1QV1A

Atomic resolution structure of obelin from obelia longissima
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
191
structure length
187
Chain Sequence
YAVKLKTDFDNPRWIKRHKHMFDFLDINGNGKITLDEIVSKASDDICAKLEATPEQTKRHQVCVEAFFRGCGMEYGKEIAFPQFLDGWKQLATSELKKWARNEPTLIREWGDAVFDIFDGTITLDEWKAYGKISGISPSQEDCEATFRHCDLDNAGDLDVDEMTRQHLGFWYTLDPEADGLYGNGVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic resolution structure of obelin: soaking with calcium enhances electron density of the second oxygen atom substituted at the C2-position of coelenterazine.
pubmed doi rcsb
molecule keywords Obelin
molecule tags Luminescent protein
source organism Obelia longissima
total genus 75
structure length 187
sequence length 191
ec nomenclature ec 1.13.12.5: Renilla-type luciferase.
pdb deposition date 2003-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1qv1A00
2Q91A 1V1FA 2LVJA 1SL7A 4BY4A 1QIVA 2KYCA 4Q04A 5AEQA 3VROA 4JQ0D 2MLFC 4MSPA 2M7LA 1J55A 1ZMZA 1CMFA 2F3YA 3ICBA 4D1EA 1NSHA 1M39A 3I5GB 5IBWA 2CT9A 1EG3A 2JPTA 1J7QA 1K9KA 1JF0A 1XFWO 3D0YB 1DJGA 2TN4A 4PHMA 1FF1A 1WLZA 1RTP1 1FPWA 4QJ3B 1SK6D 1J1DA 2WC8A 1DJZA 3PALA 1UWOA 2KOTA 1BU3A 1QX7A 1PVAA 3CTNA 1QX5B 4I5LB 2LUCA 4DUQA 3EK4A 3OX6A 3KHEA 2KI6D 4GPLB 3FS7A 1TTXA 3AKBA 1A75A 2HPSA 2IS9A 2NXQA 3HX4A 3I5IC 4XJKA 4CFQA 4DS7A 1JC2A 1CLLA 2LCPA 2M0RA 3HCMA 2BECA 2F3ZA 4YGDB 5I8NA 4M2OA 1PALA 4M2QA 1X02A 1N2DA 3PATA 2JU0A 4GGFA 3GK2A 2JTTA 1F54A 1ZOTB 1SL9A 2LVVA 4MBEA 2ZN8A 1LXFC 2MHHA 4NDCA 1MXLC 4PHNA 1A4PA 1VRKA 3D0YA 1WLMA 2BCAA 3TDUA 5GQQC 1QVIZ 1OE9B 1WRZA 2L4HA 1CB1A 2F2OA 1PULA 2BKIB 1TNPA 1TRFA 5I2LA 3EVRA 3I5IB 1TNXA 4GAOA 2NCOA 1OMDA 1IG5A 1R2UA 1NCZA 4F0ZB 3O6BA 4QJ5B 4GBAA 2Y1MA 1W7IB 4AQJA 4YRUA 2M49B 1CFDA 3M0WA 1MQ1A 4OCIA 3GK1A 2KGBC 1IWQA 3CGAA 3PLFB 4WQ2A 1EG4A 1TOPA 3DVJA 3VRRA 1A29A 1DGUA 3PM8A 1WDCC 2NCPA 3KPXA 1F4QA 1OMRA 1IGVA 1CLBA 1K2HA 3DD4A 1SKTA 2F8PA 1CDNA 1XVJA 3SG5A 4ORCB 3TDZA 1S26D 1F4OA 1S1EA 1FW4A 1YUSA 1J7OA 1WY9A 2G9BA 1B8RA 1RK9A 2KDHA 2WOSA 3EVUA 1LINA 3MSEB 2MA2A 1BJFA 5AXIA 1AP4A 1F70A 1B8CA 3BUOB 1SCMC 2JNXA 1QX2A 4OKHA 2M97A 2LLUA 4NDBA 4PE7A 1M45A 1AVSA 2I94A 1WDCB 2GGMA 2JT3A 1MUXA 4P2YB 3IQQA 3BUXB 1IJ5A 2I18A 2KGRA 2ZRSA 3JVTC 1SNLA 2LUXA 2M8UA 1SL8A 2PALA 2KFHA 1QVIY 1CNPA 2HQWA 2KBMA 2HQ8A 1MXEA 2DOQA 1NP8A 1MR8A 2LLSA 2SCPA 4MVFA 1K95A 1LVCD 1SBJA 1YVLA 4ETOA 5D7FA 1XA5A 3OB1B 1SCMB 2ZFDA 4UPGA 3WNXB 3K21A 5CSIA 2BL0C 4FQOA 3NSKA 1KWOC 1OMVA 1MWNA 1NCYA 1UHIA 1SYMA 3GOFA 4PHJA 4I5JA 1CLMA 4DCKA 3JVTB 2WCFA 1OSAA 4CFRA 1YUTA 1S5GZ 3NXAA 3O78A 1HQVA 5F6TA 2LMVA 3KO0A 1BG1A 1NWDA 1KFXS 1Y0VH 1NYAA 1AUIB 2O5GA 3DVMA 2LANA 1Y1UA 1SCVA 5K89A 1H8BA 1R6PA 2E30A 2MJWB 2JQ6A 4A4BA 2JTZA 1A2XA 3VRNA 5B8IB 3RLZA 1GGZA 1ODBA 1B1GA 1EH2A 3VRPA 2BL0B 1UHKA 3SG2A 1JUOA 5BPJA 2OPOA 1KWOB 4PE4A 4E68A 5PALA 3NSIA 1YVHA 4YI8A 1DT7B 1CM1A 2K7OA 2PMYA 2M29A 4DIRA 4ICBA 1AHRA 3CLNA 3EK8A 4HRHA 1DJWA 3NSLA 1B8LA 1Y1AA 1RFJA 1FI5A 1LA3A 3SIBA 1A03A 1RECA 2VRGA 3SG3A 1DF0B 4GNKB 1DVIA 1MF8B 1QTXA 3EVVA 1W7JB 1M63B 1ZACA 4IL1A 1DJHA 2KSPA 5HKYA 2KI4C 3PN7C 4OVNF 2Y4QA 5FYXA 1BT6A 1N0YA 2BKHB 5HLVA 1TNWA 5I2OA 1JFKA 1YX7A 2COLB 2EGDA 1BOCA 3LL8B 1DGVA 1TN4A 4PALA 1PSBA 2EHBA 5J3XA 2ISDA 4YGEB 5KSZA 3TS5C 1K8UA 1Y1XA 5ER4X 5HKZA 2ZNEA 1PSRA 2CXJA 1S6JA 1M46A 1BODA 1JWDA 2KFFA 1K90D 1CFFA 2KQYA 2MLEC 3H4SE 2F2PA 1CFCA 3LK0A 1IJ6A 2KI4B 3PN7B 1CFPA 2M1UA 1AJ4A 1QASA 5JJGA 1S5GY 4MRYA 5CPVA 1L2OC 2R2IA 1DF0A 2A4JA 4TNCA 4HSZA 1EJ3A 1ZUZA 2BE4A 4PDZA 2JT8A 4YGAA 1IQ5A 1U5IB 1NUBA 1XFUO 3TS5B 1K9PA 2KAYA 4YBHB 1G33A 2K2FA 1DTLA 1D1OA 1CDLA 1RJVA 2LMTA 3I5FC 5ER5A 2ZNDA 1XFZO 1JBAA 3WHTB 2LP2A 2L50A 1CDMA 1UHHA 3PSRA 4R1EA 1AK8A 1L2OB 4OR9B 1NX1A 1KSOA 2O60A 1QLKA 2OS8C 2KI6C 1SY9A 2JWWA 2PVBA 1TCFA 1DMOA 1IQ3A 1KQMC 3FIAA 1YTZC 2LP3A 3DF0B 2KAVA 2H2KA 1S6IA 2LNKA 2SASA 1UUSA 2CNPA 3LCPC 3LK1A 1UP5A 2MAZA 4WQ3A 2FCDA 3SG7A 4ZCVA 2L2EA 2CCMA 2V53A 1S3PA 2WNDA 1K93D 4WRIA 2KYFA 4YGCB 3D10A 2E6WA 3I5FB 3JTDC 1U5IA 4YGBB 3SIAA 4N1FA 1OZSA 2JULA 2BBMA 3CR4X 4ORAB 1BR4B 3NSOA 3LLEA 3EK7A 1TCOB 3CR2A 4AQIA 5D69A 3PFVA 2M3WA 3SJSA 1K9UA 1L7ZA 2PASA 1FBVA 3BQ3A 1C07A 2OS8B 1KK7Z 1JF2A 2JXCA 3CZTX 3DVKA 1KQMB 4N5XA 1NIWA 1E8AA 3OX5A 4C0KA 5CSNA 3TDIA 2H61C 2LHIA 5I2QA 1TIZA 4BY5A 2L98A 3WHUB 4DRWA 3DF0A 4M2PA 3JTDB 2LMUA 1PRWA 1KFXL 1OQPA 2QACA 2P6BB 1CM4A 3FWBA 2Y1NA 1B7TZ 2FOTA 4YI9A 1JFJA 2G2BA 3OB2B 4GFTA 2NZ0A 5CSJA 4QJ4B 2KFGA 1UURA 1YURA 2KHNA 4MZKA 4OV2A 1IH0A 1F71A 1DJYA 1NX3A 2BCXA 4MLWA 1HT9A 1IRJA 1RROA 1YX8A 3VRQA 1NX2A 4HRGA 2KAXA 4GUKA 2CTNA 2EC6C 1SPYA 1KK8C 1K94A 1NX0A 5DKRA 1OZOA 4PCWA 4JWQA 1PK0D 3BOWB 1Y6WA 2JZIA 3A4UB 2K0JA 1Q80A 1QV0A 3E3RA 2I2RE 1S6CA 2WORA 4L9MA 1C7WA 4A4CA 2L4IA 2JT0A 2KQ6A 1UHJA 2L5XB 1ALVA 1UHNA 2QPTA 2ZKMX 3OHMB 4NQGA 2MBXA 1G4YR 2LV7A 2PRUA 3BUNB 4I5KA 2JNFA 5KU1A 2BCBA 4MZLA 2I7AA 3RM1A 5AANA 1QJTA 2EC6B 2PSRA 1SMGA 1KK8B 3ZWHA 1N65A 1B9AA 1LKJA 2L0PA 1KFUL 2LHLA 3IQOA 1QATA 3QRXA 1KK7Y 1TNQA 3BUWB 1MHOA 1YUUA 2LVIA 1KFUS 4PE0A 4JPZB 1QIWA 3BOWA 3I5HC 1B4CA 4P5OE 2H61A 2JC2A 1QLSA 1DJIA 1CTRA 1EXRA 1PVBA 5JOLA 2GGZA 1ZFSA 3TUYC 2JXLA 5G08A 2FJUB 1H4BA 1AJ5A 1BR1B 3O2PA 4I5NB 3BXKA 2ZN9A 5AFPA 2K8MB 2K61A 1B7TY 4CPVA 2AAOA 1F55A 1G8IA 1WRLA 1XK4C 1B47A 2LAPA 2JRFA 4C0JA 3DVEA 4FTGA 1XFVO 1RWYA 3BYAA 1KCYA 2NLNA 2ZRTA 3AAJA 2F33A 2AMIA 2KNEA 4ZCUA 3AAKA 1YRTB 4GGNA 4MRXA 2Y5IA 4C0LA 3I5HB 1J7PA 1EL4A 1CMGA 3EKHA 1F8HA 2M9GA 4MN0A 3KF9A 1DJXA 4MEWA 2LM5A 2WCEA 3TUYB 3KEVA 1XYDA 2D8NA 3OP0A 5HKWA 1IKUA 2BE6A 3O4YA 1FI6A 4AOMA 2K7BA 1QS7A 1YR5A 1BF5A 1CKKA 2WCBA 1GJYA 2K7CA 2MRDA 2KBIA 2L51A 4U8DA 1M31A 4NDDA 1NPQA 2HF5A 1OOJA 4XYNA 3CS1A 1KSMA 2K7DA 2BBNA 5KTYA 1GGWA 4PHKA 1QXPA 1XFYO 4CLNA 2JOJA 1J7RA 3A8RA 3F45A 4HREE 1XFXO 5HYDA 1JSAA 2OTGC 3VGOA 1SRAA 3EKJA 3SG6A 1SR6C 1C7VA 3CR5X 1YRUB 3C1VA 1ALWA 2AUCA 5AERA 1QV1A 2LVKA 2GV5A 3AKAA 1CDPA 3GK4X 1XK4A 4PE1A 1SW8A 3WXAA 5DKQA 5HLOA 1GQMA 2CBLA 4GGFC 3TZ1A 1BMOA 2LLTA 4ORBB 1XO5A 1K96A 2FCEA 3I5GC 2LC5A 1WRKA 4MZJA 5DKNA 4N1GA 1BLQA 2HETA 5TNCA 2LE9B 2B1UA 2Q4UA 2RGIA 2K2AA 3BUMB 1NCXA 3ZNIA 1LA0A 4USLA 2OTGB 4CIDA 2M1KB 3FWCA 5CSFA 1V1GA 1KQVA 3SG4A 1SR6B 1S36A 3IF7A 3CWGA 1A75B 4XJKB 2M7NA 1J1EA
chains in the Genus database with same CATH superfamily
2Q91A 1V1FA 2LVJA 1SL7A 4BY4A 1QIVA 2KYCA 4Q04A 3K1EA 5AEQA 3VROA 4JQ0D 2MLFC 4MSPA 2M7LA 1J55A 1ZMZA 1CMFA 1DEKA 2F3YA 3ICBA 2KLEA 4D1EA 2QEBA 1NSHA 2P70A 1M39A 2L2CA 3I5GB 5IBWA 2CT9A 3R1OA 1EG3A 2JPTA 1J7QA 1K9KA 1JF0A 1XFWO 3D0YB 1DJGA 2TN4A 4PHMA 1FF1A 1WLZA 1RTP1 1FPWA 4KYNA 4QJ3B 1SK6D 1J1DA 2WC8A 1DJZA 3PALA 1UWOA 2KPHA 1BU3A 1QX7A 2KOTA 1PVAA 3CTNA 1QX5B 4I5LB 2L5YA 3RZSA 2LUCA 4DUQA 3EK4A 3OX6A 3KHEA 2KI6D 4GPLB 3S0DA 3FS7A 1TTXA 3AKBA 1A75A 2HPSA 2IS9A 2NXQA 3HX4A 3I5IC 4XJKA 4CFQA 4DS7A 1JC2A 1CLLA 3R1PA 4PT1A 2LCPA 2M0RA 1P28A 3HCMA 2BECA 2F3ZA 4YGDB 5I8NA 4M2OA 1PALA 4M2QA 1X02A 1N2DA 5HL1A 3PATA 2JU0A 2QEHA 4GGFA 3GK2A 2JTTA 1F54A 1ZOTB 1SL9A 2LVVA 4MBEA 2ZN8A 1LXFC 2MHHA 3NHTA 4NDCA 2P71A 1MXLC 4PHNA 1A4PA 1VRKA 3D0YA 1WLMA 2BCAA 1C3ZA 3TDUA 5GQQC 1QVIZ 1OE9B 1WRZA 2L4HA 1CB1A 2F2OA 1PULA 2BKIB 1TNPA 1TRFA 3OGNA 5I2LA 3EVRA 1DQEA 2QEVA 3I5IB 1TNXA 1Z4HA 4GAOA 2NCOA 1OMDA 1IG5A 1R2UA 3D73A 3DXLA 1NCZA 4F0ZB 3O6BA 4QJ5B 4GBAA 2Y1MA 1W7IB 4AQJA 4YRUA 2M49B 1CFDA 3B7AA 3M0WA 1MQ1A 4OCIA 3GK1A 4OZDA 2KGBC 1IWQA 2QDIA 3CGAA 3PLFB 4WQ2A 3S0FA 1EG4A 1TOPA 3DVJA 3VRRA 1A29A 3CZ0A 1DGUA 3PM8A 1WDCC 2NCPA 3KPXA 1F4QA 1OMRA 1IGVA 1CLBA 1K2HA 3DD4A 3R1VA 1SKTA 2F8PA 1CDNA 2ERBA 1XVJA 3SG5A 4ORCB 3TDZA 1S26D 1F4OA 1S1EA 1FW4A 1YUSA 1J7OA 1WY9A 2G9BA 1B8RA 1RK9A 2KDHA 2WOSA 3EVUA 3UO9A 2WCHA 1LINA 3MSEB 2MA2A 1BJFA 5AXIA 1TWOA 1AP4A 1F70A 1B8CA 3BUOB 3D77A 1SCMC 2PYQA 2JNXA 1QX2A 3B87A 4OKHA 2M97A 3L4LA 2LLUA 4NDBA 4PE7A 1M45A 1AVSA 2I94A 1WDCB 2GGMA 2JT3A 1MUXA 4P2YB 3IQQA 3BUXB 1IJ5A 2I18A 2KGRA 2ZRSA 3CZ2A 3JVTC 1SNLA 5D3OA 3VB1A 2LUXA 2M8UA 1SL8A 2PALA 2KFHA 1QVIY 1CNPA 2HQWA 2KBMA 2WC6A 2HQ8A 1MXEA 2DOQA 1NP8A 1MR8A 2LLSA 2SCPA 4MVFA 1K95A 1LVCD 1SBJA 1YVLA 4ETOA 5D7FA 1XA5A 3OB1B 1SCMB 2ZFDA 4UPGA 3WNXB 3K21A 5CSIA 2BL0C 4FQOA 3NSKA 1KWOC 1OMVA 1MWNA 1NCYA 1UHIA 1SYMA 3GOFA 4PHJA 4I5JA 3B88A 1OOIX 1CLMA 3N7HA 4DCKA 3B86A 3JVTB 2WCFA 1OSAA 4CFRA 1YUTA 3FE8A 1S5GZ 3NXAA 3O78A 1HQVA 5F6TA 2LMVA 3KO0A 1BG1A 1NWDA 1KFXS 1Y0VH 1NYAA 1AUIB 2O5GA 3DVMA 2LANA 1Y1UA 1SCVA 5K89A 1H8BA 1R6PA 2E30A 2MJWB 2JQ6A 4A4BA 2JTZA 1A2XA 3PM2A 3VRNA 5B8IB 3RLZA 1GGZA 1TUJA 1ODBA 1B1GA 1EH2A 1DC1A 3VRPA 2BL0B 1UHKA 3SG2A 1JUOA 5BPJA 2OPOA 1KWOB 4PE4A 4E68A 3IVTA 5PALA 3NSIA 1YVHA 3BFHA 4YI8A 1DT7B 1CM1A 2K7OA 2PMYA 2M29A 4DIRA 4ICBA 3D74A 1AHRA 3CLNA 3EK8A 4HRHA 1DJWA 3NSLA 1B8LA 3S0GA 2H8VA 1Y1AA 1LS8A 1RFJA 1FI5A 1LA3A 3SIBA 1A03A 1RECA 2VRGA 3SG3A 1DF0B 4GNKB 1DVIA 1MF8B 1QTXA 3EVVA 1W7JB 1M63B 1ZACA 4IL1A 1DJHA 2KSPA 3S0BA 5HKYA 2KI4C 3PN7C 3L4AA 4OVNF 2Y4QA 5FYXA 1BT6A 1N0YA 2BKHB 5HLVA 1TNWA 5I2OA 1JFKA 1YX7A 1Z2CB 2COLB 2EGDA 1BOCA 3LL8B 1DGVA 1TN4A 4PALA 1PSBA 2EHBA 5J3XA 2ISDA 4YGEB 5KSZA 3TS5C 1K8UA 1Y1XA 5ER4X 5HKZA 2ZNEA 1PSRA 2CXJA 1S6JA 1M46A 1BODA 1JWDA 2KFFA 1K90D 1CFFA 2KQYA 2MLEC 3H4SE 4IJ7A 2F2PA 3DY9A 1CFCA 3LK0A 1IJ6A 2KI4B 3PN7B 1CFPA 2M1UA 1AJ4A 3Q8IA 1QASA 5JJGA 1S5GY 4MRYA 5CPVA 1L2OC 2R2IA 1DF0A 2A4JA 1XFRA 4TNCA 4HSZA 1EJ3A 1ZUZA 2BE4A 3SS4A 4PDZA 2JT8A 4YGAA 3BFAA 1IQ5A 2WCJA 1U5IB 1NUBA 1XFUO 3TS5B 1K9PA 2KAYA 4YBHB 1G33A 2K2FA 1DTLA 1D1OA 1CDLA 3O4XA 1RJVA 2JPOA 2LMTA 3I5FC 5ER5A 1C3YA 2ZNDA 1XFZO 5DICA 1JBAA 3WHTB 5FI2A 2LP2A 2L50A 1CDMA 1UHHA 3PSRA 4R1EA 1AK8A 1L2OB 4OR9B 1NX1A 1KSOA 2O60A 1QLKA 2OS8C 2KI6C 1SY9A 2JWWA 2PVBA 1TCFA 1DMOA 1IQ3A 1KQMC 3FIAA 3UNWA 1YTZC 2LP3A 3DF0B 2KAVA 2H2KA 1S6IA 2LNKA 2SASA 1UUSA 2CNPA 3LCPC 3LK1A 1UP5A 2MAZA 4WQ3A 3SS3A 2FCDA 3SG7A 4ZCVA 2L2EA 3L47A 2CCMA 2V53A 1S3PA 2WNDA 1K93D 4WRIA 2KYFA 4YGCB 3V2LA 3D10A 2E6WA 3I5FB 3JTDC 1U5IA 4YGBB 3SIAA 4N1FA 1OZSA 2JULA 2BBMA 3CR4X 4ORAB 4F7FA 1BR4B 1DELA 3LLEA 3EK7A 3NSOA 1TCOB 3CR2A 4AQIA 5D69A 3PFVA 2M3WA 3SJSA 1K9UA 1L7ZA 2PASA 1FBVA 3BQ3A 3D78A 2OS8B 4JD9A 1KK7Z 1C07A 3SS5A 1JF2A 2JXCA 3CZTX 3DVKA 1KQMB 4N5XA 1NIWA 2K60A 1E8AA 2PQLA 5FI6A 3OX5A 3PJIA 4C0KA 5CSNA 1IIOA 3TDIA 2H61C 2LHIA 3S0EA 1TIZA 4BY5A 2L98A 2WC5A 3WHUB 3DF0A 4DRWA 4M2PA 5I2QA 3JTDB 2LMUA 1PRWA 1KFXL 1OQPA 2QACA 2P6BB 1CM4A 3FWBA 2Y1NA 1B7TZ 2FOTA 4YI9A 1JFJA 2G2BA 3OB2B 4GFTA 2NZ0A 5CSJA 4QJ4B 2KFGA 1UURA 1YURA 2KHNA 4MZKA 4OV2A 1IH0A 2BAPA 1F71A 1DJYA 1NX3A 1ORGA 2BCXA 4MLWA 1HT9A 1IRJA 1RROA 1YX8A 2WCMA 3VRQA 1NX2A 4HRGA 2KAXA 4GUKA 2CTNA 2EC6C 1SPYA 1KK8C 1K94A 1NX0A 5DKRA 1OZOA 4PCWA 4JWQA 1PK0D 3BOWB 1Y6WA 2JZIA 2KLDA 3A4UB 2K0JA 3CABA 1Q80A 1QV0A 3E3RA 2I2RE 3QMEA 1S6CA 2WORA 2YGUA 4L9MA 1C7WA 4A4CA 2L4IA 2JT0A 2KQ6A 1UHJA 3S0AA 3R72A 2L5XB 1ALVA 1UHNA 2QPTA 2ZKMX 3NHIA 3OHMB 4NQGA 2MBXA 1G4YR 2LV7A 2PRUA 3BUNB 4I5KA 2JNFA 5KU1A 2BCBA 4MZLA 2I7AA 3RM1A 5AANA 1OW4A 1QJTA 2EC6B 1SSEB 2PSRA 1SMGA 1KK8B 3ZWHA 1N65A 1QWVA 4JKTA 1B9AA 1LKJA 4INWA 2L0PA 1KFUL 2LHLA 3IQOA 1QATA 3QRXA 1KK7Y 1TNQA 3OBVA 3BUWB 1MHOA 1YUUA 2LVIA 1KFUS 1TUZA 4PE0A 3CDNA 4JPZB 1QIWA 3BOWA 3I5HC 1B4CA 4P5OE 2H61A 2JC2A 1QLSA 1DJIA 1CTRA 1EXRA 1PVBA 5JOLA 2GGZA 1T14A 1ZFSA 3TUYC 2JXLA 5G08A 2FJUB 1H4BA 1AJ5A 1BR1B 3O2PA 4I5NB 3BXKA 3EG5B 2ZN9A 5AFPA 3D76A 2K8MB 2K61A 1B7TY 4CPVA 2AAOA 1F55A 1G8IA 1WRLA 1XK4C 1B47A 1W9ZA 4FQTA 2LAPA 2JRFA 4C0JA 3DVEA 4FTGA 1XFVO 1RWYA 3BYAA 1KCYA 2NLNA 2ZRTA 3AAJA 2F33A 2AMIA 2KNEA 4ZCUA 2QEOA 3AAKA 1YRTB 4GGNA 4MRXA 2Y5IA 4C0LA 3I5HB 1J7PA 1EL4A 1CMGA 3EKHA 1F8HA 2M9GA 4MN0A 3KF9A 1DJXA 4MEWA 2LM5A 2WCEA 3TUYB 3KEVA 1XYDA 3CYZA 2D8NA 3OP0A 5HKWA 1IKUA 2BE6A 3O4YA 1FI6A 3NGVA 2WCKA 4AOMA 3BJHA 3BFBA 3CZ1A 1OOFA 2K7BA 1QS7A 1YR5A 3DYEA 1BF5A 1CKKA 1OOGA 2WCBA 1GJYA 2K7CA 2MRDA 2KBIA 2L51A 4U8DA 1M31A 4NDDA 1NPQA 3FE6A 2HF5A 1OOJA 2FJYA 4XYNA 3CS1A 1KSMA 2K7DA 2BBNA 5KTYA 1GGWA 4PHKA 1QXPA 1XFYO 4CLNA 2JOJA 1J7RA 3A8RA 3F45A 1OOHA 4HREE 1XFXO 5HYDA 1JSAA 2OTGC 3B6XA 3VGOA 1SRAA 3EKJA 3SG6A 1SR6C 5I94A 1C7VA 3CR5X 1YRUB 3C1VA 1ALWA 2AUCA 5AERA 1QV1A 2LVKA 2GV5A 3AKAA 1CDPA 3GK4X 1XK4A 4PE1A 1SW8A 3WXAA 3D75A 5DKQA 5HLOA 3FE9A 1GQMA 2CBLA 4GGFC 3TZ1A 1BMOA 2LLTA 4ORBB 4INXA 1XO5A 1K96A 2FCEA 3I5GC 2LC5A 1WRKA 4MZJA 5DKNA 5FI7A 3DZTA 4N1GA 1BLQA 2HETA 5TNCA 2LE9B 2WCLA 2B1UA 2Q4UA 2RGIA 2K2AA 1GM0A 3BUMB 2GTEA 1NCXA 3ZNIA 1LA0A 4USLA 2OTGB 4CIDA 2M1KB 3FWCA 2BNXA 1V1GA 5CSFA 3SG4A 1SR6B 1S36A 5EL2A 1KQVA 3IF7A 3CWGA 1A75B 4XJKB 2M7NA 1J1EA
chains in the Genus database with same CATH topology
2Q91A 1V1FA 2LVJA 1SL7A 4BY4A 1QIVA 2KYCA 4Q04A 5AEQA 3VROA 4JQ0D 2MLFC 4MSPA 2M7LA 1J55A 1ZMZA 1CMFA 2F3YA 3ICBA 4D1EA 1NSHA 1M39A 3I5GB 5IBWA 2CT9A 1EG3A 2JPTA 1J7QA 1K9KA 1JF0A 1XFWO 3D0YB 1DJGA 2TN4A 4PHMA 1FF1A 1WLZA 1RTP1 1FPWA 4QJ3B 1SK6D 1J1DA 2WC8A 1DJZA 3PALA 1UWOA 2KOTA 1BU3A 1QX7A 1PVAA 3CTNA 1QX5B 4I5LB 2LUCA 4DUQA 3EK4A 3OX6A 3KHEA 2KI6D 4GPLB 3FS7A 1TTXA 3AKBA 1A75A 2HPSA 2IS9A 2NXQA 3HX4A 3I5IC 4XJKA 4CFQA 4DS7A 1JC2A 1CLLA 2LCPA 2M0RA 3HCMA 2BECA 2F3ZA 4YGDB 5I8NA 4M2OA 1PALA 4M2QA 1X02A 1N2DA 3PATA 2JU0A 4GGFA 3GK2A 2JTTA 1F54A 1ZOTB 1SL9A 2LVVA 4MBEA 2ZN8A 1LXFC 2MHHA 4NDCA 1MXLC 4PHNA 1A4PA 1VRKA 3D0YA 1WLMA 2BCAA 3TDUA 5GQQC 1QVIZ 1OE9B 1WRZA 2L4HA 1CB1A 2F2OA 1PULA 2BKIB 1TNPA 1TRFA 5I2LA 3EVRA 3I5IB 1TNXA 4GAOA 2NCOA 1OMDA 1IG5A 1R2UA 1NCZA 4F0ZB 3O6BA 4QJ5B 4GBAA 2Y1MA 1W7IB 4AQJA 4YRUA 2M49B 1CFDA 3M0WA 1MQ1A 4OCIA 3GK1A 2KGBC 1IWQA 3CGAA 3PLFB 4WQ2A 1EG4A 1TOPA 3DVJA 3VRRA 1A29A 1DGUA 3PM8A 1WDCC 2NCPA 3KPXA 1F4QA 1OMRA 1IGVA 1CLBA 1K2HA 3DD4A 1SKTA 2F8PA 1CDNA 1XVJA 3SG5A 4ORCB 3TDZA 1S26D 1F4OA 1S1EA 1FW4A 1YUSA 1J7OA 1WY9A 2G9BA 1B8RA 1RK9A 2KDHA 2WOSA 3EVUA 1LINA 3MSEB 2MA2A 1BJFA 5AXIA 1AP4A 1F70A 1B8CA 3BUOB 1SCMC 2JNXA 1QX2A 4OKHA 2M97A 2LLUA 4NDBA 4PE7A 1M45A 1AVSA 2I94A 1WDCB 2GGMA 2JT3A 1MUXA 4P2YB 3IQQA 3BUXB 1IJ5A 2I18A 2KGRA 2ZRSA 3JVTC 1SNLA 2LUXA 2M8UA 1SL8A 2PALA 2KFHA 1QVIY 1CNPA 2HQWA 2KBMA 2HQ8A 1MXEA 2DOQA 1NP8A 1MR8A 2LLSA 2SCPA 4MVFA 1K95A 1LVCD 1SBJA 1YVLA 4ETOA 5D7FA 1XA5A 3OB1B 1SCMB 2ZFDA 4UPGA 3WNXB 3K21A 5CSIA 2BL0C 4FQOA 3NSKA 1KWOC 1OMVA 1MWNA 1NCYA 1UHIA 1SYMA 3GOFA 4PHJA 4I5JA 1CLMA 4DCKA 3JVTB 2WCFA 1OSAA 4CFRA 1YUTA 1S5GZ 3NXAA 3O78A 1HQVA 5F6TA 2LMVA 3KO0A 1BG1A 1NWDA 1KFXS 1Y0VH 1NYAA 1AUIB 2O5GA 3DVMA 2LANA 1Y1UA 1SCVA 5K89A 1H8BA 1R6PA 2E30A 2MJWB 2JQ6A 4A4BA 2JTZA 1A2XA 3VRNA 5B8IB 3RLZA 1GGZA 1ODBA 1B1GA 1EH2A 3VRPA 2BL0B 1UHKA 3SG2A 1JUOA 5BPJA 2OPOA 1KWOB 4PE4A 4E68A 5PALA 3NSIA 1YVHA 4YI8A 1DT7B 1CM1A 2K7OA 2PMYA 2M29A 4DIRA 4ICBA 1AHRA 3CLNA 3EK8A 4HRHA 1DJWA 3NSLA 1B8LA 1Y1AA 1RFJA 1FI5A 1LA3A 3SIBA 1A03A 1RECA 2VRGA 3SG3A 1DF0B 4GNKB 1DVIA 1MF8B 1QTXA 3EVVA 1W7JB 1M63B 1ZACA 4IL1A 1DJHA 2KSPA 5HKYA 2KI4C 3PN7C 4OVNF 2Y4QA 5FYXA 1BT6A 1N0YA 2BKHB 5HLVA 1TNWA 5I2OA 1JFKA 1YX7A 2COLB 2EGDA 1BOCA 3LL8B 1DGVA 1TN4A 4PALA 1PSBA 2EHBA 5J3XA 2ISDA 4YGEB 5KSZA 3TS5C 1K8UA 1Y1XA 5ER4X 5HKZA 2ZNEA 1PSRA 2CXJA 1S6JA 1M46A 1BODA 1JWDA 2KFFA 1K90D 1CFFA 2KQYA 2MLEC 3H4SE 2F2PA 1CFCA 3LK0A 1IJ6A 2KI4B 3PN7B 1CFPA 2M1UA 1AJ4A 1QASA 5JJGA 1S5GY 4MRYA 5CPVA 1L2OC 2R2IA 1DF0A 2A4JA 4TNCA 4HSZA 1EJ3A 1ZUZA 2BE4A 4PDZA 2JT8A 4YGAA 1IQ5A 1U5IB 1NUBA 1XFUO 3TS5B 1K9PA 2KAYA 4YBHB 1G33A 2K2FA 1DTLA 1D1OA 1CDLA 1RJVA 2LMTA 3I5FC 5ER5A 2ZNDA 1XFZO 1JBAA 3WHTB 2LP2A 2L50A 1CDMA 1UHHA 3PSRA 4R1EA 1AK8A 1L2OB 4OR9B 1NX1A 1KSOA 2O60A 1QLKA 2OS8C 2KI6C 1SY9A 2JWWA 2PVBA 1TCFA 1DMOA 1IQ3A 1KQMC 3FIAA 1YTZC 2LP3A 3DF0B 2KAVA 2H2KA 1S6IA 2LNKA 2SASA 1UUSA 2CNPA 3LCPC 3LK1A 1UP5A 2MAZA 4WQ3A 2FCDA 3SG7A 4ZCVA 2L2EA 2CCMA 2V53A 1S3PA 2WNDA 1K93D 4WRIA 2KYFA 4YGCB 3D10A 2E6WA 3I5FB 3JTDC 1U5IA 4YGBB 3SIAA 4N1FA 1OZSA 2JULA 2BBMA 3CR4X 4ORAB 1BR4B 3NSOA 3LLEA 3EK7A 1TCOB 3CR2A 4AQIA 5D69A 3PFVA 2M3WA 3SJSA 1K9UA 1L7ZA 2PASA 1FBVA 3BQ3A 1C07A 2OS8B 1KK7Z 1JF2A 2JXCA 3CZTX 3DVKA 1KQMB 4N5XA 1NIWA 1E8AA 3OX5A 4C0KA 5CSNA 3TDIA 2H61C 2LHIA 5I2QA 1TIZA 4BY5A 2L98A 3WHUB 4DRWA 3DF0A 4M2PA 3JTDB 2LMUA 1PRWA 1KFXL 1OQPA 2QACA 2P6BB 1CM4A 3FWBA 2Y1NA 1B7TZ 2FOTA 4YI9A 1JFJA 2G2BA 3OB2B 4GFTA 2NZ0A 5CSJA 4QJ4B 2KFGA 1UURA 1YURA 2KHNA 4MZKA 4OV2A 1IH0A 1F71A 1DJYA 1NX3A 2BCXA 4MLWA 1HT9A 1IRJA 1RROA 1YX8A 3VRQA 1NX2A 4HRGA 2KAXA 4GUKA 2CTNA 2EC6C 1SPYA 1KK8C 1K94A 1NX0A 5DKRA 1OZOA 4PCWA 4JWQA 1PK0D 3BOWB 1Y6WA 2JZIA 3A4UB 2K0JA 1Q80A 1QV0A 3E3RA 2I2RE 1S6CA 2WORA 4L9MA 1C7WA 4A4CA 2L4IA 2JT0A 2KQ6A 1UHJA 2L5XB 1ALVA 1UHNA 2QPTA 2ZKMX 3OHMB 4NQGA 2MBXA 1G4YR 2LV7A 2PRUA 3BUNB 4I5KA 2JNFA 5KU1A 2BCBA 4MZLA 2I7AA 3RM1A 5AANA 1QJTA 2EC6B 2PSRA 1SMGA 1KK8B 3ZWHA 1N65A 1B9AA 1LKJA 2L0PA 1KFUL 2LHLA 3IQOA 1QATA 3QRXA 1KK7Y 1TNQA 3BUWB 1MHOA 1YUUA 2LVIA 1KFUS 4PE0A 4JPZB 1QIWA 3BOWA 3I5HC 1B4CA 4P5OE 2H61A 2JC2A 1QLSA 1DJIA 1CTRA 1EXRA 1PVBA 5JOLA 2GGZA 1ZFSA 3TUYC 2JXLA 5G08A 2FJUB 1H4BA 1AJ5A 1BR1B 3O2PA 4I5NB 3BXKA 2ZN9A 5AFPA 2K8MB 2K61A 1B7TY 4CPVA 2AAOA 1F55A 1G8IA 1WRLA 1XK4C 1B47A 2LAPA 2JRFA 4C0JA 3DVEA 4FTGA 1XFVO 1RWYA 3BYAA 1KCYA 2NLNA 2ZRTA 3AAJA 2F33A 2AMIA 2KNEA 4ZCUA 3AAKA 1YRTB 4GGNA 4MRXA 2Y5IA 4C0LA 3I5HB 1J7PA 1EL4A 1CMGA 3EKHA 1F8HA 2M9GA 4MN0A 3KF9A 1DJXA 4MEWA 2LM5A 2WCEA 3TUYB 3KEVA 1XYDA 2D8NA 3OP0A 5HKWA 1IKUA 2BE6A 3O4YA 1FI6A 4AOMA 2K7BA 1QS7A 1YR5A 1BF5A 1CKKA 2WCBA 1GJYA 2K7CA 2MRDA 2KBIA 2L51A 4U8DA 1M31A 4NDDA 1NPQA 2HF5A 1OOJA 4XYNA 3CS1A 1KSMA 2K7DA 2BBNA 5KTYA 1GGWA 4PHKA 1QXPA 1XFYO 4CLNA 2JOJA 1J7RA 3A8RA 3F45A 4HREE 1XFXO 5HYDA 1JSAA 2OTGC 3VGOA 1SRAA 3EKJA 3SG6A 1SR6C 1C7VA 3CR5X 1YRUB 3C1VA 1ALWA 2AUCA 5AERA 1QV1A 2LVKA 2GV5A 3AKAA 1CDPA 3GK4X 1XK4A 4PE1A 1SW8A 3WXAA 5DKQA 5HLOA 1GQMA 2CBLA 4GGFC 3TZ1A 1BMOA 2LLTA 4ORBB 1XO5A 1K96A 2FCEA 3I5GC 2LC5A 1WRKA 4MZJA 5DKNA 4N1GA 1BLQA 2HETA 5TNCA 2LE9B 2B1UA 2Q4UA 2RGIA 2K2AA 3BUMB 1NCXA 3ZNIA 1LA0A 4USLA 2OTGB 4CIDA 2M1KB 3FWCA 5CSFA 1V1GA 1KQVA 3SG4A 1SR6B 1S36A 3IF7A 3CWGA 1A75B 4XJKB 2M7NA 1J1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q91 A;  1V1F A;  2LVJ A;  1SL7 A;  4BY4 A;  1QIV A;  2KYC A;  4Q04 A;  5AEQ A;  3VRO A;  4JQ0 D;  2MLF C;  4MSP A;  2M7L A;  1J55 A;  1ZMZ A;  1CMF A;  2F3Y A;  3ICB A;  4D1E A;  1NSH A;  1M39 A;  3I5G B;  5IBW A;  2CT9 A;  1EG3 A;  2JPT A;  1J7Q A;  1K9K A;  1JF0 A;  1XFW O;  3D0Y B;  1DJG A;  2TN4 A;  4PHM A;  1FF1 A;  1WLZ A;  1RTP 1;  1FPW A;  4QJ3 B;  1SK6 D;  1J1D A;  2WC8 A;  1DJZ A;  3PAL A;  1UWO A;  2KOT A;  1BU3 A;  1QX7 A;  1PVA A;  3CTN A;  1QX5 B;  4I5L B;  2LUC A;  4DUQ A;  3EK4 A;  3OX6 A;  3KHE A;  2KI6 D;  4GPL B;  3FS7 A;  1TTX A;  3AKB A;  1A75 A;  2HPS A;  2IS9 A;  2NXQ A;  3HX4 A;  3I5I C;  4XJK A;  4CFQ A;  4DS7 A;  1JC2 A;  1CLL A;  2LCP A;  2M0R A;  3HCM A;  2BEC A;  2F3Z A;  4YGD B;  5I8N A;  4M2O A;  1PAL A;  4M2Q A;  1X02 A;  1N2D A;  3PAT A;  2JU0 A;  4GGF A;  3GK2 A;  2JTT A;  1F54 A;  1ZOT B;  1SL9 A;  2LVV A;  4MBE A;  2ZN8 A;  1LXF C;  2MHH A;  4NDC A;  1MXL C;  4PHN A;  1A4P A;  1VRK A;  3D0Y A;  1WLM A;  2BCA A;  3TDU A;  5GQQ C;  1QVI Z;  1OE9 B;  1WRZ A;  2L4H A;  1CB1 A;  2F2O A;  1PUL A;  2BKI B;  1TNP A;  1TRF A;  5I2L A;  3EVR A;  3I5I B;  1TNX A;  4GAO A;  2NCO A;  1OMD A;  1IG5 A;  1R2U A;  1NCZ A;  4F0Z B;  3O6B A;  4QJ5 B;  4GBA A;  2Y1M A;  1W7I B;  4AQJ A;  4YRU A;  2M49 B;  1CFD A;  3M0W A;  1MQ1 A;  4OCI A;  3GK1 A;  2KGB C;  1IWQ A;  3CGA A;  3PLF B;  4WQ2 A;  1EG4 A;  1TOP A;  3DVJ A;  3VRR A;  1A29 A;  1DGU A;  3PM8 A;  1WDC C;  2NCP A;  3KPX A;  1F4Q A;  1OMR A;  1IGV A;  1CLB A;  1K2H A;  3DD4 A;  1SKT A;  2F8P A;  1CDN A;  1XVJ A;  3SG5 A;  4ORC B;  3TDZ A;  1S26 D;  1F4O A;  1S1E A;  1FW4 A;  1YUS A;  1J7O A;  1WY9 A;  2G9B A;  1B8R A;  1RK9 A;  2KDH A;  2WOS A;  3EVU A;  1LIN A;  3MSE B;  2MA2 A;  1BJF A;  5AXI A;  1AP4 A;  1F70 A;  1B8C A;  3BUO B;  1SCM C;  2JNX A;  1QX2 A;  4OKH A;  2M97 A;  2LLU A;  4NDB A;  4PE7 A;  1M45 A;  1AVS A;  2I94 A;  1WDC B;  2GGM A;  2JT3 A;  1MUX A;  4P2Y B;  3IQQ A;  3BUX B;  1IJ5 A;  2I18 A;  2KGR A;  2ZRS A;  3JVT C;  1SNL A;  2LUX A;  2M8U A;  1SL8 A;  2PAL A;  2KFH A;  1QVI Y;  1CNP A;  2HQW A;  2KBM A;  2HQ8 A;  1MXE A;  2DOQ A;  1NP8 A;  1MR8 A;  2LLS A;  2SCP A;  4MVF A;  1K95 A;  1LVC D;  1SBJ A;  1YVL A;  4ETO A;  5D7F A;  1XA5 A;  3OB1 B;  1SCM B;  2ZFD A;  4UPG A;  3WNX B;  3K21 A;  5CSI A;  2BL0 C;  4FQO A;  3NSK A;  1KWO C;  1OMV A;  1MWN A;  1NCY A;  1UHI A;  1SYM A;  3GOF A;  4PHJ A;  4I5J A;  1CLM A;  4DCK A;  3JVT B;  2WCF A;  1OSA A;  4CFR A;  1YUT A;  1S5G Z;  3NXA A;  3O78 A;  1HQV A;  5F6T A;  2LMV A;  3KO0 A;  1BG1 A;  1NWD A;  1KFX S;  1Y0V H;  1NYA A;  1AUI B;  2O5G A;  3DVM A;  2LAN A;  1Y1U A;  1SCV A;  5K89 A;  1H8B A;  1R6P A;  2E30 A;  2MJW B;  2JQ6 A;  4A4B A;  2JTZ A;  1A2X A;  3VRN A;  5B8I B;  3RLZ A;  1GGZ A;  1ODB A;  1B1G A;  1EH2 A;  3VRP A;  2BL0 B;  1UHK A;  3SG2 A;  1JUO A;  5BPJ A;  2OPO A;  1KWO B;  4PE4 A;  4E68 A;  5PAL A;  3NSI A;  1YVH A;  4YI8 A;  1DT7 B;  1CM1 A;  2K7O A;  2PMY A;  2M29 A;  4DIR A;  4ICB A;  1AHR A;  3CLN A;  3EK8 A;  4HRH A;  1DJW A;  3NSL A;  1B8L A;  1Y1A A;  1RFJ A;  1FI5 A;  1LA3 A;  3SIB A;  1A03 A;  1REC A;  2VRG A;  3SG3 A;  1DF0 B;  4GNK B;  1DVI A;  1MF8 B;  1QTX A;  3EVV A;  1W7J B;  1M63 B;  1ZAC A;  4IL1 A;  1DJH A;  2KSP A;  5HKY A;  2KI4 C;  3PN7 C;  4OVN F;  2Y4Q A;  5FYX A;  1BT6 A;  1N0Y A;  2BKH B;  5HLV A;  1TNW A;  5I2O A;  1JFK A;  1YX7 A;  2COL B;  2EGD A;  1BOC A;  3LL8 B;  1DGV A;  1TN4 A;  4PAL A;  1PSB A;  2EHB A;  5J3X A;  2ISD A;  4YGE B;  5KSZ A;  3TS5 C;  1K8U A;  1Y1X A;  5ER4 X;  5HKZ A;  2ZNE A;  1PSR A;  2CXJ A;  1S6J A;  1M46 A;  1BOD A;  1JWD A;  2KFF A;  1K90 D;  1CFF A;  2KQY A;  2MLE C;  3H4S E;  2F2P A;  1CFC A;  3LK0 A;  1IJ6 A;  2KI4 B;  3PN7 B;  1CFP A;  2M1U A;  1AJ4 A;  1QAS A;  5JJG A;  1S5G Y;  4MRY A;  5CPV A;  1L2O C;  2R2I A;  1DF0 A;  2A4J A;  4TNC A;  4HSZ A;  1EJ3 A;  1ZUZ A;  2BE4 A;  4PDZ A;  2JT8 A;  4YGA A;  1IQ5 A;  1U5I B;  1NUB A;  1XFU O;  3TS5 B;  1K9P A;  2KAY A;  4YBH B;  1G33 A;  2K2F A;  1DTL A;  1D1O A;  1CDL A;  1RJV A;  2LMT A;  3I5F C;  5ER5 A;  2ZND A;  1XFZ O;  1JBA A;  3WHT B;  2LP2 A;  2L50 A;  1CDM A;  1UHH A;  3PSR A;  4R1E A;  1AK8 A;  1L2O B;  4OR9 B;  1NX1 A;  1KSO A;  2O60 A;  1QLK A;  2OS8 C;  2KI6 C;  1SY9 A;  2JWW A;  2PVB A;  1TCF A;  1DMO A;  1IQ3 A;  1KQM C;  3FIA A;  1YTZ C;  2LP3 A;  3DF0 B;  2KAV A;  2H2K A;  1S6I A;  2LNK A;  2SAS A;  1UUS A;  2CNP A;  3LCP C;  3LK1 A;  1UP5 A;  2MAZ A;  4WQ3 A;  2FCD A;  3SG7 A;  4ZCV A;  2L2E A;  2CCM A;  2V53 A;  1S3P A;  2WND A;  1K93 D;  4WRI A;  2KYF A;  4YGC B;  3D10 A;  2E6W A;  3I5F B;  3JTD C;  1U5I A;  4YGB B;  3SIA A;  4N1F A;  1OZS A;  2JUL A;  2BBM A;  3CR4 X;  4ORA B;  1BR4 B;  3NSO A;  3LLE A;  3EK7 A;  1TCO B;  3CR2 A;  4AQI A;  5D69 A;  3PFV A;  2M3W A;  3SJS A;  1K9U A;  1L7Z A;  2PAS A;  1FBV A;  3BQ3 A;  1C07 A;  2OS8 B;  1KK7 Z;  1JF2 A;  2JXC A;  3CZT X;  3DVK A;  1KQM B;  4N5X A;  1NIW A;  1E8A A;  3OX5 A;  4C0K A;  5CSN A;  3TDI A;  2H61 C;  2LHI A;  5I2Q A;  1TIZ A;  4BY5 A;  2L98 A;  3WHU B;  4DRW A;  3DF0 A;  4M2P A;  3JTD B;  2LMU A;  1PRW A;  1KFX L;  1OQP A;  2QAC A;  2P6B B;  1CM4 A;  3FWB A;  2Y1N A;  1B7T Z;  2FOT A;  4YI9 A;  1JFJ A;  2G2B A;  3OB2 B;  4GFT A;  2NZ0 A;  5CSJ A;  4QJ4 B;  2KFG A;  1UUR A;  1YUR A;  2KHN A;  4MZK A;  4OV2 A;  1IH0 A;  1F71 A;  1DJY A;  1NX3 A;  2BCX A;  4MLW A;  1HT9 A;  1IRJ A;  1RRO A;  1YX8 A;  3VRQ A;  1NX2 A;  4HRG A;  2KAX A;  4GUK A;  2CTN A;  2EC6 C;  1SPY A;  1KK8 C;  1K94 A;  1NX0 A;  5DKR A;  1OZO A;  4PCW A;  4JWQ A;  1PK0 D;  3BOW B;  1Y6W A;  2JZI A;  3A4U B;  2K0J A;  1Q80 A;  1QV0 A;  3E3R A;  2I2R E;  1S6C A;  2WOR A;  4L9M A;  1C7W A;  4A4C A;  2L4I A;  2JT0 A;  2KQ6 A;  1UHJ A;  2L5X B;  1ALV A;  1UHN A;  2QPT A;  2ZKM X;  3OHM B;  4NQG A;  2MBX A;  1G4Y R;  2LV7 A;  2PRU A;  3BUN B;  4I5K A;  2JNF A;  5KU1 A;  2BCB A;  4MZL A;  2I7A A;  3RM1 A;  5AAN A;  1QJT A;  2EC6 B;  2PSR A;  1SMG A;  1KK8 B;  3ZWH A;  1N65 A;  1B9A A;  1LKJ A;  2L0P A;  1KFU L;  2LHL A;  3IQO A;  1QAT A;  3QRX A;  1KK7 Y;  1TNQ A;  3BUW B;  1MHO A;  1YUU A;  2LVI A;  1KFU S;  4PE0 A;  4JPZ B;  1QIW A;  3BOW A;  3I5H C;  1B4C A;  4P5O E;  2H61 A;  2JC2 A;  1QLS A;  1DJI A;  1CTR A;  1EXR A;  1PVB A;  5JOL A;  2GGZ A;  1ZFS A;  3TUY C;  2JXL A;  5G08 A;  2FJU B;  1H4B A;  1AJ5 A;  1BR1 B;  3O2P A;  4I5N B;  3BXK A;  2ZN9 A;  5AFP A;  2K8M B;  2K61 A;  1B7T Y;  4CPV A;  2AAO A;  1F55 A;  1G8I A;  1WRL A;  1XK4 C;  1B47 A;  2LAP A;  2JRF A;  4C0J A;  3DVE A;  4FTG A;  1XFV O;  1RWY A;  3BYA A;  1KCY A;  2NLN A;  2ZRT A;  3AAJ A;  2F33 A;  2AMI A;  2KNE A;  4ZCU A;  3AAK A;  1YRT B;  4GGN A;  4MRX A;  2Y5I A;  4C0L A;  3I5H B;  1J7P A;  1EL4 A;  1CMG A;  3EKH A;  1F8H A;  2M9G A;  4MN0 A;  3KF9 A;  1DJX A;  4MEW A;  2LM5 A;  2WCE A;  3TUY B;  3KEV A;  1XYD A;  2D8N A;  3OP0 A;  5HKW A;  1IKU A;  2BE6 A;  3O4Y A;  1FI6 A;  4AOM A;  2K7B A;  1QS7 A;  1YR5 A;  1BF5 A;  1CKK A;  2WCB A;  1GJY A;  2K7C A;  2MRD A;  2KBI A;  2L51 A;  4U8D A;  1M31 A;  4NDD A;  1NPQ A;  2HF5 A;  1OOJ A;  4XYN A;  3CS1 A;  1KSM A;  2K7D A;  2BBN A;  5KTY A;  1GGW A;  4PHK A;  1QXP A;  1XFY O;  4CLN A;  2JOJ A;  1J7R A;  3A8R A;  3F45 A;  4HRE E;  1XFX O;  5HYD A;  1JSA A;  2OTG C;  3VGO A;  1SRA A;  3EKJ A;  3SG6 A;  1SR6 C;  1C7V A;  3CR5 X;  1YRU B;  3C1V A;  1ALW A;  2AUC A;  5AER A;  1QV1 A;  2LVK A;  2GV5 A;  3AKA A;  1CDP A;  3GK4 X;  1XK4 A;  4PE1 A;  1SW8 A;  3WXA A;  5DKQ A;  5HLO A;  1GQM A;  2CBL A;  4GGF C;  3TZ1 A;  1BMO A;  2LLT A;  4ORB B;  1XO5 A;  1K96 A;  2FCE A;  3I5G C;  2LC5 A;  1WRK A;  4MZJ A;  5DKN A;  4N1G A;  1BLQ A;  2HET A;  5TNC A;  2LE9 B;  2B1U A;  2Q4U A;  2RGI A;  2K2A A;  3BUM B;  1NCX A;  3ZNI A;  1LA0 A;  4USL A;  2OTG B;  4CID A;  2M1K B;  3FWC A;  5CSF A;  1V1G A;  1KQV A;  3SG4 A;  1SR6 B;  1S36 A;  3IF7 A;  3CWG A;  1A75 B;  4XJK B;  2M7N A;  1J1E A; 
#chains in the Genus database with same CATH topology
 2Q91 A;  1V1F A;  2LVJ A;  1SL7 A;  4BY4 A;  1QIV A;  2KYC A;  4Q04 A;  3K1E A;  5AEQ A;  3VRO A;  4JQ0 D;  2MLF C;  4MSP A;  2M7L A;  1J55 A;  1ZMZ A;  1CMF A;  1DEK A;  2F3Y A;  3ICB A;  2KLE A;  4D1E A;  2QEB A;  1NSH A;  2P70 A;  1M39 A;  2L2C A;  3I5G B;  5IBW A;  2CT9 A;  3R1O A;  1EG3 A;  2JPT A;  1J7Q A;  1K9K A;  1JF0 A;  1XFW O;  3D0Y B;  1DJG A;  2TN4 A;  4PHM A;  1FF1 A;  1WLZ A;  1RTP 1;  1FPW A;  4KYN A;  4QJ3 B;  1SK6 D;  1J1D A;  2WC8 A;  1DJZ A;  3PAL A;  1UWO A;  2KPH A;  1BU3 A;  1QX7 A;  2KOT A;  1PVA A;  3CTN A;  1QX5 B;  4I5L B;  2L5Y A;  3RZS A;  2LUC A;  4DUQ A;  3EK4 A;  3OX6 A;  3KHE A;  2KI6 D;  4GPL B;  3S0D A;  3FS7 A;  1TTX A;  3AKB A;  1A75 A;  2HPS A;  2IS9 A;  2NXQ A;  3HX4 A;  3I5I C;  4XJK A;  4CFQ A;  4DS7 A;  1JC2 A;  1CLL A;  3R1P A;  4PT1 A;  2LCP A;  2M0R A;  1P28 A;  3HCM A;  2BEC A;  2F3Z A;  4YGD B;  5I8N A;  4M2O A;  1PAL A;  4M2Q A;  1X02 A;  1N2D A;  5HL1 A;  3PAT A;  2JU0 A;  2QEH A;  4GGF A;  3GK2 A;  2JTT A;  1F54 A;  1ZOT B;  1SL9 A;  2LVV A;  4MBE A;  2ZN8 A;  1LXF C;  2MHH A;  3NHT A;  4NDC A;  2P71 A;  1MXL C;  4PHN A;  1A4P A;  1VRK A;  3D0Y A;  1WLM A;  2BCA A;  1C3Z A;  3TDU A;  5GQQ C;  1QVI Z;  1OE9 B;  1WRZ A;  2L4H A;  1CB1 A;  2F2O A;  1PUL A;  2BKI B;  1TNP A;  1TRF A;  3OGN A;  5I2L A;  3EVR A;  1DQE A;  2QEV A;  3I5I B;  1TNX A;  1Z4H A;  4GAO A;  2NCO A;  1OMD A;  1IG5 A;  1R2U A;  3D73 A;  3DXL A;  1NCZ A;  4F0Z B;  3O6B A;  4QJ5 B;  4GBA A;  2Y1M A;  1W7I B;  4AQJ A;  4YRU A;  2M49 B;  1CFD A;  3B7A A;  3M0W A;  1MQ1 A;  4OCI A;  3GK1 A;  4OZD A;  2KGB C;  1IWQ A;  2QDI A;  3CGA A;  3PLF B;  4WQ2 A;  3S0F A;  1EG4 A;  1TOP A;  3DVJ A;  3VRR A;  1A29 A;  3CZ0 A;  1DGU A;  3PM8 A;  1WDC C;  2NCP A;  3KPX A;  1F4Q A;  1OMR A;  1IGV A;  1CLB A;  1K2H A;  3DD4 A;  3R1V A;  1SKT A;  2F8P A;  1CDN A;  2ERB A;  1XVJ A;  3SG5 A;  4ORC B;  3TDZ A;  1S26 D;  1F4O A;  1S1E A;  1FW4 A;  1YUS A;  1J7O A;  1WY9 A;  2G9B A;  1B8R A;  1RK9 A;  2KDH A;  2WOS A;  3EVU A;  3UO9 A;  2WCH A;  1LIN A;  3MSE B;  2MA2 A;  1BJF A;  5AXI A;  1TWO A;  1AP4 A;  1F70 A;  1B8C A;  3BUO B;  3D77 A;  1SCM C;  2PYQ A;  2JNX A;  1QX2 A;  3B87 A;  4OKH A;  2M97 A;  3L4L A;  2LLU A;  4NDB A;  4PE7 A;  1M45 A;  1AVS A;  2I94 A;  1WDC B;  2GGM A;  2JT3 A;  1MUX A;  4P2Y B;  3IQQ A;  3BUX B;  1IJ5 A;  2I18 A;  2KGR A;  2ZRS A;  3CZ2 A;  3JVT C;  1SNL A;  5D3O A;  3VB1 A;  2LUX A;  2M8U A;  1SL8 A;  2PAL A;  2KFH A;  1QVI Y;  1CNP A;  2HQW A;  2KBM A;  2WC6 A;  2HQ8 A;  1MXE A;  2DOQ A;  1NP8 A;  1MR8 A;  2LLS A;  2SCP A;  4MVF A;  1K95 A;  1LVC D;  1SBJ A;  1YVL A;  4ETO A;  5D7F A;  1XA5 A;  3OB1 B;  1SCM B;  2ZFD A;  4UPG A;  3WNX B;  3K21 A;  5CSI A;  2BL0 C;  4FQO A;  3NSK A;  1KWO C;  1OMV A;  1MWN A;  1NCY A;  1UHI A;  1SYM A;  3GOF A;  4PHJ A;  4I5J A;  3B88 A;  1OOI X;  1CLM A;  3N7H A;  4DCK A;  3B86 A;  3JVT B;  2WCF A;  1OSA A;  4CFR A;  1YUT A;  3FE8 A;  1S5G Z;  3NXA A;  3O78 A;  1HQV A;  5F6T A;  2LMV A;  3KO0 A;  1BG1 A;  1NWD A;  1KFX S;  1Y0V H;  1NYA A;  1AUI B;  2O5G A;  3DVM A;  2LAN A;  1Y1U A;  1SCV A;  5K89 A;  1H8B A;  1R6P A;  2E30 A;  2MJW B;  2JQ6 A;  4A4B A;  2JTZ A;  1A2X A;  3PM2 A;  3VRN A;  5B8I B;  3RLZ A;  1GGZ A;  1TUJ A;  1ODB A;  1B1G A;  1EH2 A;  1DC1 A;  3VRP A;  2BL0 B;  1UHK A;  3SG2 A;  1JUO A;  5BPJ A;  2OPO A;  1KWO B;  4PE4 A;  4E68 A;  3IVT A;  5PAL A;  3NSI A;  1YVH A;  3BFH A;  4YI8 A;  1DT7 B;  1CM1 A;  2K7O A;  2PMY A;  2M29 A;  4DIR A;  4ICB A;  3D74 A;  1AHR A;  3CLN A;  3EK8 A;  4HRH A;  1DJW A;  3NSL A;  1B8L A;  3S0G A;  2H8V A;  1Y1A A;  1LS8 A;  1RFJ A;  1FI5 A;  1LA3 A;  3SIB A;  1A03 A;  1REC A;  2VRG A;  3SG3 A;  1DF0 B;  4GNK B;  1DVI A;  1MF8 B;  1QTX A;  3EVV A;  1W7J B;  1M63 B;  1ZAC A;  4IL1 A;  1DJH A;  2KSP A;  3S0B A;  5HKY A;  2KI4 C;  3PN7 C;  3L4A A;  4OVN F;  2Y4Q A;  5FYX A;  1BT6 A;  1N0Y A;  2BKH B;  5HLV A;  1TNW A;  5I2O A;  1JFK A;  1YX7 A;  1Z2C B;  2COL B;  2EGD A;  1BOC A;  3LL8 B;  1DGV A;  1TN4 A;  4PAL A;  1PSB A;  2EHB A;  5J3X A;  2ISD A;  4YGE B;  5KSZ A;  3TS5 C;  1K8U A;  1Y1X A;  5ER4 X;  5HKZ A;  2ZNE A;  1PSR A;  2CXJ A;  1S6J A;  1M46 A;  1BOD A;  1JWD A;  2KFF A;  1K90 D;  1CFF A;  2KQY A;  2MLE C;  3H4S E;  4IJ7 A;  2F2P A;  3DY9 A;  1CFC A;  3LK0 A;  1IJ6 A;  2KI4 B;  3PN7 B;  1CFP A;  2M1U A;  1AJ4 A;  3Q8I A;  1QAS A;  5JJG A;  1S5G Y;  4MRY A;  5CPV A;  1L2O C;  2R2I A;  1DF0 A;  2A4J A;  1XFR A;  4TNC A;  4HSZ A;  1EJ3 A;  1ZUZ A;  2BE4 A;  3SS4 A;  4PDZ A;  2JT8 A;  4YGA A;  3BFA A;  1IQ5 A;  2WCJ A;  1U5I B;  1NUB A;  1XFU O;  3TS5 B;  1K9P A;  2KAY A;  4YBH B;  1G33 A;  2K2F A;  1DTL A;  1D1O A;  1CDL A;  3O4X A;  1RJV A;  2JPO A;  2LMT A;  3I5F C;  5ER5 A;  1C3Y A;  2ZND A;  1XFZ O;  5DIC A;  1JBA A;  3WHT B;  5FI2 A;  2LP2 A;  2L50 A;  1CDM A;  1UHH A;  3PSR A;  4R1E A;  1AK8 A;  1L2O B;  4OR9 B;  1NX1 A;  1KSO A;  2O60 A;  1QLK A;  2OS8 C;  2KI6 C;  1SY9 A;  2JWW A;  2PVB A;  1TCF A;  1DMO A;  1IQ3 A;  1KQM C;  3FIA A;  3UNW A;  1YTZ C;  2LP3 A;  3DF0 B;  2KAV A;  2H2K A;  1S6I A;  2LNK A;  2SAS A;  1UUS A;  2CNP A;  3LCP C;  3LK1 A;  1UP5 A;  2MAZ A;  4WQ3 A;  3SS3 A;  2FCD A;  3SG7 A;  4ZCV A;  2L2E A;  3L47 A;  2CCM A;  2V53 A;  1S3P A;  2WND A;  1K93 D;  4WRI A;  2KYF A;  4YGC B;  3V2L A;  3D10 A;  2E6W A;  3I5F B;  3JTD C;  1U5I A;  4YGB B;  3SIA A;  4N1F A;  1OZS A;  2JUL A;  2BBM A;  3CR4 X;  4ORA B;  4F7F A;  1BR4 B;  1DEL A;  3LLE A;  3EK7 A;  3NSO A;  1TCO B;  3CR2 A;  4AQI A;  5D69 A;  3PFV A;  2M3W A;  3SJS A;  1K9U A;  1L7Z A;  2PAS A;  1FBV A;  3BQ3 A;  3D78 A;  2OS8 B;  4JD9 A;  1KK7 Z;  1C07 A;  3SS5 A;  1JF2 A;  2JXC A;  3CZT X;  3DVK A;  1KQM B;  4N5X A;  1NIW A;  2K60 A;  1E8A A;  2PQL A;  5FI6 A;  3OX5 A;  3PJI A;  4C0K A;  5CSN A;  1IIO A;  3TDI A;  2H61 C;  2LHI A;  3S0E A;  1TIZ A;  4BY5 A;  2L98 A;  2WC5 A;  3WHU B;  3DF0 A;  4DRW A;  4M2P A;  5I2Q A;  3JTD B;  2LMU A;  1PRW A;  1KFX L;  1OQP A;  2QAC A;  2P6B B;  1CM4 A;  3FWB A;  2Y1N A;  1B7T Z;  2FOT A;  4YI9 A;  1JFJ A;  2G2B A;  3OB2 B;  4GFT A;  2NZ0 A;  5CSJ A;  4QJ4 B;  2KFG A;  1UUR A;  1YUR A;  2KHN A;  4MZK A;  4OV2 A;  1IH0 A;  2BAP A;  1F71 A;  1DJY A;  1NX3 A;  1ORG A;  2BCX A;  4MLW A;  1HT9 A;  1IRJ A;  1RRO A;  1YX8 A;  2WCM A;  3VRQ A;  1NX2 A;  4HRG A;  2KAX A;  4GUK A;  2CTN A;  2EC6 C;  1SPY A;  1KK8 C;  1K94 A;  1NX0 A;  5DKR A;  1OZO A;  4PCW A;  4JWQ A;  1PK0 D;  3BOW B;  1Y6W A;  2JZI A;  2KLD A;  3A4U B;  2K0J A;  3CAB A;  1Q80 A;  1QV0 A;  3E3R A;  2I2R E;  3QME A;  1S6C A;  2WOR A;  2YGU A;  4L9M A;  1C7W A;  4A4C A;  2L4I A;  2JT0 A;  2KQ6 A;  1UHJ A;  3S0A A;  3R72 A;  2L5X B;  1ALV A;  1UHN A;  2QPT A;  2ZKM X;  3NHI A;  3OHM B;  4NQG A;  2MBX A;  1G4Y R;  2LV7 A;  2PRU A;  3BUN B;  4I5K A;  2JNF A;  5KU1 A;  2BCB A;  4MZL A;  2I7A A;  3RM1 A;  5AAN A;  1OW4 A;  1QJT A;  2EC6 B;  1SSE B;  2PSR A;  1SMG A;  1KK8 B;  3ZWH A;  1N65 A;  1QWV A;  4JKT A;  1B9A A;  1LKJ A;  4INW A;  2L0P A;  1KFU L;  2LHL A;  3IQO A;  1QAT A;  3QRX A;  1KK7 Y;  1TNQ A;  3OBV A;  3BUW B;  1MHO A;  1YUU A;  2LVI A;  1KFU S;  1TUZ A;  4PE0 A;  3CDN A;  4JPZ B;  1QIW A;  3BOW A;  3I5H C;  1B4C A;  4P5O E;  2H61 A;  2JC2 A;  1QLS A;  1DJI A;  1CTR A;  1EXR A;  1PVB A;  5JOL A;  2GGZ A;  1T14 A;  1ZFS A;  3TUY C;  2JXL A;  5G08 A;  2FJU B;  1H4B A;  1AJ5 A;  1BR1 B;  3O2P A;  4I5N B;  3BXK A;  3EG5 B;  2ZN9 A;  5AFP A;  3D76 A;  2K8M B;  2K61 A;  1B7T Y;  4CPV A;  2AAO A;  1F55 A;  1G8I A;  1WRL A;  1XK4 C;  1B47 A;  1W9Z A;  4FQT A;  2LAP A;  2JRF A;  4C0J A;  3DVE A;  4FTG A;  1XFV O;  1RWY A;  3BYA A;  1KCY A;  2NLN A;  2ZRT A;  3AAJ A;  2F33 A;  2AMI A;  2KNE A;  4ZCU A;  2QEO A;  3AAK A;  1YRT B;  4GGN A;  4MRX A;  2Y5I A;  4C0L A;  3I5H B;  1J7P A;  1EL4 A;  1CMG A;  3EKH A;  1F8H A;  2M9G A;  4MN0 A;  3KF9 A;  1DJX A;  4MEW A;  2LM5 A;  2WCE A;  3TUY B;  3KEV A;  1XYD A;  3CYZ A;  2D8N A;  3OP0 A;  5HKW A;  1IKU A;  2BE6 A;  3O4Y A;  1FI6 A;  3NGV A;  2WCK A;  4AOM A;  3BJH A;  3BFB A;  3CZ1 A;  1OOF A;  2K7B A;  1QS7 A;  1YR5 A;  3DYE A;  1BF5 A;  1CKK A;  1OOG A;  2WCB A;  1GJY A;  2K7C A;  2MRD A;  2KBI A;  2L51 A;  4U8D A;  1M31 A;  4NDD A;  1NPQ A;  3FE6 A;  2HF5 A;  1OOJ A;  2FJY A;  4XYN A;  3CS1 A;  1KSM A;  2K7D A;  2BBN A;  5KTY A;  1GGW A;  4PHK A;  1QXP A;  1XFY O;  4CLN A;  2JOJ A;  1J7R A;  3A8R A;  3F45 A;  1OOH A;  4HRE E;  1XFX O;  5HYD A;  1JSA A;  2OTG C;  3B6X A;  3VGO A;  1SRA A;  3EKJ A;  3SG6 A;  1SR6 C;  5I94 A;  1C7V A;  3CR5 X;  1YRU B;  3C1V A;  1ALW A;  2AUC A;  5AER A;  1QV1 A;  2LVK A;  2GV5 A;  3AKA A;  1CDP A;  3GK4 X;  1XK4 A;  4PE1 A;  1SW8 A;  3WXA A;  3D75 A;  5DKQ A;  5HLO A;  3FE9 A;  1GQM A;  2CBL A;  4GGF C;  3TZ1 A;  1BMO A;  2LLT A;  4ORB B;  4INX A;  1XO5 A;  1K96 A;  2FCE A;  3I5G C;  2LC5 A;  1WRK A;  4MZJ A;  5DKN A;  5FI7 A;  3DZT A;  4N1G A;  1BLQ A;  2HET A;  5TNC A;  2LE9 B;  2WCL A;  2B1U A;  2Q4U A;  2RGI A;  2K2A A;  1GM0 A;  3BUM B;  2GTE A;  1NCX A;  3ZNI A;  1LA0 A;  4USL A;  2OTG B;  4CID A;  2M1K B;  3FWC A;  2BNX A;  1V1G A;  5CSF A;  3SG4 A;  1SR6 B;  1S36 A;  5EL2 A;  1KQV A;  3IF7 A;  3CWG A;  1A75 B;  4XJK B;  2M7N A;  1J1E A; 
#chains in the Genus database with same CATH homology
 2Q91 A;  1V1F A;  2LVJ A;  1SL7 A;  4BY4 A;  1QIV A;  2KYC A;  4Q04 A;  5AEQ A;  3VRO A;  4JQ0 D;  2MLF C;  4MSP A;  2M7L A;  1J55 A;  1ZMZ A;  1CMF A;  2F3Y A;  3ICB A;  4D1E A;  1NSH A;  1M39 A;  3I5G B;  5IBW A;  2CT9 A;  1EG3 A;  2JPT A;  1J7Q A;  1K9K A;  1JF0 A;  1XFW O;  3D0Y B;  1DJG A;  2TN4 A;  4PHM A;  1FF1 A;  1WLZ A;  1RTP 1;  1FPW A;  4QJ3 B;  1SK6 D;  1J1D A;  2WC8 A;  1DJZ A;  3PAL A;  1UWO A;  2KOT A;  1BU3 A;  1QX7 A;  1PVA A;  3CTN A;  1QX5 B;  4I5L B;  2LUC A;  4DUQ A;  3EK4 A;  3OX6 A;  3KHE A;  2KI6 D;  4GPL B;  3FS7 A;  1TTX A;  3AKB A;  1A75 A;  2HPS A;  2IS9 A;  2NXQ A;  3HX4 A;  3I5I C;  4XJK A;  4CFQ A;  4DS7 A;  1JC2 A;  1CLL A;  2LCP A;  2M0R A;  3HCM A;  2BEC A;  2F3Z A;  4YGD B;  5I8N A;  4M2O A;  1PAL A;  4M2Q A;  1X02 A;  1N2D A;  3PAT A;  2JU0 A;  4GGF A;  3GK2 A;  2JTT A;  1F54 A;  1ZOT B;  1SL9 A;  2LVV A;  4MBE A;  2ZN8 A;  1LXF C;  2MHH A;  4NDC A;  1MXL C;  4PHN A;  1A4P A;  1VRK A;  3D0Y A;  1WLM A;  2BCA A;  3TDU A;  5GQQ C;  1QVI Z;  1OE9 B;  1WRZ A;  2L4H A;  1CB1 A;  2F2O A;  1PUL A;  2BKI B;  1TNP A;  1TRF A;  5I2L A;  3EVR A;  3I5I B;  1TNX A;  4GAO A;  2NCO A;  1OMD A;  1IG5 A;  1R2U A;  1NCZ A;  4F0Z B;  3O6B A;  4QJ5 B;  4GBA A;  2Y1M A;  1W7I B;  4AQJ A;  4YRU A;  2M49 B;  1CFD A;  3M0W A;  1MQ1 A;  4OCI A;  3GK1 A;  2KGB C;  1IWQ A;  3CGA A;  3PLF B;  4WQ2 A;  1EG4 A;  1TOP A;  3DVJ A;  3VRR A;  1A29 A;  1DGU A;  3PM8 A;  1WDC C;  2NCP A;  3KPX A;  1F4Q A;  1OMR A;  1IGV A;  1CLB A;  1K2H A;  3DD4 A;  1SKT A;  2F8P A;  1CDN A;  1XVJ A;  3SG5 A;  4ORC B;  3TDZ A;  1S26 D;  1F4O A;  1S1E A;  1FW4 A;  1YUS A;  1J7O A;  1WY9 A;  2G9B A;  1B8R A;  1RK9 A;  2KDH A;  2WOS A;  3EVU A;  1LIN A;  3MSE B;  2MA2 A;  1BJF A;  5AXI A;  1AP4 A;  1F70 A;  1B8C A;  3BUO B;  1SCM C;  2JNX A;  1QX2 A;  4OKH A;  2M97 A;  2LLU A;  4NDB A;  4PE7 A;  1M45 A;  1AVS A;  2I94 A;  1WDC B;  2GGM A;  2JT3 A;  1MUX A;  4P2Y B;  3IQQ A;  3BUX B;  1IJ5 A;  2I18 A;  2KGR A;  2ZRS A;  3JVT C;  1SNL A;  2LUX A;  2M8U A;  1SL8 A;  2PAL A;  2KFH A;  1QVI Y;  1CNP A;  2HQW A;  2KBM A;  2HQ8 A;  1MXE A;  2DOQ A;  1NP8 A;  1MR8 A;  2LLS A;  2SCP A;  4MVF A;  1K95 A;  1LVC D;  1SBJ A;  1YVL A;  4ETO A;  5D7F A;  1XA5 A;  3OB1 B;  1SCM B;  2ZFD A;  4UPG A;  3WNX B;  3K21 A;  5CSI A;  2BL0 C;  4FQO A;  3NSK A;  1KWO C;  1OMV A;  1MWN A;  1NCY A;  1UHI A;  1SYM A;  3GOF A;  4PHJ A;  4I5J A;  1CLM A;  4DCK A;  3JVT B;  2WCF A;  1OSA A;  4CFR A;  1YUT A;  1S5G Z;  3NXA A;  3O78 A;  1HQV A;  5F6T A;  2LMV A;  3KO0 A;  1BG1 A;  1NWD A;  1KFX S;  1Y0V H;  1NYA A;  1AUI B;  2O5G A;  3DVM A;  2LAN A;  1Y1U A;  1SCV A;  5K89 A;  1H8B A;  1R6P A;  2E30 A;  2MJW B;  2JQ6 A;  4A4B A;  2JTZ A;  1A2X A;  3VRN A;  5B8I B;  3RLZ A;  1GGZ A;  1ODB A;  1B1G A;  1EH2 A;  3VRP A;  2BL0 B;  1UHK A;  3SG2 A;  1JUO A;  5BPJ A;  2OPO A;  1KWO B;  4PE4 A;  4E68 A;  5PAL A;  3NSI A;  1YVH A;  4YI8 A;  1DT7 B;  1CM1 A;  2K7O A;  2PMY A;  2M29 A;  4DIR A;  4ICB A;  1AHR A;  3CLN A;  3EK8 A;  4HRH A;  1DJW A;  3NSL A;  1B8L A;  1Y1A A;  1RFJ A;  1FI5 A;  1LA3 A;  3SIB A;  1A03 A;  1REC A;  2VRG A;  3SG3 A;  1DF0 B;  4GNK B;  1DVI A;  1MF8 B;  1QTX A;  3EVV A;  1W7J B;  1M63 B;  1ZAC A;  4IL1 A;  1DJH A;  2KSP A;  5HKY A;  2KI4 C;  3PN7 C;  4OVN F;  2Y4Q A;  5FYX A;  1BT6 A;  1N0Y A;  2BKH B;  5HLV A;  1TNW A;  5I2O A;  1JFK A;  1YX7 A;  2COL B;  2EGD A;  1BOC A;  3LL8 B;  1DGV A;  1TN4 A;  4PAL A;  1PSB A;  2EHB A;  5J3X A;  2ISD A;  4YGE B;  5KSZ A;  3TS5 C;  1K8U A;  1Y1X A;  5ER4 X;  5HKZ A;  2ZNE A;  1PSR A;  2CXJ A;  1S6J A;  1M46 A;  1BOD A;  1JWD A;  2KFF A;  1K90 D;  1CFF A;  2KQY A;  2MLE C;  3H4S E;  2F2P A;  1CFC A;  3LK0 A;  1IJ6 A;  2KI4 B;  3PN7 B;  1CFP A;  2M1U A;  1AJ4 A;  1QAS A;  5JJG A;  1S5G Y;  4MRY A;  5CPV A;  1L2O C;  2R2I A;  1DF0 A;  2A4J A;  4TNC A;  4HSZ A;  1EJ3 A;  1ZUZ A;  2BE4 A;  4PDZ A;  2JT8 A;  4YGA A;  1IQ5 A;  1U5I B;  1NUB A;  1XFU O;  3TS5 B;  1K9P A;  2KAY A;  4YBH B;  1G33 A;  2K2F A;  1DTL A;  1D1O A;  1CDL A;  1RJV A;  2LMT A;  3I5F C;  5ER5 A;  2ZND A;  1XFZ O;  1JBA A;  3WHT B;  2LP2 A;  2L50 A;  1CDM A;  1UHH A;  3PSR A;  4R1E A;  1AK8 A;  1L2O B;  4OR9 B;  1NX1 A;  1KSO A;  2O60 A;  1QLK A;  2OS8 C;  2KI6 C;  1SY9 A;  2JWW A;  2PVB A;  1TCF A;  1DMO A;  1IQ3 A;  1KQM C;  3FIA A;  1YTZ C;  2LP3 A;  3DF0 B;  2KAV A;  2H2K A;  1S6I A;  2LNK A;  2SAS A;  1UUS A;  2CNP A;  3LCP C;  3LK1 A;  1UP5 A;  2MAZ A;  4WQ3 A;  2FCD A;  3SG7 A;  4ZCV A;  2L2E A;  2CCM A;  2V53 A;  1S3P A;  2WND A;  1K93 D;  4WRI A;  2KYF A;  4YGC B;  3D10 A;  2E6W A;  3I5F B;  3JTD C;  1U5I A;  4YGB B;  3SIA A;  4N1F A;  1OZS A;  2JUL A;  2BBM A;  3CR4 X;  4ORA B;  1BR4 B;  3NSO A;  3LLE A;  3EK7 A;  1TCO B;  3CR2 A;  4AQI A;  5D69 A;  3PFV A;  2M3W A;  3SJS A;  1K9U A;  1L7Z A;  2PAS A;  1FBV A;  3BQ3 A;  1C07 A;  2OS8 B;  1KK7 Z;  1JF2 A;  2JXC A;  3CZT X;  3DVK A;  1KQM B;  4N5X A;  1NIW A;  1E8A A;  3OX5 A;  4C0K A;  5CSN A;  3TDI A;  2H61 C;  2LHI A;  5I2Q A;  1TIZ A;  4BY5 A;  2L98 A;  3WHU B;  4DRW A;  3DF0 A;  4M2P A;  3JTD B;  2LMU A;  1PRW A;  1KFX L;  1OQP A;  2QAC A;  2P6B B;  1CM4 A;  3FWB A;  2Y1N A;  1B7T Z;  2FOT A;  4YI9 A;  1JFJ A;  2G2B A;  3OB2 B;  4GFT A;  2NZ0 A;  5CSJ A;  4QJ4 B;  2KFG A;  1UUR A;  1YUR A;  2KHN A;  4MZK A;  4OV2 A;  1IH0 A;  1F71 A;  1DJY A;  1NX3 A;  2BCX A;  4MLW A;  1HT9 A;  1IRJ A;  1RRO A;  1YX8 A;  3VRQ A;  1NX2 A;  4HRG A;  2KAX A;  4GUK A;  2CTN A;  2EC6 C;  1SPY A;  1KK8 C;  1K94 A;  1NX0 A;  5DKR A;  1OZO A;  4PCW A;  4JWQ A;  1PK0 D;  3BOW B;  1Y6W A;  2JZI A;  3A4U B;  2K0J A;  1Q80 A;  1QV0 A;  3E3R A;  2I2R E;  1S6C A;  2WOR A;  4L9M A;  1C7W A;  4A4C A;  2L4I A;  2JT0 A;  2KQ6 A;  1UHJ A;  2L5X B;  1ALV A;  1UHN A;  2QPT A;  2ZKM X;  3OHM B;  4NQG A;  2MBX A;  1G4Y R;  2LV7 A;  2PRU A;  3BUN B;  4I5K A;  2JNF A;  5KU1 A;  2BCB A;  4MZL A;  2I7A A;  3RM1 A;  5AAN A;  1QJT A;  2EC6 B;  2PSR A;  1SMG A;  1KK8 B;  3ZWH A;  1N65 A;  1B9A A;  1LKJ A;  2L0P A;  1KFU L;  2LHL A;  3IQO A;  1QAT A;  3QRX A;  1KK7 Y;  1TNQ A;  3BUW B;  1MHO A;  1YUU A;  2LVI A;  1KFU S;  4PE0 A;  4JPZ B;  1QIW A;  3BOW A;  3I5H C;  1B4C A;  4P5O E;  2H61 A;  2JC2 A;  1QLS A;  1DJI A;  1CTR A;  1EXR A;  1PVB A;  5JOL A;  2GGZ A;  1ZFS A;  3TUY C;  2JXL A;  5G08 A;  2FJU B;  1H4B A;  1AJ5 A;  1BR1 B;  3O2P A;  4I5N B;  3BXK A;  2ZN9 A;  5AFP A;  2K8M B;  2K61 A;  1B7T Y;  4CPV A;  2AAO A;  1F55 A;  1G8I A;  1WRL A;  1XK4 C;  1B47 A;  2LAP A;  2JRF A;  4C0J A;  3DVE A;  4FTG A;  1XFV O;  1RWY A;  3BYA A;  1KCY A;  2NLN A;  2ZRT A;  3AAJ A;  2F33 A;  2AMI A;  2KNE A;  4ZCU A;  3AAK A;  1YRT B;  4GGN A;  4MRX A;  2Y5I A;  4C0L A;  3I5H B;  1J7P A;  1EL4 A;  1CMG A;  3EKH A;  1F8H A;  2M9G A;  4MN0 A;  3KF9 A;  1DJX A;  4MEW A;  2LM5 A;  2WCE A;  3TUY B;  3KEV A;  1XYD A;  2D8N A;  3OP0 A;  5HKW A;  1IKU A;  2BE6 A;  3O4Y A;  1FI6 A;  4AOM A;  2K7B A;  1QS7 A;  1YR5 A;  1BF5 A;  1CKK A;  2WCB A;  1GJY A;  2K7C A;  2MRD A;  2KBI A;  2L51 A;  4U8D A;  1M31 A;  4NDD A;  1NPQ A;  2HF5 A;  1OOJ A;  4XYN A;  3CS1 A;  1KSM A;  2K7D A;  2BBN A;  5KTY A;  1GGW A;  4PHK A;  1QXP A;  1XFY O;  4CLN A;  2JOJ A;  1J7R A;  3A8R A;  3F45 A;  4HRE E;  1XFX O;  5HYD A;  1JSA A;  2OTG C;  3VGO A;  1SRA A;  3EKJ A;  3SG6 A;  1SR6 C;  1C7V A;  3CR5 X;  1YRU B;  3C1V A;  1ALW A;  2AUC A;  5AER A;  1QV1 A;  2LVK A;  2GV5 A;  3AKA A;  1CDP A;  3GK4 X;  1XK4 A;  4PE1 A;  1SW8 A;  3WXA A;  5DKQ A;  5HLO A;  1GQM A;  2CBL A;  4GGF C;  3TZ1 A;  1BMO A;  2LLT A;  4ORB B;  1XO5 A;  1K96 A;  2FCE A;  3I5G C;  2LC5 A;  1WRK A;  4MZJ A;  5DKN A;  4N1G A;  1BLQ A;  2HET A;  5TNC A;  2LE9 B;  2B1U A;  2Q4U A;  2RGI A;  2K2A A;  3BUM B;  1NCX A;  3ZNI A;  1LA0 A;  4USL A;  2OTG B;  4CID A;  2M1K B;  3FWC A;  5CSF A;  1V1G A;  1KQV A;  3SG4 A;  1SR6 B;  1S36 A;  3IF7 A;  3CWG A;  1A75 B;  4XJK B;  2M7N A;  1J1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...