3IF7A

Structure of calmodulin complexed with its first endogenous inhibitor, sphingosylphosphorylcholine
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
144
structure length
142
Chain Sequence
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin
publication title Structure and mechanism of calmodulin binding to a signaling sphingolipid reveal new aspects of lipid-protein interactions
pubmed doi rcsb
molecule tags Calcium binding protein
total genus 52
structure length 142
sequence length 144
ec nomenclature
pdb deposition date 2009-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3if7A00
1K9PA 4CIDA 1NX2A 2JC2A 1CFCA 2M3WA 1IQ3A 1C7VA 2COLB 2PRUA 3A4UB 3IQQA 4HSZA 4C0JA 4YRUA 2I94A 3ICBA 1CTRA 1K96A 3VRRA 1GGWA 1S36A 1S6IA 3PN7C 1WDCC 1XFWO 1IG5A 1S5GY 1YX7A 2K7BA 1NPQA 1XFYO 5KSZA 4MZKA 1DJWA 2LV7A 2OTGB 1WY9A 2ZN8A 3CWGA 2JT0A 3I5HC 2NZ0A 1U5IA 2WCEA 3KPXA 4OV2A 4WQ3A 1UHNA 2H61C 4YGCB 2KAYA 2M97A 4U8DA 1TIZA 1ALWA 2VRGA 2CXJA 2KI4C 1QLKA 2O5GA 1KK8C 2JU0A 1UHIA 1CMGA 1YR5A 3I5IC 4GGFC 2L50A 1KFUL 1JC2A 1SRAA 2B1UA 1XFZO 3KHEA 3NSKA 1F70A 1Y0VH 3TDZA 4YI8A 1NWDA 4GAOA 2BBNA 1H8BA 3SIBA 1DF0A 5KTYA 1NIWA 3SG6A 1UHJA 2BE4A 1S5GZ 2JT3A 4M2OA 1IRJA 2AMIA 1H4BA 1ZOTB 1B1GA 3SG5A 2KGBC 1KFXL 1KQVA 3PATA 1X02A 1CDLA 1TRFA 2R2IA 2F33A 1BOCA 1JFKA 4DCKA 1UP5A 4PE4A 5PALA 1IH0A 5GQQC 1UURA 1LINA 1A4PA 1N65A 1TCFA 4XJKA 3VRPA 1YVHA 1F55A 1QV1A 1BLQA 1JUOA 1SCMB 3SG4A 3CTNA 3RM1A 4YBHB 1KCYA 1AJ4A 1K93D 1K90D 3ZNIA 5CSFA 1CDNA 1RJVA 1K9KA 1B9AA 3GOFA 3NSLA 2HPSA 1IJ5A 2LLUA 1SCVA 2H61A 1SKTA 2LUCA 4DS7A 3PALA 2MRDA 2LC5A 1J1EA 1KSMA 4NQGA 2LP2A 3EK4A 4ZCVA 3OHMB 5F6TA 2I7AA 1PRWA 4PHJA 3O78A 2JTZA 1F8HA 4N1GA 1IWQA 1SYMA 2KFFA 3SJSA 1MQ1A 2JXLA 5JOLA 2HQWA 2KQYA 4ORAB 1WRZA 1FF1A 1MR8A 2JQ6A 2F2PA 3GK4X 1EH2A 2SCPA 3CR2A 4YGBB 3DF0A 3F45A 1YRTB 2I2RE 1LVCD 1A29A 3LLEA 4MN0A 4OKHA 1DVIA 1LKJA 2MLFC 1TCOB 1SR6C 3DVKA 5FYXA 2NCOA 3BUNB 3VROA 1M45A 1QLSA 5I8NA 3WHUB 2LCPA 2LE9B 4YI9A 4I5NB 3SG7A 4MLWA 2L4IA 1G33A 4AOMA 1UHHA 1K8UA 2K2AA 5HKWA 2ZRTA 2HF5A 2I18A 1S6JA 1QVIY 3BOWB 3WHTB 2DOQA 1OOJA 2LAPA 1RK9A 2ZNDA 1F4OA 2BL0B 4QJ4B 3PM8A 1BR4B 2LHIA 1MUXA 4P2YB 4WQ2A 3OP0A 4ETOA 2FOTA 3TS5C 1R2UA 1B4CA 1NP8A 4JPZB 4PE1A 1DF0B 1QIWA 1CFDA 1CLLA 1DJIA 1EG4A 2PALA 1IJ6A 3E3RA 1BU3A 3DVJA 1KQMB 2CCMA 1NX1A 3HX4A 1UUSA 5AERA 2K2FA 3BQ3A 2KOTA 4GBAA 1BG1A 1QVIZ 5D69A 1PSRA 2Q4UA 4ORCB 2OTGC 1EG3A 1LXFC 1FBVA 1JF2A 1SK6D 2P6BB 3EVVA 4GFTA 2WOSA 3NSIA 4XJKB 3CZTX 2LANA 2KHNA 1CFPA 3PN7B 1KK7Y 1WDCB 2H2KA 1SNLA 2G2BA 1KFUS 1M31A 3BXKA 1YUSA 4QJ3B 4I5LB 1PVBA 1SW8A 2WNDA 3I5HB 3OB2B 3D0YB 2AUCA 1EJ3A 1OZSA 2IS9A 1WRKA 4CFRA 2M0RA 1KK8B 4YGEB 1KFXS 3DVMA 1SBJA 1RTP1 3FS7A 1DJYA 1M39A 2HQ8A 2MHHA 2NLNA 1CKKA 1L2OB 1Q80A 2EGDA 2KFGA 1QV0A 1IQ5A 4YGDB 2LVJA 1JFJA 4A4CA 2NCPA 5K89A 3OB1B 1KK7Z 3BUXB 3EVRA 2K7CA 3I5GC 1KSOA 1G8IA 2L98A 4FTGA 1F54A 1F71A 2F3ZA 2EC6B 1OQPA 1M46A 2CNPA 4WRIA 5AFPA 3AAKA 1A75B 4ICBA 2LHLA 3TZ1A 5DKNA 2CBLA 2LMTA 1DJHA 1PULA 2WORA 1SCMC 4PHNA 4DIRA 3VGOA 3PSRA 1XFVO 2K61A 1XK4C 1SL8A 1AVSA 1XO5A 5D7FA 2BCAA 4NDDA 3O2PA 1DJXA 3DVEA 4QJ5B 1BT6A 2MJWB 2Q91A 3WXAA 1TNQA 3GK2A 2JNXA 2JNFA 1J7PA 3NSOA 3LL8B 3QRXA 3FWBA 1RECA 4GGFA 1IKUA 2M29A 1QX7A 1OMRA 2KI6D 1RROA 4MSPA 5CSNA 3EK7A 5AXIA 1JWDA 1OSAA 1LA3A 1K2HA 2LNKA 1UHKA 4PHKA 3SIAA 1C7WA 1K9UA 1YURA 2M1KB 4IL1A 1OMVA 3I5FB 3O6BA 5HYDA 2FJUB 3BUMB 2KNEA 1C07A 2K7DA 4I5JA 3NXAA 1NCXA 1YRUB 1W7JB 2AAOA 4HRGA 1FI5A 2ZNEA 3C1VA 2OPOA 3TUYB 3GK1A 3BUWB 1B8CA 1KWOB 2MAZA 1MXEA 1J55A 1GJYA 4MZJA 3EK8A 1LA0A 1S1EA 1QTXA 1EXRA 4A4BA 2BECA 1OMDA 4N1FA 5HLOA 4R1EA 2E30A 2ZKMX 4USLA 4ZCUA 1QIVA 1U5IB 1B47A 4OCIA 4PE7A 1IGVA 1SMGA 3LK1A 3H4SE 5AEQA 1PSBA 5AANA 1S6CA 2KDHA 3KF9A 1RFJA 1YTZC 4L9MA 4D1EA 4PCWA 1TTXA 1XK4A 1DJGA 2LVKA 1WLZA 3DD4A 1J1DA 1MWNA 4C0LA 5B8IB 1EL4A 1XVJA 2MLEC 1FPWA 2BL0C 4FQOA 2G9BA 2KSPA 2V53A 2QPTA 4NDBA 1NCYA 3JTDB 1DGVA 1NX0A 2F8PA 2KI6C 3JVTB 3KO0A 4N5XA 2M7NA 2JZIA 1A2XA 5CSJA 2BCXA 2L4HA 1SL9A 3IQOA 4OVNF 5CPVA 2M9GA 2KAXA 2KGRA 2LUXA 5ER4X 2JT8A 1D1OA 2Y4QA 2BKIB 1AJ5A 2OS8B 2ISDA 4GPLB 2LM5A 2E6WA 5HKZA 3PLFB 1KQMC 1PVAA 3TS5B 1BMOA 2KYFA 1FI6A 1FW4A 2PASA 4PDZA 2GV5A 1ZACA 4JWQA 2ZRSA 1BR1B 2KBMA 2M8UA 1DMOA 2GGZA 2GGMA 1G4YR 1L7ZA 1TOPA 2NXQA 1UWOA 2K8MB 3CR5X 3OX5A 4JQ0D 1AHRA 1CLMA 4M2PA 5DKRA 3AKAA 4Q04A 1K95A 2L0PA 1RWYA 3RLZA 2RGIA 2M7LA 4DUQA 3FWCA 4TNCA 1ALVA 1W7IB 3OX6A 5J3XA 1PALA 3K21A 4CPVA 4F0ZB 3HCMA 1SY9A 3AKBA 4P5OE 1J7QA 1CB1A 1V1GA 2KI4B 1K94A 1QX5B 2L5XB 1E8AA 2EHBA 1Y1AA 3BOWA 3I5IB 2LVIA 1N2DA 2ZN9A 2MBXA 1YUTA 4C0KA 1DTLA 4MBEA 2BE6A 2F2OA 2QACA 1GGZA 4MVFA 1L2OC 1BJFA 1HQVA 1YUUA 5DKQA 1V1FA 2KBIA 1J7RA 4HRHA 4MRXA 1JBAA 3D10A 3DF0B 3IF7A 1TNXA 2PMYA 3VRNA 5I2QA 1MF8B 3SG2A 1Y1UA 3VRQA 1Y1XA 2EC6C 3EKJA 1PK0D 5IBWA 1B8LA 1ODBA 1CFFA 1CNPA 1QS7A 4MZLA 3PFVA 4CFQA 2LLTA 2Y1MA 1NX3A 1XFUO 4BY5A 2PVBA 1B7TY 1WRLA 1XFXO 1ZUZA 3I5GB 2JPTA 4GGNA 1N0YA 5KU1A 1QATA 2L2EA 2FCDA 2A4JA 2PSRA 4DRWA 1DT7B 1AP4A 1NUBA 4PHMA 1ZFSA 4BY4A 1Y6WA 1CDMA 2WCFA 1OZOA 2K0JA 4GUKA 3CLNA 3BUOB 5HLVA 1OE9B 4OR9B 5TNCA 4M2QA 5I2OA 5JJGA 1SPYA 1F4QA 3D0YA 1ZMZA 2M1UA 3AAJA 3EVUA 1CMFA 3I5FC 1HT9A 5BPJA 1R6PA 4GNKB 1MXLC 1YX8A 3M0WA 2ZFDA 1B7TZ 1JSAA 1JF0A 4AQIA 5G08A 2D8NA 2KAVA 2L51A 2SASA 1VRKA 2WCBA 3CS1A 2JXCA 2KFHA 3FIAA 3TUYC 2FCEA 2BBMA 2K7OA 1KWOC 4MEWA 4I5KA 2Y5IA 2LLSA 3CR4X 3ZWHA 1AK8A 1YVLA 1CLBA 2KQ6A 1MHOA 1BF5A 3LCPC 1M63B 2LVVA 1SR6B 2MA2A 1A75A 1TNWA 1WLMA 2JTTA 2JWWA 4YGAA 1NSHA 2M49B 1XYDA 2Y1NA 4ORBB 2JULA 4PE0A 3O4YA 1BODA 2O60A 1QJTA 1S3PA 1QASA 1TNPA 4E68A 3A8RA 1S26D 2WC8A 1NYAA 1DJZA 1CM4A 5CSIA 1DGUA 4UPGA 5ER5A 2LMUA 1QXPA 1NCZA 1SL7A 2F3YA 3KEVA 1QX2A 1CDPA 2BKHB 2LP3A 2CT9A 2LMVA 4AQJA 3JTDC 2KYCA 2TN4A 3JVTC 3TDUA 4PALA 1CM1A 2BCBA 5I2LA 4NDCA 1GQMA 2JRFA 3LK0A 2HETA 4MRYA 1AUIB 1B8RA 2CTNA 1TN4A 4CLNA 3SG3A 5HKYA 1A03A 1J7OA 3BYAA 4XYNA 4HREE 1XA5A 2OS8C 3MSEB 3TDIA 3WNXB 3CGAA 2JOJA 3EKHA
chains in the Genus database with same CATH superfamily
1K9PA 4CIDA 1NX2A 2JC2A 1CFCA 2M3WA 1IQ3A 1C7VA 2COLB 2PRUA 3A4UB 3IQQA 4HSZA 5DICA 4C0JA 4YRUA 2I94A 3CZ2A 3ICBA 1CTRA 1K96A 4INXA 3VRRA 1S36A 1GGWA 1S6IA 3PN7C 1WDCC 1XFWO 1IG5A 1S5GY 1YX7A 2K7BA 1NPQA 1XFYO 5KSZA 4MZKA 1DJWA 2LV7A 4PT1A 2OTGB 1WY9A 2ZN8A 3CWGA 2JT0A 3I5HC 2NZ0A 1U5IA 2WCEA 3KPXA 4OV2A 4WQ3A 1UHNA 2H61C 4YGCB 2KAYA 2M97A 4U8DA 1TIZA 1ALWA 2VRGA 2CXJA 2KI4C 3OGNA 1QLKA 2O5GA 1KK8C 2JU0A 3SS4A 1UHIA 1CMGA 1OW4A 1YR5A 3FE9A 3I5IC 2BAPA 3R1PA 4GGFC 2L50A 1KFUL 1JC2A 1SRAA 2B1UA 1XFZO 3KHEA 3NSKA 1F70A 1Y0VH 3TDZA 4YI8A 1NWDA 4GAOA 2BBNA 1H8BA 3SIBA 3DXLA 1DF0A 3DYEA 5KTYA 1NIWA 3CDNA 3SG6A 1UHJA 2BE4A 1S5GZ 2JT3A 4M2OA 1IRJA 2AMIA 1H4BA 1ZOTB 1B1GA 3SG5A 2KGBC 1KFXL 1KQVA 3PATA 1X02A 1CDLA 1TRFA 2R2IA 2F33A 1BOCA 1JFKA 4DCKA 1UP5A 4PE4A 5PALA 1IH0A 5GQQC 1UURA 1C3YA 4F7FA 1LINA 1SSEB 3S0FA 1A4PA 1N65A 1TCFA 4XJKA 3VRPA 1ORGA 1YVHA 1F55A 1QV1A 1BLQA 1JUOA 1SCMB 3SG4A 3CTNA 1P28A 3RM1A 4YBHB 1KCYA 1AJ4A 1K93D 1K90D 3ZNIA 5CSFA 1CDNA 1RJVA 1K9KA 2H8VA 1B9AA 3GOFA 3NSLA 2HPSA 1IJ5A 2LLUA 1SCVA 2H61A 1SKTA 2LUCA 3CABA 4DS7A 3PALA 2MRDA 2WCLA 2LC5A 1J1EA 3V2LA 1KSMA 4NQGA 2LP2A 3EK4A 4ZCVA 3OHMB 5F6TA 2I7AA 1PRWA 4PHJA 3O78A 2JTZA 1F8HA 4N1GA 1IWQA 1SYMA 2KFFA 3SJSA 1MQ1A 2JXLA 5JOLA 2KPHA 2HQWA 2KQYA 4ORAB 1WRZA 1FF1A 1MR8A 2JQ6A 2F2PA 3GK4X 1EH2A 2SCPA 3CR2A 4YGBB 3DF0A 3F45A 1YRTB 2I2RE 1LVCD 1A29A 3LLEA 4MN0A 4OKHA 1DVIA 1LKJA 2MLFC 1TCOB 3FE6A 1SR6C 3BFBA 3DVKA 5FYXA 2NCOA 1Z4HA 3BFAA 3BUNB 3VROA 1LS8A 1M45A 1QLSA 2YGUA 3WHUB 5I8NA 2WC5A 2LCPA 2LE9B 4YI9A 4I5NB 3SG7A 4MLWA 2L4IA 1G33A 3D77A 4AOMA 1UHHA 1K8UA 2K2AA 3NHIA 3OBVA 5HKWA 2ZRTA 2HF5A 2I18A 1S6JA 1QWVA 2PQLA 2FJYA 1QVIY 3BOWB 3WHTB 2DOQA 1OOJA 2LAPA 1RK9A 2ZNDA 1F4OA 2BL0B 4QJ4B 3PM8A 1BR4B 2LHIA 1MUXA 4P2YB 4WQ2A 3OP0A 4ETOA 2FOTA 3TS5C 1R2UA 1B4CA 1NP8A 4JPZB 4PE1A 1DF0B 1QIWA 1CFDA 1CLLA 1DJIA 1EG4A 2PALA 1IJ6A 3E3RA 1BU3A 3DVJA 1KQMB 2CCMA 1NX1A 3BFHA 3HX4A 1UUSA 5AERA 2K2FA 3BQ3A 2KOTA 2QEBA 4GBAA 1BG1A 1QVIZ 5D69A 1PSRA 2Q4UA 4ORCB 5FI2A 2OTGC 1EG3A 1LXFC 1FBVA 1JF2A 1SK6D 2P6BB 3EVVA 4GFTA 2WOSA 3NSIA 4XJKB 3CZTX 2LANA 2KHNA 3PJIA 3IVTA 1CFPA 3PN7B 1KK7Y 1WDCB 2H2KA 1SNLA 2GTEA 2G2BA 1KFUS 1M31A 3BXKA 3S0GA 1YUSA 4QJ3B 3S0BA 4I5LB 1PVBA 1SW8A 1Z2CB 2WNDA 1DEKA 3I5HB 3D0YB 3OB2B 1IIOA 2AUCA 1EJ3A 1OZSA 2IS9A 1WRKA 4CFRA 2M0RA 1KK8B 4YGEB 1KFXS 3DVMA 3DY9A 1SBJA 1RTP1 3FS7A 1DJYA 1M39A 2HQ8A 2MHHA 2NLNA 1CKKA 1L2OB 1Q80A 2EGDA 2KFGA 1QV0A 1IQ5A 4YGDB 2LVJA 1JFJA 4A4CA 2KLDA 2NCPA 5K89A 3OB1B 2ERBA 1KK7Z 3BUXB 3EVRA 2K7CA 3L47A 3I5GC 1KSOA 1G8IA 2L98A 4FTGA 1F54A 1F71A 2F3ZA 2EC6B 1OQPA 1M46A 2CNPA 4WRIA 5AFPA 3AAKA 1A75B 4ICBA 2LHLA 3TZ1A 5DKNA 3CZ0A 2CBLA 3PM2A 2LMTA 1DJHA 1PULA 2WORA 1SCMC 4PHNA 4DIRA 3VGOA 3PSRA 1XFVO 2K61A 3B7AA 1XK4C 1SL8A 1AVSA 3S0AA 1XO5A 5D7FA 3S0DA 2BCAA 4NDDA 3O2PA 1DJXA 3DVEA 4QJ5B 1BT6A 2MJWB 2Q91A 3WXAA 2WCJA 1TNQA 4IJ7A 3GK2A 2JNXA 2JNFA 2P71A 1J7PA 3NSOA 3LL8B 3L4LA 2L5YA 3QRXA 3FWBA 1RECA 4GGFA 3DZTA 1IKUA 2M29A 1QX7A 1OMRA 2KI6D 3B86A 1RROA 4MSPA 5CSNA 3EK7A 5AXIA 1JWDA 2WCHA 1OSAA 1LA3A 1K2HA 2LNKA 1UHKA 4PHKA 3SIAA 1C7WA 1K9UA 1YURA 2M1KB 4IL1A 1OMVA 3I5FB 1OOIX 3O6BA 5HYDA 2FJUB 5D3OA 3B87A 3BUMB 2KNEA 1C07A 2K7DA 4I5JA 3NXAA 3D75A 1NCXA 1YRUB 2KLEA 1W7JB 2AAOA 3EG5B 3D78A 4HRGA 1FI5A 2ZNEA 3C1VA 2OPOA 3TUYB 3GK1A 3BUWB 1B8CA 1KWOB 2MAZA 1MXEA 1J55A 1GJYA 4MZJA 3EK8A 1OOFA 1LA0A 1S1EA 3UO9A 1QTXA 1EXRA 4A4BA 2BECA 1OMDA 4N1FA 5HLOA 4R1EA 2E30A 2ZKMX 3O4XA 4USLA 1TWOA 4ZCUA 1QIVA 1U5IB 1B47A 4OCIA 4PE7A 1IGVA 1SMGA 3LK1A 3H4SE 5AEQA 1PSBA 5AANA 1S6CA 2KDHA 3KF9A 5FI6A 1RFJA 1YTZC 4L9MA 3CZ1A 3FE8A 4D1EA 4PCWA 1TTXA 1XK4A 1DJGA 2LVKA 1WLZA 3DD4A 1J1DA 1MWNA 4C0LA 5B8IB 1EL4A 1XVJA 2MLEC 1FPWA 2BL0C 4FQOA 2G9BA 2KSPA 2V53A 2QPTA 2K60A 4NDBA 1NCYA 3JTDB 1DGVA 1NX0A 2F8PA 2KI6C 3JVTB 3KO0A 4N5XA 2M7NA 2JZIA 1A2XA 5CSJA 2BCXA 2L4HA 5EL2A 1SL9A 3IQOA 4OVNF 5CPVA 2M9GA 2KAXA 2KGRA 2LUXA 5ER4X 2JT8A 1D1OA 2Y4QA 2BKIB 1AJ5A 2OS8B 2ISDA 4GPLB 2LM5A 2E6WA 5HKZA 3PLFB 1KQMC 2QDIA 1PVAA 3TS5B 1BMOA 2KYFA 1FI6A 1FW4A 2PASA 2PYQA 4PDZA 2GV5A 1ZACA 4JWQA 3SS3A 1TUJA 2ZRSA 2JPOA 1BR1B 2KBMA 2M8UA 1DMOA 2GGZA 2GGMA 4OZDA 1G4YR 1L7ZA 1TOPA 2NXQA 1UWOA 2K8MB 3CR5X 3OX5A 4JQ0D 1AHRA 1CLMA 4M2PA 5DKRA 2QEVA 1GM0A 3AKAA 4Q04A 1K95A 2L0PA 1RWYA 3RLZA 2RGIA 2M7LA 4DUQA 3FWCA 4TNCA 2BNXA 1ALVA 1W7IB 1OOHA 3OX6A 5J3XA 1PALA 3K21A 4CPVA 4F0ZB 3HCMA 1DELA 1SY9A 3AKBA 4P5OE 1J7QA 4JD9A 1V1GA 2KI4B 1CB1A 1K94A 1QX5B 2WCMA 2L5XB 1E8AA 2EHBA 1Y1AA 3BOWA 3I5IB 3R1OA 2LVIA 1N2DA 2ZN9A 2MBXA 1YUTA 4C0KA 1DTLA 4MBEA 2BE6A 2F2OA 3BJHA 2QACA 1GGZA 2L2CA 4MVFA 1L2OC 1BJFA 1HQVA 1YUUA 4INWA 1V1FA 2KBIA 1J7RA 5DKQA 2WCKA 4HRHA 4MRXA 1JBAA 3D10A 3DF0B 3IF7A 1TNXA 2PMYA 3VRNA 5I2QA 1MF8B 3SG2A 1Y1UA 3UNWA 3VRQA 1Y1XA 2EC6C 3EKJA 3CYZA 1PK0D 5IBWA 1B8LA 3SS5A 1ODBA 1CFFA 1CNPA 1QS7A 4MZLA 3NGVA 3PFVA 4CFQA 2LLTA 2Y1MA 5FI7A 1NX3A 1XFUO 4BY5A 3N7HA 2PVBA 1B7TY 1WRLA 3B88A 1XFXO 1ZUZA 2QEOA 3I5GB 3NHTA 2JPTA 4GGNA 1N0YA 3S0EA 5KU1A 1QATA 2L2EA 3D76A 2FCDA 2A4JA 2PSRA 4DRWA 1DT7B 1AP4A 1NUBA 4PHMA 1ZFSA 4BY4A 1Y6WA 1CDMA 2QEHA 1XFRA 1OZOA 2WCFA 2K0JA 4GUKA 3CLNA 3BUOB 5HLVA 1OE9B 1C3ZA 4OR9B 5TNCA 4M2QA 5I2OA 5JJGA 1SPYA 1F4QA 3D0YA 1ZMZA 2M1UA 3AAJA 3EVUA 1CMFA 3I5FC 3B6XA 1HT9A 2WC6A 5BPJA 1R6PA 4GNKB 1MXLC 1YX8A 3M0WA 2ZFDA 1B7TZ 1JSAA 1JF0A 4AQIA 5G08A 2D8NA 2KAVA 2L51A 2SASA 1VRKA 2WCBA 3CS1A 2JXCA 2KFHA 3FIAA 5HL1A 3TUYC 1W9ZA 2BBMA 2FCEA 3K1EA 2K7OA 1KWOC 4MEWA 4I5KA 2Y5IA 2LLSA 3CR4X 3ZWHA 1AK8A 1YVLA 1DC1A 1CLBA 2KQ6A 1MHOA 1BF5A 3LCPC 1M63B 2LVVA 1SR6B 3R1VA 2MA2A 1A75A 1TNWA 1WLMA 2JTTA 2JWWA 3VB1A 4YGAA 1NSHA 1T14A 2M49B 1XYDA 2Y1NA 4ORBB 1DQEA 2JULA 4PE0A 3O4YA 1BODA 2O60A 1QJTA 4JKTA 5I94A 1S3PA 1QASA 3L4AA 1TNPA 3D74A 3A8RA 1S26D 4FQTA 2WC8A 4E68A 1NYAA 1DJZA 1CM4A 5CSIA 1DGUA 4UPGA 5ER5A 2LMUA 3Q8IA 1QXPA 1NCZA 1SL7A 2F3YA 3KEVA 1QX2A 1CDPA 2BKHB 2LP3A 2CT9A 2P70A 2LMVA 4AQJA 3D73A 2KYCA 3JTDC 3QMEA 2TN4A 3JVTC 3R72A 4KYNA 1CM1A 2BCBA 4PALA 4NDCA 1GQMA 5I2LA 3TDUA 1OOGA 2JRFA 3LK0A 2HETA 4MRYA 3RZSA 1AUIB 1B8RA 2CTNA 1TN4A 4CLNA 3SG3A 5HKYA 1A03A 1J7OA 3BYAA 4XYNA 1TUZA 4HREE 1XA5A 2OS8C 3MSEB 3TDIA 3WNXB 3CGAA 2JOJA 3EKHA
chains in the Genus database with same CATH topology
1K9PA 4CIDA 1NX2A 2JC2A 1CFCA 2M3WA 1IQ3A 1C7VA 2COLB 2PRUA 3A4UB 3IQQA 4HSZA 4C0JA 4YRUA 2I94A 3ICBA 1CTRA 1K96A 3VRRA 1GGWA 1S36A 1S6IA 3PN7C 1WDCC 1XFWO 1IG5A 1S5GY 1YX7A 2K7BA 1NPQA 1XFYO 5KSZA 4MZKA 1DJWA 2LV7A 2OTGB 1WY9A 2ZN8A 3CWGA 2JT0A 3I5HC 2NZ0A 1U5IA 2WCEA 3KPXA 4OV2A 4WQ3A 1UHNA 2H61C 4YGCB 2KAYA 2M97A 4U8DA 1TIZA 1ALWA 2VRGA 2CXJA 2KI4C 1QLKA 2O5GA 1KK8C 2JU0A 1UHIA 1CMGA 1YR5A 3I5IC 4GGFC 2L50A 1KFUL 1JC2A 1SRAA 2B1UA 1XFZO 3KHEA 3NSKA 1F70A 1Y0VH 3TDZA 4YI8A 1NWDA 4GAOA 2BBNA 1H8BA 3SIBA 1DF0A 5KTYA 1NIWA 3SG6A 1UHJA 2BE4A 1S5GZ 2JT3A 4M2OA 1IRJA 2AMIA 1H4BA 1ZOTB 1B1GA 3SG5A 2KGBC 1KFXL 1KQVA 3PATA 1X02A 1CDLA 1TRFA 2R2IA 2F33A 1BOCA 1JFKA 4DCKA 1UP5A 4PE4A 5PALA 1IH0A 5GQQC 1UURA 1LINA 1A4PA 1N65A 1TCFA 4XJKA 3VRPA 1YVHA 1F55A 1QV1A 1BLQA 1JUOA 1SCMB 3SG4A 3CTNA 3RM1A 4YBHB 1KCYA 1AJ4A 1K93D 1K90D 3ZNIA 5CSFA 1CDNA 1RJVA 1K9KA 1B9AA 3GOFA 3NSLA 2HPSA 1IJ5A 2LLUA 1SCVA 2H61A 1SKTA 2LUCA 4DS7A 3PALA 2MRDA 2LC5A 1J1EA 1KSMA 4NQGA 2LP2A 3EK4A 4ZCVA 3OHMB 5F6TA 2I7AA 1PRWA 4PHJA 3O78A 2JTZA 1F8HA 4N1GA 1IWQA 1SYMA 2KFFA 3SJSA 1MQ1A 2JXLA 5JOLA 2HQWA 2KQYA 4ORAB 1WRZA 1FF1A 1MR8A 2JQ6A 2F2PA 3GK4X 1EH2A 2SCPA 3CR2A 4YGBB 3DF0A 3F45A 1YRTB 2I2RE 1LVCD 1A29A 3LLEA 4MN0A 4OKHA 1DVIA 1LKJA 2MLFC 1TCOB 1SR6C 3DVKA 5FYXA 2NCOA 3BUNB 3VROA 1M45A 1QLSA 5I8NA 3WHUB 2LCPA 2LE9B 4YI9A 4I5NB 3SG7A 4MLWA 2L4IA 1G33A 4AOMA 1UHHA 1K8UA 2K2AA 5HKWA 2ZRTA 2HF5A 2I18A 1S6JA 1QVIY 3BOWB 3WHTB 2DOQA 1OOJA 2LAPA 1RK9A 2ZNDA 1F4OA 2BL0B 4QJ4B 3PM8A 1BR4B 2LHIA 1MUXA 4P2YB 4WQ2A 3OP0A 4ETOA 2FOTA 3TS5C 1R2UA 1B4CA 1NP8A 4JPZB 4PE1A 1DF0B 1QIWA 1CFDA 1CLLA 1DJIA 1EG4A 2PALA 1IJ6A 3E3RA 1BU3A 3DVJA 1KQMB 2CCMA 1NX1A 3HX4A 1UUSA 5AERA 2K2FA 3BQ3A 2KOTA 4GBAA 1BG1A 1QVIZ 5D69A 1PSRA 2Q4UA 4ORCB 2OTGC 1EG3A 1LXFC 1FBVA 1JF2A 1SK6D 2P6BB 3EVVA 4GFTA 2WOSA 3NSIA 4XJKB 3CZTX 2LANA 2KHNA 1CFPA 3PN7B 1KK7Y 1WDCB 2H2KA 1SNLA 2G2BA 1KFUS 1M31A 3BXKA 1YUSA 4QJ3B 4I5LB 1PVBA 1SW8A 2WNDA 3I5HB 3OB2B 3D0YB 2AUCA 1EJ3A 1OZSA 2IS9A 1WRKA 4CFRA 2M0RA 1KK8B 4YGEB 1KFXS 3DVMA 1SBJA 1RTP1 3FS7A 1DJYA 1M39A 2HQ8A 2MHHA 2NLNA 1CKKA 1L2OB 1Q80A 2EGDA 2KFGA 1QV0A 1IQ5A 4YGDB 2LVJA 1JFJA 4A4CA 2NCPA 5K89A 3OB1B 1KK7Z 3BUXB 3EVRA 2K7CA 3I5GC 1KSOA 1G8IA 2L98A 4FTGA 1F54A 1F71A 2F3ZA 2EC6B 1OQPA 1M46A 2CNPA 4WRIA 5AFPA 3AAKA 1A75B 4ICBA 2LHLA 3TZ1A 5DKNA 2CBLA 2LMTA 1DJHA 1PULA 2WORA 1SCMC 4PHNA 4DIRA 3VGOA 3PSRA 1XFVO 2K61A 1XK4C 1SL8A 1AVSA 1XO5A 5D7FA 2BCAA 4NDDA 3O2PA 1DJXA 3DVEA 4QJ5B 1BT6A 2MJWB 2Q91A 3WXAA 1TNQA 3GK2A 2JNXA 2JNFA 1J7PA 3NSOA 3LL8B 3QRXA 3FWBA 1RECA 4GGFA 1IKUA 2M29A 1QX7A 1OMRA 2KI6D 1RROA 4MSPA 5CSNA 3EK7A 5AXIA 1JWDA 1OSAA 1LA3A 1K2HA 2LNKA 1UHKA 4PHKA 3SIAA 1C7WA 1K9UA 1YURA 2M1KB 4IL1A 1OMVA 3I5FB 3O6BA 5HYDA 2FJUB 3BUMB 2KNEA 1C07A 2K7DA 4I5JA 3NXAA 1NCXA 1YRUB 1W7JB 2AAOA 4HRGA 1FI5A 2ZNEA 3C1VA 2OPOA 3TUYB 3GK1A 3BUWB 1B8CA 1KWOB 2MAZA 1MXEA 1J55A 1GJYA 4MZJA 3EK8A 1LA0A 1S1EA 1QTXA 1EXRA 4A4BA 2BECA 1OMDA 4N1FA 5HLOA 4R1EA 2E30A 2ZKMX 4USLA 4ZCUA 1QIVA 1U5IB 1B47A 4OCIA 4PE7A 1IGVA 1SMGA 3LK1A 3H4SE 5AEQA 1PSBA 5AANA 1S6CA 2KDHA 3KF9A 1RFJA 1YTZC 4L9MA 4D1EA 4PCWA 1TTXA 1XK4A 1DJGA 2LVKA 1WLZA 3DD4A 1J1DA 1MWNA 4C0LA 5B8IB 1EL4A 1XVJA 2MLEC 1FPWA 2BL0C 4FQOA 2G9BA 2KSPA 2V53A 2QPTA 4NDBA 1NCYA 3JTDB 1DGVA 1NX0A 2F8PA 2KI6C 3JVTB 3KO0A 4N5XA 2M7NA 2JZIA 1A2XA 5CSJA 2BCXA 2L4HA 1SL9A 3IQOA 4OVNF 5CPVA 2M9GA 2KAXA 2KGRA 2LUXA 5ER4X 2JT8A 1D1OA 2Y4QA 2BKIB 1AJ5A 2OS8B 2ISDA 4GPLB 2LM5A 2E6WA 5HKZA 3PLFB 1KQMC 1PVAA 3TS5B 1BMOA 2KYFA 1FI6A 1FW4A 2PASA 4PDZA 2GV5A 1ZACA 4JWQA 2ZRSA 1BR1B 2KBMA 2M8UA 1DMOA 2GGZA 2GGMA 1G4YR 1L7ZA 1TOPA 2NXQA 1UWOA 2K8MB 3CR5X 3OX5A 4JQ0D 1AHRA 1CLMA 4M2PA 5DKRA 3AKAA 4Q04A 1K95A 2L0PA 1RWYA 3RLZA 2RGIA 2M7LA 4DUQA 3FWCA 4TNCA 1ALVA 1W7IB 3OX6A 5J3XA 1PALA 3K21A 4CPVA 4F0ZB 3HCMA 1SY9A 3AKBA 4P5OE 1J7QA 1CB1A 1V1GA 2KI4B 1K94A 1QX5B 2L5XB 1E8AA 2EHBA 1Y1AA 3BOWA 3I5IB 2LVIA 1N2DA 2ZN9A 2MBXA 1YUTA 4C0KA 1DTLA 4MBEA 2BE6A 2F2OA 2QACA 1GGZA 4MVFA 1L2OC 1BJFA 1HQVA 1YUUA 5DKQA 1V1FA 2KBIA 1J7RA 4HRHA 4MRXA 1JBAA 3D10A 3DF0B 3IF7A 1TNXA 2PMYA 3VRNA 5I2QA 1MF8B 3SG2A 1Y1UA 3VRQA 1Y1XA 2EC6C 3EKJA 1PK0D 5IBWA 1B8LA 1ODBA 1CFFA 1CNPA 1QS7A 4MZLA 3PFVA 4CFQA 2LLTA 2Y1MA 1NX3A 1XFUO 4BY5A 2PVBA 1B7TY 1WRLA 1XFXO 1ZUZA 3I5GB 2JPTA 4GGNA 1N0YA 5KU1A 1QATA 2L2EA 2FCDA 2A4JA 2PSRA 4DRWA 1DT7B 1AP4A 1NUBA 4PHMA 1ZFSA 4BY4A 1Y6WA 1CDMA 2WCFA 1OZOA 2K0JA 4GUKA 3CLNA 3BUOB 5HLVA 1OE9B 4OR9B 5TNCA 4M2QA 5I2OA 5JJGA 1SPYA 1F4QA 3D0YA 1ZMZA 2M1UA 3AAJA 3EVUA 1CMFA 3I5FC 1HT9A 5BPJA 1R6PA 4GNKB 1MXLC 1YX8A 3M0WA 2ZFDA 1B7TZ 1JSAA 1JF0A 4AQIA 5G08A 2D8NA 2KAVA 2L51A 2SASA 1VRKA 2WCBA 3CS1A 2JXCA 2KFHA 3FIAA 3TUYC 2FCEA 2BBMA 2K7OA 1KWOC 4MEWA 4I5KA 2Y5IA 2LLSA 3CR4X 3ZWHA 1AK8A 1YVLA 1CLBA 2KQ6A 1MHOA 1BF5A 3LCPC 1M63B 2LVVA 1SR6B 2MA2A 1A75A 1TNWA 1WLMA 2JTTA 2JWWA 4YGAA 1NSHA 2M49B 1XYDA 2Y1NA 4ORBB 2JULA 4PE0A 3O4YA 1BODA 2O60A 1QJTA 1S3PA 1QASA 1TNPA 4E68A 3A8RA 1S26D 2WC8A 1NYAA 1DJZA 1CM4A 5CSIA 1DGUA 4UPGA 5ER5A 2LMUA 1QXPA 1NCZA 1SL7A 2F3YA 3KEVA 1QX2A 1CDPA 2BKHB 2LP3A 2CT9A 2LMVA 4AQJA 3JTDC 2KYCA 2TN4A 3JVTC 3TDUA 4PALA 1CM1A 2BCBA 5I2LA 4NDCA 1GQMA 2JRFA 3LK0A 2HETA 4MRYA 1AUIB 1B8RA 2CTNA 1TN4A 4CLNA 3SG3A 5HKYA 1A03A 1J7OA 3BYAA 4XYNA 4HREE 1XA5A 2OS8C 3MSEB 3TDIA 3WNXB 3CGAA 2JOJA 3EKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9P A;  4CID A;  1NX2 A;  2JC2 A;  1CFC A;  2M3W A;  1IQ3 A;  1C7V A;  2COL B;  2PRU A;  3A4U B;  3IQQ A;  4HSZ A;  4C0J A;  4YRU A;  2I94 A;  3ICB A;  1CTR A;  1K96 A;  3VRR A;  1GGW A;  1S36 A;  1S6I A;  3PN7 C;  1WDC C;  1XFW O;  1IG5 A;  1S5G Y;  1YX7 A;  2K7B A;  1NPQ A;  1XFY O;  5KSZ A;  4MZK A;  1DJW A;  2LV7 A;  2OTG B;  1WY9 A;  2ZN8 A;  3CWG A;  2JT0 A;  3I5H C;  2NZ0 A;  1U5I A;  2WCE A;  3KPX A;  4OV2 A;  4WQ3 A;  1UHN A;  2H61 C;  4YGC B;  2KAY A;  2M97 A;  4U8D A;  1TIZ A;  1ALW A;  2VRG A;  2CXJ A;  2KI4 C;  1QLK A;  2O5G A;  1KK8 C;  2JU0 A;  1UHI A;  1CMG A;  1YR5 A;  3I5I C;  4GGF C;  2L50 A;  1KFU L;  1JC2 A;  1SRA A;  2B1U A;  1XFZ O;  3KHE A;  3NSK A;  1F70 A;  1Y0V H;  3TDZ A;  4YI8 A;  1NWD A;  4GAO A;  2BBN A;  1H8B A;  3SIB A;  1DF0 A;  5KTY A;  1NIW A;  3SG6 A;  1UHJ A;  2BE4 A;  1S5G Z;  2JT3 A;  4M2O A;  1IRJ A;  2AMI A;  1H4B A;  1ZOT B;  1B1G A;  3SG5 A;  2KGB C;  1KFX L;  1KQV A;  3PAT A;  1X02 A;  1CDL A;  1TRF A;  2R2I A;  2F33 A;  1BOC A;  1JFK A;  4DCK A;  1UP5 A;  4PE4 A;  5PAL A;  1IH0 A;  5GQQ C;  1UUR A;  1LIN A;  1A4P A;  1N65 A;  1TCF A;  4XJK A;  3VRP A;  1YVH A;  1F55 A;  1QV1 A;  1BLQ A;  1JUO A;  1SCM B;  3SG4 A;  3CTN A;  3RM1 A;  4YBH B;  1KCY A;  1AJ4 A;  1K93 D;  1K90 D;  3ZNI A;  5CSF A;  1CDN A;  1RJV A;  1K9K A;  1B9A A;  3GOF A;  3NSL A;  2HPS A;  1IJ5 A;  2LLU A;  1SCV A;  2H61 A;  1SKT A;  2LUC A;  4DS7 A;  3PAL A;  2MRD A;  2LC5 A;  1J1E A;  1KSM A;  4NQG A;  2LP2 A;  3EK4 A;  4ZCV A;  3OHM B;  5F6T A;  2I7A A;  1PRW A;  4PHJ A;  3O78 A;  2JTZ A;  1F8H A;  4N1G A;  1IWQ A;  1SYM A;  2KFF A;  3SJS A;  1MQ1 A;  2JXL A;  5JOL A;  2HQW A;  2KQY A;  4ORA B;  1WRZ A;  1FF1 A;  1MR8 A;  2JQ6 A;  2F2P A;  3GK4 X;  1EH2 A;  2SCP A;  3CR2 A;  4YGB B;  3DF0 A;  3F45 A;  1YRT B;  2I2R E;  1LVC D;  1A29 A;  3LLE A;  4MN0 A;  4OKH A;  1DVI A;  1LKJ A;  2MLF C;  1TCO B;  1SR6 C;  3DVK A;  5FYX A;  2NCO A;  3BUN B;  3VRO A;  1M45 A;  1QLS A;  5I8N A;  3WHU B;  2LCP A;  2LE9 B;  4YI9 A;  4I5N B;  3SG7 A;  4MLW A;  2L4I A;  1G33 A;  4AOM A;  1UHH A;  1K8U A;  2K2A A;  5HKW A;  2ZRT A;  2HF5 A;  2I18 A;  1S6J A;  1QVI Y;  3BOW B;  3WHT B;  2DOQ A;  1OOJ A;  2LAP A;  1RK9 A;  2ZND A;  1F4O A;  2BL0 B;  4QJ4 B;  3PM8 A;  1BR4 B;  2LHI A;  1MUX A;  4P2Y B;  4WQ2 A;  3OP0 A;  4ETO A;  2FOT A;  3TS5 C;  1R2U A;  1B4C A;  1NP8 A;  4JPZ B;  4PE1 A;  1DF0 B;  1QIW A;  1CFD A;  1CLL A;  1DJI A;  1EG4 A;  2PAL A;  1IJ6 A;  3E3R A;  1BU3 A;  3DVJ A;  1KQM B;  2CCM A;  1NX1 A;  3HX4 A;  1UUS A;  5AER A;  2K2F A;  3BQ3 A;  2KOT A;  4GBA A;  1BG1 A;  1QVI Z;  5D69 A;  1PSR A;  2Q4U A;  4ORC B;  2OTG C;  1EG3 A;  1LXF C;  1FBV A;  1JF2 A;  1SK6 D;  2P6B B;  3EVV A;  4GFT A;  2WOS A;  3NSI A;  4XJK B;  3CZT X;  2LAN A;  2KHN A;  1CFP A;  3PN7 B;  1KK7 Y;  1WDC B;  2H2K A;  1SNL A;  2G2B A;  1KFU S;  1M31 A;  3BXK A;  1YUS A;  4QJ3 B;  4I5L B;  1PVB A;  1SW8 A;  2WND A;  3I5H B;  3OB2 B;  3D0Y B;  2AUC A;  1EJ3 A;  1OZS A;  2IS9 A;  1WRK A;  4CFR A;  2M0R A;  1KK8 B;  4YGE B;  1KFX S;  3DVM A;  1SBJ A;  1RTP 1;  3FS7 A;  1DJY A;  1M39 A;  2HQ8 A;  2MHH A;  2NLN A;  1CKK A;  1L2O B;  1Q80 A;  2EGD A;  2KFG A;  1QV0 A;  1IQ5 A;  4YGD B;  2LVJ A;  1JFJ A;  4A4C A;  2NCP A;  5K89 A;  3OB1 B;  1KK7 Z;  3BUX B;  3EVR A;  2K7C A;  3I5G C;  1KSO A;  1G8I A;  2L98 A;  4FTG A;  1F54 A;  1F71 A;  2F3Z A;  2EC6 B;  1OQP A;  1M46 A;  2CNP A;  4WRI A;  5AFP A;  3AAK A;  1A75 B;  4ICB A;  2LHL A;  3TZ1 A;  5DKN A;  2CBL A;  2LMT A;  1DJH A;  1PUL A;  2WOR A;  1SCM C;  4PHN A;  4DIR A;  3VGO A;  3PSR A;  1XFV O;  2K61 A;  1XK4 C;  1SL8 A;  1AVS A;  1XO5 A;  5D7F A;  2BCA A;  4NDD A;  3O2P A;  1DJX A;  3DVE A;  4QJ5 B;  1BT6 A;  2MJW B;  2Q91 A;  3WXA A;  1TNQ A;  3GK2 A;  2JNX A;  2JNF A;  1J7P A;  3NSO A;  3LL8 B;  3QRX A;  3FWB A;  1REC A;  4GGF A;  1IKU A;  2M29 A;  1QX7 A;  1OMR A;  2KI6 D;  1RRO A;  4MSP A;  5CSN A;  3EK7 A;  5AXI A;  1JWD A;  1OSA A;  1LA3 A;  1K2H A;  2LNK A;  1UHK A;  4PHK A;  3SIA A;  1C7W A;  1K9U A;  1YUR A;  2M1K B;  4IL1 A;  1OMV A;  3I5F B;  3O6B A;  5HYD A;  2FJU B;  3BUM B;  2KNE A;  1C07 A;  2K7D A;  4I5J A;  3NXA A;  1NCX A;  1YRU B;  1W7J B;  2AAO A;  4HRG A;  1FI5 A;  2ZNE A;  3C1V A;  2OPO A;  3TUY B;  3GK1 A;  3BUW B;  1B8C A;  1KWO B;  2MAZ A;  1MXE A;  1J55 A;  1GJY A;  4MZJ A;  3EK8 A;  1LA0 A;  1S1E A;  1QTX A;  1EXR A;  4A4B A;  2BEC A;  1OMD A;  4N1F A;  5HLO A;  4R1E A;  2E30 A;  2ZKM X;  4USL A;  4ZCU A;  1QIV A;  1U5I B;  1B47 A;  4OCI A;  4PE7 A;  1IGV A;  1SMG A;  3LK1 A;  3H4S E;  5AEQ A;  1PSB A;  5AAN A;  1S6C A;  2KDH A;  3KF9 A;  1RFJ A;  1YTZ C;  4L9M A;  4D1E A;  4PCW A;  1TTX A;  1XK4 A;  1DJG A;  2LVK A;  1WLZ A;  3DD4 A;  1J1D A;  1MWN A;  4C0L A;  5B8I B;  1EL4 A;  1XVJ A;  2MLE C;  1FPW A;  2BL0 C;  4FQO A;  2G9B A;  2KSP A;  2V53 A;  2QPT A;  4NDB A;  1NCY A;  3JTD B;  1DGV A;  1NX0 A;  2F8P A;  2KI6 C;  3JVT B;  3KO0 A;  4N5X A;  2M7N A;  2JZI A;  1A2X A;  5CSJ A;  2BCX A;  2L4H A;  1SL9 A;  3IQO A;  4OVN F;  5CPV A;  2M9G A;  2KAX A;  2KGR A;  2LUX A;  5ER4 X;  2JT8 A;  1D1O A;  2Y4Q A;  2BKI B;  1AJ5 A;  2OS8 B;  2ISD A;  4GPL B;  2LM5 A;  2E6W A;  5HKZ A;  3PLF B;  1KQM C;  1PVA A;  3TS5 B;  1BMO A;  2KYF A;  1FI6 A;  1FW4 A;  2PAS A;  4PDZ A;  2GV5 A;  1ZAC A;  4JWQ A;  2ZRS A;  1BR1 B;  2KBM A;  2M8U A;  1DMO A;  2GGZ A;  2GGM A;  1G4Y R;  1L7Z A;  1TOP A;  2NXQ A;  1UWO A;  2K8M B;  3CR5 X;  3OX5 A;  4JQ0 D;  1AHR A;  1CLM A;  4M2P A;  5DKR A;  3AKA A;  4Q04 A;  1K95 A;  2L0P A;  1RWY A;  3RLZ A;  2RGI A;  2M7L A;  4DUQ A;  3FWC A;  4TNC A;  1ALV A;  1W7I B;  3OX6 A;  5J3X A;  1PAL A;  3K21 A;  4CPV A;  4F0Z B;  3HCM A;  1SY9 A;  3AKB A;  4P5O E;  1J7Q A;  1CB1 A;  1V1G A;  2KI4 B;  1K94 A;  1QX5 B;  2L5X B;  1E8A A;  2EHB A;  1Y1A A;  3BOW A;  3I5I B;  2LVI A;  1N2D A;  2ZN9 A;  2MBX A;  1YUT A;  4C0K A;  1DTL A;  4MBE A;  2BE6 A;  2F2O A;  2QAC A;  1GGZ A;  4MVF A;  1L2O C;  1BJF A;  1HQV A;  1YUU A;  5DKQ A;  1V1F A;  2KBI A;  1J7R A;  4HRH A;  4MRX A;  1JBA A;  3D10 A;  3DF0 B;  3IF7 A;  1TNX A;  2PMY A;  3VRN A;  5I2Q A;  1MF8 B;  3SG2 A;  1Y1U A;  3VRQ A;  1Y1X A;  2EC6 C;  3EKJ A;  1PK0 D;  5IBW A;  1B8L A;  1ODB A;  1CFF A;  1CNP A;  1QS7 A;  4MZL A;  3PFV A;  4CFQ A;  2LLT A;  2Y1M A;  1NX3 A;  1XFU O;  4BY5 A;  2PVB A;  1B7T Y;  1WRL A;  1XFX O;  1ZUZ A;  3I5G B;  2JPT A;  4GGN A;  1N0Y A;  5KU1 A;  1QAT A;  2L2E A;  2FCD A;  2A4J A;  2PSR A;  4DRW A;  1DT7 B;  1AP4 A;  1NUB A;  4PHM A;  1ZFS A;  4BY4 A;  1Y6W A;  1CDM A;  2WCF A;  1OZO A;  2K0J A;  4GUK A;  3CLN A;  3BUO B;  5HLV A;  1OE9 B;  4OR9 B;  5TNC A;  4M2Q A;  5I2O A;  5JJG A;  1SPY A;  1F4Q A;  3D0Y A;  1ZMZ A;  2M1U A;  3AAJ A;  3EVU A;  1CMF A;  3I5F C;  1HT9 A;  5BPJ A;  1R6P A;  4GNK B;  1MXL C;  1YX8 A;  3M0W A;  2ZFD A;  1B7T Z;  1JSA A;  1JF0 A;  4AQI A;  5G08 A;  2D8N A;  2KAV A;  2L51 A;  2SAS A;  1VRK A;  2WCB A;  3CS1 A;  2JXC A;  2KFH A;  3FIA A;  3TUY C;  2FCE A;  2BBM A;  2K7O A;  1KWO C;  4MEW A;  4I5K A;  2Y5I A;  2LLS A;  3CR4 X;  3ZWH A;  1AK8 A;  1YVL A;  1CLB A;  2KQ6 A;  1MHO A;  1BF5 A;  3LCP C;  1M63 B;  2LVV A;  1SR6 B;  2MA2 A;  1A75 A;  1TNW A;  1WLM A;  2JTT A;  2JWW A;  4YGA A;  1NSH A;  2M49 B;  1XYD A;  2Y1N A;  4ORB B;  2JUL A;  4PE0 A;  3O4Y A;  1BOD A;  2O60 A;  1QJT A;  1S3P A;  1QAS A;  1TNP A;  4E68 A;  3A8R A;  1S26 D;  2WC8 A;  1NYA A;  1DJZ A;  1CM4 A;  5CSI A;  1DGU A;  4UPG A;  5ER5 A;  2LMU A;  1QXP A;  1NCZ A;  1SL7 A;  2F3Y A;  3KEV A;  1QX2 A;  1CDP A;  2BKH B;  2LP3 A;  2CT9 A;  2LMV A;  4AQJ A;  3JTD C;  2KYC A;  2TN4 A;  3JVT C;  3TDU A;  4PAL A;  1CM1 A;  2BCB A;  5I2L A;  4NDC A;  1GQM A;  2JRF A;  3LK0 A;  2HET A;  4MRY A;  1AUI B;  1B8R A;  2CTN A;  1TN4 A;  4CLN A;  3SG3 A;  5HKY A;  1A03 A;  1J7O A;  3BYA A;  4XYN A;  4HRE E;  1XA5 A;  2OS8 C;  3MSE B;  3TDI A;  3WNX B;  3CGA A;  2JOJ A;  3EKH A; 
#chains in the Genus database with same CATH topology
 1K9P A;  4CID A;  1NX2 A;  2JC2 A;  1CFC A;  2M3W A;  1IQ3 A;  1C7V A;  2COL B;  2PRU A;  3A4U B;  3IQQ A;  4HSZ A;  5DIC A;  4C0J A;  4YRU A;  2I94 A;  3CZ2 A;  3ICB A;  1CTR A;  1K96 A;  4INX A;  3VRR A;  1S36 A;  1GGW A;  1S6I A;  3PN7 C;  1WDC C;  1XFW O;  1IG5 A;  1S5G Y;  1YX7 A;  2K7B A;  1NPQ A;  1XFY O;  5KSZ A;  4MZK A;  1DJW A;  2LV7 A;  4PT1 A;  2OTG B;  1WY9 A;  2ZN8 A;  3CWG A;  2JT0 A;  3I5H C;  2NZ0 A;  1U5I A;  2WCE A;  3KPX A;  4OV2 A;  4WQ3 A;  1UHN A;  2H61 C;  4YGC B;  2KAY A;  2M97 A;  4U8D A;  1TIZ A;  1ALW A;  2VRG A;  2CXJ A;  2KI4 C;  3OGN A;  1QLK A;  2O5G A;  1KK8 C;  2JU0 A;  3SS4 A;  1UHI A;  1CMG A;  1OW4 A;  1YR5 A;  3FE9 A;  3I5I C;  2BAP A;  3R1P A;  4GGF C;  2L50 A;  1KFU L;  1JC2 A;  1SRA A;  2B1U A;  1XFZ O;  3KHE A;  3NSK A;  1F70 A;  1Y0V H;  3TDZ A;  4YI8 A;  1NWD A;  4GAO A;  2BBN A;  1H8B A;  3SIB A;  3DXL A;  1DF0 A;  3DYE A;  5KTY A;  1NIW A;  3CDN A;  3SG6 A;  1UHJ A;  2BE4 A;  1S5G Z;  2JT3 A;  4M2O A;  1IRJ A;  2AMI A;  1H4B A;  1ZOT B;  1B1G A;  3SG5 A;  2KGB C;  1KFX L;  1KQV A;  3PAT A;  1X02 A;  1CDL A;  1TRF A;  2R2I A;  2F33 A;  1BOC A;  1JFK A;  4DCK A;  1UP5 A;  4PE4 A;  5PAL A;  1IH0 A;  5GQQ C;  1UUR A;  1C3Y A;  4F7F A;  1LIN A;  1SSE B;  3S0F A;  1A4P A;  1N65 A;  1TCF A;  4XJK A;  3VRP A;  1ORG A;  1YVH A;  1F55 A;  1QV1 A;  1BLQ A;  1JUO A;  1SCM B;  3SG4 A;  3CTN A;  1P28 A;  3RM1 A;  4YBH B;  1KCY A;  1AJ4 A;  1K93 D;  1K90 D;  3ZNI A;  5CSF A;  1CDN A;  1RJV A;  1K9K A;  2H8V A;  1B9A A;  3GOF A;  3NSL A;  2HPS A;  1IJ5 A;  2LLU A;  1SCV A;  2H61 A;  1SKT A;  2LUC A;  3CAB A;  4DS7 A;  3PAL A;  2MRD A;  2WCL A;  2LC5 A;  1J1E A;  3V2L A;  1KSM A;  4NQG A;  2LP2 A;  3EK4 A;  4ZCV A;  3OHM B;  5F6T A;  2I7A A;  1PRW A;  4PHJ A;  3O78 A;  2JTZ A;  1F8H A;  4N1G A;  1IWQ A;  1SYM A;  2KFF A;  3SJS A;  1MQ1 A;  2JXL A;  5JOL A;  2KPH A;  2HQW A;  2KQY A;  4ORA B;  1WRZ A;  1FF1 A;  1MR8 A;  2JQ6 A;  2F2P A;  3GK4 X;  1EH2 A;  2SCP A;  3CR2 A;  4YGB B;  3DF0 A;  3F45 A;  1YRT B;  2I2R E;  1LVC D;  1A29 A;  3LLE A;  4MN0 A;  4OKH A;  1DVI A;  1LKJ A;  2MLF C;  1TCO B;  3FE6 A;  1SR6 C;  3BFB A;  3DVK A;  5FYX A;  2NCO A;  1Z4H A;  3BFA A;  3BUN B;  3VRO A;  1LS8 A;  1M45 A;  1QLS A;  2YGU A;  3WHU B;  5I8N A;  2WC5 A;  2LCP A;  2LE9 B;  4YI9 A;  4I5N B;  3SG7 A;  4MLW A;  2L4I A;  1G33 A;  3D77 A;  4AOM A;  1UHH A;  1K8U A;  2K2A A;  3NHI A;  3OBV A;  5HKW A;  2ZRT A;  2HF5 A;  2I18 A;  1S6J A;  1QWV A;  2PQL A;  2FJY A;  1QVI Y;  3BOW B;  3WHT B;  2DOQ A;  1OOJ A;  2LAP A;  1RK9 A;  2ZND A;  1F4O A;  2BL0 B;  4QJ4 B;  3PM8 A;  1BR4 B;  2LHI A;  1MUX A;  4P2Y B;  4WQ2 A;  3OP0 A;  4ETO A;  2FOT A;  3TS5 C;  1R2U A;  1B4C A;  1NP8 A;  4JPZ B;  4PE1 A;  1DF0 B;  1QIW A;  1CFD A;  1CLL A;  1DJI A;  1EG4 A;  2PAL A;  1IJ6 A;  3E3R A;  1BU3 A;  3DVJ A;  1KQM B;  2CCM A;  1NX1 A;  3BFH A;  3HX4 A;  1UUS A;  5AER A;  2K2F A;  3BQ3 A;  2KOT A;  2QEB A;  4GBA A;  1BG1 A;  1QVI Z;  5D69 A;  1PSR A;  2Q4U A;  4ORC B;  5FI2 A;  2OTG C;  1EG3 A;  1LXF C;  1FBV A;  1JF2 A;  1SK6 D;  2P6B B;  3EVV A;  4GFT A;  2WOS A;  3NSI A;  4XJK B;  3CZT X;  2LAN A;  2KHN A;  3PJI A;  3IVT A;  1CFP A;  3PN7 B;  1KK7 Y;  1WDC B;  2H2K A;  1SNL A;  2GTE A;  2G2B A;  1KFU S;  1M31 A;  3BXK A;  3S0G A;  1YUS A;  4QJ3 B;  3S0B A;  4I5L B;  1PVB A;  1SW8 A;  1Z2C B;  2WND A;  1DEK A;  3I5H B;  3D0Y B;  3OB2 B;  1IIO A;  2AUC A;  1EJ3 A;  1OZS A;  2IS9 A;  1WRK A;  4CFR A;  2M0R A;  1KK8 B;  4YGE B;  1KFX S;  3DVM A;  3DY9 A;  1SBJ A;  1RTP 1;  3FS7 A;  1DJY A;  1M39 A;  2HQ8 A;  2MHH A;  2NLN A;  1CKK A;  1L2O B;  1Q80 A;  2EGD A;  2KFG A;  1QV0 A;  1IQ5 A;  4YGD B;  2LVJ A;  1JFJ A;  4A4C A;  2KLD A;  2NCP A;  5K89 A;  3OB1 B;  2ERB A;  1KK7 Z;  3BUX B;  3EVR A;  2K7C A;  3L47 A;  3I5G C;  1KSO A;  1G8I A;  2L98 A;  4FTG A;  1F54 A;  1F71 A;  2F3Z A;  2EC6 B;  1OQP A;  1M46 A;  2CNP A;  4WRI A;  5AFP A;  3AAK A;  1A75 B;  4ICB A;  2LHL A;  3TZ1 A;  5DKN A;  3CZ0 A;  2CBL A;  3PM2 A;  2LMT A;  1DJH A;  1PUL A;  2WOR A;  1SCM C;  4PHN A;  4DIR A;  3VGO A;  3PSR A;  1XFV O;  2K61 A;  3B7A A;  1XK4 C;  1SL8 A;  1AVS A;  3S0A A;  1XO5 A;  5D7F A;  3S0D A;  2BCA A;  4NDD A;  3O2P A;  1DJX A;  3DVE A;  4QJ5 B;  1BT6 A;  2MJW B;  2Q91 A;  3WXA A;  2WCJ A;  1TNQ A;  4IJ7 A;  3GK2 A;  2JNX A;  2JNF A;  2P71 A;  1J7P A;  3NSO A;  3LL8 B;  3L4L A;  2L5Y A;  3QRX A;  3FWB A;  1REC A;  4GGF A;  3DZT A;  1IKU A;  2M29 A;  1QX7 A;  1OMR A;  2KI6 D;  3B86 A;  1RRO A;  4MSP A;  5CSN A;  3EK7 A;  5AXI A;  1JWD A;  2WCH A;  1OSA A;  1LA3 A;  1K2H A;  2LNK A;  1UHK A;  4PHK A;  3SIA A;  1C7W A;  1K9U A;  1YUR A;  2M1K B;  4IL1 A;  1OMV A;  3I5F B;  1OOI X;  3O6B A;  5HYD A;  2FJU B;  5D3O A;  3B87 A;  3BUM B;  2KNE A;  1C07 A;  2K7D A;  4I5J A;  3NXA A;  3D75 A;  1NCX A;  1YRU B;  2KLE A;  1W7J B;  2AAO A;  3EG5 B;  3D78 A;  4HRG A;  1FI5 A;  2ZNE A;  3C1V A;  2OPO A;  3TUY B;  3GK1 A;  3BUW B;  1B8C A;  1KWO B;  2MAZ A;  1MXE A;  1J55 A;  1GJY A;  4MZJ A;  3EK8 A;  1OOF A;  1LA0 A;  1S1E A;  3UO9 A;  1QTX A;  1EXR A;  4A4B A;  2BEC A;  1OMD A;  4N1F A;  5HLO A;  4R1E A;  2E30 A;  2ZKM X;  3O4X A;  4USL A;  1TWO A;  4ZCU A;  1QIV A;  1U5I B;  1B47 A;  4OCI A;  4PE7 A;  1IGV A;  1SMG A;  3LK1 A;  3H4S E;  5AEQ A;  1PSB A;  5AAN A;  1S6C A;  2KDH A;  3KF9 A;  5FI6 A;  1RFJ A;  1YTZ C;  4L9M A;  3CZ1 A;  3FE8 A;  4D1E A;  4PCW A;  1TTX A;  1XK4 A;  1DJG A;  2LVK A;  1WLZ A;  3DD4 A;  1J1D A;  1MWN A;  4C0L A;  5B8I B;  1EL4 A;  1XVJ A;  2MLE C;  1FPW A;  2BL0 C;  4FQO A;  2G9B A;  2KSP A;  2V53 A;  2QPT A;  2K60 A;  4NDB A;  1NCY A;  3JTD B;  1DGV A;  1NX0 A;  2F8P A;  2KI6 C;  3JVT B;  3KO0 A;  4N5X A;  2M7N A;  2JZI A;  1A2X A;  5CSJ A;  2BCX A;  2L4H A;  5EL2 A;  1SL9 A;  3IQO A;  4OVN F;  5CPV A;  2M9G A;  2KAX A;  2KGR A;  2LUX A;  5ER4 X;  2JT8 A;  1D1O A;  2Y4Q A;  2BKI B;  1AJ5 A;  2OS8 B;  2ISD A;  4GPL B;  2LM5 A;  2E6W A;  5HKZ A;  3PLF B;  1KQM C;  2QDI A;  1PVA A;  3TS5 B;  1BMO A;  2KYF A;  1FI6 A;  1FW4 A;  2PAS A;  2PYQ A;  4PDZ A;  2GV5 A;  1ZAC A;  4JWQ A;  3SS3 A;  1TUJ A;  2ZRS A;  2JPO A;  1BR1 B;  2KBM A;  2M8U A;  1DMO A;  2GGZ A;  2GGM A;  4OZD A;  1G4Y R;  1L7Z A;  1TOP A;  2NXQ A;  1UWO A;  2K8M B;  3CR5 X;  3OX5 A;  4JQ0 D;  1AHR A;  1CLM A;  4M2P A;  5DKR A;  2QEV A;  1GM0 A;  3AKA A;  4Q04 A;  1K95 A;  2L0P A;  1RWY A;  3RLZ A;  2RGI A;  2M7L A;  4DUQ A;  3FWC A;  4TNC A;  2BNX A;  1ALV A;  1W7I B;  1OOH A;  3OX6 A;  5J3X A;  1PAL A;  3K21 A;  4CPV A;  4F0Z B;  3HCM A;  1DEL A;  1SY9 A;  3AKB A;  4P5O E;  1J7Q A;  4JD9 A;  1V1G A;  2KI4 B;  1CB1 A;  1K94 A;  1QX5 B;  2WCM A;  2L5X B;  1E8A A;  2EHB A;  1Y1A A;  3BOW A;  3I5I B;  3R1O A;  2LVI A;  1N2D A;  2ZN9 A;  2MBX A;  1YUT A;  4C0K A;  1DTL A;  4MBE A;  2BE6 A;  2F2O A;  3BJH A;  2QAC A;  1GGZ A;  2L2C A;  4MVF A;  1L2O C;  1BJF A;  1HQV A;  1YUU A;  4INW A;  1V1F A;  2KBI A;  1J7R A;  5DKQ A;  2WCK A;  4HRH A;  4MRX A;  1JBA A;  3D10 A;  3DF0 B;  3IF7 A;  1TNX A;  2PMY A;  3VRN A;  5I2Q A;  1MF8 B;  3SG2 A;  1Y1U A;  3UNW A;  3VRQ A;  1Y1X A;  2EC6 C;  3EKJ A;  3CYZ A;  1PK0 D;  5IBW A;  1B8L A;  3SS5 A;  1ODB A;  1CFF A;  1CNP A;  1QS7 A;  4MZL A;  3NGV A;  3PFV A;  4CFQ A;  2LLT A;  2Y1M A;  5FI7 A;  1NX3 A;  1XFU O;  4BY5 A;  3N7H A;  2PVB A;  1B7T Y;  1WRL A;  3B88 A;  1XFX O;  1ZUZ A;  2QEO A;  3I5G B;  3NHT A;  2JPT A;  4GGN A;  1N0Y A;  3S0E A;  5KU1 A;  1QAT A;  2L2E A;  3D76 A;  2FCD A;  2A4J A;  2PSR A;  4DRW A;  1DT7 B;  1AP4 A;  1NUB A;  4PHM A;  1ZFS A;  4BY4 A;  1Y6W A;  1CDM A;  2QEH A;  1XFR A;  1OZO A;  2WCF A;  2K0J A;  4GUK A;  3CLN A;  3BUO B;  5HLV A;  1OE9 B;  1C3Z A;  4OR9 B;  5TNC A;  4M2Q A;  5I2O A;  5JJG A;  1SPY A;  1F4Q A;  3D0Y A;  1ZMZ A;  2M1U A;  3AAJ A;  3EVU A;  1CMF A;  3I5F C;  3B6X A;  1HT9 A;  2WC6 A;  5BPJ A;  1R6P A;  4GNK B;  1MXL C;  1YX8 A;  3M0W A;  2ZFD A;  1B7T Z;  1JSA A;  1JF0 A;  4AQI A;  5G08 A;  2D8N A;  2KAV A;  2L51 A;  2SAS A;  1VRK A;  2WCB A;  3CS1 A;  2JXC A;  2KFH A;  3FIA A;  5HL1 A;  3TUY C;  1W9Z A;  2BBM A;  2FCE A;  3K1E A;  2K7O A;  1KWO C;  4MEW A;  4I5K A;  2Y5I A;  2LLS A;  3CR4 X;  3ZWH A;  1AK8 A;  1YVL A;  1DC1 A;  1CLB A;  2KQ6 A;  1MHO A;  1BF5 A;  3LCP C;  1M63 B;  2LVV A;  1SR6 B;  3R1V A;  2MA2 A;  1A75 A;  1TNW A;  1WLM A;  2JTT A;  2JWW A;  3VB1 A;  4YGA A;  1NSH A;  1T14 A;  2M49 B;  1XYD A;  2Y1N A;  4ORB B;  1DQE A;  2JUL A;  4PE0 A;  3O4Y A;  1BOD A;  2O60 A;  1QJT A;  4JKT A;  5I94 A;  1S3P A;  1QAS A;  3L4A A;  1TNP A;  3D74 A;  3A8R A;  1S26 D;  4FQT A;  2WC8 A;  4E68 A;  1NYA A;  1DJZ A;  1CM4 A;  5CSI A;  1DGU A;  4UPG A;  5ER5 A;  2LMU A;  3Q8I A;  1QXP A;  1NCZ A;  1SL7 A;  2F3Y A;  3KEV A;  1QX2 A;  1CDP A;  2BKH B;  2LP3 A;  2CT9 A;  2P70 A;  2LMV A;  4AQJ A;  3D73 A;  2KYC A;  3JTD C;  3QME A;  2TN4 A;  3JVT C;  3R72 A;  4KYN A;  1CM1 A;  2BCB A;  4PAL A;  4NDC A;  1GQM A;  5I2L A;  3TDU A;  1OOG A;  2JRF A;  3LK0 A;  2HET A;  4MRY A;  3RZS A;  1AUI B;  1B8R A;  2CTN A;  1TN4 A;  4CLN A;  3SG3 A;  5HKY A;  1A03 A;  1J7O A;  3BYA A;  4XYN A;  1TUZ A;  4HRE E;  1XA5 A;  2OS8 C;  3MSE B;  3TDI A;  3WNX B;  3CGA A;  2JOJ A;  3EKH A; 
#chains in the Genus database with same CATH homology
 1K9P A;  4CID A;  1NX2 A;  2JC2 A;  1CFC A;  2M3W A;  1IQ3 A;  1C7V A;  2COL B;  2PRU A;  3A4U B;  3IQQ A;  4HSZ A;  4C0J A;  4YRU A;  2I94 A;  3ICB A;  1CTR A;  1K96 A;  3VRR A;  1GGW A;  1S36 A;  1S6I A;  3PN7 C;  1WDC C;  1XFW O;  1IG5 A;  1S5G Y;  1YX7 A;  2K7B A;  1NPQ A;  1XFY O;  5KSZ A;  4MZK A;  1DJW A;  2LV7 A;  2OTG B;  1WY9 A;  2ZN8 A;  3CWG A;  2JT0 A;  3I5H C;  2NZ0 A;  1U5I A;  2WCE A;  3KPX A;  4OV2 A;  4WQ3 A;  1UHN A;  2H61 C;  4YGC B;  2KAY A;  2M97 A;  4U8D A;  1TIZ A;  1ALW A;  2VRG A;  2CXJ A;  2KI4 C;  1QLK A;  2O5G A;  1KK8 C;  2JU0 A;  1UHI A;  1CMG A;  1YR5 A;  3I5I C;  4GGF C;  2L50 A;  1KFU L;  1JC2 A;  1SRA A;  2B1U A;  1XFZ O;  3KHE A;  3NSK A;  1F70 A;  1Y0V H;  3TDZ A;  4YI8 A;  1NWD A;  4GAO A;  2BBN A;  1H8B A;  3SIB A;  1DF0 A;  5KTY A;  1NIW A;  3SG6 A;  1UHJ A;  2BE4 A;  1S5G Z;  2JT3 A;  4M2O A;  1IRJ A;  2AMI A;  1H4B A;  1ZOT B;  1B1G A;  3SG5 A;  2KGB C;  1KFX L;  1KQV A;  3PAT A;  1X02 A;  1CDL A;  1TRF A;  2R2I A;  2F33 A;  1BOC A;  1JFK A;  4DCK A;  1UP5 A;  4PE4 A;  5PAL A;  1IH0 A;  5GQQ C;  1UUR A;  1LIN A;  1A4P A;  1N65 A;  1TCF A;  4XJK A;  3VRP A;  1YVH A;  1F55 A;  1QV1 A;  1BLQ A;  1JUO A;  1SCM B;  3SG4 A;  3CTN A;  3RM1 A;  4YBH B;  1KCY A;  1AJ4 A;  1K93 D;  1K90 D;  3ZNI A;  5CSF A;  1CDN A;  1RJV A;  1K9K A;  1B9A A;  3GOF A;  3NSL A;  2HPS A;  1IJ5 A;  2LLU A;  1SCV A;  2H61 A;  1SKT A;  2LUC A;  4DS7 A;  3PAL A;  2MRD A;  2LC5 A;  1J1E A;  1KSM A;  4NQG A;  2LP2 A;  3EK4 A;  4ZCV A;  3OHM B;  5F6T A;  2I7A A;  1PRW A;  4PHJ A;  3O78 A;  2JTZ A;  1F8H A;  4N1G A;  1IWQ A;  1SYM A;  2KFF A;  3SJS A;  1MQ1 A;  2JXL A;  5JOL A;  2HQW A;  2KQY A;  4ORA B;  1WRZ A;  1FF1 A;  1MR8 A;  2JQ6 A;  2F2P A;  3GK4 X;  1EH2 A;  2SCP A;  3CR2 A;  4YGB B;  3DF0 A;  3F45 A;  1YRT B;  2I2R E;  1LVC D;  1A29 A;  3LLE A;  4MN0 A;  4OKH A;  1DVI A;  1LKJ A;  2MLF C;  1TCO B;  1SR6 C;  3DVK A;  5FYX A;  2NCO A;  3BUN B;  3VRO A;  1M45 A;  1QLS A;  5I8N A;  3WHU B;  2LCP A;  2LE9 B;  4YI9 A;  4I5N B;  3SG7 A;  4MLW A;  2L4I A;  1G33 A;  4AOM A;  1UHH A;  1K8U A;  2K2A A;  5HKW A;  2ZRT A;  2HF5 A;  2I18 A;  1S6J A;  1QVI Y;  3BOW B;  3WHT B;  2DOQ A;  1OOJ A;  2LAP A;  1RK9 A;  2ZND A;  1F4O A;  2BL0 B;  4QJ4 B;  3PM8 A;  1BR4 B;  2LHI A;  1MUX A;  4P2Y B;  4WQ2 A;  3OP0 A;  4ETO A;  2FOT A;  3TS5 C;  1R2U A;  1B4C A;  1NP8 A;  4JPZ B;  4PE1 A;  1DF0 B;  1QIW A;  1CFD A;  1CLL A;  1DJI A;  1EG4 A;  2PAL A;  1IJ6 A;  3E3R A;  1BU3 A;  3DVJ A;  1KQM B;  2CCM A;  1NX1 A;  3HX4 A;  1UUS A;  5AER A;  2K2F A;  3BQ3 A;  2KOT A;  4GBA A;  1BG1 A;  1QVI Z;  5D69 A;  1PSR A;  2Q4U A;  4ORC B;  2OTG C;  1EG3 A;  1LXF C;  1FBV A;  1JF2 A;  1SK6 D;  2P6B B;  3EVV A;  4GFT A;  2WOS A;  3NSI A;  4XJK B;  3CZT X;  2LAN A;  2KHN A;  1CFP A;  3PN7 B;  1KK7 Y;  1WDC B;  2H2K A;  1SNL A;  2G2B A;  1KFU S;  1M31 A;  3BXK A;  1YUS A;  4QJ3 B;  4I5L B;  1PVB A;  1SW8 A;  2WND A;  3I5H B;  3OB2 B;  3D0Y B;  2AUC A;  1EJ3 A;  1OZS A;  2IS9 A;  1WRK A;  4CFR A;  2M0R A;  1KK8 B;  4YGE B;  1KFX S;  3DVM A;  1SBJ A;  1RTP 1;  3FS7 A;  1DJY A;  1M39 A;  2HQ8 A;  2MHH A;  2NLN A;  1CKK A;  1L2O B;  1Q80 A;  2EGD A;  2KFG A;  1QV0 A;  1IQ5 A;  4YGD B;  2LVJ A;  1JFJ A;  4A4C A;  2NCP A;  5K89 A;  3OB1 B;  1KK7 Z;  3BUX B;  3EVR A;  2K7C A;  3I5G C;  1KSO A;  1G8I A;  2L98 A;  4FTG A;  1F54 A;  1F71 A;  2F3Z A;  2EC6 B;  1OQP A;  1M46 A;  2CNP A;  4WRI A;  5AFP A;  3AAK A;  1A75 B;  4ICB A;  2LHL A;  3TZ1 A;  5DKN A;  2CBL A;  2LMT A;  1DJH A;  1PUL A;  2WOR A;  1SCM C;  4PHN A;  4DIR A;  3VGO A;  3PSR A;  1XFV O;  2K61 A;  1XK4 C;  1SL8 A;  1AVS A;  1XO5 A;  5D7F A;  2BCA A;  4NDD A;  3O2P A;  1DJX A;  3DVE A;  4QJ5 B;  1BT6 A;  2MJW B;  2Q91 A;  3WXA A;  1TNQ A;  3GK2 A;  2JNX A;  2JNF A;  1J7P A;  3NSO A;  3LL8 B;  3QRX A;  3FWB A;  1REC A;  4GGF A;  1IKU A;  2M29 A;  1QX7 A;  1OMR A;  2KI6 D;  1RRO A;  4MSP A;  5CSN A;  3EK7 A;  5AXI A;  1JWD A;  1OSA A;  1LA3 A;  1K2H A;  2LNK A;  1UHK A;  4PHK A;  3SIA A;  1C7W A;  1K9U A;  1YUR A;  2M1K B;  4IL1 A;  1OMV A;  3I5F B;  3O6B A;  5HYD A;  2FJU B;  3BUM B;  2KNE A;  1C07 A;  2K7D A;  4I5J A;  3NXA A;  1NCX A;  1YRU B;  1W7J B;  2AAO A;  4HRG A;  1FI5 A;  2ZNE A;  3C1V A;  2OPO A;  3TUY B;  3GK1 A;  3BUW B;  1B8C A;  1KWO B;  2MAZ A;  1MXE A;  1J55 A;  1GJY A;  4MZJ A;  3EK8 A;  1LA0 A;  1S1E A;  1QTX A;  1EXR A;  4A4B A;  2BEC A;  1OMD A;  4N1F A;  5HLO A;  4R1E A;  2E30 A;  2ZKM X;  4USL A;  4ZCU A;  1QIV A;  1U5I B;  1B47 A;  4OCI A;  4PE7 A;  1IGV A;  1SMG A;  3LK1 A;  3H4S E;  5AEQ A;  1PSB A;  5AAN A;  1S6C A;  2KDH A;  3KF9 A;  1RFJ A;  1YTZ C;  4L9M A;  4D1E A;  4PCW A;  1TTX A;  1XK4 A;  1DJG A;  2LVK A;  1WLZ A;  3DD4 A;  1J1D A;  1MWN A;  4C0L A;  5B8I B;  1EL4 A;  1XVJ A;  2MLE C;  1FPW A;  2BL0 C;  4FQO A;  2G9B A;  2KSP A;  2V53 A;  2QPT A;  4NDB A;  1NCY A;  3JTD B;  1DGV A;  1NX0 A;  2F8P A;  2KI6 C;  3JVT B;  3KO0 A;  4N5X A;  2M7N A;  2JZI A;  1A2X A;  5CSJ A;  2BCX A;  2L4H A;  1SL9 A;  3IQO A;  4OVN F;  5CPV A;  2M9G A;  2KAX A;  2KGR A;  2LUX A;  5ER4 X;  2JT8 A;  1D1O A;  2Y4Q A;  2BKI B;  1AJ5 A;  2OS8 B;  2ISD A;  4GPL B;  2LM5 A;  2E6W A;  5HKZ A;  3PLF B;  1KQM C;  1PVA A;  3TS5 B;  1BMO A;  2KYF A;  1FI6 A;  1FW4 A;  2PAS A;  4PDZ A;  2GV5 A;  1ZAC A;  4JWQ A;  2ZRS A;  1BR1 B;  2KBM A;  2M8U A;  1DMO A;  2GGZ A;  2GGM A;  1G4Y R;  1L7Z A;  1TOP A;  2NXQ A;  1UWO A;  2K8M B;  3CR5 X;  3OX5 A;  4JQ0 D;  1AHR A;  1CLM A;  4M2P A;  5DKR A;  3AKA A;  4Q04 A;  1K95 A;  2L0P A;  1RWY A;  3RLZ A;  2RGI A;  2M7L A;  4DUQ A;  3FWC A;  4TNC A;  1ALV A;  1W7I B;  3OX6 A;  5J3X A;  1PAL A;  3K21 A;  4CPV A;  4F0Z B;  3HCM A;  1SY9 A;  3AKB A;  4P5O E;  1J7Q A;  1CB1 A;  1V1G A;  2KI4 B;  1K94 A;  1QX5 B;  2L5X B;  1E8A A;  2EHB A;  1Y1A A;  3BOW A;  3I5I B;  2LVI A;  1N2D A;  2ZN9 A;  2MBX A;  1YUT A;  4C0K A;  1DTL A;  4MBE A;  2BE6 A;  2F2O A;  2QAC A;  1GGZ A;  4MVF A;  1L2O C;  1BJF A;  1HQV A;  1YUU A;  5DKQ A;  1V1F A;  2KBI A;  1J7R A;  4HRH A;  4MRX A;  1JBA A;  3D10 A;  3DF0 B;  3IF7 A;  1TNX A;  2PMY A;  3VRN A;  5I2Q A;  1MF8 B;  3SG2 A;  1Y1U A;  3VRQ A;  1Y1X A;  2EC6 C;  3EKJ A;  1PK0 D;  5IBW A;  1B8L A;  1ODB A;  1CFF A;  1CNP A;  1QS7 A;  4MZL A;  3PFV A;  4CFQ A;  2LLT A;  2Y1M A;  1NX3 A;  1XFU O;  4BY5 A;  2PVB A;  1B7T Y;  1WRL A;  1XFX O;  1ZUZ A;  3I5G B;  2JPT A;  4GGN A;  1N0Y A;  5KU1 A;  1QAT A;  2L2E A;  2FCD A;  2A4J A;  2PSR A;  4DRW A;  1DT7 B;  1AP4 A;  1NUB A;  4PHM A;  1ZFS A;  4BY4 A;  1Y6W A;  1CDM A;  2WCF A;  1OZO A;  2K0J A;  4GUK A;  3CLN A;  3BUO B;  5HLV A;  1OE9 B;  4OR9 B;  5TNC A;  4M2Q A;  5I2O A;  5JJG A;  1SPY A;  1F4Q A;  3D0Y A;  1ZMZ A;  2M1U A;  3AAJ A;  3EVU A;  1CMF A;  3I5F C;  1HT9 A;  5BPJ A;  1R6P A;  4GNK B;  1MXL C;  1YX8 A;  3M0W A;  2ZFD A;  1B7T Z;  1JSA A;  1JF0 A;  4AQI A;  5G08 A;  2D8N A;  2KAV A;  2L51 A;  2SAS A;  1VRK A;  2WCB A;  3CS1 A;  2JXC A;  2KFH A;  3FIA A;  3TUY C;  2FCE A;  2BBM A;  2K7O A;  1KWO C;  4MEW A;  4I5K A;  2Y5I A;  2LLS A;  3CR4 X;  3ZWH A;  1AK8 A;  1YVL A;  1CLB A;  2KQ6 A;  1MHO A;  1BF5 A;  3LCP C;  1M63 B;  2LVV A;  1SR6 B;  2MA2 A;  1A75 A;  1TNW A;  1WLM A;  2JTT A;  2JWW A;  4YGA A;  1NSH A;  2M49 B;  1XYD A;  2Y1N A;  4ORB B;  2JUL A;  4PE0 A;  3O4Y A;  1BOD A;  2O60 A;  1QJT A;  1S3P A;  1QAS A;  1TNP A;  4E68 A;  3A8R A;  1S26 D;  2WC8 A;  1NYA A;  1DJZ A;  1CM4 A;  5CSI A;  1DGU A;  4UPG A;  5ER5 A;  2LMU A;  1QXP A;  1NCZ A;  1SL7 A;  2F3Y A;  3KEV A;  1QX2 A;  1CDP A;  2BKH B;  2LP3 A;  2CT9 A;  2LMV A;  4AQJ A;  3JTD C;  2KYC A;  2TN4 A;  3JVT C;  3TDU A;  4PAL A;  1CM1 A;  2BCB A;  5I2L A;  4NDC A;  1GQM A;  2JRF A;  3LK0 A;  2HET A;  4MRY A;  1AUI B;  1B8R A;  2CTN A;  1TN4 A;  4CLN A;  3SG3 A;  5HKY A;  1A03 A;  1J7O A;  3BYA A;  4XYN A;  4HRE E;  1XA5 A;  2OS8 C;  3MSE B;  3TDI A;  3WNX B;  3CGA A;  2JOJ A;  3EKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...