4PHMA

The structural basis of differential inhibition of human calpain by indole and phenyl alpha-mercaptoacrylic acids
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
173
structure length
173
Chain Sequence
EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calpain small subunit 1
publication title The structural basis of differential inhibition of human calpain by indole and phenyl alpha-mercaptoacrylic acids.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 60
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4phmA00
1CLLA 1CDLA 2BL0C 2KI6C 1WDCC 1YR5A 1SW8A 1YX7A 2BL0B 1NCZA 1WDCB 3BUXB 3EVUA 3K21A 3WHTB 2GGZA 3GK2A 1SNLA 2M8UA 3PALA 2PASA 5HLVA 4P2YB 1YRTB 2KDHA 1IJ6A 1F4QA 5B8IB 3OX6A 1BT6A 2E6WA 2ZNDA 1CLBA 2CBLA 2DOQA 1YRUB 1YTZC 2NZ0A 2WOSA 1CKKA 4I5JA 1M45A 1TCOB 1F71A 1L7ZA 1YVLA 3LLEA 1B47A 4OV2A 2COLB 1PVBA 2LANA 3AAKA 3PLFB 1Y1XA 3BOWB 2BCBA 1XFVO 3RM1A 1X02A 3WNXB 5KU1A 2KBIA 1MHOA 1N2DA 1AHRA 3FWCA 2FOTA 1CM4A 3O6BA 1JFKA 2LLTA 3KF9A 3VRQA 3DF0B 1BODA 1KFXL 1TNXA 1XA5A 4ZCUA 1JUOA 1JBAA 2QPTA 3GOFA 2LHLA 1MXLC 5BPJA 1PVAA 2Y1MA 1RFJA 2PALA 1DF0B 3CTNA 3SG2A 1IQ3A 1XFWO 2BCAA 4OR9B 4HSZA 4ORCB 2WNDA 4PDZA 2LVIA 3BYAA 1G33A 4WQ2A 1SBJA 2BKIB 4YI9A 3DVKA 5PALA 1QIVA 1RECA 1AP4A 1R6PA 1J7RA 2Y4QA 4I5NB 2Y1NA 3OB1B 2MLFC 1EG3A 3ICBA 1K96A 3JTDC 3IF7A 4MVFA 4USLA 4YGCB 3JTDB 1SY9A 1W7IB 2K7DA 2I7AA 1XFXO 2KI4C 4PE7A 1QATA 2KI4B 2JT8A 3PSRA 2LHIA 1MUXA 1FW4A 2M1UA 4MZJA 1OQPA 2L0PA 2NLNA 3LK1A 2ZNEA 2FCEA 1DJIA 4ORAB 2OPOA 3CZTX 2KBMA 3H4SE 5CSIA 3KO0A 1GGZA 2ZKMX 1R2UA 1UHNA 1TN4A 1S5GY 1NX1A 2M9GA 1W7JB 1FBVA 1PK0D 1KCYA 1WY9A 1OOJA 1SMGA 4GAOA 1TRFA 4YBHB 1F55A 1RTP1 3EKHA 1TCFA 2SASA 1CFDA 1NYAA 1ZFSA 3CGAA 2KQ6A 4M2QA 1TTXA 4MRYA 3BQ3A 1M46A 1SL8A 4PHNA 1JWDA 1UHKA 3HCMA 2CT9A 2K0JA 3BUWB 1J7QA 3AKAA 2LUXA 2MRDA 3F45A 1FF1A 2KSPA 4GGFA 4JQ0D 4MN0A 2BE4A 2JT3A 1A4PA 3ZWHA 3FIAA 4PE0A 4PE1A 3KEVA 1CMFA 1BOCA 4MLWA 1B7TY 2HPSA 4BY5A 2K7OA 3LK0A 3TDIA 1LA3A 1AJ4A 2WC8A 3SG5A 3FWBA 4M2PA 4UPGA 2ZN9A 3CWGA 3AAJA 4GPLB 4YGDB 1Y1UA 2M97A 4OVNF 1OZSA 3WHUB 4A4BA 3BUNB 4PALA 1ZOTB 2LCPA 2KAVA 2BECA 5I2QA 1K8UA 1DJXA 2BE6A 2EC6B 1KSOA 1QJTA 1H8BA 1SCVA 3PFVA 3CR5X 2BKHB 4ICBA 1NUBA 3VROA 1XFYO 3CLNA 4GUKA 1BF5A 1BLQA 1BU3A 1LKJA 2K8MB 1JF0A 2RGIA 5ER5A 1QS7A 1CDNA 4FTGA 5DKRA 5GQQC 1EH2A 2MHHA 3EK8A 1QV1A 1MR8A 1SCMC 1V1GA 1RJVA 2WORA 2KGRA 3NSIA 1SCMB 2WCEA 2ZN8A 2GV5A 3EK7A 1Y6WA 2KAYA 1IGVA 1J55A 1QV0A 3DD4A 3EVVA 3NXAA 5KSZA 1B9AA 1IH0A 1DT7B 1J7PA 5IBWA 5AXIA 1B8CA 1WRKA 2EHBA 4F0ZB 3BUMB 3C1VA 3AKBA 4GFTA 1CDMA 1QX7A 1QVIY 1Y0VH 2LVKA 2CXJA 3D0YB 2L5XB 2M1KB 4DIRA 2NXQA 2MBXA 4WQ3A 2KI6D 5CSNA 1A75B 2KNEA 3TDUA 1SL9A 4N1GA 4CPVA 2B1UA 5DKQA 2L50A 4YGAA 5AERA 3TUYC 2F8PA 1D1OA 1EL4A 3TUYB 4CFRA 1SKTA 3TS5C 2CCMA 2WCFA 3TS5B 4A4CA 2PSRA 4I5KA 1DMOA 3VRRA 5I8NA 2E30A 1K95A 3SIBA 1E8AA 1CFFA 2LUCA 4AQIA 2AMIA 2BBNA 1CTRA 1NX3A 1S26D 2JNFA 5D69A 4PCWA 1SR6C 1K9KA 1IQ5A 4XJKB 1SR6B 1K94A 1K9UA 1GJYA 1DGUA 5KTYA 1BG1A 2L4HA 2JOJA 1QXPA 4YRUA 2BBMA 2LM5A 5DKNA 1B7TZ 1NWDA 3SIAA 2LC5A 1FPWA 3HX4A 2ISDA 1FI6A 1H4BA 4FQOA 1F54A 1DVIA 4E68A 4Q04A 4BY4A 1PRWA 2M3WA 3EKJA 5K89A 2F33A 4PHMA 1K90D 3EK4A 1F4OA 4I5LB 4NQGA 5HKYA 1YVHA 2I94A 2MA2A 2AUCA 1S6IA 1QTXA 2JZIA 3EVRA 3MSEB 3IQOA 5JJGA 1DTLA 4D1EA 1WRZA 1SRAA 3A8RA 2PVBA 1HT9A 4MRXA 3DVEA 5F6TA 1S3PA 1XK4A 1NIWA 2H61C 1YX8A 1CFPA 1BJFA 5HYDA 1JC2A 1PSRA 1UUSA 2I18A 3PN7B 1OZOA 1XFZO 1LXFC 2BCXA 1OMVA 4DRWA 3CR2A 2JWWA 3O2PA 1QASA 5TNCA 2KYCA 1OMDA 1B8LA 2A4JA 4HRHA 1HQVA 2LV7A 4CLNA 1IKUA 1NX0A 2F3YA 2K7BA 1LVCD 1XFUO 1IG5A 1LA0A 1G4YR 2SCPA 1ODBA 1BR1B 2L98A 2LE9B 1M31A 3ZNIA 1ZUZA 1C07A 1KQMC 3NSKA 2P6BB 2L4IA 3DVJA 1KQMB 4HREE 3M0WA 1NSHA 1JF2A 1DGVA 3E3RA 5CSJA 1CNPA 2Q91A 3PM8A 1VRKA 4L9MA 1S36A 1EJ3A 1KK7Y 1AJ5A 1ZACA 4U8DA 2FCDA 3LL8B 2LVVA 4ZCVA 3SJSA 1KQVA 3BXKA 1UWOA 2K2AA 5HKZA 1KWOC 1KWOB 2EC6C 3CS1A 2O60A 3D0YA 3BOWA 3QRXA 1XYDA 5CSFA 2LLSA 4CFQA 2M7LA 2G9BA 1C7WA 1CM1A 1Y1AA 2I2RE 2KQYA 4QJ3B 1S6JA 1F70A 1J1EA 1YUUA 3DVMA 1PALA 3DF0A 1MQ1A 1PSBA 1JFJA 3OX5A 1B4CA 1Q80A 2IS9A 2Y5IA 2JXLA 2HF5A 4IL1A 1NPQA 1DF0A 1SL7A 1GGWA 1S1EA 2ZRTA 1J1DA 5CPVA 3I5HC 2KFFA 1WLMA 2JTZA 3I5HB 1QLKA 4YI8A 4GBAA 4DS7A 2JNXA 3OB2B 4C0KA 2PRUA 3NSLA 3OP0A 3O78A 4R1EA 4C0JA 3I5IC 2LLUA 4GGFC 3WXAA 3I5IB 4AQJA 3KPXA 1V1FA 1OMRA 3GK1A 1G8IA 2OTGC 2V53A 5D7FA 2OTGB 2ZRSA 4PHJA 1J7OA 1L2OC 1L2OB 1TOPA 1S5GZ 4DUQA 2KYFA 2H2KA 1EG4A 1OSAA 4DCKA 1U5IB 3OHMB 2KOTA 5I2LA 1B1GA 2PMYA 1CMGA 2Q4UA 2CNPA 2NCPA 2HQWA 5FYXA 1UURA 3NSOA 1MF8B 3VRNA 2HETA 2KHNA 3PATA 2QACA 3IQQA 4MZKA 5HLOA 3FS7A 2VRGA 2D8NA 2MAZA 1IRJA 5AFPA 3JVTC 1XO5A 1SK6D 1SPYA 2JC2A 2JPTA 3JVTB 3LCPC 4M2OA 4ORBB 2LNKA 2H61A 2LAPA 4OKHA 1LINA 4YGBB 2G2BA 5HKWA 1GQMA 1NX2A 1YURA 2TN4A 1CFCA 1WLZA 1BMOA 2K61A 3O4YA 2LMVA 5AANA 1TIZA 3TDZA 4CIDA 1M63B 1RWYA 4PHKA 1KK7Z 1DJZA 2F3ZA 2FJUB 2JQ6A 2MLEC 4QJ5B 1KFXS 1QIWA 1QX2A 2LMTA 1M39A 4MEWA 1A03A 3I5FC 4MZLA 1S6CA 3I5FB 2OS8C 1N65A 3VRPA 2OS8B 2L2EA 1PULA 4C0LA 2GGMA 1F8HA 2M29A 1CB1A 4NDDA 1YUSA 1CDPA 1AUIB 1TNPA 4AOMA 2EGDA 1NCYA 2JRFA 1KFUL 3PN7C 1IJ5A 3CR4X 4MBEA 2NCOA 1DJGA 1TNQA 2K2FA 3KHEA 1UHHA 1KFUS 1KSMA 3D10A 1A29A 1N0YA 1RK9A 2LVJA 1CLMA 4MSPA 2O5GA 3VGOA 4JPZB 1XVJA 1DJYA 3A4UB 2JTTA 1YUTA 2JU0A 1UP5A 1DJWA 5ER4X 1QVIZ 2R2IA 1K93D 4GGNA 2MJWB 3SG4A 1AVSA 1QLSA 4N5XA 4QJ4B 2KGBC 2M0RA 4HRGA 1RROA 4XYNA 2HQ8A 1K9PA 2LMUA 4PE4A 5JOLA 1ZMZA 4P5OE 4NDCA 3GK4X 2L51A 1WRLA 5J3XA 1ALWA 4GNKB 4NDBA 1MWNA 2M7NA 5I2OA 1UHIA 2KAXA 5AEQA 1A75A 1BR4B 2LP3A 4ETOA 1U5IA 4YGEB 1TNWA 2K7CA 2WCBA 1IWQA 1NCXA 2F2OA 4JWQA 2ZFDA 3I5GC 1K2HA 2CTNA 1SYMA 2JULA 3I5GB 1B8RA 1A2XA 3BUOB 1JSAA 2F2PA 1XK4C 1C7VA 1NP8A 2M49B 1KK8C 2JXCA 1QX5B 1KK8B 3TZ1A 1MXEA 3SG3A 1ALVA 1DJHA 2AAOA 1UHJA 3RLZA 1OE9B 4TNCA 2JT0A 3SG6A 4WRIA 5G08A 4OCIA 2KFHA 1AK8A 1FI5A 1EXRA 2LP2A 4N1FA 3SG7A 4XJKA 2KFGA
chains in the Genus database with same CATH superfamily
1CLLA 1CDLA 2BL0C 2KI6C 1WDCC 1YR5A 1SW8A 1YX7A 2BL0B 1NCZA 1WDCB 3BUXB 3EVUA 3K21A 3O4XA 3WHTB 2GGZA 3GK2A 1SNLA 2ERBA 2M8UA 3PALA 2PASA 5HLVA 4P2YB 1YRTB 2KDHA 1IJ6A 1F4QA 5B8IB 3OX6A 1BT6A 2E6WA 2ZNDA 1CLBA 2CBLA 2DOQA 1YRUB 1YTZC 2NZ0A 2WOSA 2P70A 1CKKA 4I5JA 1M45A 1TCOB 1F71A 1L7ZA 1YVLA 3LLEA 1B47A 4OV2A 2COLB 1PVBA 2LANA 3AAKA 1W9ZA 1OOGA 3PLFB 1Y1XA 3BOWB 2BCBA 1XFVO 3RM1A 1X02A 3S0DA 3WNXB 5KU1A 3D78A 2KBIA 1MHOA 1N2DA 1AHRA 3FWCA 2FOTA 1CM4A 3O6BA 1JFKA 2LLTA 3KF9A 3VRQA 3DF0B 2WC5A 1BODA 1KFXL 1TNXA 1XA5A 4ZCUA 1JUOA 1JBAA 2QPTA 3GOFA 2LHLA 3NHIA 1MXLC 5BPJA 1PVAA 2Y1MA 1RFJA 2PALA 1DF0B 3CTNA 3SG2A 1IQ3A 1XFWO 2BCAA 4OR9B 4HSZA 4ORCB 2WNDA 4PDZA 2LVIA 3BYAA 3CZ1A 1G33A 4WQ2A 1SBJA 2BKIB 4YI9A 3DVKA 5PALA 1QIVA 1RECA 1AP4A 1R6PA 1J7RA 5D3OA 2Y4QA 4I5NB 2Y1NA 3OB1B 2MLFC 1EG3A 3DYEA 3ICBA 1K96A 3JTDC 3IF7A 4MVFA 1ORGA 4USLA 4YGCB 3JTDB 1SY9A 1W7IB 2K7DA 2I7AA 1XFXO 2KI4C 4PE7A 1QATA 2KI4B 2JT8A 3K1EA 2LHIA 3PSRA 1MUXA 1FW4A 2M1UA 4MZJA 1OQPA 2L0PA 3D76A 2NLNA 3LK1A 2ZNEA 2FCEA 1DJIA 4ORAB 2OPOA 3CZTX 2KBMA 3H4SE 3IVTA 4KYNA 5CSIA 3KO0A 1GGZA 2ZKMX 1QWVA 1R2UA 1UHNA 1TN4A 1S5GY 1NX1A 2M9GA 1W7JB 1FBVA 1PK0D 1KCYA 1WY9A 1OOJA 1SMGA 2BNXA 3B86A 4GAOA 1OW4A 1TRFA 4YBHB 1F55A 1RTP1 3EKHA 1TCFA 2SASA 1CFDA 1NYAA 1ZFSA 3CGAA 2KQ6A 1DC1A 4M2QA 1TTXA 3BFAA 4MRYA 1OOFA 3BQ3A 1M46A 1SL8A 4PHNA 1JWDA 1UHKA 3SS5A 3HCMA 2CT9A 2K0JA 3BUWB 1J7QA 4PT1A 2WCHA 3AKAA 1DQEA 2LUXA 2MRDA 3F45A 1FF1A 2KSPA 4GGFA 4JQ0D 4MN0A 2BE4A 4INXA 2JT3A 1A4PA 3VB1A 2PQLA 3ZWHA 1TUZA 3FIAA 4PE0A 4PE1A 3KEVA 1CMFA 1BOCA 4MLWA 1B7TY 2HPSA 2L5YA 4BY5A 3S0AA 2GTEA 2K7OA 3LK0A 3TDIA 1LA3A 1AJ4A 2WC8A 3SG5A 2JPOA 3FWBA 4M2PA 4UPGA 2ZN9A 3CWGA 3AAJA 4GPLB 4YGDB 1Y1UA 2M97A 4OVNF 1OZSA 3WHUB 4A4BA 3BUNB 4PALA 1ZOTB 2LCPA 2KAVA 2BECA 5I2QA 1K8UA 1DJXA 2BE6A 2EC6B 1KSOA 1QJTA 1H8BA 1SCVA 3D74A 3PFVA 3CR5X 2BKHB 4ICBA 1NUBA 3VROA 1XFYO 3CLNA 4GUKA 1BF5A 1BLQA 1BU3A 1LKJA 2K8MB 1JF0A 2RGIA 5ER5A 1QS7A 1CDNA 4FTGA 5DKRA 3NGVA 5GQQC 1EH2A 2MHHA 3EK8A 1QV1A 1MR8A 1SCMC 1V1GA 1RJVA 2WORA 2KGRA 3NSIA 1SCMB 2WCEA 2ZN8A 2GV5A 3EK7A 1Y6WA 2KAYA 2QDIA 1IGVA 1J55A 1QV0A 3DD4A 3EVVA 3NXAA 5KSZA 1B9AA 1IH0A 1DT7B 1J7PA 5IBWA 5AXIA 1B8CA 1WRKA 2EHBA 4F0ZB 3BUMB 3C1VA 3AKBA 4GFTA 1CDMA 1QX7A 5FI7A 1QVIY 1Y0VH 2LVKA 2CXJA 1C3ZA 2L5XB 3D0YB 2M1KB 4DIRA 2NXQA 2MBXA 4WQ3A 2KI6D 3CABA 3SS3A 5CSNA 1A75B 2KNEA 3TDUA 1SL9A 4N1GA 4CPVA 2B1UA 3PM2A 1P28A 2KLDA 5DKQA 2L50A 3B88A 3BFBA 4YGAA 5AERA 1Z4HA 3TUYC 2F8PA 1D1OA 1EL4A 3TUYB 4CFRA 3CDNA 3DZTA 1SKTA 3TS5C 4OZDA 2CCMA 2WCFA 3TS5B 4A4CA 2PSRA 4I5KA 1DMOA 3VRRA 5I8NA 2E30A 4FQTA 1K95A 3SIBA 1E8AA 1C3YA 3DXLA 1CFFA 2LUCA 4AQIA 2AMIA 2BBNA 4JD9A 1CTRA 1NX3A 1S26D 2JNFA 5D69A 4PCWA 1SR6C 1K9KA 1IQ5A 4XJKB 1SR6B 1K94A 1K9UA 1GJYA 1DGUA 5KTYA 1BG1A 2L4HA 2JOJA 1QXPA 4YRUA 2BBMA 2LM5A 3NHTA 1B7TZ 1NWDA 5DKNA 2LC5A 3SIAA 1FPWA 3HX4A 2ISDA 1FI6A 1H4BA 5HL1A 4FQOA 1F54A 1DVIA 4E68A 4Q04A 4BY4A 1PRWA 2M3WA 3EKJA 5K89A 2F33A 4PHMA 1K90D 3EK4A 1F4OA 4I5LB 4NQGA 5HKYA 1YVHA 2I94A 2MA2A 1S6IA 1QTXA 2AUCA 2JZIA 3EVRA 3MSEB 3IQOA 4JKTA 5JJGA 1DTLA 4D1EA 1WRZA 1SRAA 3A8RA 2PVBA 1HT9A 4MRXA 2WCJA 3DVEA 5F6TA 1S3PA 3EG5B 1XK4A 2H8VA 2K60A 1NIWA 2H61C 1YX8A 1CFPA 1BJFA 5HYDA 3FE8A 1JC2A 1PSRA 1UUSA 2I18A 3PN7B 3CYZA 1IIOA 1OZOA 1XFZO 1LXFC 2BCXA 1OMVA 3S0EA 3CR2A 4DRWA 2JWWA 3O2PA 1LS8A 3OBVA 3Q8IA 1QASA 5TNCA 2KYCA 1T14A 1OMDA 1B8LA 2A4JA 4HRHA 1HQVA 2LV7A 4CLNA 1IKUA 1NX0A 2F3YA 2K7BA 1LVCD 1XFUO 1IG5A 1LA0A 1G4YR 2SCPA 1ODBA 1BR1B 2L98A 2LE9B 1M31A 3ZNIA 1ZUZA 1C07A 1KQMC 3NSKA 2P6BB 2L4IA 3DVJA 1KQMB 4HREE 3M0WA 1NSHA 1JF2A 1DGVA 3N7HA 3E3RA 5CSJA 1CNPA 5FI6A 2Q91A 3PM8A 1VRKA 4L9MA 1S36A 1EJ3A 1KK7Y 1AJ5A 1ZACA 4U8DA 2FCDA 3S0GA 3LL8B 2LVVA 4ZCVA 3SJSA 1KQVA 3BXKA 1UWOA 2K2AA 5HKZA 3R1PA 1KWOC 1KWOB 2EC6C 3CS1A 2O60A 3D0YA 3BOWA 3QRXA 1XYDA 5CSFA 2BAPA 2LLSA 3RZSA 4CFQA 2M7LA 2G9BA 1C7WA 1CM1A 1Y1AA 2I2RE 3S0BA 2KQYA 4QJ3B 1S6JA 1F70A 1J1EA 1YUUA 3DVMA 5EL2A 1PALA 3DF0A 1MQ1A 1PSBA 1JFJA 3OX5A 2WCMA 1B4CA 1Q80A 2IS9A 2Y5IA 3CZ2A 2JXLA 2HF5A 3D73A 4IL1A 1NPQA 1OOIX 1DF0A 1SL7A 1GGWA 3UO9A 1S1EA 5I94A 2QEOA 2ZRTA 1J1DA 3B87A 5CPVA 3I5HC 2KFFA 1WLMA 2JTZA 3FE9A 3I5HB 2P71A 1QLKA 4YI8A 4GBAA 4DS7A 2JNXA 3OB2B 4C0KA 2PRUA 4F7FA 3NSLA 3OP0A 3O78A 4R1EA 4C0JA 3I5IC 2LLUA 4GGFC 3WXAA 3I5IB 2QEBA 4AQJA 3KPXA 1V1FA 1OMRA 2QEVA 1G8IA 2OTGC 2V53A 3GK1A 4INWA 5D7FA 2OTGB 2ZRSA 4PHJA 1J7OA 1L2OC 2YGUA 3R72A 1L2OB 1TOPA 1S5GZ 4DUQA 1TUJA 2KYFA 2H2KA 1EG4A 1OSAA 2WC6A 3B7AA 1U5IB 4DCKA 3OHMB 2KOTA 3BFHA 5I2LA 1B1GA 3DY9A 2PMYA 2KPHA 1CMGA 2PYQA 5FI2A 3SS4A 2Q4UA 2CNPA 2NCPA 2HQWA 5FYXA 1UURA 3NSOA 1MF8B 2KLEA 3VRNA 2HETA 2KHNA 3L47A 3PATA 2QACA 3IQQA 4MZKA 5HLOA 3FS7A 2VRGA 2D8NA 2MAZA 1IRJA 5AFPA 1GM0A 3JVTC 1XO5A 1SK6D 1SPYA 2JC2A 2JPTA 3JVTB 3LCPC 4M2OA 4ORBB 2LNKA 2H61A 2LAPA 4OKHA 1LINA 4YGBB 2G2BA 5HKWA 1GQMA 1NX2A 1YURA 2TN4A 1CFCA 3V2LA 1WLZA 1BMOA 1XFRA 2K61A 2LMVA 3O4YA 5AANA 1TIZA 3TDZA 4CIDA 1M63B 1RWYA 4PHKA 1OOHA 1KK7Z 1DJZA 2F3ZA 2FJUB 2JQ6A 2MLEC 4QJ5B 1KFXS 1QIWA 1QX2A 2LMTA 3D77A 1M39A 4MEWA 1A03A 3I5FC 4MZLA 1S6CA 3I5FB 2OS8C 1N65A 3VRPA 2OS8B 2L2EA 1PULA 4C0LA 2GGMA 1F8HA 2M29A 1CB1A 4NDDA 3OGNA 1YUSA 1CDPA 3L4AA 1AUIB 1TNPA 4AOMA 2EGDA 1NCYA 2JRFA 3R1VA 1KFUL 1DEKA 3PN7C 1IJ5A 3CR4X 4MBEA 3R1OA 2QEHA 2NCOA 1DJGA 1TNQA 2K2FA 3B6XA 3KHEA 1UHHA 1DELA 1Z2CB 3BJHA 1KFUS 1KSMA 3D10A 1A29A 1N0YA 2WCLA 1RK9A 2LVJA 1CLMA 4MSPA 1SSEB 2O5GA 3VGOA 4JPZB 1XVJA 1DJYA 3A4UB 2JTTA 1YUTA 2JU0A 1UP5A 1DJWA 5ER4X 1QVIZ 2R2IA 1K93D 3D75A 4GGNA 2MJWB 2FJYA 3SG4A 4IJ7A 1AVSA 2WCKA 5DICA 1QLSA 4N5XA 4QJ4B 2KGBC 2M0RA 4HRGA 1RROA 4XYNA 2HQ8A 1K9PA 2LMUA 4PE4A 5JOLA 1ZMZA 4P5OE 4NDCA 3GK4X 2L51A 1WRLA 3L4LA 5J3XA 1ALWA 4GNKB 4NDBA 1MWNA 2M7NA 5I2OA 3CZ0A 1UHIA 1TWOA 3S0FA 2KAXA 5AEQA 1A75A 1BR4B 2LP3A 3FE6A 4ETOA 1U5IA 4YGEB 1TNWA 2K7CA 2WCBA 1IWQA 1NCXA 2F2OA 4JWQA 2ZFDA 3I5GC 1K2HA 2CTNA 1SYMA 2JULA 3I5GB 1B8RA 1A2XA 2L2CA 3BUOB 2F2PA 1JSAA 1XK4C 1C7VA 1NP8A 3QMEA 2M49B 1KK8C 2JXCA 1QX5B 1KK8B 3TZ1A 1MXEA 3SG3A 1ALVA 1DJHA 2AAOA 1UHJA 3RLZA 1OE9B 4TNCA 2JT0A 3SG6A 4WRIA 3PJIA 5G08A 4OCIA 2KFHA 1AK8A 1FI5A 1EXRA 2LP2A 3UNWA 4N1FA 3SG7A 4XJKA 2KFGA
chains in the Genus database with same CATH topology
1CLLA 1CDLA 2BL0C 2KI6C 1WDCC 1YR5A 1SW8A 1YX7A 2BL0B 1NCZA 1WDCB 3BUXB 3EVUA 3K21A 3WHTB 2GGZA 3GK2A 1SNLA 2M8UA 3PALA 2PASA 5HLVA 4P2YB 1YRTB 2KDHA 1IJ6A 1F4QA 5B8IB 3OX6A 1BT6A 2E6WA 2ZNDA 1CLBA 2CBLA 2DOQA 1YRUB 1YTZC 2NZ0A 2WOSA 1CKKA 4I5JA 1M45A 1TCOB 1F71A 1L7ZA 1YVLA 3LLEA 1B47A 4OV2A 2COLB 1PVBA 2LANA 3AAKA 3PLFB 1Y1XA 3BOWB 2BCBA 1XFVO 3RM1A 1X02A 3WNXB 5KU1A 2KBIA 1MHOA 1N2DA 1AHRA 3FWCA 2FOTA 1CM4A 3O6BA 1JFKA 2LLTA 3KF9A 3VRQA 3DF0B 1BODA 1KFXL 1TNXA 1XA5A 4ZCUA 1JUOA 1JBAA 2QPTA 3GOFA 2LHLA 1MXLC 5BPJA 1PVAA 2Y1MA 1RFJA 2PALA 1DF0B 3CTNA 3SG2A 1IQ3A 1XFWO 2BCAA 4OR9B 4HSZA 4ORCB 2WNDA 4PDZA 2LVIA 3BYAA 1G33A 4WQ2A 1SBJA 2BKIB 4YI9A 3DVKA 5PALA 1QIVA 1RECA 1AP4A 1R6PA 1J7RA 2Y4QA 4I5NB 2Y1NA 3OB1B 2MLFC 1EG3A 3ICBA 1K96A 3JTDC 3IF7A 4MVFA 4USLA 4YGCB 3JTDB 1SY9A 1W7IB 2K7DA 2I7AA 1XFXO 2KI4C 4PE7A 1QATA 2KI4B 2JT8A 3PSRA 2LHIA 1MUXA 1FW4A 2M1UA 4MZJA 1OQPA 2L0PA 2NLNA 3LK1A 2ZNEA 2FCEA 1DJIA 4ORAB 2OPOA 3CZTX 2KBMA 3H4SE 5CSIA 3KO0A 1GGZA 2ZKMX 1R2UA 1UHNA 1TN4A 1S5GY 1NX1A 2M9GA 1W7JB 1FBVA 1PK0D 1KCYA 1WY9A 1OOJA 1SMGA 4GAOA 1TRFA 4YBHB 1F55A 1RTP1 3EKHA 1TCFA 2SASA 1CFDA 1NYAA 1ZFSA 3CGAA 2KQ6A 4M2QA 1TTXA 4MRYA 3BQ3A 1M46A 1SL8A 4PHNA 1JWDA 1UHKA 3HCMA 2CT9A 2K0JA 3BUWB 1J7QA 3AKAA 2LUXA 2MRDA 3F45A 1FF1A 2KSPA 4GGFA 4JQ0D 4MN0A 2BE4A 2JT3A 1A4PA 3ZWHA 3FIAA 4PE0A 4PE1A 3KEVA 1CMFA 1BOCA 4MLWA 1B7TY 2HPSA 4BY5A 2K7OA 3LK0A 3TDIA 1LA3A 1AJ4A 2WC8A 3SG5A 3FWBA 4M2PA 4UPGA 2ZN9A 3CWGA 3AAJA 4GPLB 4YGDB 1Y1UA 2M97A 4OVNF 1OZSA 3WHUB 4A4BA 3BUNB 4PALA 1ZOTB 2LCPA 2KAVA 2BECA 5I2QA 1K8UA 1DJXA 2BE6A 2EC6B 1KSOA 1QJTA 1H8BA 1SCVA 3PFVA 3CR5X 2BKHB 4ICBA 1NUBA 3VROA 1XFYO 3CLNA 4GUKA 1BF5A 1BLQA 1BU3A 1LKJA 2K8MB 1JF0A 2RGIA 5ER5A 1QS7A 1CDNA 4FTGA 5DKRA 5GQQC 1EH2A 2MHHA 3EK8A 1QV1A 1MR8A 1SCMC 1V1GA 1RJVA 2WORA 2KGRA 3NSIA 1SCMB 2WCEA 2ZN8A 2GV5A 3EK7A 1Y6WA 2KAYA 1IGVA 1J55A 1QV0A 3DD4A 3EVVA 3NXAA 5KSZA 1B9AA 1IH0A 1DT7B 1J7PA 5IBWA 5AXIA 1B8CA 1WRKA 2EHBA 4F0ZB 3BUMB 3C1VA 3AKBA 4GFTA 1CDMA 1QX7A 1QVIY 1Y0VH 2LVKA 2CXJA 3D0YB 2L5XB 2M1KB 4DIRA 2NXQA 2MBXA 4WQ3A 2KI6D 5CSNA 1A75B 2KNEA 3TDUA 1SL9A 4N1GA 4CPVA 2B1UA 5DKQA 2L50A 4YGAA 5AERA 3TUYC 2F8PA 1D1OA 1EL4A 3TUYB 4CFRA 1SKTA 3TS5C 2CCMA 2WCFA 3TS5B 4A4CA 2PSRA 4I5KA 1DMOA 3VRRA 5I8NA 2E30A 1K95A 3SIBA 1E8AA 1CFFA 2LUCA 4AQIA 2AMIA 2BBNA 1CTRA 1NX3A 1S26D 2JNFA 5D69A 4PCWA 1SR6C 1K9KA 1IQ5A 4XJKB 1SR6B 1K94A 1K9UA 1GJYA 1DGUA 5KTYA 1BG1A 2L4HA 2JOJA 1QXPA 4YRUA 2BBMA 2LM5A 5DKNA 1B7TZ 1NWDA 3SIAA 2LC5A 1FPWA 3HX4A 2ISDA 1FI6A 1H4BA 4FQOA 1F54A 1DVIA 4E68A 4Q04A 4BY4A 1PRWA 2M3WA 3EKJA 5K89A 2F33A 4PHMA 1K90D 3EK4A 1F4OA 4I5LB 4NQGA 5HKYA 1YVHA 2I94A 2MA2A 2AUCA 1S6IA 1QTXA 2JZIA 3EVRA 3MSEB 3IQOA 5JJGA 1DTLA 4D1EA 1WRZA 1SRAA 3A8RA 2PVBA 1HT9A 4MRXA 3DVEA 5F6TA 1S3PA 1XK4A 1NIWA 2H61C 1YX8A 1CFPA 1BJFA 5HYDA 1JC2A 1PSRA 1UUSA 2I18A 3PN7B 1OZOA 1XFZO 1LXFC 2BCXA 1OMVA 4DRWA 3CR2A 2JWWA 3O2PA 1QASA 5TNCA 2KYCA 1OMDA 1B8LA 2A4JA 4HRHA 1HQVA 2LV7A 4CLNA 1IKUA 1NX0A 2F3YA 2K7BA 1LVCD 1XFUO 1IG5A 1LA0A 1G4YR 2SCPA 1ODBA 1BR1B 2L98A 2LE9B 1M31A 3ZNIA 1ZUZA 1C07A 1KQMC 3NSKA 2P6BB 2L4IA 3DVJA 1KQMB 4HREE 3M0WA 1NSHA 1JF2A 1DGVA 3E3RA 5CSJA 1CNPA 2Q91A 3PM8A 1VRKA 4L9MA 1S36A 1EJ3A 1KK7Y 1AJ5A 1ZACA 4U8DA 2FCDA 3LL8B 2LVVA 4ZCVA 3SJSA 1KQVA 3BXKA 1UWOA 2K2AA 5HKZA 1KWOC 1KWOB 2EC6C 3CS1A 2O60A 3D0YA 3BOWA 3QRXA 1XYDA 5CSFA 2LLSA 4CFQA 2M7LA 2G9BA 1C7WA 1CM1A 1Y1AA 2I2RE 2KQYA 4QJ3B 1S6JA 1F70A 1J1EA 1YUUA 3DVMA 1PALA 3DF0A 1MQ1A 1PSBA 1JFJA 3OX5A 1B4CA 1Q80A 2IS9A 2Y5IA 2JXLA 2HF5A 4IL1A 1NPQA 1DF0A 1SL7A 1GGWA 1S1EA 2ZRTA 1J1DA 5CPVA 3I5HC 2KFFA 1WLMA 2JTZA 3I5HB 1QLKA 4YI8A 4GBAA 4DS7A 2JNXA 3OB2B 4C0KA 2PRUA 3NSLA 3OP0A 3O78A 4R1EA 4C0JA 3I5IC 2LLUA 4GGFC 3WXAA 3I5IB 4AQJA 3KPXA 1V1FA 1OMRA 3GK1A 1G8IA 2OTGC 2V53A 5D7FA 2OTGB 2ZRSA 4PHJA 1J7OA 1L2OC 1L2OB 1TOPA 1S5GZ 4DUQA 2KYFA 2H2KA 1EG4A 1OSAA 4DCKA 1U5IB 3OHMB 2KOTA 5I2LA 1B1GA 2PMYA 1CMGA 2Q4UA 2CNPA 2NCPA 2HQWA 5FYXA 1UURA 3NSOA 1MF8B 3VRNA 2HETA 2KHNA 3PATA 2QACA 3IQQA 4MZKA 5HLOA 3FS7A 2VRGA 2D8NA 2MAZA 1IRJA 5AFPA 3JVTC 1XO5A 1SK6D 1SPYA 2JC2A 2JPTA 3JVTB 3LCPC 4M2OA 4ORBB 2LNKA 2H61A 2LAPA 4OKHA 1LINA 4YGBB 2G2BA 5HKWA 1GQMA 1NX2A 1YURA 2TN4A 1CFCA 1WLZA 1BMOA 2K61A 3O4YA 2LMVA 5AANA 1TIZA 3TDZA 4CIDA 1M63B 1RWYA 4PHKA 1KK7Z 1DJZA 2F3ZA 2FJUB 2JQ6A 2MLEC 4QJ5B 1KFXS 1QIWA 1QX2A 2LMTA 1M39A 4MEWA 1A03A 3I5FC 4MZLA 1S6CA 3I5FB 2OS8C 1N65A 3VRPA 2OS8B 2L2EA 1PULA 4C0LA 2GGMA 1F8HA 2M29A 1CB1A 4NDDA 1YUSA 1CDPA 1AUIB 1TNPA 4AOMA 2EGDA 1NCYA 2JRFA 1KFUL 3PN7C 1IJ5A 3CR4X 4MBEA 2NCOA 1DJGA 1TNQA 2K2FA 3KHEA 1UHHA 1KFUS 1KSMA 3D10A 1A29A 1N0YA 1RK9A 2LVJA 1CLMA 4MSPA 2O5GA 3VGOA 4JPZB 1XVJA 1DJYA 3A4UB 2JTTA 1YUTA 2JU0A 1UP5A 1DJWA 5ER4X 1QVIZ 2R2IA 1K93D 4GGNA 2MJWB 3SG4A 1AVSA 1QLSA 4N5XA 4QJ4B 2KGBC 2M0RA 4HRGA 1RROA 4XYNA 2HQ8A 1K9PA 2LMUA 4PE4A 5JOLA 1ZMZA 4P5OE 4NDCA 3GK4X 2L51A 1WRLA 5J3XA 1ALWA 4GNKB 4NDBA 1MWNA 2M7NA 5I2OA 1UHIA 2KAXA 5AEQA 1A75A 1BR4B 2LP3A 4ETOA 1U5IA 4YGEB 1TNWA 2K7CA 2WCBA 1IWQA 1NCXA 2F2OA 4JWQA 2ZFDA 3I5GC 1K2HA 2CTNA 1SYMA 2JULA 3I5GB 1B8RA 1A2XA 3BUOB 1JSAA 2F2PA 1XK4C 1C7VA 1NP8A 2M49B 1KK8C 2JXCA 1QX5B 1KK8B 3TZ1A 1MXEA 3SG3A 1ALVA 1DJHA 2AAOA 1UHJA 3RLZA 1OE9B 4TNCA 2JT0A 3SG6A 4WRIA 5G08A 4OCIA 2KFHA 1AK8A 1FI5A 1EXRA 2LP2A 4N1FA 3SG7A 4XJKA 2KFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CLL A;  1CDL A;  2BL0 C;  2KI6 C;  1WDC C;  1YR5 A;  1SW8 A;  1YX7 A;  2BL0 B;  1NCZ A;  1WDC B;  3BUX B;  3EVU A;  3K21 A;  3WHT B;  2GGZ A;  3GK2 A;  1SNL A;  2M8U A;  3PAL A;  2PAS A;  5HLV A;  4P2Y B;  1YRT B;  2KDH A;  1IJ6 A;  1F4Q A;  5B8I B;  3OX6 A;  1BT6 A;  2E6W A;  2ZND A;  1CLB A;  2CBL A;  2DOQ A;  1YRU B;  1YTZ C;  2NZ0 A;  2WOS A;  1CKK A;  4I5J A;  1M45 A;  1TCO B;  1F71 A;  1L7Z A;  1YVL A;  3LLE A;  1B47 A;  4OV2 A;  2COL B;  1PVB A;  2LAN A;  3AAK A;  3PLF B;  1Y1X A;  3BOW B;  2BCB A;  1XFV O;  3RM1 A;  1X02 A;  3WNX B;  5KU1 A;  2KBI A;  1MHO A;  1N2D A;  1AHR A;  3FWC A;  2FOT A;  1CM4 A;  3O6B A;  1JFK A;  2LLT A;  3KF9 A;  3VRQ A;  3DF0 B;  1BOD A;  1KFX L;  1TNX A;  1XA5 A;  4ZCU A;  1JUO A;  1JBA A;  2QPT A;  3GOF A;  2LHL A;  1MXL C;  5BPJ A;  1PVA A;  2Y1M A;  1RFJ A;  2PAL A;  1DF0 B;  3CTN A;  3SG2 A;  1IQ3 A;  1XFW O;  2BCA A;  4OR9 B;  4HSZ A;  4ORC B;  2WND A;  4PDZ A;  2LVI A;  3BYA A;  1G33 A;  4WQ2 A;  1SBJ A;  2BKI B;  4YI9 A;  3DVK A;  5PAL A;  1QIV A;  1REC A;  1AP4 A;  1R6P A;  1J7R A;  2Y4Q A;  4I5N B;  2Y1N A;  3OB1 B;  2MLF C;  1EG3 A;  3ICB A;  1K96 A;  3JTD C;  3IF7 A;  4MVF A;  4USL A;  4YGC B;  3JTD B;  1SY9 A;  1W7I B;  2K7D A;  2I7A A;  1XFX O;  2KI4 C;  4PE7 A;  1QAT A;  2KI4 B;  2JT8 A;  3PSR A;  2LHI A;  1MUX A;  1FW4 A;  2M1U A;  4MZJ A;  1OQP A;  2L0P A;  2NLN A;  3LK1 A;  2ZNE A;  2FCE A;  1DJI A;  4ORA B;  2OPO A;  3CZT X;  2KBM A;  3H4S E;  5CSI A;  3KO0 A;  1GGZ A;  2ZKM X;  1R2U A;  1UHN A;  1TN4 A;  1S5G Y;  1NX1 A;  2M9G A;  1W7J B;  1FBV A;  1PK0 D;  1KCY A;  1WY9 A;  1OOJ A;  1SMG A;  4GAO A;  1TRF A;  4YBH B;  1F55 A;  1RTP 1;  3EKH A;  1TCF A;  2SAS A;  1CFD A;  1NYA A;  1ZFS A;  3CGA A;  2KQ6 A;  4M2Q A;  1TTX A;  4MRY A;  3BQ3 A;  1M46 A;  1SL8 A;  4PHN A;  1JWD A;  1UHK A;  3HCM A;  2CT9 A;  2K0J A;  3BUW B;  1J7Q A;  3AKA A;  2LUX A;  2MRD A;  3F45 A;  1FF1 A;  2KSP A;  4GGF A;  4JQ0 D;  4MN0 A;  2BE4 A;  2JT3 A;  1A4P A;  3ZWH A;  3FIA A;  4PE0 A;  4PE1 A;  3KEV A;  1CMF A;  1BOC A;  4MLW A;  1B7T Y;  2HPS A;  4BY5 A;  2K7O A;  3LK0 A;  3TDI A;  1LA3 A;  1AJ4 A;  2WC8 A;  3SG5 A;  3FWB A;  4M2P A;  4UPG A;  2ZN9 A;  3CWG A;  3AAJ A;  4GPL B;  4YGD B;  1Y1U A;  2M97 A;  4OVN F;  1OZS A;  3WHU B;  4A4B A;  3BUN B;  4PAL A;  1ZOT B;  2LCP A;  2KAV A;  2BEC A;  5I2Q A;  1K8U A;  1DJX A;  2BE6 A;  2EC6 B;  1KSO A;  1QJT A;  1H8B A;  1SCV A;  3PFV A;  3CR5 X;  2BKH B;  4ICB A;  1NUB A;  3VRO A;  1XFY O;  3CLN A;  4GUK A;  1BF5 A;  1BLQ A;  1BU3 A;  1LKJ A;  2K8M B;  1JF0 A;  2RGI A;  5ER5 A;  1QS7 A;  1CDN A;  4FTG A;  5DKR A;  5GQQ C;  1EH2 A;  2MHH A;  3EK8 A;  1QV1 A;  1MR8 A;  1SCM C;  1V1G A;  1RJV A;  2WOR A;  2KGR A;  3NSI A;  1SCM B;  2WCE A;  2ZN8 A;  2GV5 A;  3EK7 A;  1Y6W A;  2KAY A;  1IGV A;  1J55 A;  1QV0 A;  3DD4 A;  3EVV A;  3NXA A;  5KSZ A;  1B9A A;  1IH0 A;  1DT7 B;  1J7P A;  5IBW A;  5AXI A;  1B8C A;  1WRK A;  2EHB A;  4F0Z B;  3BUM B;  3C1V A;  3AKB A;  4GFT A;  1CDM A;  1QX7 A;  1QVI Y;  1Y0V H;  2LVK A;  2CXJ A;  3D0Y B;  2L5X B;  2M1K B;  4DIR A;  2NXQ A;  2MBX A;  4WQ3 A;  2KI6 D;  5CSN A;  1A75 B;  2KNE A;  3TDU A;  1SL9 A;  4N1G A;  4CPV A;  2B1U A;  5DKQ A;  2L50 A;  4YGA A;  5AER A;  3TUY C;  2F8P A;  1D1O A;  1EL4 A;  3TUY B;  4CFR A;  1SKT A;  3TS5 C;  2CCM A;  2WCF A;  3TS5 B;  4A4C A;  2PSR A;  4I5K A;  1DMO A;  3VRR A;  5I8N A;  2E30 A;  1K95 A;  3SIB A;  1E8A A;  1CFF A;  2LUC A;  4AQI A;  2AMI A;  2BBN A;  1CTR A;  1NX3 A;  1S26 D;  2JNF A;  5D69 A;  4PCW A;  1SR6 C;  1K9K A;  1IQ5 A;  4XJK B;  1SR6 B;  1K94 A;  1K9U A;  1GJY A;  1DGU A;  5KTY A;  1BG1 A;  2L4H A;  2JOJ A;  1QXP A;  4YRU A;  2BBM A;  2LM5 A;  5DKN A;  1B7T Z;  1NWD A;  3SIA A;  2LC5 A;  1FPW A;  3HX4 A;  2ISD A;  1FI6 A;  1H4B A;  4FQO A;  1F54 A;  1DVI A;  4E68 A;  4Q04 A;  4BY4 A;  1PRW A;  2M3W A;  3EKJ A;  5K89 A;  2F33 A;  4PHM A;  1K90 D;  3EK4 A;  1F4O A;  4I5L B;  4NQG A;  5HKY A;  1YVH A;  2I94 A;  2MA2 A;  2AUC A;  1S6I A;  1QTX A;  2JZI A;  3EVR A;  3MSE B;  3IQO A;  5JJG A;  1DTL A;  4D1E A;  1WRZ A;  1SRA A;  3A8R A;  2PVB A;  1HT9 A;  4MRX A;  3DVE A;  5F6T A;  1S3P A;  1XK4 A;  1NIW A;  2H61 C;  1YX8 A;  1CFP A;  1BJF A;  5HYD A;  1JC2 A;  1PSR A;  1UUS A;  2I18 A;  3PN7 B;  1OZO A;  1XFZ O;  1LXF C;  2BCX A;  1OMV A;  4DRW A;  3CR2 A;  2JWW A;  3O2P A;  1QAS A;  5TNC A;  2KYC A;  1OMD A;  1B8L A;  2A4J A;  4HRH A;  1HQV A;  2LV7 A;  4CLN A;  1IKU A;  1NX0 A;  2F3Y A;  2K7B A;  1LVC D;  1XFU O;  1IG5 A;  1LA0 A;  1G4Y R;  2SCP A;  1ODB A;  1BR1 B;  2L98 A;  2LE9 B;  1M31 A;  3ZNI A;  1ZUZ A;  1C07 A;  1KQM C;  3NSK A;  2P6B B;  2L4I A;  3DVJ A;  1KQM B;  4HRE E;  3M0W A;  1NSH A;  1JF2 A;  1DGV A;  3E3R A;  5CSJ A;  1CNP A;  2Q91 A;  3PM8 A;  1VRK A;  4L9M A;  1S36 A;  1EJ3 A;  1KK7 Y;  1AJ5 A;  1ZAC A;  4U8D A;  2FCD A;  3LL8 B;  2LVV A;  4ZCV A;  3SJS A;  1KQV A;  3BXK A;  1UWO A;  2K2A A;  5HKZ A;  1KWO C;  1KWO B;  2EC6 C;  3CS1 A;  2O60 A;  3D0Y A;  3BOW A;  3QRX A;  1XYD A;  5CSF A;  2LLS A;  4CFQ A;  2M7L A;  2G9B A;  1C7W A;  1CM1 A;  1Y1A A;  2I2R E;  2KQY A;  4QJ3 B;  1S6J A;  1F70 A;  1J1E A;  1YUU A;  3DVM A;  1PAL A;  3DF0 A;  1MQ1 A;  1PSB A;  1JFJ A;  3OX5 A;  1B4C A;  1Q80 A;  2IS9 A;  2Y5I A;  2JXL A;  2HF5 A;  4IL1 A;  1NPQ A;  1DF0 A;  1SL7 A;  1GGW A;  1S1E A;  2ZRT A;  1J1D A;  5CPV A;  3I5H C;  2KFF A;  1WLM A;  2JTZ A;  3I5H B;  1QLK A;  4YI8 A;  4GBA A;  4DS7 A;  2JNX A;  3OB2 B;  4C0K A;  2PRU A;  3NSL A;  3OP0 A;  3O78 A;  4R1E A;  4C0J A;  3I5I C;  2LLU A;  4GGF C;  3WXA A;  3I5I B;  4AQJ A;  3KPX A;  1V1F A;  1OMR A;  3GK1 A;  1G8I A;  2OTG C;  2V53 A;  5D7F A;  2OTG B;  2ZRS A;  4PHJ A;  1J7O A;  1L2O C;  1L2O B;  1TOP A;  1S5G Z;  4DUQ A;  2KYF A;  2H2K A;  1EG4 A;  1OSA A;  4DCK A;  1U5I B;  3OHM B;  2KOT A;  5I2L A;  1B1G A;  2PMY A;  1CMG A;  2Q4U A;  2CNP A;  2NCP A;  2HQW A;  5FYX A;  1UUR A;  3NSO A;  1MF8 B;  3VRN A;  2HET A;  2KHN A;  3PAT A;  2QAC A;  3IQQ A;  4MZK A;  5HLO A;  3FS7 A;  2VRG A;  2D8N A;  2MAZ A;  1IRJ A;  5AFP A;  3JVT C;  1XO5 A;  1SK6 D;  1SPY A;  2JC2 A;  2JPT A;  3JVT B;  3LCP C;  4M2O A;  4ORB B;  2LNK A;  2H61 A;  2LAP A;  4OKH A;  1LIN A;  4YGB B;  2G2B A;  5HKW A;  1GQM A;  1NX2 A;  1YUR A;  2TN4 A;  1CFC A;  1WLZ A;  1BMO A;  2K61 A;  3O4Y A;  2LMV A;  5AAN A;  1TIZ A;  3TDZ A;  4CID A;  1M63 B;  1RWY A;  4PHK A;  1KK7 Z;  1DJZ A;  2F3Z A;  2FJU B;  2JQ6 A;  2MLE C;  4QJ5 B;  1KFX S;  1QIW A;  1QX2 A;  2LMT A;  1M39 A;  4MEW A;  1A03 A;  3I5F C;  4MZL A;  1S6C A;  3I5F B;  2OS8 C;  1N65 A;  3VRP A;  2OS8 B;  2L2E A;  1PUL A;  4C0L A;  2GGM A;  1F8H A;  2M29 A;  1CB1 A;  4NDD A;  1YUS A;  1CDP A;  1AUI B;  1TNP A;  4AOM A;  2EGD A;  1NCY A;  2JRF A;  1KFU L;  3PN7 C;  1IJ5 A;  3CR4 X;  4MBE A;  2NCO A;  1DJG A;  1TNQ A;  2K2F A;  3KHE A;  1UHH A;  1KFU S;  1KSM A;  3D10 A;  1A29 A;  1N0Y A;  1RK9 A;  2LVJ A;  1CLM A;  4MSP A;  2O5G A;  3VGO A;  4JPZ B;  1XVJ A;  1DJY A;  3A4U B;  2JTT A;  1YUT A;  2JU0 A;  1UP5 A;  1DJW A;  5ER4 X;  1QVI Z;  2R2I A;  1K93 D;  4GGN A;  2MJW B;  3SG4 A;  1AVS A;  1QLS A;  4N5X A;  4QJ4 B;  2KGB C;  2M0R A;  4HRG A;  1RRO A;  4XYN A;  2HQ8 A;  1K9P A;  2LMU A;  4PE4 A;  5JOL A;  1ZMZ A;  4P5O E;  4NDC A;  3GK4 X;  2L51 A;  1WRL A;  5J3X A;  1ALW A;  4GNK B;  4NDB A;  1MWN A;  2M7N A;  5I2O A;  1UHI A;  2KAX A;  5AEQ A;  1A75 A;  1BR4 B;  2LP3 A;  4ETO A;  1U5I A;  4YGE B;  1TNW A;  2K7C A;  2WCB A;  1IWQ A;  1NCX A;  2F2O A;  4JWQ A;  2ZFD A;  3I5G C;  1K2H A;  2CTN A;  1SYM A;  2JUL A;  3I5G B;  1B8R A;  1A2X A;  3BUO B;  1JSA A;  2F2P A;  1XK4 C;  1C7V A;  1NP8 A;  2M49 B;  1KK8 C;  2JXC A;  1QX5 B;  1KK8 B;  3TZ1 A;  1MXE A;  3SG3 A;  1ALV A;  1DJH A;  2AAO A;  1UHJ A;  3RLZ A;  1OE9 B;  4TNC A;  2JT0 A;  3SG6 A;  4WRI A;  5G08 A;  4OCI A;  2KFH A;  1AK8 A;  1FI5 A;  1EXR A;  2LP2 A;  4N1F A;  3SG7 A;  4XJK A;  2KFG A; 
#chains in the Genus database with same CATH topology
 1CLL A;  1CDL A;  2BL0 C;  2KI6 C;  1WDC C;  1YR5 A;  1SW8 A;  1YX7 A;  2BL0 B;  1NCZ A;  1WDC B;  3BUX B;  3EVU A;  3K21 A;  3O4X A;  3WHT B;  2GGZ A;  3GK2 A;  1SNL A;  2ERB A;  2M8U A;  3PAL A;  2PAS A;  5HLV A;  4P2Y B;  1YRT B;  2KDH A;  1IJ6 A;  1F4Q A;  5B8I B;  3OX6 A;  1BT6 A;  2E6W A;  2ZND A;  1CLB A;  2CBL A;  2DOQ A;  1YRU B;  1YTZ C;  2NZ0 A;  2WOS A;  2P70 A;  1CKK A;  4I5J A;  1M45 A;  1TCO B;  1F71 A;  1L7Z A;  1YVL A;  3LLE A;  1B47 A;  4OV2 A;  2COL B;  1PVB A;  2LAN A;  3AAK A;  1W9Z A;  1OOG A;  3PLF B;  1Y1X A;  3BOW B;  2BCB A;  1XFV O;  3RM1 A;  1X02 A;  3S0D A;  3WNX B;  5KU1 A;  3D78 A;  2KBI A;  1MHO A;  1N2D A;  1AHR A;  3FWC A;  2FOT A;  1CM4 A;  3O6B A;  1JFK A;  2LLT A;  3KF9 A;  3VRQ A;  3DF0 B;  2WC5 A;  1BOD A;  1KFX L;  1TNX A;  1XA5 A;  4ZCU A;  1JUO A;  1JBA A;  2QPT A;  3GOF A;  2LHL A;  3NHI A;  1MXL C;  5BPJ A;  1PVA A;  2Y1M A;  1RFJ A;  2PAL A;  1DF0 B;  3CTN A;  3SG2 A;  1IQ3 A;  1XFW O;  2BCA A;  4OR9 B;  4HSZ A;  4ORC B;  2WND A;  4PDZ A;  2LVI A;  3BYA A;  3CZ1 A;  1G33 A;  4WQ2 A;  1SBJ A;  2BKI B;  4YI9 A;  3DVK A;  5PAL A;  1QIV A;  1REC A;  1AP4 A;  1R6P A;  1J7R A;  5D3O A;  2Y4Q A;  4I5N B;  2Y1N A;  3OB1 B;  2MLF C;  1EG3 A;  3DYE A;  3ICB A;  1K96 A;  3JTD C;  3IF7 A;  4MVF A;  1ORG A;  4USL A;  4YGC B;  3JTD B;  1SY9 A;  1W7I B;  2K7D A;  2I7A A;  1XFX O;  2KI4 C;  4PE7 A;  1QAT A;  2KI4 B;  2JT8 A;  3K1E A;  2LHI A;  3PSR A;  1MUX A;  1FW4 A;  2M1U A;  4MZJ A;  1OQP A;  2L0P A;  3D76 A;  2NLN A;  3LK1 A;  2ZNE A;  2FCE A;  1DJI A;  4ORA B;  2OPO A;  3CZT X;  2KBM A;  3H4S E;  3IVT A;  4KYN A;  5CSI A;  3KO0 A;  1GGZ A;  2ZKM X;  1QWV A;  1R2U A;  1UHN A;  1TN4 A;  1S5G Y;  1NX1 A;  2M9G A;  1W7J B;  1FBV A;  1PK0 D;  1KCY A;  1WY9 A;  1OOJ A;  1SMG A;  2BNX A;  3B86 A;  4GAO A;  1OW4 A;  1TRF A;  4YBH B;  1F55 A;  1RTP 1;  3EKH A;  1TCF A;  2SAS A;  1CFD A;  1NYA A;  1ZFS A;  3CGA A;  2KQ6 A;  1DC1 A;  4M2Q A;  1TTX A;  3BFA A;  4MRY A;  1OOF A;  3BQ3 A;  1M46 A;  1SL8 A;  4PHN A;  1JWD A;  1UHK A;  3SS5 A;  3HCM A;  2CT9 A;  2K0J A;  3BUW B;  1J7Q A;  4PT1 A;  2WCH A;  3AKA A;  1DQE A;  2LUX A;  2MRD A;  3F45 A;  1FF1 A;  2KSP A;  4GGF A;  4JQ0 D;  4MN0 A;  2BE4 A;  4INX A;  2JT3 A;  1A4P A;  3VB1 A;  2PQL A;  3ZWH A;  1TUZ A;  3FIA A;  4PE0 A;  4PE1 A;  3KEV A;  1CMF A;  1BOC A;  4MLW A;  1B7T Y;  2HPS A;  2L5Y A;  4BY5 A;  3S0A A;  2GTE A;  2K7O A;  3LK0 A;  3TDI A;  1LA3 A;  1AJ4 A;  2WC8 A;  3SG5 A;  2JPO A;  3FWB A;  4M2P A;  4UPG A;  2ZN9 A;  3CWG A;  3AAJ A;  4GPL B;  4YGD B;  1Y1U A;  2M97 A;  4OVN F;  1OZS A;  3WHU B;  4A4B A;  3BUN B;  4PAL A;  1ZOT B;  2LCP A;  2KAV A;  2BEC A;  5I2Q A;  1K8U A;  1DJX A;  2BE6 A;  2EC6 B;  1KSO A;  1QJT A;  1H8B A;  1SCV A;  3D74 A;  3PFV A;  3CR5 X;  2BKH B;  4ICB A;  1NUB A;  3VRO A;  1XFY O;  3CLN A;  4GUK A;  1BF5 A;  1BLQ A;  1BU3 A;  1LKJ A;  2K8M B;  1JF0 A;  2RGI A;  5ER5 A;  1QS7 A;  1CDN A;  4FTG A;  5DKR A;  3NGV A;  5GQQ C;  1EH2 A;  2MHH A;  3EK8 A;  1QV1 A;  1MR8 A;  1SCM C;  1V1G A;  1RJV A;  2WOR A;  2KGR A;  3NSI A;  1SCM B;  2WCE A;  2ZN8 A;  2GV5 A;  3EK7 A;  1Y6W A;  2KAY A;  2QDI A;  1IGV A;  1J55 A;  1QV0 A;  3DD4 A;  3EVV A;  3NXA A;  5KSZ A;  1B9A A;  1IH0 A;  1DT7 B;  1J7P A;  5IBW A;  5AXI A;  1B8C A;  1WRK A;  2EHB A;  4F0Z B;  3BUM B;  3C1V A;  3AKB A;  4GFT A;  1CDM A;  1QX7 A;  5FI7 A;  1QVI Y;  1Y0V H;  2LVK A;  2CXJ A;  1C3Z A;  2L5X B;  3D0Y B;  2M1K B;  4DIR A;  2NXQ A;  2MBX A;  4WQ3 A;  2KI6 D;  3CAB A;  3SS3 A;  5CSN A;  1A75 B;  2KNE A;  3TDU A;  1SL9 A;  4N1G A;  4CPV A;  2B1U A;  3PM2 A;  1P28 A;  2KLD A;  5DKQ A;  2L50 A;  3B88 A;  3BFB A;  4YGA A;  5AER A;  1Z4H A;  3TUY C;  2F8P A;  1D1O A;  1EL4 A;  3TUY B;  4CFR A;  3CDN A;  3DZT A;  1SKT A;  3TS5 C;  4OZD A;  2CCM A;  2WCF A;  3TS5 B;  4A4C A;  2PSR A;  4I5K A;  1DMO A;  3VRR A;  5I8N A;  2E30 A;  4FQT A;  1K95 A;  3SIB A;  1E8A A;  1C3Y A;  3DXL A;  1CFF A;  2LUC A;  4AQI A;  2AMI A;  2BBN A;  4JD9 A;  1CTR A;  1NX3 A;  1S26 D;  2JNF A;  5D69 A;  4PCW A;  1SR6 C;  1K9K A;  1IQ5 A;  4XJK B;  1SR6 B;  1K94 A;  1K9U A;  1GJY A;  1DGU A;  5KTY A;  1BG1 A;  2L4H A;  2JOJ A;  1QXP A;  4YRU A;  2BBM A;  2LM5 A;  3NHT A;  1B7T Z;  1NWD A;  5DKN A;  2LC5 A;  3SIA A;  1FPW A;  3HX4 A;  2ISD A;  1FI6 A;  1H4B A;  5HL1 A;  4FQO A;  1F54 A;  1DVI A;  4E68 A;  4Q04 A;  4BY4 A;  1PRW A;  2M3W A;  3EKJ A;  5K89 A;  2F33 A;  4PHM A;  1K90 D;  3EK4 A;  1F4O A;  4I5L B;  4NQG A;  5HKY A;  1YVH A;  2I94 A;  2MA2 A;  1S6I A;  1QTX A;  2AUC A;  2JZI A;  3EVR A;  3MSE B;  3IQO A;  4JKT A;  5JJG A;  1DTL A;  4D1E A;  1WRZ A;  1SRA A;  3A8R A;  2PVB A;  1HT9 A;  4MRX A;  2WCJ A;  3DVE A;  5F6T A;  1S3P A;  3EG5 B;  1XK4 A;  2H8V A;  2K60 A;  1NIW A;  2H61 C;  1YX8 A;  1CFP A;  1BJF A;  5HYD A;  3FE8 A;  1JC2 A;  1PSR A;  1UUS A;  2I18 A;  3PN7 B;  3CYZ A;  1IIO A;  1OZO A;  1XFZ O;  1LXF C;  2BCX A;  1OMV A;  3S0E A;  3CR2 A;  4DRW A;  2JWW A;  3O2P A;  1LS8 A;  3OBV A;  3Q8I A;  1QAS A;  5TNC A;  2KYC A;  1T14 A;  1OMD A;  1B8L A;  2A4J A;  4HRH A;  1HQV A;  2LV7 A;  4CLN A;  1IKU A;  1NX0 A;  2F3Y A;  2K7B A;  1LVC D;  1XFU O;  1IG5 A;  1LA0 A;  1G4Y R;  2SCP A;  1ODB A;  1BR1 B;  2L98 A;  2LE9 B;  1M31 A;  3ZNI A;  1ZUZ A;  1C07 A;  1KQM C;  3NSK A;  2P6B B;  2L4I A;  3DVJ A;  1KQM B;  4HRE E;  3M0W A;  1NSH A;  1JF2 A;  1DGV A;  3N7H A;  3E3R A;  5CSJ A;  1CNP A;  5FI6 A;  2Q91 A;  3PM8 A;  1VRK A;  4L9M A;  1S36 A;  1EJ3 A;  1KK7 Y;  1AJ5 A;  1ZAC A;  4U8D A;  2FCD A;  3S0G A;  3LL8 B;  2LVV A;  4ZCV A;  3SJS A;  1KQV A;  3BXK A;  1UWO A;  2K2A A;  5HKZ A;  3R1P A;  1KWO C;  1KWO B;  2EC6 C;  3CS1 A;  2O60 A;  3D0Y A;  3BOW A;  3QRX A;  1XYD A;  5CSF A;  2BAP A;  2LLS A;  3RZS A;  4CFQ A;  2M7L A;  2G9B A;  1C7W A;  1CM1 A;  1Y1A A;  2I2R E;  3S0B A;  2KQY A;  4QJ3 B;  1S6J A;  1F70 A;  1J1E A;  1YUU A;  3DVM A;  5EL2 A;  1PAL A;  3DF0 A;  1MQ1 A;  1PSB A;  1JFJ A;  3OX5 A;  2WCM A;  1B4C A;  1Q80 A;  2IS9 A;  2Y5I A;  3CZ2 A;  2JXL A;  2HF5 A;  3D73 A;  4IL1 A;  1NPQ A;  1OOI X;  1DF0 A;  1SL7 A;  1GGW A;  3UO9 A;  1S1E A;  5I94 A;  2QEO A;  2ZRT A;  1J1D A;  3B87 A;  5CPV A;  3I5H C;  2KFF A;  1WLM A;  2JTZ A;  3FE9 A;  3I5H B;  2P71 A;  1QLK A;  4YI8 A;  4GBA A;  4DS7 A;  2JNX A;  3OB2 B;  4C0K A;  2PRU A;  4F7F A;  3NSL A;  3OP0 A;  3O78 A;  4R1E A;  4C0J A;  3I5I C;  2LLU A;  4GGF C;  3WXA A;  3I5I B;  2QEB A;  4AQJ A;  3KPX A;  1V1F A;  1OMR A;  2QEV A;  1G8I A;  2OTG C;  2V53 A;  3GK1 A;  4INW A;  5D7F A;  2OTG B;  2ZRS A;  4PHJ A;  1J7O A;  1L2O C;  2YGU A;  3R72 A;  1L2O B;  1TOP A;  1S5G Z;  4DUQ A;  1TUJ A;  2KYF A;  2H2K A;  1EG4 A;  1OSA A;  2WC6 A;  3B7A A;  1U5I B;  4DCK A;  3OHM B;  2KOT A;  3BFH A;  5I2L A;  1B1G A;  3DY9 A;  2PMY A;  2KPH A;  1CMG A;  2PYQ A;  5FI2 A;  3SS4 A;  2Q4U A;  2CNP A;  2NCP A;  2HQW A;  5FYX A;  1UUR A;  3NSO A;  1MF8 B;  2KLE A;  3VRN A;  2HET A;  2KHN A;  3L47 A;  3PAT A;  2QAC A;  3IQQ A;  4MZK A;  5HLO A;  3FS7 A;  2VRG A;  2D8N A;  2MAZ A;  1IRJ A;  5AFP A;  1GM0 A;  3JVT C;  1XO5 A;  1SK6 D;  1SPY A;  2JC2 A;  2JPT A;  3JVT B;  3LCP C;  4M2O A;  4ORB B;  2LNK A;  2H61 A;  2LAP A;  4OKH A;  1LIN A;  4YGB B;  2G2B A;  5HKW A;  1GQM A;  1NX2 A;  1YUR A;  2TN4 A;  1CFC A;  3V2L A;  1WLZ A;  1BMO A;  1XFR A;  2K61 A;  2LMV A;  3O4Y A;  5AAN A;  1TIZ A;  3TDZ A;  4CID A;  1M63 B;  1RWY A;  4PHK A;  1OOH A;  1KK7 Z;  1DJZ A;  2F3Z A;  2FJU B;  2JQ6 A;  2MLE C;  4QJ5 B;  1KFX S;  1QIW A;  1QX2 A;  2LMT A;  3D77 A;  1M39 A;  4MEW A;  1A03 A;  3I5F C;  4MZL A;  1S6C A;  3I5F B;  2OS8 C;  1N65 A;  3VRP A;  2OS8 B;  2L2E A;  1PUL A;  4C0L A;  2GGM A;  1F8H A;  2M29 A;  1CB1 A;  4NDD A;  3OGN A;  1YUS A;  1CDP A;  3L4A A;  1AUI B;  1TNP A;  4AOM A;  2EGD A;  1NCY A;  2JRF A;  3R1V A;  1KFU L;  1DEK A;  3PN7 C;  1IJ5 A;  3CR4 X;  4MBE A;  3R1O A;  2QEH A;  2NCO A;  1DJG A;  1TNQ A;  2K2F A;  3B6X A;  3KHE A;  1UHH A;  1DEL A;  1Z2C B;  3BJH A;  1KFU S;  1KSM A;  3D10 A;  1A29 A;  1N0Y A;  2WCL A;  1RK9 A;  2LVJ A;  1CLM A;  4MSP A;  1SSE B;  2O5G A;  3VGO A;  4JPZ B;  1XVJ A;  1DJY A;  3A4U B;  2JTT A;  1YUT A;  2JU0 A;  1UP5 A;  1DJW A;  5ER4 X;  1QVI Z;  2R2I A;  1K93 D;  3D75 A;  4GGN A;  2MJW B;  2FJY A;  3SG4 A;  4IJ7 A;  1AVS A;  2WCK A;  5DIC A;  1QLS A;  4N5X A;  4QJ4 B;  2KGB C;  2M0R A;  4HRG A;  1RRO A;  4XYN A;  2HQ8 A;  1K9P A;  2LMU A;  4PE4 A;  5JOL A;  1ZMZ A;  4P5O E;  4NDC A;  3GK4 X;  2L51 A;  1WRL A;  3L4L A;  5J3X A;  1ALW A;  4GNK B;  4NDB A;  1MWN A;  2M7N A;  5I2O A;  3CZ0 A;  1UHI A;  1TWO A;  3S0F A;  2KAX A;  5AEQ A;  1A75 A;  1BR4 B;  2LP3 A;  3FE6 A;  4ETO A;  1U5I A;  4YGE B;  1TNW A;  2K7C A;  2WCB A;  1IWQ A;  1NCX A;  2F2O A;  4JWQ A;  2ZFD A;  3I5G C;  1K2H A;  2CTN A;  1SYM A;  2JUL A;  3I5G B;  1B8R A;  1A2X A;  2L2C A;  3BUO B;  2F2P A;  1JSA A;  1XK4 C;  1C7V A;  1NP8 A;  3QME A;  2M49 B;  1KK8 C;  2JXC A;  1QX5 B;  1KK8 B;  3TZ1 A;  1MXE A;  3SG3 A;  1ALV A;  1DJH A;  2AAO A;  1UHJ A;  3RLZ A;  1OE9 B;  4TNC A;  2JT0 A;  3SG6 A;  4WRI A;  3PJI A;  5G08 A;  4OCI A;  2KFH A;  1AK8 A;  1FI5 A;  1EXR A;  2LP2 A;  3UNW A;  4N1F A;  3SG7 A;  4XJK A;  2KFG A; 
#chains in the Genus database with same CATH homology
 1CLL A;  1CDL A;  2BL0 C;  2KI6 C;  1WDC C;  1YR5 A;  1SW8 A;  1YX7 A;  2BL0 B;  1NCZ A;  1WDC B;  3BUX B;  3EVU A;  3K21 A;  3WHT B;  2GGZ A;  3GK2 A;  1SNL A;  2M8U A;  3PAL A;  2PAS A;  5HLV A;  4P2Y B;  1YRT B;  2KDH A;  1IJ6 A;  1F4Q A;  5B8I B;  3OX6 A;  1BT6 A;  2E6W A;  2ZND A;  1CLB A;  2CBL A;  2DOQ A;  1YRU B;  1YTZ C;  2NZ0 A;  2WOS A;  1CKK A;  4I5J A;  1M45 A;  1TCO B;  1F71 A;  1L7Z A;  1YVL A;  3LLE A;  1B47 A;  4OV2 A;  2COL B;  1PVB A;  2LAN A;  3AAK A;  3PLF B;  1Y1X A;  3BOW B;  2BCB A;  1XFV O;  3RM1 A;  1X02 A;  3WNX B;  5KU1 A;  2KBI A;  1MHO A;  1N2D A;  1AHR A;  3FWC A;  2FOT A;  1CM4 A;  3O6B A;  1JFK A;  2LLT A;  3KF9 A;  3VRQ A;  3DF0 B;  1BOD A;  1KFX L;  1TNX A;  1XA5 A;  4ZCU A;  1JUO A;  1JBA A;  2QPT A;  3GOF A;  2LHL A;  1MXL C;  5BPJ A;  1PVA A;  2Y1M A;  1RFJ A;  2PAL A;  1DF0 B;  3CTN A;  3SG2 A;  1IQ3 A;  1XFW O;  2BCA A;  4OR9 B;  4HSZ A;  4ORC B;  2WND A;  4PDZ A;  2LVI A;  3BYA A;  1G33 A;  4WQ2 A;  1SBJ A;  2BKI B;  4YI9 A;  3DVK A;  5PAL A;  1QIV A;  1REC A;  1AP4 A;  1R6P A;  1J7R A;  2Y4Q A;  4I5N B;  2Y1N A;  3OB1 B;  2MLF C;  1EG3 A;  3ICB A;  1K96 A;  3JTD C;  3IF7 A;  4MVF A;  4USL A;  4YGC B;  3JTD B;  1SY9 A;  1W7I B;  2K7D A;  2I7A A;  1XFX O;  2KI4 C;  4PE7 A;  1QAT A;  2KI4 B;  2JT8 A;  3PSR A;  2LHI A;  1MUX A;  1FW4 A;  2M1U A;  4MZJ A;  1OQP A;  2L0P A;  2NLN A;  3LK1 A;  2ZNE A;  2FCE A;  1DJI A;  4ORA B;  2OPO A;  3CZT X;  2KBM A;  3H4S E;  5CSI A;  3KO0 A;  1GGZ A;  2ZKM X;  1R2U A;  1UHN A;  1TN4 A;  1S5G Y;  1NX1 A;  2M9G A;  1W7J B;  1FBV A;  1PK0 D;  1KCY A;  1WY9 A;  1OOJ A;  1SMG A;  4GAO A;  1TRF A;  4YBH B;  1F55 A;  1RTP 1;  3EKH A;  1TCF A;  2SAS A;  1CFD A;  1NYA A;  1ZFS A;  3CGA A;  2KQ6 A;  4M2Q A;  1TTX A;  4MRY A;  3BQ3 A;  1M46 A;  1SL8 A;  4PHN A;  1JWD A;  1UHK A;  3HCM A;  2CT9 A;  2K0J A;  3BUW B;  1J7Q A;  3AKA A;  2LUX A;  2MRD A;  3F45 A;  1FF1 A;  2KSP A;  4GGF A;  4JQ0 D;  4MN0 A;  2BE4 A;  2JT3 A;  1A4P A;  3ZWH A;  3FIA A;  4PE0 A;  4PE1 A;  3KEV A;  1CMF A;  1BOC A;  4MLW A;  1B7T Y;  2HPS A;  4BY5 A;  2K7O A;  3LK0 A;  3TDI A;  1LA3 A;  1AJ4 A;  2WC8 A;  3SG5 A;  3FWB A;  4M2P A;  4UPG A;  2ZN9 A;  3CWG A;  3AAJ A;  4GPL B;  4YGD B;  1Y1U A;  2M97 A;  4OVN F;  1OZS A;  3WHU B;  4A4B A;  3BUN B;  4PAL A;  1ZOT B;  2LCP A;  2KAV A;  2BEC A;  5I2Q A;  1K8U A;  1DJX A;  2BE6 A;  2EC6 B;  1KSO A;  1QJT A;  1H8B A;  1SCV A;  3PFV A;  3CR5 X;  2BKH B;  4ICB A;  1NUB A;  3VRO A;  1XFY O;  3CLN A;  4GUK A;  1BF5 A;  1BLQ A;  1BU3 A;  1LKJ A;  2K8M B;  1JF0 A;  2RGI A;  5ER5 A;  1QS7 A;  1CDN A;  4FTG A;  5DKR A;  5GQQ C;  1EH2 A;  2MHH A;  3EK8 A;  1QV1 A;  1MR8 A;  1SCM C;  1V1G A;  1RJV A;  2WOR A;  2KGR A;  3NSI A;  1SCM B;  2WCE A;  2ZN8 A;  2GV5 A;  3EK7 A;  1Y6W A;  2KAY A;  1IGV A;  1J55 A;  1QV0 A;  3DD4 A;  3EVV A;  3NXA A;  5KSZ A;  1B9A A;  1IH0 A;  1DT7 B;  1J7P A;  5IBW A;  5AXI A;  1B8C A;  1WRK A;  2EHB A;  4F0Z B;  3BUM B;  3C1V A;  3AKB A;  4GFT A;  1CDM A;  1QX7 A;  1QVI Y;  1Y0V H;  2LVK A;  2CXJ A;  3D0Y B;  2L5X B;  2M1K B;  4DIR A;  2NXQ A;  2MBX A;  4WQ3 A;  2KI6 D;  5CSN A;  1A75 B;  2KNE A;  3TDU A;  1SL9 A;  4N1G A;  4CPV A;  2B1U A;  5DKQ A;  2L50 A;  4YGA A;  5AER A;  3TUY C;  2F8P A;  1D1O A;  1EL4 A;  3TUY B;  4CFR A;  1SKT A;  3TS5 C;  2CCM A;  2WCF A;  3TS5 B;  4A4C A;  2PSR A;  4I5K A;  1DMO A;  3VRR A;  5I8N A;  2E30 A;  1K95 A;  3SIB A;  1E8A A;  1CFF A;  2LUC A;  4AQI A;  2AMI A;  2BBN A;  1CTR A;  1NX3 A;  1S26 D;  2JNF A;  5D69 A;  4PCW A;  1SR6 C;  1K9K A;  1IQ5 A;  4XJK B;  1SR6 B;  1K94 A;  1K9U A;  1GJY A;  1DGU A;  5KTY A;  1BG1 A;  2L4H A;  2JOJ A;  1QXP A;  4YRU A;  2BBM A;  2LM5 A;  5DKN A;  1B7T Z;  1NWD A;  3SIA A;  2LC5 A;  1FPW A;  3HX4 A;  2ISD A;  1FI6 A;  1H4B A;  4FQO A;  1F54 A;  1DVI A;  4E68 A;  4Q04 A;  4BY4 A;  1PRW A;  2M3W A;  3EKJ A;  5K89 A;  2F33 A;  4PHM A;  1K90 D;  3EK4 A;  1F4O A;  4I5L B;  4NQG A;  5HKY A;  1YVH A;  2I94 A;  2MA2 A;  2AUC A;  1S6I A;  1QTX A;  2JZI A;  3EVR A;  3MSE B;  3IQO A;  5JJG A;  1DTL A;  4D1E A;  1WRZ A;  1SRA A;  3A8R A;  2PVB A;  1HT9 A;  4MRX A;  3DVE A;  5F6T A;  1S3P A;  1XK4 A;  1NIW A;  2H61 C;  1YX8 A;  1CFP A;  1BJF A;  5HYD A;  1JC2 A;  1PSR A;  1UUS A;  2I18 A;  3PN7 B;  1OZO A;  1XFZ O;  1LXF C;  2BCX A;  1OMV A;  4DRW A;  3CR2 A;  2JWW A;  3O2P A;  1QAS A;  5TNC A;  2KYC A;  1OMD A;  1B8L A;  2A4J A;  4HRH A;  1HQV A;  2LV7 A;  4CLN A;  1IKU A;  1NX0 A;  2F3Y A;  2K7B A;  1LVC D;  1XFU O;  1IG5 A;  1LA0 A;  1G4Y R;  2SCP A;  1ODB A;  1BR1 B;  2L98 A;  2LE9 B;  1M31 A;  3ZNI A;  1ZUZ A;  1C07 A;  1KQM C;  3NSK A;  2P6B B;  2L4I A;  3DVJ A;  1KQM B;  4HRE E;  3M0W A;  1NSH A;  1JF2 A;  1DGV A;  3E3R A;  5CSJ A;  1CNP A;  2Q91 A;  3PM8 A;  1VRK A;  4L9M A;  1S36 A;  1EJ3 A;  1KK7 Y;  1AJ5 A;  1ZAC A;  4U8D A;  2FCD A;  3LL8 B;  2LVV A;  4ZCV A;  3SJS A;  1KQV A;  3BXK A;  1UWO A;  2K2A A;  5HKZ A;  1KWO C;  1KWO B;  2EC6 C;  3CS1 A;  2O60 A;  3D0Y A;  3BOW A;  3QRX A;  1XYD A;  5CSF A;  2LLS A;  4CFQ A;  2M7L A;  2G9B A;  1C7W A;  1CM1 A;  1Y1A A;  2I2R E;  2KQY A;  4QJ3 B;  1S6J A;  1F70 A;  1J1E A;  1YUU A;  3DVM A;  1PAL A;  3DF0 A;  1MQ1 A;  1PSB A;  1JFJ A;  3OX5 A;  1B4C A;  1Q80 A;  2IS9 A;  2Y5I A;  2JXL A;  2HF5 A;  4IL1 A;  1NPQ A;  1DF0 A;  1SL7 A;  1GGW A;  1S1E A;  2ZRT A;  1J1D A;  5CPV A;  3I5H C;  2KFF A;  1WLM A;  2JTZ A;  3I5H B;  1QLK A;  4YI8 A;  4GBA A;  4DS7 A;  2JNX A;  3OB2 B;  4C0K A;  2PRU A;  3NSL A;  3OP0 A;  3O78 A;  4R1E A;  4C0J A;  3I5I C;  2LLU A;  4GGF C;  3WXA A;  3I5I B;  4AQJ A;  3KPX A;  1V1F A;  1OMR A;  3GK1 A;  1G8I A;  2OTG C;  2V53 A;  5D7F A;  2OTG B;  2ZRS A;  4PHJ A;  1J7O A;  1L2O C;  1L2O B;  1TOP A;  1S5G Z;  4DUQ A;  2KYF A;  2H2K A;  1EG4 A;  1OSA A;  4DCK A;  1U5I B;  3OHM B;  2KOT A;  5I2L A;  1B1G A;  2PMY A;  1CMG A;  2Q4U A;  2CNP A;  2NCP A;  2HQW A;  5FYX A;  1UUR A;  3NSO A;  1MF8 B;  3VRN A;  2HET A;  2KHN A;  3PAT A;  2QAC A;  3IQQ A;  4MZK A;  5HLO A;  3FS7 A;  2VRG A;  2D8N A;  2MAZ A;  1IRJ A;  5AFP A;  3JVT C;  1XO5 A;  1SK6 D;  1SPY A;  2JC2 A;  2JPT A;  3JVT B;  3LCP C;  4M2O A;  4ORB B;  2LNK A;  2H61 A;  2LAP A;  4OKH A;  1LIN A;  4YGB B;  2G2B A;  5HKW A;  1GQM A;  1NX2 A;  1YUR A;  2TN4 A;  1CFC A;  1WLZ A;  1BMO A;  2K61 A;  3O4Y A;  2LMV A;  5AAN A;  1TIZ A;  3TDZ A;  4CID A;  1M63 B;  1RWY A;  4PHK A;  1KK7 Z;  1DJZ A;  2F3Z A;  2FJU B;  2JQ6 A;  2MLE C;  4QJ5 B;  1KFX S;  1QIW A;  1QX2 A;  2LMT A;  1M39 A;  4MEW A;  1A03 A;  3I5F C;  4MZL A;  1S6C A;  3I5F B;  2OS8 C;  1N65 A;  3VRP A;  2OS8 B;  2L2E A;  1PUL A;  4C0L A;  2GGM A;  1F8H A;  2M29 A;  1CB1 A;  4NDD A;  1YUS A;  1CDP A;  1AUI B;  1TNP A;  4AOM A;  2EGD A;  1NCY A;  2JRF A;  1KFU L;  3PN7 C;  1IJ5 A;  3CR4 X;  4MBE A;  2NCO A;  1DJG A;  1TNQ A;  2K2F A;  3KHE A;  1UHH A;  1KFU S;  1KSM A;  3D10 A;  1A29 A;  1N0Y A;  1RK9 A;  2LVJ A;  1CLM A;  4MSP A;  2O5G A;  3VGO A;  4JPZ B;  1XVJ A;  1DJY A;  3A4U B;  2JTT A;  1YUT A;  2JU0 A;  1UP5 A;  1DJW A;  5ER4 X;  1QVI Z;  2R2I A;  1K93 D;  4GGN A;  2MJW B;  3SG4 A;  1AVS A;  1QLS A;  4N5X A;  4QJ4 B;  2KGB C;  2M0R A;  4HRG A;  1RRO A;  4XYN A;  2HQ8 A;  1K9P A;  2LMU A;  4PE4 A;  5JOL A;  1ZMZ A;  4P5O E;  4NDC A;  3GK4 X;  2L51 A;  1WRL A;  5J3X A;  1ALW A;  4GNK B;  4NDB A;  1MWN A;  2M7N A;  5I2O A;  1UHI A;  2KAX A;  5AEQ A;  1A75 A;  1BR4 B;  2LP3 A;  4ETO A;  1U5I A;  4YGE B;  1TNW A;  2K7C A;  2WCB A;  1IWQ A;  1NCX A;  2F2O A;  4JWQ A;  2ZFD A;  3I5G C;  1K2H A;  2CTN A;  1SYM A;  2JUL A;  3I5G B;  1B8R A;  1A2X A;  3BUO B;  1JSA A;  2F2P A;  1XK4 C;  1C7V A;  1NP8 A;  2M49 B;  1KK8 C;  2JXC A;  1QX5 B;  1KK8 B;  3TZ1 A;  1MXE A;  3SG3 A;  1ALV A;  1DJH A;  2AAO A;  1UHJ A;  3RLZ A;  1OE9 B;  4TNC A;  2JT0 A;  3SG6 A;  4WRI A;  5G08 A;  4OCI A;  2KFH A;  1AK8 A;  1FI5 A;  1EXR A;  2LP2 A;  4N1F A;  3SG7 A;  4XJK A;  2KFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...