1QV1A

Atomic resolution structure of obelin from obelia longissima
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
191
structure length
187
Chain Sequence
YAVKLKTDFDNPRWIKRHKHMFDFLDINGNGKITLDEIVSKASDDICAKLEATPEQTKRHQVCVEAFFRGCGMEYGKEIAFPQFLDGWKQLATSELKKWARNEPTLIREWGDAVFDIFDGTITLDEWKAYGKISGISPSQEDCEATFRHCDLDNAGDLDVDEMTRQHLGFWYTLDPEADGLYGNGVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Obelin
publication title Atomic resolution structure of obelin: soaking with calcium enhances electron density of the second oxygen atom substituted at the C2-position of coelenterazine.
pubmed doi rcsb
source organism Obelia longissima
molecule tags Luminescent protein
total genus 75
structure length 187
sequence length 191
ec nomenclature ec 1.13.12.5: Renilla-type luciferase.
pdb deposition date 2003-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1qv1A00
2BCBA 1IQ3A 2AAOA 1WRKA 3VRNA 1UWOA 3DF0A 3RLZA 2H61C 2LAPA 1GGZA 1Y1XA 1BT6A 1PSRA 1HQVA 5I2LA 1WDCC 3WXAA 2OPOA 3I5IB 5I2OA 1DJGA 3VRPA 4I5LB 4ETOA 3ZWHA 2LNKA 1UHKA 4FQOA 2K7CA 3BUWB 2LLSA 1LA0A 4MRXA 1GQMA 4PDZA 2JNFA 3GK4X 1K96A 4OVNF 1A75B 2FOTA 1TOPA 4WRIA 1W7JB 4ORAB 3ICBA 1LINA 2OS8C 4HSZA 1SL8A 1TNWA 3D0YA 2COLB 3DVEA 1XFWO 2BE6A 4XJKB 5AEQA 1CLBA 4QJ4B 1B8RA 2GV5A 3A8RA 5CSFA 2HETA 1F8HA 3LL8B 1BR4B 1NX2A 1S6IA 2AUCA 2BBNA 2F2OA 2BCAA 3EKJA 4NDDA 4AOMA 1PALA 1NX0A 1LXFC 1S5GY 1SCMB 2Y1MA 2SASA 1QJTA 2KBMA 4NDBA 1NSHA 2Q91A 5ER4X 1G33A 2M97A 1K9PA 1YUSA 3AAJA 1ALWA 1QLSA 2Y5IA 1CMFA 2KFGA 1FF1A 3VROA 3EK7A 3SG7A 4OCIA 1CFCA 1Y6WA 2LMTA 5CSJA 1QASA 1SBJA 2ZKMX 3M0WA 1G8IA 2L2EA 1QIVA 1QX7A 2KHNA 4GFTA 1DF0A 2O60A 1XK4A 2QPTA 2F8PA 5GQQC 2EC6C 2EGDA 1B1GA 1A4PA 2F3YA 3VRQA 1FPWA 4PALA 2GGMA 1SNLA 1WRLA 4BY4A 1JWDA 5JOLA 1A29A 1R6PA 2CNPA 2MA2A 3DF0B 2WCFA 4I5KA 1QATA 5F6TA 2LLUA 1B7TZ 3I5GB 1YVLA 2JZIA 1SMGA 3FWCA 3PALA 1KSOA 3QRXA 2LLTA 1JF2A 1MXEA 1BU3A 1IGVA 3OX5A 4M2PA 1KQVA 2L4IA 1CNPA 5I8NA 1JBAA 1K9UA 4ORBB 1KWOC 1N2DA 4MZLA 3EKHA 2L51A 2E30A 3PM8A 2MLFC 2NCPA 4M2QA 3OB1B 4A4BA 1U5IB 4NDCA 3E3RA 1RFJA 4QJ3B 2EHBA 1MF8B 1RK9A 3KEVA 1XA5A 2CBLA 1OQPA 2ZFDA 3JVTB 1CTRA 1YRTB 4YGCB 4CIDA 4GGNA 1JFKA 1JFJA 1DT7B 1N0YA 1YRUB 2JT0A 4AQJA 5G08A 2KAYA 4L9MA 5J3XA 3I5FC 2G9BA 1RWYA 1MUXA 4PCWA 4PHNA 1DJHA 2M1UA 4R1EA 1DMOA 2NXQA 2K2FA 1K2HA 1IRJA 4N1GA 2LUXA 2JNXA 2JQ6A 1S1EA 3OX6A 3PN7B 2LVJA 1KCYA 2K0JA 2JTTA 1NPQA 3AKBA 1DF0B 1BLQA 2LC5A 4CFQA 4YRUA 1L7ZA 2KAXA 3LK0A 4N5XA 3SG5A 1EXRA 1KFUL 2L4HA 1H4BA 3I5IC 4PE0A 4MBEA 2A4JA 1CMGA 2K61A 1A2XA 2JXLA 4P2YB 1LKJA 2RGIA 1IJ5A 1YTZC 2LVIA 4C0KA 3EVUA 4MEWA 2MAZA 1DGUA 1YX8A 3NXAA 5HKZA 1C7WA 5AFPA 4CLNA 2HQ8A 3CLNA 2BKIB 4JQ0D 1WRZA 1NWDA 2BCXA 1GGWA 2I18A 5D69A 3BUNB 4USLA 2PMYA 1S26D 3TDIA 1G4YR 5HKWA 3BYAA 4YGAA 3TDUA 1BF5A 1NUBA 5HYDA 1K90D 1DTLA 3CGAA 1IQ5A 1DJYA 4PHMA 1Q80A 1AJ5A 3VRRA 3JTDB 3CZTX 2M49B 4YI8A 1SCMC 5I2QA 2ZRTA 1PK0D 3EK8A 4C0JA 1OZSA 2ZNEA 2R2IA 1NX1A 1YX7A 3K21A 3NSLA 2V53A 4M2OA 4BY5A 1SRAA 2FCEA 2L98A 1IKUA 3KF9A 3RM1A 1CM4A 2LCPA 3BOWA 4I5JA 1LVCD 2NLNA 1F54A 1AK8A 3CWGA 1CFDA 4OKHA 1M46A 3MSEB 5B8IB 1SR6B 2H2KA 3A4UB 2KDHA 1V1FA 4MN0A 3ZNIA 2K2AA 2ISDA 1OMVA 4DRWA 1NP8A 1F4OA 5FYXA 2BL0B 1PULA 1S6CA 3GK1A 5DKQA 2BE4A 1NCZA 1RECA 2JWWA 3I5GC 4GGFA 4WQ3A 5PALA 3SG3A 2MBXA 4CFRA 1OZOA 1DGVA 2TN4A 2JOJA 3EK4A 1ZFSA 2IS9A 5HKYA 5JJGA 2FCDA 1B4CA 1JUOA 3BXKA 2KAVA 2WCEA 1KK7Y 1ALVA 2KQ6A 2NCOA 1K9KA 3OB2B 1IJ6A 2CCMA 2VRGA 5AERA 1OSAA 2PVBA 4PE4A 1QIWA 1S3PA 4YGBB 2LV7A 3TUYB 1WY9A 2LVVA 3NSKA 1K95A 4HRHA 3BUXB 4ZCUA 2B1UA 3JVTC 3PFVA 3FS7A 4ORCB 4DUQA 5BPJA 4F0ZB 1A03A 1XO5A 3IF7A 2CT9A 2MHHA 1BOCA 1TN4A 1YURA 1LA3A 1S36A 1OE9B 1KSMA 1SL9A 1M45A 2Y1NA 2OTGB 2JXCA 3D0YB 1CFPA 1J7OA 1QVIY 1UHNA 1C7VA 4DIRA 2LP2A 4TNCA 2K7OA 1ZACA 3GK2A 2LM5A 3TDZA 4YI9A 1KFUS 1XFZO 1E8AA 3I5HB 2F33A 1J7QA 2BECA 1FI6A 1ZUZA 1XYDA 1YVHA 4HRGA 1B7TY 3PN7C 1L2OB 3PLFB 5KTYA 1NX3A 4MRYA 1XK4C 1UHIA 1F4QA 3D10A 3WHUB 4GUKA 1KK8B 1QXPA 2H61A 3GOFA 3HX4A 1QX2A 3HCMA 3SG4A 2LE9B 5IBWA 2KI6D 4JPZB 1J1DA 5DKNA 1DJXA 4HREE 2KQYA 1SPYA 1RJVA 2ZRSA 1AP4A 2M29A 1WLZA 1C07A 1XFVO 4GBAA 2K7BA 3F45A 5HLVA 1PSBA 1NCXA 1GJYA 1Y0VH 2AMIA 1XFUO 1YUTA 4UPGA 2ZN9A 1OOJA 2QACA 2MRDA 4N1FA 1CDPA 4PHJA 1K8UA 1TNPA 1W7IB 3TS5B 2JU0A 2MLEC 3BUMB 3NSOA 4MLWA 4OR9B 1BG1A 4QJ5B 3WNXB 1H8BA 2CTNA 4WQ2A 4DCKA 2ZN8A 1TCFA 1MWNA 1UHHA 5TNCA 3JTDC 5AXIA 1RTP1 3DVJA 1DVIA 2L0PA 3EVRA 1FI5A 3IQQA 5CSIA 5ER5A 4E68A 3O2PA 2D8NA 2O5GA 3IQOA 1V1GA 4Q04A 1TRFA 1J1EA 1EG3A 1M63B 1KQMB 1XFYO 1Y1AA 4YBHB 2M7LA 1NIWA 1BODA 3VGOA 3BQ3A 2JTZA 1ODBA 2JPTA 1PVBA 1QTXA 1TNQA 2KI4B 1VRKA 1S5GZ 3H4SE 4AQIA 1OMDA 4MVFA 1ZMZA 1AJ4A 1SR6C 3CTNA 2KI6C 1NCYA 3BUOB 2CXJA 1EH2A 1RROA 2LANA 1Y1UA 2LMUA 5HLOA 1DJIA 1K93D 5K89A 3O6BA 4D1EA 1CLMA 2BL0C 5D7FA 1QV1A 1KFXL 1X02A 2NZ0A 3DVMA 3SIBA 1WDCB 3CR4X 1CDNA 2LMVA 1U5IA 2LVKA 1BR1B 1PRWA 3LLEA 2LHLA 1TNXA 1KK7Z 1CDMA 1K94A 2I94A 1ZOTB 1WLMA 1M39A 4ICBA 2OS8B 4GAOA 2JULA 3TUYC 1MR8A 1EJ3A 4XYNA 4IL1A 5DKRA 1CKKA 1CM1A 1DJZA 3SJSA 1OMRA 2M9GA 4A4CA 1CLLA 1TTXA 2PALA 3PSRA 1N65A 2BBMA 1SKTA 3SG6A 1AUIB 2OTGC 1TCOB 1B8CA 1F55A 3CS1A 2G2BA 2KFHA 1CB1A 2MJWB 4PHKA 4CPVA 1FBVA 4DS7A 1QVIZ 1JSAA 2K8MB 2KOTA 3OP0A 1XVJA 2KYFA 1HT9A 2HQWA 4YGDB 2HPSA 3FWBA 2M8UA 4ZCVA 1M31A 2M7NA 2PASA 2JT3A 3I5HC 1B9AA 3NSIA 3O78A 1BJFA 1YR5A 1JC2A 4NQGA 1XFXO 1J7RA 2KGBC 1IH0A 1L2OC 2I2RE 2ZNDA 2Q4UA 1DJWA 4PE7A 4C0LA 1MXLC 4MSPA 1B47A 1SYMA 2WORA 3LK1A 1IG5A 2EC6B 5KU1A 2LHIA 5CSNA 2KBIA 1FW4A 3KPXA 1AVSA 1KK8C 1EG4A 4PE1A 1F70A 3BOWB 3DD4A 4GNKB 1QV0A 3AAKA 2WNDA 1J55A 2FJUB 2HF5A 2KGRA 2F2PA 2WOSA 4U8DA 2LP3A 1SL7A 4GGFC 1SK6D 1YUUA 3O4YA 4P5OE 1UUSA 2L5XB 1EL4A 1JF0A 1A75A 4MZKA 1PVAA 1KWOB 2F3ZA 4I5NB 3TZ1A 2LUCA 4OV2A 1MHOA 2K7DA 2DOQA 1UHJA 1UP5A 2E6WA 2PRUA 3FIAA 4XJKA 2SCPA 1F71A 2M1KB 3TS5C 2I7AA 2L50A 3WHTB 4MZJA 1BMOA 2JT8A 2JRFA 1SCVA 2M0RA 1S6JA 3CR2A 5KSZA 4JWQA 3KHEA 4YGEB 1D1OA 3CR5X 5AANA 3OHMB 2KFFA 4FTGA 1NYAA 3C1VA 2M3WA 3PATA 1UURA 1MQ1A 3AKAA 2WC8A 3I5FB 2BKHB 1TIZA 2KYCA 1QLKA 1CDLA 1J7PA 3EVVA 1B8LA 3SIAA 1AHRA 1KQMC 1SW8A 2JC2A 2KNEA 1KFXS 1QS7A 3KO0A 5CPVA 3SG2A 2KSPA 1CFFA 1SY9A 2PSRA 2Y4QA 2GGZA 1IWQA 2KI4C 2P6BB 3DVKA 3LCPC 2WCBA 1R2UA 4GPLB 1QX5B
chains in the Genus database with same CATH superfamily
2BCBA 1IQ3A 2AAOA 1WRKA 3VRNA 1UWOA 3DF0A 3RLZA 2H61C 2LAPA 1GGZA 1Y1XA 4JKTA 1BT6A 1PSRA 1HQVA 5I2LA 1WDCC 3SS5A 2OPOA 3I5IB 3WXAA 1DJGA 5I2OA 4OZDA 4IJ7A 4I5LB 3VRPA 4ETOA 3ZWHA 2LNKA 1UHKA 2P71A 2K7CA 3BUWB 4FQOA 2LLSA 1LA0A 4MRXA 1GQMA 4PDZA 2JNFA 3GK4X 1K96A 4INWA 4OVNF 1A75B 2FOTA 1TOPA 4WRIA 1W7JB 4ORAB 3ICBA 1LINA 2OS8C 4HSZA 1SL8A 3SS4A 1TNWA 3D0YA 2COLB 3DVEA 1XFWO 2BE6A 4XJKB 5AEQA 1CLBA 4QJ4B 1B8RA 2GV5A 2WCKA 3A8RA 3DZTA 5CSFA 2HETA 1F8HA 3LL8B 3FE9A 1BR4B 2GTEA 1NX2A 1S6IA 2AUCA 2BBNA 2F2OA 2BCAA 3EKJA 4NDDA 4AOMA 1PALA 1NX0A 1LXFC 1S5GY 1SCMB 2Y1MA 2SASA 1QJTA 2KBMA 4NDBA 1NSHA 2Q91A 5ER4X 1G33A 2M97A 1K9PA 1YUSA 3AAJA 1ALWA 1QLSA 2Y5IA 1CMFA 2KFGA 1FF1A 3VROA 3EK7A 3SG7A 4OCIA 1CFCA 1W9ZA 1Y6WA 2LMTA 2WCHA 3R72A 1QASA 1SBJA 5CSJA 2ZKMX 3B88A 1G8IA 3FE6A 2L2EA 3M0WA 1QIVA 2K60A 1QX7A 2KHNA 4GFTA 1DF0A 2O60A 1XK4A 2QPTA 3B6XA 2F8PA 4JD9A 2EC6C 2EGDA 1P28A 5GQQC 1B1GA 1A4PA 2F3YA 3VRQA 1FPWA 4PALA 2GGMA 1SNLA 1WRLA 4BY4A 1JWDA 5JOLA 1A29A 1R6PA 2CNPA 3Q8IA 2MA2A 3NGVA 1OW4A 3DF0B 2WCFA 4I5KA 1QATA 5F6TA 2LLUA 1B7TZ 3I5GB 1YVLA 2JZIA 1SMGA 3FWCA 3PALA 1KSOA 3QRXA 2LLTA 1JF2A 1MXEA 1BU3A 1IGVA 3OX5A 1LS8A 2ERBA 4M2PA 1SSEB 2L4IA 1CNPA 5I8NA 1KQVA 1JBAA 1K9UA 4ORBB 2QEHA 1KWOC 1N2DA 4MZLA 3EKHA 2L51A 2E30A 3PM8A 3L47A 1IH0A 2MLFC 2NCPA 5FI2A 4M2QA 3OB1B 4A4BA 1U5IB 4NDCA 3E3RA 1RFJA 4QJ3B 2EHBA 1MF8B 1RK9A 3KEVA 1XA5A 2CBLA 1OQPA 2ZFDA 3JVTB 1CTRA 1YRTB 3L4AA 4YGCB 3CYZA 4CIDA 4GGNA 1JFKA 1JFJA 3CZ2A 1DT7B 3IVTA 3QMEA 1N0YA 1IIOA 1QWVA 1YRUB 1DQEA 2BAPA 2JT0A 3EG5B 4AQJA 5G08A 2KAYA 4L9MA 5J3XA 3I5FC 2G9BA 1RWYA 1MUXA 4PCWA 4PHNA 1DJHA 2M1UA 4R1EA 1DMOA 2NXQA 2K2FA 1K2HA 1IRJA 4N1GA 2LUXA 2JNXA 2JQ6A 1S1EA 3OX6A 3PN7B 2LVJA 1KCYA 1T14A 2K0JA 2JTTA 1NPQA 2YGUA 1DF0B 3AKBA 1BLQA 2LC5A 3OBVA 3S0AA 1DEKA 4CFQA 4YRUA 1L7ZA 2KAXA 3LK0A 4N5XA 3SG5A 1EXRA 1KFUL 2L4HA 1H4BA 3CABA 3I5IC 2P70A 4PE0A 4MBEA 3K1EA 2A4JA 1CMGA 2K61A 1A2XA 2JXLA 4P2YB 1LKJA 2RGIA 1IJ5A 1YTZC 2LVIA 4C0KA 3EVUA 4MEWA 2MAZA 3D76A 1DGUA 1YX8A 3NXAA 5HKZA 1C7WA 3UO9A 5AFPA 4CLNA 3RZSA 2HQ8A 3CLNA 2BKIB 5FI6A 4JQ0D 4PT1A 1WRZA 1NWDA 2BCXA 1GGWA 2I18A 5D69A 3BUNB 4USLA 2PMYA 1S26D 3TDIA 1G4YR 5HKWA 3BYAA 4YGAA 3BFHA 3TDUA 2WC5A 3SS3A 5D3OA 3BFBA 1BF5A 1NUBA 3CZ1A 5HYDA 1K90D 1DTLA 3CGAA 3D75A 1IQ5A 1DJYA 2WCJA 3CDNA 4PHMA 1Q80A 1AJ5A 3VRRA 3JTDB 3CZTX 2KPHA 2M49B 1SCMC 4YI8A 5I2QA 2ZRTA 1PK0D 3EK8A 4C0JA 1OZSA 2ZNEA 1TWOA 1NX1A 1YX7A 2R2IA 3K21A 3NSLA 2V53A 4M2OA 4BY5A 1SRAA 2FCEA 2L98A 3BJHA 3S0FA 1IKUA 3KF9A 3RM1A 1CM4A 2LCPA 3BOWA 3R1PA 4I5JA 1LVCD 2NLNA 1F54A 1AK8A 3CWGA 1CFDA 2FJYA 4OKHA 1M46A 1TUZA 3MSEB 5B8IB 1SR6B 3D78A 2H2KA 3A4UB 2KDHA 3BFAA 1V1FA 4MN0A 3ZNIA 2K2AA 2L2CA 1OMVA 2ISDA 4DRWA 1NP8A 1F4OA 5FYXA 2BL0B 1TUJA 1PULA 1S6CA 3GK1A 5DKQA 2BE4A 1NCZA 1RECA 2JWWA 3I5GC 4GGFA 2QDIA 4WQ3A 5PALA 2MBXA 3SG3A 1OZOA 1DGVA 2TN4A 4CFRA 2JOJA 3EK4A 1ZFSA 2IS9A 5HKYA 5JJGA 2FCDA 3D73A 1B4CA 1JUOA 3BXKA 2KAVA 2WCEA 3L4LA 1KK7Y 1ALVA 2KQ6A 2NCOA 1K9KA 3OB2B 1IJ6A 2CCMA 2QEBA 2VRGA 3V2LA 5AERA 1OSAA 2PVBA 2WC6A 4PE4A 1QIWA 1S3PA 4YGBB 2LV7A 3TUYB 1WY9A 2LVVA 2JPOA 1C3ZA 3NSKA 1K95A 4HRHA 3BUXB 4ZCUA 2B1UA 3JVTC 3PFVA 1XFRA 3FS7A 4ORCB 4DUQA 5BPJA 4F0ZB 1A03A 1XO5A 3IF7A 2CT9A 2MHHA 1BOCA 1TN4A 1YURA 1LA3A 1S36A 1OE9B 1KSMA 1SL9A 1M45A 2Y1NA 2OTGB 2JXCA 3D0YB 1CFPA 3B86A 1J7OA 1QVIY 1UHNA 1C7VA 4DIRA 2LP2A 4TNCA 2K7OA 1ZACA 3GK2A 2LM5A 3TDZA 2QEOA 4YI9A 1KFUS 1XFZO 1E8AA 3I5HB 2F33A 3R1VA 2BECA 1J7QA 1FI6A 1ZUZA 1XYDA 1YVHA 4HRGA 1B7TY 3PN7C 1L2OB 3PLFB 5KTYA 1NX3A 4MRYA 1XK4C 1UHIA 1F4QA 3D10A 3WHUB 4GUKA 5FI7A 1KK8B 1QXPA 2H61A 3GOFA 3HX4A 1QX2A 3HCMA 3SG4A 2LE9B 5IBWA 2KI6D 4JPZB 1J1DA 5DKNA 1DJXA 5I94A 4HREE 2KQYA 1SPYA 1RJVA 2ZRSA 1AP4A 2M29A 2BNXA 1WLZA 1DELA 1C07A 1XFVO 4GBAA 2K7BA 3F45A 2PYQA 5HLVA 1PSBA 1NCXA 1GJYA 1Y0VH 2AMIA 1XFUO 1YUTA 2PQLA 4UPGA 2ZN9A 5HL1A 1OOJA 2QACA 2MRDA 4N1FA 1CDPA 3O4XA 4PHJA 1K8UA 1TNPA 1W7IB 3TS5B 2JU0A 2MLEC 3B7AA 3BUMB 3CZ0A 3NSOA 4MLWA 4OR9B 1BG1A 3S0BA 4QJ5B 3WNXB 1H8BA 4FQTA 2CTNA 4WQ2A 4DCKA 2ZN8A 1TCFA 1MWNA 1UHHA 5TNCA 3JTDC 5AXIA 1DC1A 1RTP1 3DVJA 1DVIA 2L0PA 3EVRA 1FI5A 3IQQA 5CSIA 5ER5A 4F7FA 3O2PA 2D8NA 4E68A 2KLEA 2O5GA 3IQOA 1V1GA 4Q04A 1TRFA 1J1EA 1EG3A 1M63B 1KQMB 1XFYO 1Y1AA 4YBHB 2M7LA 1NIWA 1BODA 3VGOA 3BQ3A 2JTZA 1ODBA 2JPTA 1PVBA 1QTXA 1TNQA 2KI4B 1VRKA 1S5GZ 3H4SE 4AQIA 2KLDA 1OMDA 4MVFA 1ZMZA 1AJ4A 1SR6C 3CTNA 2KI6C 1NCYA 3BUOB 2CXJA 2WCLA 1EH2A 1RROA 2LANA 1Y1UA 2LMUA 3D74A 5HLOA 1DJIA 1K93D 5K89A 3B87A 3O6BA 1CLMA 4D1EA 2BL0C 5D7FA 1QV1A 1KFXL 1X02A 2NZ0A 3DVMA 3SIBA 1WDCB 3CR4X 3PM2A 1CDNA 2LMVA 1U5IA 1OOIX 2L5YA 2LVKA 1BR1B 1PRWA 3LLEA 2LHLA 1TNXA 5DICA 1KK7Z 1CDMA 1K94A 1OOHA 2I94A 3S0GA 3NHTA 1ZOTB 1WLMA 1ORGA 1M39A 4ICBA 2OS8B 4GAOA 2JULA 3DXLA 3TUYC 1MR8A 1EJ3A 4XYNA 4IL1A 1GM0A 5DKRA 1CKKA 1CM1A 1DJZA 3SJSA 1OMRA 2M9GA 3UNWA 4A4CA 1CLLA 1TTXA 2PALA 3PSRA 1N65A 2BBMA 1SKTA 3D77A 3SG6A 1AUIB 2OTGC 1TCOB 1B8CA 1F55A 3CS1A 2G2BA 2KFHA 1CB1A 2MJWB 4PHKA 4CPVA 1FBVA 4DS7A 1QVIZ 1JSAA 2K8MB 2KOTA 3OP0A 1XVJA 2KYFA 1HT9A 2HQWA 3S0EA 4YGDB 2HPSA 3FWBA 1Z2CB 2M8UA 4ZCVA 1C3YA 3DY9A 1M31A 2M7NA 2PASA 2JT3A 3I5HC 1B9AA 3NSIA 3O78A 1BJFA 1YR5A 1JC2A 4NQGA 3PJIA 1XFXO 1J7RA 2KGBC 3DYEA 1L2OC 2I2RE 2ZNDA 2Q4UA 1DJWA 4PE7A 4C0LA 1MXLC 4MSPA 1B47A 1SYMA 2WORA 3LK1A 1IG5A 2EC6B 5KU1A 2LHIA 5CSNA 2KBIA 2WCMA 1FW4A 3KPXA 1AVSA 1KK8C 1EG4A 3OGNA 4PE1A 1F70A 3BOWB 3DD4A 4GNKB 1QV0A 3AAKA 2WNDA 1J55A 2FJUB 2HF5A 2KGRA 2F2PA 2WOSA 4U8DA 2LP3A 1SL7A 4GGFC 1SK6D 1YUUA 3O4YA 4P5OE 1UUSA 2L5XB 1EL4A 1JF0A 1A75A 4MZKA 1PVAA 1KWOB 2F3ZA 2QEVA 4I5NB 3S0DA 3TZ1A 2LUCA 4OV2A 1MHOA 3VB1A 2K7DA 2DOQA 1UHJA 1UP5A 2E6WA 2PRUA 3FIAA 4XJKA 2SCPA 1F71A 2M1KB 3TS5C 2I7AA 2L50A 3WHTB 4MZJA 1BMOA 2JT8A 2JRFA 1SCVA 2M0RA 1S6JA 3CR2A 5KSZA 3NHIA 4JWQA 3KHEA 4YGEB 1D1OA 2H8VA 3CR5X 5AANA 3OHMB 1OOGA 2KFFA 4FTGA 1NYAA 3C1VA 2M3WA 3PATA 1UURA 1MQ1A 3AKAA 2WC8A 3I5FB 2BKHB 4INXA 1TIZA 2KYCA 1QLKA 1CDLA 1J7PA 3EVVA 1B8LA 3SIAA 1AHRA 1KQMC 1SW8A 2JC2A 2KNEA 1KFXS 1QS7A 3KO0A 5CPVA 3SG2A 2KSPA 3N7HA 1CFFA 1OOFA 1SY9A 1Z4HA 2PSRA 2Y4QA 2GGZA 1IWQA 2KI4C 2P6BB 3FE8A 3DVKA 3LCPC 5EL2A 2WCBA 1R2UA 3R1OA 4GPLB 4KYNA 1QX5B
chains in the Genus database with same CATH topology
2BCBA 1IQ3A 2AAOA 1WRKA 3VRNA 1UWOA 3DF0A 3RLZA 2H61C 2LAPA 1GGZA 1Y1XA 1BT6A 1PSRA 1HQVA 5I2LA 1WDCC 3WXAA 2OPOA 3I5IB 5I2OA 1DJGA 3VRPA 4I5LB 4ETOA 3ZWHA 2LNKA 1UHKA 4FQOA 2K7CA 3BUWB 2LLSA 1LA0A 4MRXA 1GQMA 4PDZA 2JNFA 3GK4X 1K96A 4OVNF 1A75B 2FOTA 1TOPA 4WRIA 1W7JB 4ORAB 3ICBA 1LINA 2OS8C 4HSZA 1SL8A 1TNWA 3D0YA 2COLB 3DVEA 1XFWO 2BE6A 4XJKB 5AEQA 1CLBA 4QJ4B 1B8RA 2GV5A 3A8RA 5CSFA 2HETA 1F8HA 3LL8B 1BR4B 1NX2A 1S6IA 2AUCA 2BBNA 2F2OA 2BCAA 3EKJA 4NDDA 4AOMA 1PALA 1NX0A 1LXFC 1S5GY 1SCMB 2Y1MA 2SASA 1QJTA 2KBMA 4NDBA 1NSHA 2Q91A 5ER4X 1G33A 2M97A 1K9PA 1YUSA 3AAJA 1ALWA 1QLSA 2Y5IA 1CMFA 2KFGA 1FF1A 3VROA 3EK7A 3SG7A 4OCIA 1CFCA 1Y6WA 2LMTA 5CSJA 1QASA 1SBJA 2ZKMX 3M0WA 1G8IA 2L2EA 1QIVA 1QX7A 2KHNA 4GFTA 1DF0A 2O60A 1XK4A 2QPTA 2F8PA 5GQQC 2EC6C 2EGDA 1B1GA 1A4PA 2F3YA 3VRQA 1FPWA 4PALA 2GGMA 1SNLA 1WRLA 4BY4A 1JWDA 5JOLA 1A29A 1R6PA 2CNPA 2MA2A 3DF0B 2WCFA 4I5KA 1QATA 5F6TA 2LLUA 1B7TZ 3I5GB 1YVLA 2JZIA 1SMGA 3FWCA 3PALA 1KSOA 3QRXA 2LLTA 1JF2A 1MXEA 1BU3A 1IGVA 3OX5A 4M2PA 1KQVA 2L4IA 1CNPA 5I8NA 1JBAA 1K9UA 4ORBB 1KWOC 1N2DA 4MZLA 3EKHA 2L51A 2E30A 3PM8A 2MLFC 2NCPA 4M2QA 3OB1B 4A4BA 1U5IB 4NDCA 3E3RA 1RFJA 4QJ3B 2EHBA 1MF8B 1RK9A 3KEVA 1XA5A 2CBLA 1OQPA 2ZFDA 3JVTB 1CTRA 1YRTB 4YGCB 4CIDA 4GGNA 1JFKA 1JFJA 1DT7B 1N0YA 1YRUB 2JT0A 4AQJA 5G08A 2KAYA 4L9MA 5J3XA 3I5FC 2G9BA 1RWYA 1MUXA 4PCWA 4PHNA 1DJHA 2M1UA 4R1EA 1DMOA 2NXQA 2K2FA 1K2HA 1IRJA 4N1GA 2LUXA 2JNXA 2JQ6A 1S1EA 3OX6A 3PN7B 2LVJA 1KCYA 2K0JA 2JTTA 1NPQA 3AKBA 1DF0B 1BLQA 2LC5A 4CFQA 4YRUA 1L7ZA 2KAXA 3LK0A 4N5XA 3SG5A 1EXRA 1KFUL 2L4HA 1H4BA 3I5IC 4PE0A 4MBEA 2A4JA 1CMGA 2K61A 1A2XA 2JXLA 4P2YB 1LKJA 2RGIA 1IJ5A 1YTZC 2LVIA 4C0KA 3EVUA 4MEWA 2MAZA 1DGUA 1YX8A 3NXAA 5HKZA 1C7WA 5AFPA 4CLNA 2HQ8A 3CLNA 2BKIB 4JQ0D 1WRZA 1NWDA 2BCXA 1GGWA 2I18A 5D69A 3BUNB 4USLA 2PMYA 1S26D 3TDIA 1G4YR 5HKWA 3BYAA 4YGAA 3TDUA 1BF5A 1NUBA 5HYDA 1K90D 1DTLA 3CGAA 1IQ5A 1DJYA 4PHMA 1Q80A 1AJ5A 3VRRA 3JTDB 3CZTX 2M49B 4YI8A 1SCMC 5I2QA 2ZRTA 1PK0D 3EK8A 4C0JA 1OZSA 2ZNEA 2R2IA 1NX1A 1YX7A 3K21A 3NSLA 2V53A 4M2OA 4BY5A 1SRAA 2FCEA 2L98A 1IKUA 3KF9A 3RM1A 1CM4A 2LCPA 3BOWA 4I5JA 1LVCD 2NLNA 1F54A 1AK8A 3CWGA 1CFDA 4OKHA 1M46A 3MSEB 5B8IB 1SR6B 2H2KA 3A4UB 2KDHA 1V1FA 4MN0A 3ZNIA 2K2AA 2ISDA 1OMVA 4DRWA 1NP8A 1F4OA 5FYXA 2BL0B 1PULA 1S6CA 3GK1A 5DKQA 2BE4A 1NCZA 1RECA 2JWWA 3I5GC 4GGFA 4WQ3A 5PALA 3SG3A 2MBXA 4CFRA 1OZOA 1DGVA 2TN4A 2JOJA 3EK4A 1ZFSA 2IS9A 5HKYA 5JJGA 2FCDA 1B4CA 1JUOA 3BXKA 2KAVA 2WCEA 1KK7Y 1ALVA 2KQ6A 2NCOA 1K9KA 3OB2B 1IJ6A 2CCMA 2VRGA 5AERA 1OSAA 2PVBA 4PE4A 1QIWA 1S3PA 4YGBB 2LV7A 3TUYB 1WY9A 2LVVA 3NSKA 1K95A 4HRHA 3BUXB 4ZCUA 2B1UA 3JVTC 3PFVA 3FS7A 4ORCB 4DUQA 5BPJA 4F0ZB 1A03A 1XO5A 3IF7A 2CT9A 2MHHA 1BOCA 1TN4A 1YURA 1LA3A 1S36A 1OE9B 1KSMA 1SL9A 1M45A 2Y1NA 2OTGB 2JXCA 3D0YB 1CFPA 1J7OA 1QVIY 1UHNA 1C7VA 4DIRA 2LP2A 4TNCA 2K7OA 1ZACA 3GK2A 2LM5A 3TDZA 4YI9A 1KFUS 1XFZO 1E8AA 3I5HB 2F33A 1J7QA 2BECA 1FI6A 1ZUZA 1XYDA 1YVHA 4HRGA 1B7TY 3PN7C 1L2OB 3PLFB 5KTYA 1NX3A 4MRYA 1XK4C 1UHIA 1F4QA 3D10A 3WHUB 4GUKA 1KK8B 1QXPA 2H61A 3GOFA 3HX4A 1QX2A 3HCMA 3SG4A 2LE9B 5IBWA 2KI6D 4JPZB 1J1DA 5DKNA 1DJXA 4HREE 2KQYA 1SPYA 1RJVA 2ZRSA 1AP4A 2M29A 1WLZA 1C07A 1XFVO 4GBAA 2K7BA 3F45A 5HLVA 1PSBA 1NCXA 1GJYA 1Y0VH 2AMIA 1XFUO 1YUTA 4UPGA 2ZN9A 1OOJA 2QACA 2MRDA 4N1FA 1CDPA 4PHJA 1K8UA 1TNPA 1W7IB 3TS5B 2JU0A 2MLEC 3BUMB 3NSOA 4MLWA 4OR9B 1BG1A 4QJ5B 3WNXB 1H8BA 2CTNA 4WQ2A 4DCKA 2ZN8A 1TCFA 1MWNA 1UHHA 5TNCA 3JTDC 5AXIA 1RTP1 3DVJA 1DVIA 2L0PA 3EVRA 1FI5A 3IQQA 5CSIA 5ER5A 4E68A 3O2PA 2D8NA 2O5GA 3IQOA 1V1GA 4Q04A 1TRFA 1J1EA 1EG3A 1M63B 1KQMB 1XFYO 1Y1AA 4YBHB 2M7LA 1NIWA 1BODA 3VGOA 3BQ3A 2JTZA 1ODBA 2JPTA 1PVBA 1QTXA 1TNQA 2KI4B 1VRKA 1S5GZ 3H4SE 4AQIA 1OMDA 4MVFA 1ZMZA 1AJ4A 1SR6C 3CTNA 2KI6C 1NCYA 3BUOB 2CXJA 1EH2A 1RROA 2LANA 1Y1UA 2LMUA 5HLOA 1DJIA 1K93D 5K89A 3O6BA 4D1EA 1CLMA 2BL0C 5D7FA 1QV1A 1KFXL 1X02A 2NZ0A 3DVMA 3SIBA 1WDCB 3CR4X 1CDNA 2LMVA 1U5IA 2LVKA 1BR1B 1PRWA 3LLEA 2LHLA 1TNXA 1KK7Z 1CDMA 1K94A 2I94A 1ZOTB 1WLMA 1M39A 4ICBA 2OS8B 4GAOA 2JULA 3TUYC 1MR8A 1EJ3A 4XYNA 4IL1A 5DKRA 1CKKA 1CM1A 1DJZA 3SJSA 1OMRA 2M9GA 4A4CA 1CLLA 1TTXA 2PALA 3PSRA 1N65A 2BBMA 1SKTA 3SG6A 1AUIB 2OTGC 1TCOB 1B8CA 1F55A 3CS1A 2G2BA 2KFHA 1CB1A 2MJWB 4PHKA 4CPVA 1FBVA 4DS7A 1QVIZ 1JSAA 2K8MB 2KOTA 3OP0A 1XVJA 2KYFA 1HT9A 2HQWA 4YGDB 2HPSA 3FWBA 2M8UA 4ZCVA 1M31A 2M7NA 2PASA 2JT3A 3I5HC 1B9AA 3NSIA 3O78A 1BJFA 1YR5A 1JC2A 4NQGA 1XFXO 1J7RA 2KGBC 1IH0A 1L2OC 2I2RE 2ZNDA 2Q4UA 1DJWA 4PE7A 4C0LA 1MXLC 4MSPA 1B47A 1SYMA 2WORA 3LK1A 1IG5A 2EC6B 5KU1A 2LHIA 5CSNA 2KBIA 1FW4A 3KPXA 1AVSA 1KK8C 1EG4A 4PE1A 1F70A 3BOWB 3DD4A 4GNKB 1QV0A 3AAKA 2WNDA 1J55A 2FJUB 2HF5A 2KGRA 2F2PA 2WOSA 4U8DA 2LP3A 1SL7A 4GGFC 1SK6D 1YUUA 3O4YA 4P5OE 1UUSA 2L5XB 1EL4A 1JF0A 1A75A 4MZKA 1PVAA 1KWOB 2F3ZA 4I5NB 3TZ1A 2LUCA 4OV2A 1MHOA 2K7DA 2DOQA 1UHJA 1UP5A 2E6WA 2PRUA 3FIAA 4XJKA 2SCPA 1F71A 2M1KB 3TS5C 2I7AA 2L50A 3WHTB 4MZJA 1BMOA 2JT8A 2JRFA 1SCVA 2M0RA 1S6JA 3CR2A 5KSZA 4JWQA 3KHEA 4YGEB 1D1OA 3CR5X 5AANA 3OHMB 2KFFA 4FTGA 1NYAA 3C1VA 2M3WA 3PATA 1UURA 1MQ1A 3AKAA 2WC8A 3I5FB 2BKHB 1TIZA 2KYCA 1QLKA 1CDLA 1J7PA 3EVVA 1B8LA 3SIAA 1AHRA 1KQMC 1SW8A 2JC2A 2KNEA 1KFXS 1QS7A 3KO0A 5CPVA 3SG2A 2KSPA 1CFFA 1SY9A 2PSRA 2Y4QA 2GGZA 1IWQA 2KI4C 2P6BB 3DVKA 3LCPC 2WCBA 1R2UA 4GPLB 1QX5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BCB A;  1IQ3 A;  2AAO A;  1WRK A;  3VRN A;  1UWO A;  3DF0 A;  3RLZ A;  2H61 C;  2LAP A;  1GGZ A;  1Y1X A;  1BT6 A;  1PSR A;  1HQV A;  5I2L A;  1WDC C;  3WXA A;  2OPO A;  3I5I B;  5I2O A;  1DJG A;  3VRP A;  4I5L B;  4ETO A;  3ZWH A;  2LNK A;  1UHK A;  4FQO A;  2K7C A;  3BUW B;  2LLS A;  1LA0 A;  4MRX A;  1GQM A;  4PDZ A;  2JNF A;  3GK4 X;  1K96 A;  4OVN F;  1A75 B;  2FOT A;  1TOP A;  4WRI A;  1W7J B;  4ORA B;  3ICB A;  1LIN A;  2OS8 C;  4HSZ A;  1SL8 A;  1TNW A;  3D0Y A;  2COL B;  3DVE A;  1XFW O;  2BE6 A;  4XJK B;  5AEQ A;  1CLB A;  4QJ4 B;  1B8R A;  2GV5 A;  3A8R A;  5CSF A;  2HET A;  1F8H A;  3LL8 B;  1BR4 B;  1NX2 A;  1S6I A;  2AUC A;  2BBN A;  2F2O A;  2BCA A;  3EKJ A;  4NDD A;  4AOM A;  1PAL A;  1NX0 A;  1LXF C;  1S5G Y;  1SCM B;  2Y1M A;  2SAS A;  1QJT A;  2KBM A;  4NDB A;  1NSH A;  2Q91 A;  5ER4 X;  1G33 A;  2M97 A;  1K9P A;  1YUS A;  3AAJ A;  1ALW A;  1QLS A;  2Y5I A;  1CMF A;  2KFG A;  1FF1 A;  3VRO A;  3EK7 A;  3SG7 A;  4OCI A;  1CFC A;  1Y6W A;  2LMT A;  5CSJ A;  1QAS A;  1SBJ A;  2ZKM X;  3M0W A;  1G8I A;  2L2E A;  1QIV A;  1QX7 A;  2KHN A;  4GFT A;  1DF0 A;  2O60 A;  1XK4 A;  2QPT A;  2F8P A;  5GQQ C;  2EC6 C;  2EGD A;  1B1G A;  1A4P A;  2F3Y A;  3VRQ A;  1FPW A;  4PAL A;  2GGM A;  1SNL A;  1WRL A;  4BY4 A;  1JWD A;  5JOL A;  1A29 A;  1R6P A;  2CNP A;  2MA2 A;  3DF0 B;  2WCF A;  4I5K A;  1QAT A;  5F6T A;  2LLU A;  1B7T Z;  3I5G B;  1YVL A;  2JZI A;  1SMG A;  3FWC A;  3PAL A;  1KSO A;  3QRX A;  2LLT A;  1JF2 A;  1MXE A;  1BU3 A;  1IGV A;  3OX5 A;  4M2P A;  1KQV A;  2L4I A;  1CNP A;  5I8N A;  1JBA A;  1K9U A;  4ORB B;  1KWO C;  1N2D A;  4MZL A;  3EKH A;  2L51 A;  2E30 A;  3PM8 A;  2MLF C;  2NCP A;  4M2Q A;  3OB1 B;  4A4B A;  1U5I B;  4NDC A;  3E3R A;  1RFJ A;  4QJ3 B;  2EHB A;  1MF8 B;  1RK9 A;  3KEV A;  1XA5 A;  2CBL A;  1OQP A;  2ZFD A;  3JVT B;  1CTR A;  1YRT B;  4YGC B;  4CID A;  4GGN A;  1JFK A;  1JFJ A;  1DT7 B;  1N0Y A;  1YRU B;  2JT0 A;  4AQJ A;  5G08 A;  2KAY A;  4L9M A;  5J3X A;  3I5F C;  2G9B A;  1RWY A;  1MUX A;  4PCW A;  4PHN A;  1DJH A;  2M1U A;  4R1E A;  1DMO A;  2NXQ A;  2K2F A;  1K2H A;  1IRJ A;  4N1G A;  2LUX A;  2JNX A;  2JQ6 A;  1S1E A;  3OX6 A;  3PN7 B;  2LVJ A;  1KCY A;  2K0J A;  2JTT A;  1NPQ A;  3AKB A;  1DF0 B;  1BLQ A;  2LC5 A;  4CFQ A;  4YRU A;  1L7Z A;  2KAX A;  3LK0 A;  4N5X A;  3SG5 A;  1EXR A;  1KFU L;  2L4H A;  1H4B A;  3I5I C;  4PE0 A;  4MBE A;  2A4J A;  1CMG A;  2K61 A;  1A2X A;  2JXL A;  4P2Y B;  1LKJ A;  2RGI A;  1IJ5 A;  1YTZ C;  2LVI A;  4C0K A;  3EVU A;  4MEW A;  2MAZ A;  1DGU A;  1YX8 A;  3NXA A;  5HKZ A;  1C7W A;  5AFP A;  4CLN A;  2HQ8 A;  3CLN A;  2BKI B;  4JQ0 D;  1WRZ A;  1NWD A;  2BCX A;  1GGW A;  2I18 A;  5D69 A;  3BUN B;  4USL A;  2PMY A;  1S26 D;  3TDI A;  1G4Y R;  5HKW A;  3BYA A;  4YGA A;  3TDU A;  1BF5 A;  1NUB A;  5HYD A;  1K90 D;  1DTL A;  3CGA A;  1IQ5 A;  1DJY A;  4PHM A;  1Q80 A;  1AJ5 A;  3VRR A;  3JTD B;  3CZT X;  2M49 B;  4YI8 A;  1SCM C;  5I2Q A;  2ZRT A;  1PK0 D;  3EK8 A;  4C0J A;  1OZS A;  2ZNE A;  2R2I A;  1NX1 A;  1YX7 A;  3K21 A;  3NSL A;  2V53 A;  4M2O A;  4BY5 A;  1SRA A;  2FCE A;  2L98 A;  1IKU A;  3KF9 A;  3RM1 A;  1CM4 A;  2LCP A;  3BOW A;  4I5J A;  1LVC D;  2NLN A;  1F54 A;  1AK8 A;  3CWG A;  1CFD A;  4OKH A;  1M46 A;  3MSE B;  5B8I B;  1SR6 B;  2H2K A;  3A4U B;  2KDH A;  1V1F A;  4MN0 A;  3ZNI A;  2K2A A;  2ISD A;  1OMV A;  4DRW A;  1NP8 A;  1F4O A;  5FYX A;  2BL0 B;  1PUL A;  1S6C A;  3GK1 A;  5DKQ A;  2BE4 A;  1NCZ A;  1REC A;  2JWW A;  3I5G C;  4GGF A;  4WQ3 A;  5PAL A;  3SG3 A;  2MBX A;  4CFR A;  1OZO A;  1DGV A;  2TN4 A;  2JOJ A;  3EK4 A;  1ZFS A;  2IS9 A;  5HKY A;  5JJG A;  2FCD A;  1B4C A;  1JUO A;  3BXK A;  2KAV A;  2WCE A;  1KK7 Y;  1ALV A;  2KQ6 A;  2NCO A;  1K9K A;  3OB2 B;  1IJ6 A;  2CCM A;  2VRG A;  5AER A;  1OSA A;  2PVB A;  4PE4 A;  1QIW A;  1S3P A;  4YGB B;  2LV7 A;  3TUY B;  1WY9 A;  2LVV A;  3NSK A;  1K95 A;  4HRH A;  3BUX B;  4ZCU A;  2B1U A;  3JVT C;  3PFV A;  3FS7 A;  4ORC B;  4DUQ A;  5BPJ A;  4F0Z B;  1A03 A;  1XO5 A;  3IF7 A;  2CT9 A;  2MHH A;  1BOC A;  1TN4 A;  1YUR A;  1LA3 A;  1S36 A;  1OE9 B;  1KSM A;  1SL9 A;  1M45 A;  2Y1N A;  2OTG B;  2JXC A;  3D0Y B;  1CFP A;  1J7O A;  1QVI Y;  1UHN A;  1C7V A;  4DIR A;  2LP2 A;  4TNC A;  2K7O A;  1ZAC A;  3GK2 A;  2LM5 A;  3TDZ A;  4YI9 A;  1KFU S;  1XFZ O;  1E8A A;  3I5H B;  2F33 A;  1J7Q A;  2BEC A;  1FI6 A;  1ZUZ A;  1XYD A;  1YVH A;  4HRG A;  1B7T Y;  3PN7 C;  1L2O B;  3PLF B;  5KTY A;  1NX3 A;  4MRY A;  1XK4 C;  1UHI A;  1F4Q A;  3D10 A;  3WHU B;  4GUK A;  1KK8 B;  1QXP A;  2H61 A;  3GOF A;  3HX4 A;  1QX2 A;  3HCM A;  3SG4 A;  2LE9 B;  5IBW A;  2KI6 D;  4JPZ B;  1J1D A;  5DKN A;  1DJX A;  4HRE E;  2KQY A;  1SPY A;  1RJV A;  2ZRS A;  1AP4 A;  2M29 A;  1WLZ A;  1C07 A;  1XFV O;  4GBA A;  2K7B A;  3F45 A;  5HLV A;  1PSB A;  1NCX A;  1GJY A;  1Y0V H;  2AMI A;  1XFU O;  1YUT A;  4UPG A;  2ZN9 A;  1OOJ A;  2QAC A;  2MRD A;  4N1F A;  1CDP A;  4PHJ A;  1K8U A;  1TNP A;  1W7I B;  3TS5 B;  2JU0 A;  2MLE C;  3BUM B;  3NSO A;  4MLW A;  4OR9 B;  1BG1 A;  4QJ5 B;  3WNX B;  1H8B A;  2CTN A;  4WQ2 A;  4DCK A;  2ZN8 A;  1TCF A;  1MWN A;  1UHH A;  5TNC A;  3JTD C;  5AXI A;  1RTP 1;  3DVJ A;  1DVI A;  2L0P A;  3EVR A;  1FI5 A;  3IQQ A;  5CSI A;  5ER5 A;  4E68 A;  3O2P A;  2D8N A;  2O5G A;  3IQO A;  1V1G A;  4Q04 A;  1TRF A;  1J1E A;  1EG3 A;  1M63 B;  1KQM B;  1XFY O;  1Y1A A;  4YBH B;  2M7L A;  1NIW A;  1BOD A;  3VGO A;  3BQ3 A;  2JTZ A;  1ODB A;  2JPT A;  1PVB A;  1QTX A;  1TNQ A;  2KI4 B;  1VRK A;  1S5G Z;  3H4S E;  4AQI A;  1OMD A;  4MVF A;  1ZMZ A;  1AJ4 A;  1SR6 C;  3CTN A;  2KI6 C;  1NCY A;  3BUO B;  2CXJ A;  1EH2 A;  1RRO A;  2LAN A;  1Y1U A;  2LMU A;  5HLO A;  1DJI A;  1K93 D;  5K89 A;  3O6B A;  4D1E A;  1CLM A;  2BL0 C;  5D7F A;  1QV1 A;  1KFX L;  1X02 A;  2NZ0 A;  3DVM A;  3SIB A;  1WDC B;  3CR4 X;  1CDN A;  2LMV A;  1U5I A;  2LVK A;  1BR1 B;  1PRW A;  3LLE A;  2LHL A;  1TNX A;  1KK7 Z;  1CDM A;  1K94 A;  2I94 A;  1ZOT B;  1WLM A;  1M39 A;  4ICB A;  2OS8 B;  4GAO A;  2JUL A;  3TUY C;  1MR8 A;  1EJ3 A;  4XYN A;  4IL1 A;  5DKR A;  1CKK A;  1CM1 A;  1DJZ A;  3SJS A;  1OMR A;  2M9G A;  4A4C A;  1CLL A;  1TTX A;  2PAL A;  3PSR A;  1N65 A;  2BBM A;  1SKT A;  3SG6 A;  1AUI B;  2OTG C;  1TCO B;  1B8C A;  1F55 A;  3CS1 A;  2G2B A;  2KFH A;  1CB1 A;  2MJW B;  4PHK A;  4CPV A;  1FBV A;  4DS7 A;  1QVI Z;  1JSA A;  2K8M B;  2KOT A;  3OP0 A;  1XVJ A;  2KYF A;  1HT9 A;  2HQW A;  4YGD B;  2HPS A;  3FWB A;  2M8U A;  4ZCV A;  1M31 A;  2M7N A;  2PAS A;  2JT3 A;  3I5H C;  1B9A A;  3NSI A;  3O78 A;  1BJF A;  1YR5 A;  1JC2 A;  4NQG A;  1XFX O;  1J7R A;  2KGB C;  1IH0 A;  1L2O C;  2I2R E;  2ZND A;  2Q4U A;  1DJW A;  4PE7 A;  4C0L A;  1MXL C;  4MSP A;  1B47 A;  1SYM A;  2WOR A;  3LK1 A;  1IG5 A;  2EC6 B;  5KU1 A;  2LHI A;  5CSN A;  2KBI A;  1FW4 A;  3KPX A;  1AVS A;  1KK8 C;  1EG4 A;  4PE1 A;  1F70 A;  3BOW B;  3DD4 A;  4GNK B;  1QV0 A;  3AAK A;  2WND A;  1J55 A;  2FJU B;  2HF5 A;  2KGR A;  2F2P A;  2WOS A;  4U8D A;  2LP3 A;  1SL7 A;  4GGF C;  1SK6 D;  1YUU A;  3O4Y A;  4P5O E;  1UUS A;  2L5X B;  1EL4 A;  1JF0 A;  1A75 A;  4MZK A;  1PVA A;  1KWO B;  2F3Z A;  4I5N B;  3TZ1 A;  2LUC A;  4OV2 A;  1MHO A;  2K7D A;  2DOQ A;  1UHJ A;  1UP5 A;  2E6W A;  2PRU A;  3FIA A;  4XJK A;  2SCP A;  1F71 A;  2M1K B;  3TS5 C;  2I7A A;  2L50 A;  3WHT B;  4MZJ A;  1BMO A;  2JT8 A;  2JRF A;  1SCV A;  2M0R A;  1S6J A;  3CR2 A;  5KSZ A;  4JWQ A;  3KHE A;  4YGE B;  1D1O A;  3CR5 X;  5AAN A;  3OHM B;  2KFF A;  4FTG A;  1NYA A;  3C1V A;  2M3W A;  3PAT A;  1UUR A;  1MQ1 A;  3AKA A;  2WC8 A;  3I5F B;  2BKH B;  1TIZ A;  2KYC A;  1QLK A;  1CDL A;  1J7P A;  3EVV A;  1B8L A;  3SIA A;  1AHR A;  1KQM C;  1SW8 A;  2JC2 A;  2KNE A;  1KFX S;  1QS7 A;  3KO0 A;  5CPV A;  3SG2 A;  2KSP A;  1CFF A;  1SY9 A;  2PSR A;  2Y4Q A;  2GGZ A;  1IWQ A;  2KI4 C;  2P6B B;  3DVK A;  3LCP C;  2WCB A;  1R2U A;  4GPL B;  1QX5 B; 
#chains in the Genus database with same CATH topology
 2BCB A;  1IQ3 A;  2AAO A;  1WRK A;  3VRN A;  1UWO A;  3DF0 A;  3RLZ A;  2H61 C;  2LAP A;  1GGZ A;  1Y1X A;  4JKT A;  1BT6 A;  1PSR A;  1HQV A;  5I2L A;  1WDC C;  3SS5 A;  2OPO A;  3I5I B;  3WXA A;  1DJG A;  5I2O A;  4OZD A;  4IJ7 A;  4I5L B;  3VRP A;  4ETO A;  3ZWH A;  2LNK A;  1UHK A;  2P71 A;  2K7C A;  3BUW B;  4FQO A;  2LLS A;  1LA0 A;  4MRX A;  1GQM A;  4PDZ A;  2JNF A;  3GK4 X;  1K96 A;  4INW A;  4OVN F;  1A75 B;  2FOT A;  1TOP A;  4WRI A;  1W7J B;  4ORA B;  3ICB A;  1LIN A;  2OS8 C;  4HSZ A;  1SL8 A;  3SS4 A;  1TNW A;  3D0Y A;  2COL B;  3DVE A;  1XFW O;  2BE6 A;  4XJK B;  5AEQ A;  1CLB A;  4QJ4 B;  1B8R A;  2GV5 A;  2WCK A;  3A8R A;  3DZT A;  5CSF A;  2HET A;  1F8H A;  3LL8 B;  3FE9 A;  1BR4 B;  2GTE A;  1NX2 A;  1S6I A;  2AUC A;  2BBN A;  2F2O A;  2BCA A;  3EKJ A;  4NDD A;  4AOM A;  1PAL A;  1NX0 A;  1LXF C;  1S5G Y;  1SCM B;  2Y1M A;  2SAS A;  1QJT A;  2KBM A;  4NDB A;  1NSH A;  2Q91 A;  5ER4 X;  1G33 A;  2M97 A;  1K9P A;  1YUS A;  3AAJ A;  1ALW A;  1QLS A;  2Y5I A;  1CMF A;  2KFG A;  1FF1 A;  3VRO A;  3EK7 A;  3SG7 A;  4OCI A;  1CFC A;  1W9Z A;  1Y6W A;  2LMT A;  2WCH A;  3R72 A;  1QAS A;  1SBJ A;  5CSJ A;  2ZKM X;  3B88 A;  1G8I A;  3FE6 A;  2L2E A;  3M0W A;  1QIV A;  2K60 A;  1QX7 A;  2KHN A;  4GFT A;  1DF0 A;  2O60 A;  1XK4 A;  2QPT A;  3B6X A;  2F8P A;  4JD9 A;  2EC6 C;  2EGD A;  1P28 A;  5GQQ C;  1B1G A;  1A4P A;  2F3Y A;  3VRQ A;  1FPW A;  4PAL A;  2GGM A;  1SNL A;  1WRL A;  4BY4 A;  1JWD A;  5JOL A;  1A29 A;  1R6P A;  2CNP A;  3Q8I A;  2MA2 A;  3NGV A;  1OW4 A;  3DF0 B;  2WCF A;  4I5K A;  1QAT A;  5F6T A;  2LLU A;  1B7T Z;  3I5G B;  1YVL A;  2JZI A;  1SMG A;  3FWC A;  3PAL A;  1KSO A;  3QRX A;  2LLT A;  1JF2 A;  1MXE A;  1BU3 A;  1IGV A;  3OX5 A;  1LS8 A;  2ERB A;  4M2P A;  1SSE B;  2L4I A;  1CNP A;  5I8N A;  1KQV A;  1JBA A;  1K9U A;  4ORB B;  2QEH A;  1KWO C;  1N2D A;  4MZL A;  3EKH A;  2L51 A;  2E30 A;  3PM8 A;  3L47 A;  1IH0 A;  2MLF C;  2NCP A;  5FI2 A;  4M2Q A;  3OB1 B;  4A4B A;  1U5I B;  4NDC A;  3E3R A;  1RFJ A;  4QJ3 B;  2EHB A;  1MF8 B;  1RK9 A;  3KEV A;  1XA5 A;  2CBL A;  1OQP A;  2ZFD A;  3JVT B;  1CTR A;  1YRT B;  3L4A A;  4YGC B;  3CYZ A;  4CID A;  4GGN A;  1JFK A;  1JFJ A;  3CZ2 A;  1DT7 B;  3IVT A;  3QME A;  1N0Y A;  1IIO A;  1QWV A;  1YRU B;  1DQE A;  2BAP A;  2JT0 A;  3EG5 B;  4AQJ A;  5G08 A;  2KAY A;  4L9M A;  5J3X A;  3I5F C;  2G9B A;  1RWY A;  1MUX A;  4PCW A;  4PHN A;  1DJH A;  2M1U A;  4R1E A;  1DMO A;  2NXQ A;  2K2F A;  1K2H A;  1IRJ A;  4N1G A;  2LUX A;  2JNX A;  2JQ6 A;  1S1E A;  3OX6 A;  3PN7 B;  2LVJ A;  1KCY A;  1T14 A;  2K0J A;  2JTT A;  1NPQ A;  2YGU A;  1DF0 B;  3AKB A;  1BLQ A;  2LC5 A;  3OBV A;  3S0A A;  1DEK A;  4CFQ A;  4YRU A;  1L7Z A;  2KAX A;  3LK0 A;  4N5X A;  3SG5 A;  1EXR A;  1KFU L;  2L4H A;  1H4B A;  3CAB A;  3I5I C;  2P70 A;  4PE0 A;  4MBE A;  3K1E A;  2A4J A;  1CMG A;  2K61 A;  1A2X A;  2JXL A;  4P2Y B;  1LKJ A;  2RGI A;  1IJ5 A;  1YTZ C;  2LVI A;  4C0K A;  3EVU A;  4MEW A;  2MAZ A;  3D76 A;  1DGU A;  1YX8 A;  3NXA A;  5HKZ A;  1C7W A;  3UO9 A;  5AFP A;  4CLN A;  3RZS A;  2HQ8 A;  3CLN A;  2BKI B;  5FI6 A;  4JQ0 D;  4PT1 A;  1WRZ A;  1NWD A;  2BCX A;  1GGW A;  2I18 A;  5D69 A;  3BUN B;  4USL A;  2PMY A;  1S26 D;  3TDI A;  1G4Y R;  5HKW A;  3BYA A;  4YGA A;  3BFH A;  3TDU A;  2WC5 A;  3SS3 A;  5D3O A;  3BFB A;  1BF5 A;  1NUB A;  3CZ1 A;  5HYD A;  1K90 D;  1DTL A;  3CGA A;  3D75 A;  1IQ5 A;  1DJY A;  2WCJ A;  3CDN A;  4PHM A;  1Q80 A;  1AJ5 A;  3VRR A;  3JTD B;  3CZT X;  2KPH A;  2M49 B;  1SCM C;  4YI8 A;  5I2Q A;  2ZRT A;  1PK0 D;  3EK8 A;  4C0J A;  1OZS A;  2ZNE A;  1TWO A;  1NX1 A;  1YX7 A;  2R2I A;  3K21 A;  3NSL A;  2V53 A;  4M2O A;  4BY5 A;  1SRA A;  2FCE A;  2L98 A;  3BJH A;  3S0F A;  1IKU A;  3KF9 A;  3RM1 A;  1CM4 A;  2LCP A;  3BOW A;  3R1P A;  4I5J A;  1LVC D;  2NLN A;  1F54 A;  1AK8 A;  3CWG A;  1CFD A;  2FJY A;  4OKH A;  1M46 A;  1TUZ A;  3MSE B;  5B8I B;  1SR6 B;  3D78 A;  2H2K A;  3A4U B;  2KDH A;  3BFA A;  1V1F A;  4MN0 A;  3ZNI A;  2K2A A;  2L2C A;  1OMV A;  2ISD A;  4DRW A;  1NP8 A;  1F4O A;  5FYX A;  2BL0 B;  1TUJ A;  1PUL A;  1S6C A;  3GK1 A;  5DKQ A;  2BE4 A;  1NCZ A;  1REC A;  2JWW A;  3I5G C;  4GGF A;  2QDI A;  4WQ3 A;  5PAL A;  2MBX A;  3SG3 A;  1OZO A;  1DGV A;  2TN4 A;  4CFR A;  2JOJ A;  3EK4 A;  1ZFS A;  2IS9 A;  5HKY A;  5JJG A;  2FCD A;  3D73 A;  1B4C A;  1JUO A;  3BXK A;  2KAV A;  2WCE A;  3L4L A;  1KK7 Y;  1ALV A;  2KQ6 A;  2NCO A;  1K9K A;  3OB2 B;  1IJ6 A;  2CCM A;  2QEB A;  2VRG A;  3V2L A;  5AER A;  1OSA A;  2PVB A;  2WC6 A;  4PE4 A;  1QIW A;  1S3P A;  4YGB B;  2LV7 A;  3TUY B;  1WY9 A;  2LVV A;  2JPO A;  1C3Z A;  3NSK A;  1K95 A;  4HRH A;  3BUX B;  4ZCU A;  2B1U A;  3JVT C;  3PFV A;  1XFR A;  3FS7 A;  4ORC B;  4DUQ A;  5BPJ A;  4F0Z B;  1A03 A;  1XO5 A;  3IF7 A;  2CT9 A;  2MHH A;  1BOC A;  1TN4 A;  1YUR A;  1LA3 A;  1S36 A;  1OE9 B;  1KSM A;  1SL9 A;  1M45 A;  2Y1N A;  2OTG B;  2JXC A;  3D0Y B;  1CFP A;  3B86 A;  1J7O A;  1QVI Y;  1UHN A;  1C7V A;  4DIR A;  2LP2 A;  4TNC A;  2K7O A;  1ZAC A;  3GK2 A;  2LM5 A;  3TDZ A;  2QEO A;  4YI9 A;  1KFU S;  1XFZ O;  1E8A A;  3I5H B;  2F33 A;  3R1V A;  2BEC A;  1J7Q A;  1FI6 A;  1ZUZ A;  1XYD A;  1YVH A;  4HRG A;  1B7T Y;  3PN7 C;  1L2O B;  3PLF B;  5KTY A;  1NX3 A;  4MRY A;  1XK4 C;  1UHI A;  1F4Q A;  3D10 A;  3WHU B;  4GUK A;  5FI7 A;  1KK8 B;  1QXP A;  2H61 A;  3GOF A;  3HX4 A;  1QX2 A;  3HCM A;  3SG4 A;  2LE9 B;  5IBW A;  2KI6 D;  4JPZ B;  1J1D A;  5DKN A;  1DJX A;  5I94 A;  4HRE E;  2KQY A;  1SPY A;  1RJV A;  2ZRS A;  1AP4 A;  2M29 A;  2BNX A;  1WLZ A;  1DEL A;  1C07 A;  1XFV O;  4GBA A;  2K7B A;  3F45 A;  2PYQ A;  5HLV A;  1PSB A;  1NCX A;  1GJY A;  1Y0V H;  2AMI A;  1XFU O;  1YUT A;  2PQL A;  4UPG A;  2ZN9 A;  5HL1 A;  1OOJ A;  2QAC A;  2MRD A;  4N1F A;  1CDP A;  3O4X A;  4PHJ A;  1K8U A;  1TNP A;  1W7I B;  3TS5 B;  2JU0 A;  2MLE C;  3B7A A;  3BUM B;  3CZ0 A;  3NSO A;  4MLW A;  4OR9 B;  1BG1 A;  3S0B A;  4QJ5 B;  3WNX B;  1H8B A;  4FQT A;  2CTN A;  4WQ2 A;  4DCK A;  2ZN8 A;  1TCF A;  1MWN A;  1UHH A;  5TNC A;  3JTD C;  5AXI A;  1DC1 A;  1RTP 1;  3DVJ A;  1DVI A;  2L0P A;  3EVR A;  1FI5 A;  3IQQ A;  5CSI A;  5ER5 A;  4F7F A;  3O2P A;  2D8N A;  4E68 A;  2KLE A;  2O5G A;  3IQO A;  1V1G A;  4Q04 A;  1TRF A;  1J1E A;  1EG3 A;  1M63 B;  1KQM B;  1XFY O;  1Y1A A;  4YBH B;  2M7L A;  1NIW A;  1BOD A;  3VGO A;  3BQ3 A;  2JTZ A;  1ODB A;  2JPT A;  1PVB A;  1QTX A;  1TNQ A;  2KI4 B;  1VRK A;  1S5G Z;  3H4S E;  4AQI A;  2KLD A;  1OMD A;  4MVF A;  1ZMZ A;  1AJ4 A;  1SR6 C;  3CTN A;  2KI6 C;  1NCY A;  3BUO B;  2CXJ A;  2WCL A;  1EH2 A;  1RRO A;  2LAN A;  1Y1U A;  2LMU A;  3D74 A;  5HLO A;  1DJI A;  1K93 D;  5K89 A;  3B87 A;  3O6B A;  1CLM A;  4D1E A;  2BL0 C;  5D7F A;  1QV1 A;  1KFX L;  1X02 A;  2NZ0 A;  3DVM A;  3SIB A;  1WDC B;  3CR4 X;  3PM2 A;  1CDN A;  2LMV A;  1U5I A;  1OOI X;  2L5Y A;  2LVK A;  1BR1 B;  1PRW A;  3LLE A;  2LHL A;  1TNX A;  5DIC A;  1KK7 Z;  1CDM A;  1K94 A;  1OOH A;  2I94 A;  3S0G A;  3NHT A;  1ZOT B;  1WLM A;  1ORG A;  1M39 A;  4ICB A;  2OS8 B;  4GAO A;  2JUL A;  3DXL A;  3TUY C;  1MR8 A;  1EJ3 A;  4XYN A;  4IL1 A;  1GM0 A;  5DKR A;  1CKK A;  1CM1 A;  1DJZ A;  3SJS A;  1OMR A;  2M9G A;  3UNW A;  4A4C A;  1CLL A;  1TTX A;  2PAL A;  3PSR A;  1N65 A;  2BBM A;  1SKT A;  3D77 A;  3SG6 A;  1AUI B;  2OTG C;  1TCO B;  1B8C A;  1F55 A;  3CS1 A;  2G2B A;  2KFH A;  1CB1 A;  2MJW B;  4PHK A;  4CPV A;  1FBV A;  4DS7 A;  1QVI Z;  1JSA A;  2K8M B;  2KOT A;  3OP0 A;  1XVJ A;  2KYF A;  1HT9 A;  2HQW A;  3S0E A;  4YGD B;  2HPS A;  3FWB A;  1Z2C B;  2M8U A;  4ZCV A;  1C3Y A;  3DY9 A;  1M31 A;  2M7N A;  2PAS A;  2JT3 A;  3I5H C;  1B9A A;  3NSI A;  3O78 A;  1BJF A;  1YR5 A;  1JC2 A;  4NQG A;  3PJI A;  1XFX O;  1J7R A;  2KGB C;  3DYE A;  1L2O C;  2I2R E;  2ZND A;  2Q4U A;  1DJW A;  4PE7 A;  4C0L A;  1MXL C;  4MSP A;  1B47 A;  1SYM A;  2WOR A;  3LK1 A;  1IG5 A;  2EC6 B;  5KU1 A;  2LHI A;  5CSN A;  2KBI A;  2WCM A;  1FW4 A;  3KPX A;  1AVS A;  1KK8 C;  1EG4 A;  3OGN A;  4PE1 A;  1F70 A;  3BOW B;  3DD4 A;  4GNK B;  1QV0 A;  3AAK A;  2WND A;  1J55 A;  2FJU B;  2HF5 A;  2KGR A;  2F2P A;  2WOS A;  4U8D A;  2LP3 A;  1SL7 A;  4GGF C;  1SK6 D;  1YUU A;  3O4Y A;  4P5O E;  1UUS A;  2L5X B;  1EL4 A;  1JF0 A;  1A75 A;  4MZK A;  1PVA A;  1KWO B;  2F3Z A;  2QEV A;  4I5N B;  3S0D A;  3TZ1 A;  2LUC A;  4OV2 A;  1MHO A;  3VB1 A;  2K7D A;  2DOQ A;  1UHJ A;  1UP5 A;  2E6W A;  2PRU A;  3FIA A;  4XJK A;  2SCP A;  1F71 A;  2M1K B;  3TS5 C;  2I7A A;  2L50 A;  3WHT B;  4MZJ A;  1BMO A;  2JT8 A;  2JRF A;  1SCV A;  2M0R A;  1S6J A;  3CR2 A;  5KSZ A;  3NHI A;  4JWQ A;  3KHE A;  4YGE B;  1D1O A;  2H8V A;  3CR5 X;  5AAN A;  3OHM B;  1OOG A;  2KFF A;  4FTG A;  1NYA A;  3C1V A;  2M3W A;  3PAT A;  1UUR A;  1MQ1 A;  3AKA A;  2WC8 A;  3I5F B;  2BKH B;  4INX A;  1TIZ A;  2KYC A;  1QLK A;  1CDL A;  1J7P A;  3EVV A;  1B8L A;  3SIA A;  1AHR A;  1KQM C;  1SW8 A;  2JC2 A;  2KNE A;  1KFX S;  1QS7 A;  3KO0 A;  5CPV A;  3SG2 A;  2KSP A;  3N7H A;  1CFF A;  1OOF A;  1SY9 A;  1Z4H A;  2PSR A;  2Y4Q A;  2GGZ A;  1IWQ A;  2KI4 C;  2P6B B;  3FE8 A;  3DVK A;  3LCP C;  5EL2 A;  2WCB A;  1R2U A;  3R1O A;  4GPL B;  4KYN A;  1QX5 B; 
#chains in the Genus database with same CATH homology
 2BCB A;  1IQ3 A;  2AAO A;  1WRK A;  3VRN A;  1UWO A;  3DF0 A;  3RLZ A;  2H61 C;  2LAP A;  1GGZ A;  1Y1X A;  1BT6 A;  1PSR A;  1HQV A;  5I2L A;  1WDC C;  3WXA A;  2OPO A;  3I5I B;  5I2O A;  1DJG A;  3VRP A;  4I5L B;  4ETO A;  3ZWH A;  2LNK A;  1UHK A;  4FQO A;  2K7C A;  3BUW B;  2LLS A;  1LA0 A;  4MRX A;  1GQM A;  4PDZ A;  2JNF A;  3GK4 X;  1K96 A;  4OVN F;  1A75 B;  2FOT A;  1TOP A;  4WRI A;  1W7J B;  4ORA B;  3ICB A;  1LIN A;  2OS8 C;  4HSZ A;  1SL8 A;  1TNW A;  3D0Y A;  2COL B;  3DVE A;  1XFW O;  2BE6 A;  4XJK B;  5AEQ A;  1CLB A;  4QJ4 B;  1B8R A;  2GV5 A;  3A8R A;  5CSF A;  2HET A;  1F8H A;  3LL8 B;  1BR4 B;  1NX2 A;  1S6I A;  2AUC A;  2BBN A;  2F2O A;  2BCA A;  3EKJ A;  4NDD A;  4AOM A;  1PAL A;  1NX0 A;  1LXF C;  1S5G Y;  1SCM B;  2Y1M A;  2SAS A;  1QJT A;  2KBM A;  4NDB A;  1NSH A;  2Q91 A;  5ER4 X;  1G33 A;  2M97 A;  1K9P A;  1YUS A;  3AAJ A;  1ALW A;  1QLS A;  2Y5I A;  1CMF A;  2KFG A;  1FF1 A;  3VRO A;  3EK7 A;  3SG7 A;  4OCI A;  1CFC A;  1Y6W A;  2LMT A;  5CSJ A;  1QAS A;  1SBJ A;  2ZKM X;  3M0W A;  1G8I A;  2L2E A;  1QIV A;  1QX7 A;  2KHN A;  4GFT A;  1DF0 A;  2O60 A;  1XK4 A;  2QPT A;  2F8P A;  5GQQ C;  2EC6 C;  2EGD A;  1B1G A;  1A4P A;  2F3Y A;  3VRQ A;  1FPW A;  4PAL A;  2GGM A;  1SNL A;  1WRL A;  4BY4 A;  1JWD A;  5JOL A;  1A29 A;  1R6P A;  2CNP A;  2MA2 A;  3DF0 B;  2WCF A;  4I5K A;  1QAT A;  5F6T A;  2LLU A;  1B7T Z;  3I5G B;  1YVL A;  2JZI A;  1SMG A;  3FWC A;  3PAL A;  1KSO A;  3QRX A;  2LLT A;  1JF2 A;  1MXE A;  1BU3 A;  1IGV A;  3OX5 A;  4M2P A;  1KQV A;  2L4I A;  1CNP A;  5I8N A;  1JBA A;  1K9U A;  4ORB B;  1KWO C;  1N2D A;  4MZL A;  3EKH A;  2L51 A;  2E30 A;  3PM8 A;  2MLF C;  2NCP A;  4M2Q A;  3OB1 B;  4A4B A;  1U5I B;  4NDC A;  3E3R A;  1RFJ A;  4QJ3 B;  2EHB A;  1MF8 B;  1RK9 A;  3KEV A;  1XA5 A;  2CBL A;  1OQP A;  2ZFD A;  3JVT B;  1CTR A;  1YRT B;  4YGC B;  4CID A;  4GGN A;  1JFK A;  1JFJ A;  1DT7 B;  1N0Y A;  1YRU B;  2JT0 A;  4AQJ A;  5G08 A;  2KAY A;  4L9M A;  5J3X A;  3I5F C;  2G9B A;  1RWY A;  1MUX A;  4PCW A;  4PHN A;  1DJH A;  2M1U A;  4R1E A;  1DMO A;  2NXQ A;  2K2F A;  1K2H A;  1IRJ A;  4N1G A;  2LUX A;  2JNX A;  2JQ6 A;  1S1E A;  3OX6 A;  3PN7 B;  2LVJ A;  1KCY A;  2K0J A;  2JTT A;  1NPQ A;  3AKB A;  1DF0 B;  1BLQ A;  2LC5 A;  4CFQ A;  4YRU A;  1L7Z A;  2KAX A;  3LK0 A;  4N5X A;  3SG5 A;  1EXR A;  1KFU L;  2L4H A;  1H4B A;  3I5I C;  4PE0 A;  4MBE A;  2A4J A;  1CMG A;  2K61 A;  1A2X A;  2JXL A;  4P2Y B;  1LKJ A;  2RGI A;  1IJ5 A;  1YTZ C;  2LVI A;  4C0K A;  3EVU A;  4MEW A;  2MAZ A;  1DGU A;  1YX8 A;  3NXA A;  5HKZ A;  1C7W A;  5AFP A;  4CLN A;  2HQ8 A;  3CLN A;  2BKI B;  4JQ0 D;  1WRZ A;  1NWD A;  2BCX A;  1GGW A;  2I18 A;  5D69 A;  3BUN B;  4USL A;  2PMY A;  1S26 D;  3TDI A;  1G4Y R;  5HKW A;  3BYA A;  4YGA A;  3TDU A;  1BF5 A;  1NUB A;  5HYD A;  1K90 D;  1DTL A;  3CGA A;  1IQ5 A;  1DJY A;  4PHM A;  1Q80 A;  1AJ5 A;  3VRR A;  3JTD B;  3CZT X;  2M49 B;  4YI8 A;  1SCM C;  5I2Q A;  2ZRT A;  1PK0 D;  3EK8 A;  4C0J A;  1OZS A;  2ZNE A;  2R2I A;  1NX1 A;  1YX7 A;  3K21 A;  3NSL A;  2V53 A;  4M2O A;  4BY5 A;  1SRA A;  2FCE A;  2L98 A;  1IKU A;  3KF9 A;  3RM1 A;  1CM4 A;  2LCP A;  3BOW A;  4I5J A;  1LVC D;  2NLN A;  1F54 A;  1AK8 A;  3CWG A;  1CFD A;  4OKH A;  1M46 A;  3MSE B;  5B8I B;  1SR6 B;  2H2K A;  3A4U B;  2KDH A;  1V1F A;  4MN0 A;  3ZNI A;  2K2A A;  2ISD A;  1OMV A;  4DRW A;  1NP8 A;  1F4O A;  5FYX A;  2BL0 B;  1PUL A;  1S6C A;  3GK1 A;  5DKQ A;  2BE4 A;  1NCZ A;  1REC A;  2JWW A;  3I5G C;  4GGF A;  4WQ3 A;  5PAL A;  3SG3 A;  2MBX A;  4CFR A;  1OZO A;  1DGV A;  2TN4 A;  2JOJ A;  3EK4 A;  1ZFS A;  2IS9 A;  5HKY A;  5JJG A;  2FCD A;  1B4C A;  1JUO A;  3BXK A;  2KAV A;  2WCE A;  1KK7 Y;  1ALV A;  2KQ6 A;  2NCO A;  1K9K A;  3OB2 B;  1IJ6 A;  2CCM A;  2VRG A;  5AER A;  1OSA A;  2PVB A;  4PE4 A;  1QIW A;  1S3P A;  4YGB B;  2LV7 A;  3TUY B;  1WY9 A;  2LVV A;  3NSK A;  1K95 A;  4HRH A;  3BUX B;  4ZCU A;  2B1U A;  3JVT C;  3PFV A;  3FS7 A;  4ORC B;  4DUQ A;  5BPJ A;  4F0Z B;  1A03 A;  1XO5 A;  3IF7 A;  2CT9 A;  2MHH A;  1BOC A;  1TN4 A;  1YUR A;  1LA3 A;  1S36 A;  1OE9 B;  1KSM A;  1SL9 A;  1M45 A;  2Y1N A;  2OTG B;  2JXC A;  3D0Y B;  1CFP A;  1J7O A;  1QVI Y;  1UHN A;  1C7V A;  4DIR A;  2LP2 A;  4TNC A;  2K7O A;  1ZAC A;  3GK2 A;  2LM5 A;  3TDZ A;  4YI9 A;  1KFU S;  1XFZ O;  1E8A A;  3I5H B;  2F33 A;  1J7Q A;  2BEC A;  1FI6 A;  1ZUZ A;  1XYD A;  1YVH A;  4HRG A;  1B7T Y;  3PN7 C;  1L2O B;  3PLF B;  5KTY A;  1NX3 A;  4MRY A;  1XK4 C;  1UHI A;  1F4Q A;  3D10 A;  3WHU B;  4GUK A;  1KK8 B;  1QXP A;  2H61 A;  3GOF A;  3HX4 A;  1QX2 A;  3HCM A;  3SG4 A;  2LE9 B;  5IBW A;  2KI6 D;  4JPZ B;  1J1D A;  5DKN A;  1DJX A;  4HRE E;  2KQY A;  1SPY A;  1RJV A;  2ZRS A;  1AP4 A;  2M29 A;  1WLZ A;  1C07 A;  1XFV O;  4GBA A;  2K7B A;  3F45 A;  5HLV A;  1PSB A;  1NCX A;  1GJY A;  1Y0V H;  2AMI A;  1XFU O;  1YUT A;  4UPG A;  2ZN9 A;  1OOJ A;  2QAC A;  2MRD A;  4N1F A;  1CDP A;  4PHJ A;  1K8U A;  1TNP A;  1W7I B;  3TS5 B;  2JU0 A;  2MLE C;  3BUM B;  3NSO A;  4MLW A;  4OR9 B;  1BG1 A;  4QJ5 B;  3WNX B;  1H8B A;  2CTN A;  4WQ2 A;  4DCK A;  2ZN8 A;  1TCF A;  1MWN A;  1UHH A;  5TNC A;  3JTD C;  5AXI A;  1RTP 1;  3DVJ A;  1DVI A;  2L0P A;  3EVR A;  1FI5 A;  3IQQ A;  5CSI A;  5ER5 A;  4E68 A;  3O2P A;  2D8N A;  2O5G A;  3IQO A;  1V1G A;  4Q04 A;  1TRF A;  1J1E A;  1EG3 A;  1M63 B;  1KQM B;  1XFY O;  1Y1A A;  4YBH B;  2M7L A;  1NIW A;  1BOD A;  3VGO A;  3BQ3 A;  2JTZ A;  1ODB A;  2JPT A;  1PVB A;  1QTX A;  1TNQ A;  2KI4 B;  1VRK A;  1S5G Z;  3H4S E;  4AQI A;  1OMD A;  4MVF A;  1ZMZ A;  1AJ4 A;  1SR6 C;  3CTN A;  2KI6 C;  1NCY A;  3BUO B;  2CXJ A;  1EH2 A;  1RRO A;  2LAN A;  1Y1U A;  2LMU A;  5HLO A;  1DJI A;  1K93 D;  5K89 A;  3O6B A;  4D1E A;  1CLM A;  2BL0 C;  5D7F A;  1QV1 A;  1KFX L;  1X02 A;  2NZ0 A;  3DVM A;  3SIB A;  1WDC B;  3CR4 X;  1CDN A;  2LMV A;  1U5I A;  2LVK A;  1BR1 B;  1PRW A;  3LLE A;  2LHL A;  1TNX A;  1KK7 Z;  1CDM A;  1K94 A;  2I94 A;  1ZOT B;  1WLM A;  1M39 A;  4ICB A;  2OS8 B;  4GAO A;  2JUL A;  3TUY C;  1MR8 A;  1EJ3 A;  4XYN A;  4IL1 A;  5DKR A;  1CKK A;  1CM1 A;  1DJZ A;  3SJS A;  1OMR A;  2M9G A;  4A4C A;  1CLL A;  1TTX A;  2PAL A;  3PSR A;  1N65 A;  2BBM A;  1SKT A;  3SG6 A;  1AUI B;  2OTG C;  1TCO B;  1B8C A;  1F55 A;  3CS1 A;  2G2B A;  2KFH A;  1CB1 A;  2MJW B;  4PHK A;  4CPV A;  1FBV A;  4DS7 A;  1QVI Z;  1JSA A;  2K8M B;  2KOT A;  3OP0 A;  1XVJ A;  2KYF A;  1HT9 A;  2HQW A;  4YGD B;  2HPS A;  3FWB A;  2M8U A;  4ZCV A;  1M31 A;  2M7N A;  2PAS A;  2JT3 A;  3I5H C;  1B9A A;  3NSI A;  3O78 A;  1BJF A;  1YR5 A;  1JC2 A;  4NQG A;  1XFX O;  1J7R A;  2KGB C;  1IH0 A;  1L2O C;  2I2R E;  2ZND A;  2Q4U A;  1DJW A;  4PE7 A;  4C0L A;  1MXL C;  4MSP A;  1B47 A;  1SYM A;  2WOR A;  3LK1 A;  1IG5 A;  2EC6 B;  5KU1 A;  2LHI A;  5CSN A;  2KBI A;  1FW4 A;  3KPX A;  1AVS A;  1KK8 C;  1EG4 A;  4PE1 A;  1F70 A;  3BOW B;  3DD4 A;  4GNK B;  1QV0 A;  3AAK A;  2WND A;  1J55 A;  2FJU B;  2HF5 A;  2KGR A;  2F2P A;  2WOS A;  4U8D A;  2LP3 A;  1SL7 A;  4GGF C;  1SK6 D;  1YUU A;  3O4Y A;  4P5O E;  1UUS A;  2L5X B;  1EL4 A;  1JF0 A;  1A75 A;  4MZK A;  1PVA A;  1KWO B;  2F3Z A;  4I5N B;  3TZ1 A;  2LUC A;  4OV2 A;  1MHO A;  2K7D A;  2DOQ A;  1UHJ A;  1UP5 A;  2E6W A;  2PRU A;  3FIA A;  4XJK A;  2SCP A;  1F71 A;  2M1K B;  3TS5 C;  2I7A A;  2L50 A;  3WHT B;  4MZJ A;  1BMO A;  2JT8 A;  2JRF A;  1SCV A;  2M0R A;  1S6J A;  3CR2 A;  5KSZ A;  4JWQ A;  3KHE A;  4YGE B;  1D1O A;  3CR5 X;  5AAN A;  3OHM B;  2KFF A;  4FTG A;  1NYA A;  3C1V A;  2M3W A;  3PAT A;  1UUR A;  1MQ1 A;  3AKA A;  2WC8 A;  3I5F B;  2BKH B;  1TIZ A;  2KYC A;  1QLK A;  1CDL A;  1J7P A;  3EVV A;  1B8L A;  3SIA A;  1AHR A;  1KQM C;  1SW8 A;  2JC2 A;  2KNE A;  1KFX S;  1QS7 A;  3KO0 A;  5CPV A;  3SG2 A;  2KSP A;  1CFF A;  1SY9 A;  2PSR A;  2Y4Q A;  2GGZ A;  1IWQ A;  2KI4 C;  2P6B B;  3DVK A;  3LCP C;  2WCB A;  1R2U A;  4GPL B;  1QX5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...