2ZRTA

Crystal structure of zn2+-bound form of des3-23alg-2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
165
structure length
165
Chain Sequence
QSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallization and X-ray diffraction analysis of N-terminally truncated human ALG-2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Programmed cell death protein 6
total genus 22
structure length 165
sequence length 165
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2zrtA00
1B4CA 2MAZA 1BF5A 3D0YA 5F6TA 2HPSA 3JTDB 4A4CA 3EVRA 1CFCA 1V1GA 4GUKA 4TNCA 1XK4A 3EK4A 3PM8A 2LNKA 1OZOA 5HLVA 1SMGA 3CR2A 1NX0A 1QLSA 1G33A 2L4IA 4HSZA 4MZKA 1MXEA 4N1GA 3DD4A 1OOJA 1UHIA 1XFZO 4BY5A 4CFQA 5TNCA 1V1FA 3AAKA 4DUQA 1RJVA 2I94A 4BY4A 2B1UA 4WRIA 2JTTA 1LA3A 5ER5A 2KOTA 1L7ZA 1SL9A 4GGFC 1UHHA 2I2RE 1AJ4A 1PSRA 3LLEA 4N1FA 3VROA 2F2OA 1FF1A 2ZRSA 3NSOA 4MBEA 2MA2A 1BR1B 2H61A 1XVJA 4M2OA 4YI8A 4JPZB 3SG2A 4E68A 2KNEA 1CDLA 1ZMZA 1NUBA 2V53A 5I8NA 1LXFC 2WOSA 1F4QA 3O2PA 4ORBB 1IGVA 2FOTA 1QX5B 2HETA 2JZIA 5DKNA 4FQOA 4YBHB 1IKUA 1SRAA 2KDHA 2LLUA 5I2LA 1AVSA 5AANA 2CBLA 2F8PA 1KQMB 1MR8A 1FBVA 1Y1AA 4OR9B 1KWOC 4USLA 1OMVA 3GOFA 4MN0A 1DGVA 1JC2A 3OB1B 4YGBB 1M31A 2SCPA 2KFGA 2NLNA 3NXAA 2ZRTA 3I5FB 5ER4X 4MZLA 4OCIA 3ZWHA 1XFUO 2BKIB 1D1OA 1BLQA 1NWDA 4XYNA 5JOLA 3BYAA 2EC6B 2JXLA 2ZFDA 1SCVA 3AAJA 2LMVA 4MRYA 5CSNA 4YGEB 2OS8B 3SG7A 1TNPA 3SG4A 3I5IB 2KYCA 2M1UA 1PVAA 1QIWA 1B8CA 1Y1XA 3BUWB 3C1VA 1DF0A 3PALA 3VRQA 1FPWA 2FJUB 5CSIA 1WDCC 1PK0D 2JWWA 1GQMA 4DS7A 2KI6D 1BODA 1QV1A 1DT7B 1NCXA 2BE6A 2A4JA 2JNFA 2G2BA 2KI4C 1CDMA 4GAOA 4MZJA 1KFUL 2K0JA 2L98A 1SYMA 1NX2A 4JWQA 5CPVA 1CFPA 1TNWA 1SR6B 3DVJA 1U5IB 3WHUB 2M49B 5KSZA 2ZKMX 4HREE 1IQ5A 2KI6C 2L50A 3I5HC 3CGAA 3VRNA 4ICBA 1S6CA 3A4UB 3OB2B 4PE0A 5BPJA 2KFHA 2KQ6A 3FWCA 2AUCA 2LLSA 1RROA 3WXAA 1DJHA 1IQ3A 4Q04A 5KTYA 1QTXA 2LP3A 4QJ3B 1MHOA 1QJTA 2GV5A 1PSBA 1HQVA 2JPTA 3VGOA 2BCBA 1DJXA 4PE1A 3TS5B 1DJZA 4QJ4B 1QIVA 1K96A 2KAXA 4JQ0D 4C0JA 2HF5A 1QVIZ 1ZFSA 1QATA 1J7QA 2BL0B 1ZUZA 2KAVA 4ORAB 3SG6A 2BKHB 2BECA 2KFFA 2L51A 1SCMB 2PVBA 2BBMA 1Y1UA 2LVKA 2K7BA 3EK8A 1KSMA 1N65A 4NDBA 4IL1A 2LUXA 1C7WA 3TUYB 1YX7A 2OS8C 2KHNA 1EJ3A 4PALA 1RTP1 1HT9A 1IG5A 1DTLA 3AKBA 3TDUA 2HQ8A 1YVLA 1K90D 1J7OA 1RWYA 2K8MB 3TDZA 2MLEC 1CM1A 2D8NA 1JF0A 1UP5A 1QASA 1WRZA 3CR4X 1TCFA 1G4YR 2F2PA 1CB1A 5HKZA 3BXKA 1K9UA 1OMDA 2K7DA 2LVVA 2JRFA 2LM5A 1YVHA 2OTGB 1CNPA 5DKQA 1EH2A 1LKJA 4YGDB 4HRGA 1IJ6A 4MRXA 5PALA 1WRKA 1N2DA 3IQOA 1UHNA 1ZACA 3NSKA 3I5GC 4GNKB 1NPQA 2CT9A 2JT0A 2JTZA 5J3XA 1VRKA 2K7OA 1QV0A 1LA0A 4ETOA 1C7VA 2WC8A 3GK2A 3OX5A 3LCPC 1SW8A 1BG1A 3AKAA 3MSEB 1UUSA 2LHLA 1S1EA 2Y5IA 4L9MA 5AXIA 4F0ZB 2QACA 1FI5A 4PHJA 1KWOB 4HRHA 2K2AA 2WORA 1Y6WA 2FCDA 4I5JA 1SCMC 1GGWA 1SY9A 1K2HA 1S26D 3OHMB 1W7JB 4XJKB 1CFDA 1B47A 2M0RA 2Q91A 5B8IB 1AHRA 3BUNB 1SPYA 5I2QA 1KFUS 2M8UA 1QX7A 1SK6D 1YURA 4AOMA 1UWOA 3PATA 3DVKA 4I5KA 1DF0B 2PMYA 1NX1A 2WCFA 4DRWA 1OMRA 1M39A 3PSRA 4WQ2A 2HQWA 3JTDC 5HKWA 1C07A 1MF8B 4U8DA 1A75A 1YX8A 2JU0A 4MLWA 1GGZA 2DOQA 2JC2A 2JNXA 1S3PA 2PASA 1U5IA 3PFVA 1LINA 1XO5A 1TNQA 4YRUA 4PE7A 3BQ3A 2G9BA 5JJGA 2ZNDA 5K89A 2EGDA 2MHHA 3IF7A 1Y0VH 1E8AA 1PULA 3IQQA 3KO0A 2KYFA 1OSAA 1TCOB 1GJYA 2M9GA 1DMOA 2L0PA 2QPTA 1QLKA 4GPLB 1BOCA 3JVTC 5AERA 3CZTX 3BUMB 2Q4UA 1BJFA 2WCEA 1L2OC 1CDPA 4PHKA 4XJKA 1OE9B 1K95A 1CM4A 3FIAA 1CTRA 2JOJA 2KGRA 3JVTB 2BCAA 1IRJA 4NDCA 1F8HA 1WY9A 4CLNA 1M45A 1B7TZ 1RK9A 1TNXA 2L2EA 1A03A 2LAPA 1EL4A 2TN4A 5AFPA 5CSJA 2JT3A 4YGAA 1J7PA 1MUXA 1B9AA 3KEVA 2COLB 4AQIA 1G8IA 1B1GA 2LLTA 3RM1A 1S5GZ 1ALWA 1S6JA 2F3ZA 2O60A 2VRGA 4MSPA 2M1KB 1KSOA 3FS7A 2CTNA 5KU1A 2LMUA 4GGFA 1A75B 5DKRA 1EG4A 2Y1NA 4CPVA 1YRUB 1QVIY 1OQPA 2JQ6A 4MEWA 3TDIA 1R6PA 2CXJA 3GK4X 4CIDA 2LUCA 1DGUA 2AAOA 4I5LB 1CMFA 3FWBA 1TOPA 1KK7Z 1SL8A 2FCEA 2I18A 1J55A 2E30A 3HCMA 3M0WA 1Q80A 1YUSA 3SG3A 1A2XA 5AEQA 1DJYA 1JF2A 3DVMA 1XFXO 3EK7A 5IBWA 1K93D 2KAYA 3DF0B 3WNXB 2LHIA 1NCZA 1ALVA 1J7RA 4OKHA 1CLMA 1K94A 5FYXA 1F54A 1B8LA 1F71A 1AUIB 1J1EA 3E3RA 4M2PA 5GQQC 4AQJA 3GK1A 1AK8A 3SG5A 1BU3A 2BBNA 1N0YA 1A29A 2LVJA 2LV7A 2K2FA 1JFKA 1K8UA 1KQVA 3LK0A 4WQ3A 3ICBA 2L4HA 1SL7A 3EKHA 1JWDA 1EG3A 2MLFC 1M63B 3I5IC 2LC5A 1CKKA 3TZ1A 2BE4A 3NSLA 4D1EA 1JSAA 5G08A 3I5HB 1LVCD 1QXPA 1H4BA 1IH0A 2E6WA 1WLZA 1S5GY 2NXQA 3HX4A 4M2QA 1ZOTB 3VRPA 3DVEA 2KQYA 2WNDA 3ZNIA 1CFFA 1R2UA 2H61C 2R2IA 4P2YB 5D69A 1YUUA 4GFTA 1NCYA 3EKJA 2EHBA 3WHTB 2MJWB 1DJGA 3I5GB 4OVNF 4OV2A 1DVIA 3D0YB 1RFJA 1XFVO 1XFYO 1IJ5A 1TN4A 2SASA 3DF0A 1YTZC 2LVIA 2Y4QA 3CR5X 1JFJA 2K7CA 3BOWA 5CSFA 3KPXA 1PALA 1PRWA 1UHJA 2I7AA 5I2OA 3D10A 4YGCB 3PLFB 1X02A 1OZSA 3SIAA 1A4PA 2ZN8A 1TTXA 2PSRA 1B7TY 1KK8B 2F3YA 1K9PA 3CS1A 1KFXL 3LL8B 1S36A 1B8RA 1DJIA 1ODBA 1WRLA 2F33A 1RECA 2NCOA 1MQ1A 1CDNA 1NSHA 4N5XA 2KGBC 1BMOA 1NX3A 1AJ5A 1SBJA 2M29A 1YRTB 3A8RA 4ZCVA 3CWGA 2BL0C 3SIBA 1XYDA 3VRRA 3O78A 3KF9A 4FTGA 4DCKA 4DIRA 1NP8A 2RGIA 1KK7Y 3BUOB 1BR4B 2JXCA 5HYDA 1JBAA 4PHMA 2MRDA 3RLZA 1NIWA 4P5OE 5HLOA 2ZN9A 3PN7B 2GGMA 3H4SE 4NDDA 2BCXA 2IS9A 2LCPA 1S6IA 1QX2A 2Y1MA 3BOWB 2NCPA 3OX6A 4C0KA 1AP4A 1IWQA 2WCBA 2O5GA 3QRXA 2M7NA 1F4OA 1XK4C 1H8BA 2CNPA 2L5XB 4PHNA 1F70A 1SR6C 2M7LA 2JT8A 1M46A 2OTGC 1CMGA 1YR5A 3KHEA 4I5NB 3CLNA 4MVFA 2NZ0A 2H2KA 1NYAA 1YUTA 2ISDA 2PALA 4QJ5B 5HKYA 4GBAA 2LE9B 3CTNA 1TIZA 3SJSA 1EXRA 1SNLA 4ORCB 1WLMA 2PRUA 1WDCB 1CLLA 3EVUA 4GGNA 4YI9A 1FI6A 1W7IB 2K61A 4A4BA 3NSIA 1J1DA 3F45A 2EC6C 1DJWA 2P6BB 1L2OB 1MWNA 1CLBA 3PN7C 1K9KA 2JULA 1XA5A 2ZNEA 3LK1A 1PVBA 4UPGA 3TUYC 4PCWA 3I5FC 4PDZA 2LANA 4C0LA 1FW4A 2OPOA 1UURA 1KCYA 1TRFA 4R1EA 3O4YA 2KBIA 3O6BA 4ZCUA 3EVVA 3K21A 1SKTA 2KBMA 3OP0A 2AMIA 2KI4B 2CCMA 1XFWO 1UHKA 2M97A 5D7FA 3TS5C 2LMTA 1KFXS 1MXLC 1BT6A 2GGZA 1QS7A 1KQMC 1JUOA 4CFRA 3BUXB 1F55A 4NQGA 4PE4A 1KK8C 2KSPA 2MBXA 2LP2A 2M3WA
chains in the Genus database with same CATH superfamily
1B4CA 2MAZA 1BF5A 3D0YA 5F6TA 2HPSA 3JTDB 4A4CA 1OOGA 3EVRA 1CFCA 1V1GA 4GUKA 4TNCA 1XK4A 3EK4A 5HL1A 3PM8A 2LNKA 1OZOA 5HLVA 1SMGA 3CR2A 1NX0A 1QLSA 1G33A 3NHTA 2L4IA 4HSZA 2H8VA 3BFBA 2WCJA 4MZKA 1MXEA 4N1GA 3DD4A 3D77A 3BFAA 1OOJA 1UHIA 1XFZO 4BY5A 4CFQA 5TNCA 1V1FA 3AAKA 4DUQA 1RJVA 1OOIX 2I94A 4BY4A 2B1UA 4WRIA 2JTTA 1LA3A 2QEOA 5ER5A 2L2CA 2KOTA 1L7ZA 1SL9A 4GGFC 1UHHA 2I2RE 1AJ4A 1PSRA 3LLEA 4N1FA 3VROA 2F2OA 1FF1A 2P71A 2ZRSA 3NSOA 4MBEA 2MA2A 1BR1B 2H61A 1XVJA 4M2OA 4YI8A 4JPZB 3SG2A 4E68A 2KNEA 3D78A 1CDLA 1ZMZA 1NUBA 2V53A 5I8NA 1LXFC 2WOSA 1F4QA 3O2PA 5I94A 4ORBB 1IGVA 2FOTA 1QX5B 2HETA 2JZIA 2P70A 4FQOA 4YBHB 5DKNA 1IKUA 1SRAA 2KDHA 2LLUA 5I2LA 1AVSA 5AANA 2CBLA 2F8PA 1KQMB 1MR8A 3OGNA 1FBVA 1Y1AA 4OR9B 1KWOC 4USLA 1OMVA 3GOFA 4MN0A 1DGVA 1JC2A 3OB1B 3S0EA 4YGBB 1M31A 2SCPA 3S0AA 2KFGA 2NLNA 3NXAA 3B86A 2ZRTA 3I5FB 3O4XA 4MZLA 5ER4X 3UNWA 4OCIA 3ZWHA 1XFUO 2BKIB 1D1OA 1BLQA 1NWDA 4XYNA 5JOLA 3BYAA 2EC6B 2JXLA 2ZFDA 1SCVA 3AAJA 2LMVA 4MRYA 2BNXA 5CSNA 2L5YA 4YGEB 2OS8B 3SG7A 1TNPA 3SG4A 1GM0A 3I5IB 2KYCA 2M1UA 1PVAA 1QIWA 1B8CA 1Y1XA 3BUWB 3C1VA 1DF0A 3PALA 3VRQA 1FPWA 1TWOA 2FJUB 5CSIA 1WDCC 1PK0D 2JWWA 1GQMA 3R72A 4DS7A 2KI6D 1BODA 1QV1A 1DT7B 1NCXA 2BE6A 2A4JA 2JNFA 2G2BA 2KI4C 1CDMA 4GAOA 4MZJA 1KFUL 2K0JA 2L98A 1SYMA 1NX2A 4JWQA 5CPVA 1CFPA 1OOHA 1TNWA 1SR6B 3DVJA 1T14A 1U5IB 1QWVA 3WHUB 3R1PA 2M49B 5KSZA 2ZKMX 4HREE 1IQ5A 1XFRA 2GTEA 2KI6C 2L50A 3I5HC 1DC1A 3CGAA 3VRNA 1C3ZA 4ICBA 1S6CA 3A4UB 3OB2B 4PE0A 3VB1A 3IVTA 5BPJA 2KFHA 2KQ6A 3FWCA 2AUCA 2LLSA 2PYQA 1RROA 3WXAA 1DJHA 2FJYA 1IQ3A 3B7AA 4JD9A 4Q04A 5KTYA 1QTXA 2LP3A 4QJ3B 1C3YA 1MHOA 1QJTA 2GV5A 1PSBA 1HQVA 2JPTA 3VGOA 2BCBA 1DJXA 4PE1A 3TS5B 1DJZA 3BJHA 1QIVA 1K96A 2KAXA 4JQ0D 4C0JA 2HF5A 1QVIZ 1ZFSA 1QATA 3DZTA 1J7QA 2BL0B 3DY9A 1ZUZA 2KAVA 4ORAB 3SG6A 2BKHB 3B6XA 2BECA 2KFFA 2L51A 1SCMB 2PVBA 2BBMA 1Y1UA 2LVKA 4PT1A 2K7BA 3EK8A 1KSMA 1N65A 4NDBA 4IL1A 2LUXA 1C7WA 3TUYB 1YX7A 2OS8C 2KHNA 1EJ3A 4PALA 1RTP1 1HT9A 1IG5A 1DTLA 3AKBA 3TDUA 2HQ8A 1YVLA 1K90D 1J7OA 1RWYA 2K8MB 2YGUA 3TDZA 2MLEC 1CM1A 2D8NA 1JF0A 1UP5A 1QASA 1WRZA 3CR4X 1TCFA 1G4YR 2F2PA 1CB1A 5HKZA 3BXKA 1K9UA 1OMDA 2K7DA 2LVVA 2JRFA 2LM5A 1YVHA 2OTGB 1CNPA 5DKQA 1EH2A 1LKJA 4YGDB 4HRGA 1TUZA 1IJ6A 2ERBA 4MRXA 5PALA 1WRKA 1N2DA 3IQOA 1UHNA 1ZACA 3NSKA 3I5GC 4GNKB 3CDNA 1NPQA 3CYZA 2CT9A 2JT0A 2JTZA 5J3XA 1VRKA 2K7OA 1QV0A 1LA0A 4ETOA 1C7VA 2WC8A 3GK2A 2KLEA 2KLDA 3OX5A 3LCPC 1SW8A 1BG1A 2WCLA 3K1EA 3AKAA 3MSEB 1UUSA 4INWA 2LHLA 1OOFA 1S1EA 2Y5IA 4L9MA 5AXIA 4F0ZB 2QACA 1FI5A 1LS8A 4PHJA 1KWOB 4HRHA 2K2AA 2WORA 1Y6WA 2FCDA 4I5JA 1SCMC 3CZ1A 1GGWA 1SY9A 1K2HA 1S26D 3OHMB 1W7JB 4XJKB 1CFDA 1B47A 2M0RA 2Q91A 5B8IB 1AHRA 3BUNB 1SPYA 5I2QA 1KFUS 2M8UA 1QX7A 3SS3A 1SK6D 1YURA 4AOMA 1UWOA 3PATA 2WCHA 3DVKA 3FE6A 1DF0B 4I5KA 2PMYA 1NX1A 2WCFA 5FI2A 4DRWA 1OMRA 1M39A 3PSRA 3CZ2A 3Q8IA 4WQ2A 2HQWA 3JTDC 5HKWA 1C07A 1MF8B 4U8DA 1A75A 1YX8A 2JU0A 4MLWA 3SS4A 1GGZA 2DOQA 2JC2A 2JNXA 1P28A 1S3PA 2PASA 1U5IA 3PFVA 1LINA 1XO5A 1TNQA 4YRUA 4PE7A 3BQ3A 2G9BA 5JJGA 2ZNDA 3B87A 5K89A 2EGDA 2MHHA 3IF7A 1Y0VH 1E8AA 1PULA 3IQQA 3KO0A 2KYFA 1OSAA 1TCOB 4KYNA 1GJYA 2M9GA 1DMOA 2L0PA 2QPTA 1QLKA 4GPLB 1DQEA 1BOCA 3JVTC 5AERA 3CZTX 3BUMB 3B88A 2Q4UA 1BJFA 2WCEA 3L47A 1L2OC 2QEBA 1CDPA 4PHKA 4XJKA 1OE9B 1K95A 1CM4A 2KPHA 3FIAA 1CTRA 3S0GA 2JOJA 2KGRA 3DYEA 2BCAA 1IRJA 3JVTB 4NDCA 1WY9A 4CLNA 1M45A 1F8HA 1B7TZ 1RK9A 1TNXA 2L2EA 1A03A 2LAPA 1EL4A 2TN4A 5AFPA 5CSJA 2JT3A 2PQLA 4YGAA 3L4AA 1MUXA 1J7PA 1B9AA 1W9ZA 3KEVA 2COLB 4AQIA 1G8IA 1B1GA 2LLTA 3RM1A 3CABA 3D73A 1S5GZ 1ALWA 1S6JA 2F3ZA 2O60A 2VRGA 4MSPA 2M1KB 1KSOA 3FS7A 2CTNA 5KU1A 2LMUA 4GGFA 1A75B 5DKRA 1EG4A 2Y1NA 4CPVA 1YRUB 1QVIY 1OQPA 2JQ6A 4MEWA 3TDIA 3FE8A 1R6PA 2CXJA 3GK4X 2WC5A 3L4LA 4CIDA 2LUCA 1DGUA 2AAOA 4I5LB 1CMFA 3FWBA 1TOPA 1KK7Z 1SL8A 2FCEA 2I18A 1J55A 2E30A 3HCMA 3M0WA 1Q80A 3OBVA 1YUSA 3SG3A 1A2XA 5AEQA 1DJYA 1JF2A 3DXLA 3DVMA 1XFXO 3EK7A 1SSEB 5IBWA 1K93D 2KAYA 3DF0B 3WNXB 2LHIA 1NCZA 1ALVA 3NHIA 1J7RA 4OKHA 1CLMA 1K94A 5FYXA 1F54A 1B8LA 1F71A 1AUIB 3D75A 1J1EA 3E3RA 4M2PA 5GQQC 4AQJA 3GK1A 5FI6A 3SG5A 1AK8A 1BU3A 2BBNA 5DICA 1N0YA 3PM2A 1A29A 2LVJA 2WCMA 3FE9A 2LV7A 2K2FA 1JFKA 1K8UA 1KQVA 3LK0A 4WQ3A 3ICBA 2L4HA 3D74A 1SL7A 3EKHA 1JWDA 4QJ4B 1EG3A 2MLFC 1M63B 3I5IC 2QDIA 2LC5A 5D3OA 4F7FA 1CKKA 3TZ1A 2BE4A 3NSLA 3S0FA 4D1EA 3S0BA 1JSAA 5G08A 3I5HB 1LVCD 3S0DA 1QXPA 1H4BA 1IH0A 2E6WA 1Z2CB 1WLZA 1S5GY 2NXQA 3HX4A 4M2QA 1ZOTB 3VRPA 3DVEA 2KQYA 2WNDA 3ZNIA 1CFFA 1R2UA 2H61C 2R2IA 4P2YB 5D69A 1YUUA 4GFTA 1NCYA 3EKJA 2EHBA 3WHTB 2MJWB 1DJGA 3I5GB 4OVNF 4OV2A 1DVIA 3D0YB 1RFJA 1XFVO 1XFYO 1IJ5A 1TN4A 2SASA 3DF0A 1YTZC 2LVIA 2Y4QA 3CR5X 1JFJA 2K7CA 3BOWA 5CSFA 3KPXA 1PALA 1PRWA 1UHJA 2I7AA 5I2OA 3D10A 4YGCB 3PLFB 4INXA 1X02A 1OW4A 1OZSA 3SIAA 3CZ0A 3PJIA 1A4PA 2ZN8A 1TTXA 2PSRA 1B7TY 1KK8B 1TUJA 1K9PA 2F3YA 1KFXL 3CS1A 4JKTA 3D76A 1S36A 3LL8B 1B8RA 1DJIA 1ODBA 1WRLA 2F33A 1RECA 2NCOA 1MQ1A 5FI7A 1CDNA 2WCKA 1NSHA 4N5XA 2KGBC 1BMOA 1NX3A 1AJ5A 1SBJA 2M29A 1YRTB 3A8RA 4ZCVA 3CWGA 2BL0C 3SIBA 1XYDA 3VRRA 3O78A 3KF9A 4FTGA 4OZDA 4DCKA 4DIRA 1NP8A 2RGIA 1KK7Y 3BUOB 1BR4B 1ORGA 2JXCA 5HYDA 1JBAA 4PHMA 2QEVA 2MRDA 3RLZA 1NIWA 1Z4HA 4P5OE 5HLOA 1DEKA 1DELA 2ZN9A 3PN7B 2GGMA 3H4SE 3N7HA 4NDDA 2BCXA 2IS9A 2LCPA 1S6IA 1QX2A 2Y1MA 3BOWB 2NCPA 3OX6A 3R1VA 5EL2A 4C0KA 1AP4A 1IWQA 2WCBA 2O5GA 3QRXA 2M7NA 3SS5A 1F4OA 3BFHA 2WC6A 1XK4C 1H8BA 2CNPA 3NGVA 2L5XB 4PHNA 1F70A 1SR6C 2M7LA 2JT8A 1M46A 2OTGC 2BAPA 1CMGA 1YR5A 3KHEA 4I5NB 3CLNA 4MVFA 2NZ0A 2H2KA 1NYAA 1YUTA 2ISDA 2PALA 4IJ7A 3QMEA 4QJ5B 5HKYA 4GBAA 2LE9B 3CTNA 1TIZA 3EG5B 1EXRA 1SNLA 2JPOA 4ORCB 1WLMA 2PRUA 1WDCB 1CLLA 3EVUA 4GGNA 4YI9A 1FI6A 1W7IB 1IIOA 2K61A 4A4BA 3NSIA 1J1DA 3F45A 2EC6C 1DJWA 2P6BB 1L2OB 1MWNA 4FQTA 3R1OA 3SJSA 1CLBA 3PN7C 1K9KA 2JULA 1XA5A 2ZNEA 3LK1A 1PVBA 4UPGA 3TUYC 4PCWA 3I5FC 4PDZA 2LANA 4C0LA 1FW4A 2OPOA 1UURA 1KCYA 1TRFA 4R1EA 3O4YA 2KBIA 3O6BA 4ZCUA 3EVVA 3K21A 1SKTA 3RZSA 2KBMA 3OP0A 2AMIA 2KI4B 2CCMA 1XFWO 1UHKA 2M97A 5D7FA 3TS5C 2LMTA 1KFXS 3UO9A 1MXLC 1BT6A 2GGZA 2K60A 1QS7A 2QEHA 1KQMC 1JUOA 4CFRA 3BUXB 1F55A 4NQGA 4PE4A 1KK8C 2KSPA 2MBXA 2LP2A 2M3WA 3V2LA
chains in the Genus database with same CATH topology
1B4CA 2MAZA 1BF5A 3D0YA 5F6TA 2HPSA 3JTDB 4A4CA 3EVRA 1CFCA 1V1GA 4GUKA 4TNCA 1XK4A 3EK4A 3PM8A 2LNKA 1OZOA 5HLVA 1SMGA 3CR2A 1NX0A 1QLSA 1G33A 2L4IA 4HSZA 4MZKA 1MXEA 4N1GA 3DD4A 1OOJA 1UHIA 1XFZO 4BY5A 4CFQA 5TNCA 1V1FA 3AAKA 4DUQA 1RJVA 2I94A 4BY4A 2B1UA 4WRIA 2JTTA 1LA3A 5ER5A 2KOTA 1L7ZA 1SL9A 4GGFC 1UHHA 2I2RE 1AJ4A 1PSRA 3LLEA 4N1FA 3VROA 2F2OA 1FF1A 2ZRSA 3NSOA 4MBEA 2MA2A 1BR1B 2H61A 1XVJA 4M2OA 4YI8A 4JPZB 3SG2A 4E68A 2KNEA 1CDLA 1ZMZA 1NUBA 2V53A 5I8NA 1LXFC 2WOSA 1F4QA 3O2PA 4ORBB 1IGVA 2FOTA 1QX5B 2HETA 2JZIA 5DKNA 4FQOA 4YBHB 1IKUA 1SRAA 2KDHA 2LLUA 5I2LA 1AVSA 5AANA 2CBLA 2F8PA 1KQMB 1MR8A 1FBVA 1Y1AA 4OR9B 1KWOC 4USLA 1OMVA 3GOFA 4MN0A 1DGVA 1JC2A 3OB1B 4YGBB 1M31A 2SCPA 2KFGA 2NLNA 3NXAA 2ZRTA 3I5FB 5ER4X 4MZLA 4OCIA 3ZWHA 1XFUO 2BKIB 1D1OA 1BLQA 1NWDA 4XYNA 5JOLA 3BYAA 2EC6B 2JXLA 2ZFDA 1SCVA 3AAJA 2LMVA 4MRYA 5CSNA 4YGEB 2OS8B 3SG7A 1TNPA 3SG4A 3I5IB 2KYCA 2M1UA 1PVAA 1QIWA 1B8CA 1Y1XA 3BUWB 3C1VA 1DF0A 3PALA 3VRQA 1FPWA 2FJUB 5CSIA 1WDCC 1PK0D 2JWWA 1GQMA 4DS7A 2KI6D 1BODA 1QV1A 1DT7B 1NCXA 2BE6A 2A4JA 2JNFA 2G2BA 2KI4C 1CDMA 4GAOA 4MZJA 1KFUL 2K0JA 2L98A 1SYMA 1NX2A 4JWQA 5CPVA 1CFPA 1TNWA 1SR6B 3DVJA 1U5IB 3WHUB 2M49B 5KSZA 2ZKMX 4HREE 1IQ5A 2KI6C 2L50A 3I5HC 3CGAA 3VRNA 4ICBA 1S6CA 3A4UB 3OB2B 4PE0A 5BPJA 2KFHA 2KQ6A 3FWCA 2AUCA 2LLSA 1RROA 3WXAA 1DJHA 1IQ3A 4Q04A 5KTYA 1QTXA 2LP3A 4QJ3B 1MHOA 1QJTA 2GV5A 1PSBA 1HQVA 2JPTA 3VGOA 2BCBA 1DJXA 4PE1A 3TS5B 1DJZA 4QJ4B 1QIVA 1K96A 2KAXA 4JQ0D 4C0JA 2HF5A 1QVIZ 1ZFSA 1QATA 1J7QA 2BL0B 1ZUZA 2KAVA 4ORAB 3SG6A 2BKHB 2BECA 2KFFA 2L51A 1SCMB 2PVBA 2BBMA 1Y1UA 2LVKA 2K7BA 3EK8A 1KSMA 1N65A 4NDBA 4IL1A 2LUXA 1C7WA 3TUYB 1YX7A 2OS8C 2KHNA 1EJ3A 4PALA 1RTP1 1HT9A 1IG5A 1DTLA 3AKBA 3TDUA 2HQ8A 1YVLA 1K90D 1J7OA 1RWYA 2K8MB 3TDZA 2MLEC 1CM1A 2D8NA 1JF0A 1UP5A 1QASA 1WRZA 3CR4X 1TCFA 1G4YR 2F2PA 1CB1A 5HKZA 3BXKA 1K9UA 1OMDA 2K7DA 2LVVA 2JRFA 2LM5A 1YVHA 2OTGB 1CNPA 5DKQA 1EH2A 1LKJA 4YGDB 4HRGA 1IJ6A 4MRXA 5PALA 1WRKA 1N2DA 3IQOA 1UHNA 1ZACA 3NSKA 3I5GC 4GNKB 1NPQA 2CT9A 2JT0A 2JTZA 5J3XA 1VRKA 2K7OA 1QV0A 1LA0A 4ETOA 1C7VA 2WC8A 3GK2A 3OX5A 3LCPC 1SW8A 1BG1A 3AKAA 3MSEB 1UUSA 2LHLA 1S1EA 2Y5IA 4L9MA 5AXIA 4F0ZB 2QACA 1FI5A 4PHJA 1KWOB 4HRHA 2K2AA 2WORA 1Y6WA 2FCDA 4I5JA 1SCMC 1GGWA 1SY9A 1K2HA 1S26D 3OHMB 1W7JB 4XJKB 1CFDA 1B47A 2M0RA 2Q91A 5B8IB 1AHRA 3BUNB 1SPYA 5I2QA 1KFUS 2M8UA 1QX7A 1SK6D 1YURA 4AOMA 1UWOA 3PATA 3DVKA 4I5KA 1DF0B 2PMYA 1NX1A 2WCFA 4DRWA 1OMRA 1M39A 3PSRA 4WQ2A 2HQWA 3JTDC 5HKWA 1C07A 1MF8B 4U8DA 1A75A 1YX8A 2JU0A 4MLWA 1GGZA 2DOQA 2JC2A 2JNXA 1S3PA 2PASA 1U5IA 3PFVA 1LINA 1XO5A 1TNQA 4YRUA 4PE7A 3BQ3A 2G9BA 5JJGA 2ZNDA 5K89A 2EGDA 2MHHA 3IF7A 1Y0VH 1E8AA 1PULA 3IQQA 3KO0A 2KYFA 1OSAA 1TCOB 1GJYA 2M9GA 1DMOA 2L0PA 2QPTA 1QLKA 4GPLB 1BOCA 3JVTC 5AERA 3CZTX 3BUMB 2Q4UA 1BJFA 2WCEA 1L2OC 1CDPA 4PHKA 4XJKA 1OE9B 1K95A 1CM4A 3FIAA 1CTRA 2JOJA 2KGRA 3JVTB 2BCAA 1IRJA 4NDCA 1F8HA 1WY9A 4CLNA 1M45A 1B7TZ 1RK9A 1TNXA 2L2EA 1A03A 2LAPA 1EL4A 2TN4A 5AFPA 5CSJA 2JT3A 4YGAA 1J7PA 1MUXA 1B9AA 3KEVA 2COLB 4AQIA 1G8IA 1B1GA 2LLTA 3RM1A 1S5GZ 1ALWA 1S6JA 2F3ZA 2O60A 2VRGA 4MSPA 2M1KB 1KSOA 3FS7A 2CTNA 5KU1A 2LMUA 4GGFA 1A75B 5DKRA 1EG4A 2Y1NA 4CPVA 1YRUB 1QVIY 1OQPA 2JQ6A 4MEWA 3TDIA 1R6PA 2CXJA 3GK4X 4CIDA 2LUCA 1DGUA 2AAOA 4I5LB 1CMFA 3FWBA 1TOPA 1KK7Z 1SL8A 2FCEA 2I18A 1J55A 2E30A 3HCMA 3M0WA 1Q80A 1YUSA 3SG3A 1A2XA 5AEQA 1DJYA 1JF2A 3DVMA 1XFXO 3EK7A 5IBWA 1K93D 2KAYA 3DF0B 3WNXB 2LHIA 1NCZA 1ALVA 1J7RA 4OKHA 1CLMA 1K94A 5FYXA 1F54A 1B8LA 1F71A 1AUIB 1J1EA 3E3RA 4M2PA 5GQQC 4AQJA 3GK1A 1AK8A 3SG5A 1BU3A 2BBNA 1N0YA 1A29A 2LVJA 2LV7A 2K2FA 1JFKA 1K8UA 1KQVA 3LK0A 4WQ3A 3ICBA 2L4HA 1SL7A 3EKHA 1JWDA 1EG3A 2MLFC 1M63B 3I5IC 2LC5A 1CKKA 3TZ1A 2BE4A 3NSLA 4D1EA 1JSAA 5G08A 3I5HB 1LVCD 1QXPA 1H4BA 1IH0A 2E6WA 1WLZA 1S5GY 2NXQA 3HX4A 4M2QA 1ZOTB 3VRPA 3DVEA 2KQYA 2WNDA 3ZNIA 1CFFA 1R2UA 2H61C 2R2IA 4P2YB 5D69A 1YUUA 4GFTA 1NCYA 3EKJA 2EHBA 3WHTB 2MJWB 1DJGA 3I5GB 4OVNF 4OV2A 1DVIA 3D0YB 1RFJA 1XFVO 1XFYO 1IJ5A 1TN4A 2SASA 3DF0A 1YTZC 2LVIA 2Y4QA 3CR5X 1JFJA 2K7CA 3BOWA 5CSFA 3KPXA 1PALA 1PRWA 1UHJA 2I7AA 5I2OA 3D10A 4YGCB 3PLFB 1X02A 1OZSA 3SIAA 1A4PA 2ZN8A 1TTXA 2PSRA 1B7TY 1KK8B 2F3YA 1K9PA 3CS1A 1KFXL 3LL8B 1S36A 1B8RA 1DJIA 1ODBA 1WRLA 2F33A 1RECA 2NCOA 1MQ1A 1CDNA 1NSHA 4N5XA 2KGBC 1BMOA 1NX3A 1AJ5A 1SBJA 2M29A 1YRTB 3A8RA 4ZCVA 3CWGA 2BL0C 3SIBA 1XYDA 3VRRA 3O78A 3KF9A 4FTGA 4DCKA 4DIRA 1NP8A 2RGIA 1KK7Y 3BUOB 1BR4B 2JXCA 5HYDA 1JBAA 4PHMA 2MRDA 3RLZA 1NIWA 4P5OE 5HLOA 2ZN9A 3PN7B 2GGMA 3H4SE 4NDDA 2BCXA 2IS9A 2LCPA 1S6IA 1QX2A 2Y1MA 3BOWB 2NCPA 3OX6A 4C0KA 1AP4A 1IWQA 2WCBA 2O5GA 3QRXA 2M7NA 1F4OA 1XK4C 1H8BA 2CNPA 2L5XB 4PHNA 1F70A 1SR6C 2M7LA 2JT8A 1M46A 2OTGC 1CMGA 1YR5A 3KHEA 4I5NB 3CLNA 4MVFA 2NZ0A 2H2KA 1NYAA 1YUTA 2ISDA 2PALA 4QJ5B 5HKYA 4GBAA 2LE9B 3CTNA 1TIZA 3SJSA 1EXRA 1SNLA 4ORCB 1WLMA 2PRUA 1WDCB 1CLLA 3EVUA 4GGNA 4YI9A 1FI6A 1W7IB 2K61A 4A4BA 3NSIA 1J1DA 3F45A 2EC6C 1DJWA 2P6BB 1L2OB 1MWNA 1CLBA 3PN7C 1K9KA 2JULA 1XA5A 2ZNEA 3LK1A 1PVBA 4UPGA 3TUYC 4PCWA 3I5FC 4PDZA 2LANA 4C0LA 1FW4A 2OPOA 1UURA 1KCYA 1TRFA 4R1EA 3O4YA 2KBIA 3O6BA 4ZCUA 3EVVA 3K21A 1SKTA 2KBMA 3OP0A 2AMIA 2KI4B 2CCMA 1XFWO 1UHKA 2M97A 5D7FA 3TS5C 2LMTA 1KFXS 1MXLC 1BT6A 2GGZA 1QS7A 1KQMC 1JUOA 4CFRA 3BUXB 1F55A 4NQGA 4PE4A 1KK8C 2KSPA 2MBXA 2LP2A 2M3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B4C A;  2MAZ A;  1BF5 A;  3D0Y A;  5F6T A;  2HPS A;  3JTD B;  4A4C A;  3EVR A;  1CFC A;  1V1G A;  4GUK A;  4TNC A;  1XK4 A;  3EK4 A;  3PM8 A;  2LNK A;  1OZO A;  5HLV A;  1SMG A;  3CR2 A;  1NX0 A;  1QLS A;  1G33 A;  2L4I A;  4HSZ A;  4MZK A;  1MXE A;  4N1G A;  3DD4 A;  1OOJ A;  1UHI A;  1XFZ O;  4BY5 A;  4CFQ A;  5TNC A;  1V1F A;  3AAK A;  4DUQ A;  1RJV A;  2I94 A;  4BY4 A;  2B1U A;  4WRI A;  2JTT A;  1LA3 A;  5ER5 A;  2KOT A;  1L7Z A;  1SL9 A;  4GGF C;  1UHH A;  2I2R E;  1AJ4 A;  1PSR A;  3LLE A;  4N1F A;  3VRO A;  2F2O A;  1FF1 A;  2ZRS A;  3NSO A;  4MBE A;  2MA2 A;  1BR1 B;  2H61 A;  1XVJ A;  4M2O A;  4YI8 A;  4JPZ B;  3SG2 A;  4E68 A;  2KNE A;  1CDL A;  1ZMZ A;  1NUB A;  2V53 A;  5I8N A;  1LXF C;  2WOS A;  1F4Q A;  3O2P A;  4ORB B;  1IGV A;  2FOT A;  1QX5 B;  2HET A;  2JZI A;  5DKN A;  4FQO A;  4YBH B;  1IKU A;  1SRA A;  2KDH A;  2LLU A;  5I2L A;  1AVS A;  5AAN A;  2CBL A;  2F8P A;  1KQM B;  1MR8 A;  1FBV A;  1Y1A A;  4OR9 B;  1KWO C;  4USL A;  1OMV A;  3GOF A;  4MN0 A;  1DGV A;  1JC2 A;  3OB1 B;  4YGB B;  1M31 A;  2SCP A;  2KFG A;  2NLN A;  3NXA A;  2ZRT A;  3I5F B;  5ER4 X;  4MZL A;  4OCI A;  3ZWH A;  1XFU O;  2BKI B;  1D1O A;  1BLQ A;  1NWD A;  4XYN A;  5JOL A;  3BYA A;  2EC6 B;  2JXL A;  2ZFD A;  1SCV A;  3AAJ A;  2LMV A;  4MRY A;  5CSN A;  4YGE B;  2OS8 B;  3SG7 A;  1TNP A;  3SG4 A;  3I5I B;  2KYC A;  2M1U A;  1PVA A;  1QIW A;  1B8C A;  1Y1X A;  3BUW B;  3C1V A;  1DF0 A;  3PAL A;  3VRQ A;  1FPW A;  2FJU B;  5CSI A;  1WDC C;  1PK0 D;  2JWW A;  1GQM A;  4DS7 A;  2KI6 D;  1BOD A;  1QV1 A;  1DT7 B;  1NCX A;  2BE6 A;  2A4J A;  2JNF A;  2G2B A;  2KI4 C;  1CDM A;  4GAO A;  4MZJ A;  1KFU L;  2K0J A;  2L98 A;  1SYM A;  1NX2 A;  4JWQ A;  5CPV A;  1CFP A;  1TNW A;  1SR6 B;  3DVJ A;  1U5I B;  3WHU B;  2M49 B;  5KSZ A;  2ZKM X;  4HRE E;  1IQ5 A;  2KI6 C;  2L50 A;  3I5H C;  3CGA A;  3VRN A;  4ICB A;  1S6C A;  3A4U B;  3OB2 B;  4PE0 A;  5BPJ A;  2KFH A;  2KQ6 A;  3FWC A;  2AUC A;  2LLS A;  1RRO A;  3WXA A;  1DJH A;  1IQ3 A;  4Q04 A;  5KTY A;  1QTX A;  2LP3 A;  4QJ3 B;  1MHO A;  1QJT A;  2GV5 A;  1PSB A;  1HQV A;  2JPT A;  3VGO A;  2BCB A;  1DJX A;  4PE1 A;  3TS5 B;  1DJZ A;  4QJ4 B;  1QIV A;  1K96 A;  2KAX A;  4JQ0 D;  4C0J A;  2HF5 A;  1QVI Z;  1ZFS A;  1QAT A;  1J7Q A;  2BL0 B;  1ZUZ A;  2KAV A;  4ORA B;  3SG6 A;  2BKH B;  2BEC A;  2KFF A;  2L51 A;  1SCM B;  2PVB A;  2BBM A;  1Y1U A;  2LVK A;  2K7B A;  3EK8 A;  1KSM A;  1N65 A;  4NDB A;  4IL1 A;  2LUX A;  1C7W A;  3TUY B;  1YX7 A;  2OS8 C;  2KHN A;  1EJ3 A;  4PAL A;  1RTP 1;  1HT9 A;  1IG5 A;  1DTL A;  3AKB A;  3TDU A;  2HQ8 A;  1YVL A;  1K90 D;  1J7O A;  1RWY A;  2K8M B;  3TDZ A;  2MLE C;  1CM1 A;  2D8N A;  1JF0 A;  1UP5 A;  1QAS A;  1WRZ A;  3CR4 X;  1TCF A;  1G4Y R;  2F2P A;  1CB1 A;  5HKZ A;  3BXK A;  1K9U A;  1OMD A;  2K7D A;  2LVV A;  2JRF A;  2LM5 A;  1YVH A;  2OTG B;  1CNP A;  5DKQ A;  1EH2 A;  1LKJ A;  4YGD B;  4HRG A;  1IJ6 A;  4MRX A;  5PAL A;  1WRK A;  1N2D A;  3IQO A;  1UHN A;  1ZAC A;  3NSK A;  3I5G C;  4GNK B;  1NPQ A;  2CT9 A;  2JT0 A;  2JTZ A;  5J3X A;  1VRK A;  2K7O A;  1QV0 A;  1LA0 A;  4ETO A;  1C7V A;  2WC8 A;  3GK2 A;  3OX5 A;  3LCP C;  1SW8 A;  1BG1 A;  3AKA A;  3MSE B;  1UUS A;  2LHL A;  1S1E A;  2Y5I A;  4L9M A;  5AXI A;  4F0Z B;  2QAC A;  1FI5 A;  4PHJ A;  1KWO B;  4HRH A;  2K2A A;  2WOR A;  1Y6W A;  2FCD A;  4I5J A;  1SCM C;  1GGW A;  1SY9 A;  1K2H A;  1S26 D;  3OHM B;  1W7J B;  4XJK B;  1CFD A;  1B47 A;  2M0R A;  2Q91 A;  5B8I B;  1AHR A;  3BUN B;  1SPY A;  5I2Q A;  1KFU S;  2M8U A;  1QX7 A;  1SK6 D;  1YUR A;  4AOM A;  1UWO A;  3PAT A;  3DVK A;  4I5K A;  1DF0 B;  2PMY A;  1NX1 A;  2WCF A;  4DRW A;  1OMR A;  1M39 A;  3PSR A;  4WQ2 A;  2HQW A;  3JTD C;  5HKW A;  1C07 A;  1MF8 B;  4U8D A;  1A75 A;  1YX8 A;  2JU0 A;  4MLW A;  1GGZ A;  2DOQ A;  2JC2 A;  2JNX A;  1S3P A;  2PAS A;  1U5I A;  3PFV A;  1LIN A;  1XO5 A;  1TNQ A;  4YRU A;  4PE7 A;  3BQ3 A;  2G9B A;  5JJG A;  2ZND A;  5K89 A;  2EGD A;  2MHH A;  3IF7 A;  1Y0V H;  1E8A A;  1PUL A;  3IQQ A;  3KO0 A;  2KYF A;  1OSA A;  1TCO B;  1GJY A;  2M9G A;  1DMO A;  2L0P A;  2QPT A;  1QLK A;  4GPL B;  1BOC A;  3JVT C;  5AER A;  3CZT X;  3BUM B;  2Q4U A;  1BJF A;  2WCE A;  1L2O C;  1CDP A;  4PHK A;  4XJK A;  1OE9 B;  1K95 A;  1CM4 A;  3FIA A;  1CTR A;  2JOJ A;  2KGR A;  3JVT B;  2BCA A;  1IRJ A;  4NDC A;  1F8H A;  1WY9 A;  4CLN A;  1M45 A;  1B7T Z;  1RK9 A;  1TNX A;  2L2E A;  1A03 A;  2LAP A;  1EL4 A;  2TN4 A;  5AFP A;  5CSJ A;  2JT3 A;  4YGA A;  1J7P A;  1MUX A;  1B9A A;  3KEV A;  2COL B;  4AQI A;  1G8I A;  1B1G A;  2LLT A;  3RM1 A;  1S5G Z;  1ALW A;  1S6J A;  2F3Z A;  2O60 A;  2VRG A;  4MSP A;  2M1K B;  1KSO A;  3FS7 A;  2CTN A;  5KU1 A;  2LMU A;  4GGF A;  1A75 B;  5DKR A;  1EG4 A;  2Y1N A;  4CPV A;  1YRU B;  1QVI Y;  1OQP A;  2JQ6 A;  4MEW A;  3TDI A;  1R6P A;  2CXJ A;  3GK4 X;  4CID A;  2LUC A;  1DGU A;  2AAO A;  4I5L B;  1CMF A;  3FWB A;  1TOP A;  1KK7 Z;  1SL8 A;  2FCE A;  2I18 A;  1J55 A;  2E30 A;  3HCM A;  3M0W A;  1Q80 A;  1YUS A;  3SG3 A;  1A2X A;  5AEQ A;  1DJY A;  1JF2 A;  3DVM A;  1XFX O;  3EK7 A;  5IBW A;  1K93 D;  2KAY A;  3DF0 B;  3WNX B;  2LHI A;  1NCZ A;  1ALV A;  1J7R A;  4OKH A;  1CLM A;  1K94 A;  5FYX A;  1F54 A;  1B8L A;  1F71 A;  1AUI B;  1J1E A;  3E3R A;  4M2P A;  5GQQ C;  4AQJ A;  3GK1 A;  1AK8 A;  3SG5 A;  1BU3 A;  2BBN A;  1N0Y A;  1A29 A;  2LVJ A;  2LV7 A;  2K2F A;  1JFK A;  1K8U A;  1KQV A;  3LK0 A;  4WQ3 A;  3ICB A;  2L4H A;  1SL7 A;  3EKH A;  1JWD A;  1EG3 A;  2MLF C;  1M63 B;  3I5I C;  2LC5 A;  1CKK A;  3TZ1 A;  2BE4 A;  3NSL A;  4D1E A;  1JSA A;  5G08 A;  3I5H B;  1LVC D;  1QXP A;  1H4B A;  1IH0 A;  2E6W A;  1WLZ A;  1S5G Y;  2NXQ A;  3HX4 A;  4M2Q A;  1ZOT B;  3VRP A;  3DVE A;  2KQY A;  2WND A;  3ZNI A;  1CFF A;  1R2U A;  2H61 C;  2R2I A;  4P2Y B;  5D69 A;  1YUU A;  4GFT A;  1NCY A;  3EKJ A;  2EHB A;  3WHT B;  2MJW B;  1DJG A;  3I5G B;  4OVN F;  4OV2 A;  1DVI A;  3D0Y B;  1RFJ A;  1XFV O;  1XFY O;  1IJ5 A;  1TN4 A;  2SAS A;  3DF0 A;  1YTZ C;  2LVI A;  2Y4Q A;  3CR5 X;  1JFJ A;  2K7C A;  3BOW A;  5CSF A;  3KPX A;  1PAL A;  1PRW A;  1UHJ A;  2I7A A;  5I2O A;  3D10 A;  4YGC B;  3PLF B;  1X02 A;  1OZS A;  3SIA A;  1A4P A;  2ZN8 A;  1TTX A;  2PSR A;  1B7T Y;  1KK8 B;  2F3Y A;  1K9P A;  3CS1 A;  1KFX L;  3LL8 B;  1S36 A;  1B8R A;  1DJI A;  1ODB A;  1WRL A;  2F33 A;  1REC A;  2NCO A;  1MQ1 A;  1CDN A;  1NSH A;  4N5X A;  2KGB C;  1BMO A;  1NX3 A;  1AJ5 A;  1SBJ A;  2M29 A;  1YRT B;  3A8R A;  4ZCV A;  3CWG A;  2BL0 C;  3SIB A;  1XYD A;  3VRR A;  3O78 A;  3KF9 A;  4FTG A;  4DCK A;  4DIR A;  1NP8 A;  2RGI A;  1KK7 Y;  3BUO B;  1BR4 B;  2JXC A;  5HYD A;  1JBA A;  4PHM A;  2MRD A;  3RLZ A;  1NIW A;  4P5O E;  5HLO A;  2ZN9 A;  3PN7 B;  2GGM A;  3H4S E;  4NDD A;  2BCX A;  2IS9 A;  2LCP A;  1S6I A;  1QX2 A;  2Y1M A;  3BOW B;  2NCP A;  3OX6 A;  4C0K A;  1AP4 A;  1IWQ A;  2WCB A;  2O5G A;  3QRX A;  2M7N A;  1F4O A;  1XK4 C;  1H8B A;  2CNP A;  2L5X B;  4PHN A;  1F70 A;  1SR6 C;  2M7L A;  2JT8 A;  1M46 A;  2OTG C;  1CMG A;  1YR5 A;  3KHE A;  4I5N B;  3CLN A;  4MVF A;  2NZ0 A;  2H2K A;  1NYA A;  1YUT A;  2ISD A;  2PAL A;  4QJ5 B;  5HKY A;  4GBA A;  2LE9 B;  3CTN A;  1TIZ A;  3SJS A;  1EXR A;  1SNL A;  4ORC B;  1WLM A;  2PRU A;  1WDC B;  1CLL A;  3EVU A;  4GGN A;  4YI9 A;  1FI6 A;  1W7I B;  2K61 A;  4A4B A;  3NSI A;  1J1D A;  3F45 A;  2EC6 C;  1DJW A;  2P6B B;  1L2O B;  1MWN A;  1CLB A;  3PN7 C;  1K9K A;  2JUL A;  1XA5 A;  2ZNE A;  3LK1 A;  1PVB A;  4UPG A;  3TUY C;  4PCW A;  3I5F C;  4PDZ A;  2LAN A;  4C0L A;  1FW4 A;  2OPO A;  1UUR A;  1KCY A;  1TRF A;  4R1E A;  3O4Y A;  2KBI A;  3O6B A;  4ZCU A;  3EVV A;  3K21 A;  1SKT A;  2KBM A;  3OP0 A;  2AMI A;  2KI4 B;  2CCM A;  1XFW O;  1UHK A;  2M97 A;  5D7F A;  3TS5 C;  2LMT A;  1KFX S;  1MXL C;  1BT6 A;  2GGZ A;  1QS7 A;  1KQM C;  1JUO A;  4CFR A;  3BUX B;  1F55 A;  4NQG A;  4PE4 A;  1KK8 C;  2KSP A;  2MBX A;  2LP2 A;  2M3W A; 
#chains in the Genus database with same CATH topology
 1B4C A;  2MAZ A;  1BF5 A;  3D0Y A;  5F6T A;  2HPS A;  3JTD B;  4A4C A;  1OOG A;  3EVR A;  1CFC A;  1V1G A;  4GUK A;  4TNC A;  1XK4 A;  3EK4 A;  5HL1 A;  3PM8 A;  2LNK A;  1OZO A;  5HLV A;  1SMG A;  3CR2 A;  1NX0 A;  1QLS A;  1G33 A;  3NHT A;  2L4I A;  4HSZ A;  2H8V A;  3BFB A;  2WCJ A;  4MZK A;  1MXE A;  4N1G A;  3DD4 A;  3D77 A;  3BFA A;  1OOJ A;  1UHI A;  1XFZ O;  4BY5 A;  4CFQ A;  5TNC A;  1V1F A;  3AAK A;  4DUQ A;  1RJV A;  1OOI X;  2I94 A;  4BY4 A;  2B1U A;  4WRI A;  2JTT A;  1LA3 A;  2QEO A;  5ER5 A;  2L2C A;  2KOT A;  1L7Z A;  1SL9 A;  4GGF C;  1UHH A;  2I2R E;  1AJ4 A;  1PSR A;  3LLE A;  4N1F A;  3VRO A;  2F2O A;  1FF1 A;  2P71 A;  2ZRS A;  3NSO A;  4MBE A;  2MA2 A;  1BR1 B;  2H61 A;  1XVJ A;  4M2O A;  4YI8 A;  4JPZ B;  3SG2 A;  4E68 A;  2KNE A;  3D78 A;  1CDL A;  1ZMZ A;  1NUB A;  2V53 A;  5I8N A;  1LXF C;  2WOS A;  1F4Q A;  3O2P A;  5I94 A;  4ORB B;  1IGV A;  2FOT A;  1QX5 B;  2HET A;  2JZI A;  2P70 A;  4FQO A;  4YBH B;  5DKN A;  1IKU A;  1SRA A;  2KDH A;  2LLU A;  5I2L A;  1AVS A;  5AAN A;  2CBL A;  2F8P A;  1KQM B;  1MR8 A;  3OGN A;  1FBV A;  1Y1A A;  4OR9 B;  1KWO C;  4USL A;  1OMV A;  3GOF A;  4MN0 A;  1DGV A;  1JC2 A;  3OB1 B;  3S0E A;  4YGB B;  1M31 A;  2SCP A;  3S0A A;  2KFG A;  2NLN A;  3NXA A;  3B86 A;  2ZRT A;  3I5F B;  3O4X A;  4MZL A;  5ER4 X;  3UNW A;  4OCI A;  3ZWH A;  1XFU O;  2BKI B;  1D1O A;  1BLQ A;  1NWD A;  4XYN A;  5JOL A;  3BYA A;  2EC6 B;  2JXL A;  2ZFD A;  1SCV A;  3AAJ A;  2LMV A;  4MRY A;  2BNX A;  5CSN A;  2L5Y A;  4YGE B;  2OS8 B;  3SG7 A;  1TNP A;  3SG4 A;  1GM0 A;  3I5I B;  2KYC A;  2M1U A;  1PVA A;  1QIW A;  1B8C A;  1Y1X A;  3BUW B;  3C1V A;  1DF0 A;  3PAL A;  3VRQ A;  1FPW A;  1TWO A;  2FJU B;  5CSI A;  1WDC C;  1PK0 D;  2JWW A;  1GQM A;  3R72 A;  4DS7 A;  2KI6 D;  1BOD A;  1QV1 A;  1DT7 B;  1NCX A;  2BE6 A;  2A4J A;  2JNF A;  2G2B A;  2KI4 C;  1CDM A;  4GAO A;  4MZJ A;  1KFU L;  2K0J A;  2L98 A;  1SYM A;  1NX2 A;  4JWQ A;  5CPV A;  1CFP A;  1OOH A;  1TNW A;  1SR6 B;  3DVJ A;  1T14 A;  1U5I B;  1QWV A;  3WHU B;  3R1P A;  2M49 B;  5KSZ A;  2ZKM X;  4HRE E;  1IQ5 A;  1XFR A;  2GTE A;  2KI6 C;  2L50 A;  3I5H C;  1DC1 A;  3CGA A;  3VRN A;  1C3Z A;  4ICB A;  1S6C A;  3A4U B;  3OB2 B;  4PE0 A;  3VB1 A;  3IVT A;  5BPJ A;  2KFH A;  2KQ6 A;  3FWC A;  2AUC A;  2LLS A;  2PYQ A;  1RRO A;  3WXA A;  1DJH A;  2FJY A;  1IQ3 A;  3B7A A;  4JD9 A;  4Q04 A;  5KTY A;  1QTX A;  2LP3 A;  4QJ3 B;  1C3Y A;  1MHO A;  1QJT A;  2GV5 A;  1PSB A;  1HQV A;  2JPT A;  3VGO A;  2BCB A;  1DJX A;  4PE1 A;  3TS5 B;  1DJZ A;  3BJH A;  1QIV A;  1K96 A;  2KAX A;  4JQ0 D;  4C0J A;  2HF5 A;  1QVI Z;  1ZFS A;  1QAT A;  3DZT A;  1J7Q A;  2BL0 B;  3DY9 A;  1ZUZ A;  2KAV A;  4ORA B;  3SG6 A;  2BKH B;  3B6X A;  2BEC A;  2KFF A;  2L51 A;  1SCM B;  2PVB A;  2BBM A;  1Y1U A;  2LVK A;  4PT1 A;  2K7B A;  3EK8 A;  1KSM A;  1N65 A;  4NDB A;  4IL1 A;  2LUX A;  1C7W A;  3TUY B;  1YX7 A;  2OS8 C;  2KHN A;  1EJ3 A;  4PAL A;  1RTP 1;  1HT9 A;  1IG5 A;  1DTL A;  3AKB A;  3TDU A;  2HQ8 A;  1YVL A;  1K90 D;  1J7O A;  1RWY A;  2K8M B;  2YGU A;  3TDZ A;  2MLE C;  1CM1 A;  2D8N A;  1JF0 A;  1UP5 A;  1QAS A;  1WRZ A;  3CR4 X;  1TCF A;  1G4Y R;  2F2P A;  1CB1 A;  5HKZ A;  3BXK A;  1K9U A;  1OMD A;  2K7D A;  2LVV A;  2JRF A;  2LM5 A;  1YVH A;  2OTG B;  1CNP A;  5DKQ A;  1EH2 A;  1LKJ A;  4YGD B;  4HRG A;  1TUZ A;  1IJ6 A;  2ERB A;  4MRX A;  5PAL A;  1WRK A;  1N2D A;  3IQO A;  1UHN A;  1ZAC A;  3NSK A;  3I5G C;  4GNK B;  3CDN A;  1NPQ A;  3CYZ A;  2CT9 A;  2JT0 A;  2JTZ A;  5J3X A;  1VRK A;  2K7O A;  1QV0 A;  1LA0 A;  4ETO A;  1C7V A;  2WC8 A;  3GK2 A;  2KLE A;  2KLD A;  3OX5 A;  3LCP C;  1SW8 A;  1BG1 A;  2WCL A;  3K1E A;  3AKA A;  3MSE B;  1UUS A;  4INW A;  2LHL A;  1OOF A;  1S1E A;  2Y5I A;  4L9M A;  5AXI A;  4F0Z B;  2QAC A;  1FI5 A;  1LS8 A;  4PHJ A;  1KWO B;  4HRH A;  2K2A A;  2WOR A;  1Y6W A;  2FCD A;  4I5J A;  1SCM C;  3CZ1 A;  1GGW A;  1SY9 A;  1K2H A;  1S26 D;  3OHM B;  1W7J B;  4XJK B;  1CFD A;  1B47 A;  2M0R A;  2Q91 A;  5B8I B;  1AHR A;  3BUN B;  1SPY A;  5I2Q A;  1KFU S;  2M8U A;  1QX7 A;  3SS3 A;  1SK6 D;  1YUR A;  4AOM A;  1UWO A;  3PAT A;  2WCH A;  3DVK A;  3FE6 A;  1DF0 B;  4I5K A;  2PMY A;  1NX1 A;  2WCF A;  5FI2 A;  4DRW A;  1OMR A;  1M39 A;  3PSR A;  3CZ2 A;  3Q8I A;  4WQ2 A;  2HQW A;  3JTD C;  5HKW A;  1C07 A;  1MF8 B;  4U8D A;  1A75 A;  1YX8 A;  2JU0 A;  4MLW A;  3SS4 A;  1GGZ A;  2DOQ A;  2JC2 A;  2JNX A;  1P28 A;  1S3P A;  2PAS A;  1U5I A;  3PFV A;  1LIN A;  1XO5 A;  1TNQ A;  4YRU A;  4PE7 A;  3BQ3 A;  2G9B A;  5JJG A;  2ZND A;  3B87 A;  5K89 A;  2EGD A;  2MHH A;  3IF7 A;  1Y0V H;  1E8A A;  1PUL A;  3IQQ A;  3KO0 A;  2KYF A;  1OSA A;  1TCO B;  4KYN A;  1GJY A;  2M9G A;  1DMO A;  2L0P A;  2QPT A;  1QLK A;  4GPL B;  1DQE A;  1BOC A;  3JVT C;  5AER A;  3CZT X;  3BUM B;  3B88 A;  2Q4U A;  1BJF A;  2WCE A;  3L47 A;  1L2O C;  2QEB A;  1CDP A;  4PHK A;  4XJK A;  1OE9 B;  1K95 A;  1CM4 A;  2KPH A;  3FIA A;  1CTR A;  3S0G A;  2JOJ A;  2KGR A;  3DYE A;  2BCA A;  1IRJ A;  3JVT B;  4NDC A;  1WY9 A;  4CLN A;  1M45 A;  1F8H A;  1B7T Z;  1RK9 A;  1TNX A;  2L2E A;  1A03 A;  2LAP A;  1EL4 A;  2TN4 A;  5AFP A;  5CSJ A;  2JT3 A;  2PQL A;  4YGA A;  3L4A A;  1MUX A;  1J7P A;  1B9A A;  1W9Z A;  3KEV A;  2COL B;  4AQI A;  1G8I A;  1B1G A;  2LLT A;  3RM1 A;  3CAB A;  3D73 A;  1S5G Z;  1ALW A;  1S6J A;  2F3Z A;  2O60 A;  2VRG A;  4MSP A;  2M1K B;  1KSO A;  3FS7 A;  2CTN A;  5KU1 A;  2LMU A;  4GGF A;  1A75 B;  5DKR A;  1EG4 A;  2Y1N A;  4CPV A;  1YRU B;  1QVI Y;  1OQP A;  2JQ6 A;  4MEW A;  3TDI A;  3FE8 A;  1R6P A;  2CXJ A;  3GK4 X;  2WC5 A;  3L4L A;  4CID A;  2LUC A;  1DGU A;  2AAO A;  4I5L B;  1CMF A;  3FWB A;  1TOP A;  1KK7 Z;  1SL8 A;  2FCE A;  2I18 A;  1J55 A;  2E30 A;  3HCM A;  3M0W A;  1Q80 A;  3OBV A;  1YUS A;  3SG3 A;  1A2X A;  5AEQ A;  1DJY A;  1JF2 A;  3DXL A;  3DVM A;  1XFX O;  3EK7 A;  1SSE B;  5IBW A;  1K93 D;  2KAY A;  3DF0 B;  3WNX B;  2LHI A;  1NCZ A;  1ALV A;  3NHI A;  1J7R A;  4OKH A;  1CLM A;  1K94 A;  5FYX A;  1F54 A;  1B8L A;  1F71 A;  1AUI B;  3D75 A;  1J1E A;  3E3R A;  4M2P A;  5GQQ C;  4AQJ A;  3GK1 A;  5FI6 A;  3SG5 A;  1AK8 A;  1BU3 A;  2BBN A;  5DIC A;  1N0Y A;  3PM2 A;  1A29 A;  2LVJ A;  2WCM A;  3FE9 A;  2LV7 A;  2K2F A;  1JFK A;  1K8U A;  1KQV A;  3LK0 A;  4WQ3 A;  3ICB A;  2L4H A;  3D74 A;  1SL7 A;  3EKH A;  1JWD A;  4QJ4 B;  1EG3 A;  2MLF C;  1M63 B;  3I5I C;  2QDI A;  2LC5 A;  5D3O A;  4F7F A;  1CKK A;  3TZ1 A;  2BE4 A;  3NSL A;  3S0F A;  4D1E A;  3S0B A;  1JSA A;  5G08 A;  3I5H B;  1LVC D;  3S0D A;  1QXP A;  1H4B A;  1IH0 A;  2E6W A;  1Z2C B;  1WLZ A;  1S5G Y;  2NXQ A;  3HX4 A;  4M2Q A;  1ZOT B;  3VRP A;  3DVE A;  2KQY A;  2WND A;  3ZNI A;  1CFF A;  1R2U A;  2H61 C;  2R2I A;  4P2Y B;  5D69 A;  1YUU A;  4GFT A;  1NCY A;  3EKJ A;  2EHB A;  3WHT B;  2MJW B;  1DJG A;  3I5G B;  4OVN F;  4OV2 A;  1DVI A;  3D0Y B;  1RFJ A;  1XFV O;  1XFY O;  1IJ5 A;  1TN4 A;  2SAS A;  3DF0 A;  1YTZ C;  2LVI A;  2Y4Q A;  3CR5 X;  1JFJ A;  2K7C A;  3BOW A;  5CSF A;  3KPX A;  1PAL A;  1PRW A;  1UHJ A;  2I7A A;  5I2O A;  3D10 A;  4YGC B;  3PLF B;  4INX A;  1X02 A;  1OW4 A;  1OZS A;  3SIA A;  3CZ0 A;  3PJI A;  1A4P A;  2ZN8 A;  1TTX A;  2PSR A;  1B7T Y;  1KK8 B;  1TUJ A;  1K9P A;  2F3Y A;  1KFX L;  3CS1 A;  4JKT A;  3D76 A;  1S36 A;  3LL8 B;  1B8R A;  1DJI A;  1ODB A;  1WRL A;  2F33 A;  1REC A;  2NCO A;  1MQ1 A;  5FI7 A;  1CDN A;  2WCK A;  1NSH A;  4N5X A;  2KGB C;  1BMO A;  1NX3 A;  1AJ5 A;  1SBJ A;  2M29 A;  1YRT B;  3A8R A;  4ZCV A;  3CWG A;  2BL0 C;  3SIB A;  1XYD A;  3VRR A;  3O78 A;  3KF9 A;  4FTG A;  4OZD A;  4DCK A;  4DIR A;  1NP8 A;  2RGI A;  1KK7 Y;  3BUO B;  1BR4 B;  1ORG A;  2JXC A;  5HYD A;  1JBA A;  4PHM A;  2QEV A;  2MRD A;  3RLZ A;  1NIW A;  1Z4H A;  4P5O E;  5HLO A;  1DEK A;  1DEL A;  2ZN9 A;  3PN7 B;  2GGM A;  3H4S E;  3N7H A;  4NDD A;  2BCX A;  2IS9 A;  2LCP A;  1S6I A;  1QX2 A;  2Y1M A;  3BOW B;  2NCP A;  3OX6 A;  3R1V A;  5EL2 A;  4C0K A;  1AP4 A;  1IWQ A;  2WCB A;  2O5G A;  3QRX A;  2M7N A;  3SS5 A;  1F4O A;  3BFH A;  2WC6 A;  1XK4 C;  1H8B A;  2CNP A;  3NGV A;  2L5X B;  4PHN A;  1F70 A;  1SR6 C;  2M7L A;  2JT8 A;  1M46 A;  2OTG C;  2BAP A;  1CMG A;  1YR5 A;  3KHE A;  4I5N B;  3CLN A;  4MVF A;  2NZ0 A;  2H2K A;  1NYA A;  1YUT A;  2ISD A;  2PAL A;  4IJ7 A;  3QME A;  4QJ5 B;  5HKY A;  4GBA A;  2LE9 B;  3CTN A;  1TIZ A;  3EG5 B;  1EXR A;  1SNL A;  2JPO A;  4ORC B;  1WLM A;  2PRU A;  1WDC B;  1CLL A;  3EVU A;  4GGN A;  4YI9 A;  1FI6 A;  1W7I B;  1IIO A;  2K61 A;  4A4B A;  3NSI A;  1J1D A;  3F45 A;  2EC6 C;  1DJW A;  2P6B B;  1L2O B;  1MWN A;  4FQT A;  3R1O A;  3SJS A;  1CLB A;  3PN7 C;  1K9K A;  2JUL A;  1XA5 A;  2ZNE A;  3LK1 A;  1PVB A;  4UPG A;  3TUY C;  4PCW A;  3I5F C;  4PDZ A;  2LAN A;  4C0L A;  1FW4 A;  2OPO A;  1UUR A;  1KCY A;  1TRF A;  4R1E A;  3O4Y A;  2KBI A;  3O6B A;  4ZCU A;  3EVV A;  3K21 A;  1SKT A;  3RZS A;  2KBM A;  3OP0 A;  2AMI A;  2KI4 B;  2CCM A;  1XFW O;  1UHK A;  2M97 A;  5D7F A;  3TS5 C;  2LMT A;  1KFX S;  3UO9 A;  1MXL C;  1BT6 A;  2GGZ A;  2K60 A;  1QS7 A;  2QEH A;  1KQM C;  1JUO A;  4CFR A;  3BUX B;  1F55 A;  4NQG A;  4PE4 A;  1KK8 C;  2KSP A;  2MBX A;  2LP2 A;  2M3W A;  3V2L A; 
#chains in the Genus database with same CATH homology
 1B4C A;  2MAZ A;  1BF5 A;  3D0Y A;  5F6T A;  2HPS A;  3JTD B;  4A4C A;  3EVR A;  1CFC A;  1V1G A;  4GUK A;  4TNC A;  1XK4 A;  3EK4 A;  3PM8 A;  2LNK A;  1OZO A;  5HLV A;  1SMG A;  3CR2 A;  1NX0 A;  1QLS A;  1G33 A;  2L4I A;  4HSZ A;  4MZK A;  1MXE A;  4N1G A;  3DD4 A;  1OOJ A;  1UHI A;  1XFZ O;  4BY5 A;  4CFQ A;  5TNC A;  1V1F A;  3AAK A;  4DUQ A;  1RJV A;  2I94 A;  4BY4 A;  2B1U A;  4WRI A;  2JTT A;  1LA3 A;  5ER5 A;  2KOT A;  1L7Z A;  1SL9 A;  4GGF C;  1UHH A;  2I2R E;  1AJ4 A;  1PSR A;  3LLE A;  4N1F A;  3VRO A;  2F2O A;  1FF1 A;  2ZRS A;  3NSO A;  4MBE A;  2MA2 A;  1BR1 B;  2H61 A;  1XVJ A;  4M2O A;  4YI8 A;  4JPZ B;  3SG2 A;  4E68 A;  2KNE A;  1CDL A;  1ZMZ A;  1NUB A;  2V53 A;  5I8N A;  1LXF C;  2WOS A;  1F4Q A;  3O2P A;  4ORB B;  1IGV A;  2FOT A;  1QX5 B;  2HET A;  2JZI A;  5DKN A;  4FQO A;  4YBH B;  1IKU A;  1SRA A;  2KDH A;  2LLU A;  5I2L A;  1AVS A;  5AAN A;  2CBL A;  2F8P A;  1KQM B;  1MR8 A;  1FBV A;  1Y1A A;  4OR9 B;  1KWO C;  4USL A;  1OMV A;  3GOF A;  4MN0 A;  1DGV A;  1JC2 A;  3OB1 B;  4YGB B;  1M31 A;  2SCP A;  2KFG A;  2NLN A;  3NXA A;  2ZRT A;  3I5F B;  5ER4 X;  4MZL A;  4OCI A;  3ZWH A;  1XFU O;  2BKI B;  1D1O A;  1BLQ A;  1NWD A;  4XYN A;  5JOL A;  3BYA A;  2EC6 B;  2JXL A;  2ZFD A;  1SCV A;  3AAJ A;  2LMV A;  4MRY A;  5CSN A;  4YGE B;  2OS8 B;  3SG7 A;  1TNP A;  3SG4 A;  3I5I B;  2KYC A;  2M1U A;  1PVA A;  1QIW A;  1B8C A;  1Y1X A;  3BUW B;  3C1V A;  1DF0 A;  3PAL A;  3VRQ A;  1FPW A;  2FJU B;  5CSI A;  1WDC C;  1PK0 D;  2JWW A;  1GQM A;  4DS7 A;  2KI6 D;  1BOD A;  1QV1 A;  1DT7 B;  1NCX A;  2BE6 A;  2A4J A;  2JNF A;  2G2B A;  2KI4 C;  1CDM A;  4GAO A;  4MZJ A;  1KFU L;  2K0J A;  2L98 A;  1SYM A;  1NX2 A;  4JWQ A;  5CPV A;  1CFP A;  1TNW A;  1SR6 B;  3DVJ A;  1U5I B;  3WHU B;  2M49 B;  5KSZ A;  2ZKM X;  4HRE E;  1IQ5 A;  2KI6 C;  2L50 A;  3I5H C;  3CGA A;  3VRN A;  4ICB A;  1S6C A;  3A4U B;  3OB2 B;  4PE0 A;  5BPJ A;  2KFH A;  2KQ6 A;  3FWC A;  2AUC A;  2LLS A;  1RRO A;  3WXA A;  1DJH A;  1IQ3 A;  4Q04 A;  5KTY A;  1QTX A;  2LP3 A;  4QJ3 B;  1MHO A;  1QJT A;  2GV5 A;  1PSB A;  1HQV A;  2JPT A;  3VGO A;  2BCB A;  1DJX A;  4PE1 A;  3TS5 B;  1DJZ A;  4QJ4 B;  1QIV A;  1K96 A;  2KAX A;  4JQ0 D;  4C0J A;  2HF5 A;  1QVI Z;  1ZFS A;  1QAT A;  1J7Q A;  2BL0 B;  1ZUZ A;  2KAV A;  4ORA B;  3SG6 A;  2BKH B;  2BEC A;  2KFF A;  2L51 A;  1SCM B;  2PVB A;  2BBM A;  1Y1U A;  2LVK A;  2K7B A;  3EK8 A;  1KSM A;  1N65 A;  4NDB A;  4IL1 A;  2LUX A;  1C7W A;  3TUY B;  1YX7 A;  2OS8 C;  2KHN A;  1EJ3 A;  4PAL A;  1RTP 1;  1HT9 A;  1IG5 A;  1DTL A;  3AKB A;  3TDU A;  2HQ8 A;  1YVL A;  1K90 D;  1J7O A;  1RWY A;  2K8M B;  3TDZ A;  2MLE C;  1CM1 A;  2D8N A;  1JF0 A;  1UP5 A;  1QAS A;  1WRZ A;  3CR4 X;  1TCF A;  1G4Y R;  2F2P A;  1CB1 A;  5HKZ A;  3BXK A;  1K9U A;  1OMD A;  2K7D A;  2LVV A;  2JRF A;  2LM5 A;  1YVH A;  2OTG B;  1CNP A;  5DKQ A;  1EH2 A;  1LKJ A;  4YGD B;  4HRG A;  1IJ6 A;  4MRX A;  5PAL A;  1WRK A;  1N2D A;  3IQO A;  1UHN A;  1ZAC A;  3NSK A;  3I5G C;  4GNK B;  1NPQ A;  2CT9 A;  2JT0 A;  2JTZ A;  5J3X A;  1VRK A;  2K7O A;  1QV0 A;  1LA0 A;  4ETO A;  1C7V A;  2WC8 A;  3GK2 A;  3OX5 A;  3LCP C;  1SW8 A;  1BG1 A;  3AKA A;  3MSE B;  1UUS A;  2LHL A;  1S1E A;  2Y5I A;  4L9M A;  5AXI A;  4F0Z B;  2QAC A;  1FI5 A;  4PHJ A;  1KWO B;  4HRH A;  2K2A A;  2WOR A;  1Y6W A;  2FCD A;  4I5J A;  1SCM C;  1GGW A;  1SY9 A;  1K2H A;  1S26 D;  3OHM B;  1W7J B;  4XJK B;  1CFD A;  1B47 A;  2M0R A;  2Q91 A;  5B8I B;  1AHR A;  3BUN B;  1SPY A;  5I2Q A;  1KFU S;  2M8U A;  1QX7 A;  1SK6 D;  1YUR A;  4AOM A;  1UWO A;  3PAT A;  3DVK A;  4I5K A;  1DF0 B;  2PMY A;  1NX1 A;  2WCF A;  4DRW A;  1OMR A;  1M39 A;  3PSR A;  4WQ2 A;  2HQW A;  3JTD C;  5HKW A;  1C07 A;  1MF8 B;  4U8D A;  1A75 A;  1YX8 A;  2JU0 A;  4MLW A;  1GGZ A;  2DOQ A;  2JC2 A;  2JNX A;  1S3P A;  2PAS A;  1U5I A;  3PFV A;  1LIN A;  1XO5 A;  1TNQ A;  4YRU A;  4PE7 A;  3BQ3 A;  2G9B A;  5JJG A;  2ZND A;  5K89 A;  2EGD A;  2MHH A;  3IF7 A;  1Y0V H;  1E8A A;  1PUL A;  3IQQ A;  3KO0 A;  2KYF A;  1OSA A;  1TCO B;  1GJY A;  2M9G A;  1DMO A;  2L0P A;  2QPT A;  1QLK A;  4GPL B;  1BOC A;  3JVT C;  5AER A;  3CZT X;  3BUM B;  2Q4U A;  1BJF A;  2WCE A;  1L2O C;  1CDP A;  4PHK A;  4XJK A;  1OE9 B;  1K95 A;  1CM4 A;  3FIA A;  1CTR A;  2JOJ A;  2KGR A;  3JVT B;  2BCA A;  1IRJ A;  4NDC A;  1F8H A;  1WY9 A;  4CLN A;  1M45 A;  1B7T Z;  1RK9 A;  1TNX A;  2L2E A;  1A03 A;  2LAP A;  1EL4 A;  2TN4 A;  5AFP A;  5CSJ A;  2JT3 A;  4YGA A;  1J7P A;  1MUX A;  1B9A A;  3KEV A;  2COL B;  4AQI A;  1G8I A;  1B1G A;  2LLT A;  3RM1 A;  1S5G Z;  1ALW A;  1S6J A;  2F3Z A;  2O60 A;  2VRG A;  4MSP A;  2M1K B;  1KSO A;  3FS7 A;  2CTN A;  5KU1 A;  2LMU A;  4GGF A;  1A75 B;  5DKR A;  1EG4 A;  2Y1N A;  4CPV A;  1YRU B;  1QVI Y;  1OQP A;  2JQ6 A;  4MEW A;  3TDI A;  1R6P A;  2CXJ A;  3GK4 X;  4CID A;  2LUC A;  1DGU A;  2AAO A;  4I5L B;  1CMF A;  3FWB A;  1TOP A;  1KK7 Z;  1SL8 A;  2FCE A;  2I18 A;  1J55 A;  2E30 A;  3HCM A;  3M0W A;  1Q80 A;  1YUS A;  3SG3 A;  1A2X A;  5AEQ A;  1DJY A;  1JF2 A;  3DVM A;  1XFX O;  3EK7 A;  5IBW A;  1K93 D;  2KAY A;  3DF0 B;  3WNX B;  2LHI A;  1NCZ A;  1ALV A;  1J7R A;  4OKH A;  1CLM A;  1K94 A;  5FYX A;  1F54 A;  1B8L A;  1F71 A;  1AUI B;  1J1E A;  3E3R A;  4M2P A;  5GQQ C;  4AQJ A;  3GK1 A;  1AK8 A;  3SG5 A;  1BU3 A;  2BBN A;  1N0Y A;  1A29 A;  2LVJ A;  2LV7 A;  2K2F A;  1JFK A;  1K8U A;  1KQV A;  3LK0 A;  4WQ3 A;  3ICB A;  2L4H A;  1SL7 A;  3EKH A;  1JWD A;  1EG3 A;  2MLF C;  1M63 B;  3I5I C;  2LC5 A;  1CKK A;  3TZ1 A;  2BE4 A;  3NSL A;  4D1E A;  1JSA A;  5G08 A;  3I5H B;  1LVC D;  1QXP A;  1H4B A;  1IH0 A;  2E6W A;  1WLZ A;  1S5G Y;  2NXQ A;  3HX4 A;  4M2Q A;  1ZOT B;  3VRP A;  3DVE A;  2KQY A;  2WND A;  3ZNI A;  1CFF A;  1R2U A;  2H61 C;  2R2I A;  4P2Y B;  5D69 A;  1YUU A;  4GFT A;  1NCY A;  3EKJ A;  2EHB A;  3WHT B;  2MJW B;  1DJG A;  3I5G B;  4OVN F;  4OV2 A;  1DVI A;  3D0Y B;  1RFJ A;  1XFV O;  1XFY O;  1IJ5 A;  1TN4 A;  2SAS A;  3DF0 A;  1YTZ C;  2LVI A;  2Y4Q A;  3CR5 X;  1JFJ A;  2K7C A;  3BOW A;  5CSF A;  3KPX A;  1PAL A;  1PRW A;  1UHJ A;  2I7A A;  5I2O A;  3D10 A;  4YGC B;  3PLF B;  1X02 A;  1OZS A;  3SIA A;  1A4P A;  2ZN8 A;  1TTX A;  2PSR A;  1B7T Y;  1KK8 B;  2F3Y A;  1K9P A;  3CS1 A;  1KFX L;  3LL8 B;  1S36 A;  1B8R A;  1DJI A;  1ODB A;  1WRL A;  2F33 A;  1REC A;  2NCO A;  1MQ1 A;  1CDN A;  1NSH A;  4N5X A;  2KGB C;  1BMO A;  1NX3 A;  1AJ5 A;  1SBJ A;  2M29 A;  1YRT B;  3A8R A;  4ZCV A;  3CWG A;  2BL0 C;  3SIB A;  1XYD A;  3VRR A;  3O78 A;  3KF9 A;  4FTG A;  4DCK A;  4DIR A;  1NP8 A;  2RGI A;  1KK7 Y;  3BUO B;  1BR4 B;  2JXC A;  5HYD A;  1JBA A;  4PHM A;  2MRD A;  3RLZ A;  1NIW A;  4P5O E;  5HLO A;  2ZN9 A;  3PN7 B;  2GGM A;  3H4S E;  4NDD A;  2BCX A;  2IS9 A;  2LCP A;  1S6I A;  1QX2 A;  2Y1M A;  3BOW B;  2NCP A;  3OX6 A;  4C0K A;  1AP4 A;  1IWQ A;  2WCB A;  2O5G A;  3QRX A;  2M7N A;  1F4O A;  1XK4 C;  1H8B A;  2CNP A;  2L5X B;  4PHN A;  1F70 A;  1SR6 C;  2M7L A;  2JT8 A;  1M46 A;  2OTG C;  1CMG A;  1YR5 A;  3KHE A;  4I5N B;  3CLN A;  4MVF A;  2NZ0 A;  2H2K A;  1NYA A;  1YUT A;  2ISD A;  2PAL A;  4QJ5 B;  5HKY A;  4GBA A;  2LE9 B;  3CTN A;  1TIZ A;  3SJS A;  1EXR A;  1SNL A;  4ORC B;  1WLM A;  2PRU A;  1WDC B;  1CLL A;  3EVU A;  4GGN A;  4YI9 A;  1FI6 A;  1W7I B;  2K61 A;  4A4B A;  3NSI A;  1J1D A;  3F45 A;  2EC6 C;  1DJW A;  2P6B B;  1L2O B;  1MWN A;  1CLB A;  3PN7 C;  1K9K A;  2JUL A;  1XA5 A;  2ZNE A;  3LK1 A;  1PVB A;  4UPG A;  3TUY C;  4PCW A;  3I5F C;  4PDZ A;  2LAN A;  4C0L A;  1FW4 A;  2OPO A;  1UUR A;  1KCY A;  1TRF A;  4R1E A;  3O4Y A;  2KBI A;  3O6B A;  4ZCU A;  3EVV A;  3K21 A;  1SKT A;  2KBM A;  3OP0 A;  2AMI A;  2KI4 B;  2CCM A;  1XFW O;  1UHK A;  2M97 A;  5D7F A;  3TS5 C;  2LMT A;  1KFX S;  1MXL C;  1BT6 A;  2GGZ A;  1QS7 A;  1KQM C;  1JUO A;  4CFR A;  3BUX B;  1F55 A;  4NQG A;  4PE4 A;  1KK8 C;  2KSP A;  2MBX A;  2LP2 A;  2M3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...