 1IKUA 2KGBC 1NWDA 1A75B 3BUXB 1S26D 1Y6WA 1WRLA 1CDPA 2SASA 2AUCA 2NLNA 4YGEB 1LXFC 1DJGA 2KYFA 1QIVA 3NSIA 3NSKA 1M31A 2BL0C 1M46A 2MLFC 1WDCB 2F3YA 2OTGC 1JUOA 2KFHA 4PHNA 3TZ1A 2JOJA 2OPOA 5HKWA 1MUXA 2LAPA 4AQJA 2KI4B 1TOPA 1DJIA 1S36A 1SKTA 2LLTA 2LMTA 1IG5A 3AKAA 3CWGA 4HRGA 1MXEA 2K61A 2Y1MA 1J55A 3EKJA 3BUNB 1KFXS 2LP2A 2LM5A 2KHNA 1C7VA 2L51A 4PHKA 2LUCA 3I5HB 1UURA 1XFVO 2BECA 3DF0B 3I5FB 1XVJA 1SW8A 1B8CA 5CSNA 1FPWA 1V1FA 5G08A 1JF2A 1GJYA 2AAOA 4I5KA 2KYCA 1IQ3A 1LKJA 2HF5A 1NCZA 3CLNA 1R6PA 3KF9A 3WHUB 4D1EA 5I2OA 1DF0A 1PVBA 1WY9A 3TDUA 1QVIZ 3CR4X 2JT0A 4M2QA 5HKYA 1MR8A 2FOTA 2F33A 2CTNA 2KI6D 2ISDA 1IWQA 1V1GA 4WQ2A 3DVJA 5FYXA 2QPTA 3BUMB 1J7OA 3K21A 4MZJA 1UHJA 1QTXA 1Y1XA 3WHTB 1U5IA 1CLBA 1CTRA 4MLWA 1J7QA 4ORAB 4XJKB 2EC6C 2K2FA 3SIBA 4GUKA 2KFFA 4NQGA 1BT6A 2MAZA 1SYMA 1B8LA 2KBIA 2F8PA 2MHHA 3D0YB 3JTDB 4I5NB 4NDCA 3VRQA 3OX5A 5B8IB 2M29A 1AVSA 1TNWA 2JTZA 2L4HA 3GK4X 4GGFC 4L9MA 3RM1A 3SJSA 1F55A 1DMOA 2OS8C 3BQ3A 1W7JB 3BUOB 3NSLA 2L98A 3PFVA 4HSZA 4M2PA 2K7OA 1CMGA 1CFPA 2WOSA 2BBNA 2WORA 4OVNF 3PN7C 2AMIA 3CZTX 3SIAA 1N2DA 5DKRA 3TS5C 1K9KA 1KK8C 4N5XA 3RLZA 1CMFA 3SG2A 3AAJA 3DF0A 1TNQA 2Y1NA 4YRUA 2E6WA 2M97A 1C7WA 1NSHA 2NCPA 1RK9A 1F54A 4AQIA 1KQVA 3EK7A 3FIAA 3TUYC 1KK7Z 4MVFA 5KU1A 1WLZA 1HT9A 1QV0A 3JTDC 2NXQA 4GNKB 5J3XA 3QRXA 2CXJA 4NDDA 4GGNA 2EHBA 2KDHA 2LC5A 2CBLA 5AFPA 1NYAA 3EVUA 1S1EA 3A4UB 4FQOA 1LVCD 1SL7A 2M1UA 3C1VA 2JZIA 3I5GC 5HYDA 1A2XA 4C0JA 2I7AA 2LP3A 1NX2A 1XYDA 4YGBB 5KSZA 1JWDA 4PDZA 1KSOA 1RROA 2BCAA 2KQ6A 2VRGA 1C07A 4QJ4B 3EK8A 1AJ5A 1KK7Y 5HLOA 4MEWA 1BJFA 3IQQA 1IJ6A 1Y0VH 2WCEA 2JQ6A 1Y1AA 2MRDA 3D10A 3M0WA 1FW4A 3CS1A 3TUYB 1TNXA 4PALA 2FJUB 4DIRA 1J1DA 5CSJA 3LLEA 1UHNA 4GAOA 3SG7A 4HREE 2E30A 4F0ZB 4MZKA 2MA2A 1U5IB 1OSAA 3H4SE 2JWWA 3FWBA 1L7ZA 4ORBB 2LANA 2BE6A 2LLUA 1RTP1 1SRAA 1S6JA 1PVAA 4USLA 1J7PA 1Y1UA 1YUUA 1JF0A 1F70A 2OTGB 2ZN9A 1DJWA 1YX7A 1QS7A 2TN4A 1B9AA 2H61C 4FTGA 1XK4A 1SNLA 1XFZO 3EVVA 3JVTC 4WQ3A 4C0KA 1ODBA 1PULA 2FCDA 1SR6C 4N1GA 4YGCB 3VGOA 4YBHB 1S5GY 3SG3A 1PSBA 1M45A 2G9BA 2KI4C 1KFUL 5CSIA 3BUWB 1BR4B 2V53A 1G4YR 1QLKA 1DJXA 1XFWO 1DGUA 3I5HC 2BCXA 2LCPA 1S6IA 3SG4A 1K2HA 1F8HA 2B1UA 2LVJA 3GOFA 1SY9A 2KGRA 1NX1A 1K93D 1SCVA 3O78A 5PALA 4MSPA 1SK6D 3O4YA 4YGAA 1DT7B 2F3ZA 2RGIA 1PALA 2COLB 1UHIA 1UUSA 4PE4A 2H2KA 3PM8A 5ER5A 3DVEA 3HCMA 4NDBA 1OZSA 3OB1B 3LL8B 4JWQA 4IL1A 4CIDA 2HQ8A 1CKKA 3OP0A 1CM4A 2MLEC 2LV7A 3BOWA 1YX8A 5DKNA 1GGWA 5K89A 1QXPA 4ZCUA 2Y4QA 2ZNEA 1S6CA 1OQPA 3O6BA 1ALVA 2BE4A 3NSOA 5GQQC 3A8RA 1K96A 2K8MB 2KBMA 2L50A 1QV1A 1AK8A 2LHIA 1VRKA 2IS9A 3EK4A 1SMGA 4PHMA 1X02A 1IJ5A 1ZFSA 2GGMA 1KWOB 2FCEA 2Y5IA 1LINA 2Q4UA 4UPGA 3ZWHA 1LA3A 1EH2A 1DF0B 2PRUA 1K9UA 3VRPA 3WXAA 2LLSA 1B47A 1W7IB 4XYNA 4R1EA 1DJZA 1K8UA 1AUIB 2Q91A 2M7NA 4BY5A 5I2QA 5KTYA 1NX0A 3PATA 3ZNIA 1YUTA 2M1KB 1XK4C 3CR5X 4DS7A 3LK1A 3DD4A 1F4QA 1TTXA 2M49B 1A03A 2WCBA 5IBWA 1N0YA 1YVHA 2JNFA 1PSRA 1WLMA 1ZMZA 4OCIA 5ER4X 3I5GB 1DTLA 4OV2A 2I18A 2JTTA 3CGAA 2L0PA 1AJ4A 1CDLA 4JPZB 2GV5A 2HETA 2EGDA 4PE1A 1CNPA 1MF8B 5D7FA 1IQ5A 2JT8A 1NUBA 1XA5A 1K9PA 2WC8A 1ALWA 2JU0A 1UHHA 2BL0B 3IF7A 2KI6C 1WDCC 1SPYA 3NXAA 4I5JA 2JC2A 3AKBA 1FF1A 3FWCA 1S3PA 1DJYA 1IRJA 1ZOTB 2F2PA 3PALA 2LHLA 5I8NA 3SG5A 2ZRTA 3TDIA 1JFJA 1YVLA 4M2OA 2JPTA 1MXLC 1CFCA 4YGDB 3I5FC 4DUQA 1WRKA 1BODA 1QVIY 1K94A 2OS8B 1JSAA 3OB2B 1NIWA 4OR9B 1YTZC 4WRIA 2M9GA 1L2OC 1G33A 3JVTB 3OHMB 2M8UA 1KQMC 2NZ0A 1RWYA 3CTNA 3PN7B 1OMRA 1CLLA 3WNXB 2HPSA 1QX2A 2JULA 5CPVA 3SG6A 1BF5A 1UWOA 1BOCA 4OKHA 2H61A 4YI8A 5BPJA 1CLMA 1N65A 2ZNDA 2BBMA 1B8RA 3ICBA 3MSEB 1OMVA 2M3WA 1A29A 1KSMA 2ZRSA 1HQVA 4PHJA 1EJ3A 1ZUZA 2HQWA 2KAVA 2O5GA 2ZN8A 4DCKA 2PASA 4GGFA 4N1FA 2PMYA 4A4BA 1NCYA 3KEVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QAT A;  5AER A;  3BYA A;  2I2R E;  2CCM A;  5JOL A;  2DOQ A;  1OOJ A;  1CFF A;  1SCM C;  5D69 A;  1CB1 A;  3KO0 A;  4P5O E;  1E8A A;  3OX6 A;  1TRF A;  1MHO A;  2K7B A;  4CPV A;  5HKZ A;  1K95 A;  1DGV A;  4PE7 A;  1UHK A;  2GGZ A;  2K7D A;  1LA0 A;  3O2P A;  1IH0 A;  1EXR A;  2K2A A;  4MRX A;  1TNP A;  4CLN A;  2CNP A;  1TCO B;  1CM1 A;  1GQM A;  1YR5 A;  2M0R A;  1H4B A;  1AHR A;  2LUX A;  2LVK A;  3KHE A;  1FBV A;  2ZKM X;  1B4C A;  3GK2 A;  4ICB A;  1OMD A;  2BCB A;  2G2B A;  1F71 A;  1JFK A;  2L2E A;  1RJV A;  1R2U A;  1NPQ A;  2L4I A;  4E68 A;  3VRO A;  1NCX A;  1SCM B;  1EL4 A;  1TCF A;  4QJ5 B;  2R2I A;  1YRT B;  1YUS A;  5I2L A;  2JNX A;  5TNC A;  1BG1 A;  1MWN A;  1PRW A;  3KPX A;  2BKI B;  4CFR A;  1KFX L;  1CFD A;  1KWO C;  1QIW A;  2KAX A;  4HRH A;  3TDZ A;  4GFT A;  3BXK A;  2EC6 B;  2JXL A;  4PCW A;  1B7T Z;  1QJT A;  2PSR A;  4P2Y B;  1PK0 D;  1XFX O;  3DVK A;  4MN0 A;  1GGZ A;  4A4C A;  3D0Y A;  1RFJ A;  1EG4 A;  2KSP A;  1QAS A;  1NX3 A;  2LVV A;  4ZCV A;  4QJ3 B;  2QAC A;  1OE9 B;  4ORC B;  1J1E A;  2F2O A;  1ZAC A;  1XO5 A;  4YI9 A;  4GPL B;  1MQ1 A;  4BY4 A;  3BOW B;  1M63 B;  4MBE A;  1QX7 A;  1CDM A;  5JJG A;  1SBJ A;  1B1G A;  3CR2 A;  3EKH A;  1FI5 A;  1BMO A;  1REC A;  1KK8 B;  1K90 D;  1H8B A;  1WRZ A;  4GBA A;  3LK0 A;  1BU3 A;  5DKQ A;  3IQO A;  2JXC A;  3I5I B;  2WCF A;  2LVI A;  4ETO A;  1BLQ A;  4Q04 A;  1NP8 A;  3FS7 A;  2O60 A;  2CT9 A;  1DVI A;  3GK1 A;  1B7T Y;  1SR6 B;  2BKH B;  3TS5 B;  2SCP A;  2K7C A;  2KFG A;  1BR1 B;  3PSR A;  1KCY A;  2LMV A;  3EVR A;  2JT3 A;  2KQY A;  4TNC A;  1EG3 A;  2LNK A;  1TIZ A;  2K0J A;  1A75 A;  3LCP C;  4I5L B;  1SL8 A;  2D8N A;  2I94 A;  1UP5 A;  2WND A;  3DVM A;  4XJK A;  1JC2 A;  5CSF A;  4PE0 A;  5AXI A;  1OZO A;  2PVB A;  2A4J A;  1M39 A;  2PAL A;  2LMU A;  1DJH A;  1AP4 A;  1CDN A;  2MJW B;  2M7L A;  1YRU B;  2LE9 B;  1SL9 A;  2JRF A;  1G8I A;  3I5I C;  3HX4 A;  4C0L A;  4JQ0 D;  1F4O A;  1KFU S;  1L2O B;  2MBX A;  4DRW A;  1KQM B;  3VRN A;  2KOT A;  5AAN A;  2KNE A;  5HLV A;  1QX5 B;  4MZL A;  2KAY A;  3VRR A;  3AAK A;  2ZFD A;  1IGV A;  3F45 A;  5AEQ A;  4MRY A;  1S5G Z;  1YUR A;  4U8D A;  1D1O A;  3E3R A;  1FI6 A;  4AOM A;  5F6T A;  1TN4 A;  2L5X B;  1J7R A;  1Q80 A;  1A4P A;  2P6B B;  4CFQ A;  2NCO A;  3PLF B;  1XFU O;  1JBA A;  1XFY O;  1QLS A;  1IKU A;  2KGB C;  1NWD A;  1A75 B;  3BUX B;  1S26 D;  1Y6W A;  1WRL A;  1CDP A;  2SAS A;  2AUC A;  2NLN A;  4YGE B;  1LXF C;  1DJG A;  2KYF A;  1QIV A;  3NSI A;  3NSK A;  1M31 A;  2BL0 C;  1M46 A;  2MLF C;  1WDC B;  2F3Y A;  2OTG C;  1JUO A;  2KFH A;  4PHN A;  3TZ1 A;  2JOJ A;  2OPO A;  5HKW A;  1MUX A;  2LAP A;  4AQJ A;  2KI4 B;  1TOP A;  1DJI A;  1S36 A;  1SKT A;  2LLT A;  2LMT A;  1IG5 A;  3AKA A;  3CWG A;  4HRG A;  1MXE A;  2K61 A;  2Y1M A;  1J55 A;  3EKJ A;  3BUN B;  1KFX S;  2LP2 A;  2LM5 A;  2KHN A;  1C7V A;  2L51 A;  4PHK A;  2LUC A;  3I5H B;  1UUR A;  1XFV O;  2BEC A;  3DF0 B;  3I5F B;  1XVJ A;  1SW8 A;  1B8C A;  5CSN A;  1FPW A;  1V1F A;  5G08 A;  1JF2 A;  1GJY A;  2AAO A;  4I5K A;  2KYC A;  1IQ3 A;  1LKJ A;  2HF5 A;  1NCZ A;  3CLN A;  1R6P A;  3KF9 A;  3WHU B;  4D1E A;  5I2O A;  1DF0 A;  1PVB A;  1WY9 A;  3TDU A;  1QVI Z;  3CR4 X;  2JT0 A;  4M2Q A;  5HKY A;  1MR8 A;  2FOT A;  2F33 A;  2CTN A;  2KI6 D;  2ISD A;  1IWQ A;  1V1G A;  4WQ2 A;  3DVJ A;  5FYX A;  2QPT A;  3BUM B;  1J7O A;  3K21 A;  4MZJ A;  1UHJ A;  1QTX A;  1Y1X A;  3WHT B;  1U5I A;  1CLB A;  1CTR A;  4MLW A;  1J7Q A;  4ORA B;  4XJK B;  2EC6 C;  2K2F A;  3SIB A;  4GUK A;  2KFF A;  4NQG A;  1BT6 A;  2MAZ A;  1SYM A;  1B8L A;  2KBI A;  2F8P A;  2MHH A;  3D0Y B;  3JTD B;  4I5N B;  4NDC A;  3VRQ A;  3OX5 A;  5B8I B;  2M29 A;  1AVS A;  1TNW A;  2JTZ A;  2L4H A;  3GK4 X;  4GGF C;  4L9M A;  3RM1 A;  3SJS A;  1F55 A;  1DMO A;  2OS8 C;  3BQ3 A;  1W7J B;  3BUO B;  3NSL A;  2L98 A;  3PFV A;  4HSZ A;  4M2P A;  2K7O A;  1CMG A;  1CFP A;  2WOS A;  2BBN A;  2WOR A;  4OVN F;  3PN7 C;  2AMI A;  3CZT X;  3SIA A;  1N2D A;  5DKR A;  3TS5 C;  1K9K A;  1KK8 C;  4N5X A;  3RLZ A;  1CMF A;  3SG2 A;  3AAJ A;  3DF0 A;  1TNQ A;  2Y1N A;  4YRU A;  2E6W A;  2M97 A;  1C7W A;  1NSH A;  2NCP A;  1RK9 A;  1F54 A;  4AQI A;  1KQV A;  3EK7 A;  3FIA A;  3TUY C;  1KK7 Z;  4MVF A;  5KU1 A;  1WLZ A;  1HT9 A;  1QV0 A;  3JTD C;  2NXQ A;  4GNK B;  5J3X A;  3QRX A;  2CXJ A;  4NDD A;  4GGN A;  2EHB A;  2KDH A;  2LC5 A;  2CBL A;  5AFP A;  1NYA A;  3EVU A;  1S1E A;  3A4U B;  4FQO A;  1LVC D;  1SL7 A;  2M1U A;  3C1V A;  2JZI A;  3I5G C;  5HYD A;  1A2X A;  4C0J A;  2I7A A;  2LP3 A;  1NX2 A;  1XYD A;  4YGB B;  5KSZ A;  1JWD A;  4PDZ A;  1KSO A;  1RRO A;  2BCA A;  2KQ6 A;  2VRG A;  1C07 A;  4QJ4 B;  3EK8 A;  1AJ5 A;  1KK7 Y;  5HLO A;  4MEW A;  1BJF A;  3IQQ A;  1IJ6 A;  1Y0V H;  2WCE A;  2JQ6 A;  1Y1A A;  2MRD A;  3D10 A;  3M0W A;  1FW4 A;  3CS1 A;  3TUY B;  1TNX A;  4PAL A;  2FJU B;  4DIR A;  1J1D A;  5CSJ A;  3LLE A;  1UHN A;  4GAO A;  3SG7 A;  4HRE E;  2E30 A;  4F0Z B;  4MZK A;  2MA2 A;  1U5I B;  1OSA A;  3H4S E;  2JWW A;  3FWB A;  1L7Z A;  4ORB B;  2LAN A;  2BE6 A;  2LLU A;  1RTP 1;  1SRA A;  1S6J A;  1PVA A;  4USL A;  1J7P A;  1Y1U A;  1YUU A;  1JF0 A;  1F70 A;  2OTG B;  2ZN9 A;  1DJW A;  1YX7 A;  1QS7 A;  2TN4 A;  1B9A A;  2H61 C;  4FTG A;  1XK4 A;  1SNL A;  1XFZ O;  3EVV A;  3JVT C;  4WQ3 A;  4C0K A;  1ODB A;  1PUL A;  2FCD A;  1SR6 C;  4N1G A;  4YGC B;  3VGO A;  4YBH B;  1S5G Y;  3SG3 A;  1PSB A;  1M45 A;  2G9B A;  2KI4 C;  1KFU L;  5CSI A;  3BUW B;  1BR4 B;  2V53 A;  1G4Y R;  1QLK A;  1DJX A;  1XFW O;  1DGU A;  3I5H C;  2BCX A;  2LCP A;  1S6I A;  3SG4 A;  1K2H A;  1F8H A;  2B1U A;  2LVJ A;  3GOF A;  1SY9 A;  2KGR A;  1NX1 A;  1K93 D;  1SCV A;  3O78 A;  5PAL A;  4MSP A;  1SK6 D;  3O4Y A;  4YGA A;  1DT7 B;  2F3Z A;  2RGI A;  1PAL A;  2COL B;  1UHI A;  1UUS A;  4PE4 A;  2H2K A;  3PM8 A;  5ER5 A;  3DVE A;  3HCM A;  4NDB A;  1OZS A;  3OB1 B;  3LL8 B;  4JWQ A;  4IL1 A;  4CID A;  2HQ8 A;  1CKK A;  3OP0 A;  1CM4 A;  2MLE C;  2LV7 A;  3BOW A;  1YX8 A;  5DKN A;  1GGW A;  5K89 A;  1QXP A;  4ZCU A;  2Y4Q A;  2ZNE A;  1S6C A;  1OQP A;  3O6B A;  1ALV A;  2BE4 A;  3NSO A;  5GQQ C;  3A8R A;  1K96 A;  2K8M B;  2KBM A;  2L50 A;  1QV1 A;  1AK8 A;  2LHI A;  1VRK A;  2IS9 A;  3EK4 A;  1SMG A;  4PHM A;  1X02 A;  1IJ5 A;  1ZFS A;  2GGM A;  1KWO B;  2FCE A;  2Y5I A;  1LIN A;  2Q4U A;  4UPG A;  3ZWH A;  1LA3 A;  1EH2 A;  1DF0 B;  2PRU A;  1K9U A;  3VRP A;  3WXA A;  2LLS A;  1B47 A;  1W7I B;  4XYN A;  4R1E A;  1DJZ A;  1K8U A;  1AUI B;  2Q91 A;  2M7N A;  4BY5 A;  5I2Q A;  5KTY A;  1NX0 A;  3PAT A;  3ZNI A;  1YUT A;  2M1K B;  1XK4 C;  3CR5 X;  4DS7 A;  3LK1 A;  3DD4 A;  1F4Q A;  1TTX A;  2M49 B;  1A03 A;  2WCB A;  5IBW A;  1N0Y A;  1YVH A;  2JNF A;  1PSR A;  1WLM A;  1ZMZ A;  4OCI A;  5ER4 X;  3I5G B;  1DTL A;  4OV2 A;  2I18 A;  2JTT A;  3CGA A;  2L0P A;  1AJ4 A;  1CDL A;  4JPZ B;  2GV5 A;  2HET A;  2EGD A;  4PE1 A;  1CNP A;  1MF8 B;  5D7F A;  1IQ5 A;  2JT8 A;  1NUB A;  1XA5 A;  1K9P A;  2WC8 A;  1ALW A;  2JU0 A;  1UHH A;  2BL0 B;  3IF7 A;  2KI6 C;  1WDC C;  1SPY A;  3NXA A;  4I5J A;  2JC2 A;  3AKB A;  1FF1 A;  3FWC A;  1S3P A;  1DJY A;  1IRJ A;  1ZOT B;  2F2P A;  3PAL A;  2LHL A;  5I8N A;  3SG5 A;  2ZRT A;  3TDI A;  1JFJ A;  1YVL A;  4M2O A;  2JPT A;  1MXL C;  1CFC A;  4YGD B;  3I5F C;  4DUQ A;  1WRK A;  1BOD A;  1QVI Y;  1K94 A;  2OS8 B;  1JSA A;  3OB2 B;  1NIW A;  4OR9 B;  1YTZ C;  4WRI A;  2M9G A;  1L2O C;  1G33 A;  3JVT B;  3OHM B;  2M8U A;  1KQM C;  2NZ0 A;  1RWY A;  3CTN A;  3PN7 B;  1OMR A;  1CLL A;  3WNX B;  2HPS A;  1QX2 A;  2JUL A;  5CPV A;  3SG6 A;  1BF5 A;  1UWO A;  1BOC A;  4OKH A;  2H61 A;  4YI8 A;  5BPJ A;  1CLM A;  1N65 A;  2ZND A;  2BBM A;  1B8R A;  3ICB A;  3MSE B;  1OMV A;  2M3W A;  1A29 A;  1KSM A;  2ZRS A;  1HQV A;  4PHJ A;  1EJ3 A;  1ZUZ A;  2HQW A;  2KAV A;  2O5G A;  2ZN8 A;  4DCK A;  2PAS A;  4GGF A;  4N1F A;  2PMY A;  4A4B A;  1NCY A;  3KEV A; 
#chains in the Genus database with same CATH topology
 1QAT A;  5AER A;  3BYA A;  2I2R E;  2CCM A;  3DY9 A;  5JOL A;  1OOF A;  2DOQ A;  1OOJ A;  1CFF A;  1SCM C;  5D69 A;  1CB1 A;  3KO0 A;  4P5O E;  1E8A A;  3OX6 A;  3VB1 A;  1TRF A;  1MHO A;  2WCJ A;  2K7B A;  4F7F A;  4CPV A;  5I94 A;  5HKZ A;  1K95 A;  1DGV A;  4PE7 A;  1UHK A;  1LS8 A;  2P71 A;  2GGZ A;  2K7D A;  1LA0 A;  3O2P A;  4IJ7 A;  1IH0 A;  1EXR A;  2K2A A;  4MRX A;  1TNP A;  4CLN A;  2CNP A;  1TCO B;  1CM1 A;  1GQM A;  1YR5 A;  2M0R A;  1H4B A;  1AHR A;  2LUX A;  2LVK A;  3KHE A;  1FBV A;  2L5Y A;  2ZKM X;  3UNW A;  1B4C A;  3GK2 A;  3IVT A;  4ICB A;  1OMD A;  2BCB A;  2G2B A;  1F71 A;  1JFK A;  2BAP A;  2L2E A;  1RJV A;  1R2U A;  1NPQ A;  2L4I A;  4E68 A;  3VRO A;  1NCX A;  1SCM B;  2L2C A;  1EL4 A;  1TCF A;  4QJ5 B;  2R2I A;  1YRT B;  1YUS A;  5I2L A;  2JNX A;  5TNC A;  1BG1 A;  1MWN A;  1PRW A;  3FE6 A;  2BKI B;  3KPX A;  4CFR A;  1KFX L;  1CFD A;  1KWO C;  1ORG A;  1QIW A;  2KAX A;  3D76 A;  4HRH A;  3TDZ A;  4GFT A;  3BXK A;  2EC6 B;  2JXL A;  4PCW A;  1B7T Z;  1QJT A;  2PSR A;  1DQE A;  4P2Y B;  1PK0 D;  1XFX O;  3DVK A;  4MN0 A;  1GGZ A;  4A4C A;  3D0Y A;  1RFJ A;  1EG4 A;  2KSP A;  1GM0 A;  1QAS A;  1NX3 A;  2LVV A;  4ZCV A;  4QJ3 B;  2QAC A;  1OE9 B;  4ORC B;  1J1E A;  2F2O A;  1ZAC A;  1XO5 A;  4YI9 A;  4GPL B;  1MQ1 A;  4BY4 A;  3FE9 A;  3BOW B;  1M63 B;  4MBE A;  1QX7 A;  1CDM A;  5JJG A;  1SBJ A;  3PJI A;  1OW4 A;  1B1G A;  3CR2 A;  3EKH A;  1FI5 A;  1BMO A;  1REC A;  1KK8 B;  1K90 D;  1H8B A;  1WRZ A;  4GBA A;  3LK0 A;  1BU3 A;  5DKQ A;  3IQO A;  2JXC A;  3I5I B;  2WCF A;  2LVI A;  3OBV A;  4ETO A;  1DEK A;  4Q04 A;  2WCM A;  1NP8 A;  3FS7 A;  1BLQ A;  1C3Z A;  2O60 A;  2CT9 A;  2QEH A;  1DVI A;  2QEO A;  1B7T Y;  1SR6 B;  2BKH B;  3GK1 A;  3TS5 B;  1SSE B;  2SCP A;  2K7C A;  2KFG A;  1BR1 B;  2K60 A;  3PSR A;  2LMV A;  3EVR A;  1XFR A;  1KCY A;  2JT3 A;  3S0A A;  2KQY A;  4TNC A;  1EG3 A;  2LNK A;  1TIZ A;  2K0J A;  1A75 A;  3LCP C;  4I5L B;  1SL8 A;  2D8N A;  2I94 A;  3CZ2 A;  1UP5 A;  2WND A;  3DVM A;  4XJK A;  1JC2 A;  5CSF A;  4PE0 A;  1P28 A;  5AXI A;  1Z2C B;  3SS4 A;  1OZO A;  2PVB A;  3SS5 A;  2A4J A;  1M39 A;  2PAL A;  2LMU A;  1DJH A;  1AP4 A;  1CDN A;  2MJW B;  2M7L A;  1YRU B;  2LE9 B;  1SL9 A;  2JRF A;  4FQT A;  5DIC A;  1G8I A;  3I5I C;  3HX4 A;  4C0L A;  4JQ0 D;  1F4O A;  1KFU S;  1L2O B;  2MBX A;  4DRW A;  1KQM B;  3VRN A;  3S0E A;  1QWV A;  2KOT A;  5AAN A;  3R1O A;  2KNE A;  5HLV A;  1QX5 B;  4MZL A;  2KAY A;  3VRR A;  3AAK A;  2ZFD A;  1IGV A;  3F45 A;  5AEQ A;  4MRY A;  1S5G Z;  3B7A A;  1YUR A;  4U8D A;  1D1O A;  3E3R A;  1FI6 A;  4AOM A;  5F6T A;  1TN4 A;  2L5X B;  1J7R A;  1Q80 A;  1A4P A;  2P6B B;  4CFQ A;  3L4A A;  2NCO A;  3PLF B;  1XFU O;  1JBA A;  1XFY O;  1QLS A;  1IKU A;  2KGB C;  1NWD A;  1A75 B;  3BUX B;  3BJH A;  1S26 D;  1Y6W A;  1WRL A;  1CDP A;  2SAS A;  2AUC A;  2NLN A;  4YGE B;  1LXF C;  1DJG A;  2KYF A;  1QIV A;  3NSI A;  4INW A;  3NSK A;  1M31 A;  2BL0 C;  1M46 A;  2MLF C;  1WDC B;  2F3Y A;  2OTG C;  1JUO A;  2KFH A;  4PHN A;  3TZ1 A;  3B6X A;  2JOJ A;  2OPO A;  5HKW A;  1MUX A;  2LAP A;  4AQJ A;  2KI4 B;  1TOP A;  1DJI A;  1S36 A;  1SKT A;  2LLT A;  2LMT A;  1IG5 A;  3AKA A;  3CWG A;  2YGU A;  1MXE A;  4HRG A;  4PT1 A;  2K61 A;  2Y1M A;  1J55 A;  3EKJ A;  3BUN B;  1KFX S;  2LP2 A;  2LM5 A;  2KHN A;  1C7V A;  2L51 A;  3CAB A;  2LUC A;  3I5H B;  3L47 A;  1UUR A;  1XFV O;  2BEC A;  4PHK A;  3DF0 B;  3I5F B;  1XVJ A;  1SW8 A;  1IIO A;  1B8C A;  5CSN A;  1FPW A;  1V1F A;  5G08 A;  1JF2 A;  1GJY A;  2AAO A;  4I5K A;  2KYC A;  1IQ3 A;  1LKJ A;  2HF5 A;  1NCZ A;  1C3Y A;  3CLN A;  1R6P A;  3KF9 A;  3WHU B;  4D1E A;  3CYZ A;  1DF0 A;  1PVB A;  5I2O A;  1WY9 A;  3TDU A;  1QVI Z;  3CR4 X;  2QDI A;  2JT0 A;  4M2Q A;  5HKY A;  1MR8 A;  2FOT A;  2F33 A;  2CTN A;  2KI6 D;  2ISD A;  1IWQ A;  1V1G A;  4WQ2 A;  3DVJ A;  5FYX A;  2QPT A;  3D74 A;  3BUM B;  1J7O A;  3K21 A;  4MZJ A;  1UHJ A;  1QTX A;  1Y1X A;  3WHT B;  1U5I A;  1CLB A;  1CTR A;  1W9Z A;  4MLW A;  1J7Q A;  4ORA B;  4XJK B;  2EC6 C;  2K2F A;  3SIB A;  4GUK A;  2KFF A;  3DZT A;  4NQG A;  1BT6 A;  2MAZ A;  1SYM A;  1B8L A;  2KBI A;  2F8P A;  2MHH A;  3D0Y B;  3JTD B;  4I5N B;  4NDC A;  3VRQ A;  3OX5 A;  2PYQ A;  5B8I B;  2M29 A;  1AVS A;  1TNW A;  2JTZ A;  2L4H A;  3GK4 X;  2KPH A;  4GGF C;  4L9M A;  5FI6 A;  3RM1 A;  3SJS A;  1F55 A;  2WCH A;  1DMO A;  2GTE A;  2OS8 C;  3BQ3 A;  1W7J B;  3BUO B;  3NSL A;  2L98 A;  3PFV A;  4HSZ A;  4M2P A;  2K7O A;  1CMG A;  1CFP A;  2WOS A;  3S0F A;  3O4X A;  2BBN A;  2WOR A;  4OVN F;  3PN7 C;  2AMI A;  4INX A;  3CZT X;  3SIA A;  1N2D A;  3EG5 B;  5DKR A;  3TS5 C;  3SS3 A;  1K9K A;  1KK8 C;  4N5X A;  3RLZ A;  1CMF A;  3SG2 A;  3S0G A;  3AAJ A;  3DF0 A;  1TNQ A;  2Y1N A;  4YRU A;  2E6W A;  2M97 A;  1C7W A;  1NSH A;  2NCP A;  1RK9 A;  1F54 A;  4AQI A;  1KQV A;  3RZS A;  3EK7 A;  4OZD A;  3FIA A;  3TUY C;  1KK7 Z;  1OOI X;  4MVF A;  5KU1 A;  3NHT A;  1WLZ A;  1HT9 A;  1QV0 A;  3JTD C;  2NXQ A;  4GNK B;  5J3X A;  3QRX A;  2CXJ A;  4NDD A;  4GGN A;  2EHB A;  2KDH A;  2QEV A;  3R1V A;  2LC5 A;  2CBL A;  3BFH A;  5AFP A;  1NYA A;  3EVU A;  1S1E A;  3A4U B;  4FQO A;  1LVC D;  1SL7 A;  2M1U A;  3C1V A;  2JZI A;  3I5G C;  5HYD A;  1A2X A;  4C0J A;  2I7A A;  3CDN A;  2LP3 A;  1NX2 A;  1XYD A;  4YGB B;  5KSZ A;  1JWD A;  4PDZ A;  1KSO A;  1RRO A;  2BCA A;  2KQ6 A;  3D77 A;  2VRG A;  2ERB A;  1C07 A;  4QJ4 B;  3EK8 A;  1AJ5 A;  1KK7 Y;  5HLO A;  4MEW A;  1BJF A;  3IQQ A;  1IJ6 A;  1Y0V H;  2WCE A;  2JQ6 A;  1Y1A A;  2MRD A;  3D10 A;  3M0W A;  1FW4 A;  3CS1 A;  3TUY B;  1TNX A;  3BFB A;  4PAL A;  2FJU B;  4DIR A;  1J1D A;  5CSJ A;  3LLE A;  1UHN A;  4GAO A;  3SG7 A;  4HRE E;  2E30 A;  4F0Z B;  4MZK A;  2MA2 A;  1U5I B;  3B88 A;  1OSA A;  3DYE A;  2JWW A;  3H4S E;  3FWB A;  1L7Z A;  4ORB B;  2LAN A;  2BE6 A;  3QME A;  2LLU A;  1RTP 1;  1SRA A;  1S6J A;  1PVA A;  4USL A;  1J7P A;  1Y1U A;  2BNX A;  1YUU A;  1JF0 A;  1F70 A;  2OTG B;  2ZN9 A;  1DJW A;  1YX7 A;  1QS7 A;  2WC5 A;  2TN4 A;  1B9A A;  2H61 C;  4FTG A;  1XK4 A;  1SNL A;  1XFZ O;  3EVV A;  3JVT C;  4WQ3 A;  4C0K A;  1ODB A;  1PUL A;  2FCD A;  1SR6 C;  4N1G A;  4YGC B;  3VGO A;  2PQL A;  4YBH B;  1S5G Y;  3SG3 A;  1PSB A;  1M45 A;  2G9B A;  2KI4 C;  1OOG A;  1KFU L;  5CSI A;  3BUW B;  1BR4 B;  2V53 A;  1G4Y R;  1QLK A;  1DJX A;  1XFW O;  1DGU A;  3L4L A;  3I5H C;  2BCX A;  2LCP A;  1S6I A;  3SG4 A;  1Z4H A;  1F8H A;  2B1U A;  2LVJ A;  1K2H A;  3GOF A;  1SY9 A;  2KGR A;  1NX1 A;  1K93 D;  1SCV A;  3O78 A;  5PAL A;  3NHI A;  4MSP A;  1SK6 D;  3O4Y A;  4YGA A;  1OOH A;  2KLD A;  1DT7 B;  2F3Z A;  2RGI A;  1PAL A;  2COL B;  1UHI A;  1UUS A;  4PE4 A;  4KYN A;  2H2K A;  3PM8 A;  3R72 A;  5ER5 A;  3DVE A;  3B86 A;  3HCM A;  4NDB A;  3UO9 A;  3K1E A;  1OZS A;  3R1P A;  2FJY A;  3OB1 B;  3LL8 B;  4JWQ A;  4IL1 A;  4CID A;  2JPO A;  2HQ8 A;  1CKK A;  3OP0 A;  1CM4 A;  2MLE C;  2LV7 A;  3BOW A;  1YX8 A;  5DKN A;  2WC6 A;  1GGW A;  5K89 A;  1QXP A;  4ZCU A;  2Y4Q A;  2ZNE A;  1S6C A;  1OQP A;  3O6B A;  1ALV A;  2BE4 A;  3NSO A;  5GQQ C;  3A8R A;  1K96 A;  3CZ1 A;  2K8M B;  2KBM A;  2L50 A;  1QV1 A;  1AK8 A;  2LHI A;  1VRK A;  2IS9 A;  1DC1 A;  3EK4 A;  3CZ0 A;  5D3O A;  1SMG A;  4PHM A;  1X02 A;  1IJ5 A;  1ZFS A;  2GGM A;  1KWO B;  2FCE A;  2Y5I A;  1LIN A;  2Q4U A;  4UPG A;  3ZWH A;  1LA3 A;  2P70 A;  1EH2 A;  1DF0 B;  2PRU A;  1K9U A;  3VRP A;  3WXA A;  2LLS A;  1B47 A;  1W7I B;  4XYN A;  4R1E A;  1DJZ A;  1K8U A;  1AUI B;  2Q91 A;  2M7N A;  4BY5 A;  5I2Q A;  5KTY A;  1NX0 A;  3PAT A;  3ZNI A;  1YUT A;  2M1K B;  3B87 A;  1XK4 C;  3CR5 X;  4DS7 A;  2WCL A;  3LK1 A;  3DD4 A;  1F4Q A;  1TTX A;  2M49 B;  1A03 A;  2WCB A;  5IBW A;  2QEB A;  1N0Y A;  1YVH A;  2JNF A;  1PSR A;  1WLM A;  1ZMZ A;  4OCI A;  5ER4 X;  3I5G B;  1DTL A;  4OV2 A;  2I18 A;  2JTT A;  3CGA A;  5EL2 A;  2L0P A;  1AJ4 A;  1CDL A;  3BFA A;  2GV5 A;  2HET A;  4JPZ B;  2EGD A;  4PE1 A;  1CNP A;  1MF8 B;  3D75 A;  5D7F A;  1IQ5 A;  2WCK A;  2JT8 A;  1NUB A;  1XA5 A;  1DEL A;  1K9P A;  2WC8 A;  1ALW A;  3D78 A;  2JU0 A;  1UHH A;  5FI2 A;  2BL0 B;  3IF7 A;  2KI6 C;  1WDC C;  1SPY A;  3D73 A;  3NXA A;  2JC2 A;  3AKB A;  4I5J A;  3FWC A;  1S3P A;  1FF1 A;  1DJY A;  1IRJ A;  1ZOT B;  2F2P A;  4JD9 A;  5FI7 A;  3S0D A;  3PAL A;  2LHL A;  3S0B A;  5HL1 A;  5I8N A;  3Q8I A;  3SG5 A;  2ZRT A;  3TDI A;  3FE8 A;  1YVL A;  4M2O A;  1JFJ A;  2JPT A;  1MXL C;  2KLE A;  3OGN A;  1CFC A;  4YGD B;  3I5F C;  4DUQ A;  1WRK A;  1TWO A;  1BOD A;  1QVI Y;  1K94 A;  2OS8 B;  1JSA A;  3OB2 B;  3N7H A;  1NIW A;  3NGV A;  4OR9 B;  1YTZ C;  4WRI A;  2M9G A;  1L2O C;  1G33 A;  3JVT B;  3OHM B;  2M8U A;  1KQM C;  2NZ0 A;  1RWY A;  3CTN A;  3PN7 B;  1T14 A;  1OMR A;  1CLL A;  3WNX B;  2HPS A;  1QX2 A;  2JUL A;  5CPV A;  3SG6 A;  1BF5 A;  1UWO A;  1BOC A;  4OKH A;  2H61 A;  4YI8 A;  3DXL A;  3PM2 A;  5BPJ A;  1CLM A;  1N65 A;  2ZND A;  2BBM A;  1B8R A;  3ICB A;  3MSE B;  1OMV A;  2M3W A;  1A29 A;  1KSM A;  4JKT A;  2ZRS A;  1HQV A;  4PHJ A;  1EJ3 A;  1ZUZ A;  2HQW A;  1TUJ A;  3V2L A;  1TUZ A;  2KAV A;  2O5G A;  2ZN8 A;  4DCK A;  2PAS A;  4GGF A;  4N1F A;  2H8V A;  2PMY A;  4A4B A;  1NCY A;  3KEV A; 
#chains in the Genus database with same CATH homology
 1QAT A;  5AER A;  3BYA A;  2I2R E;  2CCM A;  5JOL A;  2DOQ A;  1OOJ A;  1CFF A;  1SCM C;  5D69 A;  1CB1 A;  3KO0 A;  4P5O E;  1E8A A;  3OX6 A;  1TRF A;  1MHO A;  2K7B A;  4CPV A;  5HKZ A;  1K95 A;  1DGV A;  4PE7 A;  1UHK A;  2GGZ A;  2K7D A;  1LA0 A;  3O2P A;  1IH0 A;  1EXR A;  2K2A A;  4MRX A;  1TNP A;  4CLN A;  2CNP A;  1TCO B;  1CM1 A;  1GQM A;  1YR5 A;  2M0R A;  1H4B A;  1AHR A;  2LUX A;  2LVK A;  3KHE A;  1FBV A;  2ZKM X;  1B4C A;  3GK2 A;  4ICB A;  1OMD A;  2BCB A;  2G2B A;  1F71 A;  1JFK A;  2L2E A;  1RJV A;  1R2U A;  1NPQ A;  2L4I A;  4E68 A;  3VRO A;  1NCX A;  1SCM B;  1EL4 A;  1TCF A;  4QJ5 B;  2R2I A;  1YRT B;  1YUS A;  5I2L A;  2JNX A;  5TNC A;  1BG1 A;  1MWN A;  1PRW A;  3KPX A;  2BKI B;  4CFR A;  1KFX L;  1CFD A;  1KWO C;  1QIW A;  2KAX A;  4HRH A;  3TDZ A;  4GFT A;  3BXK A;  2EC6 B;  2JXL A;  4PCW A;  1B7T Z;  1QJT A;  2PSR A;  4P2Y B;  1PK0 D;  1XFX O;  3DVK A;  4MN0 A;  1GGZ A;  4A4C A;  3D0Y A;  1RFJ A;  1EG4 A;  2KSP A;  1QAS A;  1NX3 A;  2LVV A;  4ZCV A;  4QJ3 B;  2QAC A;  1OE9 B;  4ORC B;  1J1E A;  2F2O A;  1ZAC A;  1XO5 A;  4YI9 A;  4GPL B;  1MQ1 A;  4BY4 A;  3BOW B;  1M63 B;  4MBE A;  1QX7 A;  1CDM A;  5JJG A;  1SBJ A;  1B1G A;  3CR2 A;  3EKH A;  1FI5 A;  1BMO A;  1REC A;  1KK8 B;  1K90 D;  1H8B A;  1WRZ A;  4GBA A;  3LK0 A;  1BU3 A;  5DKQ A;  3IQO A;  2JXC A;  3I5I B;  2WCF A;  2LVI A;  4ETO A;  1BLQ A;  4Q04 A;  1NP8 A;  3FS7 A;  2O60 A;  2CT9 A;  1DVI A;  3GK1 A;  1B7T Y;  1SR6 B;  2BKH B;  3TS5 B;  2SCP A;  2K7C A;  2KFG A;  1BR1 B;  3PSR A;  1KCY A;  2LMV A;  3EVR A;  2JT3 A;  2KQY A;  4TNC A;  1EG3 A;  2LNK A;  1TIZ A;  2K0J A;  1A75 A;  3LCP C;  4I5L B;  1SL8 A;  2D8N A;  2I94 A;  1UP5 A;  2WND A;  3DVM A;  4XJK A;  1JC2 A;  5CSF A;  4PE0 A;  5AXI A;  1OZO A;  2PVB A;  2A4J A;  1M39 A;  2PAL A;  2LMU A;  1DJH A;  1AP4 A;  1CDN A;  2MJW B;  2M7L A;  1YRU B;  2LE9 B;  1SL9 A;  2JRF A;  1G8I A;  3I5I C;  3HX4 A;  4C0L A;  4JQ0 D;  1F4O A;  1KFU S;  1L2O B;  2MBX A;  4DRW A;  1KQM B;  3VRN A;  2KOT A;  5AAN A;  2KNE A;  5HLV A;  1QX5 B;  4MZL A;  2KAY A;  3VRR A;  3AAK A;  2ZFD A;  1IGV A;  3F45 A;  5AEQ A;  4MRY A;  1S5G Z;  1YUR A;  4U8D A;  1D1O A;  3E3R A;  1FI6 A;  4AOM A;  5F6T A;  1TN4 A;  2L5X B;  1J7R A;  1Q80 A;  1A4P A;  2P6B B;  4CFQ A;  2NCO A;  3PLF B;  1XFU O;  1JBA A;  1XFY O;  1QLS A;  1IKU A;  2KGB C;  1NWD A;  1A75 B;  3BUX B;  1S26 D;  1Y6W A;  1WRL A;  1CDP A;  2SAS A;  2AUC A;  2NLN A;  4YGE B;  1LXF C;  1DJG A;  2KYF A;  1QIV A;  3NSI A;  3NSK A;  1M31 A;  2BL0 C;  1M46 A;  2MLF C;  1WDC B;  2F3Y A;  2OTG C;  1JUO A;  2KFH A;  4PHN A;  3TZ1 A;  2JOJ A;  2OPO A;  5HKW A;  1MUX A;  2LAP A;  4AQJ A;  2KI4 B;  1TOP A;  1DJI A;  1S36 A;  1SKT A;  2LLT A;  2LMT A;  1IG5 A;  3AKA A;  3CWG A;  4HRG A;  1MXE A;  2K61 A;  2Y1M A;  1J55 A;  3EKJ A;  3BUN B;  1KFX S;  2LP2 A;  2LM5 A;  2KHN A;  1C7V A;  2L51 A;  4PHK A;  2LUC A;  3I5H B;  1UUR A;  1XFV O;  2BEC A;  3DF0 B;  3I5F B;  1XVJ A;  1SW8 A;  1B8C A;  5CSN A;  1FPW A;  1V1F A;  5G08 A;  1JF2 A;  1GJY A;  2AAO A;  4I5K A;  2KYC A;  1IQ3 A;  1LKJ A;  2HF5 A;  1NCZ A;  3CLN A;  1R6P A;  3KF9 A;  3WHU B;  4D1E A;  5I2O A;  1DF0 A;  1PVB A;  1WY9 A;  3TDU A;  1QVI Z;  3CR4 X;  2JT0 A;  4M2Q A;  5HKY A;  1MR8 A;  2FOT A;  2F33 A;  2CTN A;  2KI6 D;  2ISD A;  1IWQ A;  1V1G A;  4WQ2 A;  3DVJ A;  5FYX A;  2QPT A;  3BUM B;  1J7O A;  3K21 A;  4MZJ A;  1UHJ A;  1QTX A;  1Y1X A;  3WHT B;  1U5I A;  1CLB A;  1CTR A;  4MLW A;  1J7Q A;  4ORA B;  4XJK B;  2EC6 C;  2K2F A;  3SIB A;  4GUK A;  2KFF A;  4NQG A;  1BT6 A;  2MAZ A;  1SYM A;  1B8L A;  2KBI A;  2F8P A;  2MHH A;  3D0Y B;  3JTD B;  4I5N B;  4NDC A;  3VRQ A;  3OX5 A;  5B8I B;  2M29 A;  1AVS A;  1TNW A;  2JTZ A;  2L4H A;  3GK4 X;  4GGF C;  4L9M A;  3RM1 A;  3SJS A;  1F55 A;  1DMO A;  2OS8 C;  3BQ3 A;  1W7J B;  3BUO B;  3NSL A;  2L98 A;  3PFV A;  4HSZ A;  4M2P A;  2K7O A;  1CMG A;  1CFP A;  2WOS A;  2BBN A;  2WOR A;  4OVN F;  3PN7 C;  2AMI A;  3CZT X;  3SIA A;  1N2D A;  5DKR A;  3TS5 C;  1K9K A;  1KK8 C;  4N5X A;  3RLZ A;  1CMF A;  3SG2 A;  3AAJ A;  3DF0 A;  1TNQ A;  2Y1N A;  4YRU A;  2E6W A;  2M97 A;  1C7W A;  1NSH A;  2NCP A;  1RK9 A;  1F54 A;  4AQI A;  1KQV A;  3EK7 A;  3FIA A;  3TUY C;  1KK7 Z;  4MVF A;  5KU1 A;  1WLZ A;  1HT9 A;  1QV0 A;  3JTD C;  2NXQ A;  4GNK B;  5J3X A;  3QRX A;  2CXJ A;  4NDD A;  4GGN A;  2EHB A;  2KDH A;  2LC5 A;  2CBL A;  5AFP A;  1NYA A;  3EVU A;  1S1E A;  3A4U B;  4FQO A;  1LVC D;  1SL7 A;  2M1U A;  3C1V A;  2JZI A;  3I5G C;  5HYD A;  1A2X A;  4C0J A;  2I7A A;  2LP3 A;  1NX2 A;  1XYD A;  4YGB B;  5KSZ A;  1JWD A;  4PDZ A;  1KSO A;  1RRO A;  2BCA A;  2KQ6 A;  2VRG A;  1C07 A;  4QJ4 B;  3EK8 A;  1AJ5 A;  1KK7 Y;  5HLO A;  4MEW A;  1BJF A;  3IQQ A;  1IJ6 A;  1Y0V H;  2WCE A;  2JQ6 A;  1Y1A A;  2MRD A;  3D10 A;  3M0W A;  1FW4 A;  3CS1 A;  3TUY B;  1TNX A;  4PAL A;  2FJU B;  4DIR A;  1J1D A;  5CSJ A;  3LLE A;  1UHN A;  4GAO A;  3SG7 A;  4HRE E;  2E30 A;  4F0Z B;  4MZK A;  2MA2 A;  1U5I B;  1OSA A;  3H4S E;  2JWW A;  3FWB A;  1L7Z A;  4ORB B;  2LAN A;  2BE6 A;  2LLU A;  1RTP 1;  1SRA A;  1S6J A;  1PVA A;  4USL A;  1J7P A;  1Y1U A;  1YUU A;  1JF0 A;  1F70 A;  2OTG B;  2ZN9 A;  1DJW A;  1YX7 A;  1QS7 A;  2TN4 A;  1B9A A;  2H61 C;  4FTG A;  1XK4 A;  1SNL A;  1XFZ O;  3EVV A;  3JVT C;  4WQ3 A;  4C0K A;  1ODB A;  1PUL A;  2FCD A;  1SR6 C;  4N1G A;  4YGC B;  3VGO A;  4YBH B;  1S5G Y;  3SG3 A;  1PSB A;  1M45 A;  2G9B A;  2KI4 C;  1KFU L;  5CSI A;  3BUW B;  1BR4 B;  2V53 A;  1G4Y R;  1QLK A;  1DJX A;  1XFW O;  1DGU A;  3I5H C;  2BCX A;  2LCP A;  1S6I A;  3SG4 A;  1K2H A;  1F8H A;  2B1U A;  2LVJ A;  3GOF A;  1SY9 A;  2KGR A;  1NX1 A;  1K93 D;  1SCV A;  3O78 A;  5PAL A;  4MSP A;  1SK6 D;  3O4Y A;  4YGA A;  1DT7 B;  2F3Z A;  2RGI A;  1PAL A;  2COL B;  1UHI A;  1UUS A;  4PE4 A;  2H2K A;  3PM8 A;  5ER5 A;  3DVE A;  3HCM A;  4NDB A;  1OZS A;  3OB1 B;  3LL8 B;  4JWQ A;  4IL1 A;  4CID A;  2HQ8 A;  1CKK A;  3OP0 A;  1CM4 A;  2MLE C;  2LV7 A;  3BOW A;  1YX8 A;  5DKN A;  1GGW A;  5K89 A;  1QXP A;  4ZCU A;  2Y4Q A;  2ZNE A;  1S6C A;  1OQP A;  3O6B A;  1ALV A;  2BE4 A;  3NSO A;  5GQQ C;  3A8R A;  1K96 A;  2K8M B;  2KBM A;  2L50 A;  1QV1 A;  1AK8 A;  2LHI A;  1VRK A;  2IS9 A;  3EK4 A;  1SMG A;  4PHM A;  1X02 A;  1IJ5 A;  1ZFS A;  2GGM A;  1KWO B;  2FCE A;  2Y5I A;  1LIN A;  2Q4U A;  4UPG A;  3ZWH A;  1LA3 A;  1EH2 A;  1DF0 B;  2PRU A;  1K9U A;  3VRP A;  3WXA A;  2LLS A;  1B47 A;  1W7I B;  4XYN A;  4R1E A;  1DJZ A;  1K8U A;  1AUI B;  2Q91 A;  2M7N A;  4BY5 A;  5I2Q A;  5KTY A;  1NX0 A;  3PAT A;  3ZNI A;  1YUT A;  2M1K B;  1XK4 C;  3CR5 X;  4DS7 A;  3LK1 A;  3DD4 A;  1F4Q A;  1TTX A;  2M49 B;  1A03 A;  2WCB A;  5IBW A;  1N0Y A;  1YVH A;  2JNF A;  1PSR A;  1WLM A;  1ZMZ A;  4OCI A;  5ER4 X;  3I5G B;  1DTL A;  4OV2 A;  2I18 A;  2JTT A;  3CGA A;  2L0P A;  1AJ4 A;  1CDL A;  4JPZ B;  2GV5 A;  2HET A;  2EGD A;  4PE1 A;  1CNP A;  1MF8 B;  5D7F A;  1IQ5 A;  2JT8 A;  1NUB A;  1XA5 A;  1K9P A;  2WC8 A;  1ALW A;  2JU0 A;  1UHH A;  2BL0 B;  3IF7 A;  2KI6 C;  1WDC C;  1SPY A;  3NXA A;  4I5J A;  2JC2 A;  3AKB A;  1FF1 A;  3FWC A;  1S3P A;  1DJY A;  1IRJ A;  1ZOT B;  2F2P A;  3PAL A;  2LHL A;  5I8N A;  3SG5 A;  2ZRT A;  3TDI A;  1JFJ A;  1YVL A;  4M2O A;  2JPT A;  1MXL C;  1CFC A;  4YGD B;  3I5F C;  4DUQ A;  1WRK A;  1BOD A;  1QVI Y;  1K94 A;  2OS8 B;  1JSA A;  3OB2 B;  1NIW A;  4OR9 B;  1YTZ C;  4WRI A;  2M9G A;  1L2O C;  1G33 A;  3JVT B;  3OHM B;  2M8U A;  1KQM C;  2NZ0 A;  1RWY A;  3CTN A;  3PN7 B;  1OMR A;  1CLL A;  3WNX B;  2HPS A;  1QX2 A;  2JUL A;  5CPV A;  3SG6 A;  1BF5 A;  1UWO A;  1BOC A;  4OKH A;  2H61 A;  4YI8 A;  5BPJ A;  1CLM A;  1N65 A;  2ZND A;  2BBM A;  1B8R A;  3ICB A;  3MSE B;  1OMV A;  2M3W A;  1A29 A;  1KSM A;  2ZRS A;  1HQV A;  4PHJ A;  1EJ3 A;  1ZUZ A;  2HQW A;  2KAV A;  2O5G A;  2ZN8 A;  4DCK A;  2PAS A;  4GGF A;  4N1F A;  2PMY A;  4A4B A;  1NCY A;  3KEV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...