3IF7A

Structure of calmodulin complexed with its first endogenous inhibitor, sphingosylphosphorylcholine
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
144
structure length
142
Chain Sequence
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanism of calmodulin binding to a signaling sphingolipid reveal new aspects of lipid-protein interactions
pubmed doi rcsb
molecule tags Calcium binding protein
molecule keywords Calmodulin
total genus 52
structure length 142
sequence length 144
ec nomenclature
pdb deposition date 2009-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3if7A00
1TNXA 4GPLB 1LINA 2LE9B 2KFHA 2LM5A 3DD4A 4HREE 1UP5A 1BMOA 1CDMA 2M9GA 3O4YA 1XFZO 1RK9A 2LLTA 2M7NA 1CLBA 1UHNA 1EG3A 5HKZA 4C0KA 1C7WA 1M39A 4U8DA 1TNWA 2K7CA 1NWDA 4QJ4B 1CFPA 1NX0A 5BPJA 1TRFA 2KAXA 4BY4A 5KSZA 1RECA 3VRNA 2BECA 5CSNA 4L9MA 3FWCA 3KF9A 1FBVA 1GQMA 1Y0VH 1QX2A 2M49B 3PM8A 1OZSA 1IWQA 4QJ3B 1JFKA 2BBMA 3BUMB 3I5HB 5B8IB 2KAVA 1K9KA 3CS1A 4CIDA 1QTXA 3H4SE 4MZKA 1B7TZ 1GJYA 2EGDA 2BKIB 2OS8B 3OX5A 2JXLA 1Q80A 1TIZA 1JUOA 1Y6WA 1HQVA 2BCXA 2OTGC 2PRUA 1J7OA 2JQ6A 4GBAA 2LNKA 1S6JA 2EC6C 2KYFA 4DIRA 3BUXB 2E6WA 2O60A 4C0LA 2KBIA 1DJWA 4XYNA 1KQMC 4PALA 3NSIA 5ER5A 1EG4A 1QATA 3SIBA 3CWGA 1B8RA 1EJ3A 3WXAA 1WLMA 1L7ZA 1D1OA 3TDIA 2CXJA 1CTRA 1WY9A 3BQ3A 3LL8B 3VRPA 2FOTA 1QLSA 3ICBA 3PFVA 1SK6D 3LK1A 2K2FA 1DF0A 4YBHB 1S36A 3SG4A 2M8UA 3OX6A 4CLNA 2L50A 1CMGA 2KBMA 2ZRSA 1LA0A 1A4PA 1SY9A 3DVEA 4MZLA 3LK0A 1PSRA 2EC6B 2MLEC 2WCFA 1XFWO 1DGVA 1YURA 2LHIA 1QJTA 1B9AA 1R6PA 1MWNA 3WNXB 2BL0C 1XO5A 3HCMA 4OCIA 1UUSA 2LCPA 2AMIA 1CMFA 1UHKA 4ETOA 4JPZB 1JSAA 3VROA 4N5XA 3I5HC 1KFXS 1PK0D 1RJVA 4HSZA 3TDZA 3ZNIA 2G9BA 2FCDA 4A4CA 5DKRA 1YUUA 1FF1A 3PATA 4XJKB 4YGCB 1GGZA 3FS7A 4QJ5B 1ZFSA 1JWDA 1OOJA 1NX3A 1TN4A 4PE7A 2LV7A 1M31A 2MLFC 4GNKB 2JU0A 3TDUA 1QS7A 3PSRA 4DRWA 2SCPA 1FI5A 2PALA 1DGUA 1K94A 1K9UA 2KOTA 1AHRA 3TUYB 3GK4X 1R2UA 2LP2A 3DF0A 2PMYA 1AJ4A 1SL7A 3JVTC 1CFCA 2KGBC 4DCKA 1WDCB 1S6CA 2CCMA 2OPOA 5D7FA 5HLVA 5I2OA 1W7IB 2ZFDA 2JNXA 3I5IC 5I8NA 2M1KB 4DS7A 1EL4A 1NSHA 2ZNDA 1NP8A 1S1EA 1ZOTB 2JNFA 4GGFC 3CGAA 3NSOA 4PE1A 2L4HA 3AKBA 1MQ1A 1MR8A 2M3WA 3FWBA 2KI4B 1WDCC 4I5JA 4WRIA 4DUQA 3A8RA 2IS9A 3E3RA 1OQPA 1WLZA 3SG7A 2MBXA 4M2OA 1PVAA 3D10A 2K8MB 5AXIA 1S6IA 1DF0B 1A75B 1QVIY 1OMDA 3JTDB 1F8HA 1DJZA 1K95A 5I2QA 3EKHA 4F0ZB 1SNLA 4HRGA 2HF5A 2MA2A 1NCZA 2ZN9A 4FQOA 4I5LB 2F33A 3SG2A 3BUOB 4PDZA 5AERA 1CNPA 1J7QA 2BCAA 4YGEB 2F8PA 3GK1A 5FYXA 4MSPA 1B8CA 1Y1UA 4NDCA 2LMTA 3DF0B 1L2OB 1ZUZA 1DJYA 4AQJA 1DJHA 3BUWB 2LMVA 2LLUA 2M29A 5JJGA 2DOQA 1LA3A 3IQQA 3RLZA 1NYAA 3EVVA 1H8BA 1RFJA 1DTLA 4P5OE 2F2PA 3AAKA 2E30A 3SG3A 2L98A 1SMGA 1BJFA 2LVVA 1IGVA 2VRGA 1NCXA 1XYDA 4FTGA 4IL1A 4MLWA 4Q04A 1KK7Y 2KI4C 3M0WA 1YUTA 5HLOA 3OB1B 5IBWA 1RWYA 1CLLA 1AUIB 1OMVA 1UURA 3A4UB 5HKYA 1IRJA 1GGWA 1VRKA 5K89A 5CSFA 2JULA 4MZJA 2I2RE 4YGDB 5KTYA 4PCWA 1F54A 1QASA 1SCVA 1F70A 1Y1XA 1WRKA 1SCMC 2LANA 1S5GY 1SKTA 1PULA 2O5GA 2OTGB 5AFPA 1B8LA 2LHLA 1SL8A 2MJWB 1CB1A 1JC2A 2JZIA 2M97A 4ORCB 4CPVA 3KPXA 1QX5B 3SG5A 1OSAA 2CT9A 3BOWB 3O6BA 1CM1A 3K21A 2H2KA 1WRLA 1YTZC 5CSJA 1XFXO 2F2OA 1AP4A 1CDLA 5F6TA 2P6BB 2NLNA 3KHEA 2JT0A 3TS5B 1A29A 1A75A 5JOLA 2FCEA 1PVBA 2OS8C 2MAZA 3CR4X 3ZWHA 4NQGA 1LKJA 3GOFA 3I5GC 5DKQA 2WORA 3CR5X 1KWOB 2NXQA 3WHTB 2MHHA 1K2HA 1LXFC 1MXLC 1U5IA 3O2PA 2QPTA 1XK4C 2ZKMX 4JWQA 2F3YA 4MVFA 2FJUB 2KFGA 4OV2A 1B47A 3WHUB 4P2YB 1IQ5A 1MF8B 1KK7Z 1YX7A 4E68A 3LLEA 1MHOA 1CDNA 3NXAA 1KWOC 2ZNEA 2KAYA 4MRYA 1B4CA 1YRTB 4YI9A 2COLB 4HRHA 4AQIA 1TCOB 1EXRA 1JF0A 3CZTX 4YGAA 1YRUB 2B1UA 1CDPA 1K90D 4PHNA 1QX7A 2KI6D 1QIVA 1NX2A 1DVIA 1QLKA 3D0YA 1K96A 1V1GA 3CR2A 5ER4X 1QVIZ 3CTNA 3RM1A 4AOMA 2CBLA 1UHHA 2LAPA 3FIAA 3AKAA 3EK8A 4A4BA 1XA5A 4WQ2A 2L2EA 2GV5A 3TS5C 2WOSA 3EVRA 3OP0A 4MEWA 2H61A 2V53A 2PVBA 1IH0A 2BE4A 1B7TY 5D69A 2JT8A 3EK4A 1KFUL 3KO0A 1NCYA 2WC8A 2K7BA 3I5IB 4ORAB 2Q4UA 4YGBB 3JVTB 2HPSA 1CFDA 2L51A 4ORBB 2K0JA 3BOWA 4GGFA 2Q91A 2JC2A 2ZRTA 1J55A 3KEVA 2CTNA 1PRWA 1SBJA 2KI6C 3NSLA 1SYMA 1N2DA 2HQWA 3NSKA 1QV0A 1Y1AA 2WNDA 1AK8A 2RGIA 1MUXA 4MBEA 1KFUS 2Y4QA 5CSIA 1KCYA 1A2XA 2K7OA 2KGRA 1AVSA 2JXCA 3HX4A 2M1UA 3PLFB 2SASA 1OZOA 1XFVO 2KSPA 2GGMA 4C0JA 3AAJA 2LVIA 2BBNA 1F4OA 1JBAA 1BT6A 1E8AA 2LMUA 1ALWA 1F4QA 1ALVA 1J7PA 2KYCA 1XFUO 1HT9A 1BU3A 1X02A 2BKHB 1OE9B 1S5GZ 3EKJA 1IQ3A 1K9PA 2G2BA 4ZCVA 4MRXA 1KK8C 3QRXA 2HETA 3DVKA 1TTXA 1AJ5A 1SR6C 1G4YR 1U5IB 1BR1B 1KFXL 1IG5A 1N65A 1TNPA 2KNEA 2ZN8A 3C1VA 4D1EA 1QV1A 2K61A 1M46A 1CLMA 2K7DA 3EK7A 4USLA 3VRRA 4M2PA 2BCBA 1KSOA 1A03A 5J3XA 4GGNA 2LC5A 3SG6A 3CLNA 4NDDA 3DVJA 3EVUA 1TOPA 5KU1A 2BL0B 2CNPA 3GK2A 1DJXA 2TN4A 2ISDA 4UPGA 5G08A 3TZ1A 1MXEA 1V1FA 1FPWA 1YX8A 2PSRA 4YI8A 5HKWA 2Y5IA 1K8UA 1NIWA 3I5GB 3I5FC 3SJSA 2R2IA 3PN7C 1SPYA 5AEQA 2AAOA 1ZACA 2QACA 2JT3A 2K2AA 4OR9B 1W7JB 2LUCA 3VGOA 1BR4B 4OKHA 1SL9A 2BE6A 2NCOA 1BOCA 4ICBA 4CFQA 1JF2A 1ZMZA 2D8NA 5DKNA 2NZ0A 3OHMB 2PASA 3DVMA 2JTZA 2LP3A 5AANA 1YUSA 1DJGA 5I2LA 1S26D 1BODA 3PN7B 2JRFA 1N0YA 1NPQA 1M63B 2LVKA 3TUYC 4I5KA 1FW4A 1RTP1 3SIAA 4GFTA 4PHJA 1BG1A 1C07A 1F55A 4NDBA 4MN0A 4WQ3A 2M0RA 4OVNF 1PSBA 4R1EA 5CPVA 2MRDA 2F3ZA 1JFJA 4N1FA 1BF5A 1C7VA 4PHKA 4N1GA 3D0YB 1KK8B 5PALA 2GGZA 2KHNA 4GAOA 1J1EA 1IJ6A 1NUBA 2A4JA 1S3PA 1J1DA 1K93D 2KDHA 2LUXA 4XJKA 1M45A 2JWWA 2HQ8A 1SW8A 2L5XB 5HYDA 1SR6B 2KQ6A 1XVJA 1UWOA 1YVLA 2I7AA 1L2OC 1KQVA 2KQYA 2NCPA 1TCFA 3BXKA 2LVJA 4TNCA 2I94A 3JTDC 3BYAA 3IQOA 1CKKA 5TNCA 4I5NB 1TNQA 2WCBA 3PALA 2JTTA 2L0PA 3O78A 1F71A 1DT7B 1CFFA 1KQMB 3BUNB 4YRUA 1IJ5A 1H4BA 5GQQC 1UHJA 2Y1NA 4GUKA 2WCEA 1ODBA 1XFYO 1G8IA 2Y1MA 4PE0A 2KFFA 3OB2B 1KSMA 1LVCD 1NX1A 1UHIA 1SCMB 4JQ0D 3MSEB 1WRZA 4PHMA 2EHBA 1PALA 1OMRA 2H61C 1YVHA 1BLQA 2I18A 1DMOA 1EH2A 1CM4A 1XK4A 1SRAA 1QIWA 1DJIA 3I5FB 3LCPC 1J7RA 2AUCA 3F45A 2LLSA 1G33A 3IF7A 4M2QA 4PE4A 2JPTA 3VRQA 1FI6A 1YR5A 4BY5A 1IKUA 2JOJA 1RROA 1QXPA 2L4IA 4ZCUA 2M7LA 4CFRA 1B1GA
chains in the Genus database with same CATH superfamily
1ORGA 1TNXA 4GPLB 1LINA 2LE9B 2KFHA 3S0FA 3BJHA 2BAPA 2LM5A 3DD4A 3R72A 4HREE 1UP5A 1BMOA 1CDMA 2M9GA 3O4YA 1TUZA 1XFZO 1TUJA 1RK9A 2LLTA 2M7NA 2P70A 3S0AA 1CLBA 1UHNA 1EG3A 5D3OA 5HKZA 4C0KA 3D77A 1C7WA 1M39A 4U8DA 1TNWA 2K7CA 1NWDA 4QJ4B 1CFPA 1NX0A 5BPJA 1TRFA 2KAXA 4BY4A 5KSZA 1RECA 3VRNA 2BECA 3DY9A 3D78A 5CSNA 4L9MA 3FWCA 3KF9A 1FBVA 1GQMA 1Y0VH 1QX2A 2M49B 3PM8A 5HL1A 1OZSA 1IWQA 3R1PA 5I94A 4QJ3B 1JFKA 2BBMA 3BUMB 3I5HB 5B8IB 2KAVA 1K9KA 3CS1A 4CIDA 3DZTA 1QTXA 2JPOA 3H4SE 4MZKA 1B7TZ 1GJYA 2EGDA 2BKIB 2OS8B 3OX5A 2JXLA 1Q80A 1TIZA 1JUOA 1Y6WA 1HQVA 2BCXA 2OTGC 2PRUA 1J7OA 2JQ6A 4GBAA 2LNKA 1S6JA 3B86A 2EC6C 2KYFA 4DIRA 2PQLA 3BUXB 3VB1A 2E6WA 2O60A 4C0LA 2QEOA 2KBIA 1DJWA 4XYNA 1KQMC 4PALA 3NSIA 5ER5A 1EG4A 1QATA 3SIBA 3CWGA 1B8RA 1EJ3A 3WXAA 1WLMA 5FI6A 1L7ZA 1D1OA 2WC6A 3TDIA 2CXJA 1Z4HA 1CTRA 1WY9A 3BQ3A 3LL8B 3VRPA 2FOTA 1QLSA 3ICBA 3PFVA 1SK6D 3LK1A 2K2FA 1DF0A 4YBHB 1S36A 3SG4A 2M8UA 3OX6A 4CLNA 2L50A 1CMGA 2KBMA 2ZRSA 1LA0A 1A4PA 1SY9A 3DVEA 4MZLA 3LK0A 1PSRA 2EC6B 2MLEC 2WCFA 1XFWO 3DYEA 3S0EA 1DGVA 1YURA 2LHIA 1QJTA 1B9AA 1R6PA 1MWNA 3WNXB 2BL0C 3FE8A 1XO5A 3HCMA 4OCIA 1DQEA 3V2LA 4F7FA 2WCHA 1UUSA 2LCPA 2AMIA 1CMFA 1UHKA 4ETOA 3B87A 3L47A 4JPZB 1JSAA 3VROA 4N5XA 3I5HC 1KFXS 1PK0D 1RJVA 4HSZA 3TDZA 3OBVA 3ZNIA 2G9BA 2FCDA 4A4CA 5DKRA 1YUUA 1FF1A 3PATA 4XJKB 1OOFA 4YGCB 1GGZA 3FS7A 4JD9A 4QJ5B 1ZFSA 1JWDA 1OOJA 1NX3A 1TN4A 4PE7A 2LV7A 1M31A 2MLFC 4GNKB 2JU0A 3TDUA 1QS7A 3B7AA 3PSRA 2SCPA 4DRWA 2PALA 1DGUA 1K94A 1K9UA 3NHTA 2KOTA 1AHRA 3TUYB 3D74A 1R2UA 2LP2A 3DF0A 2PMYA 1AJ4A 1SL7A 3GK4X 3JVTC 1C3YA 1CFCA 2KGBC 4DCKA 1WDCB 1S6CA 2CCMA 2OPOA 5D7FA 5HLVA 2FJYA 5I2OA 1W7IB 2ZFDA 2JNXA 3I5IC 5I8NA 2M1KB 5DICA 4DS7A 1EL4A 1NSHA 2ZNDA 1NP8A 1S1EA 1ZOTB 2JNFA 4GGFC 3CGAA 3NSOA 4PE1A 2L4HA 3AKBA 1MQ1A 4INXA 2YGUA 1MR8A 2M3WA 1XFRA 3FWBA 2KI4B 1WDCC 4I5JA 4WRIA 4DUQA 3A8RA 4JKTA 2IS9A 3E3RA 1OQPA 1WLZA 3SG7A 2MBXA 4M2OA 1PVAA 3D10A 2K8MB 5AXIA 1S6IA 1DF0B 1A75B 1QVIY 1OMDA 3JTDB 1F8HA 1DJZA 1K95A 5I2QA 3EKHA 4F0ZB 1SNLA 2QDIA 3O4XA 4HRGA 2HF5A 2MA2A 1NCZA 3PJIA 2ZN9A 4FQOA 4I5LB 2F33A 3SG2A 3BUOB 4PDZA 5AERA 1CNPA 1J7QA 2BCAA 3CDNA 4YGEB 2F8PA 3GK1A 5FYXA 1QWVA 3DXLA 4MSPA 1B8CA 1OOIX 1Y1UA 4NDCA 2LMTA 3DF0B 1L2OB 1ZUZA 1DJYA 4AQJA 1DJHA 3BUWB 2LMVA 2LLUA 2M29A 5JJGA 2DOQA 1LA3A 3IQQA 3RLZA 1TWOA 1NYAA 3EVVA 1H8BA 1RFJA 1DTLA 4P5OE 2F2PA 3AAKA 2E30A 3SG3A 2L98A 1SMGA 1BJFA 2LVVA 1IGVA 2VRGA 1NCXA 1XYDA 4FTGA 4IL1A 3L4AA 4MLWA 4Q04A 1KK7Y 2KI4C 3M0WA 1YUTA 5HLOA 3OB1B 5IBWA 1RWYA 1CLLA 1AUIB 1OMVA 1UURA 3A4UB 5HKYA 1IRJA 1GGWA 1VRKA 5K89A 5CSFA 2JULA 4MZJA 2I2RE 4YGDB 5KTYA 4PCWA 1F54A 1QASA 1SCVA 3SS4A 1F70A 1Y1XA 1WRKA 1SCMC 2LANA 1S5GY 1SKTA 1PULA 2O5GA 2OTGB 5AFPA 1B8LA 2LHLA 3EG5B 1SL8A 2MJWB 1CB1A 1JC2A 2JZIA 2M97A 4ORCB 4CPVA 3KPXA 1QX5B 3R1VA 3SG5A 1OSAA 2CT9A 3BOWB 3O6BA 1CM1A 3FE9A 2H2KA 1WRLA 3K21A 1YTZC 5CSJA 1XFXO 2F2OA 3D76A 1AP4A 1CDLA 5F6TA 2P6BB 1FI5A 2NLNA 3K1EA 3KHEA 2JT0A 3B88A 3SS5A 3TS5B 1A29A 1A75A 4INWA 5JOLA 2FCEA 1LS8A 1PVBA 2OS8C 2MAZA 3CR4X 3ZWHA 1Z2CB 4NQGA 1LKJA 3GOFA 3I5GC 5DKQA 2WORA 3CR5X 1KWOB 2NXQA 3WHTB 2MHHA 1K2HA 1LXFC 1MXLC 1U5IA 3O2PA 3NHIA 2QPTA 1XK4C 1SSEB 2ZKMX 1T14A 3D75A 2F3YA 4JWQA 2FJUB 2KFGA 4MVFA 1B47A 4OV2A 3WHUB 4P2YB 1IQ5A 1MF8B 1KK7Z 1YX7A 5FI7A 4E68A 3LLEA 1MHOA 1CDNA 3NXAA 1KWOC 2ZNEA 2KAYA 5FI2A 4MRYA 1B4CA 1GM0A 1YRTB 4YI9A 2COLB 4HRHA 4AQIA 1TCOB 1EXRA 1JF0A 3CZTX 4YGAA 1YRUB 2B1UA 1CDPA 1K90D 4PHNA 1QX7A 2KI6D 1QIVA 1NX2A 1DVIA 3L4LA 1QLKA 3D0YA 1K96A 1V1GA 3CR2A 5ER4X 1QVIZ 3CTNA 3RM1A 4AOMA 2CBLA 1UHHA 2LAPA 3FIAA 1DEKA 3AKAA 3EK8A 3N7HA 4A4BA 1XA5A 1DELA 4WQ2A 2L2EA 2GV5A 3TS5C 2WOSA 5EL2A 3EVRA 3OP0A 4MEWA 2H61A 2V53A 2PVBA 1IH0A 2BE4A 1B7TY 1W9ZA 5D69A 2JT8A 3EK4A 3CZ0A 1KFUL 3KO0A 1NCYA 2WC8A 2K7BA 3I5IB 4ORAB 2Q4UA 2H8VA 4YGBB 3JVTB 2HPSA 1CFDA 2L51A 4ORBB 2K0JA 3BOWA 4GGFA 2Q91A 2JC2A 2ZRTA 1J55A 3KEVA 2CTNA 1PRWA 1SBJA 2KI6C 3NSLA 1SYMA 1N2DA 2HQWA 3NSKA 1QV0A 1Y1AA 2WNDA 1AK8A 2RGIA 1MUXA 4MBEA 1KFUS 3BFBA 2Y4QA 5CSIA 2QEVA 1A2XA 3B6XA 1KCYA 2K7OA 2KGRA 1AVSA 2JXCA 3HX4A 2M1UA 2PYQA 3PLFB 2SASA 1OZOA 1XFVO 2KSPA 2GGMA 4C0JA 3AAJA 2LVIA 2BBNA 1F4OA 1JBAA 1BT6A 2QEHA 3R1OA 1E8AA 2LMUA 1ALWA 1F4QA 1ALVA 1J7PA 1C3ZA 2KYCA 1XFUO 1HT9A 1BU3A 1X02A 2BKHB 1OE9B 1S5GZ 3EKJA 1IQ3A 1K9PA 2G2BA 4ZCVA 4MRXA 1KK8C 3QRXA 4IJ7A 2HETA 3DVKA 1TTXA 3NGVA 1P28A 1AJ5A 4FQTA 1SR6C 1G4YR 1U5IB 1BR1B 1KFXL 1IG5A 1N65A 1TNPA 2KNEA 2ZN8A 3C1VA 4D1EA 1QV1A 3CABA 2K61A 1DC1A 1M46A 3RZSA 1CLMA 2K7DA 3EK7A 4USLA 3VRRA 4M2PA 2BCBA 1KSOA 1A03A 5J3XA 2L5YA 4GGNA 2LC5A 3SG6A 3CLNA 4NDDA 3DVJA 3EVUA 1TOPA 5KU1A 2BL0B 2CNPA 3GK2A 1OOGA 1DJXA 2TN4A 2ISDA 1OOHA 4UPGA 5G08A 3TZ1A 1OW4A 1MXEA 1V1FA 1FPWA 1YX8A 2PSRA 4YI8A 5HKWA 2Y5IA 1K8UA 3BFAA 1NIWA 3I5GB 3I5FC 3SJSA 2R2IA 3PN7C 1SPYA 5AEQA 2AAOA 1ZACA 2QACA 2JT3A 2K2AA 4OR9B 4KYNA 1W7JB 2LUCA 3VGOA 1BR4B 3SS3A 4OKHA 1SL9A 2BE6A 2NCOA 1BOCA 4ICBA 4CFQA 1JF2A 1ZMZA 2D8NA 5DKNA 2NZ0A 3OHMB 2PASA 3DVMA 2JTZA 2LP3A 5AANA 4PT1A 1YUSA 1DJGA 2KPHA 5I2LA 1S26D 1BODA 3PN7B 2JRFA 1N0YA 1NPQA 1M63B 2LVKA 3UNWA 4I5KA 1FW4A 1RTP1 3SIAA 4GFTA 4PHJA 3TUYC 1BG1A 1C07A 1F55A 4NDBA 3QMEA 2KLEA 4MN0A 2L2CA 3S0GA 2QEBA 4WQ3A 2M0RA 4OVNF 1PSBA 3D73A 4R1EA 5CPVA 2MRDA 2F3ZA 1JFJA 4N1FA 1BF5A 1C7VA 2ERBA 2KLDA 4PHKA 4N1GA 3D0YB 1KK8B 5PALA 2K60A 2GGZA 2KHNA 4GAOA 1J1EA 1IJ6A 1NUBA 2A4JA 1S3PA 1J1DA 3S0DA 1K93D 2KDHA 2LUXA 4XJKA 1M45A 2JWWA 2HQ8A 1SW8A 2L5XB 5HYDA 1SR6B 2KQ6A 1XVJA 1UWOA 1YVLA 2I7AA 1L2OC 3CYZA 1KQVA 2KQYA 2NCPA 1TCFA 3BXKA 3Q8IA 2LVJA 4TNCA 2WC5A 2I94A 3JTDC 3BYAA 3BFHA 3IQOA 2WCJA 1CKKA 5TNCA 4I5NB 3PM2A 1TNQA 2WCBA 3PALA 2JTTA 2L0PA 3O78A 1F71A 1DT7B 1CFFA 2WCMA 1KQMB 4OZDA 3BUNB 4YRUA 1IJ5A 1H4BA 5GQQC 1UHJA 2Y1NA 3CZ1A 2WCEA 1ODBA 3IVTA 4GUKA 1XFYO 1G8IA 2Y1MA 4PE0A 2KFFA 3OB2B 1KSMA 1LVCD 3FE6A 1NX1A 1UHIA 1SCMB 4JQ0D 3MSEB 1WRZA 4PHMA 2EHBA 1PALA 2GTEA 1OMRA 2H61C 1YVHA 2BNXA 1BLQA 2I18A 3CZ2A 1DMOA 1EH2A 1CM4A 1XK4A 1SRAA 1QIWA 1DJIA 2P71A 2WCKA 3I5FB 1J7RA 2AUCA 3LCPC 3F45A 2LLSA 1G33A 3IF7A 3UO9A 4M2QA 1IIOA 4PE4A 2JPTA 3S0BA 2WCLA 3VRQA 1FI6A 1YR5A 3OGNA 4BY5A 1IKUA 2JOJA 1RROA 1QXPA 2L4IA 4ZCUA 2M7LA 4CFRA 1B1GA
chains in the Genus database with same CATH topology
1TNXA 4GPLB 1LINA 2LE9B 2KFHA 2LM5A 3DD4A 4HREE 1UP5A 1BMOA 1CDMA 2M9GA 3O4YA 1XFZO 1RK9A 2LLTA 2M7NA 1CLBA 1UHNA 1EG3A 5HKZA 4C0KA 1C7WA 1M39A 4U8DA 1TNWA 2K7CA 1NWDA 4QJ4B 1CFPA 1NX0A 5BPJA 1TRFA 2KAXA 4BY4A 5KSZA 1RECA 3VRNA 2BECA 5CSNA 4L9MA 3FWCA 3KF9A 1FBVA 1GQMA 1Y0VH 1QX2A 2M49B 3PM8A 1OZSA 1IWQA 4QJ3B 1JFKA 2BBMA 3BUMB 3I5HB 5B8IB 2KAVA 1K9KA 3CS1A 4CIDA 1QTXA 3H4SE 4MZKA 1B7TZ 1GJYA 2EGDA 2BKIB 2OS8B 3OX5A 2JXLA 1Q80A 1TIZA 1JUOA 1Y6WA 1HQVA 2BCXA 2OTGC 2PRUA 1J7OA 2JQ6A 4GBAA 2LNKA 1S6JA 2EC6C 2KYFA 4DIRA 3BUXB 2E6WA 2O60A 4C0LA 2KBIA 1DJWA 4XYNA 1KQMC 4PALA 3NSIA 5ER5A 1EG4A 1QATA 3SIBA 3CWGA 1B8RA 1EJ3A 3WXAA 1WLMA 1L7ZA 1D1OA 3TDIA 2CXJA 1CTRA 1WY9A 3BQ3A 3LL8B 3VRPA 2FOTA 1QLSA 3ICBA 3PFVA 1SK6D 3LK1A 2K2FA 1DF0A 4YBHB 1S36A 3SG4A 2M8UA 3OX6A 4CLNA 2L50A 1CMGA 2KBMA 2ZRSA 1LA0A 1A4PA 1SY9A 3DVEA 4MZLA 3LK0A 1PSRA 2EC6B 2MLEC 2WCFA 1XFWO 1DGVA 1YURA 2LHIA 1QJTA 1B9AA 1R6PA 1MWNA 3WNXB 2BL0C 1XO5A 3HCMA 4OCIA 1UUSA 2LCPA 2AMIA 1CMFA 1UHKA 4ETOA 4JPZB 1JSAA 3VROA 4N5XA 3I5HC 1KFXS 1PK0D 1RJVA 4HSZA 3TDZA 3ZNIA 2G9BA 2FCDA 4A4CA 5DKRA 1YUUA 1FF1A 3PATA 4XJKB 4YGCB 1GGZA 3FS7A 4QJ5B 1ZFSA 1JWDA 1OOJA 1NX3A 1TN4A 4PE7A 2LV7A 1M31A 2MLFC 4GNKB 2JU0A 3TDUA 1QS7A 3PSRA 4DRWA 2SCPA 1FI5A 2PALA 1DGUA 1K94A 1K9UA 2KOTA 1AHRA 3TUYB 3GK4X 1R2UA 2LP2A 3DF0A 2PMYA 1AJ4A 1SL7A 3JVTC 1CFCA 2KGBC 4DCKA 1WDCB 1S6CA 2CCMA 2OPOA 5D7FA 5HLVA 5I2OA 1W7IB 2ZFDA 2JNXA 3I5IC 5I8NA 2M1KB 4DS7A 1EL4A 1NSHA 2ZNDA 1NP8A 1S1EA 1ZOTB 2JNFA 4GGFC 3CGAA 3NSOA 4PE1A 2L4HA 3AKBA 1MQ1A 1MR8A 2M3WA 3FWBA 2KI4B 1WDCC 4I5JA 4WRIA 4DUQA 3A8RA 2IS9A 3E3RA 1OQPA 1WLZA 3SG7A 2MBXA 4M2OA 1PVAA 3D10A 2K8MB 5AXIA 1S6IA 1DF0B 1A75B 1QVIY 1OMDA 3JTDB 1F8HA 1DJZA 1K95A 5I2QA 3EKHA 4F0ZB 1SNLA 4HRGA 2HF5A 2MA2A 1NCZA 2ZN9A 4FQOA 4I5LB 2F33A 3SG2A 3BUOB 4PDZA 5AERA 1CNPA 1J7QA 2BCAA 4YGEB 2F8PA 3GK1A 5FYXA 4MSPA 1B8CA 1Y1UA 4NDCA 2LMTA 3DF0B 1L2OB 1ZUZA 1DJYA 4AQJA 1DJHA 3BUWB 2LMVA 2LLUA 2M29A 5JJGA 2DOQA 1LA3A 3IQQA 3RLZA 1NYAA 3EVVA 1H8BA 1RFJA 1DTLA 4P5OE 2F2PA 3AAKA 2E30A 3SG3A 2L98A 1SMGA 1BJFA 2LVVA 1IGVA 2VRGA 1NCXA 1XYDA 4FTGA 4IL1A 4MLWA 4Q04A 1KK7Y 2KI4C 3M0WA 1YUTA 5HLOA 3OB1B 5IBWA 1RWYA 1CLLA 1AUIB 1OMVA 1UURA 3A4UB 5HKYA 1IRJA 1GGWA 1VRKA 5K89A 5CSFA 2JULA 4MZJA 2I2RE 4YGDB 5KTYA 4PCWA 1F54A 1QASA 1SCVA 1F70A 1Y1XA 1WRKA 1SCMC 2LANA 1S5GY 1SKTA 1PULA 2O5GA 2OTGB 5AFPA 1B8LA 2LHLA 1SL8A 2MJWB 1CB1A 1JC2A 2JZIA 2M97A 4ORCB 4CPVA 3KPXA 1QX5B 3SG5A 1OSAA 2CT9A 3BOWB 3O6BA 1CM1A 3K21A 2H2KA 1WRLA 1YTZC 5CSJA 1XFXO 2F2OA 1AP4A 1CDLA 5F6TA 2P6BB 2NLNA 3KHEA 2JT0A 3TS5B 1A29A 1A75A 5JOLA 2FCEA 1PVBA 2OS8C 2MAZA 3CR4X 3ZWHA 4NQGA 1LKJA 3GOFA 3I5GC 5DKQA 2WORA 3CR5X 1KWOB 2NXQA 3WHTB 2MHHA 1K2HA 1LXFC 1MXLC 1U5IA 3O2PA 2QPTA 1XK4C 2ZKMX 4JWQA 2F3YA 4MVFA 2FJUB 2KFGA 4OV2A 1B47A 3WHUB 4P2YB 1IQ5A 1MF8B 1KK7Z 1YX7A 4E68A 3LLEA 1MHOA 1CDNA 3NXAA 1KWOC 2ZNEA 2KAYA 4MRYA 1B4CA 1YRTB 4YI9A 2COLB 4HRHA 4AQIA 1TCOB 1EXRA 1JF0A 3CZTX 4YGAA 1YRUB 2B1UA 1CDPA 1K90D 4PHNA 1QX7A 2KI6D 1QIVA 1NX2A 1DVIA 1QLKA 3D0YA 1K96A 1V1GA 3CR2A 5ER4X 1QVIZ 3CTNA 3RM1A 4AOMA 2CBLA 1UHHA 2LAPA 3FIAA 3AKAA 3EK8A 4A4BA 1XA5A 4WQ2A 2L2EA 2GV5A 3TS5C 2WOSA 3EVRA 3OP0A 4MEWA 2H61A 2V53A 2PVBA 1IH0A 2BE4A 1B7TY 5D69A 2JT8A 3EK4A 1KFUL 3KO0A 1NCYA 2WC8A 2K7BA 3I5IB 4ORAB 2Q4UA 4YGBB 3JVTB 2HPSA 1CFDA 2L51A 4ORBB 2K0JA 3BOWA 4GGFA 2Q91A 2JC2A 2ZRTA 1J55A 3KEVA 2CTNA 1PRWA 1SBJA 2KI6C 3NSLA 1SYMA 1N2DA 2HQWA 3NSKA 1QV0A 1Y1AA 2WNDA 1AK8A 2RGIA 1MUXA 4MBEA 1KFUS 2Y4QA 5CSIA 1KCYA 1A2XA 2K7OA 2KGRA 1AVSA 2JXCA 3HX4A 2M1UA 3PLFB 2SASA 1OZOA 1XFVO 2KSPA 2GGMA 4C0JA 3AAJA 2LVIA 2BBNA 1F4OA 1JBAA 1BT6A 1E8AA 2LMUA 1ALWA 1F4QA 1ALVA 1J7PA 2KYCA 1XFUO 1HT9A 1BU3A 1X02A 2BKHB 1OE9B 1S5GZ 3EKJA 1IQ3A 1K9PA 2G2BA 4ZCVA 4MRXA 1KK8C 3QRXA 2HETA 3DVKA 1TTXA 1AJ5A 1SR6C 1G4YR 1U5IB 1BR1B 1KFXL 1IG5A 1N65A 1TNPA 2KNEA 2ZN8A 3C1VA 4D1EA 1QV1A 2K61A 1M46A 1CLMA 2K7DA 3EK7A 4USLA 3VRRA 4M2PA 2BCBA 1KSOA 1A03A 5J3XA 4GGNA 2LC5A 3SG6A 3CLNA 4NDDA 3DVJA 3EVUA 1TOPA 5KU1A 2BL0B 2CNPA 3GK2A 1DJXA 2TN4A 2ISDA 4UPGA 5G08A 3TZ1A 1MXEA 1V1FA 1FPWA 1YX8A 2PSRA 4YI8A 5HKWA 2Y5IA 1K8UA 1NIWA 3I5GB 3I5FC 3SJSA 2R2IA 3PN7C 1SPYA 5AEQA 2AAOA 1ZACA 2QACA 2JT3A 2K2AA 4OR9B 1W7JB 2LUCA 3VGOA 1BR4B 4OKHA 1SL9A 2BE6A 2NCOA 1BOCA 4ICBA 4CFQA 1JF2A 1ZMZA 2D8NA 5DKNA 2NZ0A 3OHMB 2PASA 3DVMA 2JTZA 2LP3A 5AANA 1YUSA 1DJGA 5I2LA 1S26D 1BODA 3PN7B 2JRFA 1N0YA 1NPQA 1M63B 2LVKA 3TUYC 4I5KA 1FW4A 1RTP1 3SIAA 4GFTA 4PHJA 1BG1A 1C07A 1F55A 4NDBA 4MN0A 4WQ3A 2M0RA 4OVNF 1PSBA 4R1EA 5CPVA 2MRDA 2F3ZA 1JFJA 4N1FA 1BF5A 1C7VA 4PHKA 4N1GA 3D0YB 1KK8B 5PALA 2GGZA 2KHNA 4GAOA 1J1EA 1IJ6A 1NUBA 2A4JA 1S3PA 1J1DA 1K93D 2KDHA 2LUXA 4XJKA 1M45A 2JWWA 2HQ8A 1SW8A 2L5XB 5HYDA 1SR6B 2KQ6A 1XVJA 1UWOA 1YVLA 2I7AA 1L2OC 1KQVA 2KQYA 2NCPA 1TCFA 3BXKA 2LVJA 4TNCA 2I94A 3JTDC 3BYAA 3IQOA 1CKKA 5TNCA 4I5NB 1TNQA 2WCBA 3PALA 2JTTA 2L0PA 3O78A 1F71A 1DT7B 1CFFA 1KQMB 3BUNB 4YRUA 1IJ5A 1H4BA 5GQQC 1UHJA 2Y1NA 4GUKA 2WCEA 1ODBA 1XFYO 1G8IA 2Y1MA 4PE0A 2KFFA 3OB2B 1KSMA 1LVCD 1NX1A 1UHIA 1SCMB 4JQ0D 3MSEB 1WRZA 4PHMA 2EHBA 1PALA 1OMRA 2H61C 1YVHA 1BLQA 2I18A 1DMOA 1EH2A 1CM4A 1XK4A 1SRAA 1QIWA 1DJIA 3I5FB 3LCPC 1J7RA 2AUCA 3F45A 2LLSA 1G33A 3IF7A 4M2QA 4PE4A 2JPTA 3VRQA 1FI6A 1YR5A 4BY5A 1IKUA 2JOJA 1RROA 1QXPA 2L4IA 4ZCUA 2M7LA 4CFRA 1B1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TNX A;  4GPL B;  1LIN A;  2LE9 B;  2KFH A;  2LM5 A;  3DD4 A;  4HRE E;  1UP5 A;  1BMO A;  1CDM A;  2M9G A;  3O4Y A;  1XFZ O;  1RK9 A;  2LLT A;  2M7N A;  1CLB A;  1UHN A;  1EG3 A;  5HKZ A;  4C0K A;  1C7W A;  1M39 A;  4U8D A;  1TNW A;  2K7C A;  1NWD A;  4QJ4 B;  1CFP A;  1NX0 A;  5BPJ A;  1TRF A;  2KAX A;  4BY4 A;  5KSZ A;  1REC A;  3VRN A;  2BEC A;  5CSN A;  4L9M A;  3FWC A;  3KF9 A;  1FBV A;  1GQM A;  1Y0V H;  1QX2 A;  2M49 B;  3PM8 A;  1OZS A;  1IWQ A;  4QJ3 B;  1JFK A;  2BBM A;  3BUM B;  3I5H B;  5B8I B;  2KAV A;  1K9K A;  3CS1 A;  4CID A;  1QTX A;  3H4S E;  4MZK A;  1B7T Z;  1GJY A;  2EGD A;  2BKI B;  2OS8 B;  3OX5 A;  2JXL A;  1Q80 A;  1TIZ A;  1JUO A;  1Y6W A;  1HQV A;  2BCX A;  2OTG C;  2PRU A;  1J7O A;  2JQ6 A;  4GBA A;  2LNK A;  1S6J A;  2EC6 C;  2KYF A;  4DIR A;  3BUX B;  2E6W A;  2O60 A;  4C0L A;  2KBI A;  1DJW A;  4XYN A;  1KQM C;  4PAL A;  3NSI A;  5ER5 A;  1EG4 A;  1QAT A;  3SIB A;  3CWG A;  1B8R A;  1EJ3 A;  3WXA A;  1WLM A;  1L7Z A;  1D1O A;  3TDI A;  2CXJ A;  1CTR A;  1WY9 A;  3BQ3 A;  3LL8 B;  3VRP A;  2FOT A;  1QLS A;  3ICB A;  3PFV A;  1SK6 D;  3LK1 A;  2K2F A;  1DF0 A;  4YBH B;  1S36 A;  3SG4 A;  2M8U A;  3OX6 A;  4CLN A;  2L50 A;  1CMG A;  2KBM A;  2ZRS A;  1LA0 A;  1A4P A;  1SY9 A;  3DVE A;  4MZL A;  3LK0 A;  1PSR A;  2EC6 B;  2MLE C;  2WCF A;  1XFW O;  1DGV A;  1YUR A;  2LHI A;  1QJT A;  1B9A A;  1R6P A;  1MWN A;  3WNX B;  2BL0 C;  1XO5 A;  3HCM A;  4OCI A;  1UUS A;  2LCP A;  2AMI A;  1CMF A;  1UHK A;  4ETO A;  4JPZ B;  1JSA A;  3VRO A;  4N5X A;  3I5H C;  1KFX S;  1PK0 D;  1RJV A;  4HSZ A;  3TDZ A;  3ZNI A;  2G9B A;  2FCD A;  4A4C A;  5DKR A;  1YUU A;  1FF1 A;  3PAT A;  4XJK B;  4YGC B;  1GGZ A;  3FS7 A;  4QJ5 B;  1ZFS A;  1JWD A;  1OOJ A;  1NX3 A;  1TN4 A;  4PE7 A;  2LV7 A;  1M31 A;  2MLF C;  4GNK B;  2JU0 A;  3TDU A;  1QS7 A;  3PSR A;  4DRW A;  2SCP A;  1FI5 A;  2PAL A;  1DGU A;  1K94 A;  1K9U A;  2KOT A;  1AHR A;  3TUY B;  3GK4 X;  1R2U A;  2LP2 A;  3DF0 A;  2PMY A;  1AJ4 A;  1SL7 A;  3JVT C;  1CFC A;  2KGB C;  4DCK A;  1WDC B;  1S6C A;  2CCM A;  2OPO A;  5D7F A;  5HLV A;  5I2O A;  1W7I B;  2ZFD A;  2JNX A;  3I5I C;  5I8N A;  2M1K B;  4DS7 A;  1EL4 A;  1NSH A;  2ZND A;  1NP8 A;  1S1E A;  1ZOT B;  2JNF A;  4GGF C;  3CGA A;  3NSO A;  4PE1 A;  2L4H A;  3AKB A;  1MQ1 A;  1MR8 A;  2M3W A;  3FWB A;  2KI4 B;  1WDC C;  4I5J A;  4WRI A;  4DUQ A;  3A8R A;  2IS9 A;  3E3R A;  1OQP A;  1WLZ A;  3SG7 A;  2MBX A;  4M2O A;  1PVA A;  3D10 A;  2K8M B;  5AXI A;  1S6I A;  1DF0 B;  1A75 B;  1QVI Y;  1OMD A;  3JTD B;  1F8H A;  1DJZ A;  1K95 A;  5I2Q A;  3EKH A;  4F0Z B;  1SNL A;  4HRG A;  2HF5 A;  2MA2 A;  1NCZ A;  2ZN9 A;  4FQO A;  4I5L B;  2F33 A;  3SG2 A;  3BUO B;  4PDZ A;  5AER A;  1CNP A;  1J7Q A;  2BCA A;  4YGE B;  2F8P A;  3GK1 A;  5FYX A;  4MSP A;  1B8C A;  1Y1U A;  4NDC A;  2LMT A;  3DF0 B;  1L2O B;  1ZUZ A;  1DJY A;  4AQJ A;  1DJH A;  3BUW B;  2LMV A;  2LLU A;  2M29 A;  5JJG A;  2DOQ A;  1LA3 A;  3IQQ A;  3RLZ A;  1NYA A;  3EVV A;  1H8B A;  1RFJ A;  1DTL A;  4P5O E;  2F2P A;  3AAK A;  2E30 A;  3SG3 A;  2L98 A;  1SMG A;  1BJF A;  2LVV A;  1IGV A;  2VRG A;  1NCX A;  1XYD A;  4FTG A;  4IL1 A;  4MLW A;  4Q04 A;  1KK7 Y;  2KI4 C;  3M0W A;  1YUT A;  5HLO A;  3OB1 B;  5IBW A;  1RWY A;  1CLL A;  1AUI B;  1OMV A;  1UUR A;  3A4U B;  5HKY A;  1IRJ A;  1GGW A;  1VRK A;  5K89 A;  5CSF A;  2JUL A;  4MZJ A;  2I2R E;  4YGD B;  5KTY A;  4PCW A;  1F54 A;  1QAS A;  1SCV A;  1F70 A;  1Y1X A;  1WRK A;  1SCM C;  2LAN A;  1S5G Y;  1SKT A;  1PUL A;  2O5G A;  2OTG B;  5AFP A;  1B8L A;  2LHL A;  1SL8 A;  2MJW B;  1CB1 A;  1JC2 A;  2JZI A;  2M97 A;  4ORC B;  4CPV A;  3KPX A;  1QX5 B;  3SG5 A;  1OSA A;  2CT9 A;  3BOW B;  3O6B A;  1CM1 A;  3K21 A;  2H2K A;  1WRL A;  1YTZ C;  5CSJ A;  1XFX O;  2F2O A;  1AP4 A;  1CDL A;  5F6T A;  2P6B B;  2NLN A;  3KHE A;  2JT0 A;  3TS5 B;  1A29 A;  1A75 A;  5JOL A;  2FCE A;  1PVB A;  2OS8 C;  2MAZ A;  3CR4 X;  3ZWH A;  4NQG A;  1LKJ A;  3GOF A;  3I5G C;  5DKQ A;  2WOR A;  3CR5 X;  1KWO B;  2NXQ A;  3WHT B;  2MHH A;  1K2H A;  1LXF C;  1MXL C;  1U5I A;  3O2P A;  2QPT A;  1XK4 C;  2ZKM X;  4JWQ A;  2F3Y A;  4MVF A;  2FJU B;  2KFG A;  4OV2 A;  1B47 A;  3WHU B;  4P2Y B;  1IQ5 A;  1MF8 B;  1KK7 Z;  1YX7 A;  4E68 A;  3LLE A;  1MHO A;  1CDN A;  3NXA A;  1KWO C;  2ZNE A;  2KAY A;  4MRY A;  1B4C A;  1YRT B;  4YI9 A;  2COL B;  4HRH A;  4AQI A;  1TCO B;  1EXR A;  1JF0 A;  3CZT X;  4YGA A;  1YRU B;  2B1U A;  1CDP A;  1K90 D;  4PHN A;  1QX7 A;  2KI6 D;  1QIV A;  1NX2 A;  1DVI A;  1QLK A;  3D0Y A;  1K96 A;  1V1G A;  3CR2 A;  5ER4 X;  1QVI Z;  3CTN A;  3RM1 A;  4AOM A;  2CBL A;  1UHH A;  2LAP A;  3FIA A;  3AKA A;  3EK8 A;  4A4B A;  1XA5 A;  4WQ2 A;  2L2E A;  2GV5 A;  3TS5 C;  2WOS A;  3EVR A;  3OP0 A;  4MEW A;  2H61 A;  2V53 A;  2PVB A;  1IH0 A;  2BE4 A;  1B7T Y;  5D69 A;  2JT8 A;  3EK4 A;  1KFU L;  3KO0 A;  1NCY A;  2WC8 A;  2K7B A;  3I5I B;  4ORA B;  2Q4U A;  4YGB B;  3JVT B;  2HPS A;  1CFD A;  2L51 A;  4ORB B;  2K0J A;  3BOW A;  4GGF A;  2Q91 A;  2JC2 A;  2ZRT A;  1J55 A;  3KEV A;  2CTN A;  1PRW A;  1SBJ A;  2KI6 C;  3NSL A;  1SYM A;  1N2D A;  2HQW A;  3NSK A;  1QV0 A;  1Y1A A;  2WND A;  1AK8 A;  2RGI A;  1MUX A;  4MBE A;  1KFU S;  2Y4Q A;  5CSI A;  1KCY A;  1A2X A;  2K7O A;  2KGR A;  1AVS A;  2JXC A;  3HX4 A;  2M1U A;  3PLF B;  2SAS A;  1OZO A;  1XFV O;  2KSP A;  2GGM A;  4C0J A;  3AAJ A;  2LVI A;  2BBN A;  1F4O A;  1JBA A;  1BT6 A;  1E8A A;  2LMU A;  1ALW A;  1F4Q A;  1ALV A;  1J7P A;  2KYC A;  1XFU O;  1HT9 A;  1BU3 A;  1X02 A;  2BKH B;  1OE9 B;  1S5G Z;  3EKJ A;  1IQ3 A;  1K9P A;  2G2B A;  4ZCV A;  4MRX A;  1KK8 C;  3QRX A;  2HET A;  3DVK A;  1TTX A;  1AJ5 A;  1SR6 C;  1G4Y R;  1U5I B;  1BR1 B;  1KFX L;  1IG5 A;  1N65 A;  1TNP A;  2KNE A;  2ZN8 A;  3C1V A;  4D1E A;  1QV1 A;  2K61 A;  1M46 A;  1CLM A;  2K7D A;  3EK7 A;  4USL A;  3VRR A;  4M2P A;  2BCB A;  1KSO A;  1A03 A;  5J3X A;  4GGN A;  2LC5 A;  3SG6 A;  3CLN A;  4NDD A;  3DVJ A;  3EVU A;  1TOP A;  5KU1 A;  2BL0 B;  2CNP A;  3GK2 A;  1DJX A;  2TN4 A;  2ISD A;  4UPG A;  5G08 A;  3TZ1 A;  1MXE A;  1V1F A;  1FPW A;  1YX8 A;  2PSR A;  4YI8 A;  5HKW A;  2Y5I A;  1K8U A;  1NIW A;  3I5G B;  3I5F C;  3SJS A;  2R2I A;  3PN7 C;  1SPY A;  5AEQ A;  2AAO A;  1ZAC A;  2QAC A;  2JT3 A;  2K2A A;  4OR9 B;  1W7J B;  2LUC A;  3VGO A;  1BR4 B;  4OKH A;  1SL9 A;  2BE6 A;  2NCO A;  1BOC A;  4ICB A;  4CFQ A;  1JF2 A;  1ZMZ A;  2D8N A;  5DKN A;  2NZ0 A;  3OHM B;  2PAS A;  3DVM A;  2JTZ A;  2LP3 A;  5AAN A;  1YUS A;  1DJG A;  5I2L A;  1S26 D;  1BOD A;  3PN7 B;  2JRF A;  1N0Y A;  1NPQ A;  1M63 B;  2LVK A;  3TUY C;  4I5K A;  1FW4 A;  1RTP 1;  3SIA A;  4GFT A;  4PHJ A;  1BG1 A;  1C07 A;  1F55 A;  4NDB A;  4MN0 A;  4WQ3 A;  2M0R A;  4OVN F;  1PSB A;  4R1E A;  5CPV A;  2MRD A;  2F3Z A;  1JFJ A;  4N1F A;  1BF5 A;  1C7V A;  4PHK A;  4N1G A;  3D0Y B;  1KK8 B;  5PAL A;  2GGZ A;  2KHN A;  4GAO A;  1J1E A;  1IJ6 A;  1NUB A;  2A4J A;  1S3P A;  1J1D A;  1K93 D;  2KDH A;  2LUX A;  4XJK A;  1M45 A;  2JWW A;  2HQ8 A;  1SW8 A;  2L5X B;  5HYD A;  1SR6 B;  2KQ6 A;  1XVJ A;  1UWO A;  1YVL A;  2I7A A;  1L2O C;  1KQV A;  2KQY A;  2NCP A;  1TCF A;  3BXK A;  2LVJ A;  4TNC A;  2I94 A;  3JTD C;  3BYA A;  3IQO A;  1CKK A;  5TNC A;  4I5N B;  1TNQ A;  2WCB A;  3PAL A;  2JTT A;  2L0P A;  3O78 A;  1F71 A;  1DT7 B;  1CFF A;  1KQM B;  3BUN B;  4YRU A;  1IJ5 A;  1H4B A;  5GQQ C;  1UHJ A;  2Y1N A;  4GUK A;  2WCE A;  1ODB A;  1XFY O;  1G8I A;  2Y1M A;  4PE0 A;  2KFF A;  3OB2 B;  1KSM A;  1LVC D;  1NX1 A;  1UHI A;  1SCM B;  4JQ0 D;  3MSE B;  1WRZ A;  4PHM A;  2EHB A;  1PAL A;  1OMR A;  2H61 C;  1YVH A;  1BLQ A;  2I18 A;  1DMO A;  1EH2 A;  1CM4 A;  1XK4 A;  1SRA A;  1QIW A;  1DJI A;  3I5F B;  3LCP C;  1J7R A;  2AUC A;  3F45 A;  2LLS A;  1G33 A;  3IF7 A;  4M2Q A;  4PE4 A;  2JPT A;  3VRQ A;  1FI6 A;  1YR5 A;  4BY5 A;  1IKU A;  2JOJ A;  1RRO A;  1QXP A;  2L4I A;  4ZCU A;  2M7L A;  4CFR A;  1B1G A; 
#chains in the Genus database with same CATH topology
 1ORG A;  1TNX A;  4GPL B;  1LIN A;  2LE9 B;  2KFH A;  3S0F A;  3BJH A;  2BAP A;  2LM5 A;  3DD4 A;  3R72 A;  4HRE E;  1UP5 A;  1BMO A;  1CDM A;  2M9G A;  3O4Y A;  1TUZ A;  1XFZ O;  1TUJ A;  1RK9 A;  2LLT A;  2M7N A;  2P70 A;  3S0A A;  1CLB A;  1UHN A;  1EG3 A;  5D3O A;  5HKZ A;  4C0K A;  3D77 A;  1C7W A;  1M39 A;  4U8D A;  1TNW A;  2K7C A;  1NWD A;  4QJ4 B;  1CFP A;  1NX0 A;  5BPJ A;  1TRF A;  2KAX A;  4BY4 A;  5KSZ A;  1REC A;  3VRN A;  2BEC A;  3DY9 A;  3D78 A;  5CSN A;  4L9M A;  3FWC A;  3KF9 A;  1FBV A;  1GQM A;  1Y0V H;  1QX2 A;  2M49 B;  3PM8 A;  5HL1 A;  1OZS A;  1IWQ A;  3R1P A;  5I94 A;  4QJ3 B;  1JFK A;  2BBM A;  3BUM B;  3I5H B;  5B8I B;  2KAV A;  1K9K A;  3CS1 A;  4CID A;  3DZT A;  1QTX A;  2JPO A;  3H4S E;  4MZK A;  1B7T Z;  1GJY A;  2EGD A;  2BKI B;  2OS8 B;  3OX5 A;  2JXL A;  1Q80 A;  1TIZ A;  1JUO A;  1Y6W A;  1HQV A;  2BCX A;  2OTG C;  2PRU A;  1J7O A;  2JQ6 A;  4GBA A;  2LNK A;  1S6J A;  3B86 A;  2EC6 C;  2KYF A;  4DIR A;  2PQL A;  3BUX B;  3VB1 A;  2E6W A;  2O60 A;  4C0L A;  2QEO A;  2KBI A;  1DJW A;  4XYN A;  1KQM C;  4PAL A;  3NSI A;  5ER5 A;  1EG4 A;  1QAT A;  3SIB A;  3CWG A;  1B8R A;  1EJ3 A;  3WXA A;  1WLM A;  5FI6 A;  1L7Z A;  1D1O A;  2WC6 A;  3TDI A;  2CXJ A;  1Z4H A;  1CTR A;  1WY9 A;  3BQ3 A;  3LL8 B;  3VRP A;  2FOT A;  1QLS A;  3ICB A;  3PFV A;  1SK6 D;  3LK1 A;  2K2F A;  1DF0 A;  4YBH B;  1S36 A;  3SG4 A;  2M8U A;  3OX6 A;  4CLN A;  2L50 A;  1CMG A;  2KBM A;  2ZRS A;  1LA0 A;  1A4P A;  1SY9 A;  3DVE A;  4MZL A;  3LK0 A;  1PSR A;  2EC6 B;  2MLE C;  2WCF A;  1XFW O;  3DYE A;  3S0E A;  1DGV A;  1YUR A;  2LHI A;  1QJT A;  1B9A A;  1R6P A;  1MWN A;  3WNX B;  2BL0 C;  3FE8 A;  1XO5 A;  3HCM A;  4OCI A;  1DQE A;  3V2L A;  4F7F A;  2WCH A;  1UUS A;  2LCP A;  2AMI A;  1CMF A;  1UHK A;  4ETO A;  3B87 A;  3L47 A;  4JPZ B;  1JSA A;  3VRO A;  4N5X A;  3I5H C;  1KFX S;  1PK0 D;  1RJV A;  4HSZ A;  3TDZ A;  3OBV A;  3ZNI A;  2G9B A;  2FCD A;  4A4C A;  5DKR A;  1YUU A;  1FF1 A;  3PAT A;  4XJK B;  1OOF A;  4YGC B;  1GGZ A;  3FS7 A;  4JD9 A;  4QJ5 B;  1ZFS A;  1JWD A;  1OOJ A;  1NX3 A;  1TN4 A;  4PE7 A;  2LV7 A;  1M31 A;  2MLF C;  4GNK B;  2JU0 A;  3TDU A;  1QS7 A;  3B7A A;  3PSR A;  2SCP A;  4DRW A;  2PAL A;  1DGU A;  1K94 A;  1K9U A;  3NHT A;  2KOT A;  1AHR A;  3TUY B;  3D74 A;  1R2U A;  2LP2 A;  3DF0 A;  2PMY A;  1AJ4 A;  1SL7 A;  3GK4 X;  3JVT C;  1C3Y A;  1CFC A;  2KGB C;  4DCK A;  1WDC B;  1S6C A;  2CCM A;  2OPO A;  5D7F A;  5HLV A;  2FJY A;  5I2O A;  1W7I B;  2ZFD A;  2JNX A;  3I5I C;  5I8N A;  2M1K B;  5DIC A;  4DS7 A;  1EL4 A;  1NSH A;  2ZND A;  1NP8 A;  1S1E A;  1ZOT B;  2JNF A;  4GGF C;  3CGA A;  3NSO A;  4PE1 A;  2L4H A;  3AKB A;  1MQ1 A;  4INX A;  2YGU A;  1MR8 A;  2M3W A;  1XFR A;  3FWB A;  2KI4 B;  1WDC C;  4I5J A;  4WRI A;  4DUQ A;  3A8R A;  4JKT A;  2IS9 A;  3E3R A;  1OQP A;  1WLZ A;  3SG7 A;  2MBX A;  4M2O A;  1PVA A;  3D10 A;  2K8M B;  5AXI A;  1S6I A;  1DF0 B;  1A75 B;  1QVI Y;  1OMD A;  3JTD B;  1F8H A;  1DJZ A;  1K95 A;  5I2Q A;  3EKH A;  4F0Z B;  1SNL A;  2QDI A;  3O4X A;  4HRG A;  2HF5 A;  2MA2 A;  1NCZ A;  3PJI A;  2ZN9 A;  4FQO A;  4I5L B;  2F33 A;  3SG2 A;  3BUO B;  4PDZ A;  5AER A;  1CNP A;  1J7Q A;  2BCA A;  3CDN A;  4YGE B;  2F8P A;  3GK1 A;  5FYX A;  1QWV A;  3DXL A;  4MSP A;  1B8C A;  1OOI X;  1Y1U A;  4NDC A;  2LMT A;  3DF0 B;  1L2O B;  1ZUZ A;  1DJY A;  4AQJ A;  1DJH A;  3BUW B;  2LMV A;  2LLU A;  2M29 A;  5JJG A;  2DOQ A;  1LA3 A;  3IQQ A;  3RLZ A;  1TWO A;  1NYA A;  3EVV A;  1H8B A;  1RFJ A;  1DTL A;  4P5O E;  2F2P A;  3AAK A;  2E30 A;  3SG3 A;  2L98 A;  1SMG A;  1BJF A;  2LVV A;  1IGV A;  2VRG A;  1NCX A;  1XYD A;  4FTG A;  4IL1 A;  3L4A A;  4MLW A;  4Q04 A;  1KK7 Y;  2KI4 C;  3M0W A;  1YUT A;  5HLO A;  3OB1 B;  5IBW A;  1RWY A;  1CLL A;  1AUI B;  1OMV A;  1UUR A;  3A4U B;  5HKY A;  1IRJ A;  1GGW A;  1VRK A;  5K89 A;  5CSF A;  2JUL A;  4MZJ A;  2I2R E;  4YGD B;  5KTY A;  4PCW A;  1F54 A;  1QAS A;  1SCV A;  3SS4 A;  1F70 A;  1Y1X A;  1WRK A;  1SCM C;  2LAN A;  1S5G Y;  1SKT A;  1PUL A;  2O5G A;  2OTG B;  5AFP A;  1B8L A;  2LHL A;  3EG5 B;  1SL8 A;  2MJW B;  1CB1 A;  1JC2 A;  2JZI A;  2M97 A;  4ORC B;  4CPV A;  3KPX A;  1QX5 B;  3R1V A;  3SG5 A;  1OSA A;  2CT9 A;  3BOW B;  3O6B A;  1CM1 A;  3FE9 A;  2H2K A;  1WRL A;  3K21 A;  1YTZ C;  5CSJ A;  1XFX O;  2F2O A;  3D76 A;  1AP4 A;  1CDL A;  5F6T A;  2P6B B;  1FI5 A;  2NLN A;  3K1E A;  3KHE A;  2JT0 A;  3B88 A;  3SS5 A;  3TS5 B;  1A29 A;  1A75 A;  4INW A;  5JOL A;  2FCE A;  1LS8 A;  1PVB A;  2OS8 C;  2MAZ A;  3CR4 X;  3ZWH A;  1Z2C B;  4NQG A;  1LKJ A;  3GOF A;  3I5G C;  5DKQ A;  2WOR A;  3CR5 X;  1KWO B;  2NXQ A;  3WHT B;  2MHH A;  1K2H A;  1LXF C;  1MXL C;  1U5I A;  3O2P A;  3NHI A;  2QPT A;  1XK4 C;  1SSE B;  2ZKM X;  1T14 A;  3D75 A;  2F3Y A;  4JWQ A;  2FJU B;  2KFG A;  4MVF A;  1B47 A;  4OV2 A;  3WHU B;  4P2Y B;  1IQ5 A;  1MF8 B;  1KK7 Z;  1YX7 A;  5FI7 A;  4E68 A;  3LLE A;  1MHO A;  1CDN A;  3NXA A;  1KWO C;  2ZNE A;  2KAY A;  5FI2 A;  4MRY A;  1B4C A;  1GM0 A;  1YRT B;  4YI9 A;  2COL B;  4HRH A;  4AQI A;  1TCO B;  1EXR A;  1JF0 A;  3CZT X;  4YGA A;  1YRU B;  2B1U A;  1CDP A;  1K90 D;  4PHN A;  1QX7 A;  2KI6 D;  1QIV A;  1NX2 A;  1DVI A;  3L4L A;  1QLK A;  3D0Y A;  1K96 A;  1V1G A;  3CR2 A;  5ER4 X;  1QVI Z;  3CTN A;  3RM1 A;  4AOM A;  2CBL A;  1UHH A;  2LAP A;  3FIA A;  1DEK A;  3AKA A;  3EK8 A;  3N7H A;  4A4B A;  1XA5 A;  1DEL A;  4WQ2 A;  2L2E A;  2GV5 A;  3TS5 C;  2WOS A;  5EL2 A;  3EVR A;  3OP0 A;  4MEW A;  2H61 A;  2V53 A;  2PVB A;  1IH0 A;  2BE4 A;  1B7T Y;  1W9Z A;  5D69 A;  2JT8 A;  3EK4 A;  3CZ0 A;  1KFU L;  3KO0 A;  1NCY A;  2WC8 A;  2K7B A;  3I5I B;  4ORA B;  2Q4U A;  2H8V A;  4YGB B;  3JVT B;  2HPS A;  1CFD A;  2L51 A;  4ORB B;  2K0J A;  3BOW A;  4GGF A;  2Q91 A;  2JC2 A;  2ZRT A;  1J55 A;  3KEV A;  2CTN A;  1PRW A;  1SBJ A;  2KI6 C;  3NSL A;  1SYM A;  1N2D A;  2HQW A;  3NSK A;  1QV0 A;  1Y1A A;  2WND A;  1AK8 A;  2RGI A;  1MUX A;  4MBE A;  1KFU S;  3BFB A;  2Y4Q A;  5CSI A;  2QEV A;  1A2X A;  3B6X A;  1KCY A;  2K7O A;  2KGR A;  1AVS A;  2JXC A;  3HX4 A;  2M1U A;  2PYQ A;  3PLF B;  2SAS A;  1OZO A;  1XFV O;  2KSP A;  2GGM A;  4C0J A;  3AAJ A;  2LVI A;  2BBN A;  1F4O A;  1JBA A;  1BT6 A;  2QEH A;  3R1O A;  1E8A A;  2LMU A;  1ALW A;  1F4Q A;  1ALV A;  1J7P A;  1C3Z A;  2KYC A;  1XFU O;  1HT9 A;  1BU3 A;  1X02 A;  2BKH B;  1OE9 B;  1S5G Z;  3EKJ A;  1IQ3 A;  1K9P A;  2G2B A;  4ZCV A;  4MRX A;  1KK8 C;  3QRX A;  4IJ7 A;  2HET A;  3DVK A;  1TTX A;  3NGV A;  1P28 A;  1AJ5 A;  4FQT A;  1SR6 C;  1G4Y R;  1U5I B;  1BR1 B;  1KFX L;  1IG5 A;  1N65 A;  1TNP A;  2KNE A;  2ZN8 A;  3C1V A;  4D1E A;  1QV1 A;  3CAB A;  2K61 A;  1DC1 A;  1M46 A;  3RZS A;  1CLM A;  2K7D A;  3EK7 A;  4USL A;  3VRR A;  4M2P A;  2BCB A;  1KSO A;  1A03 A;  5J3X A;  2L5Y A;  4GGN A;  2LC5 A;  3SG6 A;  3CLN A;  4NDD A;  3DVJ A;  3EVU A;  1TOP A;  5KU1 A;  2BL0 B;  2CNP A;  3GK2 A;  1OOG A;  1DJX A;  2TN4 A;  2ISD A;  1OOH A;  4UPG A;  5G08 A;  3TZ1 A;  1OW4 A;  1MXE A;  1V1F A;  1FPW A;  1YX8 A;  2PSR A;  4YI8 A;  5HKW A;  2Y5I A;  1K8U A;  3BFA A;  1NIW A;  3I5G B;  3I5F C;  3SJS A;  2R2I A;  3PN7 C;  1SPY A;  5AEQ A;  2AAO A;  1ZAC A;  2QAC A;  2JT3 A;  2K2A A;  4OR9 B;  4KYN A;  1W7J B;  2LUC A;  3VGO A;  1BR4 B;  3SS3 A;  4OKH A;  1SL9 A;  2BE6 A;  2NCO A;  1BOC A;  4ICB A;  4CFQ A;  1JF2 A;  1ZMZ A;  2D8N A;  5DKN A;  2NZ0 A;  3OHM B;  2PAS A;  3DVM A;  2JTZ A;  2LP3 A;  5AAN A;  4PT1 A;  1YUS A;  1DJG A;  2KPH A;  5I2L A;  1S26 D;  1BOD A;  3PN7 B;  2JRF A;  1N0Y A;  1NPQ A;  1M63 B;  2LVK A;  3UNW A;  4I5K A;  1FW4 A;  1RTP 1;  3SIA A;  4GFT A;  4PHJ A;  3TUY C;  1BG1 A;  1C07 A;  1F55 A;  4NDB A;  3QME A;  2KLE A;  4MN0 A;  2L2C A;  3S0G A;  2QEB A;  4WQ3 A;  2M0R A;  4OVN F;  1PSB A;  3D73 A;  4R1E A;  5CPV A;  2MRD A;  2F3Z A;  1JFJ A;  4N1F A;  1BF5 A;  1C7V A;  2ERB A;  2KLD A;  4PHK A;  4N1G A;  3D0Y B;  1KK8 B;  5PAL A;  2K60 A;  2GGZ A;  2KHN A;  4GAO A;  1J1E A;  1IJ6 A;  1NUB A;  2A4J A;  1S3P A;  1J1D A;  3S0D A;  1K93 D;  2KDH A;  2LUX A;  4XJK A;  1M45 A;  2JWW A;  2HQ8 A;  1SW8 A;  2L5X B;  5HYD A;  1SR6 B;  2KQ6 A;  1XVJ A;  1UWO A;  1YVL A;  2I7A A;  1L2O C;  3CYZ A;  1KQV A;  2KQY A;  2NCP A;  1TCF A;  3BXK A;  3Q8I A;  2LVJ A;  4TNC A;  2WC5 A;  2I94 A;  3JTD C;  3BYA A;  3BFH A;  3IQO A;  2WCJ A;  1CKK A;  5TNC A;  4I5N B;  3PM2 A;  1TNQ A;  2WCB A;  3PAL A;  2JTT A;  2L0P A;  3O78 A;  1F71 A;  1DT7 B;  1CFF A;  2WCM A;  1KQM B;  4OZD A;  3BUN B;  4YRU A;  1IJ5 A;  1H4B A;  5GQQ C;  1UHJ A;  2Y1N A;  3CZ1 A;  2WCE A;  1ODB A;  3IVT A;  4GUK A;  1XFY O;  1G8I A;  2Y1M A;  4PE0 A;  2KFF A;  3OB2 B;  1KSM A;  1LVC D;  3FE6 A;  1NX1 A;  1UHI A;  1SCM B;  4JQ0 D;  3MSE B;  1WRZ A;  4PHM A;  2EHB A;  1PAL A;  2GTE A;  1OMR A;  2H61 C;  1YVH A;  2BNX A;  1BLQ A;  2I18 A;  3CZ2 A;  1DMO A;  1EH2 A;  1CM4 A;  1XK4 A;  1SRA A;  1QIW A;  1DJI A;  2P71 A;  2WCK A;  3I5F B;  1J7R A;  2AUC A;  3LCP C;  3F45 A;  2LLS A;  1G33 A;  3IF7 A;  3UO9 A;  4M2Q A;  1IIO A;  4PE4 A;  2JPT A;  3S0B A;  2WCL A;  3VRQ A;  1FI6 A;  1YR5 A;  3OGN A;  4BY5 A;  1IKU A;  2JOJ A;  1RRO A;  1QXP A;  2L4I A;  4ZCU A;  2M7L A;  4CFR A;  1B1G A; 
#chains in the Genus database with same CATH homology
 1TNX A;  4GPL B;  1LIN A;  2LE9 B;  2KFH A;  2LM5 A;  3DD4 A;  4HRE E;  1UP5 A;  1BMO A;  1CDM A;  2M9G A;  3O4Y A;  1XFZ O;  1RK9 A;  2LLT A;  2M7N A;  1CLB A;  1UHN A;  1EG3 A;  5HKZ A;  4C0K A;  1C7W A;  1M39 A;  4U8D A;  1TNW A;  2K7C A;  1NWD A;  4QJ4 B;  1CFP A;  1NX0 A;  5BPJ A;  1TRF A;  2KAX A;  4BY4 A;  5KSZ A;  1REC A;  3VRN A;  2BEC A;  5CSN A;  4L9M A;  3FWC A;  3KF9 A;  1FBV A;  1GQM A;  1Y0V H;  1QX2 A;  2M49 B;  3PM8 A;  1OZS A;  1IWQ A;  4QJ3 B;  1JFK A;  2BBM A;  3BUM B;  3I5H B;  5B8I B;  2KAV A;  1K9K A;  3CS1 A;  4CID A;  1QTX A;  3H4S E;  4MZK A;  1B7T Z;  1GJY A;  2EGD A;  2BKI B;  2OS8 B;  3OX5 A;  2JXL A;  1Q80 A;  1TIZ A;  1JUO A;  1Y6W A;  1HQV A;  2BCX A;  2OTG C;  2PRU A;  1J7O A;  2JQ6 A;  4GBA A;  2LNK A;  1S6J A;  2EC6 C;  2KYF A;  4DIR A;  3BUX B;  2E6W A;  2O60 A;  4C0L A;  2KBI A;  1DJW A;  4XYN A;  1KQM C;  4PAL A;  3NSI A;  5ER5 A;  1EG4 A;  1QAT A;  3SIB A;  3CWG A;  1B8R A;  1EJ3 A;  3WXA A;  1WLM A;  1L7Z A;  1D1O A;  3TDI A;  2CXJ A;  1CTR A;  1WY9 A;  3BQ3 A;  3LL8 B;  3VRP A;  2FOT A;  1QLS A;  3ICB A;  3PFV A;  1SK6 D;  3LK1 A;  2K2F A;  1DF0 A;  4YBH B;  1S36 A;  3SG4 A;  2M8U A;  3OX6 A;  4CLN A;  2L50 A;  1CMG A;  2KBM A;  2ZRS A;  1LA0 A;  1A4P A;  1SY9 A;  3DVE A;  4MZL A;  3LK0 A;  1PSR A;  2EC6 B;  2MLE C;  2WCF A;  1XFW O;  1DGV A;  1YUR A;  2LHI A;  1QJT A;  1B9A A;  1R6P A;  1MWN A;  3WNX B;  2BL0 C;  1XO5 A;  3HCM A;  4OCI A;  1UUS A;  2LCP A;  2AMI A;  1CMF A;  1UHK A;  4ETO A;  4JPZ B;  1JSA A;  3VRO A;  4N5X A;  3I5H C;  1KFX S;  1PK0 D;  1RJV A;  4HSZ A;  3TDZ A;  3ZNI A;  2G9B A;  2FCD A;  4A4C A;  5DKR A;  1YUU A;  1FF1 A;  3PAT A;  4XJK B;  4YGC B;  1GGZ A;  3FS7 A;  4QJ5 B;  1ZFS A;  1JWD A;  1OOJ A;  1NX3 A;  1TN4 A;  4PE7 A;  2LV7 A;  1M31 A;  2MLF C;  4GNK B;  2JU0 A;  3TDU A;  1QS7 A;  3PSR A;  4DRW A;  2SCP A;  1FI5 A;  2PAL A;  1DGU A;  1K94 A;  1K9U A;  2KOT A;  1AHR A;  3TUY B;  3GK4 X;  1R2U A;  2LP2 A;  3DF0 A;  2PMY A;  1AJ4 A;  1SL7 A;  3JVT C;  1CFC A;  2KGB C;  4DCK A;  1WDC B;  1S6C A;  2CCM A;  2OPO A;  5D7F A;  5HLV A;  5I2O A;  1W7I B;  2ZFD A;  2JNX A;  3I5I C;  5I8N A;  2M1K B;  4DS7 A;  1EL4 A;  1NSH A;  2ZND A;  1NP8 A;  1S1E A;  1ZOT B;  2JNF A;  4GGF C;  3CGA A;  3NSO A;  4PE1 A;  2L4H A;  3AKB A;  1MQ1 A;  1MR8 A;  2M3W A;  3FWB A;  2KI4 B;  1WDC C;  4I5J A;  4WRI A;  4DUQ A;  3A8R A;  2IS9 A;  3E3R A;  1OQP A;  1WLZ A;  3SG7 A;  2MBX A;  4M2O A;  1PVA A;  3D10 A;  2K8M B;  5AXI A;  1S6I A;  1DF0 B;  1A75 B;  1QVI Y;  1OMD A;  3JTD B;  1F8H A;  1DJZ A;  1K95 A;  5I2Q A;  3EKH A;  4F0Z B;  1SNL A;  4HRG A;  2HF5 A;  2MA2 A;  1NCZ A;  2ZN9 A;  4FQO A;  4I5L B;  2F33 A;  3SG2 A;  3BUO B;  4PDZ A;  5AER A;  1CNP A;  1J7Q A;  2BCA A;  4YGE B;  2F8P A;  3GK1 A;  5FYX A;  4MSP A;  1B8C A;  1Y1U A;  4NDC A;  2LMT A;  3DF0 B;  1L2O B;  1ZUZ A;  1DJY A;  4AQJ A;  1DJH A;  3BUW B;  2LMV A;  2LLU A;  2M29 A;  5JJG A;  2DOQ A;  1LA3 A;  3IQQ A;  3RLZ A;  1NYA A;  3EVV A;  1H8B A;  1RFJ A;  1DTL A;  4P5O E;  2F2P A;  3AAK A;  2E30 A;  3SG3 A;  2L98 A;  1SMG A;  1BJF A;  2LVV A;  1IGV A;  2VRG A;  1NCX A;  1XYD A;  4FTG A;  4IL1 A;  4MLW A;  4Q04 A;  1KK7 Y;  2KI4 C;  3M0W A;  1YUT A;  5HLO A;  3OB1 B;  5IBW A;  1RWY A;  1CLL A;  1AUI B;  1OMV A;  1UUR A;  3A4U B;  5HKY A;  1IRJ A;  1GGW A;  1VRK A;  5K89 A;  5CSF A;  2JUL A;  4MZJ A;  2I2R E;  4YGD B;  5KTY A;  4PCW A;  1F54 A;  1QAS A;  1SCV A;  1F70 A;  1Y1X A;  1WRK A;  1SCM C;  2LAN A;  1S5G Y;  1SKT A;  1PUL A;  2O5G A;  2OTG B;  5AFP A;  1B8L A;  2LHL A;  1SL8 A;  2MJW B;  1CB1 A;  1JC2 A;  2JZI A;  2M97 A;  4ORC B;  4CPV A;  3KPX A;  1QX5 B;  3SG5 A;  1OSA A;  2CT9 A;  3BOW B;  3O6B A;  1CM1 A;  3K21 A;  2H2K A;  1WRL A;  1YTZ C;  5CSJ A;  1XFX O;  2F2O A;  1AP4 A;  1CDL A;  5F6T A;  2P6B B;  2NLN A;  3KHE A;  2JT0 A;  3TS5 B;  1A29 A;  1A75 A;  5JOL A;  2FCE A;  1PVB A;  2OS8 C;  2MAZ A;  3CR4 X;  3ZWH A;  4NQG A;  1LKJ A;  3GOF A;  3I5G C;  5DKQ A;  2WOR A;  3CR5 X;  1KWO B;  2NXQ A;  3WHT B;  2MHH A;  1K2H A;  1LXF C;  1MXL C;  1U5I A;  3O2P A;  2QPT A;  1XK4 C;  2ZKM X;  4JWQ A;  2F3Y A;  4MVF A;  2FJU B;  2KFG A;  4OV2 A;  1B47 A;  3WHU B;  4P2Y B;  1IQ5 A;  1MF8 B;  1KK7 Z;  1YX7 A;  4E68 A;  3LLE A;  1MHO A;  1CDN A;  3NXA A;  1KWO C;  2ZNE A;  2KAY A;  4MRY A;  1B4C A;  1YRT B;  4YI9 A;  2COL B;  4HRH A;  4AQI A;  1TCO B;  1EXR A;  1JF0 A;  3CZT X;  4YGA A;  1YRU B;  2B1U A;  1CDP A;  1K90 D;  4PHN A;  1QX7 A;  2KI6 D;  1QIV A;  1NX2 A;  1DVI A;  1QLK A;  3D0Y A;  1K96 A;  1V1G A;  3CR2 A;  5ER4 X;  1QVI Z;  3CTN A;  3RM1 A;  4AOM A;  2CBL A;  1UHH A;  2LAP A;  3FIA A;  3AKA A;  3EK8 A;  4A4B A;  1XA5 A;  4WQ2 A;  2L2E A;  2GV5 A;  3TS5 C;  2WOS A;  3EVR A;  3OP0 A;  4MEW A;  2H61 A;  2V53 A;  2PVB A;  1IH0 A;  2BE4 A;  1B7T Y;  5D69 A;  2JT8 A;  3EK4 A;  1KFU L;  3KO0 A;  1NCY A;  2WC8 A;  2K7B A;  3I5I B;  4ORA B;  2Q4U A;  4YGB B;  3JVT B;  2HPS A;  1CFD A;  2L51 A;  4ORB B;  2K0J A;  3BOW A;  4GGF A;  2Q91 A;  2JC2 A;  2ZRT A;  1J55 A;  3KEV A;  2CTN A;  1PRW A;  1SBJ A;  2KI6 C;  3NSL A;  1SYM A;  1N2D A;  2HQW A;  3NSK A;  1QV0 A;  1Y1A A;  2WND A;  1AK8 A;  2RGI A;  1MUX A;  4MBE A;  1KFU S;  2Y4Q A;  5CSI A;  1KCY A;  1A2X A;  2K7O A;  2KGR A;  1AVS A;  2JXC A;  3HX4 A;  2M1U A;  3PLF B;  2SAS A;  1OZO A;  1XFV O;  2KSP A;  2GGM A;  4C0J A;  3AAJ A;  2LVI A;  2BBN A;  1F4O A;  1JBA A;  1BT6 A;  1E8A A;  2LMU A;  1ALW A;  1F4Q A;  1ALV A;  1J7P A;  2KYC A;  1XFU O;  1HT9 A;  1BU3 A;  1X02 A;  2BKH B;  1OE9 B;  1S5G Z;  3EKJ A;  1IQ3 A;  1K9P A;  2G2B A;  4ZCV A;  4MRX A;  1KK8 C;  3QRX A;  2HET A;  3DVK A;  1TTX A;  1AJ5 A;  1SR6 C;  1G4Y R;  1U5I B;  1BR1 B;  1KFX L;  1IG5 A;  1N65 A;  1TNP A;  2KNE A;  2ZN8 A;  3C1V A;  4D1E A;  1QV1 A;  2K61 A;  1M46 A;  1CLM A;  2K7D A;  3EK7 A;  4USL A;  3VRR A;  4M2P A;  2BCB A;  1KSO A;  1A03 A;  5J3X A;  4GGN A;  2LC5 A;  3SG6 A;  3CLN A;  4NDD A;  3DVJ A;  3EVU A;  1TOP A;  5KU1 A;  2BL0 B;  2CNP A;  3GK2 A;  1DJX A;  2TN4 A;  2ISD A;  4UPG A;  5G08 A;  3TZ1 A;  1MXE A;  1V1F A;  1FPW A;  1YX8 A;  2PSR A;  4YI8 A;  5HKW A;  2Y5I A;  1K8U A;  1NIW A;  3I5G B;  3I5F C;  3SJS A;  2R2I A;  3PN7 C;  1SPY A;  5AEQ A;  2AAO A;  1ZAC A;  2QAC A;  2JT3 A;  2K2A A;  4OR9 B;  1W7J B;  2LUC A;  3VGO A;  1BR4 B;  4OKH A;  1SL9 A;  2BE6 A;  2NCO A;  1BOC A;  4ICB A;  4CFQ A;  1JF2 A;  1ZMZ A;  2D8N A;  5DKN A;  2NZ0 A;  3OHM B;  2PAS A;  3DVM A;  2JTZ A;  2LP3 A;  5AAN A;  1YUS A;  1DJG A;  5I2L A;  1S26 D;  1BOD A;  3PN7 B;  2JRF A;  1N0Y A;  1NPQ A;  1M63 B;  2LVK A;  3TUY C;  4I5K A;  1FW4 A;  1RTP 1;  3SIA A;  4GFT A;  4PHJ A;  1BG1 A;  1C07 A;  1F55 A;  4NDB A;  4MN0 A;  4WQ3 A;  2M0R A;  4OVN F;  1PSB A;  4R1E A;  5CPV A;  2MRD A;  2F3Z A;  1JFJ A;  4N1F A;  1BF5 A;  1C7V A;  4PHK A;  4N1G A;  3D0Y B;  1KK8 B;  5PAL A;  2GGZ A;  2KHN A;  4GAO A;  1J1E A;  1IJ6 A;  1NUB A;  2A4J A;  1S3P A;  1J1D A;  1K93 D;  2KDH A;  2LUX A;  4XJK A;  1M45 A;  2JWW A;  2HQ8 A;  1SW8 A;  2L5X B;  5HYD A;  1SR6 B;  2KQ6 A;  1XVJ A;  1UWO A;  1YVL A;  2I7A A;  1L2O C;  1KQV A;  2KQY A;  2NCP A;  1TCF A;  3BXK A;  2LVJ A;  4TNC A;  2I94 A;  3JTD C;  3BYA A;  3IQO A;  1CKK A;  5TNC A;  4I5N B;  1TNQ A;  2WCB A;  3PAL A;  2JTT A;  2L0P A;  3O78 A;  1F71 A;  1DT7 B;  1CFF A;  1KQM B;  3BUN B;  4YRU A;  1IJ5 A;  1H4B A;  5GQQ C;  1UHJ A;  2Y1N A;  4GUK A;  2WCE A;  1ODB A;  1XFY O;  1G8I A;  2Y1M A;  4PE0 A;  2KFF A;  3OB2 B;  1KSM A;  1LVC D;  1NX1 A;  1UHI A;  1SCM B;  4JQ0 D;  3MSE B;  1WRZ A;  4PHM A;  2EHB A;  1PAL A;  1OMR A;  2H61 C;  1YVH A;  1BLQ A;  2I18 A;  1DMO A;  1EH2 A;  1CM4 A;  1XK4 A;  1SRA A;  1QIW A;  1DJI A;  3I5F B;  3LCP C;  1J7R A;  2AUC A;  3F45 A;  2LLS A;  1G33 A;  3IF7 A;  4M2Q A;  4PE4 A;  2JPT A;  3VRQ A;  1FI6 A;  1YR5 A;  4BY5 A;  1IKU A;  2JOJ A;  1RRO A;  1QXP A;  2L4I A;  4ZCU A;  2M7L A;  4CFR A;  1B1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...