4PHMA

The structural basis of differential inhibition of human calpain by indole and phenyl alpha-mercaptoacrylic acids
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
173
structure length
173
Chain Sequence
EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calpain small subunit 1
publication title The structural basis of differential inhibition of human calpain by indole and phenyl alpha-mercaptoacrylic acids.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 60
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4phmA00
2L4IA 2A4JA 2NLNA 1K8UA 4JQ0D 1ODBA 2CCMA 1IH0A 1EG3A 2JRFA 3DVMA 2PSRA 1FF1A 2CNPA 1RK9A 2FOTA 1KSMA 2BL0B 3GK4X 1J55A 1C7VA 2GGZA 1F54A 4MBEA 1SRAA 1QIVA 2PRUA 2AAOA 4N1FA 3DVJA 1QX7A 3PALA 1LKJA 5HLOA 3HCMA 1K2HA 1GGZA 1MWNA 1S1EA 2LNKA 3HX4A 4M2PA 2VRGA 2V53A 1DJZA 1S26D 1A29A 4BY4A 1QV0A 2L2EA 2HETA 2MLFC 4PHNA 4NDCA 1TIZA 1DF0A 1QLKA 3O6BA 2SCPA 1AJ5A 2JQ6A 3K21A 1TTXA 1UHJA 2JWWA 2K2FA 3AAJA 1Q80A 4YGDB 4HREE 3WXAA 1B4CA 1B47A 2BE6A 3PN7C 1KFUS 1RJVA 2JZIA 3DF0B 1M46A 2MRDA 1BR4B 1TNXA 2EHBA 2KBIA 2ZN9A 2K0JA 4I5NB 2OPOA 1S36A 3KPXA 1LA3A 3CR5X 1LVCD 2LUCA 1ALVA 1SR6B 1IKUA 1FPWA 3VRNA 5TNCA 5I2OA 3AKAA 1ZOTB 1KFXL 1KK7Z 1SL9A 2LHLA 2LVKA 3EVVA 5CSNA 1XFUO 4U8DA 1NCXA 1FI6A 1MUXA 2ZFDA 1QLSA 2FJUB 3NSIA 2JNXA 1QATA 1ZMZA 1IQ5A 1JF0A 2BCXA 2CXJA 3BUXB 3FWCA 3GOFA 2EGDA 1LINA 3EK7A 4MEWA 2MHHA 5IBWA 3WHTB 4MRXA 3D0YB 1RFJA 1UHIA 2KFFA 1M63B 2ZNEA 4GNKB 4M2QA 3BUMB 1OMRA 3GK1A 3MSEB 1B9AA 2LC5A 3CS1A 2I2RE 1RTP1 1XA5A 3DD4A 5K89A 1YR5A 5F6TA 3FWBA 2CTNA 2H2KA 2OTGB 4FQOA 3A8RA 2M29A 1AVSA 2AUCA 2JPTA 2O60A 1K96A 1NP8A 1SYMA 1AP4A 4PDZA 2TN4A 2BL0C 3F45A 3KHEA 1CFPA 2H61A 2WC8A 3FIAA 2E6WA 5GQQC 2B1UA 1DGVA 5DKQA 5AFPA 1EG4A 1SBJA 1NYAA 4XYNA 3ZWHA 1DVIA 3IQOA 1F8HA 4XJKB 1VRKA 4QJ5B 3KEVA 3WNXB 3VROA 1OZOA 3KF9A 3KO0A 3TDIA 4BY5A 1SPYA 1M39A 1DJHA 1BLQA 2JULA 1ZUZA 4D1EA 3VRPA 1XFYO 2K7BA 3GK2A 3JVTB 2JT8A 1NCYA 5D69A 3SG5A 1X02A 2JU0A 3D10A 1BU3A 1XYDA 2Q4UA 1MF8B 1QXPA 1B7TZ 1M31A 1SR6C 3TDUA 1JUOA 1CDMA 2IS9A 1PVBA 1PULA 2MLEC 2JNFA 4WQ2A 4CFRA 2LANA 2LE9B 3O78A 1SW8A 5CSFA 4C0JA 2K7CA 4PHKA 3EKHA 1A4PA 1RECA 1IJ5A 3SIBA 1MHOA 2G2BA 4QJ4B 1QVIZ 2JT3A 1TNPA 4JPZB 4PE4A 1L2OB 1UWOA 1WRZA 1NX3A 2KI6C 3OX6A 4PHJA 2MBXA 1SL8A 4YBHB 1D1OA 5JOLA 3CR4X 3O2PA 3RM1A 1SNLA 1UURA 1S6CA 1OE9B 2H61C 2JXLA 1JC2A 1NUBA 5I8NA 1NX2A 3FS7A 1H8BA 1YVHA 2JTZA 1H4BA 1L7ZA 2KQYA 2LHIA 1SKTA 2OTGC 2ZN8A 1CLMA 3CGAA 3CR2A 4AQJA 1QX2A 3EKJA 4FTGA 1F55A 2HF5A 1YUTA 4PE0A 2HQWA 1DF0B 3PFVA 3BUOB 3OP0A 4Q04A 3BYAA 3C1VA 2BCBA 4MZJA 5B8IB 1YRTB 2LMVA 3EK8A 4HSZA 1DJWA 1R6PA 1B8CA 1SMGA 1N0YA 1CNPA 1A2XA 4GPLB 1GJYA 5KTYA 1NSHA 2F2OA 2LVJA 1UHHA 4MSPA 1JF2A 1OQPA 1PVAA 2F3ZA 2KI4B 1DJGA 1UHKA 4I5KA 3EVUA 2BECA 1XFVO 3H4SE 3SG2A 3JVTC 1QASA 1YTZC 2KQ6A 2LM5A 1S6JA 4IL1A 3NSOA 1KQMB 2K8MB 4GFTA 2Y4QA 2LVVA 1BMOA 5I2LA 3SG3A 1YUUA 1CKKA 1CLLA 1W7IB 3NSLA 3ZNIA 1OMDA 3CZTX 4PALA 1JFKA 2LLUA 5D7FA 1TN4A 3BQ3A 1EJ3A 1CMGA 2F2PA 4ORAB 2DOQA 2MJWB 2LP3A 1BT6A 1L2OC 1WDCB 2JXCA 1R2UA 2KGBC 1NIWA 1TRFA 1QTXA 2PASA 2G9BA 1B8RA 2I18A 1YURA 1F71A 1U5IB 1W7JB 1G8IA 1PK0D 1UP5A 2ZRSA 5HKYA 3JTDB 2KBMA 1B1GA 1WLMA 3TDZA 4YGCB 1K9PA 4MVFA 4A4BA 1K9KA 1Y1XA 2K7DA 1EXRA 2M1KB 5CSJA 1KK8B 1DT7B 2NZ0A 1TNWA 1U5IA 3I5GB 1QS7A 1KSOA 4N1GA 4ORCB 5ER5A 2NCPA 3IQQA 1BJFA 2KHNA 1QX5B 1KCYA 1SCMB 1CDPA 3I5HB 2QPTA 1MR8A 3RLZA 1OZSA 2M8UA 5AANA 1RROA 1KWOB 2Q91A 2FCEA 2KOTA 4GAOA 5DKNA 3OB2B 1QV1A 4DIRA 4P2YB 1OOJA 2Y1NA 2LUXA 4ZCUA 1E8AA 2KI4C 1ZFSA 3M0WA 1IG5A 4JWQA 1K93D 2I7AA 3SJSA 1EL4A 2WCBA 1LXFC 2KNEA 1A75A 2K2AA 4OR9B 2AMIA 2LMUA 2ZNDA 1KQMC 5CPVA 3TZ1A 1YX7A 1PSBA 2M7LA 3TUYB 5AEQA 2NCOA 2BKIB 3NSKA 2JC2A 3O4YA 2OS8B 4DRWA 2PALA 3BXKA 1S5GY 3QRXA 2BKHB 3SIAA 2L5XB 1MXLC 1G4YR 4MZKA 2D8NA 1V1GA 1WDCC 2HQ8A 5DKRA 1AJ4A 4F0ZB 4GBAA 2LV7A 1BF5A 2MA2A 4MLWA 4PE1A 1K9UA 1QVIY 3CLNA 3BOWA 3JTDC 2R2IA 3EK4A 2LVIA 4WQ3A 1CB1A 1OSAA 2F8PA 3SG7A 4ZCVA 1WRKA 3I5FB 1IWQA 3PATA 1PALA 1N65A 2K61A 2M7NA 1IJ6A 1PSRA 1KK8C 1G33A 3I5GC 2NXQA 2P6BB 5HKWA 1ALWA 1SCMC 4NQGA 1HT9A 3VRQA 2WNDA 1CM1A 3I5HC 1TCOB 5AXIA 2M1UA 1CM4A 4YI9A 1NCZA 3EVRA 1KWOC 5J3XA 5AERA 1C07A 2KGRA 3LLEA 4USLA 4P5OE 1F4QA 1XFWO 2KSPA 2EC6B 1K95A 2KYCA 5ER4X 4GUKA 3TS5B 2WCFA 5G08A 2LLSA 3AAKA 4YI8A 4I5JA 3VGOA 1UHNA 3I5IB 5FYXA 2M3WA 4AOMA 4PCWA 4N5XA 1IGVA 1BODA 4HRGA 1YVLA 3OB1B 3TUYC 1J1EA 1Y6WA 5CSIA 4YGBB 1IRJA 1NX0A 1J7QA 1XVJA 2CT9A 1DGUA 2OS8C 1AUIB 2K7OA 4CPVA 3SG6A 2FCDA 2L0PA 1BOCA 1YRUB 4NDDA 1CTRA 4ICBA 1J7PA 2LAPA 1CFCA 4GGFA 1KK7Y 1WY9A 4L9MA 3ICBA 2JOJA 3CTNA 5HKZA 2RGIA 2ZRTA 2BE4A 2CBLA 1MXEA 1SY9A 4YGEB 1N2DA 2E30A 4C0LA 3NXAA 1AK8A 2M49B 4TNCA 2KFGA 1DMOA 2L4HA 2M0RA 1J7OA 1F70A 4CLNA 2HPSA 3I5FC 4ORBB 4PE7A 3E3RA 1CFFA 4A4CA 1Y0VH 3BUNB 3DF0A 1BG1A 4PHMA 2LP2A 3PM8A 2GV5A 2M9GA 3PLFB 3LK0A 1JFJA 1FW4A 4NDBA 4DCKA 1AHRA 4OKHA 3OHMB 2KAYA 1YX8A 1DJYA 2JT0A 2LMTA 5BPJA 4CFQA 5KSZA 3BUWB 2LLTA 1WRLA 2F33A 1FI5A 1LA0A 2O5GA 1CLBA 4I5LB 4OCIA 1J1DA 1NX1A 1A75B 1J7RA 4DUQA 1TOPA 2BBMA 4QJ3B 2EC6C 3TS5C 1ZACA 2I94A 1XO5A 1TCFA 1FBVA 1Y1UA 1XK4A 1SL7A 3IF7A 3A4UB 5KU1A 3I5IC 3D0YA 4R1EA 4ETOA 3AKBA 4UPGA 2WORA 1RWYA 4GGFC 1A03A 1DTLA 2PMYA 1F4OA 1M45A 1SCVA 2COLB 2KI6D 2KYFA 4OVNF 1S3PA 4WRIA 2PVBA 2L51A 1NWDA 2QACA 3DVKA 3BOWB 1B7TY 2BBNA 1IQ3A 1UUSA 1C7WA 3LK1A 4C0KA 5JJGA 2M97A 1K94A 4MZLA 1JWDA 2KDHA 3LL8B 1BR1B 1KFUL 3PN7B 4DS7A 1CDLA 4XJKA 2SASA 1XFZO 1EH2A 1Y1AA 1GQMA 3PSRA 1WLZA 1QIWA 1V1FA 3DVEA 1NPQA 5HLVA 1CDNA 1K90D 1S5GZ 2Y5IA 1DJIA 4CIDA 2BCAA 1CMFA 3OX5A 4OV2A 5I2QA 1JBAA 1KQVA 4YGAA 2LCPA 2F3YA 3LCPC 1KFXS 1QJTA 2WCEA 5PALA 1PRWA 4YRUA 2L50A 2MAZA 2KAXA 3WHUB 1YUSA 2L98A 1DJXA 1MQ1A 1SK6D 2KFHA 1TNQA 2WOSA 4M2OA 3CWGA 2JTTA 2Y1MA 1S6IA 2KAVA 1XK4C 4MRYA 4MN0A 1GGWA 4AQIA 1OMVA 4E68A 4HRHA 1B8LA 3VRRA 1CFDA 1HQVA 1XFXO 1JSAA 2GGMA 2ISDA 2ZKMX 4GGNA 5HYDA 3SG4A
chains in the Genus database with same CATH superfamily
1OOHA 2L4IA 2A4JA 2PQLA 2NLNA 3S0GA 1K8UA 4JQ0D 1ODBA 2CCMA 3D74A 1IH0A 1EG3A 2JRFA 3DVMA 2PSRA 1FF1A 2CNPA 1RK9A 2FOTA 1KSMA 2BL0B 3GK4X 1J55A 1C7VA 2GGZA 1F54A 3O4XA 4MBEA 1SRAA 1QIVA 2PRUA 2AAOA 4N1FA 3DVJA 1QX7A 3PALA 1LKJA 5HLOA 3HCMA 2WC5A 1K2HA 1GGZA 1MWNA 2PYQA 1S1EA 2LNKA 3HX4A 4M2PA 2VRGA 2V53A 1DJZA 1S26D 1A29A 4BY4A 1QV0A 2L2EA 2HETA 2MLFC 4PHNA 4NDCA 2KLEA 1TIZA 4F7FA 1DF0A 1QLKA 3O6BA 2SCPA 1AJ5A 2JQ6A 3K21A 1TTXA 1UHJA 2JWWA 2K2FA 3AAJA 1Q80A 4YGDB 4HREE 3WXAA 1B4CA 1B47A 3PJIA 2BE6A 3PN7C 1KFUS 1RJVA 2JZIA 3BFAA 1M46A 2MRDA 1BR4B 1TNXA 3DF0B 2EHBA 2KBIA 4JD9A 2ZN9A 2K0JA 4I5NB 2OPOA 1S36A 2WCHA 3KPXA 1LA3A 3CR5X 3NHIA 1LVCD 2LUCA 1ALVA 3V2LA 1SR6B 3B86A 1IKUA 1FPWA 3VRNA 5TNCA 5I2OA 3AKAA 1ZOTB 1KFXL 1KK7Z 1SL9A 2LHLA 2LVKA 3EVVA 5CSNA 1XFUO 1DC1A 4U8DA 1NCXA 1FI6A 1MUXA 2ZFDA 1QLSA 2FJUB 3NSIA 2JNXA 1QATA 1ZMZA 1IQ5A 1JF0A 1SSEB 2BCXA 2CXJA 3BUXB 3FWCA 3GOFA 2EGDA 1LINA 1W9ZA 3EK7A 2QEHA 4MEWA 2MHHA 5IBWA 3WHTB 2BNXA 4MRXA 3D0YB 1RFJA 1UHIA 2KFFA 1M63B 2ZNEA 4GNKB 4M2QA 3BUMB 1OMRA 3GK1A 3MSEB 1B9AA 2LC5A 3CS1A 2I2RE 1RTP1 1XA5A 3DD4A 3L4AA 5K89A 1YR5A 5FI7A 5F6TA 3S0AA 3FWBA 2CTNA 2H2KA 2OTGB 4FQOA 3A8RA 2M29A 1AVSA 2AUCA 2JPTA 2O60A 1K96A 1NP8A 3B6XA 1SYMA 1AP4A 4PDZA 2TN4A 2BL0C 3F45A 3KHEA 1CFPA 2H61A 2WC8A 3FIAA 2E6WA 5GQQC 2B1UA 1DGVA 5DKQA 5AFPA 1EG4A 1SBJA 1NYAA 4XYNA 3ZWHA 1DVIA 3IQOA 1F8HA 4XJKB 1VRKA 4QJ5B 3KEVA 3WNXB 3VROA 1OZOA 2WCJA 3KF9A 3KO0A 4FQTA 3TDIA 4BY5A 1SPYA 1M39A 1DJHA 1T14A 1BLQA 2JULA 1ZUZA 4D1EA 3VRPA 1XFYO 2K7BA 3GK2A 3JVTB 2JT8A 1NCYA 5D69A 3SG5A 1X02A 1D1OA 2JU0A 3D10A 1BU3A 1XYDA 2Q4UA 1MF8B 1QXPA 1B7TZ 1M31A 1DELA 1SR6C 4IJ7A 3TDUA 4OZDA 1JUOA 2L5YA 2H8VA 1CDMA 2IS9A 1PVBA 1PULA 2MLEC 2JNFA 4WQ2A 4CFRA 3FE6A 2LANA 2LE9B 3DYEA 3O78A 1SW8A 5CSFA 4C0JA 2K7CA 4PHKA 3EKHA 1A4PA 1RECA 1IJ5A 3SIBA 1MHOA 2G2BA 4QJ4B 1QVIZ 2JT3A 1TNPA 4JPZB 4PE4A 1L2OB 1UWOA 1WRZA 1NX3A 2KI6C 2WCKA 2QEBA 3OX6A 1SL8A 4PHJA 4YBHB 1Z4HA 3CR4X 3O2PA 3BJHA 3QMEA 1SNLA 1UURA 1S6CA 1OE9B 2H61C 3RM1A 2JXLA 1JC2A 1NUBA 5I8NA 1NX2A 3FS7A 5I94A 1H8BA 1YVHA 2JTZA 1H4BA 1L7ZA 2KQYA 2LHIA 1SKTA 2OTGC 2ZN8A 1CLMA 3DY9A 3CGAA 3N7HA 3CR2A 4AQJA 1QX2A 3EKJA 4FTGA 4INWA 1F55A 2HF5A 1YUTA 4PE0A 1OOIX 2HQWA 1DF0B 1C3ZA 3BUOB 3OP0A 3PFVA 3BYAA 3C1VA 4Q04A 2BCBA 4MZJA 5EL2A 5B8IB 1YRTB 2LMVA 3EK8A 4HSZA 1DJWA 1R6PA 1B8CA 1SMGA 2WC6A 1N0YA 1CNPA 3PM2A 1A2XA 4GPLB 1GJYA 5KTYA 1NSHA 2F2OA 2LVJA 1UHHA 4MSPA 1JF2A 1OQPA 1PVAA 2QDIA 2F3ZA 2KI4B 1DJGA 1UHKA 4I5KA 3EVUA 2BECA 1XFVO 3H4SE 3SG2A 3JVTC 1QASA 1YTZC 2KQ6A 5JOLA 3B7AA 3VB1A 2LM5A 1TUZA 1S6JA 4IL1A 5DICA 2KPHA 1KQMB 2K8MB 3NSOA 2Y4QA 4GFTA 2LVVA 1BMOA 5I2LA 3SG3A 1YUUA 4PT1A 1CLLA 1W7IB 3NSLA 1CKKA 3ZNIA 1OMDA 3CZTX 3OBVA 4PALA 1JFKA 2LLUA 5D7FA 1TN4A 3B87A 3B88A 1EJ3A 3BQ3A 1CMGA 2F2PA 4ORAB 2DOQA 2MJWB 2LP3A 1BT6A 1L2OC 1WDCB 2JXCA 1R2UA 2KGBC 3CZ1A 1NIWA 1TRFA 1QTXA 2PASA 2G9BA 3CABA 1B8RA 2I18A 1YURA 1F71A 1U5IB 1W7JB 1G8IA 1PK0D 1UP5A 2ZRSA 3IVTA 5HKYA 3JTDB 2KBMA 1B1GA 2QEOA 1WLMA 2BAPA 3TDZA 4YGCB 1K9PA 2P70A 4MVFA 4A4BA 1K9KA 1Y1XA 2K7DA 1EXRA 2M1KB 5CSJA 1IIOA 1KK8B 1DT7B 2NZ0A 3D75A 1TNWA 1U5IA 3I5GB 1QS7A 1KSOA 4N1GA 1OW4A 4ORCB 5ER5A 2NCPA 3IQQA 1BJFA 2KHNA 1QX5B 3D76A 1KCYA 1SCMB 3D78A 1CDPA 3SS5A 3I5HB 2QPTA 1MR8A 3RLZA 1OZSA 2M8UA 5AANA 1RROA 1KWOB 2Q91A 1P28A 2FCEA 2KOTA 4GAOA 3OB2B 5DKNA 1QV1A 4DIRA 4P2YB 1OOJA 2Y1NA 2LUXA 4ZCUA 1E8AA 2KI4C 1ZFSA 3M0WA 1QWVA 1IG5A 4JWQA 1K93D 2I7AA 3SJSA 1LS8A 1EL4A 2WCBA 1LXFC 2KNEA 1A75A 2K2AA 4OR9B 2AMIA 2JPOA 2LMUA 2ZNDA 1KQMC 3K1EA 5CPVA 3TZ1A 1YX7A 1PSBA 3CZ0A 2M7LA 5AEQA 3TUYB 1DQEA 2NCOA 2BKIB 2WCLA 3NHTA 2JC2A 3EG5B 3NSKA 2OS8B 3O4YA 4DRWA 2PALA 3BXKA 1S5GY 3QRXA 2BKHB 3SIAA 2L5XB 1MXLC 1G4YR 4MZKA 2D8NA 1V1GA 2MBXA 1WDCC 2HQ8A 5DKRA 1AJ4A 3L47A 4F0ZB 4GBAA 2LV7A 3NGVA 2L2CA 1BF5A 2MA2A 1Z2CB 4MLWA 4PE1A 1K9UA 3L4LA 1QVIY 3CLNA 3BOWA 3JTDC 2R2IA 3EK4A 2GTEA 2WCMA 2LVIA 4WQ3A 3FE9A 1CB1A 1OSAA 1GM0A 2F8PA 3SG7A 4ZCVA 1WRKA 3I5FB 1IWQA 3R1PA 3PATA 1PALA 1N65A 2K61A 2M7NA 1IJ6A 1PSRA 1KK8C 5FI2A 1G33A 3I5GC 2NXQA 2P6BB 3R72A 5HKWA 1C3YA 5FI6A 1ALWA 1SCMC 4NQGA 1HT9A 3VRQA 2WNDA 1CM1A 3I5HC 1TCOB 5AXIA 2M1UA 1CM4A 3BFHA 1NCZA 3EVRA 1KWOC 4YI9A 5J3XA 5AERA 1C07A 2KGRA 3LLEA 4USLA 4P5OE 1F4QA 1XFWO 2KSPA 2EC6B 1K95A 2KYCA 5ER4X 4GUKA 3TS5B 2WCFA 3BFBA 4INXA 5G08A 2LLSA 3AAKA 4YI8A 4I5JA 3VGOA 1UHNA 3I5IB 5FYXA 2M3WA 4AOMA 4PCWA 4N5XA 4KYNA 1IGVA 1BODA 4HRGA 3CYZA 1YVLA 3OB1B 1OOFA 1J1EA 1Y6WA 5CSIA 4YGBB 1IRJA 1NX0A 3TUYC 1TWOA 1J7QA 1XVJA 2CT9A 1DGUA 2OS8C 1AUIB 2K7OA 4CPVA 5D3OA 3S0DA 2YGUA 3SG6A 2FCDA 2L0PA 1BOCA 1YRUB 4NDDA 1CTRA 4ICBA 1J7PA 2LAPA 1CFCA 4GGFA 1KK7Y 1WY9A 1DEKA 4L9MA 3ICBA 2JOJA 3CTNA 5HKZA 2RGIA 2ZRTA 2BE4A 2CBLA 3OGNA 3SS3A 2QEVA 1MXEA 1SY9A 3Q8IA 4YGEB 1N2DA 2E30A 4C0LA 3NXAA 1AK8A 2M49B 4TNCA 2KFGA 1DMOA 2L4HA 2M0RA 1J7OA 1F70A 4CLNA 2HPSA 3I5FC 4ORBB 4PE7A 3E3RA 1CFFA 2KLDA 4A4CA 1Y0VH 3BUNB 3DF0A 1BG1A 4PHMA 2LP2A 3PM8A 2GV5A 2M9GA 3PLFB 2K60A 3LK0A 1FW4A 4NDBA 1JFJA 4DCKA 1AHRA 4OKHA 3OHMB 2KAYA 1YX8A 1DJYA 2JT0A 2LMTA 5BPJA 3CDNA 4CFQA 5KSZA 3BUWB 1XFRA 2LLTA 1WRLA 2F33A 1FI5A 1LA0A 2O5GA 1CLBA 4I5LB 4OCIA 1J1DA 1NX1A 1A75B 1J7RA 3UNWA 4DUQA 1TOPA 2BBMA 4QJ3B 2EC6C 3TS5C 1ZACA 3DXLA 2I94A 1XO5A 1OOGA 1TCFA 1FBVA 1Y1UA 1XK4A 1SL7A 3IF7A 3A4UB 5KU1A 3I5IC 3D0YA 4R1EA 3D73A 4ETOA 3RZSA 3AKBA 4UPGA 3D77A 2WORA 1RWYA 4GGFC 1A03A 1DTLA 3S0EA 2PMYA 1F4OA 1M45A 1SCVA 2COLB 2KI6D 2KYFA 4OVNF 1S3PA 4WRIA 2PVBA 3R1OA 2L51A 1NWDA 3R1VA 2ERBA 2QACA 3DVKA 2P71A 3BOWB 1B7TY 2BBNA 1IQ3A 1UUSA 1C7WA 3LK1A 4C0KA 5JJGA 2M97A 1K94A 4MZLA 1JWDA 2KDHA 3LL8B 1BR1B 3FE8A 1KFUL 3PN7B 4DS7A 1CDLA 4XJKA 2SASA 1XFZO 1EH2A 1Y1AA 1GQMA 3PSRA 1WLZA 1QIWA 1V1FA 3DVEA 1NPQA 5HLVA 1CDNA 3CZ2A 1K90D 1S5GZ 2Y5IA 1DJIA 4CIDA 2BCAA 1CMFA 3OX5A 4OV2A 5I2QA 1JBAA 1KQVA 4YGAA 2LCPA 2F3YA 3LCPC 1KFXS 1QJTA 2WCEA 5PALA 1PRWA 4YRUA 2L50A 2MAZA 2KAXA 3WHUB 1YUSA 2L98A 3S0FA 1DJXA 1MQ1A 1SK6D 2KFHA 1TNQA 2WOSA 4M2OA 1TUJA 3CWGA 2JTTA 2Y1MA 5HL1A 1S6IA 2KAVA 1XK4C 4JKTA 4MRYA 4MN0A 2FJYA 1GGWA 4AQIA 1OMVA 4E68A 3SS4A 1ORGA 3DZTA 4HRHA 3S0BA 1B8LA 3VRRA 3UO9A 1CFDA 1HQVA 1XFXO 1JSAA 2GGMA 2ISDA 2ZKMX 4GGNA 5HYDA 3SG4A
chains in the Genus database with same CATH topology
2L4IA 2A4JA 2NLNA 1K8UA 4JQ0D 1ODBA 2CCMA 1IH0A 1EG3A 2JRFA 3DVMA 2PSRA 1FF1A 2CNPA 1RK9A 2FOTA 1KSMA 2BL0B 3GK4X 1J55A 1C7VA 2GGZA 1F54A 4MBEA 1SRAA 1QIVA 2PRUA 2AAOA 4N1FA 3DVJA 1QX7A 3PALA 1LKJA 5HLOA 3HCMA 1K2HA 1GGZA 1MWNA 1S1EA 2LNKA 3HX4A 4M2PA 2VRGA 2V53A 1DJZA 1S26D 1A29A 4BY4A 1QV0A 2L2EA 2HETA 2MLFC 4PHNA 4NDCA 1TIZA 1DF0A 1QLKA 3O6BA 2SCPA 1AJ5A 2JQ6A 3K21A 1TTXA 1UHJA 2JWWA 2K2FA 3AAJA 1Q80A 4YGDB 4HREE 3WXAA 1B4CA 1B47A 2BE6A 3PN7C 1KFUS 1RJVA 2JZIA 3DF0B 1M46A 2MRDA 1BR4B 1TNXA 2EHBA 2KBIA 2ZN9A 2K0JA 4I5NB 2OPOA 1S36A 3KPXA 1LA3A 3CR5X 1LVCD 2LUCA 1ALVA 1SR6B 1IKUA 1FPWA 3VRNA 5TNCA 5I2OA 3AKAA 1ZOTB 1KFXL 1KK7Z 1SL9A 2LHLA 2LVKA 3EVVA 5CSNA 1XFUO 4U8DA 1NCXA 1FI6A 1MUXA 2ZFDA 1QLSA 2FJUB 3NSIA 2JNXA 1QATA 1ZMZA 1IQ5A 1JF0A 2BCXA 2CXJA 3BUXB 3FWCA 3GOFA 2EGDA 1LINA 3EK7A 4MEWA 2MHHA 5IBWA 3WHTB 4MRXA 3D0YB 1RFJA 1UHIA 2KFFA 1M63B 2ZNEA 4GNKB 4M2QA 3BUMB 1OMRA 3GK1A 3MSEB 1B9AA 2LC5A 3CS1A 2I2RE 1RTP1 1XA5A 3DD4A 5K89A 1YR5A 5F6TA 3FWBA 2CTNA 2H2KA 2OTGB 4FQOA 3A8RA 2M29A 1AVSA 2AUCA 2JPTA 2O60A 1K96A 1NP8A 1SYMA 1AP4A 4PDZA 2TN4A 2BL0C 3F45A 3KHEA 1CFPA 2H61A 2WC8A 3FIAA 2E6WA 5GQQC 2B1UA 1DGVA 5DKQA 5AFPA 1EG4A 1SBJA 1NYAA 4XYNA 3ZWHA 1DVIA 3IQOA 1F8HA 4XJKB 1VRKA 4QJ5B 3KEVA 3WNXB 3VROA 1OZOA 3KF9A 3KO0A 3TDIA 4BY5A 1SPYA 1M39A 1DJHA 1BLQA 2JULA 1ZUZA 4D1EA 3VRPA 1XFYO 2K7BA 3GK2A 3JVTB 2JT8A 1NCYA 5D69A 3SG5A 1X02A 2JU0A 3D10A 1BU3A 1XYDA 2Q4UA 1MF8B 1QXPA 1B7TZ 1M31A 1SR6C 3TDUA 1JUOA 1CDMA 2IS9A 1PVBA 1PULA 2MLEC 2JNFA 4WQ2A 4CFRA 2LANA 2LE9B 3O78A 1SW8A 5CSFA 4C0JA 2K7CA 4PHKA 3EKHA 1A4PA 1RECA 1IJ5A 3SIBA 1MHOA 2G2BA 4QJ4B 1QVIZ 2JT3A 1TNPA 4JPZB 4PE4A 1L2OB 1UWOA 1WRZA 1NX3A 2KI6C 3OX6A 4PHJA 2MBXA 1SL8A 4YBHB 1D1OA 5JOLA 3CR4X 3O2PA 3RM1A 1SNLA 1UURA 1S6CA 1OE9B 2H61C 2JXLA 1JC2A 1NUBA 5I8NA 1NX2A 3FS7A 1H8BA 1YVHA 2JTZA 1H4BA 1L7ZA 2KQYA 2LHIA 1SKTA 2OTGC 2ZN8A 1CLMA 3CGAA 3CR2A 4AQJA 1QX2A 3EKJA 4FTGA 1F55A 2HF5A 1YUTA 4PE0A 2HQWA 1DF0B 3PFVA 3BUOB 3OP0A 4Q04A 3BYAA 3C1VA 2BCBA 4MZJA 5B8IB 1YRTB 2LMVA 3EK8A 4HSZA 1DJWA 1R6PA 1B8CA 1SMGA 1N0YA 1CNPA 1A2XA 4GPLB 1GJYA 5KTYA 1NSHA 2F2OA 2LVJA 1UHHA 4MSPA 1JF2A 1OQPA 1PVAA 2F3ZA 2KI4B 1DJGA 1UHKA 4I5KA 3EVUA 2BECA 1XFVO 3H4SE 3SG2A 3JVTC 1QASA 1YTZC 2KQ6A 2LM5A 1S6JA 4IL1A 3NSOA 1KQMB 2K8MB 4GFTA 2Y4QA 2LVVA 1BMOA 5I2LA 3SG3A 1YUUA 1CKKA 1CLLA 1W7IB 3NSLA 3ZNIA 1OMDA 3CZTX 4PALA 1JFKA 2LLUA 5D7FA 1TN4A 3BQ3A 1EJ3A 1CMGA 2F2PA 4ORAB 2DOQA 2MJWB 2LP3A 1BT6A 1L2OC 1WDCB 2JXCA 1R2UA 2KGBC 1NIWA 1TRFA 1QTXA 2PASA 2G9BA 1B8RA 2I18A 1YURA 1F71A 1U5IB 1W7JB 1G8IA 1PK0D 1UP5A 2ZRSA 5HKYA 3JTDB 2KBMA 1B1GA 1WLMA 3TDZA 4YGCB 1K9PA 4MVFA 4A4BA 1K9KA 1Y1XA 2K7DA 1EXRA 2M1KB 5CSJA 1KK8B 1DT7B 2NZ0A 1TNWA 1U5IA 3I5GB 1QS7A 1KSOA 4N1GA 4ORCB 5ER5A 2NCPA 3IQQA 1BJFA 2KHNA 1QX5B 1KCYA 1SCMB 1CDPA 3I5HB 2QPTA 1MR8A 3RLZA 1OZSA 2M8UA 5AANA 1RROA 1KWOB 2Q91A 2FCEA 2KOTA 4GAOA 5DKNA 3OB2B 1QV1A 4DIRA 4P2YB 1OOJA 2Y1NA 2LUXA 4ZCUA 1E8AA 2KI4C 1ZFSA 3M0WA 1IG5A 4JWQA 1K93D 2I7AA 3SJSA 1EL4A 2WCBA 1LXFC 2KNEA 1A75A 2K2AA 4OR9B 2AMIA 2LMUA 2ZNDA 1KQMC 5CPVA 3TZ1A 1YX7A 1PSBA 2M7LA 3TUYB 5AEQA 2NCOA 2BKIB 3NSKA 2JC2A 3O4YA 2OS8B 4DRWA 2PALA 3BXKA 1S5GY 3QRXA 2BKHB 3SIAA 2L5XB 1MXLC 1G4YR 4MZKA 2D8NA 1V1GA 1WDCC 2HQ8A 5DKRA 1AJ4A 4F0ZB 4GBAA 2LV7A 1BF5A 2MA2A 4MLWA 4PE1A 1K9UA 1QVIY 3CLNA 3BOWA 3JTDC 2R2IA 3EK4A 2LVIA 4WQ3A 1CB1A 1OSAA 2F8PA 3SG7A 4ZCVA 1WRKA 3I5FB 1IWQA 3PATA 1PALA 1N65A 2K61A 2M7NA 1IJ6A 1PSRA 1KK8C 1G33A 3I5GC 2NXQA 2P6BB 5HKWA 1ALWA 1SCMC 4NQGA 1HT9A 3VRQA 2WNDA 1CM1A 3I5HC 1TCOB 5AXIA 2M1UA 1CM4A 4YI9A 1NCZA 3EVRA 1KWOC 5J3XA 5AERA 1C07A 2KGRA 3LLEA 4USLA 4P5OE 1F4QA 1XFWO 2KSPA 2EC6B 1K95A 2KYCA 5ER4X 4GUKA 3TS5B 2WCFA 5G08A 2LLSA 3AAKA 4YI8A 4I5JA 3VGOA 1UHNA 3I5IB 5FYXA 2M3WA 4AOMA 4PCWA 4N5XA 1IGVA 1BODA 4HRGA 1YVLA 3OB1B 3TUYC 1J1EA 1Y6WA 5CSIA 4YGBB 1IRJA 1NX0A 1J7QA 1XVJA 2CT9A 1DGUA 2OS8C 1AUIB 2K7OA 4CPVA 3SG6A 2FCDA 2L0PA 1BOCA 1YRUB 4NDDA 1CTRA 4ICBA 1J7PA 2LAPA 1CFCA 4GGFA 1KK7Y 1WY9A 4L9MA 3ICBA 2JOJA 3CTNA 5HKZA 2RGIA 2ZRTA 2BE4A 2CBLA 1MXEA 1SY9A 4YGEB 1N2DA 2E30A 4C0LA 3NXAA 1AK8A 2M49B 4TNCA 2KFGA 1DMOA 2L4HA 2M0RA 1J7OA 1F70A 4CLNA 2HPSA 3I5FC 4ORBB 4PE7A 3E3RA 1CFFA 4A4CA 1Y0VH 3BUNB 3DF0A 1BG1A 4PHMA 2LP2A 3PM8A 2GV5A 2M9GA 3PLFB 3LK0A 1JFJA 1FW4A 4NDBA 4DCKA 1AHRA 4OKHA 3OHMB 2KAYA 1YX8A 1DJYA 2JT0A 2LMTA 5BPJA 4CFQA 5KSZA 3BUWB 2LLTA 1WRLA 2F33A 1FI5A 1LA0A 2O5GA 1CLBA 4I5LB 4OCIA 1J1DA 1NX1A 1A75B 1J7RA 4DUQA 1TOPA 2BBMA 4QJ3B 2EC6C 3TS5C 1ZACA 2I94A 1XO5A 1TCFA 1FBVA 1Y1UA 1XK4A 1SL7A 3IF7A 3A4UB 5KU1A 3I5IC 3D0YA 4R1EA 4ETOA 3AKBA 4UPGA 2WORA 1RWYA 4GGFC 1A03A 1DTLA 2PMYA 1F4OA 1M45A 1SCVA 2COLB 2KI6D 2KYFA 4OVNF 1S3PA 4WRIA 2PVBA 2L51A 1NWDA 2QACA 3DVKA 3BOWB 1B7TY 2BBNA 1IQ3A 1UUSA 1C7WA 3LK1A 4C0KA 5JJGA 2M97A 1K94A 4MZLA 1JWDA 2KDHA 3LL8B 1BR1B 1KFUL 3PN7B 4DS7A 1CDLA 4XJKA 2SASA 1XFZO 1EH2A 1Y1AA 1GQMA 3PSRA 1WLZA 1QIWA 1V1FA 3DVEA 1NPQA 5HLVA 1CDNA 1K90D 1S5GZ 2Y5IA 1DJIA 4CIDA 2BCAA 1CMFA 3OX5A 4OV2A 5I2QA 1JBAA 1KQVA 4YGAA 2LCPA 2F3YA 3LCPC 1KFXS 1QJTA 2WCEA 5PALA 1PRWA 4YRUA 2L50A 2MAZA 2KAXA 3WHUB 1YUSA 2L98A 1DJXA 1MQ1A 1SK6D 2KFHA 1TNQA 2WOSA 4M2OA 3CWGA 2JTTA 2Y1MA 1S6IA 2KAVA 1XK4C 4MRYA 4MN0A 1GGWA 4AQIA 1OMVA 4E68A 4HRHA 1B8LA 3VRRA 1CFDA 1HQVA 1XFXO 1JSAA 2GGMA 2ISDA 2ZKMX 4GGNA 5HYDA 3SG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L4I A;  2A4J A;  2NLN A;  1K8U A;  4JQ0 D;  1ODB A;  2CCM A;  1IH0 A;  1EG3 A;  2JRF A;  3DVM A;  2PSR A;  1FF1 A;  2CNP A;  1RK9 A;  2FOT A;  1KSM A;  2BL0 B;  3GK4 X;  1J55 A;  1C7V A;  2GGZ A;  1F54 A;  4MBE A;  1SRA A;  1QIV A;  2PRU A;  2AAO A;  4N1F A;  3DVJ A;  1QX7 A;  3PAL A;  1LKJ A;  5HLO A;  3HCM A;  1K2H A;  1GGZ A;  1MWN A;  1S1E A;  2LNK A;  3HX4 A;  4M2P A;  2VRG A;  2V53 A;  1DJZ A;  1S26 D;  1A29 A;  4BY4 A;  1QV0 A;  2L2E A;  2HET A;  2MLF C;  4PHN A;  4NDC A;  1TIZ A;  1DF0 A;  1QLK A;  3O6B A;  2SCP A;  1AJ5 A;  2JQ6 A;  3K21 A;  1TTX A;  1UHJ A;  2JWW A;  2K2F A;  3AAJ A;  1Q80 A;  4YGD B;  4HRE E;  3WXA A;  1B4C A;  1B47 A;  2BE6 A;  3PN7 C;  1KFU S;  1RJV A;  2JZI A;  3DF0 B;  1M46 A;  2MRD A;  1BR4 B;  1TNX A;  2EHB A;  2KBI A;  2ZN9 A;  2K0J A;  4I5N B;  2OPO A;  1S36 A;  3KPX A;  1LA3 A;  3CR5 X;  1LVC D;  2LUC A;  1ALV A;  1SR6 B;  1IKU A;  1FPW A;  3VRN A;  5TNC A;  5I2O A;  3AKA A;  1ZOT B;  1KFX L;  1KK7 Z;  1SL9 A;  2LHL A;  2LVK A;  3EVV A;  5CSN A;  1XFU O;  4U8D A;  1NCX A;  1FI6 A;  1MUX A;  2ZFD A;  1QLS A;  2FJU B;  3NSI A;  2JNX A;  1QAT A;  1ZMZ A;  1IQ5 A;  1JF0 A;  2BCX A;  2CXJ A;  3BUX B;  3FWC A;  3GOF A;  2EGD A;  1LIN A;  3EK7 A;  4MEW A;  2MHH A;  5IBW A;  3WHT B;  4MRX A;  3D0Y B;  1RFJ A;  1UHI A;  2KFF A;  1M63 B;  2ZNE A;  4GNK B;  4M2Q A;  3BUM B;  1OMR A;  3GK1 A;  3MSE B;  1B9A A;  2LC5 A;  3CS1 A;  2I2R E;  1RTP 1;  1XA5 A;  3DD4 A;  5K89 A;  1YR5 A;  5F6T A;  3FWB A;  2CTN A;  2H2K A;  2OTG B;  4FQO A;  3A8R A;  2M29 A;  1AVS A;  2AUC A;  2JPT A;  2O60 A;  1K96 A;  1NP8 A;  1SYM A;  1AP4 A;  4PDZ A;  2TN4 A;  2BL0 C;  3F45 A;  3KHE A;  1CFP A;  2H61 A;  2WC8 A;  3FIA A;  2E6W A;  5GQQ C;  2B1U A;  1DGV A;  5DKQ A;  5AFP A;  1EG4 A;  1SBJ A;  1NYA A;  4XYN A;  3ZWH A;  1DVI A;  3IQO A;  1F8H A;  4XJK B;  1VRK A;  4QJ5 B;  3KEV A;  3WNX B;  3VRO A;  1OZO A;  3KF9 A;  3KO0 A;  3TDI A;  4BY5 A;  1SPY A;  1M39 A;  1DJH A;  1BLQ A;  2JUL A;  1ZUZ A;  4D1E A;  3VRP A;  1XFY O;  2K7B A;  3GK2 A;  3JVT B;  2JT8 A;  1NCY A;  5D69 A;  3SG5 A;  1X02 A;  2JU0 A;  3D10 A;  1BU3 A;  1XYD A;  2Q4U A;  1MF8 B;  1QXP A;  1B7T Z;  1M31 A;  1SR6 C;  3TDU A;  1JUO A;  1CDM A;  2IS9 A;  1PVB A;  1PUL A;  2MLE C;  2JNF A;  4WQ2 A;  4CFR A;  2LAN A;  2LE9 B;  3O78 A;  1SW8 A;  5CSF A;  4C0J A;  2K7C A;  4PHK A;  3EKH A;  1A4P A;  1REC A;  1IJ5 A;  3SIB A;  1MHO A;  2G2B A;  4QJ4 B;  1QVI Z;  2JT3 A;  1TNP A;  4JPZ B;  4PE4 A;  1L2O B;  1UWO A;  1WRZ A;  1NX3 A;  2KI6 C;  3OX6 A;  4PHJ A;  2MBX A;  1SL8 A;  4YBH B;  1D1O A;  5JOL A;  3CR4 X;  3O2P A;  3RM1 A;  1SNL A;  1UUR A;  1S6C A;  1OE9 B;  2H61 C;  2JXL A;  1JC2 A;  1NUB A;  5I8N A;  1NX2 A;  3FS7 A;  1H8B A;  1YVH A;  2JTZ A;  1H4B A;  1L7Z A;  2KQY A;  2LHI A;  1SKT A;  2OTG C;  2ZN8 A;  1CLM A;  3CGA A;  3CR2 A;  4AQJ A;  1QX2 A;  3EKJ A;  4FTG A;  1F55 A;  2HF5 A;  1YUT A;  4PE0 A;  2HQW A;  1DF0 B;  3PFV A;  3BUO B;  3OP0 A;  4Q04 A;  3BYA A;  3C1V A;  2BCB A;  4MZJ A;  5B8I B;  1YRT B;  2LMV A;  3EK8 A;  4HSZ A;  1DJW A;  1R6P A;  1B8C A;  1SMG A;  1N0Y A;  1CNP A;  1A2X A;  4GPL B;  1GJY A;  5KTY A;  1NSH A;  2F2O A;  2LVJ A;  1UHH A;  4MSP A;  1JF2 A;  1OQP A;  1PVA A;  2F3Z A;  2KI4 B;  1DJG A;  1UHK A;  4I5K A;  3EVU A;  2BEC A;  1XFV O;  3H4S E;  3SG2 A;  3JVT C;  1QAS A;  1YTZ C;  2KQ6 A;  2LM5 A;  1S6J A;  4IL1 A;  3NSO A;  1KQM B;  2K8M B;  4GFT A;  2Y4Q A;  2LVV A;  1BMO A;  5I2L A;  3SG3 A;  1YUU A;  1CKK A;  1CLL A;  1W7I B;  3NSL A;  3ZNI A;  1OMD A;  3CZT X;  4PAL A;  1JFK A;  2LLU A;  5D7F A;  1TN4 A;  3BQ3 A;  1EJ3 A;  1CMG A;  2F2P A;  4ORA B;  2DOQ A;  2MJW B;  2LP3 A;  1BT6 A;  1L2O C;  1WDC B;  2JXC A;  1R2U A;  2KGB C;  1NIW A;  1TRF A;  1QTX A;  2PAS A;  2G9B A;  1B8R A;  2I18 A;  1YUR A;  1F71 A;  1U5I B;  1W7J B;  1G8I A;  1PK0 D;  1UP5 A;  2ZRS A;  5HKY A;  3JTD B;  2KBM A;  1B1G A;  1WLM A;  3TDZ A;  4YGC B;  1K9P A;  4MVF A;  4A4B A;  1K9K A;  1Y1X A;  2K7D A;  1EXR A;  2M1K B;  5CSJ A;  1KK8 B;  1DT7 B;  2NZ0 A;  1TNW A;  1U5I A;  3I5G B;  1QS7 A;  1KSO A;  4N1G A;  4ORC B;  5ER5 A;  2NCP A;  3IQQ A;  1BJF A;  2KHN A;  1QX5 B;  1KCY A;  1SCM B;  1CDP A;  3I5H B;  2QPT A;  1MR8 A;  3RLZ A;  1OZS A;  2M8U A;  5AAN A;  1RRO A;  1KWO B;  2Q91 A;  2FCE A;  2KOT A;  4GAO A;  5DKN A;  3OB2 B;  1QV1 A;  4DIR A;  4P2Y B;  1OOJ A;  2Y1N A;  2LUX A;  4ZCU A;  1E8A A;  2KI4 C;  1ZFS A;  3M0W A;  1IG5 A;  4JWQ A;  1K93 D;  2I7A A;  3SJS A;  1EL4 A;  2WCB A;  1LXF C;  2KNE A;  1A75 A;  2K2A A;  4OR9 B;  2AMI A;  2LMU A;  2ZND A;  1KQM C;  5CPV A;  3TZ1 A;  1YX7 A;  1PSB A;  2M7L A;  3TUY B;  5AEQ A;  2NCO A;  2BKI B;  3NSK A;  2JC2 A;  3O4Y A;  2OS8 B;  4DRW A;  2PAL A;  3BXK A;  1S5G Y;  3QRX A;  2BKH B;  3SIA A;  2L5X B;  1MXL C;  1G4Y R;  4MZK A;  2D8N A;  1V1G A;  1WDC C;  2HQ8 A;  5DKR A;  1AJ4 A;  4F0Z B;  4GBA A;  2LV7 A;  1BF5 A;  2MA2 A;  4MLW A;  4PE1 A;  1K9U A;  1QVI Y;  3CLN A;  3BOW A;  3JTD C;  2R2I A;  3EK4 A;  2LVI A;  4WQ3 A;  1CB1 A;  1OSA A;  2F8P A;  3SG7 A;  4ZCV A;  1WRK A;  3I5F B;  1IWQ A;  3PAT A;  1PAL A;  1N65 A;  2K61 A;  2M7N A;  1IJ6 A;  1PSR A;  1KK8 C;  1G33 A;  3I5G C;  2NXQ A;  2P6B B;  5HKW A;  1ALW A;  1SCM C;  4NQG A;  1HT9 A;  3VRQ A;  2WND A;  1CM1 A;  3I5H C;  1TCO B;  5AXI A;  2M1U A;  1CM4 A;  4YI9 A;  1NCZ A;  3EVR A;  1KWO C;  5J3X A;  5AER A;  1C07 A;  2KGR A;  3LLE A;  4USL A;  4P5O E;  1F4Q A;  1XFW O;  2KSP A;  2EC6 B;  1K95 A;  2KYC A;  5ER4 X;  4GUK A;  3TS5 B;  2WCF A;  5G08 A;  2LLS A;  3AAK A;  4YI8 A;  4I5J A;  3VGO A;  1UHN A;  3I5I B;  5FYX A;  2M3W A;  4AOM A;  4PCW A;  4N5X A;  1IGV A;  1BOD A;  4HRG A;  1YVL A;  3OB1 B;  3TUY C;  1J1E A;  1Y6W A;  5CSI A;  4YGB B;  1IRJ A;  1NX0 A;  1J7Q A;  1XVJ A;  2CT9 A;  1DGU A;  2OS8 C;  1AUI B;  2K7O A;  4CPV A;  3SG6 A;  2FCD A;  2L0P A;  1BOC A;  1YRU B;  4NDD A;  1CTR A;  4ICB A;  1J7P A;  2LAP A;  1CFC A;  4GGF A;  1KK7 Y;  1WY9 A;  4L9M A;  3ICB A;  2JOJ A;  3CTN A;  5HKZ A;  2RGI A;  2ZRT A;  2BE4 A;  2CBL A;  1MXE A;  1SY9 A;  4YGE B;  1N2D A;  2E30 A;  4C0L A;  3NXA A;  1AK8 A;  2M49 B;  4TNC A;  2KFG A;  1DMO A;  2L4H A;  2M0R A;  1J7O A;  1F70 A;  4CLN A;  2HPS A;  3I5F C;  4ORB B;  4PE7 A;  3E3R A;  1CFF A;  4A4C A;  1Y0V H;  3BUN B;  3DF0 A;  1BG1 A;  4PHM A;  2LP2 A;  3PM8 A;  2GV5 A;  2M9G A;  3PLF B;  3LK0 A;  1JFJ A;  1FW4 A;  4NDB A;  4DCK A;  1AHR A;  4OKH A;  3OHM B;  2KAY A;  1YX8 A;  1DJY A;  2JT0 A;  2LMT A;  5BPJ A;  4CFQ A;  5KSZ A;  3BUW B;  2LLT A;  1WRL A;  2F33 A;  1FI5 A;  1LA0 A;  2O5G A;  1CLB A;  4I5L B;  4OCI A;  1J1D A;  1NX1 A;  1A75 B;  1J7R A;  4DUQ A;  1TOP A;  2BBM A;  4QJ3 B;  2EC6 C;  3TS5 C;  1ZAC A;  2I94 A;  1XO5 A;  1TCF A;  1FBV A;  1Y1U A;  1XK4 A;  1SL7 A;  3IF7 A;  3A4U B;  5KU1 A;  3I5I C;  3D0Y A;  4R1E A;  4ETO A;  3AKB A;  4UPG A;  2WOR A;  1RWY A;  4GGF C;  1A03 A;  1DTL A;  2PMY A;  1F4O A;  1M45 A;  1SCV A;  2COL B;  2KI6 D;  2KYF A;  4OVN F;  1S3P A;  4WRI A;  2PVB A;  2L51 A;  1NWD A;  2QAC A;  3DVK A;  3BOW B;  1B7T Y;  2BBN A;  1IQ3 A;  1UUS A;  1C7W A;  3LK1 A;  4C0K A;  5JJG A;  2M97 A;  1K94 A;  4MZL A;  1JWD A;  2KDH A;  3LL8 B;  1BR1 B;  1KFU L;  3PN7 B;  4DS7 A;  1CDL A;  4XJK A;  2SAS A;  1XFZ O;  1EH2 A;  1Y1A A;  1GQM A;  3PSR A;  1WLZ A;  1QIW A;  1V1F A;  3DVE A;  1NPQ A;  5HLV A;  1CDN A;  1K90 D;  1S5G Z;  2Y5I A;  1DJI A;  4CID A;  2BCA A;  1CMF A;  3OX5 A;  4OV2 A;  5I2Q A;  1JBA A;  1KQV A;  4YGA A;  2LCP A;  2F3Y A;  3LCP C;  1KFX S;  1QJT A;  2WCE A;  5PAL A;  1PRW A;  4YRU A;  2L50 A;  2MAZ A;  2KAX A;  3WHU B;  1YUS A;  2L98 A;  1DJX A;  1MQ1 A;  1SK6 D;  2KFH A;  1TNQ A;  2WOS A;  4M2O A;  3CWG A;  2JTT A;  2Y1M A;  1S6I A;  2KAV A;  1XK4 C;  4MRY A;  4MN0 A;  1GGW A;  4AQI A;  1OMV A;  4E68 A;  4HRH A;  1B8L A;  3VRR A;  1CFD A;  1HQV A;  1XFX O;  1JSA A;  2GGM A;  2ISD A;  2ZKM X;  4GGN A;  5HYD A;  3SG4 A; 
#chains in the Genus database with same CATH topology
 1OOH A;  2L4I A;  2A4J A;  2PQL A;  2NLN A;  3S0G A;  1K8U A;  4JQ0 D;  1ODB A;  2CCM A;  3D74 A;  1IH0 A;  1EG3 A;  2JRF A;  3DVM A;  2PSR A;  1FF1 A;  2CNP A;  1RK9 A;  2FOT A;  1KSM A;  2BL0 B;  3GK4 X;  1J55 A;  1C7V A;  2GGZ A;  1F54 A;  3O4X A;  4MBE A;  1SRA A;  1QIV A;  2PRU A;  2AAO A;  4N1F A;  3DVJ A;  1QX7 A;  3PAL A;  1LKJ A;  5HLO A;  3HCM A;  2WC5 A;  1K2H A;  1GGZ A;  1MWN A;  2PYQ A;  1S1E A;  2LNK A;  3HX4 A;  4M2P A;  2VRG A;  2V53 A;  1DJZ A;  1S26 D;  1A29 A;  4BY4 A;  1QV0 A;  2L2E A;  2HET A;  2MLF C;  4PHN A;  4NDC A;  2KLE A;  1TIZ A;  4F7F A;  1DF0 A;  1QLK A;  3O6B A;  2SCP A;  1AJ5 A;  2JQ6 A;  3K21 A;  1TTX A;  1UHJ A;  2JWW A;  2K2F A;  3AAJ A;  1Q80 A;  4YGD B;  4HRE E;  3WXA A;  1B4C A;  1B47 A;  3PJI A;  2BE6 A;  3PN7 C;  1KFU S;  1RJV A;  2JZI A;  3BFA A;  1M46 A;  2MRD A;  1BR4 B;  1TNX A;  3DF0 B;  2EHB A;  2KBI A;  4JD9 A;  2ZN9 A;  2K0J A;  4I5N B;  2OPO A;  1S36 A;  2WCH A;  3KPX A;  1LA3 A;  3CR5 X;  3NHI A;  1LVC D;  2LUC A;  1ALV A;  3V2L A;  1SR6 B;  3B86 A;  1IKU A;  1FPW A;  3VRN A;  5TNC A;  5I2O A;  3AKA A;  1ZOT B;  1KFX L;  1KK7 Z;  1SL9 A;  2LHL A;  2LVK A;  3EVV A;  5CSN A;  1XFU O;  1DC1 A;  4U8D A;  1NCX A;  1FI6 A;  1MUX A;  2ZFD A;  1QLS A;  2FJU B;  3NSI A;  2JNX A;  1QAT A;  1ZMZ A;  1IQ5 A;  1JF0 A;  1SSE B;  2BCX A;  2CXJ A;  3BUX B;  3FWC A;  3GOF A;  2EGD A;  1LIN A;  1W9Z A;  3EK7 A;  2QEH A;  4MEW A;  2MHH A;  5IBW A;  3WHT B;  2BNX A;  4MRX A;  3D0Y B;  1RFJ A;  1UHI A;  2KFF A;  1M63 B;  2ZNE A;  4GNK B;  4M2Q A;  3BUM B;  1OMR A;  3GK1 A;  3MSE B;  1B9A A;  2LC5 A;  3CS1 A;  2I2R E;  1RTP 1;  1XA5 A;  3DD4 A;  3L4A A;  5K89 A;  1YR5 A;  5FI7 A;  5F6T A;  3S0A A;  3FWB A;  2CTN A;  2H2K A;  2OTG B;  4FQO A;  3A8R A;  2M29 A;  1AVS A;  2AUC A;  2JPT A;  2O60 A;  1K96 A;  1NP8 A;  3B6X A;  1SYM A;  1AP4 A;  4PDZ A;  2TN4 A;  2BL0 C;  3F45 A;  3KHE A;  1CFP A;  2H61 A;  2WC8 A;  3FIA A;  2E6W A;  5GQQ C;  2B1U A;  1DGV A;  5DKQ A;  5AFP A;  1EG4 A;  1SBJ A;  1NYA A;  4XYN A;  3ZWH A;  1DVI A;  3IQO A;  1F8H A;  4XJK B;  1VRK A;  4QJ5 B;  3KEV A;  3WNX B;  3VRO A;  1OZO A;  2WCJ A;  3KF9 A;  3KO0 A;  4FQT A;  3TDI A;  4BY5 A;  1SPY A;  1M39 A;  1DJH A;  1T14 A;  1BLQ A;  2JUL A;  1ZUZ A;  4D1E A;  3VRP A;  1XFY O;  2K7B A;  3GK2 A;  3JVT B;  2JT8 A;  1NCY A;  5D69 A;  3SG5 A;  1X02 A;  1D1O A;  2JU0 A;  3D10 A;  1BU3 A;  1XYD A;  2Q4U A;  1MF8 B;  1QXP A;  1B7T Z;  1M31 A;  1DEL A;  1SR6 C;  4IJ7 A;  3TDU A;  4OZD A;  1JUO A;  2L5Y A;  2H8V A;  1CDM A;  2IS9 A;  1PVB A;  1PUL A;  2MLE C;  2JNF A;  4WQ2 A;  4CFR A;  3FE6 A;  2LAN A;  2LE9 B;  3DYE A;  3O78 A;  1SW8 A;  5CSF A;  4C0J A;  2K7C A;  4PHK A;  3EKH A;  1A4P A;  1REC A;  1IJ5 A;  3SIB A;  1MHO A;  2G2B A;  4QJ4 B;  1QVI Z;  2JT3 A;  1TNP A;  4JPZ B;  4PE4 A;  1L2O B;  1UWO A;  1WRZ A;  1NX3 A;  2KI6 C;  2WCK A;  2QEB A;  3OX6 A;  1SL8 A;  4PHJ A;  4YBH B;  1Z4H A;  3CR4 X;  3O2P A;  3BJH A;  3QME A;  1SNL A;  1UUR A;  1S6C A;  1OE9 B;  2H61 C;  3RM1 A;  2JXL A;  1JC2 A;  1NUB A;  5I8N A;  1NX2 A;  3FS7 A;  5I94 A;  1H8B A;  1YVH A;  2JTZ A;  1H4B A;  1L7Z A;  2KQY A;  2LHI A;  1SKT A;  2OTG C;  2ZN8 A;  1CLM A;  3DY9 A;  3CGA A;  3N7H A;  3CR2 A;  4AQJ A;  1QX2 A;  3EKJ A;  4FTG A;  4INW A;  1F55 A;  2HF5 A;  1YUT A;  4PE0 A;  1OOI X;  2HQW A;  1DF0 B;  1C3Z A;  3BUO B;  3OP0 A;  3PFV A;  3BYA A;  3C1V A;  4Q04 A;  2BCB A;  4MZJ A;  5EL2 A;  5B8I B;  1YRT B;  2LMV A;  3EK8 A;  4HSZ A;  1DJW A;  1R6P A;  1B8C A;  1SMG A;  2WC6 A;  1N0Y A;  1CNP A;  3PM2 A;  1A2X A;  4GPL B;  1GJY A;  5KTY A;  1NSH A;  2F2O A;  2LVJ A;  1UHH A;  4MSP A;  1JF2 A;  1OQP A;  1PVA A;  2QDI A;  2F3Z A;  2KI4 B;  1DJG A;  1UHK A;  4I5K A;  3EVU A;  2BEC A;  1XFV O;  3H4S E;  3SG2 A;  3JVT C;  1QAS A;  1YTZ C;  2KQ6 A;  5JOL A;  3B7A A;  3VB1 A;  2LM5 A;  1TUZ A;  1S6J A;  4IL1 A;  5DIC A;  2KPH A;  1KQM B;  2K8M B;  3NSO A;  2Y4Q A;  4GFT A;  2LVV A;  1BMO A;  5I2L A;  3SG3 A;  1YUU A;  4PT1 A;  1CLL A;  1W7I B;  3NSL A;  1CKK A;  3ZNI A;  1OMD A;  3CZT X;  3OBV A;  4PAL A;  1JFK A;  2LLU A;  5D7F A;  1TN4 A;  3B87 A;  3B88 A;  1EJ3 A;  3BQ3 A;  1CMG A;  2F2P A;  4ORA B;  2DOQ A;  2MJW B;  2LP3 A;  1BT6 A;  1L2O C;  1WDC B;  2JXC A;  1R2U A;  2KGB C;  3CZ1 A;  1NIW A;  1TRF A;  1QTX A;  2PAS A;  2G9B A;  3CAB A;  1B8R A;  2I18 A;  1YUR A;  1F71 A;  1U5I B;  1W7J B;  1G8I A;  1PK0 D;  1UP5 A;  2ZRS A;  3IVT A;  5HKY A;  3JTD B;  2KBM A;  1B1G A;  2QEO A;  1WLM A;  2BAP A;  3TDZ A;  4YGC B;  1K9P A;  2P70 A;  4MVF A;  4A4B A;  1K9K A;  1Y1X A;  2K7D A;  1EXR A;  2M1K B;  5CSJ A;  1IIO A;  1KK8 B;  1DT7 B;  2NZ0 A;  3D75 A;  1TNW A;  1U5I A;  3I5G B;  1QS7 A;  1KSO A;  4N1G A;  1OW4 A;  4ORC B;  5ER5 A;  2NCP A;  3IQQ A;  1BJF A;  2KHN A;  1QX5 B;  3D76 A;  1KCY A;  1SCM B;  3D78 A;  1CDP A;  3SS5 A;  3I5H B;  2QPT A;  1MR8 A;  3RLZ A;  1OZS A;  2M8U A;  5AAN A;  1RRO A;  1KWO B;  2Q91 A;  1P28 A;  2FCE A;  2KOT A;  4GAO A;  3OB2 B;  5DKN A;  1QV1 A;  4DIR A;  4P2Y B;  1OOJ A;  2Y1N A;  2LUX A;  4ZCU A;  1E8A A;  2KI4 C;  1ZFS A;  3M0W A;  1QWV A;  1IG5 A;  4JWQ A;  1K93 D;  2I7A A;  3SJS A;  1LS8 A;  1EL4 A;  2WCB A;  1LXF C;  2KNE A;  1A75 A;  2K2A A;  4OR9 B;  2AMI A;  2JPO A;  2LMU A;  2ZND A;  1KQM C;  3K1E A;  5CPV A;  3TZ1 A;  1YX7 A;  1PSB A;  3CZ0 A;  2M7L A;  5AEQ A;  3TUY B;  1DQE A;  2NCO A;  2BKI B;  2WCL A;  3NHT A;  2JC2 A;  3EG5 B;  3NSK A;  2OS8 B;  3O4Y A;  4DRW A;  2PAL A;  3BXK A;  1S5G Y;  3QRX A;  2BKH B;  3SIA A;  2L5X B;  1MXL C;  1G4Y R;  4MZK A;  2D8N A;  1V1G A;  2MBX A;  1WDC C;  2HQ8 A;  5DKR A;  1AJ4 A;  3L47 A;  4F0Z B;  4GBA A;  2LV7 A;  3NGV A;  2L2C A;  1BF5 A;  2MA2 A;  1Z2C B;  4MLW A;  4PE1 A;  1K9U A;  3L4L A;  1QVI Y;  3CLN A;  3BOW A;  3JTD C;  2R2I A;  3EK4 A;  2GTE A;  2WCM A;  2LVI A;  4WQ3 A;  3FE9 A;  1CB1 A;  1OSA A;  1GM0 A;  2F8P A;  3SG7 A;  4ZCV A;  1WRK A;  3I5F B;  1IWQ A;  3R1P A;  3PAT A;  1PAL A;  1N65 A;  2K61 A;  2M7N A;  1IJ6 A;  1PSR A;  1KK8 C;  5FI2 A;  1G33 A;  3I5G C;  2NXQ A;  2P6B B;  3R72 A;  5HKW A;  1C3Y A;  5FI6 A;  1ALW A;  1SCM C;  4NQG A;  1HT9 A;  3VRQ A;  2WND A;  1CM1 A;  3I5H C;  1TCO B;  5AXI A;  2M1U A;  1CM4 A;  3BFH A;  1NCZ A;  3EVR A;  1KWO C;  4YI9 A;  5J3X A;  5AER A;  1C07 A;  2KGR A;  3LLE A;  4USL A;  4P5O E;  1F4Q A;  1XFW O;  2KSP A;  2EC6 B;  1K95 A;  2KYC A;  5ER4 X;  4GUK A;  3TS5 B;  2WCF A;  3BFB A;  4INX A;  5G08 A;  2LLS A;  3AAK A;  4YI8 A;  4I5J A;  3VGO A;  1UHN A;  3I5I B;  5FYX A;  2M3W A;  4AOM A;  4PCW A;  4N5X A;  4KYN A;  1IGV A;  1BOD A;  4HRG A;  3CYZ A;  1YVL A;  3OB1 B;  1OOF A;  1J1E A;  1Y6W A;  5CSI A;  4YGB B;  1IRJ A;  1NX0 A;  3TUY C;  1TWO A;  1J7Q A;  1XVJ A;  2CT9 A;  1DGU A;  2OS8 C;  1AUI B;  2K7O A;  4CPV A;  5D3O A;  3S0D A;  2YGU A;  3SG6 A;  2FCD A;  2L0P A;  1BOC A;  1YRU B;  4NDD A;  1CTR A;  4ICB A;  1J7P A;  2LAP A;  1CFC A;  4GGF A;  1KK7 Y;  1WY9 A;  1DEK A;  4L9M A;  3ICB A;  2JOJ A;  3CTN A;  5HKZ A;  2RGI A;  2ZRT A;  2BE4 A;  2CBL A;  3OGN A;  3SS3 A;  2QEV A;  1MXE A;  1SY9 A;  3Q8I A;  4YGE B;  1N2D A;  2E30 A;  4C0L A;  3NXA A;  1AK8 A;  2M49 B;  4TNC A;  2KFG A;  1DMO A;  2L4H A;  2M0R A;  1J7O A;  1F70 A;  4CLN A;  2HPS A;  3I5F C;  4ORB B;  4PE7 A;  3E3R A;  1CFF A;  2KLD A;  4A4C A;  1Y0V H;  3BUN B;  3DF0 A;  1BG1 A;  4PHM A;  2LP2 A;  3PM8 A;  2GV5 A;  2M9G A;  3PLF B;  2K60 A;  3LK0 A;  1FW4 A;  4NDB A;  1JFJ A;  4DCK A;  1AHR A;  4OKH A;  3OHM B;  2KAY A;  1YX8 A;  1DJY A;  2JT0 A;  2LMT A;  5BPJ A;  3CDN A;  4CFQ A;  5KSZ A;  3BUW B;  1XFR A;  2LLT A;  1WRL A;  2F33 A;  1FI5 A;  1LA0 A;  2O5G A;  1CLB A;  4I5L B;  4OCI A;  1J1D A;  1NX1 A;  1A75 B;  1J7R A;  3UNW A;  4DUQ A;  1TOP A;  2BBM A;  4QJ3 B;  2EC6 C;  3TS5 C;  1ZAC A;  3DXL A;  2I94 A;  1XO5 A;  1OOG A;  1TCF A;  1FBV A;  1Y1U A;  1XK4 A;  1SL7 A;  3IF7 A;  3A4U B;  5KU1 A;  3I5I C;  3D0Y A;  4R1E A;  3D73 A;  4ETO A;  3RZS A;  3AKB A;  4UPG A;  3D77 A;  2WOR A;  1RWY A;  4GGF C;  1A03 A;  1DTL A;  3S0E A;  2PMY A;  1F4O A;  1M45 A;  1SCV A;  2COL B;  2KI6 D;  2KYF A;  4OVN F;  1S3P A;  4WRI A;  2PVB A;  3R1O A;  2L51 A;  1NWD A;  3R1V A;  2ERB A;  2QAC A;  3DVK A;  2P71 A;  3BOW B;  1B7T Y;  2BBN A;  1IQ3 A;  1UUS A;  1C7W A;  3LK1 A;  4C0K A;  5JJG A;  2M97 A;  1K94 A;  4MZL A;  1JWD A;  2KDH A;  3LL8 B;  1BR1 B;  3FE8 A;  1KFU L;  3PN7 B;  4DS7 A;  1CDL A;  4XJK A;  2SAS A;  1XFZ O;  1EH2 A;  1Y1A A;  1GQM A;  3PSR A;  1WLZ A;  1QIW A;  1V1F A;  3DVE A;  1NPQ A;  5HLV A;  1CDN A;  3CZ2 A;  1K90 D;  1S5G Z;  2Y5I A;  1DJI A;  4CID A;  2BCA A;  1CMF A;  3OX5 A;  4OV2 A;  5I2Q A;  1JBA A;  1KQV A;  4YGA A;  2LCP A;  2F3Y A;  3LCP C;  1KFX S;  1QJT A;  2WCE A;  5PAL A;  1PRW A;  4YRU A;  2L50 A;  2MAZ A;  2KAX A;  3WHU B;  1YUS A;  2L98 A;  3S0F A;  1DJX A;  1MQ1 A;  1SK6 D;  2KFH A;  1TNQ A;  2WOS A;  4M2O A;  1TUJ A;  3CWG A;  2JTT A;  2Y1M A;  5HL1 A;  1S6I A;  2KAV A;  1XK4 C;  4JKT A;  4MRY A;  4MN0 A;  2FJY A;  1GGW A;  4AQI A;  1OMV A;  4E68 A;  3SS4 A;  1ORG A;  3DZT A;  4HRH A;  3S0B A;  1B8L A;  3VRR A;  3UO9 A;  1CFD A;  1HQV A;  1XFX O;  1JSA A;  2GGM A;  2ISD A;  2ZKM X;  4GGN A;  5HYD A;  3SG4 A; 
#chains in the Genus database with same CATH homology
 2L4I A;  2A4J A;  2NLN A;  1K8U A;  4JQ0 D;  1ODB A;  2CCM A;  1IH0 A;  1EG3 A;  2JRF A;  3DVM A;  2PSR A;  1FF1 A;  2CNP A;  1RK9 A;  2FOT A;  1KSM A;  2BL0 B;  3GK4 X;  1J55 A;  1C7V A;  2GGZ A;  1F54 A;  4MBE A;  1SRA A;  1QIV A;  2PRU A;  2AAO A;  4N1F A;  3DVJ A;  1QX7 A;  3PAL A;  1LKJ A;  5HLO A;  3HCM A;  1K2H A;  1GGZ A;  1MWN A;  1S1E A;  2LNK A;  3HX4 A;  4M2P A;  2VRG A;  2V53 A;  1DJZ A;  1S26 D;  1A29 A;  4BY4 A;  1QV0 A;  2L2E A;  2HET A;  2MLF C;  4PHN A;  4NDC A;  1TIZ A;  1DF0 A;  1QLK A;  3O6B A;  2SCP A;  1AJ5 A;  2JQ6 A;  3K21 A;  1TTX A;  1UHJ A;  2JWW A;  2K2F A;  3AAJ A;  1Q80 A;  4YGD B;  4HRE E;  3WXA A;  1B4C A;  1B47 A;  2BE6 A;  3PN7 C;  1KFU S;  1RJV A;  2JZI A;  3DF0 B;  1M46 A;  2MRD A;  1BR4 B;  1TNX A;  2EHB A;  2KBI A;  2ZN9 A;  2K0J A;  4I5N B;  2OPO A;  1S36 A;  3KPX A;  1LA3 A;  3CR5 X;  1LVC D;  2LUC A;  1ALV A;  1SR6 B;  1IKU A;  1FPW A;  3VRN A;  5TNC A;  5I2O A;  3AKA A;  1ZOT B;  1KFX L;  1KK7 Z;  1SL9 A;  2LHL A;  2LVK A;  3EVV A;  5CSN A;  1XFU O;  4U8D A;  1NCX A;  1FI6 A;  1MUX A;  2ZFD A;  1QLS A;  2FJU B;  3NSI A;  2JNX A;  1QAT A;  1ZMZ A;  1IQ5 A;  1JF0 A;  2BCX A;  2CXJ A;  3BUX B;  3FWC A;  3GOF A;  2EGD A;  1LIN A;  3EK7 A;  4MEW A;  2MHH A;  5IBW A;  3WHT B;  4MRX A;  3D0Y B;  1RFJ A;  1UHI A;  2KFF A;  1M63 B;  2ZNE A;  4GNK B;  4M2Q A;  3BUM B;  1OMR A;  3GK1 A;  3MSE B;  1B9A A;  2LC5 A;  3CS1 A;  2I2R E;  1RTP 1;  1XA5 A;  3DD4 A;  5K89 A;  1YR5 A;  5F6T A;  3FWB A;  2CTN A;  2H2K A;  2OTG B;  4FQO A;  3A8R A;  2M29 A;  1AVS A;  2AUC A;  2JPT A;  2O60 A;  1K96 A;  1NP8 A;  1SYM A;  1AP4 A;  4PDZ A;  2TN4 A;  2BL0 C;  3F45 A;  3KHE A;  1CFP A;  2H61 A;  2WC8 A;  3FIA A;  2E6W A;  5GQQ C;  2B1U A;  1DGV A;  5DKQ A;  5AFP A;  1EG4 A;  1SBJ A;  1NYA A;  4XYN A;  3ZWH A;  1DVI A;  3IQO A;  1F8H A;  4XJK B;  1VRK A;  4QJ5 B;  3KEV A;  3WNX B;  3VRO A;  1OZO A;  3KF9 A;  3KO0 A;  3TDI A;  4BY5 A;  1SPY A;  1M39 A;  1DJH A;  1BLQ A;  2JUL A;  1ZUZ A;  4D1E A;  3VRP A;  1XFY O;  2K7B A;  3GK2 A;  3JVT B;  2JT8 A;  1NCY A;  5D69 A;  3SG5 A;  1X02 A;  2JU0 A;  3D10 A;  1BU3 A;  1XYD A;  2Q4U A;  1MF8 B;  1QXP A;  1B7T Z;  1M31 A;  1SR6 C;  3TDU A;  1JUO A;  1CDM A;  2IS9 A;  1PVB A;  1PUL A;  2MLE C;  2JNF A;  4WQ2 A;  4CFR A;  2LAN A;  2LE9 B;  3O78 A;  1SW8 A;  5CSF A;  4C0J A;  2K7C A;  4PHK A;  3EKH A;  1A4P A;  1REC A;  1IJ5 A;  3SIB A;  1MHO A;  2G2B A;  4QJ4 B;  1QVI Z;  2JT3 A;  1TNP A;  4JPZ B;  4PE4 A;  1L2O B;  1UWO A;  1WRZ A;  1NX3 A;  2KI6 C;  3OX6 A;  4PHJ A;  2MBX A;  1SL8 A;  4YBH B;  1D1O A;  5JOL A;  3CR4 X;  3O2P A;  3RM1 A;  1SNL A;  1UUR A;  1S6C A;  1OE9 B;  2H61 C;  2JXL A;  1JC2 A;  1NUB A;  5I8N A;  1NX2 A;  3FS7 A;  1H8B A;  1YVH A;  2JTZ A;  1H4B A;  1L7Z A;  2KQY A;  2LHI A;  1SKT A;  2OTG C;  2ZN8 A;  1CLM A;  3CGA A;  3CR2 A;  4AQJ A;  1QX2 A;  3EKJ A;  4FTG A;  1F55 A;  2HF5 A;  1YUT A;  4PE0 A;  2HQW A;  1DF0 B;  3PFV A;  3BUO B;  3OP0 A;  4Q04 A;  3BYA A;  3C1V A;  2BCB A;  4MZJ A;  5B8I B;  1YRT B;  2LMV A;  3EK8 A;  4HSZ A;  1DJW A;  1R6P A;  1B8C A;  1SMG A;  1N0Y A;  1CNP A;  1A2X A;  4GPL B;  1GJY A;  5KTY A;  1NSH A;  2F2O A;  2LVJ A;  1UHH A;  4MSP A;  1JF2 A;  1OQP A;  1PVA A;  2F3Z A;  2KI4 B;  1DJG A;  1UHK A;  4I5K A;  3EVU A;  2BEC A;  1XFV O;  3H4S E;  3SG2 A;  3JVT C;  1QAS A;  1YTZ C;  2KQ6 A;  2LM5 A;  1S6J A;  4IL1 A;  3NSO A;  1KQM B;  2K8M B;  4GFT A;  2Y4Q A;  2LVV A;  1BMO A;  5I2L A;  3SG3 A;  1YUU A;  1CKK A;  1CLL A;  1W7I B;  3NSL A;  3ZNI A;  1OMD A;  3CZT X;  4PAL A;  1JFK A;  2LLU A;  5D7F A;  1TN4 A;  3BQ3 A;  1EJ3 A;  1CMG A;  2F2P A;  4ORA B;  2DOQ A;  2MJW B;  2LP3 A;  1BT6 A;  1L2O C;  1WDC B;  2JXC A;  1R2U A;  2KGB C;  1NIW A;  1TRF A;  1QTX A;  2PAS A;  2G9B A;  1B8R A;  2I18 A;  1YUR A;  1F71 A;  1U5I B;  1W7J B;  1G8I A;  1PK0 D;  1UP5 A;  2ZRS A;  5HKY A;  3JTD B;  2KBM A;  1B1G A;  1WLM A;  3TDZ A;  4YGC B;  1K9P A;  4MVF A;  4A4B A;  1K9K A;  1Y1X A;  2K7D A;  1EXR A;  2M1K B;  5CSJ A;  1KK8 B;  1DT7 B;  2NZ0 A;  1TNW A;  1U5I A;  3I5G B;  1QS7 A;  1KSO A;  4N1G A;  4ORC B;  5ER5 A;  2NCP A;  3IQQ A;  1BJF A;  2KHN A;  1QX5 B;  1KCY A;  1SCM B;  1CDP A;  3I5H B;  2QPT A;  1MR8 A;  3RLZ A;  1OZS A;  2M8U A;  5AAN A;  1RRO A;  1KWO B;  2Q91 A;  2FCE A;  2KOT A;  4GAO A;  5DKN A;  3OB2 B;  1QV1 A;  4DIR A;  4P2Y B;  1OOJ A;  2Y1N A;  2LUX A;  4ZCU A;  1E8A A;  2KI4 C;  1ZFS A;  3M0W A;  1IG5 A;  4JWQ A;  1K93 D;  2I7A A;  3SJS A;  1EL4 A;  2WCB A;  1LXF C;  2KNE A;  1A75 A;  2K2A A;  4OR9 B;  2AMI A;  2LMU A;  2ZND A;  1KQM C;  5CPV A;  3TZ1 A;  1YX7 A;  1PSB A;  2M7L A;  3TUY B;  5AEQ A;  2NCO A;  2BKI B;  3NSK A;  2JC2 A;  3O4Y A;  2OS8 B;  4DRW A;  2PAL A;  3BXK A;  1S5G Y;  3QRX A;  2BKH B;  3SIA A;  2L5X B;  1MXL C;  1G4Y R;  4MZK A;  2D8N A;  1V1G A;  1WDC C;  2HQ8 A;  5DKR A;  1AJ4 A;  4F0Z B;  4GBA A;  2LV7 A;  1BF5 A;  2MA2 A;  4MLW A;  4PE1 A;  1K9U A;  1QVI Y;  3CLN A;  3BOW A;  3JTD C;  2R2I A;  3EK4 A;  2LVI A;  4WQ3 A;  1CB1 A;  1OSA A;  2F8P A;  3SG7 A;  4ZCV A;  1WRK A;  3I5F B;  1IWQ A;  3PAT A;  1PAL A;  1N65 A;  2K61 A;  2M7N A;  1IJ6 A;  1PSR A;  1KK8 C;  1G33 A;  3I5G C;  2NXQ A;  2P6B B;  5HKW A;  1ALW A;  1SCM C;  4NQG A;  1HT9 A;  3VRQ A;  2WND A;  1CM1 A;  3I5H C;  1TCO B;  5AXI A;  2M1U A;  1CM4 A;  4YI9 A;  1NCZ A;  3EVR A;  1KWO C;  5J3X A;  5AER A;  1C07 A;  2KGR A;  3LLE A;  4USL A;  4P5O E;  1F4Q A;  1XFW O;  2KSP A;  2EC6 B;  1K95 A;  2KYC A;  5ER4 X;  4GUK A;  3TS5 B;  2WCF A;  5G08 A;  2LLS A;  3AAK A;  4YI8 A;  4I5J A;  3VGO A;  1UHN A;  3I5I B;  5FYX A;  2M3W A;  4AOM A;  4PCW A;  4N5X A;  1IGV A;  1BOD A;  4HRG A;  1YVL A;  3OB1 B;  3TUY C;  1J1E A;  1Y6W A;  5CSI A;  4YGB B;  1IRJ A;  1NX0 A;  1J7Q A;  1XVJ A;  2CT9 A;  1DGU A;  2OS8 C;  1AUI B;  2K7O A;  4CPV A;  3SG6 A;  2FCD A;  2L0P A;  1BOC A;  1YRU B;  4NDD A;  1CTR A;  4ICB A;  1J7P A;  2LAP A;  1CFC A;  4GGF A;  1KK7 Y;  1WY9 A;  4L9M A;  3ICB A;  2JOJ A;  3CTN A;  5HKZ A;  2RGI A;  2ZRT A;  2BE4 A;  2CBL A;  1MXE A;  1SY9 A;  4YGE B;  1N2D A;  2E30 A;  4C0L A;  3NXA A;  1AK8 A;  2M49 B;  4TNC A;  2KFG A;  1DMO A;  2L4H A;  2M0R A;  1J7O A;  1F70 A;  4CLN A;  2HPS A;  3I5F C;  4ORB B;  4PE7 A;  3E3R A;  1CFF A;  4A4C A;  1Y0V H;  3BUN B;  3DF0 A;  1BG1 A;  4PHM A;  2LP2 A;  3PM8 A;  2GV5 A;  2M9G A;  3PLF B;  3LK0 A;  1JFJ A;  1FW4 A;  4NDB A;  4DCK A;  1AHR A;  4OKH A;  3OHM B;  2KAY A;  1YX8 A;  1DJY A;  2JT0 A;  2LMT A;  5BPJ A;  4CFQ A;  5KSZ A;  3BUW B;  2LLT A;  1WRL A;  2F33 A;  1FI5 A;  1LA0 A;  2O5G A;  1CLB A;  4I5L B;  4OCI A;  1J1D A;  1NX1 A;  1A75 B;  1J7R A;  4DUQ A;  1TOP A;  2BBM A;  4QJ3 B;  2EC6 C;  3TS5 C;  1ZAC A;  2I94 A;  1XO5 A;  1TCF A;  1FBV A;  1Y1U A;  1XK4 A;  1SL7 A;  3IF7 A;  3A4U B;  5KU1 A;  3I5I C;  3D0Y A;  4R1E A;  4ETO A;  3AKB A;  4UPG A;  2WOR A;  1RWY A;  4GGF C;  1A03 A;  1DTL A;  2PMY A;  1F4O A;  1M45 A;  1SCV A;  2COL B;  2KI6 D;  2KYF A;  4OVN F;  1S3P A;  4WRI A;  2PVB A;  2L51 A;  1NWD A;  2QAC A;  3DVK A;  3BOW B;  1B7T Y;  2BBN A;  1IQ3 A;  1UUS A;  1C7W A;  3LK1 A;  4C0K A;  5JJG A;  2M97 A;  1K94 A;  4MZL A;  1JWD A;  2KDH A;  3LL8 B;  1BR1 B;  1KFU L;  3PN7 B;  4DS7 A;  1CDL A;  4XJK A;  2SAS A;  1XFZ O;  1EH2 A;  1Y1A A;  1GQM A;  3PSR A;  1WLZ A;  1QIW A;  1V1F A;  3DVE A;  1NPQ A;  5HLV A;  1CDN A;  1K90 D;  1S5G Z;  2Y5I A;  1DJI A;  4CID A;  2BCA A;  1CMF A;  3OX5 A;  4OV2 A;  5I2Q A;  1JBA A;  1KQV A;  4YGA A;  2LCP A;  2F3Y A;  3LCP C;  1KFX S;  1QJT A;  2WCE A;  5PAL A;  1PRW A;  4YRU A;  2L50 A;  2MAZ A;  2KAX A;  3WHU B;  1YUS A;  2L98 A;  1DJX A;  1MQ1 A;  1SK6 D;  2KFH A;  1TNQ A;  2WOS A;  4M2O A;  3CWG A;  2JTT A;  2Y1M A;  1S6I A;  2KAV A;  1XK4 C;  4MRY A;  4MN0 A;  1GGW A;  4AQI A;  1OMV A;  4E68 A;  4HRH A;  1B8L A;  3VRR A;  1CFD A;  1HQV A;  1XFX O;  1JSA A;  2GGM A;  2ISD A;  2ZKM X;  4GGN A;  5HYD A;  3SG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...