2ZRTA

Crystal structure of zn2+-bound form of des3-23alg-2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
165
structure length
165
Chain Sequence
QSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallization and X-ray diffraction analysis of N-terminally truncated human ALG-2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Programmed cell death protein 6
total genus 22
structure length 165
sequence length 165
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2zrtA00
2Y4QA 5I2QA 3JTDB 1CDNA 2BE6A 1L2OC 1C07A 3ICBA 2JULA 2K2AA 1CDMA 1DF0A 5IBWA 5GQQC 2L2EA 2CNPA 1ZUZA 1IQ5A 1BT6A 2JOJA 4N5XA 2M9GA 1PK0D 1UHIA 2E6WA 1SW8A 2L5XB 2JNXA 2LVIA 1AUIB 1KQVA 4PCWA 4MRXA 1JFJA 1PSBA 1CFFA 3AKBA 1DJWA 1NSHA 5HKYA 1S6IA 1IWQA 1K93D 1AJ4A 3AKAA 1GQMA 1B8CA 2AAOA 1QV0A 2V53A 1JF0A 1UWOA 3WNXB 5ER5A 1DJZA 3SIAA 1OZSA 1MF8B 2M29A 5ER4X 3JVTB 1OMVA 2M0RA 1FF1A 1SL9A 1UHKA 2GGZA 4ZCVA 4FTGA 1RJVA 4M2OA 5CSNA 2Y5IA 1MWNA 1SKTA 2KSPA 3LK0A 1SR6C 2JC2A 1QX7A 2M7LA 5CSIA 3PFVA 2PMYA 2KQYA 1TCOB 1OSAA 4YGAA 5DKRA 2GV5A 2KI6C 1K94A 1LKJA 3I5FC 5BPJA 3K21A 1CDPA 5AANA 4I5KA 1YRUB 3PN7B 3BUMB 4A4BA 5KSZA 2F8PA 5B8IB 4OV2A 3VRPA 4D1EA 3O6BA 1QS7A 4OKHA 4GAOA 1SCMB 1Y1UA 4ZCUA 3TDUA 1KFUL 1QASA 1HQVA 1RWYA 4GFTA 1KSOA 4PHKA 4ORBB 2ZFDA 3OB2B 4PALA 1BR4B 2LAPA 2KOTA 1YTZC 1C7VA 3D0YB 3DVJA 3GOFA 5I2OA 3WHUB 1ALVA 2LUCA 1IJ6A 1K9UA 1M63B 3CS1A 2F3ZA 4U8DA 2M1KB 3IF7A 1J7OA 1J1EA 1QX2A 2KI4C 1QLSA 1AVSA 1W7JB 3PN7C 5K89A 3O78A 2BBNA 1CLBA 2KFFA 4WQ2A 1KK8B 4MBEA 3TZ1A 1BJFA 1K90D 3H4SE 4E68A 2FCEA 1K96A 1KWOB 1XYDA 1H4BA 1TNPA 1AHRA 3DF0A 3E3RA 2KGBC 1RROA 2LLUA 3TS5B 2EGDA 4C0JA 2JZIA 1YX8A 1G8IA 1A2XA 3GK2A 3BUNB 2CCMA 1OE9B 1V1GA 4N1GA 2OTGC 3BUOB 3TUYC 1CFCA 1DT7B 3HX4A 1A75A 3IQQA 1CDLA 2WCBA 1DJGA 2I2RE 3A8RA 3DF0B 3I5FB 4NDBA 5KTYA 3EVVA 1TRFA 2BCBA 1KWOC 2KAXA 1PALA 2H61A 4HREE 1LVCD 2QPTA 4Q04A 3BXKA 1QVIY 2NCOA 1QX5B 2KFHA 5AXIA 2HETA 1XFWO 2EC6C 1OMRA 1R6PA 2JTZA 3C1VA 3OX6A 4HRHA 5JOLA 1EH2A 3AAKA 3FWBA 1N65A 1F4OA 3BYAA 2BBMA 4F0ZB 1UHNA 1QV1A 2LC5A 1F4QA 1AK8A 1Q80A 2F2PA 2WCEA 1X02A 4FQOA 4DCKA 1NP8A 2LMVA 2KNEA 1DJIA 2KYFA 3CTNA 1RK9A 2GGMA 4NQGA 2H61C 1S5GY 1CMGA 4P2YB 5PALA 4GUKA 1H8BA 1W7IB 2CBLA 1K95A 1KQMB 4DIRA 1UHHA 2KI6D 4WRIA 2A4JA 2R2IA 3IQOA 3SG5A 4AQJA 2LMTA 2K7OA 1YR5A 2LLSA 2RGIA 2PVBA 5D69A 1NUBA 3OHMB 2MJWB 2KHNA 1UHJA 3JVTC 1B7TZ 3KEVA 3LCPC 2K7BA 5J3XA 4PE7A 2LLTA 1AJ5A 3JTDC 1CFPA 4MRYA 2KQ6A 2MAZA 4PE4A 1CFDA 1SR6B 3EVRA 2JRFA 1SBJA 2F33A 2I18A 3QRXA 4CLNA 2KGRA 2PRUA 1KQMC 1IGVA 5CSJA 1ZOTB 5TNCA 1F71A 1CM1A 3SG7A 3F45A 3OX5A 1JUOA 4P5OE 1UP5A 2JWWA 3DVKA 1K2HA 2O60A 2LVVA 3SG6A 1M39A 1MXEA 1CTRA 3HCMA 1QXPA 1G4YR 1SL7A 3I5GC 1RTP1 1SK6D 5D7FA 1V1FA 4MSPA 3I5IC 2LCPA 4N1FA 2KYCA 1PSRA 3OB1B 4I5JA 2H2KA 3SG4A 2M8UA 1WY9A 2M3WA 3BQ3A 5AFPA 1CNPA 1DGUA 1XFXO 1QLKA 3EK7A 2BKHB 3EVUA 4PDZA 1NX2A 2SCPA 5AEQA 4YGBB 1IH0A 1GJYA 4C0LA 1RFJA 1TNQA 3EKJA 1CMFA 2MBXA 5JJGA 2CTNA 1PVAA 1CLMA 4I5NB 3WXAA 1LINA 3LK1A 4JPZB 4L9MA 4AQIA 1TCFA 1B7TY 1K8UA 4M2PA 3SG3A 3KO0A 2JQ6A 1JC2A 1KFXS 1KFXL 4QJ3B 2P6BB 1BOCA 2LUXA 2HF5A 1S1EA 3VGOA 2LHLA 2EHBA 2MHHA 2M49B 1WRKA 3DVMA 3MSEB 1FPWA 4QJ5B 1N2DA 1ZFSA 1XO5A 4JQ0D 1OMDA 2WOSA 4OCIA 4DUQA 2BL0B 3CWGA 1E8AA 3PALA 3ZNIA 1MQ1A 1XA5A 2ZRSA 1Y1XA 3EKHA 5HLVA 3LLEA 1A4PA 1SYMA 2NZ0A 3NSKA 1J55A 4GGFA 2NLNA 4GPLB 2KDHA 2CXJA 2BCAA 2WC8A 5FYXA 1DTLA 2ZNDA 1DMOA 2AMIA 3TDIA 3CR5X 1FI5A 2Y1MA 4CFQA 1JSAA 3I5IB 4I5LB 3BUXB 1JBAA 4PE0A 3BUWB 1CKKA 1EXRA 1S5GZ 1XFZO 3ZWHA 1GGWA 5AERA 2LV7A 1B8RA 1B8LA 3CR2A 1BMOA 2L4HA 2L98A 2E30A 1F8HA 1TTXA 4MLWA 2LP3A 4OR9B 3M0WA 4CFRA 1IJ5A 2L4IA 2LMUA 4YI9A 5I8NA 1YURA 1ZMZA 1DJYA 4GGNA 1C7WA 2D8NA 1NIWA 2HQ8A 2LANA 4GGFC 1L2OB 1IRJA 2MLFC 2JT8A 4R1EA 1KK7Z 1KSMA 1NPQA 3VRNA 2JXLA 1F55A 2JTTA 4CIDA 1NYAA 1AP4A 3RLZA 1A29A 1TIZA 3CR4X 1EG4A 1NCZA 4NDCA 2NXQA 3TDZA 1LA0A 3TUYB 1BF5A 2ISDA 3CZTX 1SPYA 1WDCC 2ZN8A 1VRKA 1MR8A 3DVEA 4PHMA 2M1UA 1IKUA 1IQ3A 3BOWB 1NX0A 2VRGA 1SRAA 2BCXA 1J7RA 2JU0A 1Y1AA 2PASA 4ORAB 2BL0C 2OS8C 2LE9B 2OTGB 1ODBA 4YI8A 1J7PA 1B47A 1F54A 1XFUO 5HKZA 3FS7A 4GBAA 4QJ4B 4PHJA 1S6CA 4MZKA 2EC6B 3WHTB 1OOJA 3OP0A 2LNKA 2JPTA 1RECA 1MHOA 1QIVA 1XFVO 1OZOA 4ICBA 3CGAA 1BR1B 1QVIZ 1K9KA 2K61A 1EL4A 3PSRA 2LHIA 3A4UB 1U5IB 2LP2A 1YRTB 1JWDA 2COLB 2G2BA 1FW4A 1ZACA 4A4CA 1NCYA 1SCVA 3O2PA 5HYDA 4MN0A 2K8MB 1U5IA 4DS7A 4UPGA 1K9PA 2MRDA 1B1GA 4XJKB 4M2QA 1NX1A 3VROA 4YRUA 5CPVA 2KAYA 2M7NA 1HT9A 3D10A 3GK1A 4AOMA 3FWCA 4MZJA 1IG5A 2IS9A 2BKIB 2I7AA 2DOQA 3KPXA 4YBHB 1A75B 3PATA 1UUSA 1Y0VH 4ETOA 1QIWA 3I5GB 3EK8A 2KBMA 2I94A 2NCPA 1DVIA 2MLEC 1XFYO 1YUTA 3I5HB 1SCMC 3KHEA 2M97A 4MVFA 3BOWA 2JXCA 1S3PA 2KBIA 1TN4A 4YGDB 1XK4A 2LVKA 1D1OA 2CT9A 1WDCB 1XK4C 1GGZA 3O4YA 1S6JA 1Y6WA 1TOPA 2LM5A 1TNXA 2QACA 1DJXA 3NXAA 2OS8B 1WRZA 1R2UA 5DKNA 2L50A 1KCYA 1DJHA 5DKQA 1ALWA 1EJ3A 1JFKA 2AUCA 3SG2A 1N0YA 2G9BA 2Y1NA 2BE4A 1KK8C 1G33A 1YX7A 3D0YA 4TNCA 1M31A 2ZRTA 4PHNA 2PSRA 1KFUS 2FOTA 1QTXA 1BODA 3FIAA 1PRWA 2WNDA 3GK4X 4JWQA 4NDDA 4XYNA 5KU1A 3VRQA 1NX3A 4OVNF 1WRLA 4PE1A 4YGCB 1YUSA 4CPVA 1A03A 1TNWA 3EK4A 4USLA 1MUXA 1FI6A 2PALA 2ZN9A 4BY5A 4C0KA 2WORA 1EG3A 2FJUB 2HQWA 4XJKA 1SNLA 2B1UA 3AAJA 3LL8B 3KF9A 1SMGA 1B4CA 2KFGA 4HRGA 1BU3A 3TS5C 3SIBA 2FCDA 1DF0B 2K7DA 2F3YA 3VRRA 2WCFA 3CLNA 1YVLA 1QATA 3DD4A 3NSOA 3NSIA 5HLOA 2K2FA 3PM8A 5CSFA 1OQPA 1B9AA 1J1DA 1PVBA 1CM4A 1WLMA 2JNFA 1XVJA 4WQ3A 1M45A 1MXLC 2F2OA 2TN4A 1DGVA 2Q91A 4HSZA 3NSLA 4IL1A 1M46A 2SASA 3SJSA 5I2LA 4BY4A 1PULA 1NCXA 2L51A 1YVHA 1SY9A 1J7QA 2ZKMX 1CB1A 5HKWA 2ZNEA 1BLQA 2MA2A 1QJTA 2K0JA 2LVJA 2K7CA 1CLLA 1WLZA 4MEWA 1BG1A 3I5HC 1NWDA 5F6TA 2BECA 1YUUA 3PLFB 2KAVA 2L0PA 1S26D 1UURA 1LXFC 1LA3A 1SL8A 4GNKB 1JF2A 2JT0A 4YGEB 1FBVA 2HPSA 2OPOA 1F70A 4MZLA 1L7ZA 1KK7Y 1S36A 2JT3A 4DRWA 2KI4B 2Q4UA 4ORCB 2O5GA 5G08A 3RM1A
chains in the Genus database with same CATH superfamily
2Y4QA 2K60A 5I2QA 3JTDB 1CDNA 2BE6A 1L2OC 1DEKA 1C07A 3ICBA 2JULA 2K2AA 3NHIA 1CDMA 1DF0A 5IBWA 5GQQC 2L2EA 2CNPA 1ZUZA 1IQ5A 1BT6A 2JOJA 4N5XA 3S0EA 2M9GA 4F7FA 1PK0D 1UHIA 2E6WA 1SW8A 2L5XB 2JNXA 2LVIA 1AUIB 1KQVA 4PCWA 4MRXA 1JFJA 1PSBA 1CFFA 3AKBA 1XFRA 3S0BA 1DJWA 3DYEA 1NSHA 5HKYA 1S6IA 1IWQA 1K93D 1C3YA 3V2LA 1AJ4A 3AKAA 1GQMA 1B8CA 2AAOA 3L4AA 1QV0A 2V53A 1JF0A 1UWOA 3R1PA 5ER5A 3WNXB 1DJZA 3SIAA 1OZSA 1MF8B 1Z4HA 2M29A 3CZ0A 3JVTB 1OMVA 2M0RA 3R72A 1SL9A 1UHKA 5ER4X 1FF1A 2GGZA 1QWVA 3CABA 4ZCVA 4FTGA 1RJVA 3DY9A 4M2OA 5CSNA 2Y5IA 1MWNA 1SKTA 2KSPA 3LK0A 1SR6C 2JC2A 1QX7A 2M7LA 2GTEA 5CSIA 2WCLA 3PFVA 2PMYA 2KQYA 1TCOB 1OSAA 3PM2A 4YGAA 5DKRA 2GV5A 2KI6C 1K94A 1LKJA 3I5FC 5BPJA 3K21A 1CDPA 5AANA 4I5KA 1YRUB 3NHTA 3BUMB 3D74A 3PN7B 4A4BA 5KSZA 2F8PA 5B8IB 4OV2A 3VRPA 4D1EA 1W9ZA 3DXLA 3O6BA 1QS7A 4OKHA 4GAOA 1SCMB 1Y1UA 4ZCUA 3TDUA 1OOFA 5D3OA 1KFUL 1QASA 1HQVA 1RWYA 4GFTA 1KSOA 4PHKA 4ORBB 2ZFDA 3OB2B 4PALA 3SS3A 1BR4B 2LAPA 2KOTA 1YTZC 1C7VA 3D0YB 3DVJA 1DQEA 3GOFA 5I2OA 3WHUB 1ALVA 2LUCA 1IJ6A 1K9UA 1M63B 3CS1A 2F3ZA 4U8DA 2M1KB 3IF7A 1J7OA 1J1EA 1QX2A 2KI4C 1QLSA 1AVSA 1W7JB 3PN7C 5K89A 3O78A 2BBNA 1CLBA 2KFFA 4WQ2A 2KPHA 1KK8B 4MBEA 3TZ1A 1BJFA 1K90D 3BFBA 3H4SE 2FCEA 4E68A 1K96A 1KWOB 1XYDA 1H4BA 2QEVA 1TNPA 1AHRA 3DF0A 5HL1A 3S0GA 3E3RA 2KGBC 1RROA 2LLUA 3TS5B 2EGDA 4C0JA 2JZIA 1YX8A 1G8IA 4KYNA 1A2XA 3GK2A 1DELA 3BUNB 2CCMA 1OE9B 1V1GA 4N1GA 2OTGC 3BUOB 3TUYC 1CFCA 1DT7B 3HX4A 1A75A 3IQQA 3RZSA 1CDLA 2WCBA 1DJGA 2I2RE 3A8RA 3DF0B 2KLEA 3I5FB 4NDBA 5KTYA 3EVVA 1TRFA 3L4LA 2BCBA 1KWOC 2KAXA 1PALA 2H61A 4HREE 1LVCD 2P71A 3CZ1A 2QPTA 4Q04A 3BXKA 1QVIY 2NCOA 1QX5B 3D75A 2KFHA 5AXIA 2HETA 1XFWO 2EC6C 1OMRA 1R6PA 2JTZA 3C1VA 3OX6A 4HRHA 5JOLA 1EH2A 3AAKA 3FWBA 1N65A 1F4OA 3BYAA 2BBMA 3PJIA 4F0ZB 1UHNA 1QV1A 2LC5A 1F4QA 1AK8A 1Q80A 2F2PA 2FJYA 2WCEA 1X02A 4FQOA 4DCKA 1NP8A 2LMVA 2KNEA 1DJIA 2KYFA 3CTNA 1RK9A 2GGMA 5FI6A 4NQGA 2H61C 1S5GY 3B87A 1CMGA 4P2YB 5PALA 4GUKA 5FI7A 1W7IB 1H8BA 2CBLA 1K95A 1KQMB 4DIRA 1UHHA 2KI6D 4WRIA 2A4JA 2R2IA 3IQOA 3SG5A 4AQJA 2LMTA 2K7OA 1OOHA 3Q8IA 1YR5A 2LLSA 2RGIA 4FQTA 2PVBA 4INWA 5D69A 1NUBA 3OHMB 2MJWB 2KHNA 1UHJA 3JVTC 1B7TZ 3KEVA 3LCPC 2K7BA 1ORGA 3FE8A 4PE7A 5J3XA 2LLTA 1AJ5A 3R1OA 3JTDC 1CFPA 4MRYA 2KQ6A 2MAZA 4PE4A 1CFDA 1SR6B 3EVRA 3S0AA 2JRFA 1SBJA 2F33A 2I18A 3QRXA 4CLNA 2KGRA 2PRUA 1KQMC 1IGVA 1SSEB 5CSJA 3BFHA 1ZOTB 5TNCA 1F71A 1CM1A 3SG7A 3F45A 3OX5A 1JUOA 4JKTA 4P5OE 1TUJA 1UP5A 2JWWA 3DVKA 5FI2A 2O60A 2LVVA 3SG6A 1K2HA 1M39A 1MXEA 1CTRA 3HCMA 1QXPA 1IIOA 1G4YR 1SL7A 3I5GC 3BJHA 1RTP1 1SK6D 5D7FA 1V1FA 4MSPA 3I5IC 3SS5A 2LCPA 4N1FA 2KYCA 1PSRA 2L5YA 3OB1B 4I5JA 2H2KA 3SG4A 2M8UA 1WY9A 2M3WA 3BQ3A 5AFPA 1CNPA 1DGUA 1XFXO 1QLKA 3EK7A 2BKHB 3EVUA 4PDZA 1NX2A 2SCPA 5AEQA 4YGBB 1IH0A 1GJYA 4C0LA 1RFJA 1TNQA 3EKJA 1CMFA 2MBXA 5JJGA 2CTNA 1PVAA 1CLMA 4I5NB 3WXAA 1LINA 3LK1A 4JPZB 4L9MA 4AQIA 1TCFA 1B7TY 1K8UA 4M2PA 3SG3A 3KO0A 2QEOA 2JQ6A 1JC2A 1KFXS 2BAPA 1KFXL 4QJ3B 2P6BB 1BOCA 1OOGA 2LUXA 2HF5A 1S1EA 3VGOA 2LHLA 2EHBA 3D77A 2MHHA 2M49B 1WRKA 3DVMA 3MSEB 1FPWA 4QJ5B 3CDNA 1N2DA 1ZFSA 1XO5A 4JQ0D 1OMDA 2WOSA 4OCIA 4DUQA 2BL0B 3CWGA 1E8AA 3PALA 2YGUA 3ZNIA 2BNXA 1MQ1A 1XA5A 2ZRSA 1Y1XA 3EKHA 5HLVA 3LLEA 1A4PA 1SYMA 2NZ0A 3NSKA 1J55A 1DC1A 4GGFA 2NLNA 4GPLB 2KDHA 2CXJA 5I94A 2BCAA 2WC8A 5FYXA 1DTLA 2ZNDA 2QEHA 1DMOA 2AMIA 3D73A 3FE6A 3TDIA 3CR5X 1FI5A 2Y1MA 4CFQA 1JSAA 3I5IB 4I5LB 3BUXB 3D78A 1JBAA 4PE0A 2WCMA 3BUWB 1CKKA 1EXRA 1S5GZ 1XFZO 3ZWHA 1GGWA 5AERA 2LV7A 1B8RA 1B8LA 3CR2A 1BMOA 2L4HA 2L98A 2E30A 1F8HA 1TTXA 4MLWA 2LP3A 4OR9B 3M0WA 4CFRA 1IJ5A 2L4IA 2LMUA 4YI9A 2WCKA 5EL2A 4JD9A 1YURA 1ZMZA 1DJYA 4GGNA 5I8NA 1C7WA 2D8NA 1NIWA 2HQ8A 2LANA 4GGFC 1L2OB 1IRJA 2MLFC 2JT8A 4R1EA 1KK7Z 1KSMA 1NPQA 3VRNA 3FE9A 2JXLA 1F55A 2JTTA 2QDIA 4CIDA 1NYAA 1AP4A 3RLZA 1A29A 1TIZA 3CR4X 1EG4A 3CZ2A 1NCZA 4NDCA 2JPOA 2NXQA 3TDZA 1LA0A 3TUYB 3QMEA 5DICA 1BF5A 2ISDA 3CZTX 1SPYA 1WDCC 2ZN8A 3S0DA 1VRKA 3R1VA 1MR8A 3DVEA 4PHMA 2M1UA 3BFAA 1IKUA 1IQ3A 3BOWB 1NX0A 2VRGA 1SRAA 2BCXA 1J7RA 2JU0A 1Y1AA 2PASA 4ORAB 2BL0C 2OS8C 1Z2CB 2L2CA 2WC5A 2LE9B 2OTGB 1ODBA 4YI8A 1J7PA 1B47A 1F54A 1XFUO 3K1EA 3L47A 5HKZA 3FS7A 4GBAA 1C3ZA 4QJ4B 4PHJA 1S6CA 4MZKA 2EC6B 3WHTB 1OOJA 3OP0A 2LNKA 3OBVA 2JPTA 1RECA 4IJ7A 1MHOA 3O4XA 1QIVA 1XFVO 1OZOA 3S0FA 4ICBA 2WC6A 3CGAA 1BR1B 1QVIZ 1K9KA 2K61A 1EL4A 3PSRA 2LHIA 3A4UB 1U5IB 2LP2A 1YRTB 1JWDA 2COLB 2G2BA 3B86A 1FW4A 1ZACA 4A4CA 1NCYA 1SCVA 2ERBA 3O2PA 5HYDA 1GM0A 4MN0A 2K8MB 1U5IA 4DS7A 4UPGA 1K9PA 2MRDA 1B1GA 2PYQA 4XJKB 4M2QA 1NX1A 3CYZA 3VROA 1OW4A 4YRUA 5CPVA 2KAYA 2M7NA 1HT9A 3D10A 3GK1A 4AOMA 3FWCA 4MZJA 1IG5A 2IS9A 2BKIB 2I7AA 2DOQA 3KPXA 4YBHB 1A75B 3PATA 1UUSA 1Y0VH 4ETOA 1QIWA 3I5GB 3EK8A 2KBMA 3N7HA 2I94A 2KLDA 2NCPA 1DVIA 2MLEC 1XFYO 1YUTA 3I5HB 1SCMC 3KHEA 2H8VA 2M97A 4MVFA 3BOWA 2JXCA 1S3PA 2KBIA 1TN4A 3DZTA 1XK4A 2LVKA 4YGDB 1D1OA 2CT9A 1XK4C 1WDCB 1GGZA 3O4YA 1S6JA 1Y6WA 1TOPA 2LM5A 1TNXA 2QACA 1DJXA 3VB1A 3NXAA 1T14A 2OS8B 1WRZA 1R2UA 5DKNA 2L50A 1KCYA 1DJHA 5DKQA 1ALWA 2WCHA 3UO9A 1EJ3A 1JFKA 2AUCA 3SG2A 1N0YA 2G9BA 2Y1NA 2PQLA 2BE4A 1KK8C 1G33A 1YX7A 3D0YA 4TNCA 1M31A 2ZRTA 4PHNA 2PSRA 1KFUS 3IVTA 2FOTA 1QTXA 1BODA 3FIAA 1PRWA 2WNDA 3GK4X 3OGNA 4JWQA 4NDDA 4XYNA 5KU1A 3VRQA 1NX3A 4OVNF 2QEBA 1P28A 1WRLA 4PE1A 4YGCB 1YUSA 4CPVA 1A03A 1TNWA 3EK4A 4USLA 1MUXA 1FI6A 2PALA 2ZN9A 4BY5A 4C0KA 2WORA 1EG3A 2FJUB 2HQWA 3EG5B 4XJKA 1SNLA 2B1UA 3AAJA 3LL8B 4INXA 3KF9A 1SMGA 1B4CA 2KFGA 4HRGA 1BU3A 3TS5C 3SIBA 2FCDA 1DF0B 2K7DA 2F3YA 3VRRA 2WCFA 3B88A 1YVLA 1QATA 3CLNA 3DD4A 3NSIA 3NSOA 1OOIX 5HLOA 2K2FA 3PM8A 5CSFA 1OQPA 1B9AA 1WLMA 1J1DA 1CM4A 1PVBA 2JNFA 1XVJA 4WQ3A 1M45A 1MXLC 2F2OA 2TN4A 1DGVA 2Q91A 4HSZA 3NSLA 4IL1A 1M46A 3D76A 2SASA 3SJSA 5I2LA 4BY4A 1PULA 1NCXA 1TWOA 2P70A 3B7AA 2L51A 1YVHA 1SY9A 1J7QA 2ZKMX 1CB1A 1TUZA 2ZNEA 5HKWA 1BLQA 2MA2A 1QJTA 2K0JA 2LVJA 3SS4A 2K7CA 1CLLA 1WLZA 4MEWA 1BG1A 4OZDA 1LS8A 3I5HC 1NWDA 5F6TA 2BECA 1YUUA 3PLFB 2KAVA 2L0PA 1S26D 1UURA 1LXFC 1LA3A 1SL8A 4GNKB 4PT1A 1JF2A 2JT0A 4YGEB 1FBVA 3UNWA 2HPSA 3NGVA 2OPOA 1F70A 2WCJA 4MZLA 1L7ZA 1KK7Y 1S36A 2JT3A 4DRWA 3B6XA 2KI4B 2Q4UA 4ORCB 2O5GA 5G08A 3RM1A
chains in the Genus database with same CATH topology
2Y4QA 5I2QA 3JTDB 1CDNA 2BE6A 1L2OC 1C07A 3ICBA 2JULA 2K2AA 1CDMA 1DF0A 5IBWA 5GQQC 2L2EA 2CNPA 1ZUZA 1IQ5A 1BT6A 2JOJA 4N5XA 2M9GA 1PK0D 1UHIA 2E6WA 1SW8A 2L5XB 2JNXA 2LVIA 1AUIB 1KQVA 4PCWA 4MRXA 1JFJA 1PSBA 1CFFA 3AKBA 1DJWA 1NSHA 5HKYA 1S6IA 1IWQA 1K93D 1AJ4A 3AKAA 1GQMA 1B8CA 2AAOA 1QV0A 2V53A 1JF0A 1UWOA 3WNXB 5ER5A 1DJZA 3SIAA 1OZSA 1MF8B 2M29A 5ER4X 3JVTB 1OMVA 2M0RA 1FF1A 1SL9A 1UHKA 2GGZA 4ZCVA 4FTGA 1RJVA 4M2OA 5CSNA 2Y5IA 1MWNA 1SKTA 2KSPA 3LK0A 1SR6C 2JC2A 1QX7A 2M7LA 5CSIA 3PFVA 2PMYA 2KQYA 1TCOB 1OSAA 4YGAA 5DKRA 2GV5A 2KI6C 1K94A 1LKJA 3I5FC 5BPJA 3K21A 1CDPA 5AANA 4I5KA 1YRUB 3PN7B 3BUMB 4A4BA 5KSZA 2F8PA 5B8IB 4OV2A 3VRPA 4D1EA 3O6BA 1QS7A 4OKHA 4GAOA 1SCMB 1Y1UA 4ZCUA 3TDUA 1KFUL 1QASA 1HQVA 1RWYA 4GFTA 1KSOA 4PHKA 4ORBB 2ZFDA 3OB2B 4PALA 1BR4B 2LAPA 2KOTA 1YTZC 1C7VA 3D0YB 3DVJA 3GOFA 5I2OA 3WHUB 1ALVA 2LUCA 1IJ6A 1K9UA 1M63B 3CS1A 2F3ZA 4U8DA 2M1KB 3IF7A 1J7OA 1J1EA 1QX2A 2KI4C 1QLSA 1AVSA 1W7JB 3PN7C 5K89A 3O78A 2BBNA 1CLBA 2KFFA 4WQ2A 1KK8B 4MBEA 3TZ1A 1BJFA 1K90D 3H4SE 4E68A 2FCEA 1K96A 1KWOB 1XYDA 1H4BA 1TNPA 1AHRA 3DF0A 3E3RA 2KGBC 1RROA 2LLUA 3TS5B 2EGDA 4C0JA 2JZIA 1YX8A 1G8IA 1A2XA 3GK2A 3BUNB 2CCMA 1OE9B 1V1GA 4N1GA 2OTGC 3BUOB 3TUYC 1CFCA 1DT7B 3HX4A 1A75A 3IQQA 1CDLA 2WCBA 1DJGA 2I2RE 3A8RA 3DF0B 3I5FB 4NDBA 5KTYA 3EVVA 1TRFA 2BCBA 1KWOC 2KAXA 1PALA 2H61A 4HREE 1LVCD 2QPTA 4Q04A 3BXKA 1QVIY 2NCOA 1QX5B 2KFHA 5AXIA 2HETA 1XFWO 2EC6C 1OMRA 1R6PA 2JTZA 3C1VA 3OX6A 4HRHA 5JOLA 1EH2A 3AAKA 3FWBA 1N65A 1F4OA 3BYAA 2BBMA 4F0ZB 1UHNA 1QV1A 2LC5A 1F4QA 1AK8A 1Q80A 2F2PA 2WCEA 1X02A 4FQOA 4DCKA 1NP8A 2LMVA 2KNEA 1DJIA 2KYFA 3CTNA 1RK9A 2GGMA 4NQGA 2H61C 1S5GY 1CMGA 4P2YB 5PALA 4GUKA 1H8BA 1W7IB 2CBLA 1K95A 1KQMB 4DIRA 1UHHA 2KI6D 4WRIA 2A4JA 2R2IA 3IQOA 3SG5A 4AQJA 2LMTA 2K7OA 1YR5A 2LLSA 2RGIA 2PVBA 5D69A 1NUBA 3OHMB 2MJWB 2KHNA 1UHJA 3JVTC 1B7TZ 3KEVA 3LCPC 2K7BA 5J3XA 4PE7A 2LLTA 1AJ5A 3JTDC 1CFPA 4MRYA 2KQ6A 2MAZA 4PE4A 1CFDA 1SR6B 3EVRA 2JRFA 1SBJA 2F33A 2I18A 3QRXA 4CLNA 2KGRA 2PRUA 1KQMC 1IGVA 5CSJA 1ZOTB 5TNCA 1F71A 1CM1A 3SG7A 3F45A 3OX5A 1JUOA 4P5OE 1UP5A 2JWWA 3DVKA 1K2HA 2O60A 2LVVA 3SG6A 1M39A 1MXEA 1CTRA 3HCMA 1QXPA 1G4YR 1SL7A 3I5GC 1RTP1 1SK6D 5D7FA 1V1FA 4MSPA 3I5IC 2LCPA 4N1FA 2KYCA 1PSRA 3OB1B 4I5JA 2H2KA 3SG4A 2M8UA 1WY9A 2M3WA 3BQ3A 5AFPA 1CNPA 1DGUA 1XFXO 1QLKA 3EK7A 2BKHB 3EVUA 4PDZA 1NX2A 2SCPA 5AEQA 4YGBB 1IH0A 1GJYA 4C0LA 1RFJA 1TNQA 3EKJA 1CMFA 2MBXA 5JJGA 2CTNA 1PVAA 1CLMA 4I5NB 3WXAA 1LINA 3LK1A 4JPZB 4L9MA 4AQIA 1TCFA 1B7TY 1K8UA 4M2PA 3SG3A 3KO0A 2JQ6A 1JC2A 1KFXS 1KFXL 4QJ3B 2P6BB 1BOCA 2LUXA 2HF5A 1S1EA 3VGOA 2LHLA 2EHBA 2MHHA 2M49B 1WRKA 3DVMA 3MSEB 1FPWA 4QJ5B 1N2DA 1ZFSA 1XO5A 4JQ0D 1OMDA 2WOSA 4OCIA 4DUQA 2BL0B 3CWGA 1E8AA 3PALA 3ZNIA 1MQ1A 1XA5A 2ZRSA 1Y1XA 3EKHA 5HLVA 3LLEA 1A4PA 1SYMA 2NZ0A 3NSKA 1J55A 4GGFA 2NLNA 4GPLB 2KDHA 2CXJA 2BCAA 2WC8A 5FYXA 1DTLA 2ZNDA 1DMOA 2AMIA 3TDIA 3CR5X 1FI5A 2Y1MA 4CFQA 1JSAA 3I5IB 4I5LB 3BUXB 1JBAA 4PE0A 3BUWB 1CKKA 1EXRA 1S5GZ 1XFZO 3ZWHA 1GGWA 5AERA 2LV7A 1B8RA 1B8LA 3CR2A 1BMOA 2L4HA 2L98A 2E30A 1F8HA 1TTXA 4MLWA 2LP3A 4OR9B 3M0WA 4CFRA 1IJ5A 2L4IA 2LMUA 4YI9A 5I8NA 1YURA 1ZMZA 1DJYA 4GGNA 1C7WA 2D8NA 1NIWA 2HQ8A 2LANA 4GGFC 1L2OB 1IRJA 2MLFC 2JT8A 4R1EA 1KK7Z 1KSMA 1NPQA 3VRNA 2JXLA 1F55A 2JTTA 4CIDA 1NYAA 1AP4A 3RLZA 1A29A 1TIZA 3CR4X 1EG4A 1NCZA 4NDCA 2NXQA 3TDZA 1LA0A 3TUYB 1BF5A 2ISDA 3CZTX 1SPYA 1WDCC 2ZN8A 1VRKA 1MR8A 3DVEA 4PHMA 2M1UA 1IKUA 1IQ3A 3BOWB 1NX0A 2VRGA 1SRAA 2BCXA 1J7RA 2JU0A 1Y1AA 2PASA 4ORAB 2BL0C 2OS8C 2LE9B 2OTGB 1ODBA 4YI8A 1J7PA 1B47A 1F54A 1XFUO 5HKZA 3FS7A 4GBAA 4QJ4B 4PHJA 1S6CA 4MZKA 2EC6B 3WHTB 1OOJA 3OP0A 2LNKA 2JPTA 1RECA 1MHOA 1QIVA 1XFVO 1OZOA 4ICBA 3CGAA 1BR1B 1QVIZ 1K9KA 2K61A 1EL4A 3PSRA 2LHIA 3A4UB 1U5IB 2LP2A 1YRTB 1JWDA 2COLB 2G2BA 1FW4A 1ZACA 4A4CA 1NCYA 1SCVA 3O2PA 5HYDA 4MN0A 2K8MB 1U5IA 4DS7A 4UPGA 1K9PA 2MRDA 1B1GA 4XJKB 4M2QA 1NX1A 3VROA 4YRUA 5CPVA 2KAYA 2M7NA 1HT9A 3D10A 3GK1A 4AOMA 3FWCA 4MZJA 1IG5A 2IS9A 2BKIB 2I7AA 2DOQA 3KPXA 4YBHB 1A75B 3PATA 1UUSA 1Y0VH 4ETOA 1QIWA 3I5GB 3EK8A 2KBMA 2I94A 2NCPA 1DVIA 2MLEC 1XFYO 1YUTA 3I5HB 1SCMC 3KHEA 2M97A 4MVFA 3BOWA 2JXCA 1S3PA 2KBIA 1TN4A 4YGDB 1XK4A 2LVKA 1D1OA 2CT9A 1WDCB 1XK4C 1GGZA 3O4YA 1S6JA 1Y6WA 1TOPA 2LM5A 1TNXA 2QACA 1DJXA 3NXAA 2OS8B 1WRZA 1R2UA 5DKNA 2L50A 1KCYA 1DJHA 5DKQA 1ALWA 1EJ3A 1JFKA 2AUCA 3SG2A 1N0YA 2G9BA 2Y1NA 2BE4A 1KK8C 1G33A 1YX7A 3D0YA 4TNCA 1M31A 2ZRTA 4PHNA 2PSRA 1KFUS 2FOTA 1QTXA 1BODA 3FIAA 1PRWA 2WNDA 3GK4X 4JWQA 4NDDA 4XYNA 5KU1A 3VRQA 1NX3A 4OVNF 1WRLA 4PE1A 4YGCB 1YUSA 4CPVA 1A03A 1TNWA 3EK4A 4USLA 1MUXA 1FI6A 2PALA 2ZN9A 4BY5A 4C0KA 2WORA 1EG3A 2FJUB 2HQWA 4XJKA 1SNLA 2B1UA 3AAJA 3LL8B 3KF9A 1SMGA 1B4CA 2KFGA 4HRGA 1BU3A 3TS5C 3SIBA 2FCDA 1DF0B 2K7DA 2F3YA 3VRRA 2WCFA 3CLNA 1YVLA 1QATA 3DD4A 3NSOA 3NSIA 5HLOA 2K2FA 3PM8A 5CSFA 1OQPA 1B9AA 1J1DA 1PVBA 1CM4A 1WLMA 2JNFA 1XVJA 4WQ3A 1M45A 1MXLC 2F2OA 2TN4A 1DGVA 2Q91A 4HSZA 3NSLA 4IL1A 1M46A 2SASA 3SJSA 5I2LA 4BY4A 1PULA 1NCXA 2L51A 1YVHA 1SY9A 1J7QA 2ZKMX 1CB1A 5HKWA 2ZNEA 1BLQA 2MA2A 1QJTA 2K0JA 2LVJA 2K7CA 1CLLA 1WLZA 4MEWA 1BG1A 3I5HC 1NWDA 5F6TA 2BECA 1YUUA 3PLFB 2KAVA 2L0PA 1S26D 1UURA 1LXFC 1LA3A 1SL8A 4GNKB 1JF2A 2JT0A 4YGEB 1FBVA 2HPSA 2OPOA 1F70A 4MZLA 1L7ZA 1KK7Y 1S36A 2JT3A 4DRWA 2KI4B 2Q4UA 4ORCB 2O5GA 5G08A 3RM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y4Q A;  5I2Q A;  3JTD B;  1CDN A;  2BE6 A;  1L2O C;  1C07 A;  3ICB A;  2JUL A;  2K2A A;  1CDM A;  1DF0 A;  5IBW A;  5GQQ C;  2L2E A;  2CNP A;  1ZUZ A;  1IQ5 A;  1BT6 A;  2JOJ A;  4N5X A;  2M9G A;  1PK0 D;  1UHI A;  2E6W A;  1SW8 A;  2L5X B;  2JNX A;  2LVI A;  1AUI B;  1KQV A;  4PCW A;  4MRX A;  1JFJ A;  1PSB A;  1CFF A;  3AKB A;  1DJW A;  1NSH A;  5HKY A;  1S6I A;  1IWQ A;  1K93 D;  1AJ4 A;  3AKA A;  1GQM A;  1B8C A;  2AAO A;  1QV0 A;  2V53 A;  1JF0 A;  1UWO A;  3WNX B;  5ER5 A;  1DJZ A;  3SIA A;  1OZS A;  1MF8 B;  2M29 A;  5ER4 X;  3JVT B;  1OMV A;  2M0R A;  1FF1 A;  1SL9 A;  1UHK A;  2GGZ A;  4ZCV A;  4FTG A;  1RJV A;  4M2O A;  5CSN A;  2Y5I A;  1MWN A;  1SKT A;  2KSP A;  3LK0 A;  1SR6 C;  2JC2 A;  1QX7 A;  2M7L A;  5CSI A;  3PFV A;  2PMY A;  2KQY A;  1TCO B;  1OSA A;  4YGA A;  5DKR A;  2GV5 A;  2KI6 C;  1K94 A;  1LKJ A;  3I5F C;  5BPJ A;  3K21 A;  1CDP A;  5AAN A;  4I5K A;  1YRU B;  3PN7 B;  3BUM B;  4A4B A;  5KSZ A;  2F8P A;  5B8I B;  4OV2 A;  3VRP A;  4D1E A;  3O6B A;  1QS7 A;  4OKH A;  4GAO A;  1SCM B;  1Y1U A;  4ZCU A;  3TDU A;  1KFU L;  1QAS A;  1HQV A;  1RWY A;  4GFT A;  1KSO A;  4PHK A;  4ORB B;  2ZFD A;  3OB2 B;  4PAL A;  1BR4 B;  2LAP A;  2KOT A;  1YTZ C;  1C7V A;  3D0Y B;  3DVJ A;  3GOF A;  5I2O A;  3WHU B;  1ALV A;  2LUC A;  1IJ6 A;  1K9U A;  1M63 B;  3CS1 A;  2F3Z A;  4U8D A;  2M1K B;  3IF7 A;  1J7O A;  1J1E A;  1QX2 A;  2KI4 C;  1QLS A;  1AVS A;  1W7J B;  3PN7 C;  5K89 A;  3O78 A;  2BBN A;  1CLB A;  2KFF A;  4WQ2 A;  1KK8 B;  4MBE A;  3TZ1 A;  1BJF A;  1K90 D;  3H4S E;  4E68 A;  2FCE A;  1K96 A;  1KWO B;  1XYD A;  1H4B A;  1TNP A;  1AHR A;  3DF0 A;  3E3R A;  2KGB C;  1RRO A;  2LLU A;  3TS5 B;  2EGD A;  4C0J A;  2JZI A;  1YX8 A;  1G8I A;  1A2X A;  3GK2 A;  3BUN B;  2CCM A;  1OE9 B;  1V1G A;  4N1G A;  2OTG C;  3BUO B;  3TUY C;  1CFC A;  1DT7 B;  3HX4 A;  1A75 A;  3IQQ A;  1CDL A;  2WCB A;  1DJG A;  2I2R E;  3A8R A;  3DF0 B;  3I5F B;  4NDB A;  5KTY A;  3EVV A;  1TRF A;  2BCB A;  1KWO C;  2KAX A;  1PAL A;  2H61 A;  4HRE E;  1LVC D;  2QPT A;  4Q04 A;  3BXK A;  1QVI Y;  2NCO A;  1QX5 B;  2KFH A;  5AXI A;  2HET A;  1XFW O;  2EC6 C;  1OMR A;  1R6P A;  2JTZ A;  3C1V A;  3OX6 A;  4HRH A;  5JOL A;  1EH2 A;  3AAK A;  3FWB A;  1N65 A;  1F4O A;  3BYA A;  2BBM A;  4F0Z B;  1UHN A;  1QV1 A;  2LC5 A;  1F4Q A;  1AK8 A;  1Q80 A;  2F2P A;  2WCE A;  1X02 A;  4FQO A;  4DCK A;  1NP8 A;  2LMV A;  2KNE A;  1DJI A;  2KYF A;  3CTN A;  1RK9 A;  2GGM A;  4NQG A;  2H61 C;  1S5G Y;  1CMG A;  4P2Y B;  5PAL A;  4GUK A;  1H8B A;  1W7I B;  2CBL A;  1K95 A;  1KQM B;  4DIR A;  1UHH A;  2KI6 D;  4WRI A;  2A4J A;  2R2I A;  3IQO A;  3SG5 A;  4AQJ A;  2LMT A;  2K7O A;  1YR5 A;  2LLS A;  2RGI A;  2PVB A;  5D69 A;  1NUB A;  3OHM B;  2MJW B;  2KHN A;  1UHJ A;  3JVT C;  1B7T Z;  3KEV A;  3LCP C;  2K7B A;  5J3X A;  4PE7 A;  2LLT A;  1AJ5 A;  3JTD C;  1CFP A;  4MRY A;  2KQ6 A;  2MAZ A;  4PE4 A;  1CFD A;  1SR6 B;  3EVR A;  2JRF A;  1SBJ A;  2F33 A;  2I18 A;  3QRX A;  4CLN A;  2KGR A;  2PRU A;  1KQM C;  1IGV A;  5CSJ A;  1ZOT B;  5TNC A;  1F71 A;  1CM1 A;  3SG7 A;  3F45 A;  3OX5 A;  1JUO A;  4P5O E;  1UP5 A;  2JWW A;  3DVK A;  1K2H A;  2O60 A;  2LVV A;  3SG6 A;  1M39 A;  1MXE A;  1CTR A;  3HCM A;  1QXP A;  1G4Y R;  1SL7 A;  3I5G C;  1RTP 1;  1SK6 D;  5D7F A;  1V1F A;  4MSP A;  3I5I C;  2LCP A;  4N1F A;  2KYC A;  1PSR A;  3OB1 B;  4I5J A;  2H2K A;  3SG4 A;  2M8U A;  1WY9 A;  2M3W A;  3BQ3 A;  5AFP A;  1CNP A;  1DGU A;  1XFX O;  1QLK A;  3EK7 A;  2BKH B;  3EVU A;  4PDZ A;  1NX2 A;  2SCP A;  5AEQ A;  4YGB B;  1IH0 A;  1GJY A;  4C0L A;  1RFJ A;  1TNQ A;  3EKJ A;  1CMF A;  2MBX A;  5JJG A;  2CTN A;  1PVA A;  1CLM A;  4I5N B;  3WXA A;  1LIN A;  3LK1 A;  4JPZ B;  4L9M A;  4AQI A;  1TCF A;  1B7T Y;  1K8U A;  4M2P A;  3SG3 A;  3KO0 A;  2JQ6 A;  1JC2 A;  1KFX S;  1KFX L;  4QJ3 B;  2P6B B;  1BOC A;  2LUX A;  2HF5 A;  1S1E A;  3VGO A;  2LHL A;  2EHB A;  2MHH A;  2M49 B;  1WRK A;  3DVM A;  3MSE B;  1FPW A;  4QJ5 B;  1N2D A;  1ZFS A;  1XO5 A;  4JQ0 D;  1OMD A;  2WOS A;  4OCI A;  4DUQ A;  2BL0 B;  3CWG A;  1E8A A;  3PAL A;  3ZNI A;  1MQ1 A;  1XA5 A;  2ZRS A;  1Y1X A;  3EKH A;  5HLV A;  3LLE A;  1A4P A;  1SYM A;  2NZ0 A;  3NSK A;  1J55 A;  4GGF A;  2NLN A;  4GPL B;  2KDH A;  2CXJ A;  2BCA A;  2WC8 A;  5FYX A;  1DTL A;  2ZND A;  1DMO A;  2AMI A;  3TDI A;  3CR5 X;  1FI5 A;  2Y1M A;  4CFQ A;  1JSA A;  3I5I B;  4I5L B;  3BUX B;  1JBA A;  4PE0 A;  3BUW B;  1CKK A;  1EXR A;  1S5G Z;  1XFZ O;  3ZWH A;  1GGW A;  5AER A;  2LV7 A;  1B8R A;  1B8L A;  3CR2 A;  1BMO A;  2L4H A;  2L98 A;  2E30 A;  1F8H A;  1TTX A;  4MLW A;  2LP3 A;  4OR9 B;  3M0W A;  4CFR A;  1IJ5 A;  2L4I A;  2LMU A;  4YI9 A;  5I8N A;  1YUR A;  1ZMZ A;  1DJY A;  4GGN A;  1C7W A;  2D8N A;  1NIW A;  2HQ8 A;  2LAN A;  4GGF C;  1L2O B;  1IRJ A;  2MLF C;  2JT8 A;  4R1E A;  1KK7 Z;  1KSM A;  1NPQ A;  3VRN A;  2JXL A;  1F55 A;  2JTT A;  4CID A;  1NYA A;  1AP4 A;  3RLZ A;  1A29 A;  1TIZ A;  3CR4 X;  1EG4 A;  1NCZ A;  4NDC A;  2NXQ A;  3TDZ A;  1LA0 A;  3TUY B;  1BF5 A;  2ISD A;  3CZT X;  1SPY A;  1WDC C;  2ZN8 A;  1VRK A;  1MR8 A;  3DVE A;  4PHM A;  2M1U A;  1IKU A;  1IQ3 A;  3BOW B;  1NX0 A;  2VRG A;  1SRA A;  2BCX A;  1J7R A;  2JU0 A;  1Y1A A;  2PAS A;  4ORA B;  2BL0 C;  2OS8 C;  2LE9 B;  2OTG B;  1ODB A;  4YI8 A;  1J7P A;  1B47 A;  1F54 A;  1XFU O;  5HKZ A;  3FS7 A;  4GBA A;  4QJ4 B;  4PHJ A;  1S6C A;  4MZK A;  2EC6 B;  3WHT B;  1OOJ A;  3OP0 A;  2LNK A;  2JPT A;  1REC A;  1MHO A;  1QIV A;  1XFV O;  1OZO A;  4ICB A;  3CGA A;  1BR1 B;  1QVI Z;  1K9K A;  2K61 A;  1EL4 A;  3PSR A;  2LHI A;  3A4U B;  1U5I B;  2LP2 A;  1YRT B;  1JWD A;  2COL B;  2G2B A;  1FW4 A;  1ZAC A;  4A4C A;  1NCY A;  1SCV A;  3O2P A;  5HYD A;  4MN0 A;  2K8M B;  1U5I A;  4DS7 A;  4UPG A;  1K9P A;  2MRD A;  1B1G A;  4XJK B;  4M2Q A;  1NX1 A;  3VRO A;  4YRU A;  5CPV A;  2KAY A;  2M7N A;  1HT9 A;  3D10 A;  3GK1 A;  4AOM A;  3FWC A;  4MZJ A;  1IG5 A;  2IS9 A;  2BKI B;  2I7A A;  2DOQ A;  3KPX A;  4YBH B;  1A75 B;  3PAT A;  1UUS A;  1Y0V H;  4ETO A;  1QIW A;  3I5G B;  3EK8 A;  2KBM A;  2I94 A;  2NCP A;  1DVI A;  2MLE C;  1XFY O;  1YUT A;  3I5H B;  1SCM C;  3KHE A;  2M97 A;  4MVF A;  3BOW A;  2JXC A;  1S3P A;  2KBI A;  1TN4 A;  4YGD B;  1XK4 A;  2LVK A;  1D1O A;  2CT9 A;  1WDC B;  1XK4 C;  1GGZ A;  3O4Y A;  1S6J A;  1Y6W A;  1TOP A;  2LM5 A;  1TNX A;  2QAC A;  1DJX A;  3NXA A;  2OS8 B;  1WRZ A;  1R2U A;  5DKN A;  2L50 A;  1KCY A;  1DJH A;  5DKQ A;  1ALW A;  1EJ3 A;  1JFK A;  2AUC A;  3SG2 A;  1N0Y A;  2G9B A;  2Y1N A;  2BE4 A;  1KK8 C;  1G33 A;  1YX7 A;  3D0Y A;  4TNC A;  1M31 A;  2ZRT A;  4PHN A;  2PSR A;  1KFU S;  2FOT A;  1QTX A;  1BOD A;  3FIA A;  1PRW A;  2WND A;  3GK4 X;  4JWQ A;  4NDD A;  4XYN A;  5KU1 A;  3VRQ A;  1NX3 A;  4OVN F;  1WRL A;  4PE1 A;  4YGC B;  1YUS A;  4CPV A;  1A03 A;  1TNW A;  3EK4 A;  4USL A;  1MUX A;  1FI6 A;  2PAL A;  2ZN9 A;  4BY5 A;  4C0K A;  2WOR A;  1EG3 A;  2FJU B;  2HQW A;  4XJK A;  1SNL A;  2B1U A;  3AAJ A;  3LL8 B;  3KF9 A;  1SMG A;  1B4C A;  2KFG A;  4HRG A;  1BU3 A;  3TS5 C;  3SIB A;  2FCD A;  1DF0 B;  2K7D A;  2F3Y A;  3VRR A;  2WCF A;  3CLN A;  1YVL A;  1QAT A;  3DD4 A;  3NSO A;  3NSI A;  5HLO A;  2K2F A;  3PM8 A;  5CSF A;  1OQP A;  1B9A A;  1J1D A;  1PVB A;  1CM4 A;  1WLM A;  2JNF A;  1XVJ A;  4WQ3 A;  1M45 A;  1MXL C;  2F2O A;  2TN4 A;  1DGV A;  2Q91 A;  4HSZ A;  3NSL A;  4IL1 A;  1M46 A;  2SAS A;  3SJS A;  5I2L A;  4BY4 A;  1PUL A;  1NCX A;  2L51 A;  1YVH A;  1SY9 A;  1J7Q A;  2ZKM X;  1CB1 A;  5HKW A;  2ZNE A;  1BLQ A;  2MA2 A;  1QJT A;  2K0J A;  2LVJ A;  2K7C A;  1CLL A;  1WLZ A;  4MEW A;  1BG1 A;  3I5H C;  1NWD A;  5F6T A;  2BEC A;  1YUU A;  3PLF B;  2KAV A;  2L0P A;  1S26 D;  1UUR A;  1LXF C;  1LA3 A;  1SL8 A;  4GNK B;  1JF2 A;  2JT0 A;  4YGE B;  1FBV A;  2HPS A;  2OPO A;  1F70 A;  4MZL A;  1L7Z A;  1KK7 Y;  1S36 A;  2JT3 A;  4DRW A;  2KI4 B;  2Q4U A;  4ORC B;  2O5G A;  5G08 A;  3RM1 A; 
#chains in the Genus database with same CATH topology
 2Y4Q A;  2K60 A;  5I2Q A;  3JTD B;  1CDN A;  2BE6 A;  1L2O C;  1DEK A;  1C07 A;  3ICB A;  2JUL A;  2K2A A;  3NHI A;  1CDM A;  1DF0 A;  5IBW A;  5GQQ C;  2L2E A;  2CNP A;  1ZUZ A;  1IQ5 A;  1BT6 A;  2JOJ A;  4N5X A;  3S0E A;  2M9G A;  4F7F A;  1PK0 D;  1UHI A;  2E6W A;  1SW8 A;  2L5X B;  2JNX A;  2LVI A;  1AUI B;  1KQV A;  4PCW A;  4MRX A;  1JFJ A;  1PSB A;  1CFF A;  3AKB A;  1XFR A;  3S0B A;  1DJW A;  3DYE A;  1NSH A;  5HKY A;  1S6I A;  1IWQ A;  1K93 D;  1C3Y A;  3V2L A;  1AJ4 A;  3AKA A;  1GQM A;  1B8C A;  2AAO A;  3L4A A;  1QV0 A;  2V53 A;  1JF0 A;  1UWO A;  3R1P A;  5ER5 A;  3WNX B;  1DJZ A;  3SIA A;  1OZS A;  1MF8 B;  1Z4H A;  2M29 A;  3CZ0 A;  3JVT B;  1OMV A;  2M0R A;  3R72 A;  1SL9 A;  1UHK A;  5ER4 X;  1FF1 A;  2GGZ A;  1QWV A;  3CAB A;  4ZCV A;  4FTG A;  1RJV A;  3DY9 A;  4M2O A;  5CSN A;  2Y5I A;  1MWN A;  1SKT A;  2KSP A;  3LK0 A;  1SR6 C;  2JC2 A;  1QX7 A;  2M7L A;  2GTE A;  5CSI A;  2WCL A;  3PFV A;  2PMY A;  2KQY A;  1TCO B;  1OSA A;  3PM2 A;  4YGA A;  5DKR A;  2GV5 A;  2KI6 C;  1K94 A;  1LKJ A;  3I5F C;  5BPJ A;  3K21 A;  1CDP A;  5AAN A;  4I5K A;  1YRU B;  3NHT A;  3BUM B;  3D74 A;  3PN7 B;  4A4B A;  5KSZ A;  2F8P A;  5B8I B;  4OV2 A;  3VRP A;  4D1E A;  1W9Z A;  3DXL A;  3O6B A;  1QS7 A;  4OKH A;  4GAO A;  1SCM B;  1Y1U A;  4ZCU A;  3TDU A;  1OOF A;  5D3O A;  1KFU L;  1QAS A;  1HQV A;  1RWY A;  4GFT A;  1KSO A;  4PHK A;  4ORB B;  2ZFD A;  3OB2 B;  4PAL A;  3SS3 A;  1BR4 B;  2LAP A;  2KOT A;  1YTZ C;  1C7V A;  3D0Y B;  3DVJ A;  1DQE A;  3GOF A;  5I2O A;  3WHU B;  1ALV A;  2LUC A;  1IJ6 A;  1K9U A;  1M63 B;  3CS1 A;  2F3Z A;  4U8D A;  2M1K B;  3IF7 A;  1J7O A;  1J1E A;  1QX2 A;  2KI4 C;  1QLS A;  1AVS A;  1W7J B;  3PN7 C;  5K89 A;  3O78 A;  2BBN A;  1CLB A;  2KFF A;  4WQ2 A;  2KPH A;  1KK8 B;  4MBE A;  3TZ1 A;  1BJF A;  1K90 D;  3BFB A;  3H4S E;  2FCE A;  4E68 A;  1K96 A;  1KWO B;  1XYD A;  1H4B A;  2QEV A;  1TNP A;  1AHR A;  3DF0 A;  5HL1 A;  3S0G A;  3E3R A;  2KGB C;  1RRO A;  2LLU A;  3TS5 B;  2EGD A;  4C0J A;  2JZI A;  1YX8 A;  1G8I A;  4KYN A;  1A2X A;  3GK2 A;  1DEL A;  3BUN B;  2CCM A;  1OE9 B;  1V1G A;  4N1G A;  2OTG C;  3BUO B;  3TUY C;  1CFC A;  1DT7 B;  3HX4 A;  1A75 A;  3IQQ A;  3RZS A;  1CDL A;  2WCB A;  1DJG A;  2I2R E;  3A8R A;  3DF0 B;  2KLE A;  3I5F B;  4NDB A;  5KTY A;  3EVV A;  1TRF A;  3L4L A;  2BCB A;  1KWO C;  2KAX A;  1PAL A;  2H61 A;  4HRE E;  1LVC D;  2P71 A;  3CZ1 A;  2QPT A;  4Q04 A;  3BXK A;  1QVI Y;  2NCO A;  1QX5 B;  3D75 A;  2KFH A;  5AXI A;  2HET A;  1XFW O;  2EC6 C;  1OMR A;  1R6P A;  2JTZ A;  3C1V A;  3OX6 A;  4HRH A;  5JOL A;  1EH2 A;  3AAK A;  3FWB A;  1N65 A;  1F4O A;  3BYA A;  2BBM A;  3PJI A;  4F0Z B;  1UHN A;  1QV1 A;  2LC5 A;  1F4Q A;  1AK8 A;  1Q80 A;  2F2P A;  2FJY A;  2WCE A;  1X02 A;  4FQO A;  4DCK A;  1NP8 A;  2LMV A;  2KNE A;  1DJI A;  2KYF A;  3CTN A;  1RK9 A;  2GGM A;  5FI6 A;  4NQG A;  2H61 C;  1S5G Y;  3B87 A;  1CMG A;  4P2Y B;  5PAL A;  4GUK A;  5FI7 A;  1W7I B;  1H8B A;  2CBL A;  1K95 A;  1KQM B;  4DIR A;  1UHH A;  2KI6 D;  4WRI A;  2A4J A;  2R2I A;  3IQO A;  3SG5 A;  4AQJ A;  2LMT A;  2K7O A;  1OOH A;  3Q8I A;  1YR5 A;  2LLS A;  2RGI A;  4FQT A;  2PVB A;  4INW A;  5D69 A;  1NUB A;  3OHM B;  2MJW B;  2KHN A;  1UHJ A;  3JVT C;  1B7T Z;  3KEV A;  3LCP C;  2K7B A;  1ORG A;  3FE8 A;  4PE7 A;  5J3X A;  2LLT A;  1AJ5 A;  3R1O A;  3JTD C;  1CFP A;  4MRY A;  2KQ6 A;  2MAZ A;  4PE4 A;  1CFD A;  1SR6 B;  3EVR A;  3S0A A;  2JRF A;  1SBJ A;  2F33 A;  2I18 A;  3QRX A;  4CLN A;  2KGR A;  2PRU A;  1KQM C;  1IGV A;  1SSE B;  5CSJ A;  3BFH A;  1ZOT B;  5TNC A;  1F71 A;  1CM1 A;  3SG7 A;  3F45 A;  3OX5 A;  1JUO A;  4JKT A;  4P5O E;  1TUJ A;  1UP5 A;  2JWW A;  3DVK A;  5FI2 A;  2O60 A;  2LVV A;  3SG6 A;  1K2H A;  1M39 A;  1MXE A;  1CTR A;  3HCM A;  1QXP A;  1IIO A;  1G4Y R;  1SL7 A;  3I5G C;  3BJH A;  1RTP 1;  1SK6 D;  5D7F A;  1V1F A;  4MSP A;  3I5I C;  3SS5 A;  2LCP A;  4N1F A;  2KYC A;  1PSR A;  2L5Y A;  3OB1 B;  4I5J A;  2H2K A;  3SG4 A;  2M8U A;  1WY9 A;  2M3W A;  3BQ3 A;  5AFP A;  1CNP A;  1DGU A;  1XFX O;  1QLK A;  3EK7 A;  2BKH B;  3EVU A;  4PDZ A;  1NX2 A;  2SCP A;  5AEQ A;  4YGB B;  1IH0 A;  1GJY A;  4C0L A;  1RFJ A;  1TNQ A;  3EKJ A;  1CMF A;  2MBX A;  5JJG A;  2CTN A;  1PVA A;  1CLM A;  4I5N B;  3WXA A;  1LIN A;  3LK1 A;  4JPZ B;  4L9M A;  4AQI A;  1TCF A;  1B7T Y;  1K8U A;  4M2P A;  3SG3 A;  3KO0 A;  2QEO A;  2JQ6 A;  1JC2 A;  1KFX S;  2BAP A;  1KFX L;  4QJ3 B;  2P6B B;  1BOC A;  1OOG A;  2LUX A;  2HF5 A;  1S1E A;  3VGO A;  2LHL A;  2EHB A;  3D77 A;  2MHH A;  2M49 B;  1WRK A;  3DVM A;  3MSE B;  1FPW A;  4QJ5 B;  3CDN A;  1N2D A;  1ZFS A;  1XO5 A;  4JQ0 D;  1OMD A;  2WOS A;  4OCI A;  4DUQ A;  2BL0 B;  3CWG A;  1E8A A;  3PAL A;  2YGU A;  3ZNI A;  2BNX A;  1MQ1 A;  1XA5 A;  2ZRS A;  1Y1X A;  3EKH A;  5HLV A;  3LLE A;  1A4P A;  1SYM A;  2NZ0 A;  3NSK A;  1J55 A;  1DC1 A;  4GGF A;  2NLN A;  4GPL B;  2KDH A;  2CXJ A;  5I94 A;  2BCA A;  2WC8 A;  5FYX A;  1DTL A;  2ZND A;  2QEH A;  1DMO A;  2AMI A;  3D73 A;  3FE6 A;  3TDI A;  3CR5 X;  1FI5 A;  2Y1M A;  4CFQ A;  1JSA A;  3I5I B;  4I5L B;  3BUX B;  3D78 A;  1JBA A;  4PE0 A;  2WCM A;  3BUW B;  1CKK A;  1EXR A;  1S5G Z;  1XFZ O;  3ZWH A;  1GGW A;  5AER A;  2LV7 A;  1B8R A;  1B8L A;  3CR2 A;  1BMO A;  2L4H A;  2L98 A;  2E30 A;  1F8H A;  1TTX A;  4MLW A;  2LP3 A;  4OR9 B;  3M0W A;  4CFR A;  1IJ5 A;  2L4I A;  2LMU A;  4YI9 A;  2WCK A;  5EL2 A;  4JD9 A;  1YUR A;  1ZMZ A;  1DJY A;  4GGN A;  5I8N A;  1C7W A;  2D8N A;  1NIW A;  2HQ8 A;  2LAN A;  4GGF C;  1L2O B;  1IRJ A;  2MLF C;  2JT8 A;  4R1E A;  1KK7 Z;  1KSM A;  1NPQ A;  3VRN A;  3FE9 A;  2JXL A;  1F55 A;  2JTT A;  2QDI A;  4CID A;  1NYA A;  1AP4 A;  3RLZ A;  1A29 A;  1TIZ A;  3CR4 X;  1EG4 A;  3CZ2 A;  1NCZ A;  4NDC A;  2JPO A;  2NXQ A;  3TDZ A;  1LA0 A;  3TUY B;  3QME A;  5DIC A;  1BF5 A;  2ISD A;  3CZT X;  1SPY A;  1WDC C;  2ZN8 A;  3S0D A;  1VRK A;  3R1V A;  1MR8 A;  3DVE A;  4PHM A;  2M1U A;  3BFA A;  1IKU A;  1IQ3 A;  3BOW B;  1NX0 A;  2VRG A;  1SRA A;  2BCX A;  1J7R A;  2JU0 A;  1Y1A A;  2PAS A;  4ORA B;  2BL0 C;  2OS8 C;  1Z2C B;  2L2C A;  2WC5 A;  2LE9 B;  2OTG B;  1ODB A;  4YI8 A;  1J7P A;  1B47 A;  1F54 A;  1XFU O;  3K1E A;  3L47 A;  5HKZ A;  3FS7 A;  4GBA A;  1C3Z A;  4QJ4 B;  4PHJ A;  1S6C A;  4MZK A;  2EC6 B;  3WHT B;  1OOJ A;  3OP0 A;  2LNK A;  3OBV A;  2JPT A;  1REC A;  4IJ7 A;  1MHO A;  3O4X A;  1QIV A;  1XFV O;  1OZO A;  3S0F A;  4ICB A;  2WC6 A;  3CGA A;  1BR1 B;  1QVI Z;  1K9K A;  2K61 A;  1EL4 A;  3PSR A;  2LHI A;  3A4U B;  1U5I B;  2LP2 A;  1YRT B;  1JWD A;  2COL B;  2G2B A;  3B86 A;  1FW4 A;  1ZAC A;  4A4C A;  1NCY A;  1SCV A;  2ERB A;  3O2P A;  5HYD A;  1GM0 A;  4MN0 A;  2K8M B;  1U5I A;  4DS7 A;  4UPG A;  1K9P A;  2MRD A;  1B1G A;  2PYQ A;  4XJK B;  4M2Q A;  1NX1 A;  3CYZ A;  3VRO A;  1OW4 A;  4YRU A;  5CPV A;  2KAY A;  2M7N A;  1HT9 A;  3D10 A;  3GK1 A;  4AOM A;  3FWC A;  4MZJ A;  1IG5 A;  2IS9 A;  2BKI B;  2I7A A;  2DOQ A;  3KPX A;  4YBH B;  1A75 B;  3PAT A;  1UUS A;  1Y0V H;  4ETO A;  1QIW A;  3I5G B;  3EK8 A;  2KBM A;  3N7H A;  2I94 A;  2KLD A;  2NCP A;  1DVI A;  2MLE C;  1XFY O;  1YUT A;  3I5H B;  1SCM C;  3KHE A;  2H8V A;  2M97 A;  4MVF A;  3BOW A;  2JXC A;  1S3P A;  2KBI A;  1TN4 A;  3DZT A;  1XK4 A;  2LVK A;  4YGD B;  1D1O A;  2CT9 A;  1XK4 C;  1WDC B;  1GGZ A;  3O4Y A;  1S6J A;  1Y6W A;  1TOP A;  2LM5 A;  1TNX A;  2QAC A;  1DJX A;  3VB1 A;  3NXA A;  1T14 A;  2OS8 B;  1WRZ A;  1R2U A;  5DKN A;  2L50 A;  1KCY A;  1DJH A;  5DKQ A;  1ALW A;  2WCH A;  3UO9 A;  1EJ3 A;  1JFK A;  2AUC A;  3SG2 A;  1N0Y A;  2G9B A;  2Y1N A;  2PQL A;  2BE4 A;  1KK8 C;  1G33 A;  1YX7 A;  3D0Y A;  4TNC A;  1M31 A;  2ZRT A;  4PHN A;  2PSR A;  1KFU S;  3IVT A;  2FOT A;  1QTX A;  1BOD A;  3FIA A;  1PRW A;  2WND A;  3GK4 X;  3OGN A;  4JWQ A;  4NDD A;  4XYN A;  5KU1 A;  3VRQ A;  1NX3 A;  4OVN F;  2QEB A;  1P28 A;  1WRL A;  4PE1 A;  4YGC B;  1YUS A;  4CPV A;  1A03 A;  1TNW A;  3EK4 A;  4USL A;  1MUX A;  1FI6 A;  2PAL A;  2ZN9 A;  4BY5 A;  4C0K A;  2WOR A;  1EG3 A;  2FJU B;  2HQW A;  3EG5 B;  4XJK A;  1SNL A;  2B1U A;  3AAJ A;  3LL8 B;  4INX A;  3KF9 A;  1SMG A;  1B4C A;  2KFG A;  4HRG A;  1BU3 A;  3TS5 C;  3SIB A;  2FCD A;  1DF0 B;  2K7D A;  2F3Y A;  3VRR A;  2WCF A;  3B88 A;  1YVL A;  1QAT A;  3CLN A;  3DD4 A;  3NSI A;  3NSO A;  1OOI X;  5HLO A;  2K2F A;  3PM8 A;  5CSF A;  1OQP A;  1B9A A;  1WLM A;  1J1D A;  1CM4 A;  1PVB A;  2JNF A;  1XVJ A;  4WQ3 A;  1M45 A;  1MXL C;  2F2O A;  2TN4 A;  1DGV A;  2Q91 A;  4HSZ A;  3NSL A;  4IL1 A;  1M46 A;  3D76 A;  2SAS A;  3SJS A;  5I2L A;  4BY4 A;  1PUL A;  1NCX A;  1TWO A;  2P70 A;  3B7A A;  2L51 A;  1YVH A;  1SY9 A;  1J7Q A;  2ZKM X;  1CB1 A;  1TUZ A;  2ZNE A;  5HKW A;  1BLQ A;  2MA2 A;  1QJT A;  2K0J A;  2LVJ A;  3SS4 A;  2K7C A;  1CLL A;  1WLZ A;  4MEW A;  1BG1 A;  4OZD A;  1LS8 A;  3I5H C;  1NWD A;  5F6T A;  2BEC A;  1YUU A;  3PLF B;  2KAV A;  2L0P A;  1S26 D;  1UUR A;  1LXF C;  1LA3 A;  1SL8 A;  4GNK B;  4PT1 A;  1JF2 A;  2JT0 A;  4YGE B;  1FBV A;  3UNW A;  2HPS A;  3NGV A;  2OPO A;  1F70 A;  2WCJ A;  4MZL A;  1L7Z A;  1KK7 Y;  1S36 A;  2JT3 A;  4DRW A;  3B6X A;  2KI4 B;  2Q4U A;  4ORC B;  2O5G A;  5G08 A;  3RM1 A; 
#chains in the Genus database with same CATH homology
 2Y4Q A;  5I2Q A;  3JTD B;  1CDN A;  2BE6 A;  1L2O C;  1C07 A;  3ICB A;  2JUL A;  2K2A A;  1CDM A;  1DF0 A;  5IBW A;  5GQQ C;  2L2E A;  2CNP A;  1ZUZ A;  1IQ5 A;  1BT6 A;  2JOJ A;  4N5X A;  2M9G A;  1PK0 D;  1UHI A;  2E6W A;  1SW8 A;  2L5X B;  2JNX A;  2LVI A;  1AUI B;  1KQV A;  4PCW A;  4MRX A;  1JFJ A;  1PSB A;  1CFF A;  3AKB A;  1DJW A;  1NSH A;  5HKY A;  1S6I A;  1IWQ A;  1K93 D;  1AJ4 A;  3AKA A;  1GQM A;  1B8C A;  2AAO A;  1QV0 A;  2V53 A;  1JF0 A;  1UWO A;  3WNX B;  5ER5 A;  1DJZ A;  3SIA A;  1OZS A;  1MF8 B;  2M29 A;  5ER4 X;  3JVT B;  1OMV A;  2M0R A;  1FF1 A;  1SL9 A;  1UHK A;  2GGZ A;  4ZCV A;  4FTG A;  1RJV A;  4M2O A;  5CSN A;  2Y5I A;  1MWN A;  1SKT A;  2KSP A;  3LK0 A;  1SR6 C;  2JC2 A;  1QX7 A;  2M7L A;  5CSI A;  3PFV A;  2PMY A;  2KQY A;  1TCO B;  1OSA A;  4YGA A;  5DKR A;  2GV5 A;  2KI6 C;  1K94 A;  1LKJ A;  3I5F C;  5BPJ A;  3K21 A;  1CDP A;  5AAN A;  4I5K A;  1YRU B;  3PN7 B;  3BUM B;  4A4B A;  5KSZ A;  2F8P A;  5B8I B;  4OV2 A;  3VRP A;  4D1E A;  3O6B A;  1QS7 A;  4OKH A;  4GAO A;  1SCM B;  1Y1U A;  4ZCU A;  3TDU A;  1KFU L;  1QAS A;  1HQV A;  1RWY A;  4GFT A;  1KSO A;  4PHK A;  4ORB B;  2ZFD A;  3OB2 B;  4PAL A;  1BR4 B;  2LAP A;  2KOT A;  1YTZ C;  1C7V A;  3D0Y B;  3DVJ A;  3GOF A;  5I2O A;  3WHU B;  1ALV A;  2LUC A;  1IJ6 A;  1K9U A;  1M63 B;  3CS1 A;  2F3Z A;  4U8D A;  2M1K B;  3IF7 A;  1J7O A;  1J1E A;  1QX2 A;  2KI4 C;  1QLS A;  1AVS A;  1W7J B;  3PN7 C;  5K89 A;  3O78 A;  2BBN A;  1CLB A;  2KFF A;  4WQ2 A;  1KK8 B;  4MBE A;  3TZ1 A;  1BJF A;  1K90 D;  3H4S E;  4E68 A;  2FCE A;  1K96 A;  1KWO B;  1XYD A;  1H4B A;  1TNP A;  1AHR A;  3DF0 A;  3E3R A;  2KGB C;  1RRO A;  2LLU A;  3TS5 B;  2EGD A;  4C0J A;  2JZI A;  1YX8 A;  1G8I A;  1A2X A;  3GK2 A;  3BUN B;  2CCM A;  1OE9 B;  1V1G A;  4N1G A;  2OTG C;  3BUO B;  3TUY C;  1CFC A;  1DT7 B;  3HX4 A;  1A75 A;  3IQQ A;  1CDL A;  2WCB A;  1DJG A;  2I2R E;  3A8R A;  3DF0 B;  3I5F B;  4NDB A;  5KTY A;  3EVV A;  1TRF A;  2BCB A;  1KWO C;  2KAX A;  1PAL A;  2H61 A;  4HRE E;  1LVC D;  2QPT A;  4Q04 A;  3BXK A;  1QVI Y;  2NCO A;  1QX5 B;  2KFH A;  5AXI A;  2HET A;  1XFW O;  2EC6 C;  1OMR A;  1R6P A;  2JTZ A;  3C1V A;  3OX6 A;  4HRH A;  5JOL A;  1EH2 A;  3AAK A;  3FWB A;  1N65 A;  1F4O A;  3BYA A;  2BBM A;  4F0Z B;  1UHN A;  1QV1 A;  2LC5 A;  1F4Q A;  1AK8 A;  1Q80 A;  2F2P A;  2WCE A;  1X02 A;  4FQO A;  4DCK A;  1NP8 A;  2LMV A;  2KNE A;  1DJI A;  2KYF A;  3CTN A;  1RK9 A;  2GGM A;  4NQG A;  2H61 C;  1S5G Y;  1CMG A;  4P2Y B;  5PAL A;  4GUK A;  1H8B A;  1W7I B;  2CBL A;  1K95 A;  1KQM B;  4DIR A;  1UHH A;  2KI6 D;  4WRI A;  2A4J A;  2R2I A;  3IQO A;  3SG5 A;  4AQJ A;  2LMT A;  2K7O A;  1YR5 A;  2LLS A;  2RGI A;  2PVB A;  5D69 A;  1NUB A;  3OHM B;  2MJW B;  2KHN A;  1UHJ A;  3JVT C;  1B7T Z;  3KEV A;  3LCP C;  2K7B A;  5J3X A;  4PE7 A;  2LLT A;  1AJ5 A;  3JTD C;  1CFP A;  4MRY A;  2KQ6 A;  2MAZ A;  4PE4 A;  1CFD A;  1SR6 B;  3EVR A;  2JRF A;  1SBJ A;  2F33 A;  2I18 A;  3QRX A;  4CLN A;  2KGR A;  2PRU A;  1KQM C;  1IGV A;  5CSJ A;  1ZOT B;  5TNC A;  1F71 A;  1CM1 A;  3SG7 A;  3F45 A;  3OX5 A;  1JUO A;  4P5O E;  1UP5 A;  2JWW A;  3DVK A;  1K2H A;  2O60 A;  2LVV A;  3SG6 A;  1M39 A;  1MXE A;  1CTR A;  3HCM A;  1QXP A;  1G4Y R;  1SL7 A;  3I5G C;  1RTP 1;  1SK6 D;  5D7F A;  1V1F A;  4MSP A;  3I5I C;  2LCP A;  4N1F A;  2KYC A;  1PSR A;  3OB1 B;  4I5J A;  2H2K A;  3SG4 A;  2M8U A;  1WY9 A;  2M3W A;  3BQ3 A;  5AFP A;  1CNP A;  1DGU A;  1XFX O;  1QLK A;  3EK7 A;  2BKH B;  3EVU A;  4PDZ A;  1NX2 A;  2SCP A;  5AEQ A;  4YGB B;  1IH0 A;  1GJY A;  4C0L A;  1RFJ A;  1TNQ A;  3EKJ A;  1CMF A;  2MBX A;  5JJG A;  2CTN A;  1PVA A;  1CLM A;  4I5N B;  3WXA A;  1LIN A;  3LK1 A;  4JPZ B;  4L9M A;  4AQI A;  1TCF A;  1B7T Y;  1K8U A;  4M2P A;  3SG3 A;  3KO0 A;  2JQ6 A;  1JC2 A;  1KFX S;  1KFX L;  4QJ3 B;  2P6B B;  1BOC A;  2LUX A;  2HF5 A;  1S1E A;  3VGO A;  2LHL A;  2EHB A;  2MHH A;  2M49 B;  1WRK A;  3DVM A;  3MSE B;  1FPW A;  4QJ5 B;  1N2D A;  1ZFS A;  1XO5 A;  4JQ0 D;  1OMD A;  2WOS A;  4OCI A;  4DUQ A;  2BL0 B;  3CWG A;  1E8A A;  3PAL A;  3ZNI A;  1MQ1 A;  1XA5 A;  2ZRS A;  1Y1X A;  3EKH A;  5HLV A;  3LLE A;  1A4P A;  1SYM A;  2NZ0 A;  3NSK A;  1J55 A;  4GGF A;  2NLN A;  4GPL B;  2KDH A;  2CXJ A;  2BCA A;  2WC8 A;  5FYX A;  1DTL A;  2ZND A;  1DMO A;  2AMI A;  3TDI A;  3CR5 X;  1FI5 A;  2Y1M A;  4CFQ A;  1JSA A;  3I5I B;  4I5L B;  3BUX B;  1JBA A;  4PE0 A;  3BUW B;  1CKK A;  1EXR A;  1S5G Z;  1XFZ O;  3ZWH A;  1GGW A;  5AER A;  2LV7 A;  1B8R A;  1B8L A;  3CR2 A;  1BMO A;  2L4H A;  2L98 A;  2E30 A;  1F8H A;  1TTX A;  4MLW A;  2LP3 A;  4OR9 B;  3M0W A;  4CFR A;  1IJ5 A;  2L4I A;  2LMU A;  4YI9 A;  5I8N A;  1YUR A;  1ZMZ A;  1DJY A;  4GGN A;  1C7W A;  2D8N A;  1NIW A;  2HQ8 A;  2LAN A;  4GGF C;  1L2O B;  1IRJ A;  2MLF C;  2JT8 A;  4R1E A;  1KK7 Z;  1KSM A;  1NPQ A;  3VRN A;  2JXL A;  1F55 A;  2JTT A;  4CID A;  1NYA A;  1AP4 A;  3RLZ A;  1A29 A;  1TIZ A;  3CR4 X;  1EG4 A;  1NCZ A;  4NDC A;  2NXQ A;  3TDZ A;  1LA0 A;  3TUY B;  1BF5 A;  2ISD A;  3CZT X;  1SPY A;  1WDC C;  2ZN8 A;  1VRK A;  1MR8 A;  3DVE A;  4PHM A;  2M1U A;  1IKU A;  1IQ3 A;  3BOW B;  1NX0 A;  2VRG A;  1SRA A;  2BCX A;  1J7R A;  2JU0 A;  1Y1A A;  2PAS A;  4ORA B;  2BL0 C;  2OS8 C;  2LE9 B;  2OTG B;  1ODB A;  4YI8 A;  1J7P A;  1B47 A;  1F54 A;  1XFU O;  5HKZ A;  3FS7 A;  4GBA A;  4QJ4 B;  4PHJ A;  1S6C A;  4MZK A;  2EC6 B;  3WHT B;  1OOJ A;  3OP0 A;  2LNK A;  2JPT A;  1REC A;  1MHO A;  1QIV A;  1XFV O;  1OZO A;  4ICB A;  3CGA A;  1BR1 B;  1QVI Z;  1K9K A;  2K61 A;  1EL4 A;  3PSR A;  2LHI A;  3A4U B;  1U5I B;  2LP2 A;  1YRT B;  1JWD A;  2COL B;  2G2B A;  1FW4 A;  1ZAC A;  4A4C A;  1NCY A;  1SCV A;  3O2P A;  5HYD A;  4MN0 A;  2K8M B;  1U5I A;  4DS7 A;  4UPG A;  1K9P A;  2MRD A;  1B1G A;  4XJK B;  4M2Q A;  1NX1 A;  3VRO A;  4YRU A;  5CPV A;  2KAY A;  2M7N A;  1HT9 A;  3D10 A;  3GK1 A;  4AOM A;  3FWC A;  4MZJ A;  1IG5 A;  2IS9 A;  2BKI B;  2I7A A;  2DOQ A;  3KPX A;  4YBH B;  1A75 B;  3PAT A;  1UUS A;  1Y0V H;  4ETO A;  1QIW A;  3I5G B;  3EK8 A;  2KBM A;  2I94 A;  2NCP A;  1DVI A;  2MLE C;  1XFY O;  1YUT A;  3I5H B;  1SCM C;  3KHE A;  2M97 A;  4MVF A;  3BOW A;  2JXC A;  1S3P A;  2KBI A;  1TN4 A;  4YGD B;  1XK4 A;  2LVK A;  1D1O A;  2CT9 A;  1WDC B;  1XK4 C;  1GGZ A;  3O4Y A;  1S6J A;  1Y6W A;  1TOP A;  2LM5 A;  1TNX A;  2QAC A;  1DJX A;  3NXA A;  2OS8 B;  1WRZ A;  1R2U A;  5DKN A;  2L50 A;  1KCY A;  1DJH A;  5DKQ A;  1ALW A;  1EJ3 A;  1JFK A;  2AUC A;  3SG2 A;  1N0Y A;  2G9B A;  2Y1N A;  2BE4 A;  1KK8 C;  1G33 A;  1YX7 A;  3D0Y A;  4TNC A;  1M31 A;  2ZRT A;  4PHN A;  2PSR A;  1KFU S;  2FOT A;  1QTX A;  1BOD A;  3FIA A;  1PRW A;  2WND A;  3GK4 X;  4JWQ A;  4NDD A;  4XYN A;  5KU1 A;  3VRQ A;  1NX3 A;  4OVN F;  1WRL A;  4PE1 A;  4YGC B;  1YUS A;  4CPV A;  1A03 A;  1TNW A;  3EK4 A;  4USL A;  1MUX A;  1FI6 A;  2PAL A;  2ZN9 A;  4BY5 A;  4C0K A;  2WOR A;  1EG3 A;  2FJU B;  2HQW A;  4XJK A;  1SNL A;  2B1U A;  3AAJ A;  3LL8 B;  3KF9 A;  1SMG A;  1B4C A;  2KFG A;  4HRG A;  1BU3 A;  3TS5 C;  3SIB A;  2FCD A;  1DF0 B;  2K7D A;  2F3Y A;  3VRR A;  2WCF A;  3CLN A;  1YVL A;  1QAT A;  3DD4 A;  3NSO A;  3NSI A;  5HLO A;  2K2F A;  3PM8 A;  5CSF A;  1OQP A;  1B9A A;  1J1D A;  1PVB A;  1CM4 A;  1WLM A;  2JNF A;  1XVJ A;  4WQ3 A;  1M45 A;  1MXL C;  2F2O A;  2TN4 A;  1DGV A;  2Q91 A;  4HSZ A;  3NSL A;  4IL1 A;  1M46 A;  2SAS A;  3SJS A;  5I2L A;  4BY4 A;  1PUL A;  1NCX A;  2L51 A;  1YVH A;  1SY9 A;  1J7Q A;  2ZKM X;  1CB1 A;  5HKW A;  2ZNE A;  1BLQ A;  2MA2 A;  1QJT A;  2K0J A;  2LVJ A;  2K7C A;  1CLL A;  1WLZ A;  4MEW A;  1BG1 A;  3I5H C;  1NWD A;  5F6T A;  2BEC A;  1YUU A;  3PLF B;  2KAV A;  2L0P A;  1S26 D;  1UUR A;  1LXF C;  1LA3 A;  1SL8 A;  4GNK B;  1JF2 A;  2JT0 A;  4YGE B;  1FBV A;  2HPS A;  2OPO A;  1F70 A;  4MZL A;  1L7Z A;  1KK7 Y;  1S36 A;  2JT3 A;  4DRW A;  2KI4 B;  2Q4U A;  4ORC B;  2O5G A;  5G08 A;  3RM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...