3IF7A

Structure of calmodulin complexed with its first endogenous inhibitor, sphingosylphosphorylcholine
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
144
structure length
142
Chain Sequence
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium binding protein
molecule keywords Calmodulin
publication title Structure and mechanism of calmodulin binding to a signaling sphingolipid reveal new aspects of lipid-protein interactions
pubmed doi rcsb
total genus 52
structure length 142
sequence length 144
ec nomenclature
pdb deposition date 2009-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3if7A00
1AJ4A 3WNXB 1SPYA 1F71A 3JVTC 2JNXA 1TTXA 2OS8C 3QRXA 5HLOA 1IQ5A 1SR6C 3CR4X 3I5GB 3O6BA 1KSMA 1BG1A 1IWQA 2JU0A 1DT7B 1QX7A 1CTRA 1QVIY 2KQ6A 2JT3A 2KI6C 2WCFA 1NWDA 4MLWA 5JOLA 3WXAA 2WCEA 4FTGA 2GV5A 1N0YA 1J7RA 5G08A 4Q04A 1KFUS 1NIWA 3GK2A 2JT8A 1NCZA 1S3PA 1QJTA 3I5GC 1MUXA 1S1EA 2HETA 2K8MB 4GFTA 2JRFA 3NSOA 1QTXA 2MRDA 5F6TA 1CFCA 1CMGA 2QACA 3IF7A 1TNPA 1K90D 1RJVA 2HQWA 3HCMA 2COLB 4E68A 5ER5A 2WNDA 3KO0A 4PE4A 3K21A 2B1UA 4DS7A 2K7BA 2NXQA 1IQ3A 4GPLB 2L4IA 2HQ8A 2CBLA 4CFQA 4OVNF 1YX7A 1Y1UA 4YBHB 1F70A 2I18A 4PE7A 1TN4A 2FJUB 3VRQA 1W7JB 1SL8A 3BYAA 3O2PA 3SG5A 1AUIB 1MQ1A 1IJ5A 3AKBA 1QATA 2LLTA 2NZ0A 1XFWO 1CLBA 5J3XA 2K2AA 2M29A 1M63B 4MRXA 2G2BA 2KGBC 2LE9B 3MSEB 4GGNA 1QLSA 1J1DA 1S26D 1J7PA 3BUNB 2AUCA 2M8UA 1M31A 2WCBA 1KQVA 4MZLA 5IBWA 1JWDA 5GQQC 3HX4A 1AVSA 3RM1A 3CR5X 4BY4A 1ZMZA 2M9GA 3KEVA 4XJKB 2M7NA 4L9MA 2ZNEA 4YGDB 1XFZO 1SCMB 1J7QA 1D1OA 5CPVA 5KU1A 2LV7A 2PASA 5HKWA 1BU3A 1NPQA 1UHJA 3DVKA 1XFVO 4YRUA 2NLNA 2IS9A 3BUOB 4I5NB 4NQGA 2P6BB 1EL4A 3VGOA 3OHMB 3I5HB 1JF0A 1UHNA 4GAOA 1IJ6A 1L2OB 1QASA 1SCMC 1TNWA 1L7ZA 1EG3A 2KFGA 2JTZA 2LM5A 1TNXA 1DF0A 2OPOA 1TCFA 2I7AA 4JWQA 4PE1A 2LVJA 1MR8A 4PHKA 4GGFA 1SNLA 2Y1NA 3I5HC 1G4YR 2OTGC 5BPJA 3DVJA 4CFRA 1UURA 4JQ0D 2FCEA 4MBEA 1GGZA 1OMDA 3PALA 1EG4A 3KHEA 4PHMA 1KCYA 1Y1XA 1DJYA 4HRHA 2LNKA 1QVIZ 4MZJA 1JBAA 2CCMA 1SKTA 1Y1AA 1K96A 1F54A 2BCBA 4DUQA 2KQYA 2JULA 3DVEA 4MN0A 1IGVA 2PMYA 3LK1A 1GQMA 4M2OA 1WLMA 4BY5A 4C0LA 1CDMA 3D0YB 3AKAA 1BMOA 3TDUA 3IQQA 5I2OA 2K61A 2BL0B 3BOWB 1X02A 2F3ZA 4YI8A 3A8RA 1XA5A 2LUXA 4YI9A 2JXLA 1ZFSA 3ZNIA 2JQ6A 1J55A 1XK4C 5CSFA 1B9AA 1KWOB 1CFFA 4I5JA 1YTZC 2KFFA 4MSPA 1XFXO 5HKYA 4HRGA 2BL0C 1EH2A 4HSZA 1YUTA 2L5XB 2TN4A 3KF9A 1S6IA 1S5GY 1JFJA 1UHHA 2KDHA 1GGWA 4M2QA 2LHIA 1PALA 3EVVA 1KWOC 4AQJA 3NXAA 1A75A 2KGRA 5AERA 1XFUO 3RLZA 3I5FB 1CNPA 2G9BA 3SG2A 1E8AA 5CSJA 1JUOA 2KFHA 3PN7B 4C0KA 3VRNA 2L98A 4YGAA 1MWNA 1C07A 2H2KA 2BE4A 1IG5A 2KAVA 2PRUA 5TNCA 4CPVA 3D10A 3FWBA 2E6WA 3WHUB 1KK7Y 3DF0A 5AXIA 1YRUB 4GUKA 1DJXA 2CXJA 5ER4X 2K7OA 1NX1A 3OX6A 1PVBA 1KSOA 3SIAA 1WY9A 2KBIA 3TZ1A 1NX2A 2MBXA 1IRJA 2L51A 2BBMA 2M3WA 3CTNA 1F55A 2ZNDA 1CM4A 1QV1A 2KAYA 2LVIA 3PSRA 4ZCVA 4DRWA 2L0PA 2AMIA 2F2PA 2JC2A 1K9PA 3LK0A 1CM1A 3SG7A 5HLVA 4DCKA 2A4JA 4YGBB 1CB1A 2KNEA 1NUBA 4FQOA 1QLKA 1JFKA 1S6CA 1W7IB 1SL9A 1K8UA 1LA3A 1SW8A 1OQPA 1TRFA 2KAXA 1B47A 4I5LB 3NSKA 4I5KA 3PLFB 1K93D 2D8NA 3LCPC 2CTNA 1QX5B 1XFYO 1BODA 3FWCA 2L50A 2LVKA 1OSAA 1QIVA 1RFJA 1K94A 4HREE 4M2PA 4C0JA 1NYAA 4GNKB 3EK8A 1DJZA 2M1KB 2O60A 1BJFA 1ZUZA 3DVMA 1V1FA 1J7OA 1B1GA 3E3RA 4U8DA 1Y6WA 1QV0A 2JZIA 1PVAA 3EKJA 1G33A 2CNPA 1CLMA 1S36A 4D1EA 5AFPA 2JXCA 3FS7A 1K2HA 4MRYA 1NX0A 4PALA 1U5IB 1PRWA 2LCPA 2MLEC 1K95A 2FOTA 4OV2A 1WRZA 1FI6A 1DJWA 3EK4A 2F33A 3SG4A 4WQ3A 1C7WA 1KK8B 1SL7A 2LP2A 3VRPA 3CR2A 4WQ2A 4ORCB 3BUXB 3LL8B 1B8RA 3OX5A 4ICBA 1FF1A 3A4UB 1FBVA 2NCOA 1L2OC 4MZKA 2LMVA 1H4BA 2ZKMX 1RROA 1UP5A 1F4QA 2WORA 4P2YB 4R1EA 1B4CA 2HPSA 2JNFA 3OB1B 1B7TZ 1C7VA 1CFDA 2LMUA 1XO5A 2BKHB 1KK8C 2H61C 1RK9A 1YVLA 3AAJA 2I94A 3DD4A 1DTLA 1MF8B 1Q80A 2JTTA 5DKQA 1OZOA 2F3YA 1S5GZ 3OP0A 5AEQA 1AP4A 3IQOA 4GBAA 5PALA 4XJKA 2KBMA 2LC5A 1RTP1 3EVUA 1BT6A 2LUCA 3CZTX 1WDCB 2I2RE 2KYFA 1DGVA 2Q91A 1LXFC 3JTDB 2BE6A 1CDPA 2KHNA 4OCIA 5HKZA 1B8LA 1K9UA 1TCOB 1R6PA 3O4YA 5CSNA 1XVJA 2L4HA 1GJYA 2ZN8A 1SK6D 1K9KA 1CKKA 1KK7Z 1YVHA 5K89A 2LAPA 3SG3A 4F0ZB 1DVIA 1G8IA 1YR5A 2CT9A 3JTDC 2OS8B 2ISDA 1CDNA 1B7TY 2K7DA 4QJ3B 2WOSA 3AAKA 1B8CA 2K0JA 3TS5B 1IKUA 2K7CA 1A2XA 1TIZA 1CFPA 1NX3A 2H61A 2LLUA 2NCPA 3EKHA 2BBNA 4N1GA 4PHJA 1BF5A 2EHBA 2M49B 3BXKA 4NDCA 1LVCD 3SG6A 4ETOA 4JPZB 2Y5IA 1OMRA 3CWGA 2ZFDA 1BR4B 2GGMA 2MA2A 3ICBA 1MXLC 4UPGA 1DJHA 1N65A 2M0RA 3PFVA 4ORBB 2F8PA 2LHLA 1AJ5A 1YUSA 3TS5C 2ZRSA 1RECA 5I8NA 1KQMB 3ZWHA 1RWYA 1UHKA 1NP8A 1ZOTB 2KI4B 1AHRA 1JSAA 4QJ4B 3VROA 3GOFA 1XK4A 1LINA 3I5FC 1UHIA 1ZACA 4WRIA 3D0YA 3PN7C 4YGEB 4MVFA 1YUUA 1KQMC 1YX8A 4A4CA 1QX2A 2L2EA 2WC8A 2KI4C 3BOWA 4USLA 3VRRA 1MXEA 5CSIA 5AANA 3F45A 3BQ3A 5D69A 1F4OA 4PHNA 4QJ5B 4AOMA 1LKJA 2O5GA 1WRLA 1DF0B 4XYNA 1M39A 2QPTA 4ORAB 1ALWA 1H8BA 2LVVA 1TOPA 2Q4UA 1Y0VH 3FIAA 4NDDA 3EK7A 3PATA 1FW4A 3KPXA 3SJSA 1CLLA 4N1FA 3SIBA 2EGDA 1LA0A 2PALA 4OKHA 1KFUL 1DJIA 1V1GA 1OZSA 1YRTB 1M46A 1OE9B 1SBJA 5KTYA 2DOQA 2VRGA 2KI6D 1J1EA 1NCXA 1YURA 2F2OA 1QS7A 2JT0A 2M1UA 1ODBA 1A29A 4GGFC 3O78A 1A4PA 2BCXA 3BUMB 3NSIA 3NSLA 4PCWA 1SCVA 1NCYA 2BCAA 1CDLA 4NDBA 1IH0A 2M97A 1JF2A 1PK0D 1FI5A 3TDIA 3CGAA 1S6JA 3GK4X 2AAOA 4TNCA 2KSPA 1PSRA 1QIWA 4MEWA 3H4SE 4A4BA 1F8HA 2MAZA 4PDZA 5FYXA 2LMTA 5DKRA 3CS1A 1NSHA 2LLSA 2SCPA 1DGUA 2V53A 2Y4QA 3GK1A 1UUSA 4N5XA 1QXPA 2OTGB 2M7LA 1M45A 4IL1A 5DKNA 3I5IB 1R2UA 2BECA 2E30A 2LP3A 1JC2A 1PULA 1OOJA 2JWWA 3CLNA 3M0WA 2ZRTA 1BOCA 1KFXS 4AQIA 2BKIB 4CLNA 1TNQA 2JOJA 2KOTA 1XYDA 1DJGA 1EXRA 1SY9A 1FPWA 4CIDA 2KYCA 1N2DA 3TUYB 5I2LA 1AK8A 2MLFC 3EVRA 5KSZA 1HQVA 3OB2B 1BR1B 1A75B 1UWOA 4YGCB 4ZCUA 3I5IC 2EC6B 2PVBA 1HT9A 1ALVA 2HF5A 1BLQA 5B8IB 2LANA 2RGIA 2R2IA 3LLEA 5HYDA 1A03A 2PSRA 3C1VA 3WHTB 2SASA 3TUYC 2MJWB 3PM8A 1SYMA 1WDCC 3DF0B 1WRKA 2FCDA 3JVTB 1CMFA 1SMGA 1EJ3A 4OR9B 1SRAA 1U5IA 2EC6C 2K2FA 2Y1MA 1SR6B 1VRKA 1KFXL 2GGZA 3TDZA 5JJGA 1WLZA 1MHOA 5D7FA 2JPTA 5I2QA 2ZN9A 1PSBA 3BUWB 4DIRA 1DMOA 4P5OE 1OMVA 2MHHA 4PE0A
chains in the Genus database with same CATH superfamily
1AJ4A 2BAPA 1SPYA 3UNWA 3WNXB 1F71A 3JVTC 2JNXA 1TTXA 2OS8C 3QRXA 5HLOA 1IQ5A 1SR6C 3CR4X 3I5GB 3O6BA 3B87A 1KSMA 1BG1A 1IWQA 3FE6A 2JU0A 1DT7B 1QX7A 1CTRA 1QVIY 2WCMA 3OGNA 2KLDA 2JT3A 2KI6C 2KQ6A 2WCFA 1NWDA 4MLWA 5JOLA 3WXAA 2WCEA 4FTGA 2GV5A 1N0YA 1J7RA 5G08A 4Q04A 1KFUS 1NIWA 3GK2A 1Z2CB 1NCZA 1S3PA 2JT8A 1QJTA 3CABA 3I5GC 1MUXA 1S1EA 2HETA 2K8MB 4GFTA 2JRFA 3NSOA 1QTXA 2MRDA 5F6TA 1CFCA 1CMGA 2QACA 3IF7A 1TNPA 1K90D 1RJVA 2HQWA 3HCMA 2COLB 4E68A 5ER5A 2WNDA 3KO0A 4PE4A 3K21A 2B1UA 2PQLA 4DS7A 2K7BA 2NXQA 1IQ3A 4GPLB 2L4IA 2HQ8A 2CBLA 4CFQA 4OVNF 1YX7A 1Y1UA 4YBHB 1F70A 2I18A 4PE7A 1DC1A 1TN4A 2FJUB 3VRQA 1W7JB 1SL8A 1IIOA 3BYAA 3O2PA 3SG5A 1AUIB 1MQ1A 1IJ5A 3AKBA 1TWOA 1QATA 2LLTA 4FQTA 2NZ0A 1XFWO 1CLBA 5J3XA 2K2AA 2M29A 1M63B 4MRXA 3N7HA 5EL2A 2G2BA 2KGBC 2LE9B 3MSEB 1DEKA 4GGNA 1QLSA 3S0DA 1J1DA 3UO9A 3D75A 1S26D 1J7PA 3BUNB 2AUCA 2M8UA 1M31A 2WCBA 1KQVA 4MZLA 5IBWA 1JWDA 5GQQC 2WC5A 2WCJA 3HX4A 1AVSA 3RM1A 3CR5X 4BY4A 1ZMZA 2M9GA 3KEVA 3D77A 4XJKB 2M7NA 4L9MA 2ZNEA 4YGDB 1XFZO 1SCMB 1J7QA 1D1OA 5CPVA 5KU1A 2LV7A 2PASA 1T14A 2YGUA 3IVTA 5HKWA 1BU3A 1NPQA 1UHJA 3DVKA 1XFVO 3BFBA 4YRUA 2NLNA 2IS9A 3BUOB 3SS5A 2H8VA 4I5NB 4NQGA 2P6BB 1EL4A 1SSEB 4PT1A 3VGOA 3OHMB 3I5HB 1JF0A 4OZDA 1UHNA 4GAOA 1IJ6A 1L2OB 1QASA 1SCMC 1TNWA 1L7ZA 1EG3A 2KPHA 2KFGA 3CZ0A 2JTZA 2LM5A 1TNXA 1DF0A 2OPOA 1TCFA 2I7AA 4JWQA 4PE1A 2KLEA 2LVJA 3DXLA 1MR8A 4PHKA 4GGFA 1SNLA 2Y1NA 3I5HC 1G4YR 2OTGC 5BPJA 3DVJA 4CFRA 1UURA 4JQ0D 2FCEA 4MBEA 1GGZA 1OMDA 2BNXA 1EG4A 3PALA 3KHEA 4PHMA 1KCYA 1Y1XA 1DJYA 4HRHA 2LNKA 1QVIZ 1GM0A 4MZJA 1JBAA 2CCMA 2WCKA 1SKTA 1Y1AA 1K96A 1F54A 2BCBA 4DUQA 2KQYA 2JULA 3DVEA 4MN0A 3D78A 1IGVA 2PMYA 3LK1A 1GQMA 4M2OA 1WLMA 4BY5A 4C0LA 1CDMA 3D0YB 3AKAA 1BMOA 3TDUA 3D73A 3IQQA 5I2OA 2K61A 2BL0B 3BOWB 1X02A 2F3ZA 4YI8A 3A8RA 1XA5A 2LUXA 4YI9A 2JXLA 1ZFSA 5I94A 3ZNIA 2JQ6A 1J55A 1XK4C 5CSFA 1B9AA 5FI7A 1KWOB 1CFFA 4I5JA 3EG5B 1YTZC 2KFFA 2P71A 2QEOA 1XFXO 2QDIA 4MSPA 5HKYA 4HRGA 2BL0C 1EH2A 4HSZA 1YUTA 2L5XB 2TN4A 3KF9A 1S6IA 1S5GY 1JFJA 1UHHA 2KDHA 1GGWA 4M2QA 2LHIA 1PALA 3EVVA 3NHIA 1KWOC 4AQJA 3NXAA 1A75A 2KGRA 5AERA 1XFUO 3RLZA 3I5FB 2PYQA 1CNPA 2G9BA 3SG2A 1E8AA 5CSJA 1JUOA 2KFHA 3PN7B 1LS8A 4JD9A 3VRNA 2L98A 4YGAA 4C0KA 2GTEA 1MWNA 1C07A 2H2KA 2BE4A 1IG5A 2KAVA 2PRUA 3R72A 5TNCA 4CPVA 3D10A 3FWBA 3R1OA 2FJYA 2E6WA 3WHUB 1KK7Y 3DF0A 5AXIA 1YRUB 4GUKA 1DJXA 2CXJA 5ER4X 2K7OA 1NX1A 3OX6A 1PVBA 1KSOA 3SIAA 1WY9A 2KBIA 2WCLA 3TZ1A 1NX2A 2MBXA 1IRJA 2L51A 2BBMA 2M3WA 3CTNA 1OW4A 1F55A 2ZNDA 1CM4A 1QV1A 2KAYA 2LVIA 3L4LA 3PSRA 4ZCVA 4DRWA 2L0PA 2AMIA 2JPOA 2F2PA 2JC2A 1K9PA 3LK0A 1CM1A 3S0EA 3SG7A 5HLVA 4DCKA 4F7FA 2A4JA 2K60A 4YGBB 1CB1A 2KNEA 1NUBA 4FQOA 1QLKA 1JFKA 1S6CA 1W7IB 1SL9A 1K8UA 1LA3A 1SW8A 1C3YA 1OQPA 1TRFA 2KAXA 1B47A 4I5LB 3NSKA 4I5KA 3PLFB 1K93D 2D8NA 1TUJA 3LCPC 2CTNA 3NGVA 1QX5B 1XFYO 1BODA 3FWCA 2L50A 3S0AA 2LVKA 1OSAA 1QIVA 1RFJA 1K94A 4HREE 4M2PA 4C0JA 1NYAA 3OBVA 3EK8A 4GNKB 1DJZA 2M1KB 3B7AA 3D74A 2O60A 1BJFA 1ZUZA 3DVMA 1V1FA 1J7OA 1Z4HA 1B1GA 3E3RA 4U8DA 1Y6WA 1QV0A 2JZIA 1PVAA 3EKJA 1G33A 2CNPA 1CLMA 1S36A 4D1EA 3K1EA 5AFPA 2JXCA 3FS7A 1K2HA 4MRYA 1NX0A 3DY9A 4PALA 1U5IB 1PRWA 2LCPA 3S0FA 2MLEC 1K95A 2FOTA 4OV2A 1WRZA 1FI6A 1DJWA 3SS3A 3EK4A 2F33A 3SG4A 4WQ3A 1C7WA 1KK8B 1SL7A 2LP2A 3VRPA 3CR2A 4WQ2A 3D76A 4ORCB 3BUXB 3LL8B 1B8RA 3OX5A 4ICBA 1FF1A 3A4UB 1FBVA 2NCOA 1L2OC 4MZKA 2LMVA 2QEBA 1H4BA 2ZKMX 1RROA 1UP5A 1F4QA 2WORA 4P2YB 4R1EA 1B4CA 2HPSA 2JNFA 3OB1B 1B7TZ 1C7VA 1CFDA 2LMUA 1XO5A 2BKHB 1KK8C 2H61C 3B86A 1RK9A 1YVLA 3AAJA 2I94A 3DD4A 1DTLA 1MF8B 1Q80A 2JTTA 5DKQA 1OZOA 3NHTA 2F3YA 1S5GZ 3OP0A 5AEQA 1AP4A 3IQOA 4GBAA 5PALA 4XJKA 2KBMA 2LC5A 1RTP1 3EVUA 1BT6A 2LUCA 3CZTX 1WDCB 2I2RE 2KYFA 1DGVA 2Q91A 1LXFC 3JTDB 2BE6A 1CDPA 2KHNA 4OCIA 5HKZA 1B8LA 1P28A 5D3OA 1K9UA 1TCOB 1R6PA 3O4YA 5CSNA 1XVJA 2L4HA 1GJYA 2ZN8A 1SK6D 1K9KA 1CKKA 1KK7Z 1YVHA 5K89A 2LAPA 3SG3A 4F0ZB 1DVIA 1G8IA 1YR5A 2CT9A 3JTDC 2OS8B 2ISDA 1CDNA 1B7TY 2K7DA 4QJ3B 2WOSA 4INWA 3DYEA 1XFRA 3AAKA 1B8CA 2K0JA 3TS5B 1IKUA 2K7CA 1A2XA 1TIZA 1CFPA 1NX3A 3Q8IA 2H61A 2LLUA 2NCPA 3EKHA 2BBNA 4N1GA 4PHJA 5HL1A 1BF5A 2EHBA 2M49B 3BXKA 4NDCA 1LVCD 3SG6A 4ETOA 4JPZB 2Y5IA 1OMRA 3CWGA 5DICA 3S0GA 2ZFDA 1BR4B 2GGMA 2MA2A 3ICBA 1MXLC 2QEVA 4UPGA 1DJHA 1N65A 2M0RA 3PFVA 3BFAA 3BFHA 2F8PA 2LHLA 2P70A 4ORBB 1AJ5A 1YUSA 1OOGA 2ZRSA 1RECA 3B88A 1KQMB 3CDNA 4INXA 3TS5C 1RWYA 3ZWHA 1UHKA 5I8NA 1NP8A 1ZOTB 2KI4B 1AHRA 2WC6A 3B6XA 1JSAA 4QJ4B 3VROA 3GOFA 4JKTA 3L4AA 1XK4A 1LINA 3L47A 3I5FC 1UHIA 1ZACA 3QMEA 3D0YA 4WRIA 3PN7C 4YGEB 4MVFA 1YUUA 1KQMC 1YX8A 4A4CA 1OOFA 1QX2A 2L2EA 2WC8A 2KI4C 3BOWA 4USLA 3VRRA 1MXEA 5CSIA 5AANA 3F45A 3BQ3A 5D69A 1F4OA 4PHNA 4QJ5B 4AOMA 3DZTA 3O4XA 1LKJA 2O5GA 1WRLA 3R1PA 1DF0B 4XYNA 3SS4A 1M39A 2QPTA 4ORAB 1ALWA 1H8BA 2LVVA 1TOPA 2Q4UA 1Y0VH 3CZ2A 3FIAA 1QWVA 3EK7A 1FW4A 3PATA 3KPXA 4NDDA 3R1VA 1TUZA 1CLLA 3SJSA 4N1FA 3SIBA 4KYNA 2EGDA 2L2CA 1LA0A 2PALA 4OKHA 1KFUL 1DJIA 1V1GA 1OZSA 1YRTB 1M46A 1OE9B 3CZ1A 1SBJA 5KTYA 2DOQA 2VRGA 1DQEA 2KI6D 1J1EA 1NCXA 1YURA 2F2OA 1QS7A 2JT0A 2M1UA 1ODBA 1A29A 4GGFC 3O78A 1A4PA 2BCXA 3BUMB 3NSIA 3NSLA 4PCWA 1SCVA 2L5YA 1NCYA 2BCAA 2ERBA 1CDLA 4NDBA 1IH0A 2M97A 1JF2A 1PK0D 1FI5A 3TDIA 3S0BA 3CGAA 1S6JA 3GK4X 2AAOA 4TNCA 2KSPA 1PSRA 1QIWA 4MEWA 3H4SE 4A4BA 1F8HA 2MAZA 3CYZA 4PDZA 5FYXA 2LMTA 5DKRA 3CS1A 1NSHA 2LLSA 2SCPA 1DGUA 2V53A 2Y4QA 3GK1A 3PJIA 5FI6A 3VB1A 1UUSA 4N5XA 3RZSA 1DELA 1QXPA 2OTGB 2M7LA 1M45A 4IL1A 2WCHA 5DKNA 3I5IB 1R2UA 2BECA 2E30A 2LP3A 1C3ZA 1JC2A 1PULA 1OOJA 2JWWA 3CLNA 3PM2A 3M0WA 2ZRTA 1BOCA 1KFXS 4AQIA 2BKIB 3FE8A 4CLNA 1TNQA 2JOJA 2KOTA 1XYDA 1DJGA 1EXRA 1SY9A 1FPWA 4CIDA 2KYCA 1N2DA 3TUYB 5I2LA 1AK8A 2MLFC 3EVRA 5KSZA 5FI2A 1HQVA 3OB2B 1BR1B 1A75B 1OOHA 1UWOA 4YGCB 4ZCUA 3I5IC 2EC6B 2PVBA 1OOIX 4IJ7A 1HT9A 1ALVA 2HF5A 1BLQA 5B8IB 2LANA 2QEHA 2RGIA 2R2IA 3LLEA 5HYDA 1A03A 2PSRA 3C1VA 3WHTB 2SASA 3TUYC 2MJWB 3FE9A 3PM8A 1SYMA 1WDCC 3DF0B 1WRKA 2FCDA 3JVTB 1CMFA 1SMGA 1EJ3A 4OR9B 3V2LA 1SRAA 1U5IA 2EC6C 2K2FA 2Y1MA 3BJHA 1SR6B 1VRKA 1KFXL 2GGZA 3TDZA 5JJGA 1ORGA 1MHOA 1WLZA 5D7FA 2JPTA 5I2QA 2ZN9A 1PSBA 3BUWB 4DIRA 1DMOA 1W9ZA 4P5OE 1OMVA 2MHHA 4PE0A
chains in the Genus database with same CATH topology
1AJ4A 3WNXB 1SPYA 1F71A 3JVTC 2JNXA 1TTXA 2OS8C 3QRXA 5HLOA 1IQ5A 1SR6C 3CR4X 3I5GB 3O6BA 1KSMA 1BG1A 1IWQA 2JU0A 1DT7B 1QX7A 1CTRA 1QVIY 2KQ6A 2JT3A 2KI6C 2WCFA 1NWDA 4MLWA 5JOLA 3WXAA 2WCEA 4FTGA 2GV5A 1N0YA 1J7RA 5G08A 4Q04A 1KFUS 1NIWA 3GK2A 2JT8A 1NCZA 1S3PA 1QJTA 3I5GC 1MUXA 1S1EA 2HETA 2K8MB 4GFTA 2JRFA 3NSOA 1QTXA 2MRDA 5F6TA 1CFCA 1CMGA 2QACA 3IF7A 1TNPA 1K90D 1RJVA 2HQWA 3HCMA 2COLB 4E68A 5ER5A 2WNDA 3KO0A 4PE4A 3K21A 2B1UA 4DS7A 2K7BA 2NXQA 1IQ3A 4GPLB 2L4IA 2HQ8A 2CBLA 4CFQA 4OVNF 1YX7A 1Y1UA 4YBHB 1F70A 2I18A 4PE7A 1TN4A 2FJUB 3VRQA 1W7JB 1SL8A 3BYAA 3O2PA 3SG5A 1AUIB 1MQ1A 1IJ5A 3AKBA 1QATA 2LLTA 2NZ0A 1XFWO 1CLBA 5J3XA 2K2AA 2M29A 1M63B 4MRXA 2G2BA 2KGBC 2LE9B 3MSEB 4GGNA 1QLSA 1J1DA 1S26D 1J7PA 3BUNB 2AUCA 2M8UA 1M31A 2WCBA 1KQVA 4MZLA 5IBWA 1JWDA 5GQQC 3HX4A 1AVSA 3RM1A 3CR5X 4BY4A 1ZMZA 2M9GA 3KEVA 4XJKB 2M7NA 4L9MA 2ZNEA 4YGDB 1XFZO 1SCMB 1J7QA 1D1OA 5CPVA 5KU1A 2LV7A 2PASA 5HKWA 1BU3A 1NPQA 1UHJA 3DVKA 1XFVO 4YRUA 2NLNA 2IS9A 3BUOB 4I5NB 4NQGA 2P6BB 1EL4A 3VGOA 3OHMB 3I5HB 1JF0A 1UHNA 4GAOA 1IJ6A 1L2OB 1QASA 1SCMC 1TNWA 1L7ZA 1EG3A 2KFGA 2JTZA 2LM5A 1TNXA 1DF0A 2OPOA 1TCFA 2I7AA 4JWQA 4PE1A 2LVJA 1MR8A 4PHKA 4GGFA 1SNLA 2Y1NA 3I5HC 1G4YR 2OTGC 5BPJA 3DVJA 4CFRA 1UURA 4JQ0D 2FCEA 4MBEA 1GGZA 1OMDA 3PALA 1EG4A 3KHEA 4PHMA 1KCYA 1Y1XA 1DJYA 4HRHA 2LNKA 1QVIZ 4MZJA 1JBAA 2CCMA 1SKTA 1Y1AA 1K96A 1F54A 2BCBA 4DUQA 2KQYA 2JULA 3DVEA 4MN0A 1IGVA 2PMYA 3LK1A 1GQMA 4M2OA 1WLMA 4BY5A 4C0LA 1CDMA 3D0YB 3AKAA 1BMOA 3TDUA 3IQQA 5I2OA 2K61A 2BL0B 3BOWB 1X02A 2F3ZA 4YI8A 3A8RA 1XA5A 2LUXA 4YI9A 2JXLA 1ZFSA 3ZNIA 2JQ6A 1J55A 1XK4C 5CSFA 1B9AA 1KWOB 1CFFA 4I5JA 1YTZC 2KFFA 4MSPA 1XFXO 5HKYA 4HRGA 2BL0C 1EH2A 4HSZA 1YUTA 2L5XB 2TN4A 3KF9A 1S6IA 1S5GY 1JFJA 1UHHA 2KDHA 1GGWA 4M2QA 2LHIA 1PALA 3EVVA 1KWOC 4AQJA 3NXAA 1A75A 2KGRA 5AERA 1XFUO 3RLZA 3I5FB 1CNPA 2G9BA 3SG2A 1E8AA 5CSJA 1JUOA 2KFHA 3PN7B 4C0KA 3VRNA 2L98A 4YGAA 1MWNA 1C07A 2H2KA 2BE4A 1IG5A 2KAVA 2PRUA 5TNCA 4CPVA 3D10A 3FWBA 2E6WA 3WHUB 1KK7Y 3DF0A 5AXIA 1YRUB 4GUKA 1DJXA 2CXJA 5ER4X 2K7OA 1NX1A 3OX6A 1PVBA 1KSOA 3SIAA 1WY9A 2KBIA 3TZ1A 1NX2A 2MBXA 1IRJA 2L51A 2BBMA 2M3WA 3CTNA 1F55A 2ZNDA 1CM4A 1QV1A 2KAYA 2LVIA 3PSRA 4ZCVA 4DRWA 2L0PA 2AMIA 2F2PA 2JC2A 1K9PA 3LK0A 1CM1A 3SG7A 5HLVA 4DCKA 2A4JA 4YGBB 1CB1A 2KNEA 1NUBA 4FQOA 1QLKA 1JFKA 1S6CA 1W7IB 1SL9A 1K8UA 1LA3A 1SW8A 1OQPA 1TRFA 2KAXA 1B47A 4I5LB 3NSKA 4I5KA 3PLFB 1K93D 2D8NA 3LCPC 2CTNA 1QX5B 1XFYO 1BODA 3FWCA 2L50A 2LVKA 1OSAA 1QIVA 1RFJA 1K94A 4HREE 4M2PA 4C0JA 1NYAA 4GNKB 3EK8A 1DJZA 2M1KB 2O60A 1BJFA 1ZUZA 3DVMA 1V1FA 1J7OA 1B1GA 3E3RA 4U8DA 1Y6WA 1QV0A 2JZIA 1PVAA 3EKJA 1G33A 2CNPA 1CLMA 1S36A 4D1EA 5AFPA 2JXCA 3FS7A 1K2HA 4MRYA 1NX0A 4PALA 1U5IB 1PRWA 2LCPA 2MLEC 1K95A 2FOTA 4OV2A 1WRZA 1FI6A 1DJWA 3EK4A 2F33A 3SG4A 4WQ3A 1C7WA 1KK8B 1SL7A 2LP2A 3VRPA 3CR2A 4WQ2A 4ORCB 3BUXB 3LL8B 1B8RA 3OX5A 4ICBA 1FF1A 3A4UB 1FBVA 2NCOA 1L2OC 4MZKA 2LMVA 1H4BA 2ZKMX 1RROA 1UP5A 1F4QA 2WORA 4P2YB 4R1EA 1B4CA 2HPSA 2JNFA 3OB1B 1B7TZ 1C7VA 1CFDA 2LMUA 1XO5A 2BKHB 1KK8C 2H61C 1RK9A 1YVLA 3AAJA 2I94A 3DD4A 1DTLA 1MF8B 1Q80A 2JTTA 5DKQA 1OZOA 2F3YA 1S5GZ 3OP0A 5AEQA 1AP4A 3IQOA 4GBAA 5PALA 4XJKA 2KBMA 2LC5A 1RTP1 3EVUA 1BT6A 2LUCA 3CZTX 1WDCB 2I2RE 2KYFA 1DGVA 2Q91A 1LXFC 3JTDB 2BE6A 1CDPA 2KHNA 4OCIA 5HKZA 1B8LA 1K9UA 1TCOB 1R6PA 3O4YA 5CSNA 1XVJA 2L4HA 1GJYA 2ZN8A 1SK6D 1K9KA 1CKKA 1KK7Z 1YVHA 5K89A 2LAPA 3SG3A 4F0ZB 1DVIA 1G8IA 1YR5A 2CT9A 3JTDC 2OS8B 2ISDA 1CDNA 1B7TY 2K7DA 4QJ3B 2WOSA 3AAKA 1B8CA 2K0JA 3TS5B 1IKUA 2K7CA 1A2XA 1TIZA 1CFPA 1NX3A 2H61A 2LLUA 2NCPA 3EKHA 2BBNA 4N1GA 4PHJA 1BF5A 2EHBA 2M49B 3BXKA 4NDCA 1LVCD 3SG6A 4ETOA 4JPZB 2Y5IA 1OMRA 3CWGA 2ZFDA 1BR4B 2GGMA 2MA2A 3ICBA 1MXLC 4UPGA 1DJHA 1N65A 2M0RA 3PFVA 4ORBB 2F8PA 2LHLA 1AJ5A 1YUSA 3TS5C 2ZRSA 1RECA 5I8NA 1KQMB 3ZWHA 1RWYA 1UHKA 1NP8A 1ZOTB 2KI4B 1AHRA 1JSAA 4QJ4B 3VROA 3GOFA 1XK4A 1LINA 3I5FC 1UHIA 1ZACA 4WRIA 3D0YA 3PN7C 4YGEB 4MVFA 1YUUA 1KQMC 1YX8A 4A4CA 1QX2A 2L2EA 2WC8A 2KI4C 3BOWA 4USLA 3VRRA 1MXEA 5CSIA 5AANA 3F45A 3BQ3A 5D69A 1F4OA 4PHNA 4QJ5B 4AOMA 1LKJA 2O5GA 1WRLA 1DF0B 4XYNA 1M39A 2QPTA 4ORAB 1ALWA 1H8BA 2LVVA 1TOPA 2Q4UA 1Y0VH 3FIAA 4NDDA 3EK7A 3PATA 1FW4A 3KPXA 3SJSA 1CLLA 4N1FA 3SIBA 2EGDA 1LA0A 2PALA 4OKHA 1KFUL 1DJIA 1V1GA 1OZSA 1YRTB 1M46A 1OE9B 1SBJA 5KTYA 2DOQA 2VRGA 2KI6D 1J1EA 1NCXA 1YURA 2F2OA 1QS7A 2JT0A 2M1UA 1ODBA 1A29A 4GGFC 3O78A 1A4PA 2BCXA 3BUMB 3NSIA 3NSLA 4PCWA 1SCVA 1NCYA 2BCAA 1CDLA 4NDBA 1IH0A 2M97A 1JF2A 1PK0D 1FI5A 3TDIA 3CGAA 1S6JA 3GK4X 2AAOA 4TNCA 2KSPA 1PSRA 1QIWA 4MEWA 3H4SE 4A4BA 1F8HA 2MAZA 4PDZA 5FYXA 2LMTA 5DKRA 3CS1A 1NSHA 2LLSA 2SCPA 1DGUA 2V53A 2Y4QA 3GK1A 1UUSA 4N5XA 1QXPA 2OTGB 2M7LA 1M45A 4IL1A 5DKNA 3I5IB 1R2UA 2BECA 2E30A 2LP3A 1JC2A 1PULA 1OOJA 2JWWA 3CLNA 3M0WA 2ZRTA 1BOCA 1KFXS 4AQIA 2BKIB 4CLNA 1TNQA 2JOJA 2KOTA 1XYDA 1DJGA 1EXRA 1SY9A 1FPWA 4CIDA 2KYCA 1N2DA 3TUYB 5I2LA 1AK8A 2MLFC 3EVRA 5KSZA 1HQVA 3OB2B 1BR1B 1A75B 1UWOA 4YGCB 4ZCUA 3I5IC 2EC6B 2PVBA 1HT9A 1ALVA 2HF5A 1BLQA 5B8IB 2LANA 2RGIA 2R2IA 3LLEA 5HYDA 1A03A 2PSRA 3C1VA 3WHTB 2SASA 3TUYC 2MJWB 3PM8A 1SYMA 1WDCC 3DF0B 1WRKA 2FCDA 3JVTB 1CMFA 1SMGA 1EJ3A 4OR9B 1SRAA 1U5IA 2EC6C 2K2FA 2Y1MA 1SR6B 1VRKA 1KFXL 2GGZA 3TDZA 5JJGA 1WLZA 1MHOA 5D7FA 2JPTA 5I2QA 2ZN9A 1PSBA 3BUWB 4DIRA 1DMOA 4P5OE 1OMVA 2MHHA 4PE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AJ4 A;  3WNX B;  1SPY A;  1F71 A;  3JVT C;  2JNX A;  1TTX A;  2OS8 C;  3QRX A;  5HLO A;  1IQ5 A;  1SR6 C;  3CR4 X;  3I5G B;  3O6B A;  1KSM A;  1BG1 A;  1IWQ A;  2JU0 A;  1DT7 B;  1QX7 A;  1CTR A;  1QVI Y;  2KQ6 A;  2JT3 A;  2KI6 C;  2WCF A;  1NWD A;  4MLW A;  5JOL A;  3WXA A;  2WCE A;  4FTG A;  2GV5 A;  1N0Y A;  1J7R A;  5G08 A;  4Q04 A;  1KFU S;  1NIW A;  3GK2 A;  2JT8 A;  1NCZ A;  1S3P A;  1QJT A;  3I5G C;  1MUX A;  1S1E A;  2HET A;  2K8M B;  4GFT A;  2JRF A;  3NSO A;  1QTX A;  2MRD A;  5F6T A;  1CFC A;  1CMG A;  2QAC A;  3IF7 A;  1TNP A;  1K90 D;  1RJV A;  2HQW A;  3HCM A;  2COL B;  4E68 A;  5ER5 A;  2WND A;  3KO0 A;  4PE4 A;  3K21 A;  2B1U A;  4DS7 A;  2K7B A;  2NXQ A;  1IQ3 A;  4GPL B;  2L4I A;  2HQ8 A;  2CBL A;  4CFQ A;  4OVN F;  1YX7 A;  1Y1U A;  4YBH B;  1F70 A;  2I18 A;  4PE7 A;  1TN4 A;  2FJU B;  3VRQ A;  1W7J B;  1SL8 A;  3BYA A;  3O2P A;  3SG5 A;  1AUI B;  1MQ1 A;  1IJ5 A;  3AKB A;  1QAT A;  2LLT A;  2NZ0 A;  1XFW O;  1CLB A;  5J3X A;  2K2A A;  2M29 A;  1M63 B;  4MRX A;  2G2B A;  2KGB C;  2LE9 B;  3MSE B;  4GGN A;  1QLS A;  1J1D A;  1S26 D;  1J7P A;  3BUN B;  2AUC A;  2M8U A;  1M31 A;  2WCB A;  1KQV A;  4MZL A;  5IBW A;  1JWD A;  5GQQ C;  3HX4 A;  1AVS A;  3RM1 A;  3CR5 X;  4BY4 A;  1ZMZ A;  2M9G A;  3KEV A;  4XJK B;  2M7N A;  4L9M A;  2ZNE A;  4YGD B;  1XFZ O;  1SCM B;  1J7Q A;  1D1O A;  5CPV A;  5KU1 A;  2LV7 A;  2PAS A;  5HKW A;  1BU3 A;  1NPQ A;  1UHJ A;  3DVK A;  1XFV O;  4YRU A;  2NLN A;  2IS9 A;  3BUO B;  4I5N B;  4NQG A;  2P6B B;  1EL4 A;  3VGO A;  3OHM B;  3I5H B;  1JF0 A;  1UHN A;  4GAO A;  1IJ6 A;  1L2O B;  1QAS A;  1SCM C;  1TNW A;  1L7Z A;  1EG3 A;  2KFG A;  2JTZ A;  2LM5 A;  1TNX A;  1DF0 A;  2OPO A;  1TCF A;  2I7A A;  4JWQ A;  4PE1 A;  2LVJ A;  1MR8 A;  4PHK A;  4GGF A;  1SNL A;  2Y1N A;  3I5H C;  1G4Y R;  2OTG C;  5BPJ A;  3DVJ A;  4CFR A;  1UUR A;  4JQ0 D;  2FCE A;  4MBE A;  1GGZ A;  1OMD A;  3PAL A;  1EG4 A;  3KHE A;  4PHM A;  1KCY A;  1Y1X A;  1DJY A;  4HRH A;  2LNK A;  1QVI Z;  4MZJ A;  1JBA A;  2CCM A;  1SKT A;  1Y1A A;  1K96 A;  1F54 A;  2BCB A;  4DUQ A;  2KQY A;  2JUL A;  3DVE A;  4MN0 A;  1IGV A;  2PMY A;  3LK1 A;  1GQM A;  4M2O A;  1WLM A;  4BY5 A;  4C0L A;  1CDM A;  3D0Y B;  3AKA A;  1BMO A;  3TDU A;  3IQQ A;  5I2O A;  2K61 A;  2BL0 B;  3BOW B;  1X02 A;  2F3Z A;  4YI8 A;  3A8R A;  1XA5 A;  2LUX A;  4YI9 A;  2JXL A;  1ZFS A;  3ZNI A;  2JQ6 A;  1J55 A;  1XK4 C;  5CSF A;  1B9A A;  1KWO B;  1CFF A;  4I5J A;  1YTZ C;  2KFF A;  4MSP A;  1XFX O;  5HKY A;  4HRG A;  2BL0 C;  1EH2 A;  4HSZ A;  1YUT A;  2L5X B;  2TN4 A;  3KF9 A;  1S6I A;  1S5G Y;  1JFJ A;  1UHH A;  2KDH A;  1GGW A;  4M2Q A;  2LHI A;  1PAL A;  3EVV A;  1KWO C;  4AQJ A;  3NXA A;  1A75 A;  2KGR A;  5AER A;  1XFU O;  3RLZ A;  3I5F B;  1CNP A;  2G9B A;  3SG2 A;  1E8A A;  5CSJ A;  1JUO A;  2KFH A;  3PN7 B;  4C0K A;  3VRN A;  2L98 A;  4YGA A;  1MWN A;  1C07 A;  2H2K A;  2BE4 A;  1IG5 A;  2KAV A;  2PRU A;  5TNC A;  4CPV A;  3D10 A;  3FWB A;  2E6W A;  3WHU B;  1KK7 Y;  3DF0 A;  5AXI A;  1YRU B;  4GUK A;  1DJX A;  2CXJ A;  5ER4 X;  2K7O A;  1NX1 A;  3OX6 A;  1PVB A;  1KSO A;  3SIA A;  1WY9 A;  2KBI A;  3TZ1 A;  1NX2 A;  2MBX A;  1IRJ A;  2L51 A;  2BBM A;  2M3W A;  3CTN A;  1F55 A;  2ZND A;  1CM4 A;  1QV1 A;  2KAY A;  2LVI A;  3PSR A;  4ZCV A;  4DRW A;  2L0P A;  2AMI A;  2F2P A;  2JC2 A;  1K9P A;  3LK0 A;  1CM1 A;  3SG7 A;  5HLV A;  4DCK A;  2A4J A;  4YGB B;  1CB1 A;  2KNE A;  1NUB A;  4FQO A;  1QLK A;  1JFK A;  1S6C A;  1W7I B;  1SL9 A;  1K8U A;  1LA3 A;  1SW8 A;  1OQP A;  1TRF A;  2KAX A;  1B47 A;  4I5L B;  3NSK A;  4I5K A;  3PLF B;  1K93 D;  2D8N A;  3LCP C;  2CTN A;  1QX5 B;  1XFY O;  1BOD A;  3FWC A;  2L50 A;  2LVK A;  1OSA A;  1QIV A;  1RFJ A;  1K94 A;  4HRE E;  4M2P A;  4C0J A;  1NYA A;  4GNK B;  3EK8 A;  1DJZ A;  2M1K B;  2O60 A;  1BJF A;  1ZUZ A;  3DVM A;  1V1F A;  1J7O A;  1B1G A;  3E3R A;  4U8D A;  1Y6W A;  1QV0 A;  2JZI A;  1PVA A;  3EKJ A;  1G33 A;  2CNP A;  1CLM A;  1S36 A;  4D1E A;  5AFP A;  2JXC A;  3FS7 A;  1K2H A;  4MRY A;  1NX0 A;  4PAL A;  1U5I B;  1PRW A;  2LCP A;  2MLE C;  1K95 A;  2FOT A;  4OV2 A;  1WRZ A;  1FI6 A;  1DJW A;  3EK4 A;  2F33 A;  3SG4 A;  4WQ3 A;  1C7W A;  1KK8 B;  1SL7 A;  2LP2 A;  3VRP A;  3CR2 A;  4WQ2 A;  4ORC B;  3BUX B;  3LL8 B;  1B8R A;  3OX5 A;  4ICB A;  1FF1 A;  3A4U B;  1FBV A;  2NCO A;  1L2O C;  4MZK A;  2LMV A;  1H4B A;  2ZKM X;  1RRO A;  1UP5 A;  1F4Q A;  2WOR A;  4P2Y B;  4R1E A;  1B4C A;  2HPS A;  2JNF A;  3OB1 B;  1B7T Z;  1C7V A;  1CFD A;  2LMU A;  1XO5 A;  2BKH B;  1KK8 C;  2H61 C;  1RK9 A;  1YVL A;  3AAJ A;  2I94 A;  3DD4 A;  1DTL A;  1MF8 B;  1Q80 A;  2JTT A;  5DKQ A;  1OZO A;  2F3Y A;  1S5G Z;  3OP0 A;  5AEQ A;  1AP4 A;  3IQO A;  4GBA A;  5PAL A;  4XJK A;  2KBM A;  2LC5 A;  1RTP 1;  3EVU A;  1BT6 A;  2LUC A;  3CZT X;  1WDC B;  2I2R E;  2KYF A;  1DGV A;  2Q91 A;  1LXF C;  3JTD B;  2BE6 A;  1CDP A;  2KHN A;  4OCI A;  5HKZ A;  1B8L A;  1K9U A;  1TCO B;  1R6P A;  3O4Y A;  5CSN A;  1XVJ A;  2L4H A;  1GJY A;  2ZN8 A;  1SK6 D;  1K9K A;  1CKK A;  1KK7 Z;  1YVH A;  5K89 A;  2LAP A;  3SG3 A;  4F0Z B;  1DVI A;  1G8I A;  1YR5 A;  2CT9 A;  3JTD C;  2OS8 B;  2ISD A;  1CDN A;  1B7T Y;  2K7D A;  4QJ3 B;  2WOS A;  3AAK A;  1B8C A;  2K0J A;  3TS5 B;  1IKU A;  2K7C A;  1A2X A;  1TIZ A;  1CFP A;  1NX3 A;  2H61 A;  2LLU A;  2NCP A;  3EKH A;  2BBN A;  4N1G A;  4PHJ A;  1BF5 A;  2EHB A;  2M49 B;  3BXK A;  4NDC A;  1LVC D;  3SG6 A;  4ETO A;  4JPZ B;  2Y5I A;  1OMR A;  3CWG A;  2ZFD A;  1BR4 B;  2GGM A;  2MA2 A;  3ICB A;  1MXL C;  4UPG A;  1DJH A;  1N65 A;  2M0R A;  3PFV A;  4ORB B;  2F8P A;  2LHL A;  1AJ5 A;  1YUS A;  3TS5 C;  2ZRS A;  1REC A;  5I8N A;  1KQM B;  3ZWH A;  1RWY A;  1UHK A;  1NP8 A;  1ZOT B;  2KI4 B;  1AHR A;  1JSA A;  4QJ4 B;  3VRO A;  3GOF A;  1XK4 A;  1LIN A;  3I5F C;  1UHI A;  1ZAC A;  4WRI A;  3D0Y A;  3PN7 C;  4YGE B;  4MVF A;  1YUU A;  1KQM C;  1YX8 A;  4A4C A;  1QX2 A;  2L2E A;  2WC8 A;  2KI4 C;  3BOW A;  4USL A;  3VRR A;  1MXE A;  5CSI A;  5AAN A;  3F45 A;  3BQ3 A;  5D69 A;  1F4O A;  4PHN A;  4QJ5 B;  4AOM A;  1LKJ A;  2O5G A;  1WRL A;  1DF0 B;  4XYN A;  1M39 A;  2QPT A;  4ORA B;  1ALW A;  1H8B A;  2LVV A;  1TOP A;  2Q4U A;  1Y0V H;  3FIA A;  4NDD A;  3EK7 A;  3PAT A;  1FW4 A;  3KPX A;  3SJS A;  1CLL A;  4N1F A;  3SIB A;  2EGD A;  1LA0 A;  2PAL A;  4OKH A;  1KFU L;  1DJI A;  1V1G A;  1OZS A;  1YRT B;  1M46 A;  1OE9 B;  1SBJ A;  5KTY A;  2DOQ A;  2VRG A;  2KI6 D;  1J1E A;  1NCX A;  1YUR A;  2F2O A;  1QS7 A;  2JT0 A;  2M1U A;  1ODB A;  1A29 A;  4GGF C;  3O78 A;  1A4P A;  2BCX A;  3BUM B;  3NSI A;  3NSL A;  4PCW A;  1SCV A;  1NCY A;  2BCA A;  1CDL A;  4NDB A;  1IH0 A;  2M97 A;  1JF2 A;  1PK0 D;  1FI5 A;  3TDI A;  3CGA A;  1S6J A;  3GK4 X;  2AAO A;  4TNC A;  2KSP A;  1PSR A;  1QIW A;  4MEW A;  3H4S E;  4A4B A;  1F8H A;  2MAZ A;  4PDZ A;  5FYX A;  2LMT A;  5DKR A;  3CS1 A;  1NSH A;  2LLS A;  2SCP A;  1DGU A;  2V53 A;  2Y4Q A;  3GK1 A;  1UUS A;  4N5X A;  1QXP A;  2OTG B;  2M7L A;  1M45 A;  4IL1 A;  5DKN A;  3I5I B;  1R2U A;  2BEC A;  2E30 A;  2LP3 A;  1JC2 A;  1PUL A;  1OOJ A;  2JWW A;  3CLN A;  3M0W A;  2ZRT A;  1BOC A;  1KFX S;  4AQI A;  2BKI B;  4CLN A;  1TNQ A;  2JOJ A;  2KOT A;  1XYD A;  1DJG A;  1EXR A;  1SY9 A;  1FPW A;  4CID A;  2KYC A;  1N2D A;  3TUY B;  5I2L A;  1AK8 A;  2MLF C;  3EVR A;  5KSZ A;  1HQV A;  3OB2 B;  1BR1 B;  1A75 B;  1UWO A;  4YGC B;  4ZCU A;  3I5I C;  2EC6 B;  2PVB A;  1HT9 A;  1ALV A;  2HF5 A;  1BLQ A;  5B8I B;  2LAN A;  2RGI A;  2R2I A;  3LLE A;  5HYD A;  1A03 A;  2PSR A;  3C1V A;  3WHT B;  2SAS A;  3TUY C;  2MJW B;  3PM8 A;  1SYM A;  1WDC C;  3DF0 B;  1WRK A;  2FCD A;  3JVT B;  1CMF A;  1SMG A;  1EJ3 A;  4OR9 B;  1SRA A;  1U5I A;  2EC6 C;  2K2F A;  2Y1M A;  1SR6 B;  1VRK A;  1KFX L;  2GGZ A;  3TDZ A;  5JJG A;  1WLZ A;  1MHO A;  5D7F A;  2JPT A;  5I2Q A;  2ZN9 A;  1PSB A;  3BUW B;  4DIR A;  1DMO A;  4P5O E;  1OMV A;  2MHH A;  4PE0 A; 
#chains in the Genus database with same CATH topology
 1AJ4 A;  2BAP A;  1SPY A;  3UNW A;  3WNX B;  1F71 A;  3JVT C;  2JNX A;  1TTX A;  2OS8 C;  3QRX A;  5HLO A;  1IQ5 A;  1SR6 C;  3CR4 X;  3I5G B;  3O6B A;  3B87 A;  1KSM A;  1BG1 A;  1IWQ A;  3FE6 A;  2JU0 A;  1DT7 B;  1QX7 A;  1CTR A;  1QVI Y;  2WCM A;  3OGN A;  2KLD A;  2JT3 A;  2KI6 C;  2KQ6 A;  2WCF A;  1NWD A;  4MLW A;  5JOL A;  3WXA A;  2WCE A;  4FTG A;  2GV5 A;  1N0Y A;  1J7R A;  5G08 A;  4Q04 A;  1KFU S;  1NIW A;  3GK2 A;  1Z2C B;  1NCZ A;  1S3P A;  2JT8 A;  1QJT A;  3CAB A;  3I5G C;  1MUX A;  1S1E A;  2HET A;  2K8M B;  4GFT A;  2JRF A;  3NSO A;  1QTX A;  2MRD A;  5F6T A;  1CFC A;  1CMG A;  2QAC A;  3IF7 A;  1TNP A;  1K90 D;  1RJV A;  2HQW A;  3HCM A;  2COL B;  4E68 A;  5ER5 A;  2WND A;  3KO0 A;  4PE4 A;  3K21 A;  2B1U A;  2PQL A;  4DS7 A;  2K7B A;  2NXQ A;  1IQ3 A;  4GPL B;  2L4I A;  2HQ8 A;  2CBL A;  4CFQ A;  4OVN F;  1YX7 A;  1Y1U A;  4YBH B;  1F70 A;  2I18 A;  4PE7 A;  1DC1 A;  1TN4 A;  2FJU B;  3VRQ A;  1W7J B;  1SL8 A;  1IIO A;  3BYA A;  3O2P A;  3SG5 A;  1AUI B;  1MQ1 A;  1IJ5 A;  3AKB A;  1TWO A;  1QAT A;  2LLT A;  4FQT A;  2NZ0 A;  1XFW O;  1CLB A;  5J3X A;  2K2A A;  2M29 A;  1M63 B;  4MRX A;  3N7H A;  5EL2 A;  2G2B A;  2KGB C;  2LE9 B;  3MSE B;  1DEK A;  4GGN A;  1QLS A;  3S0D A;  1J1D A;  3UO9 A;  3D75 A;  1S26 D;  1J7P A;  3BUN B;  2AUC A;  2M8U A;  1M31 A;  2WCB A;  1KQV A;  4MZL A;  5IBW A;  1JWD A;  5GQQ C;  2WC5 A;  2WCJ A;  3HX4 A;  1AVS A;  3RM1 A;  3CR5 X;  4BY4 A;  1ZMZ A;  2M9G A;  3KEV A;  3D77 A;  4XJK B;  2M7N A;  4L9M A;  2ZNE A;  4YGD B;  1XFZ O;  1SCM B;  1J7Q A;  1D1O A;  5CPV A;  5KU1 A;  2LV7 A;  2PAS A;  1T14 A;  2YGU A;  3IVT A;  5HKW A;  1BU3 A;  1NPQ A;  1UHJ A;  3DVK A;  1XFV O;  3BFB A;  4YRU A;  2NLN A;  2IS9 A;  3BUO B;  3SS5 A;  2H8V A;  4I5N B;  4NQG A;  2P6B B;  1EL4 A;  1SSE B;  4PT1 A;  3VGO A;  3OHM B;  3I5H B;  1JF0 A;  4OZD A;  1UHN A;  4GAO A;  1IJ6 A;  1L2O B;  1QAS A;  1SCM C;  1TNW A;  1L7Z A;  1EG3 A;  2KPH A;  2KFG A;  3CZ0 A;  2JTZ A;  2LM5 A;  1TNX A;  1DF0 A;  2OPO A;  1TCF A;  2I7A A;  4JWQ A;  4PE1 A;  2KLE A;  2LVJ A;  3DXL A;  1MR8 A;  4PHK A;  4GGF A;  1SNL A;  2Y1N A;  3I5H C;  1G4Y R;  2OTG C;  5BPJ A;  3DVJ A;  4CFR A;  1UUR A;  4JQ0 D;  2FCE A;  4MBE A;  1GGZ A;  1OMD A;  2BNX A;  1EG4 A;  3PAL A;  3KHE A;  4PHM A;  1KCY A;  1Y1X A;  1DJY A;  4HRH A;  2LNK A;  1QVI Z;  1GM0 A;  4MZJ A;  1JBA A;  2CCM A;  2WCK A;  1SKT A;  1Y1A A;  1K96 A;  1F54 A;  2BCB A;  4DUQ A;  2KQY A;  2JUL A;  3DVE A;  4MN0 A;  3D78 A;  1IGV A;  2PMY A;  3LK1 A;  1GQM A;  4M2O A;  1WLM A;  4BY5 A;  4C0L A;  1CDM A;  3D0Y B;  3AKA A;  1BMO A;  3TDU A;  3D73 A;  3IQQ A;  5I2O A;  2K61 A;  2BL0 B;  3BOW B;  1X02 A;  2F3Z A;  4YI8 A;  3A8R A;  1XA5 A;  2LUX A;  4YI9 A;  2JXL A;  1ZFS A;  5I94 A;  3ZNI A;  2JQ6 A;  1J55 A;  1XK4 C;  5CSF A;  1B9A A;  5FI7 A;  1KWO B;  1CFF A;  4I5J A;  3EG5 B;  1YTZ C;  2KFF A;  2P71 A;  2QEO A;  1XFX O;  2QDI A;  4MSP A;  5HKY A;  4HRG A;  2BL0 C;  1EH2 A;  4HSZ A;  1YUT A;  2L5X B;  2TN4 A;  3KF9 A;  1S6I A;  1S5G Y;  1JFJ A;  1UHH A;  2KDH A;  1GGW A;  4M2Q A;  2LHI A;  1PAL A;  3EVV A;  3NHI A;  1KWO C;  4AQJ A;  3NXA A;  1A75 A;  2KGR A;  5AER A;  1XFU O;  3RLZ A;  3I5F B;  2PYQ A;  1CNP A;  2G9B A;  3SG2 A;  1E8A A;  5CSJ A;  1JUO A;  2KFH A;  3PN7 B;  1LS8 A;  4JD9 A;  3VRN A;  2L98 A;  4YGA A;  4C0K A;  2GTE A;  1MWN A;  1C07 A;  2H2K A;  2BE4 A;  1IG5 A;  2KAV A;  2PRU A;  3R72 A;  5TNC A;  4CPV A;  3D10 A;  3FWB A;  3R1O A;  2FJY A;  2E6W A;  3WHU B;  1KK7 Y;  3DF0 A;  5AXI A;  1YRU B;  4GUK A;  1DJX A;  2CXJ A;  5ER4 X;  2K7O A;  1NX1 A;  3OX6 A;  1PVB A;  1KSO A;  3SIA A;  1WY9 A;  2KBI A;  2WCL A;  3TZ1 A;  1NX2 A;  2MBX A;  1IRJ A;  2L51 A;  2BBM A;  2M3W A;  3CTN A;  1OW4 A;  1F55 A;  2ZND A;  1CM4 A;  1QV1 A;  2KAY A;  2LVI A;  3L4L A;  3PSR A;  4ZCV A;  4DRW A;  2L0P A;  2AMI A;  2JPO A;  2F2P A;  2JC2 A;  1K9P A;  3LK0 A;  1CM1 A;  3S0E A;  3SG7 A;  5HLV A;  4DCK A;  4F7F A;  2A4J A;  2K60 A;  4YGB B;  1CB1 A;  2KNE A;  1NUB A;  4FQO A;  1QLK A;  1JFK A;  1S6C A;  1W7I B;  1SL9 A;  1K8U A;  1LA3 A;  1SW8 A;  1C3Y A;  1OQP A;  1TRF A;  2KAX A;  1B47 A;  4I5L B;  3NSK A;  4I5K A;  3PLF B;  1K93 D;  2D8N A;  1TUJ A;  3LCP C;  2CTN A;  3NGV A;  1QX5 B;  1XFY O;  1BOD A;  3FWC A;  2L50 A;  3S0A A;  2LVK A;  1OSA A;  1QIV A;  1RFJ A;  1K94 A;  4HRE E;  4M2P A;  4C0J A;  1NYA A;  3OBV A;  3EK8 A;  4GNK B;  1DJZ A;  2M1K B;  3B7A A;  3D74 A;  2O60 A;  1BJF A;  1ZUZ A;  3DVM A;  1V1F A;  1J7O A;  1Z4H A;  1B1G A;  3E3R A;  4U8D A;  1Y6W A;  1QV0 A;  2JZI A;  1PVA A;  3EKJ A;  1G33 A;  2CNP A;  1CLM A;  1S36 A;  4D1E A;  3K1E A;  5AFP A;  2JXC A;  3FS7 A;  1K2H A;  4MRY A;  1NX0 A;  3DY9 A;  4PAL A;  1U5I B;  1PRW A;  2LCP A;  3S0F A;  2MLE C;  1K95 A;  2FOT A;  4OV2 A;  1WRZ A;  1FI6 A;  1DJW A;  3SS3 A;  3EK4 A;  2F33 A;  3SG4 A;  4WQ3 A;  1C7W A;  1KK8 B;  1SL7 A;  2LP2 A;  3VRP A;  3CR2 A;  4WQ2 A;  3D76 A;  4ORC B;  3BUX B;  3LL8 B;  1B8R A;  3OX5 A;  4ICB A;  1FF1 A;  3A4U B;  1FBV A;  2NCO A;  1L2O C;  4MZK A;  2LMV A;  2QEB A;  1H4B A;  2ZKM X;  1RRO A;  1UP5 A;  1F4Q A;  2WOR A;  4P2Y B;  4R1E A;  1B4C A;  2HPS A;  2JNF A;  3OB1 B;  1B7T Z;  1C7V A;  1CFD A;  2LMU A;  1XO5 A;  2BKH B;  1KK8 C;  2H61 C;  3B86 A;  1RK9 A;  1YVL A;  3AAJ A;  2I94 A;  3DD4 A;  1DTL A;  1MF8 B;  1Q80 A;  2JTT A;  5DKQ A;  1OZO A;  3NHT A;  2F3Y A;  1S5G Z;  3OP0 A;  5AEQ A;  1AP4 A;  3IQO A;  4GBA A;  5PAL A;  4XJK A;  2KBM A;  2LC5 A;  1RTP 1;  3EVU A;  1BT6 A;  2LUC A;  3CZT X;  1WDC B;  2I2R E;  2KYF A;  1DGV A;  2Q91 A;  1LXF C;  3JTD B;  2BE6 A;  1CDP A;  2KHN A;  4OCI A;  5HKZ A;  1B8L A;  1P28 A;  5D3O A;  1K9U A;  1TCO B;  1R6P A;  3O4Y A;  5CSN A;  1XVJ A;  2L4H A;  1GJY A;  2ZN8 A;  1SK6 D;  1K9K A;  1CKK A;  1KK7 Z;  1YVH A;  5K89 A;  2LAP A;  3SG3 A;  4F0Z B;  1DVI A;  1G8I A;  1YR5 A;  2CT9 A;  3JTD C;  2OS8 B;  2ISD A;  1CDN A;  1B7T Y;  2K7D A;  4QJ3 B;  2WOS A;  4INW A;  3DYE A;  1XFR A;  3AAK A;  1B8C A;  2K0J A;  3TS5 B;  1IKU A;  2K7C A;  1A2X A;  1TIZ A;  1CFP A;  1NX3 A;  3Q8I A;  2H61 A;  2LLU A;  2NCP A;  3EKH A;  2BBN A;  4N1G A;  4PHJ A;  5HL1 A;  1BF5 A;  2EHB A;  2M49 B;  3BXK A;  4NDC A;  1LVC D;  3SG6 A;  4ETO A;  4JPZ B;  2Y5I A;  1OMR A;  3CWG A;  5DIC A;  3S0G A;  2ZFD A;  1BR4 B;  2GGM A;  2MA2 A;  3ICB A;  1MXL C;  2QEV A;  4UPG A;  1DJH A;  1N65 A;  2M0R A;  3PFV A;  3BFA A;  3BFH A;  2F8P A;  2LHL A;  2P70 A;  4ORB B;  1AJ5 A;  1YUS A;  1OOG A;  2ZRS A;  1REC A;  3B88 A;  1KQM B;  3CDN A;  4INX A;  3TS5 C;  1RWY A;  3ZWH A;  1UHK A;  5I8N A;  1NP8 A;  1ZOT B;  2KI4 B;  1AHR A;  2WC6 A;  3B6X A;  1JSA A;  4QJ4 B;  3VRO A;  3GOF A;  4JKT A;  3L4A A;  1XK4 A;  1LIN A;  3L47 A;  3I5F C;  1UHI A;  1ZAC A;  3QME A;  3D0Y A;  4WRI A;  3PN7 C;  4YGE B;  4MVF A;  1YUU A;  1KQM C;  1YX8 A;  4A4C A;  1OOF A;  1QX2 A;  2L2E A;  2WC8 A;  2KI4 C;  3BOW A;  4USL A;  3VRR A;  1MXE A;  5CSI A;  5AAN A;  3F45 A;  3BQ3 A;  5D69 A;  1F4O A;  4PHN A;  4QJ5 B;  4AOM A;  3DZT A;  3O4X A;  1LKJ A;  2O5G A;  1WRL A;  3R1P A;  1DF0 B;  4XYN A;  3SS4 A;  1M39 A;  2QPT A;  4ORA B;  1ALW A;  1H8B A;  2LVV A;  1TOP A;  2Q4U A;  1Y0V H;  3CZ2 A;  3FIA A;  1QWV A;  3EK7 A;  1FW4 A;  3PAT A;  3KPX A;  4NDD A;  3R1V A;  1TUZ A;  1CLL A;  3SJS A;  4N1F A;  3SIB A;  4KYN A;  2EGD A;  2L2C A;  1LA0 A;  2PAL A;  4OKH A;  1KFU L;  1DJI A;  1V1G A;  1OZS A;  1YRT B;  1M46 A;  1OE9 B;  3CZ1 A;  1SBJ A;  5KTY A;  2DOQ A;  2VRG A;  1DQE A;  2KI6 D;  1J1E A;  1NCX A;  1YUR A;  2F2O A;  1QS7 A;  2JT0 A;  2M1U A;  1ODB A;  1A29 A;  4GGF C;  3O78 A;  1A4P A;  2BCX A;  3BUM B;  3NSI A;  3NSL A;  4PCW A;  1SCV A;  2L5Y A;  1NCY A;  2BCA A;  2ERB A;  1CDL A;  4NDB A;  1IH0 A;  2M97 A;  1JF2 A;  1PK0 D;  1FI5 A;  3TDI A;  3S0B A;  3CGA A;  1S6J A;  3GK4 X;  2AAO A;  4TNC A;  2KSP A;  1PSR A;  1QIW A;  4MEW A;  3H4S E;  4A4B A;  1F8H A;  2MAZ A;  3CYZ A;  4PDZ A;  5FYX A;  2LMT A;  5DKR A;  3CS1 A;  1NSH A;  2LLS A;  2SCP A;  1DGU A;  2V53 A;  2Y4Q A;  3GK1 A;  3PJI A;  5FI6 A;  3VB1 A;  1UUS A;  4N5X A;  3RZS A;  1DEL A;  1QXP A;  2OTG B;  2M7L A;  1M45 A;  4IL1 A;  2WCH A;  5DKN A;  3I5I B;  1R2U A;  2BEC A;  2E30 A;  2LP3 A;  1C3Z A;  1JC2 A;  1PUL A;  1OOJ A;  2JWW A;  3CLN A;  3PM2 A;  3M0W A;  2ZRT A;  1BOC A;  1KFX S;  4AQI A;  2BKI B;  3FE8 A;  4CLN A;  1TNQ A;  2JOJ A;  2KOT A;  1XYD A;  1DJG A;  1EXR A;  1SY9 A;  1FPW A;  4CID A;  2KYC A;  1N2D A;  3TUY B;  5I2L A;  1AK8 A;  2MLF C;  3EVR A;  5KSZ A;  5FI2 A;  1HQV A;  3OB2 B;  1BR1 B;  1A75 B;  1OOH A;  1UWO A;  4YGC B;  4ZCU A;  3I5I C;  2EC6 B;  2PVB A;  1OOI X;  4IJ7 A;  1HT9 A;  1ALV A;  2HF5 A;  1BLQ A;  5B8I B;  2LAN A;  2QEH A;  2RGI A;  2R2I A;  3LLE A;  5HYD A;  1A03 A;  2PSR A;  3C1V A;  3WHT B;  2SAS A;  3TUY C;  2MJW B;  3FE9 A;  3PM8 A;  1SYM A;  1WDC C;  3DF0 B;  1WRK A;  2FCD A;  3JVT B;  1CMF A;  1SMG A;  1EJ3 A;  4OR9 B;  3V2L A;  1SRA A;  1U5I A;  2EC6 C;  2K2F A;  2Y1M A;  3BJH A;  1SR6 B;  1VRK A;  1KFX L;  2GGZ A;  3TDZ A;  5JJG A;  1ORG A;  1MHO A;  1WLZ A;  5D7F A;  2JPT A;  5I2Q A;  2ZN9 A;  1PSB A;  3BUW B;  4DIR A;  1DMO A;  1W9Z A;  4P5O E;  1OMV A;  2MHH A;  4PE0 A; 
#chains in the Genus database with same CATH homology
 1AJ4 A;  3WNX B;  1SPY A;  1F71 A;  3JVT C;  2JNX A;  1TTX A;  2OS8 C;  3QRX A;  5HLO A;  1IQ5 A;  1SR6 C;  3CR4 X;  3I5G B;  3O6B A;  1KSM A;  1BG1 A;  1IWQ A;  2JU0 A;  1DT7 B;  1QX7 A;  1CTR A;  1QVI Y;  2KQ6 A;  2JT3 A;  2KI6 C;  2WCF A;  1NWD A;  4MLW A;  5JOL A;  3WXA A;  2WCE A;  4FTG A;  2GV5 A;  1N0Y A;  1J7R A;  5G08 A;  4Q04 A;  1KFU S;  1NIW A;  3GK2 A;  2JT8 A;  1NCZ A;  1S3P A;  1QJT A;  3I5G C;  1MUX A;  1S1E A;  2HET A;  2K8M B;  4GFT A;  2JRF A;  3NSO A;  1QTX A;  2MRD A;  5F6T A;  1CFC A;  1CMG A;  2QAC A;  3IF7 A;  1TNP A;  1K90 D;  1RJV A;  2HQW A;  3HCM A;  2COL B;  4E68 A;  5ER5 A;  2WND A;  3KO0 A;  4PE4 A;  3K21 A;  2B1U A;  4DS7 A;  2K7B A;  2NXQ A;  1IQ3 A;  4GPL B;  2L4I A;  2HQ8 A;  2CBL A;  4CFQ A;  4OVN F;  1YX7 A;  1Y1U A;  4YBH B;  1F70 A;  2I18 A;  4PE7 A;  1TN4 A;  2FJU B;  3VRQ A;  1W7J B;  1SL8 A;  3BYA A;  3O2P A;  3SG5 A;  1AUI B;  1MQ1 A;  1IJ5 A;  3AKB A;  1QAT A;  2LLT A;  2NZ0 A;  1XFW O;  1CLB A;  5J3X A;  2K2A A;  2M29 A;  1M63 B;  4MRX A;  2G2B A;  2KGB C;  2LE9 B;  3MSE B;  4GGN A;  1QLS A;  1J1D A;  1S26 D;  1J7P A;  3BUN B;  2AUC A;  2M8U A;  1M31 A;  2WCB A;  1KQV A;  4MZL A;  5IBW A;  1JWD A;  5GQQ C;  3HX4 A;  1AVS A;  3RM1 A;  3CR5 X;  4BY4 A;  1ZMZ A;  2M9G A;  3KEV A;  4XJK B;  2M7N A;  4L9M A;  2ZNE A;  4YGD B;  1XFZ O;  1SCM B;  1J7Q A;  1D1O A;  5CPV A;  5KU1 A;  2LV7 A;  2PAS A;  5HKW A;  1BU3 A;  1NPQ A;  1UHJ A;  3DVK A;  1XFV O;  4YRU A;  2NLN A;  2IS9 A;  3BUO B;  4I5N B;  4NQG A;  2P6B B;  1EL4 A;  3VGO A;  3OHM B;  3I5H B;  1JF0 A;  1UHN A;  4GAO A;  1IJ6 A;  1L2O B;  1QAS A;  1SCM C;  1TNW A;  1L7Z A;  1EG3 A;  2KFG A;  2JTZ A;  2LM5 A;  1TNX A;  1DF0 A;  2OPO A;  1TCF A;  2I7A A;  4JWQ A;  4PE1 A;  2LVJ A;  1MR8 A;  4PHK A;  4GGF A;  1SNL A;  2Y1N A;  3I5H C;  1G4Y R;  2OTG C;  5BPJ A;  3DVJ A;  4CFR A;  1UUR A;  4JQ0 D;  2FCE A;  4MBE A;  1GGZ A;  1OMD A;  3PAL A;  1EG4 A;  3KHE A;  4PHM A;  1KCY A;  1Y1X A;  1DJY A;  4HRH A;  2LNK A;  1QVI Z;  4MZJ A;  1JBA A;  2CCM A;  1SKT A;  1Y1A A;  1K96 A;  1F54 A;  2BCB A;  4DUQ A;  2KQY A;  2JUL A;  3DVE A;  4MN0 A;  1IGV A;  2PMY A;  3LK1 A;  1GQM A;  4M2O A;  1WLM A;  4BY5 A;  4C0L A;  1CDM A;  3D0Y B;  3AKA A;  1BMO A;  3TDU A;  3IQQ A;  5I2O A;  2K61 A;  2BL0 B;  3BOW B;  1X02 A;  2F3Z A;  4YI8 A;  3A8R A;  1XA5 A;  2LUX A;  4YI9 A;  2JXL A;  1ZFS A;  3ZNI A;  2JQ6 A;  1J55 A;  1XK4 C;  5CSF A;  1B9A A;  1KWO B;  1CFF A;  4I5J A;  1YTZ C;  2KFF A;  4MSP A;  1XFX O;  5HKY A;  4HRG A;  2BL0 C;  1EH2 A;  4HSZ A;  1YUT A;  2L5X B;  2TN4 A;  3KF9 A;  1S6I A;  1S5G Y;  1JFJ A;  1UHH A;  2KDH A;  1GGW A;  4M2Q A;  2LHI A;  1PAL A;  3EVV A;  1KWO C;  4AQJ A;  3NXA A;  1A75 A;  2KGR A;  5AER A;  1XFU O;  3RLZ A;  3I5F B;  1CNP A;  2G9B A;  3SG2 A;  1E8A A;  5CSJ A;  1JUO A;  2KFH A;  3PN7 B;  4C0K A;  3VRN A;  2L98 A;  4YGA A;  1MWN A;  1C07 A;  2H2K A;  2BE4 A;  1IG5 A;  2KAV A;  2PRU A;  5TNC A;  4CPV A;  3D10 A;  3FWB A;  2E6W A;  3WHU B;  1KK7 Y;  3DF0 A;  5AXI A;  1YRU B;  4GUK A;  1DJX A;  2CXJ A;  5ER4 X;  2K7O A;  1NX1 A;  3OX6 A;  1PVB A;  1KSO A;  3SIA A;  1WY9 A;  2KBI A;  3TZ1 A;  1NX2 A;  2MBX A;  1IRJ A;  2L51 A;  2BBM A;  2M3W A;  3CTN A;  1F55 A;  2ZND A;  1CM4 A;  1QV1 A;  2KAY A;  2LVI A;  3PSR A;  4ZCV A;  4DRW A;  2L0P A;  2AMI A;  2F2P A;  2JC2 A;  1K9P A;  3LK0 A;  1CM1 A;  3SG7 A;  5HLV A;  4DCK A;  2A4J A;  4YGB B;  1CB1 A;  2KNE A;  1NUB A;  4FQO A;  1QLK A;  1JFK A;  1S6C A;  1W7I B;  1SL9 A;  1K8U A;  1LA3 A;  1SW8 A;  1OQP A;  1TRF A;  2KAX A;  1B47 A;  4I5L B;  3NSK A;  4I5K A;  3PLF B;  1K93 D;  2D8N A;  3LCP C;  2CTN A;  1QX5 B;  1XFY O;  1BOD A;  3FWC A;  2L50 A;  2LVK A;  1OSA A;  1QIV A;  1RFJ A;  1K94 A;  4HRE E;  4M2P A;  4C0J A;  1NYA A;  4GNK B;  3EK8 A;  1DJZ A;  2M1K B;  2O60 A;  1BJF A;  1ZUZ A;  3DVM A;  1V1F A;  1J7O A;  1B1G A;  3E3R A;  4U8D A;  1Y6W A;  1QV0 A;  2JZI A;  1PVA A;  3EKJ A;  1G33 A;  2CNP A;  1CLM A;  1S36 A;  4D1E A;  5AFP A;  2JXC A;  3FS7 A;  1K2H A;  4MRY A;  1NX0 A;  4PAL A;  1U5I B;  1PRW A;  2LCP A;  2MLE C;  1K95 A;  2FOT A;  4OV2 A;  1WRZ A;  1FI6 A;  1DJW A;  3EK4 A;  2F33 A;  3SG4 A;  4WQ3 A;  1C7W A;  1KK8 B;  1SL7 A;  2LP2 A;  3VRP A;  3CR2 A;  4WQ2 A;  4ORC B;  3BUX B;  3LL8 B;  1B8R A;  3OX5 A;  4ICB A;  1FF1 A;  3A4U B;  1FBV A;  2NCO A;  1L2O C;  4MZK A;  2LMV A;  1H4B A;  2ZKM X;  1RRO A;  1UP5 A;  1F4Q A;  2WOR A;  4P2Y B;  4R1E A;  1B4C A;  2HPS A;  2JNF A;  3OB1 B;  1B7T Z;  1C7V A;  1CFD A;  2LMU A;  1XO5 A;  2BKH B;  1KK8 C;  2H61 C;  1RK9 A;  1YVL A;  3AAJ A;  2I94 A;  3DD4 A;  1DTL A;  1MF8 B;  1Q80 A;  2JTT A;  5DKQ A;  1OZO A;  2F3Y A;  1S5G Z;  3OP0 A;  5AEQ A;  1AP4 A;  3IQO A;  4GBA A;  5PAL A;  4XJK A;  2KBM A;  2LC5 A;  1RTP 1;  3EVU A;  1BT6 A;  2LUC A;  3CZT X;  1WDC B;  2I2R E;  2KYF A;  1DGV A;  2Q91 A;  1LXF C;  3JTD B;  2BE6 A;  1CDP A;  2KHN A;  4OCI A;  5HKZ A;  1B8L A;  1K9U A;  1TCO B;  1R6P A;  3O4Y A;  5CSN A;  1XVJ A;  2L4H A;  1GJY A;  2ZN8 A;  1SK6 D;  1K9K A;  1CKK A;  1KK7 Z;  1YVH A;  5K89 A;  2LAP A;  3SG3 A;  4F0Z B;  1DVI A;  1G8I A;  1YR5 A;  2CT9 A;  3JTD C;  2OS8 B;  2ISD A;  1CDN A;  1B7T Y;  2K7D A;  4QJ3 B;  2WOS A;  3AAK A;  1B8C A;  2K0J A;  3TS5 B;  1IKU A;  2K7C A;  1A2X A;  1TIZ A;  1CFP A;  1NX3 A;  2H61 A;  2LLU A;  2NCP A;  3EKH A;  2BBN A;  4N1G A;  4PHJ A;  1BF5 A;  2EHB A;  2M49 B;  3BXK A;  4NDC A;  1LVC D;  3SG6 A;  4ETO A;  4JPZ B;  2Y5I A;  1OMR A;  3CWG A;  2ZFD A;  1BR4 B;  2GGM A;  2MA2 A;  3ICB A;  1MXL C;  4UPG A;  1DJH A;  1N65 A;  2M0R A;  3PFV A;  4ORB B;  2F8P A;  2LHL A;  1AJ5 A;  1YUS A;  3TS5 C;  2ZRS A;  1REC A;  5I8N A;  1KQM B;  3ZWH A;  1RWY A;  1UHK A;  1NP8 A;  1ZOT B;  2KI4 B;  1AHR A;  1JSA A;  4QJ4 B;  3VRO A;  3GOF A;  1XK4 A;  1LIN A;  3I5F C;  1UHI A;  1ZAC A;  4WRI A;  3D0Y A;  3PN7 C;  4YGE B;  4MVF A;  1YUU A;  1KQM C;  1YX8 A;  4A4C A;  1QX2 A;  2L2E A;  2WC8 A;  2KI4 C;  3BOW A;  4USL A;  3VRR A;  1MXE A;  5CSI A;  5AAN A;  3F45 A;  3BQ3 A;  5D69 A;  1F4O A;  4PHN A;  4QJ5 B;  4AOM A;  1LKJ A;  2O5G A;  1WRL A;  1DF0 B;  4XYN A;  1M39 A;  2QPT A;  4ORA B;  1ALW A;  1H8B A;  2LVV A;  1TOP A;  2Q4U A;  1Y0V H;  3FIA A;  4NDD A;  3EK7 A;  3PAT A;  1FW4 A;  3KPX A;  3SJS A;  1CLL A;  4N1F A;  3SIB A;  2EGD A;  1LA0 A;  2PAL A;  4OKH A;  1KFU L;  1DJI A;  1V1G A;  1OZS A;  1YRT B;  1M46 A;  1OE9 B;  1SBJ A;  5KTY A;  2DOQ A;  2VRG A;  2KI6 D;  1J1E A;  1NCX A;  1YUR A;  2F2O A;  1QS7 A;  2JT0 A;  2M1U A;  1ODB A;  1A29 A;  4GGF C;  3O78 A;  1A4P A;  2BCX A;  3BUM B;  3NSI A;  3NSL A;  4PCW A;  1SCV A;  1NCY A;  2BCA A;  1CDL A;  4NDB A;  1IH0 A;  2M97 A;  1JF2 A;  1PK0 D;  1FI5 A;  3TDI A;  3CGA A;  1S6J A;  3GK4 X;  2AAO A;  4TNC A;  2KSP A;  1PSR A;  1QIW A;  4MEW A;  3H4S E;  4A4B A;  1F8H A;  2MAZ A;  4PDZ A;  5FYX A;  2LMT A;  5DKR A;  3CS1 A;  1NSH A;  2LLS A;  2SCP A;  1DGU A;  2V53 A;  2Y4Q A;  3GK1 A;  1UUS A;  4N5X A;  1QXP A;  2OTG B;  2M7L A;  1M45 A;  4IL1 A;  5DKN A;  3I5I B;  1R2U A;  2BEC A;  2E30 A;  2LP3 A;  1JC2 A;  1PUL A;  1OOJ A;  2JWW A;  3CLN A;  3M0W A;  2ZRT A;  1BOC A;  1KFX S;  4AQI A;  2BKI B;  4CLN A;  1TNQ A;  2JOJ A;  2KOT A;  1XYD A;  1DJG A;  1EXR A;  1SY9 A;  1FPW A;  4CID A;  2KYC A;  1N2D A;  3TUY B;  5I2L A;  1AK8 A;  2MLF C;  3EVR A;  5KSZ A;  1HQV A;  3OB2 B;  1BR1 B;  1A75 B;  1UWO A;  4YGC B;  4ZCU A;  3I5I C;  2EC6 B;  2PVB A;  1HT9 A;  1ALV A;  2HF5 A;  1BLQ A;  5B8I B;  2LAN A;  2RGI A;  2R2I A;  3LLE A;  5HYD A;  1A03 A;  2PSR A;  3C1V A;  3WHT B;  2SAS A;  3TUY C;  2MJW B;  3PM8 A;  1SYM A;  1WDC C;  3DF0 B;  1WRK A;  2FCD A;  3JVT B;  1CMF A;  1SMG A;  1EJ3 A;  4OR9 B;  1SRA A;  1U5I A;  2EC6 C;  2K2F A;  2Y1M A;  1SR6 B;  1VRK A;  1KFX L;  2GGZ A;  3TDZ A;  5JJG A;  1WLZ A;  1MHO A;  5D7F A;  2JPT A;  5I2Q A;  2ZN9 A;  1PSB A;  3BUW B;  4DIR A;  1DMO A;  4P5O E;  1OMV A;  2MHH A;  4PE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...