2JXLA

Solution structure of cardiac n-domain troponin c mutant f77w-v82a
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
89
structure length
89
Chain Sequence
b'MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEWLVMMARCMKDDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Troponin C, slow skeletal and cardiac muscles
publication title Tryptophan Mutants of Cardiac Troponin C: 3D Structure, Troponin I Affinity, and in Situ Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 20
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2007-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jxlA00
1KFXS 5JJGA 4PHJA 3E3RA 1CNPA 3SIBA 4N5XA 2PMYA 2MAZA 1LA3A 1OMDA 1X02A 2ZNEA 2LE9B 1TIZA 4HRGA 2JT0A 1DF0B 2M3WA 1EG3A 2K2AA 1KK7Y 1J7RA 2JOJA 1IH0A 1TOPA 1QJTA 3KPXA 1BG1A 2HPSA 1EH2A 4MVFA 1FI6A 1DJYA 2BL0C 2Y5IA 4I5KA 3EK8A 4N1GA 1IQ3A 1WRKA 2M8UA 1M46A 1OE9B 1PSRA 1K94A 1ALWA 5FYXA 4YGAA 4WQ2A 2MHHA 2WCFA 2OTGC 1QX7A 2KSPA 1A75B 1AJ4A 4L9MA 1IJ5A 2SASA 1BJFA 3WNXB 2FCDA 3CR5X 1YUSA 1EXRA 4QJ4B 2M7NA 2KHNA 4PDZA 4CIDA 2V53A 4GGFC 1KWOC 1MQ1A 2PASA 4FTGA 1DJWA 1WLZA 2KAYA 3VRQA 3DF0A 2OTGB 3BXKA 2LVKA 3FWBA 2F3YA 2M7LA 1CM4A 1RECA 1U5IB 3DVMA 3KF9A 5TNCA 3RLZA 3SG3A 1H4BA 1L7ZA 4ICBA 2OS8C 1KQVA 2MA2A 2KGBC 1B8LA 1UP5A 4BY5A 2WORA 1AHRA 1GGWA 3TUYC 1V1GA 1QASA 1NCYA 3NSKA 3LLEA 1KWOB 4MN0A 1J1DA 5DKQA 4USLA 3PLFB 2Q4UA 4MZLA 1QV0A 1F70A 2NZ0A 3CR4X 5I2QA 4YGCB 4C0JA 1KK7Z 3D0YB 3C1VA 4HRHA 4DUQA 1RJVA 2OS8B 1M39A 1OOJA 1ALVA 1XA5A 1AK8A 2KBIA 3BUXB 1J7OA 5CSIA 3PSRA 3TUYB 1BU3A 2KQ6A 1YTZC 1PULA 2BE6A 1S26D 1CFCA 1NSHA 2JT8A 2LUCA 1BF5A 1KSMA 1QIWA 1XFUO 4JWQA 2KI6C 4NDDA 4P5OE 1K9KA 1DVIA 1LVCD 1MUXA 3BOWA 4I5LB 1MHOA 1IGVA 1YUUA 2FJUB 1NUBA 2HF5A 1XVJA 3KEVA 1RWYA 2H61C 2OPOA 2LANA 1PRWA 4BY4A 1DJIA 3FIAA 1JBAA 2KAVA 5AERA 2JTTA 2LP2A 1K95A 4PHNA 4GAOA 4CPVA 4PCWA 1PVBA 5F6TA 3O78A 4PHKA 2KI4C 4GGNA 4PALA 1B8RA 1BR4B 2MJWB 3ICBA 4YGBB 1CDPA 1J7PA 5ER4X 1Q80A 3CS1A 4GBAA 1OQPA 1ZOTB 1EG4A 1XFYO 3EKHA 1RROA 4JQ0D 1YURA 5AXIA 1SL8A 3TDIA 3BOWB 2KYCA 1KFUL 4M2PA 1SK6D 3EVRA 1QATA 1CMFA 1NIWA 4A4CA 2LLSA 1NWDA 2COLB 3TZ1A 3ZNIA 1YUTA 3GK1A 2KFGA 4MLWA 1QTXA 2G9BA 3M0WA 4GPLB 4YRUA 2M1UA 2L51A 5AANA 1QX2A 3TDZA 1CLMA 2MLFC 4D1EA 4MZJA 5PALA 2D8NA 4N1FA 2JXCA 1BMOA 1SYMA 2WCBA 3CWGA 1B47A 2LNKA 2E6WA 1SCMC 1TRFA 1DT7B 1RTP1 4ORBB 1LINA 1M45A 3SG7A 3BQ3A 3IF7A 1SL9A 2QACA 3CTNA 2AMIA 2CCMA 5HKZA 5BPJA 2NCPA 1IJ6A 2LVIA 2BCBA 4WRIA 5B8IB 1A4PA 1KFXL 1UUSA 3SG5A 4OCIA 1NX3A 1NP8A 1SCMB 5I8NA 2JRFA 2R2IA 1CFFA 2PVBA 3PN7C 4PE1A 3EK4A 3GOFA 2JXLA 1QLSA 5HLOA 1YRUB 2KOTA 1S1EA 1RK9A 3F45A 1GJYA 1AVSA 1CLBA 3TDUA 3A4UB 4MSPA 1SKTA 4MBEA 2BL0B 1M63B 4PE7A 1DJGA 1N2DA 4DCKA 2EC6C 2WOSA 1SY9A 2KDHA 1XFZO 4QJ5B 1FBVA 2F3ZA 3WHTB 4YBHB 2BBMA 1Y1XA 2KFHA 3SIAA 3A8RA 2MRDA 3I5FC 1KQMC 4QJ3B 2EC6B 2ZN8A 3I5HC 3MSEB 1D1OA 1CDNA 2K2FA 1QLKA 5D7FA 4PE4A 3BYAA 2MLEC 2GV5A 2LVVA 4MEWA 2L4IA 2K7CA 1DJZA 1CFDA 1QXPA 2JPTA 3QRXA 3ZWHA 2JTZA 1S3PA 1Y1UA 3EVVA 1C7WA 2M29A 3I5FB 3BUNB 3CGAA 4OV2A 4ETOA 3DF0B 1JFKA 1KQMB 4ORAB 3I5HB 4F0ZB 1KSOA 2LM5A 1OMRA 3JTDC 5CPVA 4OKHA 3DVJA 1AP4A 1SNLA 2K7BA 1ZMZA 3DVEA 5HKYA 1PSBA 2MBXA 1SPYA 1BLQA 3SG4A 4YI8A 2ISDA 2L2EA 1CLLA 4OVNF 1MF8B 1QVIY 1CB1A 3JTDB 2I2RE 3PM8A 1SCVA 3VROA 2PSRA 2CBLA 3PFVA 3SJSA 2L0PA 2WNDA 2CNPA 2KGRA 3AKBA 1CDLA 1KK8C 1DJHA 1F4QA 2LLTA 1K8UA 2NCOA 5KSZA 3PALA 1ZFSA 1PK0D 2K8MB 1R6PA 1TCOB 1S6JA 1YVLA 5D69A 5J3XA 5KTYA 2LAPA 5AEQA 4XJKA 4IL1A 1TNWA 1LKJA 3LK0A 1Y6WA 3AAKA 1UWOA 4YGEB 2QPTA 4CFRA 2LHIA 2O60A 3BUOB 2RGIA 4FQOA 1A03A 1QIVA 1OZSA 4C0KA 2KI4B 1FI5A 3IQQA 2L50A 1CKKA 4M2OA 1TN4A 3LCPC 2JZIA 2A4JA 1MXEA 1EL4A 2B1UA 4YGDB 4GUKA 5GQQC 2WCEA 1NCXA 2F2OA 2LV7A 3EKJA 4NDBA 1HQVA 1BOCA 4OR9B 3HX4A 2JWWA 4DS7A 4M2QA 2K61A 1J1EA 1G8IA 1UHKA 1SBJA 1TNXA 4TNCA 3OX5A 1QX5B 1K9PA 1CMGA 1A2XA 2HQWA 1DGUA 3HCMA 4NQGA 1XYDA 1DJXA 2ZNDA 4HSZA 4MZKA 2I18A 3VRNA 1J55A 1C7VA 4ZCVA 2FOTA 3EK7A 1QVIZ 1K96A 1DF0A 3CLNA 5DKNA 4I5JA 1SR6C 5JOLA 4CFQA 1FW4A 1N0YA 1WDCC 1XFWO 4A4BA 4AQJA 1C07A 2JNFA 1IQ5A 3CZTX 2LUXA 1E8AA 2L5XB 1NCZA 3AKAA 2LLUA 5IBWA 2CXJA 1B8CA 2KI6D 2K0JA 1WRZA 4U8DA 1PALA 1J7QA 2BKIB 1ZUZA 1YX8A 1G4YR 1SR6B 5I2LA 4CLNA 1A75A 1WDCB 4Q04A 1GQMA 2PRUA 1Y1AA 1OZOA 2K7OA 3FWCA 1W7IB 3O6BA 2Y4QA 3PN7B 3WHUB 1AJ5A 4XYNA 4UPGA 1XFVO 1YVHA 1JF0A 1TTXA 2G2BA 3PATA 3GK2A 5I2OA 4PHMA 1U5IA 2F8PA 2KFFA 1F71A 3OB1B 1JFJA 1BT6A 1MXLC 2ZKMX 3BUMB 1M31A 1UHNA 2F2PA 5HKWA 2ZRSA 1IG5A 1HT9A 1OSAA 2GGZA 4YI9A 1UHHA 3TS5C 1XK4A 1B9AA 1FF1A 4GGFA 4AQIA 2JC2A 4I5NB 4MRXA 2LMVA 2M49B 1XFXO 2JNXA 3O4YA 3D0YA 3JVTC 1XK4C 3KO0A 1L2OC 1NX2A 1CTRA 2Q91A 1JWDA 2L4HA 2ZN9A 1JC2A 2JQ6A 2L98A 2LC5A 2NLNA 3TS5B 2DOQA 2SCPA 1UHIA 1K93D 2LCPA 1JSAA 2WC8A 3DD4A 3VGOA 1WLMA 1TNPA 2JULA 3NSOA 1NX0A 2M1KB 1B4CA 2M97A 2O5GA 2AUCA 1W7JB 3I5IC 4R1EA 2NXQA 3JVTB 1B7TY 1L2OB 2HETA 3FS7A 1ZACA 2EGDA 4GFTA 1K9UA 2CTNA 3OP0A 1BR1B 5AFPA 2VRGA 2F33A 1S6CA 1S5GY 2LMUA 2BE4A 2P6BB 1ODBA 3VRRA 5HYDA 3O2PA 2JT3A 1VRKA 1CDMA 2M9GA 2TN4A 5K89A 3I5IB 4C0LA 1IWQA 1F55A 1LA0A 3D10A 3AAJA 1S6IA 1K90D 4AOMA 2M0RA 3K21A 4E68A 1KCYA 1N65A 1F8HA 1YX7A 1SW8A 1SRAA 1IKUA 3OB2B 3WXAA 1JF2A 2H61A 5HLVA 2E30A 2BKHB 1S36A 2I94A 3EVUA 3H4SE 1BODA 4P2YB 1PVAA 1FPWA 1NPQA 3VRPA 1CM1A 1LXFC 2HQ8A 5DKRA 4WQ3A 1KK8B 1K2HA 1WY9A 2LHLA 1OMVA 2LVJA 2Y1NA 2K7DA 4NDCA 1QS7A 2KBMA 1NYAA 1Y0VH 3DVKA 1KFUS 1TCFA 4ORCB 3SG2A 2KQYA 2ZFDA 2GGMA 3BUWB 1UHJA 5CSFA 1SL7A 4DRWA 3OHMB 1DTLA 1UURA 1AUIB 2I7AA 2KYFA 3LK1A 4DIRA 1CFPA 2KAXA 3SG6A 1V1FA 1TNQA 3OX6A 3NSIA 1DMOA 1MWNA 5CSJA 1SMGA 2LP3A 1IRJA 1F54A 1MR8A 1B7TZ 3NSLA 4PE0A 3CR2A 1H8BA 5CSNA 4JPZB 1NX1A 3I5GC 4XJKB 2CT9A 3KHEA 2H2KA 3GK4X 5G08A 1S5GZ 1A29A 1QV1A 1G33A 2FCEA 2KNEA 2IS9A 1R2UA 1B1GA 2LMTA 4MRYA 1WRLA 4GNKB 2BCXA 2BECA 3IQOA 3NXAA 5ER5A 5KU1A 1RFJA 2PALA 2ZRTA 3LL8B 1F4OA 1XO5A 1JUOA 2EHBA 3I5GB 3RM1A 2Y1MA 2BCAA 1YR5A 1EJ3A 1GGZA 4ZCUA 2AAOA 4HREE 1DGVA 1YRTB 2JU0A 2BBNA
chains in the Genus database with same CATH superfamily
1KFXS 5JJGA 3UNWA 2JPOA 4PHJA 3E3RA 1CNPA 3SIBA 4N5XA 2PMYA 3R1VA 2MAZA 1LA3A 1OMDA 1X02A 2ZNEA 2LE9B 1TIZA 4HRGA 2JT0A 1DF0B 2M3WA 1EG3A 2K2AA 1KK7Y 1J7RA 2JOJA 1IH0A 1TOPA 1QJTA 3KPXA 1BG1A 2HPSA 1EH2A 3BJHA 4MVFA 1FI6A 1DJYA 2BL0C 5DICA 3CZ2A 2Y5IA 4I5KA 3EK8A 4N1GA 3OGNA 1IQ3A 1WRKA 2M8UA 1M46A 1OE9B 1PSRA 1K94A 1ALWA 5FYXA 4YGAA 4WQ2A 2MHHA 2WCFA 2OTGC 1QX7A 2KSPA 1A75B 1AJ4A 1GM0A 4L9MA 1IJ5A 2SASA 1BJFA 3WNXB 2FCDA 3CR5X 1YUSA 1EXRA 1IIOA 3B88A 4QJ4B 2M7NA 2KHNA 4PDZA 4CIDA 2V53A 4GGFC 1KWOC 1MQ1A 2PASA 4FTGA 1DJWA 1WLZA 2KAYA 3VRQA 3DF0A 2OTGB 3BXKA 2LVKA 3FWBA 2F3YA 2M7LA 1CM4A 1RECA 1U5IB 3DVMA 4INXA 3KF9A 5TNCA 3RLZA 3SG3A 1H4BA 1L7ZA 4ICBA 2OS8C 1KQVA 2MA2A 2KGBC 3O4XA 3S0DA 1B8LA 1UP5A 5EL2A 4BY5A 2WORA 1AHRA 1GGWA 3TUYC 1V1GA 1QASA 1NCYA 3NSKA 3LLEA 1KWOB 4MN0A 1J1DA 5DKQA 4USLA 3PLFB 2Q4UA 3FE8A 4MZLA 1ORGA 1QV0A 1F70A 2NZ0A 3CR4X 5I2QA 4YGCB 4C0JA 1KK7Z 3B86A 3D0YB 1OOFA 3C1VA 4HRHA 1RJVA 2OS8B 1M39A 1OOJA 4DUQA 1ALVA 1XA5A 5FI7A 2KBIA 3BUXB 1AK8A 1J7OA 5CSIA 3PSRA 3Q8IA 3TUYB 1BU3A 2KQ6A 5I94A 3CZ1A 1YTZC 1PULA 3R1PA 2BE6A 1S26D 1CFCA 1TWOA 1NSHA 2JT8A 2LUCA 1BF5A 1KSMA 1QIWA 1XFUO 2ERBA 2KI6C 2QDIA 4JWQA 4NDDA 3S0AA 4P5OE 1K9KA 1DVIA 1LVCD 1MUXA 3BOWA 3NHTA 4I5LB 1MHOA 1IGVA 1YUUA 2FJUB 1NUBA 2HF5A 1XVJA 2QEHA 3KEVA 1RWYA 1C3YA 2H61C 2OPOA 2LANA 3S0GA 1PRWA 4BY4A 1DJIA 3FIAA 1JBAA 2KAVA 4JD9A 5AERA 2JTTA 2LP2A 1K95A 4PHNA 4GAOA 1Z2CB 2WCJA 3CDNA 1PVBA 4PCWA 3O78A 4PHKA 2KI4C 4GGNA 1DQEA 4PALA 5F6TA 3VB1A 1B8RA 1BR4B 2MJWB 3ICBA 4YGBB 1CDPA 1J7PA 5ER4X 1Q80A 3CS1A 4GBAA 1OQPA 1ZOTB 2KPHA 1EG4A 1XFYO 3EKHA 1RROA 4JQ0D 1YURA 5AXIA 1SL8A 3TDIA 3BOWB 3DZTA 2KYCA 1KFUL 3DY9A 1SK6D 4M2PA 3EVRA 1QATA 1CMFA 1NIWA 2P70A 4A4CA 2LLSA 2P71A 3DXLA 1NWDA 2COLB 3TZ1A 2PYQA 3ZNIA 1YUTA 3GK1A 2KFGA 3L47A 1QTXA 2G9BA 3M0WA 4GPLB 4MLWA 2M1UA 2L51A 5AANA 1TUJA 4YRUA 5D3OA 1QX2A 3NHIA 1CLMA 3TDZA 2MLFC 4D1EA 4MZJA 5PALA 2D8NA 4N1FA 2JXCA 4JKTA 1BMOA 1SYMA 1Z4HA 2WCBA 3CWGA 1B47A 2LNKA 2E6WA 1SCMC 1TRFA 3CABA 3SS4A 1DT7B 1RTP1 4ORBB 1LINA 1M45A 3SG7A 3BQ3A 3IF7A 1SL9A 2QACA 3CTNA 1P28A 2AMIA 2CCMA 5HKZA 5BPJA 2NCPA 1IJ6A 2LVIA 2BCBA 4WRIA 5B8IB 1A4PA 1KFXL 1UUSA 3SG5A 4OCIA 1NX3A 2QEVA 1NP8A 1SCMB 5I8NA 2JRFA 2R2IA 1QWVA 1CFFA 2PVBA 3PN7C 1OW4A 4PE1A 4KYNA 3EK4A 3GOFA 2JXLA 1QLSA 5HLOA 1YRUB 3QMEA 2KOTA 1S1EA 3RZSA 1RK9A 3F45A 1GJYA 1AVSA 1CLBA 3TDUA 3A4UB 4MSPA 1LS8A 1SKTA 2QEOA 3D74A 2BL0B 4MBEA 1M63B 4PE7A 3D77A 1TUZA 1DJGA 2KLEA 3D73A 1N2DA 1XFRA 2EC6C 2WOSA 4DCKA 3PJIA 1SY9A 1C3ZA 2KDHA 1XFZO 4FQTA 4QJ5B 1FBVA 2F3ZA 3WHTB 4YBHB 2BBMA 1Y1XA 3IVTA 2KFHA 2K60A 3SIAA 1OOIX 3A8RA 2MRDA 3I5FC 1KQMC 1SSEB 4QJ3B 2EC6B 2ZN8A 3I5HC 3MSEB 2WC6A 2PQLA 1CDNA 2K2FA 1D1OA 1QLKA 5D7FA 2KLDA 4PE4A 3BYAA 2MLEC 2GV5A 4IJ7A 2LVVA 4MEWA 2L4IA 2K7CA 1DJZA 1CFDA 1QXPA 2JPTA 3QRXA 3ZWHA 2JTZA 1S3PA 1Y1UA 3EVVA 1C7WA 2M29A 2L2CA 3I5FB 3BUNB 3CGAA 4OV2A 4ETOA 3DF0B 4CPVA 1CFPA 1JFKA 1KQMB 4ORAB 3I5HB 4F0ZB 1KSOA 2LM5A 1OMRA 3JTDC 5CPVA 4OKHA 3SS5A 3DVJA 1AP4A 1SNLA 2K7BA 1ZMZA 3DVEA 5HKYA 1PSBA 5FI2A 1SPYA 2MBXA 1BLQA 3BFHA 3SG4A 4YI8A 2ISDA 3OBVA 2L2EA 1CLLA 4OVNF 4F7FA 2YGUA 1MF8B 1QVIY 2BBNA 3V2LA 1CB1A 3JTDB 2I2RE 3PM8A 1SCVA 3D75A 2WCHA 2PSRA 2CBLA 3L4LA 3PFVA 3SJSA 2L0PA 3VROA 2WNDA 2CNPA 3UO9A 2KGRA 3AKBA 1CDLA 1KK8C 1DJHA 1F4QA 2LLTA 1K8UA 2NCOA 4PT1A 3PALA 3NGVA 5KSZA 1ZFSA 1PK0D 2K8MB 1R6PA 2BAPA 1TCOB 5D69A 1YVLA 5J3XA 5KTYA 2LAPA 5AEQA 4XJKA 4IL1A 1TNWA 1LKJA 2FJYA 3CYZA 3LK0A 1Y6WA 3AAKA 1UWOA 4YGEB 2QPTA 4CFRA 2LHIA 2O60A 3BUOB 2RGIA 4FQOA 1DELA 2BNXA 1A03A 2H8VA 1QIVA 1OZSA 4C0KA 2KI4B 1FI5A 3IQQA 2L50A 1CKKA 4M2OA 1TN4A 3LCPC 2JZIA 2A4JA 1MXEA 1EL4A 2B1UA 4YGDB 4GUKA 5GQQC 2WCEA 3D76A 1NCXA 2F2OA 2LV7A 3EKJA 4NDBA 1HQVA 1BOCA 4OR9B 3HX4A 2JWWA 4DS7A 4M2QA 2K61A 1J1EA 1G8IA 1UHKA 1SBJA 1TNXA 4TNCA 3OX5A 1QX5B 1K9PA 1CMGA 1A2XA 2HQWA 1DGUA 2WCLA 3HCMA 4NQGA 1XYDA 1DJXA 2ZNDA 4HSZA 4MZKA 2I18A 3VRNA 1J55A 1C7VA 4ZCVA 2FOTA 3EK7A 1QVIZ 1K96A 1DF0A 3CLNA 5DKNA 4I5JA 1SR6C 5JOLA 4CFQA 1FW4A 1N0YA 1WDCC 1XFWO 4A4BA 4AQJA 1C07A 3D78A 3S0FA 2JNFA 1IQ5A 3CZTX 2LUXA 1E8AA 2L5XB 1NCZA 3AKAA 2LLUA 5IBWA 3BFAA 2CXJA 1B8CA 2KI6D 2K0JA 1WRZA 3DYEA 4U8DA 1PALA 1J7QA 3BFBA 2BKIB 1ZUZA 1YX8A 1G4YR 3R1OA 1SR6B 5I2LA 1OOGA 4CLNA 1A75A 1WDCB 4Q04A 1GQMA 2PRUA 1Y1AA 1OZOA 3FE9A 1DEKA 2K7OA 3FWCA 1W7IB 3O6BA 2Y4QA 3PN7B 3WHUB 1AJ5A 4XYNA 4UPGA 1XFVO 1YVHA 1JF0A 1TTXA 2G2BA 3PATA 3GK2A 5I2OA 4PHMA 1U5IA 2F8PA 2KFFA 1F71A 3OB1B 3B6XA 1JFJA 1BT6A 1MXLC 1OOHA 2ZKMX 3BUMB 1M31A 1UHNA 3CZ0A 3EG5B 2F2PA 5HKWA 2ZRSA 1IG5A 1HT9A 1OSAA 2GGZA 2WCMA 4YI9A 1UHHA 3TS5C 1XK4A 1B9AA 1FF1A 4GGFA 4AQIA 2JC2A 2WCKA 4I5NB 4MRXA 2LMVA 2M49B 2QEBA 1XFXO 2JNXA 3O4YA 3D0YA 3JVTC 1XK4C 3KO0A 5HL1A 1L2OC 1NX2A 1CTRA 2Q91A 1JWDA 2L4HA 2ZN9A 1JC2A 2JQ6A 2L98A 4OZDA 2LC5A 2NLNA 2WC5A 2DOQA 3TS5B 2SCPA 1UHIA 1K93D 2LCPA 1JSAA 2WC8A 3DD4A 3VGOA 1WLMA 1TNPA 2JULA 3NSOA 1NX0A 2M1KB 1B4CA 2M97A 2O5GA 2AUCA 3S0BA 1W7JB 3I5IC 4R1EA 2NXQA 3JVTB 1B7TY 1W9ZA 1L2OB 2HETA 3FS7A 1ZACA 2EGDA 4GFTA 1K9UA 2CTNA 2L5YA 1BR1B 3OP0A 5AFPA 2VRGA 2F33A 1S6CA 1S5GY 2LMUA 2BE4A 3SS3A 2P6BB 1ODBA 3VRRA 5HYDA 3O2PA 2JT3A 1VRKA 1CDMA 2M9GA 2TN4A 3FE6A 5K89A 3I5IB 4C0LA 1IWQA 3PM2A 1LA0A 3D10A 3AAJA 1F55A 1S6IA 1K90D 4AOMA 2M0RA 3K21A 4E68A 1KCYA 1N65A 1F8HA 1YX7A 1SW8A 1SRAA 1IKUA 3OB2B 3B87A 3WXAA 1JF2A 2H61A 5HLVA 2E30A 2BKHB 1S36A 2I94A 3EVUA 3H4SE 1BODA 4P2YB 1PVAA 1FPWA 1NPQA 3VRPA 1CM1A 1LXFC 2HQ8A 5DKRA 4WQ3A 1KK8B 5FI6A 1K2HA 1WY9A 2LHLA 1OMVA 2LVJA 2Y1NA 2K7DA 4NDCA 1QS7A 2KBMA 3B7AA 1NYAA 1Y0VH 3DVKA 1KFUS 1TCFA 3R72A 4ORCB 2KQYA 2ZFDA 2GGMA 3BUWB 3SG2A 1UHJA 3L4AA 5CSFA 1SL7A 4DRWA 3OHMB 1DTLA 1UURA 1AUIB 2I7AA 2KYFA 3K1EA 3LK1A 4DIRA 2KAXA 3SG6A 1V1FA 1TNQA 3OX6A 3NSIA 1DMOA 1MWNA 5CSJA 1SMGA 2LP3A 1IRJA 4INWA 1F54A 1MR8A 1B7TZ 3NSLA 4PE0A 3CR2A 1H8BA 3N7HA 1DC1A 5CSNA 4JPZB 1NX1A 3I5GC 4XJKB 2CT9A 3KHEA 2H2KA 3GK4X 2GTEA 5G08A 1S5GZ 1A29A 3S0EA 1QV1A 1G33A 2FCEA 2KNEA 2IS9A 1R2UA 1B1GA 2LMTA 4MRYA 1WRLA 4GNKB 2BCXA 2BECA 3IQOA 3NXAA 5ER5A 5KU1A 1RFJA 2PALA 2ZRTA 3LL8B 1F4OA 1XO5A 1JUOA 2EHBA 3I5GB 3RM1A 2Y1MA 2BCAA 1YR5A 1EJ3A 1GGZA 1T14A 4ZCUA 2AAOA 4HREE 1DGVA 1YRTB 2JU0A 1S6JA
chains in the Genus database with same CATH topology
1KFXS 5JJGA 4PHJA 3E3RA 1CNPA 3SIBA 4N5XA 2PMYA 2MAZA 1LA3A 1OMDA 1X02A 2ZNEA 2LE9B 1TIZA 4HRGA 2JT0A 1DF0B 2M3WA 1EG3A 2K2AA 1KK7Y 1J7RA 2JOJA 1IH0A 1TOPA 1QJTA 3KPXA 1BG1A 2HPSA 1EH2A 4MVFA 1FI6A 1DJYA 2BL0C 2Y5IA 4I5KA 3EK8A 4N1GA 1IQ3A 1WRKA 2M8UA 1M46A 1OE9B 1PSRA 1K94A 1ALWA 5FYXA 4YGAA 4WQ2A 2MHHA 2WCFA 2OTGC 1QX7A 2KSPA 1A75B 1AJ4A 4L9MA 1IJ5A 2SASA 1BJFA 3WNXB 2FCDA 3CR5X 1YUSA 1EXRA 4QJ4B 2M7NA 2KHNA 4PDZA 4CIDA 2V53A 4GGFC 1KWOC 1MQ1A 2PASA 4FTGA 1DJWA 1WLZA 2KAYA 3VRQA 3DF0A 2OTGB 3BXKA 2LVKA 3FWBA 2F3YA 2M7LA 1CM4A 1RECA 1U5IB 3DVMA 3KF9A 5TNCA 3RLZA 3SG3A 1H4BA 1L7ZA 4ICBA 2OS8C 1KQVA 2MA2A 2KGBC 1B8LA 1UP5A 4BY5A 2WORA 1AHRA 1GGWA 3TUYC 1V1GA 1QASA 1NCYA 3NSKA 3LLEA 1KWOB 4MN0A 1J1DA 5DKQA 4USLA 3PLFB 2Q4UA 4MZLA 1QV0A 1F70A 2NZ0A 3CR4X 5I2QA 4YGCB 4C0JA 1KK7Z 3D0YB 3C1VA 4HRHA 4DUQA 1RJVA 2OS8B 1M39A 1OOJA 1ALVA 1XA5A 1AK8A 2KBIA 3BUXB 1J7OA 5CSIA 3PSRA 3TUYB 1BU3A 2KQ6A 1YTZC 1PULA 2BE6A 1S26D 1CFCA 1NSHA 2JT8A 2LUCA 1BF5A 1KSMA 1QIWA 1XFUO 4JWQA 2KI6C 4NDDA 4P5OE 1K9KA 1DVIA 1LVCD 1MUXA 3BOWA 4I5LB 1MHOA 1IGVA 1YUUA 2FJUB 1NUBA 2HF5A 1XVJA 3KEVA 1RWYA 2H61C 2OPOA 2LANA 1PRWA 4BY4A 1DJIA 3FIAA 1JBAA 2KAVA 5AERA 2JTTA 2LP2A 1K95A 4PHNA 4GAOA 4CPVA 4PCWA 1PVBA 5F6TA 3O78A 4PHKA 2KI4C 4GGNA 4PALA 1B8RA 1BR4B 2MJWB 3ICBA 4YGBB 1CDPA 1J7PA 5ER4X 1Q80A 3CS1A 4GBAA 1OQPA 1ZOTB 1EG4A 1XFYO 3EKHA 1RROA 4JQ0D 1YURA 5AXIA 1SL8A 3TDIA 3BOWB 2KYCA 1KFUL 4M2PA 1SK6D 3EVRA 1QATA 1CMFA 1NIWA 4A4CA 2LLSA 1NWDA 2COLB 3TZ1A 3ZNIA 1YUTA 3GK1A 2KFGA 4MLWA 1QTXA 2G9BA 3M0WA 4GPLB 4YRUA 2M1UA 2L51A 5AANA 1QX2A 3TDZA 1CLMA 2MLFC 4D1EA 4MZJA 5PALA 2D8NA 4N1FA 2JXCA 1BMOA 1SYMA 2WCBA 3CWGA 1B47A 2LNKA 2E6WA 1SCMC 1TRFA 1DT7B 1RTP1 4ORBB 1LINA 1M45A 3SG7A 3BQ3A 3IF7A 1SL9A 2QACA 3CTNA 2AMIA 2CCMA 5HKZA 5BPJA 2NCPA 1IJ6A 2LVIA 2BCBA 4WRIA 5B8IB 1A4PA 1KFXL 1UUSA 3SG5A 4OCIA 1NX3A 1NP8A 1SCMB 5I8NA 2JRFA 2R2IA 1CFFA 2PVBA 3PN7C 4PE1A 3EK4A 3GOFA 2JXLA 1QLSA 5HLOA 1YRUB 2KOTA 1S1EA 1RK9A 3F45A 1GJYA 1AVSA 1CLBA 3TDUA 3A4UB 4MSPA 1SKTA 4MBEA 2BL0B 1M63B 4PE7A 1DJGA 1N2DA 4DCKA 2EC6C 2WOSA 1SY9A 2KDHA 1XFZO 4QJ5B 1FBVA 2F3ZA 3WHTB 4YBHB 2BBMA 1Y1XA 2KFHA 3SIAA 3A8RA 2MRDA 3I5FC 1KQMC 4QJ3B 2EC6B 2ZN8A 3I5HC 3MSEB 1D1OA 1CDNA 2K2FA 1QLKA 5D7FA 4PE4A 3BYAA 2MLEC 2GV5A 2LVVA 4MEWA 2L4IA 2K7CA 1DJZA 1CFDA 1QXPA 2JPTA 3QRXA 3ZWHA 2JTZA 1S3PA 1Y1UA 3EVVA 1C7WA 2M29A 3I5FB 3BUNB 3CGAA 4OV2A 4ETOA 3DF0B 1JFKA 1KQMB 4ORAB 3I5HB 4F0ZB 1KSOA 2LM5A 1OMRA 3JTDC 5CPVA 4OKHA 3DVJA 1AP4A 1SNLA 2K7BA 1ZMZA 3DVEA 5HKYA 1PSBA 2MBXA 1SPYA 1BLQA 3SG4A 4YI8A 2ISDA 2L2EA 1CLLA 4OVNF 1MF8B 1QVIY 1CB1A 3JTDB 2I2RE 3PM8A 1SCVA 3VROA 2PSRA 2CBLA 3PFVA 3SJSA 2L0PA 2WNDA 2CNPA 2KGRA 3AKBA 1CDLA 1KK8C 1DJHA 1F4QA 2LLTA 1K8UA 2NCOA 5KSZA 3PALA 1ZFSA 1PK0D 2K8MB 1R6PA 1TCOB 1S6JA 1YVLA 5D69A 5J3XA 5KTYA 2LAPA 5AEQA 4XJKA 4IL1A 1TNWA 1LKJA 3LK0A 1Y6WA 3AAKA 1UWOA 4YGEB 2QPTA 4CFRA 2LHIA 2O60A 3BUOB 2RGIA 4FQOA 1A03A 1QIVA 1OZSA 4C0KA 2KI4B 1FI5A 3IQQA 2L50A 1CKKA 4M2OA 1TN4A 3LCPC 2JZIA 2A4JA 1MXEA 1EL4A 2B1UA 4YGDB 4GUKA 5GQQC 2WCEA 1NCXA 2F2OA 2LV7A 3EKJA 4NDBA 1HQVA 1BOCA 4OR9B 3HX4A 2JWWA 4DS7A 4M2QA 2K61A 1J1EA 1G8IA 1UHKA 1SBJA 1TNXA 4TNCA 3OX5A 1QX5B 1K9PA 1CMGA 1A2XA 2HQWA 1DGUA 3HCMA 4NQGA 1XYDA 1DJXA 2ZNDA 4HSZA 4MZKA 2I18A 3VRNA 1J55A 1C7VA 4ZCVA 2FOTA 3EK7A 1QVIZ 1K96A 1DF0A 3CLNA 5DKNA 4I5JA 1SR6C 5JOLA 4CFQA 1FW4A 1N0YA 1WDCC 1XFWO 4A4BA 4AQJA 1C07A 2JNFA 1IQ5A 3CZTX 2LUXA 1E8AA 2L5XB 1NCZA 3AKAA 2LLUA 5IBWA 2CXJA 1B8CA 2KI6D 2K0JA 1WRZA 4U8DA 1PALA 1J7QA 2BKIB 1ZUZA 1YX8A 1G4YR 1SR6B 5I2LA 4CLNA 1A75A 1WDCB 4Q04A 1GQMA 2PRUA 1Y1AA 1OZOA 2K7OA 3FWCA 1W7IB 3O6BA 2Y4QA 3PN7B 3WHUB 1AJ5A 4XYNA 4UPGA 1XFVO 1YVHA 1JF0A 1TTXA 2G2BA 3PATA 3GK2A 5I2OA 4PHMA 1U5IA 2F8PA 2KFFA 1F71A 3OB1B 1JFJA 1BT6A 1MXLC 2ZKMX 3BUMB 1M31A 1UHNA 2F2PA 5HKWA 2ZRSA 1IG5A 1HT9A 1OSAA 2GGZA 4YI9A 1UHHA 3TS5C 1XK4A 1B9AA 1FF1A 4GGFA 4AQIA 2JC2A 4I5NB 4MRXA 2LMVA 2M49B 1XFXO 2JNXA 3O4YA 3D0YA 3JVTC 1XK4C 3KO0A 1L2OC 1NX2A 1CTRA 2Q91A 1JWDA 2L4HA 2ZN9A 1JC2A 2JQ6A 2L98A 2LC5A 2NLNA 3TS5B 2DOQA 2SCPA 1UHIA 1K93D 2LCPA 1JSAA 2WC8A 3DD4A 3VGOA 1WLMA 1TNPA 2JULA 3NSOA 1NX0A 2M1KB 1B4CA 2M97A 2O5GA 2AUCA 1W7JB 3I5IC 4R1EA 2NXQA 3JVTB 1B7TY 1L2OB 2HETA 3FS7A 1ZACA 2EGDA 4GFTA 1K9UA 2CTNA 3OP0A 1BR1B 5AFPA 2VRGA 2F33A 1S6CA 1S5GY 2LMUA 2BE4A 2P6BB 1ODBA 3VRRA 5HYDA 3O2PA 2JT3A 1VRKA 1CDMA 2M9GA 2TN4A 5K89A 3I5IB 4C0LA 1IWQA 1F55A 1LA0A 3D10A 3AAJA 1S6IA 1K90D 4AOMA 2M0RA 3K21A 4E68A 1KCYA 1N65A 1F8HA 1YX7A 1SW8A 1SRAA 1IKUA 3OB2B 3WXAA 1JF2A 2H61A 5HLVA 2E30A 2BKHB 1S36A 2I94A 3EVUA 3H4SE 1BODA 4P2YB 1PVAA 1FPWA 1NPQA 3VRPA 1CM1A 1LXFC 2HQ8A 5DKRA 4WQ3A 1KK8B 1K2HA 1WY9A 2LHLA 1OMVA 2LVJA 2Y1NA 2K7DA 4NDCA 1QS7A 2KBMA 1NYAA 1Y0VH 3DVKA 1KFUS 1TCFA 4ORCB 3SG2A 2KQYA 2ZFDA 2GGMA 3BUWB 1UHJA 5CSFA 1SL7A 4DRWA 3OHMB 1DTLA 1UURA 1AUIB 2I7AA 2KYFA 3LK1A 4DIRA 1CFPA 2KAXA 3SG6A 1V1FA 1TNQA 3OX6A 3NSIA 1DMOA 1MWNA 5CSJA 1SMGA 2LP3A 1IRJA 1F54A 1MR8A 1B7TZ 3NSLA 4PE0A 3CR2A 1H8BA 5CSNA 4JPZB 1NX1A 3I5GC 4XJKB 2CT9A 3KHEA 2H2KA 3GK4X 5G08A 1S5GZ 1A29A 1QV1A 1G33A 2FCEA 2KNEA 2IS9A 1R2UA 1B1GA 2LMTA 4MRYA 1WRLA 4GNKB 2BCXA 2BECA 3IQOA 3NXAA 5ER5A 5KU1A 1RFJA 2PALA 2ZRTA 3LL8B 1F4OA 1XO5A 1JUOA 2EHBA 3I5GB 3RM1A 2Y1MA 2BCAA 1YR5A 1EJ3A 1GGZA 4ZCUA 2AAOA 4HREE 1DGVA 1YRTB 2JU0A 2BBNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KFX S;  5JJG A;  4PHJ A;  3E3R A;  1CNP A;  3SIB A;  4N5X A;  2PMY A;  2MAZ A;  1LA3 A;  1OMD A;  1X02 A;  2ZNE A;  2LE9 B;  1TIZ A;  4HRG A;  2JT0 A;  1DF0 B;  2M3W A;  1EG3 A;  2K2A A;  1KK7 Y;  1J7R A;  2JOJ A;  1IH0 A;  1TOP A;  1QJT A;  3KPX A;  1BG1 A;  2HPS A;  1EH2 A;  4MVF A;  1FI6 A;  1DJY A;  2BL0 C;  2Y5I A;  4I5K A;  3EK8 A;  4N1G A;  1IQ3 A;  1WRK A;  2M8U A;  1M46 A;  1OE9 B;  1PSR A;  1K94 A;  1ALW A;  5FYX A;  4YGA A;  4WQ2 A;  2MHH A;  2WCF A;  2OTG C;  1QX7 A;  2KSP A;  1A75 B;  1AJ4 A;  4L9M A;  1IJ5 A;  2SAS A;  1BJF A;  3WNX B;  2FCD A;  3CR5 X;  1YUS A;  1EXR A;  4QJ4 B;  2M7N A;  2KHN A;  4PDZ A;  4CID A;  2V53 A;  4GGF C;  1KWO C;  1MQ1 A;  2PAS A;  4FTG A;  1DJW A;  1WLZ A;  2KAY A;  3VRQ A;  3DF0 A;  2OTG B;  3BXK A;  2LVK A;  3FWB A;  2F3Y A;  2M7L A;  1CM4 A;  1REC A;  1U5I B;  3DVM A;  3KF9 A;  5TNC A;  3RLZ A;  3SG3 A;  1H4B A;  1L7Z A;  4ICB A;  2OS8 C;  1KQV A;  2MA2 A;  2KGB C;  1B8L A;  1UP5 A;  4BY5 A;  2WOR A;  1AHR A;  1GGW A;  3TUY C;  1V1G A;  1QAS A;  1NCY A;  3NSK A;  3LLE A;  1KWO B;  4MN0 A;  1J1D A;  5DKQ A;  4USL A;  3PLF B;  2Q4U A;  4MZL A;  1QV0 A;  1F70 A;  2NZ0 A;  3CR4 X;  5I2Q A;  4YGC B;  4C0J A;  1KK7 Z;  3D0Y B;  3C1V A;  4HRH A;  4DUQ A;  1RJV A;  2OS8 B;  1M39 A;  1OOJ A;  1ALV A;  1XA5 A;  1AK8 A;  2KBI A;  3BUX B;  1J7O A;  5CSI A;  3PSR A;  3TUY B;  1BU3 A;  2KQ6 A;  1YTZ C;  1PUL A;  2BE6 A;  1S26 D;  1CFC A;  1NSH A;  2JT8 A;  2LUC A;  1BF5 A;  1KSM A;  1QIW A;  1XFU O;  4JWQ A;  2KI6 C;  4NDD A;  4P5O E;  1K9K A;  1DVI A;  1LVC D;  1MUX A;  3BOW A;  4I5L B;  1MHO A;  1IGV A;  1YUU A;  2FJU B;  1NUB A;  2HF5 A;  1XVJ A;  3KEV A;  1RWY A;  2H61 C;  2OPO A;  2LAN A;  1PRW A;  4BY4 A;  1DJI A;  3FIA A;  1JBA A;  2KAV A;  5AER A;  2JTT A;  2LP2 A;  1K95 A;  4PHN A;  4GAO A;  4CPV A;  4PCW A;  1PVB A;  5F6T A;  3O78 A;  4PHK A;  2KI4 C;  4GGN A;  4PAL A;  1B8R A;  1BR4 B;  2MJW B;  3ICB A;  4YGB B;  1CDP A;  1J7P A;  5ER4 X;  1Q80 A;  3CS1 A;  4GBA A;  1OQP A;  1ZOT B;  1EG4 A;  1XFY O;  3EKH A;  1RRO A;  4JQ0 D;  1YUR A;  5AXI A;  1SL8 A;  3TDI A;  3BOW B;  2KYC A;  1KFU L;  4M2P A;  1SK6 D;  3EVR A;  1QAT A;  1CMF A;  1NIW A;  4A4C A;  2LLS A;  1NWD A;  2COL B;  3TZ1 A;  3ZNI A;  1YUT A;  3GK1 A;  2KFG A;  4MLW A;  1QTX A;  2G9B A;  3M0W A;  4GPL B;  4YRU A;  2M1U A;  2L51 A;  5AAN A;  1QX2 A;  3TDZ A;  1CLM A;  2MLF C;  4D1E A;  4MZJ A;  5PAL A;  2D8N A;  4N1F A;  2JXC A;  1BMO A;  1SYM A;  2WCB A;  3CWG A;  1B47 A;  2LNK A;  2E6W A;  1SCM C;  1TRF A;  1DT7 B;  1RTP 1;  4ORB B;  1LIN A;  1M45 A;  3SG7 A;  3BQ3 A;  3IF7 A;  1SL9 A;  2QAC A;  3CTN A;  2AMI A;  2CCM A;  5HKZ A;  5BPJ A;  2NCP A;  1IJ6 A;  2LVI A;  2BCB A;  4WRI A;  5B8I B;  1A4P A;  1KFX L;  1UUS A;  3SG5 A;  4OCI A;  1NX3 A;  1NP8 A;  1SCM B;  5I8N A;  2JRF A;  2R2I A;  1CFF A;  2PVB A;  3PN7 C;  4PE1 A;  3EK4 A;  3GOF A;  2JXL A;  1QLS A;  5HLO A;  1YRU B;  2KOT A;  1S1E A;  1RK9 A;  3F45 A;  1GJY A;  1AVS A;  1CLB A;  3TDU A;  3A4U B;  4MSP A;  1SKT A;  4MBE A;  2BL0 B;  1M63 B;  4PE7 A;  1DJG A;  1N2D A;  4DCK A;  2EC6 C;  2WOS A;  1SY9 A;  2KDH A;  1XFZ O;  4QJ5 B;  1FBV A;  2F3Z A;  3WHT B;  4YBH B;  2BBM A;  1Y1X A;  2KFH A;  3SIA A;  3A8R A;  2MRD A;  3I5F C;  1KQM C;  4QJ3 B;  2EC6 B;  2ZN8 A;  3I5H C;  3MSE B;  1D1O A;  1CDN A;  2K2F A;  1QLK A;  5D7F A;  4PE4 A;  3BYA A;  2MLE C;  2GV5 A;  2LVV A;  4MEW A;  2L4I A;  2K7C A;  1DJZ A;  1CFD A;  1QXP A;  2JPT A;  3QRX A;  3ZWH A;  2JTZ A;  1S3P A;  1Y1U A;  3EVV A;  1C7W A;  2M29 A;  3I5F B;  3BUN B;  3CGA A;  4OV2 A;  4ETO A;  3DF0 B;  1JFK A;  1KQM B;  4ORA B;  3I5H B;  4F0Z B;  1KSO A;  2LM5 A;  1OMR A;  3JTD C;  5CPV A;  4OKH A;  3DVJ A;  1AP4 A;  1SNL A;  2K7B A;  1ZMZ A;  3DVE A;  5HKY A;  1PSB A;  2MBX A;  1SPY A;  1BLQ A;  3SG4 A;  4YI8 A;  2ISD A;  2L2E A;  1CLL A;  4OVN F;  1MF8 B;  1QVI Y;  1CB1 A;  3JTD B;  2I2R E;  3PM8 A;  1SCV A;  3VRO A;  2PSR A;  2CBL A;  3PFV A;  3SJS A;  2L0P A;  2WND A;  2CNP A;  2KGR A;  3AKB A;  1CDL A;  1KK8 C;  1DJH A;  1F4Q A;  2LLT A;  1K8U A;  2NCO A;  5KSZ A;  3PAL A;  1ZFS A;  1PK0 D;  2K8M B;  1R6P A;  1TCO B;  1S6J A;  1YVL A;  5D69 A;  5J3X A;  5KTY A;  2LAP A;  5AEQ A;  4XJK A;  4IL1 A;  1TNW A;  1LKJ A;  3LK0 A;  1Y6W A;  3AAK A;  1UWO A;  4YGE B;  2QPT A;  4CFR A;  2LHI A;  2O60 A;  3BUO B;  2RGI A;  4FQO A;  1A03 A;  1QIV A;  1OZS A;  4C0K A;  2KI4 B;  1FI5 A;  3IQQ A;  2L50 A;  1CKK A;  4M2O A;  1TN4 A;  3LCP C;  2JZI A;  2A4J A;  1MXE A;  1EL4 A;  2B1U A;  4YGD B;  4GUK A;  5GQQ C;  2WCE A;  1NCX A;  2F2O A;  2LV7 A;  3EKJ A;  4NDB A;  1HQV A;  1BOC A;  4OR9 B;  3HX4 A;  2JWW A;  4DS7 A;  4M2Q A;  2K61 A;  1J1E A;  1G8I A;  1UHK A;  1SBJ A;  1TNX A;  4TNC A;  3OX5 A;  1QX5 B;  1K9P A;  1CMG A;  1A2X A;  2HQW A;  1DGU A;  3HCM A;  4NQG A;  1XYD A;  1DJX A;  2ZND A;  4HSZ A;  4MZK A;  2I18 A;  3VRN A;  1J55 A;  1C7V A;  4ZCV A;  2FOT A;  3EK7 A;  1QVI Z;  1K96 A;  1DF0 A;  3CLN A;  5DKN A;  4I5J A;  1SR6 C;  5JOL A;  4CFQ A;  1FW4 A;  1N0Y A;  1WDC C;  1XFW O;  4A4B A;  4AQJ A;  1C07 A;  2JNF A;  1IQ5 A;  3CZT X;  2LUX A;  1E8A A;  2L5X B;  1NCZ A;  3AKA A;  2LLU A;  5IBW A;  2CXJ A;  1B8C A;  2KI6 D;  2K0J A;  1WRZ A;  4U8D A;  1PAL A;  1J7Q A;  2BKI B;  1ZUZ A;  1YX8 A;  1G4Y R;  1SR6 B;  5I2L A;  4CLN A;  1A75 A;  1WDC B;  4Q04 A;  1GQM A;  2PRU A;  1Y1A A;  1OZO A;  2K7O A;  3FWC A;  1W7I B;  3O6B A;  2Y4Q A;  3PN7 B;  3WHU B;  1AJ5 A;  4XYN A;  4UPG A;  1XFV O;  1YVH A;  1JF0 A;  1TTX A;  2G2B A;  3PAT A;  3GK2 A;  5I2O A;  4PHM A;  1U5I A;  2F8P A;  2KFF A;  1F71 A;  3OB1 B;  1JFJ A;  1BT6 A;  1MXL C;  2ZKM X;  3BUM B;  1M31 A;  1UHN A;  2F2P A;  5HKW A;  2ZRS A;  1IG5 A;  1HT9 A;  1OSA A;  2GGZ A;  4YI9 A;  1UHH A;  3TS5 C;  1XK4 A;  1B9A A;  1FF1 A;  4GGF A;  4AQI A;  2JC2 A;  4I5N B;  4MRX A;  2LMV A;  2M49 B;  1XFX O;  2JNX A;  3O4Y A;  3D0Y A;  3JVT C;  1XK4 C;  3KO0 A;  1L2O C;  1NX2 A;  1CTR A;  2Q91 A;  1JWD A;  2L4H A;  2ZN9 A;  1JC2 A;  2JQ6 A;  2L98 A;  2LC5 A;  2NLN A;  3TS5 B;  2DOQ A;  2SCP A;  1UHI A;  1K93 D;  2LCP A;  1JSA A;  2WC8 A;  3DD4 A;  3VGO A;  1WLM A;  1TNP A;  2JUL A;  3NSO A;  1NX0 A;  2M1K B;  1B4C A;  2M97 A;  2O5G A;  2AUC A;  1W7J B;  3I5I C;  4R1E A;  2NXQ A;  3JVT B;  1B7T Y;  1L2O B;  2HET A;  3FS7 A;  1ZAC A;  2EGD A;  4GFT A;  1K9U A;  2CTN A;  3OP0 A;  1BR1 B;  5AFP A;  2VRG A;  2F33 A;  1S6C A;  1S5G Y;  2LMU A;  2BE4 A;  2P6B B;  1ODB A;  3VRR A;  5HYD A;  3O2P A;  2JT3 A;  1VRK A;  1CDM A;  2M9G A;  2TN4 A;  5K89 A;  3I5I B;  4C0L A;  1IWQ A;  1F55 A;  1LA0 A;  3D10 A;  3AAJ A;  1S6I A;  1K90 D;  4AOM A;  2M0R A;  3K21 A;  4E68 A;  1KCY A;  1N65 A;  1F8H A;  1YX7 A;  1SW8 A;  1SRA A;  1IKU A;  3OB2 B;  3WXA A;  1JF2 A;  2H61 A;  5HLV A;  2E30 A;  2BKH B;  1S36 A;  2I94 A;  3EVU A;  3H4S E;  1BOD A;  4P2Y B;  1PVA A;  1FPW A;  1NPQ A;  3VRP A;  1CM1 A;  1LXF C;  2HQ8 A;  5DKR A;  4WQ3 A;  1KK8 B;  1K2H A;  1WY9 A;  2LHL A;  1OMV A;  2LVJ A;  2Y1N A;  2K7D A;  4NDC A;  1QS7 A;  2KBM A;  1NYA A;  1Y0V H;  3DVK A;  1KFU S;  1TCF A;  4ORC B;  3SG2 A;  2KQY A;  2ZFD A;  2GGM A;  3BUW B;  1UHJ A;  5CSF A;  1SL7 A;  4DRW A;  3OHM B;  1DTL A;  1UUR A;  1AUI B;  2I7A A;  2KYF A;  3LK1 A;  4DIR A;  1CFP A;  2KAX A;  3SG6 A;  1V1F A;  1TNQ A;  3OX6 A;  3NSI A;  1DMO A;  1MWN A;  5CSJ A;  1SMG A;  2LP3 A;  1IRJ A;  1F54 A;  1MR8 A;  1B7T Z;  3NSL A;  4PE0 A;  3CR2 A;  1H8B A;  5CSN A;  4JPZ B;  1NX1 A;  3I5G C;  4XJK B;  2CT9 A;  3KHE A;  2H2K A;  3GK4 X;  5G08 A;  1S5G Z;  1A29 A;  1QV1 A;  1G33 A;  2FCE A;  2KNE A;  2IS9 A;  1R2U A;  1B1G A;  2LMT A;  4MRY A;  1WRL A;  4GNK B;  2BCX A;  2BEC A;  3IQO A;  3NXA A;  5ER5 A;  5KU1 A;  1RFJ A;  2PAL A;  2ZRT A;  3LL8 B;  1F4O A;  1XO5 A;  1JUO A;  2EHB A;  3I5G B;  3RM1 A;  2Y1M A;  2BCA A;  1YR5 A;  1EJ3 A;  1GGZ A;  4ZCU A;  2AAO A;  4HRE E;  1DGV A;  1YRT B;  2JU0 A;  2BBN A; 
#chains in the Genus database with same CATH topology
 1KFX S;  5JJG A;  3UNW A;  2JPO A;  4PHJ A;  3E3R A;  1CNP A;  3SIB A;  4N5X A;  2PMY A;  3R1V A;  2MAZ A;  1LA3 A;  1OMD A;  1X02 A;  2ZNE A;  2LE9 B;  1TIZ A;  4HRG A;  2JT0 A;  1DF0 B;  2M3W A;  1EG3 A;  2K2A A;  1KK7 Y;  1J7R A;  2JOJ A;  1IH0 A;  1TOP A;  1QJT A;  3KPX A;  1BG1 A;  2HPS A;  1EH2 A;  3BJH A;  4MVF A;  1FI6 A;  1DJY A;  2BL0 C;  5DIC A;  3CZ2 A;  2Y5I A;  4I5K A;  3EK8 A;  4N1G A;  3OGN A;  1IQ3 A;  1WRK A;  2M8U A;  1M46 A;  1OE9 B;  1PSR A;  1K94 A;  1ALW A;  5FYX A;  4YGA A;  4WQ2 A;  2MHH A;  2WCF A;  2OTG C;  1QX7 A;  2KSP A;  1A75 B;  1AJ4 A;  1GM0 A;  4L9M A;  1IJ5 A;  2SAS A;  1BJF A;  3WNX B;  2FCD A;  3CR5 X;  1YUS A;  1EXR A;  1IIO A;  3B88 A;  4QJ4 B;  2M7N A;  2KHN A;  4PDZ A;  4CID A;  2V53 A;  4GGF C;  1KWO C;  1MQ1 A;  2PAS A;  4FTG A;  1DJW A;  1WLZ A;  2KAY A;  3VRQ A;  3DF0 A;  2OTG B;  3BXK A;  2LVK A;  3FWB A;  2F3Y A;  2M7L A;  1CM4 A;  1REC A;  1U5I B;  3DVM A;  4INX A;  3KF9 A;  5TNC A;  3RLZ A;  3SG3 A;  1H4B A;  1L7Z A;  4ICB A;  2OS8 C;  1KQV A;  2MA2 A;  2KGB C;  3O4X A;  3S0D A;  1B8L A;  1UP5 A;  5EL2 A;  4BY5 A;  2WOR A;  1AHR A;  1GGW A;  3TUY C;  1V1G A;  1QAS A;  1NCY A;  3NSK A;  3LLE A;  1KWO B;  4MN0 A;  1J1D A;  5DKQ A;  4USL A;  3PLF B;  2Q4U A;  3FE8 A;  4MZL A;  1ORG A;  1QV0 A;  1F70 A;  2NZ0 A;  3CR4 X;  5I2Q A;  4YGC B;  4C0J A;  1KK7 Z;  3B86 A;  3D0Y B;  1OOF A;  3C1V A;  4HRH A;  1RJV A;  2OS8 B;  1M39 A;  1OOJ A;  4DUQ A;  1ALV A;  1XA5 A;  5FI7 A;  2KBI A;  3BUX B;  1AK8 A;  1J7O A;  5CSI A;  3PSR A;  3Q8I A;  3TUY B;  1BU3 A;  2KQ6 A;  5I94 A;  3CZ1 A;  1YTZ C;  1PUL A;  3R1P A;  2BE6 A;  1S26 D;  1CFC A;  1TWO A;  1NSH A;  2JT8 A;  2LUC A;  1BF5 A;  1KSM A;  1QIW A;  1XFU O;  2ERB A;  2KI6 C;  2QDI A;  4JWQ A;  4NDD A;  3S0A A;  4P5O E;  1K9K A;  1DVI A;  1LVC D;  1MUX A;  3BOW A;  3NHT A;  4I5L B;  1MHO A;  1IGV A;  1YUU A;  2FJU B;  1NUB A;  2HF5 A;  1XVJ A;  2QEH A;  3KEV A;  1RWY A;  1C3Y A;  2H61 C;  2OPO A;  2LAN A;  3S0G A;  1PRW A;  4BY4 A;  1DJI A;  3FIA A;  1JBA A;  2KAV A;  4JD9 A;  5AER A;  2JTT A;  2LP2 A;  1K95 A;  4PHN A;  4GAO A;  1Z2C B;  2WCJ A;  3CDN A;  1PVB A;  4PCW A;  3O78 A;  4PHK A;  2KI4 C;  4GGN A;  1DQE A;  4PAL A;  5F6T A;  3VB1 A;  1B8R A;  1BR4 B;  2MJW B;  3ICB A;  4YGB B;  1CDP A;  1J7P A;  5ER4 X;  1Q80 A;  3CS1 A;  4GBA A;  1OQP A;  1ZOT B;  2KPH A;  1EG4 A;  1XFY O;  3EKH A;  1RRO A;  4JQ0 D;  1YUR A;  5AXI A;  1SL8 A;  3TDI A;  3BOW B;  3DZT A;  2KYC A;  1KFU L;  3DY9 A;  1SK6 D;  4M2P A;  3EVR A;  1QAT A;  1CMF A;  1NIW A;  2P70 A;  4A4C A;  2LLS A;  2P71 A;  3DXL A;  1NWD A;  2COL B;  3TZ1 A;  2PYQ A;  3ZNI A;  1YUT A;  3GK1 A;  2KFG A;  3L47 A;  1QTX A;  2G9B A;  3M0W A;  4GPL B;  4MLW A;  2M1U A;  2L51 A;  5AAN A;  1TUJ A;  4YRU A;  5D3O A;  1QX2 A;  3NHI A;  1CLM A;  3TDZ A;  2MLF C;  4D1E A;  4MZJ A;  5PAL A;  2D8N A;  4N1F A;  2JXC A;  4JKT A;  1BMO A;  1SYM A;  1Z4H A;  2WCB A;  3CWG A;  1B47 A;  2LNK A;  2E6W A;  1SCM C;  1TRF A;  3CAB A;  3SS4 A;  1DT7 B;  1RTP 1;  4ORB B;  1LIN A;  1M45 A;  3SG7 A;  3BQ3 A;  3IF7 A;  1SL9 A;  2QAC A;  3CTN A;  1P28 A;  2AMI A;  2CCM A;  5HKZ A;  5BPJ A;  2NCP A;  1IJ6 A;  2LVI A;  2BCB A;  4WRI A;  5B8I B;  1A4P A;  1KFX L;  1UUS A;  3SG5 A;  4OCI A;  1NX3 A;  2QEV A;  1NP8 A;  1SCM B;  5I8N A;  2JRF A;  2R2I A;  1QWV A;  1CFF A;  2PVB A;  3PN7 C;  1OW4 A;  4PE1 A;  4KYN A;  3EK4 A;  3GOF A;  2JXL A;  1QLS A;  5HLO A;  1YRU B;  3QME A;  2KOT A;  1S1E A;  3RZS A;  1RK9 A;  3F45 A;  1GJY A;  1AVS A;  1CLB A;  3TDU A;  3A4U B;  4MSP A;  1LS8 A;  1SKT A;  2QEO A;  3D74 A;  2BL0 B;  4MBE A;  1M63 B;  4PE7 A;  3D77 A;  1TUZ A;  1DJG A;  2KLE A;  3D73 A;  1N2D A;  1XFR A;  2EC6 C;  2WOS A;  4DCK A;  3PJI A;  1SY9 A;  1C3Z A;  2KDH A;  1XFZ O;  4FQT A;  4QJ5 B;  1FBV A;  2F3Z A;  3WHT B;  4YBH B;  2BBM A;  1Y1X A;  3IVT A;  2KFH A;  2K60 A;  3SIA A;  1OOI X;  3A8R A;  2MRD A;  3I5F C;  1KQM C;  1SSE B;  4QJ3 B;  2EC6 B;  2ZN8 A;  3I5H C;  3MSE B;  2WC6 A;  2PQL A;  1CDN A;  2K2F A;  1D1O A;  1QLK A;  5D7F A;  2KLD A;  4PE4 A;  3BYA A;  2MLE C;  2GV5 A;  4IJ7 A;  2LVV A;  4MEW A;  2L4I A;  2K7C A;  1DJZ A;  1CFD A;  1QXP A;  2JPT A;  3QRX A;  3ZWH A;  2JTZ A;  1S3P A;  1Y1U A;  3EVV A;  1C7W A;  2M29 A;  2L2C A;  3I5F B;  3BUN B;  3CGA A;  4OV2 A;  4ETO A;  3DF0 B;  4CPV A;  1CFP A;  1JFK A;  1KQM B;  4ORA B;  3I5H B;  4F0Z B;  1KSO A;  2LM5 A;  1OMR A;  3JTD C;  5CPV A;  4OKH A;  3SS5 A;  3DVJ A;  1AP4 A;  1SNL A;  2K7B A;  1ZMZ A;  3DVE A;  5HKY A;  1PSB A;  5FI2 A;  1SPY A;  2MBX A;  1BLQ A;  3BFH A;  3SG4 A;  4YI8 A;  2ISD A;  3OBV A;  2L2E A;  1CLL A;  4OVN F;  4F7F A;  2YGU A;  1MF8 B;  1QVI Y;  2BBN A;  3V2L A;  1CB1 A;  3JTD B;  2I2R E;  3PM8 A;  1SCV A;  3D75 A;  2WCH A;  2PSR A;  2CBL A;  3L4L A;  3PFV A;  3SJS A;  2L0P A;  3VRO A;  2WND A;  2CNP A;  3UO9 A;  2KGR A;  3AKB A;  1CDL A;  1KK8 C;  1DJH A;  1F4Q A;  2LLT A;  1K8U A;  2NCO A;  4PT1 A;  3PAL A;  3NGV A;  5KSZ A;  1ZFS A;  1PK0 D;  2K8M B;  1R6P A;  2BAP A;  1TCO B;  5D69 A;  1YVL A;  5J3X A;  5KTY A;  2LAP A;  5AEQ A;  4XJK A;  4IL1 A;  1TNW A;  1LKJ A;  2FJY A;  3CYZ A;  3LK0 A;  1Y6W A;  3AAK A;  1UWO A;  4YGE B;  2QPT A;  4CFR A;  2LHI A;  2O60 A;  3BUO B;  2RGI A;  4FQO A;  1DEL A;  2BNX A;  1A03 A;  2H8V A;  1QIV A;  1OZS A;  4C0K A;  2KI4 B;  1FI5 A;  3IQQ A;  2L50 A;  1CKK A;  4M2O A;  1TN4 A;  3LCP C;  2JZI A;  2A4J A;  1MXE A;  1EL4 A;  2B1U A;  4YGD B;  4GUK A;  5GQQ C;  2WCE A;  3D76 A;  1NCX A;  2F2O A;  2LV7 A;  3EKJ A;  4NDB A;  1HQV A;  1BOC A;  4OR9 B;  3HX4 A;  2JWW A;  4DS7 A;  4M2Q A;  2K61 A;  1J1E A;  1G8I A;  1UHK A;  1SBJ A;  1TNX A;  4TNC A;  3OX5 A;  1QX5 B;  1K9P A;  1CMG A;  1A2X A;  2HQW A;  1DGU A;  2WCL A;  3HCM A;  4NQG A;  1XYD A;  1DJX A;  2ZND A;  4HSZ A;  4MZK A;  2I18 A;  3VRN A;  1J55 A;  1C7V A;  4ZCV A;  2FOT A;  3EK7 A;  1QVI Z;  1K96 A;  1DF0 A;  3CLN A;  5DKN A;  4I5J A;  1SR6 C;  5JOL A;  4CFQ A;  1FW4 A;  1N0Y A;  1WDC C;  1XFW O;  4A4B A;  4AQJ A;  1C07 A;  3D78 A;  3S0F A;  2JNF A;  1IQ5 A;  3CZT X;  2LUX A;  1E8A A;  2L5X B;  1NCZ A;  3AKA A;  2LLU A;  5IBW A;  3BFA A;  2CXJ A;  1B8C A;  2KI6 D;  2K0J A;  1WRZ A;  3DYE A;  4U8D A;  1PAL A;  1J7Q A;  3BFB A;  2BKI B;  1ZUZ A;  1YX8 A;  1G4Y R;  3R1O A;  1SR6 B;  5I2L A;  1OOG A;  4CLN A;  1A75 A;  1WDC B;  4Q04 A;  1GQM A;  2PRU A;  1Y1A A;  1OZO A;  3FE9 A;  1DEK A;  2K7O A;  3FWC A;  1W7I B;  3O6B A;  2Y4Q A;  3PN7 B;  3WHU B;  1AJ5 A;  4XYN A;  4UPG A;  1XFV O;  1YVH A;  1JF0 A;  1TTX A;  2G2B A;  3PAT A;  3GK2 A;  5I2O A;  4PHM A;  1U5I A;  2F8P A;  2KFF A;  1F71 A;  3OB1 B;  3B6X A;  1JFJ A;  1BT6 A;  1MXL C;  1OOH A;  2ZKM X;  3BUM B;  1M31 A;  1UHN A;  3CZ0 A;  3EG5 B;  2F2P A;  5HKW A;  2ZRS A;  1IG5 A;  1HT9 A;  1OSA A;  2GGZ A;  2WCM A;  4YI9 A;  1UHH A;  3TS5 C;  1XK4 A;  1B9A A;  1FF1 A;  4GGF A;  4AQI A;  2JC2 A;  2WCK A;  4I5N B;  4MRX A;  2LMV A;  2M49 B;  2QEB A;  1XFX O;  2JNX A;  3O4Y A;  3D0Y A;  3JVT C;  1XK4 C;  3KO0 A;  5HL1 A;  1L2O C;  1NX2 A;  1CTR A;  2Q91 A;  1JWD A;  2L4H A;  2ZN9 A;  1JC2 A;  2JQ6 A;  2L98 A;  4OZD A;  2LC5 A;  2NLN A;  2WC5 A;  2DOQ A;  3TS5 B;  2SCP A;  1UHI A;  1K93 D;  2LCP A;  1JSA A;  2WC8 A;  3DD4 A;  3VGO A;  1WLM A;  1TNP A;  2JUL A;  3NSO A;  1NX0 A;  2M1K B;  1B4C A;  2M97 A;  2O5G A;  2AUC A;  3S0B A;  1W7J B;  3I5I C;  4R1E A;  2NXQ A;  3JVT B;  1B7T Y;  1W9Z A;  1L2O B;  2HET A;  3FS7 A;  1ZAC A;  2EGD A;  4GFT A;  1K9U A;  2CTN A;  2L5Y A;  1BR1 B;  3OP0 A;  5AFP A;  2VRG A;  2F33 A;  1S6C A;  1S5G Y;  2LMU A;  2BE4 A;  3SS3 A;  2P6B B;  1ODB A;  3VRR A;  5HYD A;  3O2P A;  2JT3 A;  1VRK A;  1CDM A;  2M9G A;  2TN4 A;  3FE6 A;  5K89 A;  3I5I B;  4C0L A;  1IWQ A;  3PM2 A;  1LA0 A;  3D10 A;  3AAJ A;  1F55 A;  1S6I A;  1K90 D;  4AOM A;  2M0R A;  3K21 A;  4E68 A;  1KCY A;  1N65 A;  1F8H A;  1YX7 A;  1SW8 A;  1SRA A;  1IKU A;  3OB2 B;  3B87 A;  3WXA A;  1JF2 A;  2H61 A;  5HLV A;  2E30 A;  2BKH B;  1S36 A;  2I94 A;  3EVU A;  3H4S E;  1BOD A;  4P2Y B;  1PVA A;  1FPW A;  1NPQ A;  3VRP A;  1CM1 A;  1LXF C;  2HQ8 A;  5DKR A;  4WQ3 A;  1KK8 B;  5FI6 A;  1K2H A;  1WY9 A;  2LHL A;  1OMV A;  2LVJ A;  2Y1N A;  2K7D A;  4NDC A;  1QS7 A;  2KBM A;  3B7A A;  1NYA A;  1Y0V H;  3DVK A;  1KFU S;  1TCF A;  3R72 A;  4ORC B;  2KQY A;  2ZFD A;  2GGM A;  3BUW B;  3SG2 A;  1UHJ A;  3L4A A;  5CSF A;  1SL7 A;  4DRW A;  3OHM B;  1DTL A;  1UUR A;  1AUI B;  2I7A A;  2KYF A;  3K1E A;  3LK1 A;  4DIR A;  2KAX A;  3SG6 A;  1V1F A;  1TNQ A;  3OX6 A;  3NSI A;  1DMO A;  1MWN A;  5CSJ A;  1SMG A;  2LP3 A;  1IRJ A;  4INW A;  1F54 A;  1MR8 A;  1B7T Z;  3NSL A;  4PE0 A;  3CR2 A;  1H8B A;  3N7H A;  1DC1 A;  5CSN A;  4JPZ B;  1NX1 A;  3I5G C;  4XJK B;  2CT9 A;  3KHE A;  2H2K A;  3GK4 X;  2GTE A;  5G08 A;  1S5G Z;  1A29 A;  3S0E A;  1QV1 A;  1G33 A;  2FCE A;  2KNE A;  2IS9 A;  1R2U A;  1B1G A;  2LMT A;  4MRY A;  1WRL A;  4GNK B;  2BCX A;  2BEC A;  3IQO A;  3NXA A;  5ER5 A;  5KU1 A;  1RFJ A;  2PAL A;  2ZRT A;  3LL8 B;  1F4O A;  1XO5 A;  1JUO A;  2EHB A;  3I5G B;  3RM1 A;  2Y1M A;  2BCA A;  1YR5 A;  1EJ3 A;  1GGZ A;  1T14 A;  4ZCU A;  2AAO A;  4HRE E;  1DGV A;  1YRT B;  2JU0 A;  1S6J A; 
#chains in the Genus database with same CATH homology
 1KFX S;  5JJG A;  4PHJ A;  3E3R A;  1CNP A;  3SIB A;  4N5X A;  2PMY A;  2MAZ A;  1LA3 A;  1OMD A;  1X02 A;  2ZNE A;  2LE9 B;  1TIZ A;  4HRG A;  2JT0 A;  1DF0 B;  2M3W A;  1EG3 A;  2K2A A;  1KK7 Y;  1J7R A;  2JOJ A;  1IH0 A;  1TOP A;  1QJT A;  3KPX A;  1BG1 A;  2HPS A;  1EH2 A;  4MVF A;  1FI6 A;  1DJY A;  2BL0 C;  2Y5I A;  4I5K A;  3EK8 A;  4N1G A;  1IQ3 A;  1WRK A;  2M8U A;  1M46 A;  1OE9 B;  1PSR A;  1K94 A;  1ALW A;  5FYX A;  4YGA A;  4WQ2 A;  2MHH A;  2WCF A;  2OTG C;  1QX7 A;  2KSP A;  1A75 B;  1AJ4 A;  4L9M A;  1IJ5 A;  2SAS A;  1BJF A;  3WNX B;  2FCD A;  3CR5 X;  1YUS A;  1EXR A;  4QJ4 B;  2M7N A;  2KHN A;  4PDZ A;  4CID A;  2V53 A;  4GGF C;  1KWO C;  1MQ1 A;  2PAS A;  4FTG A;  1DJW A;  1WLZ A;  2KAY A;  3VRQ A;  3DF0 A;  2OTG B;  3BXK A;  2LVK A;  3FWB A;  2F3Y A;  2M7L A;  1CM4 A;  1REC A;  1U5I B;  3DVM A;  3KF9 A;  5TNC A;  3RLZ A;  3SG3 A;  1H4B A;  1L7Z A;  4ICB A;  2OS8 C;  1KQV A;  2MA2 A;  2KGB C;  1B8L A;  1UP5 A;  4BY5 A;  2WOR A;  1AHR A;  1GGW A;  3TUY C;  1V1G A;  1QAS A;  1NCY A;  3NSK A;  3LLE A;  1KWO B;  4MN0 A;  1J1D A;  5DKQ A;  4USL A;  3PLF B;  2Q4U A;  4MZL A;  1QV0 A;  1F70 A;  2NZ0 A;  3CR4 X;  5I2Q A;  4YGC B;  4C0J A;  1KK7 Z;  3D0Y B;  3C1V A;  4HRH A;  4DUQ A;  1RJV A;  2OS8 B;  1M39 A;  1OOJ A;  1ALV A;  1XA5 A;  1AK8 A;  2KBI A;  3BUX B;  1J7O A;  5CSI A;  3PSR A;  3TUY B;  1BU3 A;  2KQ6 A;  1YTZ C;  1PUL A;  2BE6 A;  1S26 D;  1CFC A;  1NSH A;  2JT8 A;  2LUC A;  1BF5 A;  1KSM A;  1QIW A;  1XFU O;  4JWQ A;  2KI6 C;  4NDD A;  4P5O E;  1K9K A;  1DVI A;  1LVC D;  1MUX A;  3BOW A;  4I5L B;  1MHO A;  1IGV A;  1YUU A;  2FJU B;  1NUB A;  2HF5 A;  1XVJ A;  3KEV A;  1RWY A;  2H61 C;  2OPO A;  2LAN A;  1PRW A;  4BY4 A;  1DJI A;  3FIA A;  1JBA A;  2KAV A;  5AER A;  2JTT A;  2LP2 A;  1K95 A;  4PHN A;  4GAO A;  4CPV A;  4PCW A;  1PVB A;  5F6T A;  3O78 A;  4PHK A;  2KI4 C;  4GGN A;  4PAL A;  1B8R A;  1BR4 B;  2MJW B;  3ICB A;  4YGB B;  1CDP A;  1J7P A;  5ER4 X;  1Q80 A;  3CS1 A;  4GBA A;  1OQP A;  1ZOT B;  1EG4 A;  1XFY O;  3EKH A;  1RRO A;  4JQ0 D;  1YUR A;  5AXI A;  1SL8 A;  3TDI A;  3BOW B;  2KYC A;  1KFU L;  4M2P A;  1SK6 D;  3EVR A;  1QAT A;  1CMF A;  1NIW A;  4A4C A;  2LLS A;  1NWD A;  2COL B;  3TZ1 A;  3ZNI A;  1YUT A;  3GK1 A;  2KFG A;  4MLW A;  1QTX A;  2G9B A;  3M0W A;  4GPL B;  4YRU A;  2M1U A;  2L51 A;  5AAN A;  1QX2 A;  3TDZ A;  1CLM A;  2MLF C;  4D1E A;  4MZJ A;  5PAL A;  2D8N A;  4N1F A;  2JXC A;  1BMO A;  1SYM A;  2WCB A;  3CWG A;  1B47 A;  2LNK A;  2E6W A;  1SCM C;  1TRF A;  1DT7 B;  1RTP 1;  4ORB B;  1LIN A;  1M45 A;  3SG7 A;  3BQ3 A;  3IF7 A;  1SL9 A;  2QAC A;  3CTN A;  2AMI A;  2CCM A;  5HKZ A;  5BPJ A;  2NCP A;  1IJ6 A;  2LVI A;  2BCB A;  4WRI A;  5B8I B;  1A4P A;  1KFX L;  1UUS A;  3SG5 A;  4OCI A;  1NX3 A;  1NP8 A;  1SCM B;  5I8N A;  2JRF A;  2R2I A;  1CFF A;  2PVB A;  3PN7 C;  4PE1 A;  3EK4 A;  3GOF A;  2JXL A;  1QLS A;  5HLO A;  1YRU B;  2KOT A;  1S1E A;  1RK9 A;  3F45 A;  1GJY A;  1AVS A;  1CLB A;  3TDU A;  3A4U B;  4MSP A;  1SKT A;  4MBE A;  2BL0 B;  1M63 B;  4PE7 A;  1DJG A;  1N2D A;  4DCK A;  2EC6 C;  2WOS A;  1SY9 A;  2KDH A;  1XFZ O;  4QJ5 B;  1FBV A;  2F3Z A;  3WHT B;  4YBH B;  2BBM A;  1Y1X A;  2KFH A;  3SIA A;  3A8R A;  2MRD A;  3I5F C;  1KQM C;  4QJ3 B;  2EC6 B;  2ZN8 A;  3I5H C;  3MSE B;  1D1O A;  1CDN A;  2K2F A;  1QLK A;  5D7F A;  4PE4 A;  3BYA A;  2MLE C;  2GV5 A;  2LVV A;  4MEW A;  2L4I A;  2K7C A;  1DJZ A;  1CFD A;  1QXP A;  2JPT A;  3QRX A;  3ZWH A;  2JTZ A;  1S3P A;  1Y1U A;  3EVV A;  1C7W A;  2M29 A;  3I5F B;  3BUN B;  3CGA A;  4OV2 A;  4ETO A;  3DF0 B;  1JFK A;  1KQM B;  4ORA B;  3I5H B;  4F0Z B;  1KSO A;  2LM5 A;  1OMR A;  3JTD C;  5CPV A;  4OKH A;  3DVJ A;  1AP4 A;  1SNL A;  2K7B A;  1ZMZ A;  3DVE A;  5HKY A;  1PSB A;  2MBX A;  1SPY A;  1BLQ A;  3SG4 A;  4YI8 A;  2ISD A;  2L2E A;  1CLL A;  4OVN F;  1MF8 B;  1QVI Y;  1CB1 A;  3JTD B;  2I2R E;  3PM8 A;  1SCV A;  3VRO A;  2PSR A;  2CBL A;  3PFV A;  3SJS A;  2L0P A;  2WND A;  2CNP A;  2KGR A;  3AKB A;  1CDL A;  1KK8 C;  1DJH A;  1F4Q A;  2LLT A;  1K8U A;  2NCO A;  5KSZ A;  3PAL A;  1ZFS A;  1PK0 D;  2K8M B;  1R6P A;  1TCO B;  1S6J A;  1YVL A;  5D69 A;  5J3X A;  5KTY A;  2LAP A;  5AEQ A;  4XJK A;  4IL1 A;  1TNW A;  1LKJ A;  3LK0 A;  1Y6W A;  3AAK A;  1UWO A;  4YGE B;  2QPT A;  4CFR A;  2LHI A;  2O60 A;  3BUO B;  2RGI A;  4FQO A;  1A03 A;  1QIV A;  1OZS A;  4C0K A;  2KI4 B;  1FI5 A;  3IQQ A;  2L50 A;  1CKK A;  4M2O A;  1TN4 A;  3LCP C;  2JZI A;  2A4J A;  1MXE A;  1EL4 A;  2B1U A;  4YGD B;  4GUK A;  5GQQ C;  2WCE A;  1NCX A;  2F2O A;  2LV7 A;  3EKJ A;  4NDB A;  1HQV A;  1BOC A;  4OR9 B;  3HX4 A;  2JWW A;  4DS7 A;  4M2Q A;  2K61 A;  1J1E A;  1G8I A;  1UHK A;  1SBJ A;  1TNX A;  4TNC A;  3OX5 A;  1QX5 B;  1K9P A;  1CMG A;  1A2X A;  2HQW A;  1DGU A;  3HCM A;  4NQG A;  1XYD A;  1DJX A;  2ZND A;  4HSZ A;  4MZK A;  2I18 A;  3VRN A;  1J55 A;  1C7V A;  4ZCV A;  2FOT A;  3EK7 A;  1QVI Z;  1K96 A;  1DF0 A;  3CLN A;  5DKN A;  4I5J A;  1SR6 C;  5JOL A;  4CFQ A;  1FW4 A;  1N0Y A;  1WDC C;  1XFW O;  4A4B A;  4AQJ A;  1C07 A;  2JNF A;  1IQ5 A;  3CZT X;  2LUX A;  1E8A A;  2L5X B;  1NCZ A;  3AKA A;  2LLU A;  5IBW A;  2CXJ A;  1B8C A;  2KI6 D;  2K0J A;  1WRZ A;  4U8D A;  1PAL A;  1J7Q A;  2BKI B;  1ZUZ A;  1YX8 A;  1G4Y R;  1SR6 B;  5I2L A;  4CLN A;  1A75 A;  1WDC B;  4Q04 A;  1GQM A;  2PRU A;  1Y1A A;  1OZO A;  2K7O A;  3FWC A;  1W7I B;  3O6B A;  2Y4Q A;  3PN7 B;  3WHU B;  1AJ5 A;  4XYN A;  4UPG A;  1XFV O;  1YVH A;  1JF0 A;  1TTX A;  2G2B A;  3PAT A;  3GK2 A;  5I2O A;  4PHM A;  1U5I A;  2F8P A;  2KFF A;  1F71 A;  3OB1 B;  1JFJ A;  1BT6 A;  1MXL C;  2ZKM X;  3BUM B;  1M31 A;  1UHN A;  2F2P A;  5HKW A;  2ZRS A;  1IG5 A;  1HT9 A;  1OSA A;  2GGZ A;  4YI9 A;  1UHH A;  3TS5 C;  1XK4 A;  1B9A A;  1FF1 A;  4GGF A;  4AQI A;  2JC2 A;  4I5N B;  4MRX A;  2LMV A;  2M49 B;  1XFX O;  2JNX A;  3O4Y A;  3D0Y A;  3JVT C;  1XK4 C;  3KO0 A;  1L2O C;  1NX2 A;  1CTR A;  2Q91 A;  1JWD A;  2L4H A;  2ZN9 A;  1JC2 A;  2JQ6 A;  2L98 A;  2LC5 A;  2NLN A;  3TS5 B;  2DOQ A;  2SCP A;  1UHI A;  1K93 D;  2LCP A;  1JSA A;  2WC8 A;  3DD4 A;  3VGO A;  1WLM A;  1TNP A;  2JUL A;  3NSO A;  1NX0 A;  2M1K B;  1B4C A;  2M97 A;  2O5G A;  2AUC A;  1W7J B;  3I5I C;  4R1E A;  2NXQ A;  3JVT B;  1B7T Y;  1L2O B;  2HET A;  3FS7 A;  1ZAC A;  2EGD A;  4GFT A;  1K9U A;  2CTN A;  3OP0 A;  1BR1 B;  5AFP A;  2VRG A;  2F33 A;  1S6C A;  1S5G Y;  2LMU A;  2BE4 A;  2P6B B;  1ODB A;  3VRR A;  5HYD A;  3O2P A;  2JT3 A;  1VRK A;  1CDM A;  2M9G A;  2TN4 A;  5K89 A;  3I5I B;  4C0L A;  1IWQ A;  1F55 A;  1LA0 A;  3D10 A;  3AAJ A;  1S6I A;  1K90 D;  4AOM A;  2M0R A;  3K21 A;  4E68 A;  1KCY A;  1N65 A;  1F8H A;  1YX7 A;  1SW8 A;  1SRA A;  1IKU A;  3OB2 B;  3WXA A;  1JF2 A;  2H61 A;  5HLV A;  2E30 A;  2BKH B;  1S36 A;  2I94 A;  3EVU A;  3H4S E;  1BOD A;  4P2Y B;  1PVA A;  1FPW A;  1NPQ A;  3VRP A;  1CM1 A;  1LXF C;  2HQ8 A;  5DKR A;  4WQ3 A;  1KK8 B;  1K2H A;  1WY9 A;  2LHL A;  1OMV A;  2LVJ A;  2Y1N A;  2K7D A;  4NDC A;  1QS7 A;  2KBM A;  1NYA A;  1Y0V H;  3DVK A;  1KFU S;  1TCF A;  4ORC B;  3SG2 A;  2KQY A;  2ZFD A;  2GGM A;  3BUW B;  1UHJ A;  5CSF A;  1SL7 A;  4DRW A;  3OHM B;  1DTL A;  1UUR A;  1AUI B;  2I7A A;  2KYF A;  3LK1 A;  4DIR A;  1CFP A;  2KAX A;  3SG6 A;  1V1F A;  1TNQ A;  3OX6 A;  3NSI A;  1DMO A;  1MWN A;  5CSJ A;  1SMG A;  2LP3 A;  1IRJ A;  1F54 A;  1MR8 A;  1B7T Z;  3NSL A;  4PE0 A;  3CR2 A;  1H8B A;  5CSN A;  4JPZ B;  1NX1 A;  3I5G C;  4XJK B;  2CT9 A;  3KHE A;  2H2K A;  3GK4 X;  5G08 A;  1S5G Z;  1A29 A;  1QV1 A;  1G33 A;  2FCE A;  2KNE A;  2IS9 A;  1R2U A;  1B1G A;  2LMT A;  4MRY A;  1WRL A;  4GNK B;  2BCX A;  2BEC A;  3IQO A;  3NXA A;  5ER5 A;  5KU1 A;  1RFJ A;  2PAL A;  2ZRT A;  3LL8 B;  1F4O A;  1XO5 A;  1JUO A;  2EHB A;  3I5G B;  3RM1 A;  2Y1M A;  2BCA A;  1YR5 A;  1EJ3 A;  1GGZ A;  4ZCU A;  2AAO A;  4HRE E;  1DGV A;  1YRT B;  2JU0 A;  2BBN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...