2ZRTA

Crystal structure of zn2+-bound form of des3-23alg-2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
165
structure length
165
Chain Sequence
b'QSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 6
publication title Crystallization and X-ray diffraction analysis of N-terminally truncated human ALG-2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 22
structure length 165
sequence length 165
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2zrtA00
4DUQA 2MA2A 2WNDA 2Q91A 5TNCA 3TDIA 1YR5A 5I2QA 4I5KA 1DJWA 5CSFA 4YGAA 1UHNA 2O60A 4PHMA 1SCMC 3EK7A 1K90D 1CTRA 1PSBA 2K2AA 2LLTA 2M8UA 3PATA 1JSAA 1G33A 4YRUA 1SW8A 4FQOA 1UHJA 4CPVA 1RTP1 4I5LB 1IRJA 4MVFA 1DJIA 2I94A 2MJWB 3KEVA 1CMFA 2KI4B 1TCFA 1J55A 1WRZA 3BYAA 3JVTB 1YRTB 3O6BA 5I2OA 3TUYB 1ZUZA 2L2EA 2LMVA 2LNKA 4WRIA 2KI6C 1DVIA 2R2IA 1PULA 2JULA 1MXEA 2L50A 2F2OA 3PN7B 4GPLB 2HQ8A 5GQQC 4P5OE 1N2DA 5AXIA 1CFDA 1RROA 1B47A 4M2QA 4YGBB 1MHOA 1GQMA 1LA0A 5FYXA 1TNWA 3CS1A 1U5IA 1OOJA 3WHUB 2PMYA 3CTNA 1L2OC 1QATA 2AUCA 2LP3A 2LM5A 1XK4C 2H2KA 4UPGA 1GGZA 2FCEA 2LVJA 3EVRA 3I5FB 4XYNA 3VRQA 2BCBA 1JBAA 1A2XA 3E3RA 3O2PA 1F54A 1DGUA 3GOFA 4E68A 1LXFC 2KYFA 3CGAA 4ZCUA 4N1GA 1K9UA 1AP4A 1CM1A 2KFHA 1UHHA 1C7WA 2HETA 4GBAA 1NCZA 1QIVA 1SL9A 1B8LA 1BG1A 2AAOA 4MZLA 1XFWO 2L98A 3FWBA 3SG3A 2F3YA 3VRRA 3MSEB 1BF5A 3SG4A 2KAXA 2G9BA 1KFUL 2L5XB 3HX4A 1NX2A 3PFVA 2LHIA 1RECA 2OPOA 2MHHA 2OS8C 2FJUB 1SK6D 1QX7A 1YRUB 2EC6B 2JPTA 2LUCA 2JQ6A 1IG5A 3EKJA 3FS7A 1S36A 3CR4X 3D0YB 2LCPA 1AJ4A 1ODBA 1NP8A 2K8MB 2KI6D 2KBMA 1C7VA 1AJ5A 4PCWA 3GK2A 1K93D 2OTGB 2KAVA 3LK0A 1PALA 4HRGA 3TDUA 1XFYO 1MWNA 1F4QA 2LUXA 4P2YB 3FWCA 1BOCA 3C1VA 1JFKA 1SYMA 1NCXA 3SG2A 2BCXA 2O5GA 3H4SE 1Y0VH 1XO5A 1TRFA 2M7NA 1M39A 1UURA 1K96A 1DJXA 1IH0A 2NCPA 2NLNA 1E8AA 3JTDB 1TOPA 3KPXA 2JTZA 1KFUS 1QXPA 5DKRA 3IQOA 2MBXA 1RJVA 5BPJA 1UUSA 2BL0C 1BR4B 3TDZA 4A4BA 1CKKA 2KYCA 3A4UB 3NXAA 1FI6A 1TNPA 4I5JA 1F71A 1HT9A 5G08A 2CBLA 3RLZA 2ISDA 3I5HB 5DKQA 1OE9B 1R6PA 1JF2A 4WQ3A 2HPSA 4DCKA 2I2RE 3DVJA 1KK8C 3BUOB 1CM4A 4C0JA 4YI8A 1EG3A 1AHRA 3WNXB 1RFJA 4QJ5B 1NX3A 2KDHA 4GGFA 4C0LA 1MR8A 1C07A 1OZSA 1TN4A 1B7TY 2Y1NA 3VGOA 5AERA 3I5GC 1FBVA 2ZRSA 1F55A 3BOWB 1A03A 1CMGA 1WLZA 3GK1A 4N5XA 4I5NB 5I2LA 3TS5B 5J3XA 2IS9A 2ZN8A 1TTXA 1B9AA 1YX8A 1NIWA 1H4BA 4JPZB 1X02A 5CSNA 2Y1MA 2RGIA 2SASA 2WCBA 4DRWA 2KQ6A 4PALA 4GAOA 2BBNA 1WDCB 1TNQA 2B1UA 4N1FA 5HLVA 4D1EA 2I18A 1Y1UA 3BQ3A 2V53A 1DJYA 1QASA 2EGDA 1BJFA 1SRAA 1B8CA 2K7DA 3BUMB 3PSRA 3SG5A 3TZ1A 2WOSA 1B4CA 2K61A 4PHJA 1KWOB 1S6IA 2Q4UA 4HRHA 2JZIA 3F45A 1Y1AA 2I7AA 1J7QA 3NSLA 2M3WA 2LHLA 3OX5A 1EH2A 1IJ6A 1DMOA 4HSZA 4ORAB 1S6CA 1J7PA 2KFGA 3VROA 4GGFC 3EVVA 1ALVA 2PVBA 2M49B 4BY4A 2KGRA 1RWYA 1NPQA 2GGMA 3DD4A 4GFTA 2K2FA 2NCOA 1CFPA 4M2OA 2K7OA 1Q80A 2QACA 2L4HA 3I5IB 4XJKB 2Y5IA 2LE9B 5HKWA 3DF0B 1GJYA 1A75B 1OMDA 5HKYA 1L7ZA 2JC2A 1F70A 1XFVO 1SR6C 1NYAA 2LVKA 1BODA 1KSOA 1CNPA 4PHKA 2JXCA 1KSMA 4A4CA 3O4YA 3GK4X 2E30A 3KO0A 5ER5A 1QVIY 1Y1XA 5CSJA 4JWQA 1QV1A 5IBWA 5ER4X 3A8RA 2KQYA 1TIZA 4DS7A 4BY5A 5K89A 1NSHA 1SCMB 3AKBA 3O78A 2CCMA 1CLBA 3OHMB 3SG6A 1W7IB 3OB1B 2JRFA 2BE6A 4GNKB 5AANA 1CFFA 1S3PA 1KQVA 2G2BA 1PVAA 2KSPA 1QLSA 3BUXB 2KOTA 2E6WA 3CWGA 4NQGA 4OKHA 2PASA 1N0YA 2AMIA 4OV2A 5KSZA 1LKJA 1DT7B 2CNPA 5KU1A 2LC5A 1AK8A 3LCPC 2KBIA 1KFXL 1S5GY 4AQJA 1IGVA 3NSIA 2LANA 1JWDA 3CR5X 1B7TZ 3DF0A 1SNLA 1V1GA 4CIDA 1A75A 1NCYA 2F8PA 2JT8A 2M29A 4USLA 4C0KA 1FPWA 2MLEC 1N65A 1XA5A 1ZACA 4R1EA 1WRLA 3OX6A 2JXLA 1L2OB 1QLKA 2K0JA 2KI4C 4PDZA 4YBHB 2LVIA 1QJTA 2K7BA 3JVTC 4NDBA 1BT6A 1CDNA 1MQ1A 3NSOA 1XYDA 4Q04A 3TUYC 1HQVA 2M0RA 3M0WA 4QJ4B 1UHIA 1PRWA 2D8NA 1EL4A 1KWOC 3LL8B 1PK0D 2CT9A 1A4PA 1G4YR 4PE1A 1KK7Z 1K9PA 1G8IA 1SKTA 3PN7C 3KHEA 3BXKA 2TN4A 1IQ3A 4IL1A 2A4JA 1SCVA 1XVJA 3LK1A 3LLEA 4YGCB 2DOQA 1K9KA 1UP5A 1CDMA 4F0ZB 5CSIA 5AFPA 1DJGA 4PE4A 2JTTA 3D0YA 1BU3A 1OSAA 4MZJA 3HCMA 2OS8B 5HKZA 1EG4A 3CLNA 5JJGA 5F6TA 1YUTA 1QX5B 2JU0A 1M63B 2ZKMX 1K94A 1LVCD 3I5FC 1J1DA 1OQPA 4PE0A 4YGEB 3WXAA 1M45A 2JNXA 1ZMZA 2LV7A 4ICBA 2NXQA 3DVKA 2HF5A 1EJ3A 1KK7Y 4JQ0D 1KQMB 5DKNA 1SL7A 1WY9A 2FCDA 4CLNA 4ORCB 4CFQA 1IWQA 2P6BB 3EVUA 2BKIB 3OP0A 1J7RA 1QVIZ 1XK4A 3SG7A 5I8NA 1CB1A 1DJHA 2KNEA 1V1FA 1LA3A 2WORA 1TNXA 1BMOA 4U8DA 3SIBA 1FW4A 2EC6C 1JC2A 4MZKA 2ZNEA 1YTZC 2BL0B 3NSKA 1DTLA 3OB2B 2ZN9A 4MSPA 1BLQA 3AKAA 3RM1A 4FTGA 1XFUO 2GV5A 1ZOTB 2OTGC 2ZFDA 2ZNDA 2GGZA 2M9GA 1KK8B 2F2PA 2F33A 1K8UA 3BOWA 1TCOB 1FI5A 1UHKA 5HLOA 1ALWA 4MN0A 3DVMA 2PALA 2WCFA 1OMVA 2BKHB 4L9MA 5B8IB 1D1OA 4OR9B 5AEQA 2VRGA 1S5GZ 3I5GB 1FF1A 1IJ5A 1K95A 2LLSA 3JTDC 1K2HA 2LVVA 1YVLA 4HREE 3KF9A 3VRPA 4AOMA 2BBMA 2BECA 1LINA 5PALA 4NDCA 2MRDA 3QRXA 1DF0B 3VRNA 3D10A 1JFJA 2QPTA 1Y6WA 3ZWHA 2JOJA 4MRXA 4OCIA 1MXLC 1BR1B 1S26D 1SMGA 3EK4A 1QIWA 3I5HC 1S6JA 2BCAA 2FOTA 1MUXA 1B1GA 3K21A 5D7FA 1SPYA 2JWWA 4MRYA 1CLMA 4TNCA 4NDDA 2BE4A 1ZFSA 1YX7A 2SCPA 4QJ3B 4GUKA 3ICBA 1XFXO 2M1KB 3AAJA 3DVEA 1QTXA 1IQ5A 2KAYA 2MAZA 4PHNA 1CDLA 4MLWA 2M1UA 1S1EA 2M97A 5KTYA 1DJZA 3CZTX 4ZCVA 4WQ2A 4XJKA 1VRKA 1F4OA 1JF0A 3TS5C 1EXRA 1B8RA 1M46A 2WC8A 2JT3A 2LMUA 4PE7A 1R2UA 3EKHA 5JOLA 4DIRA 1WLMA 2KFFA 3CR2A 2NZ0A 1YURA 1WDCC 3BUWB 1AUIB 2L0PA 2H61A 2MLFC 4CFRA 3IF7A 2PRUA 2ZRTA 1J7OA 1OMRA 3PALA 1YUSA 3IQQA 2M7LA 4YI9A 1KQMC 1PSRA 1OZOA 1SR6B 1H8BA 2L51A 1SY9A 1NUBA 4ORBB 2JNFA 1RK9A 1DF0A 3FIAA 2EHBA 4ETOA 1QX2A 3PLFB 1DGVA 2CXJA 5HYDA 1KFXS 2JT0A 4MBEA 2F3ZA 1W7JB 2WCEA 3PM8A 1IKUA 2PSRA 1PVBA 2KGBC 1CFCA 1YVHA 3AAKA 2Y4QA 1NX0A 4MEWA 1QS7A 3I5IC 3SIAA 3BUNB 1JUOA 4M2PA 5CPVA 2L4IA 3WHTB 3ZNIA 2CTNA 2LMTA 1GGWA 1NX1A 1J1EA 5D69A 4AQIA 1MF8B 2LLUA 1F8HA 1QV0A 1UWOA 1XFZO 1U5IB 1CDPA 1WRKA 2K7CA 1KCYA 2COLB 1M31A 1NWDA 2KHNA 1SL8A 1AVSA 4YGDB 4OVNF 4GGNA 3SJSA 1CLLA 2H61C 2HQWA 1SBJA 2LAPA 3EK8A 1A29A 2LP2A 1YUUA
chains in the Genus database with same CATH superfamily
4DUQA 1LS8A 2ERBA 2MA2A 2Q91A 2WC6A 2WNDA 1YR5A 5TNCA 3TDIA 5I2QA 4I5KA 1DJWA 5CSFA 4YGAA 1UHNA 2O60A 3B86A 4PHMA 1SCMC 3EK7A 4INWA 1K90D 1CTRA 1PSBA 1TWOA 2K2AA 2LLTA 2M8UA 3PATA 1JSAA 1OOIX 1G33A 4YRUA 1SW8A 4FQOA 1UHJA 4CPVA 1RTP1 4I5LB 1IRJA 4MVFA 1DJIA 2I94A 2MJWB 3KEVA 1CMFA 2KI4B 1TCFA 3S0EA 1J55A 1WRZA 3BYAA 3JVTB 1YRTB 3O6BA 5I2OA 3TUYB 1ZUZA 2L2EA 2LMVA 2LNKA 4WRIA 2KI6C 1DVIA 2R2IA 1PULA 2JULA 1MXEA 2L50A 2F2OA 3V2LA 1DC1A 3PN7B 4GPLB 2HQ8A 5GQQC 4P5OE 1N2DA 5AXIA 1CFDA 1RROA 1B47A 4M2QA 3NHIA 3S0AA 4YGBB 1MHOA 1GQMA 1LA0A 5FYXA 1TNWA 3CS1A 1U5IA 1OOJA 3WHUB 2PMYA 3DYEA 3BFAA 3CTNA 1L2OC 1QATA 2AUCA 2LP3A 2LM5A 1XK4C 2H2KA 4UPGA 1GGZA 2FCEA 2LVJA 3EVRA 3I5FB 4KYNA 4XYNA 3VRQA 2K60A 4PT1A 2BCBA 1JBAA 1A2XA 3E3RA 3O2PA 1F54A 1DGUA 3GOFA 4E68A 1LXFC 2KYFA 3CGAA 4ZCUA 4N1GA 1K9UA 1AP4A 1CM1A 2KFHA 3D78A 1UHHA 1C7WA 2HETA 4GBAA 1NCZA 1QIVA 1SL9A 1B8LA 1BG1A 2AAOA 1ORGA 4MZLA 1XFWO 1XFRA 2L98A 1OOFA 3FWBA 3SG3A 2F3YA 3VRRA 3MSEB 3Q8IA 3SG4A 2KAXA 2G9BA 1KFUL 2L5XB 3EG5B 1NX2A 3HX4A 2LHIA 3B6XA 3PFVA 1RECA 2OPOA 2MHHA 2OS8C 2FJUB 1SK6D 1QX7A 3SS4A 1YRUB 2EC6B 2JPTA 2LUCA 2WCKA 2JQ6A 1IG5A 3EKJA 3FS7A 1S36A 3CR4X 3D0YB 2WCHA 2LCPA 1AJ4A 1ODBA 1NP8A 2K8MB 2KI6D 3CDNA 3B7AA 2KBMA 1C7VA 1AJ5A 4PCWA 3GK2A 1K93D 2OTGB 2KAVA 2QEHA 1PALA 3LK0A 3NHTA 4HRGA 3TDUA 1XFYO 1MWNA 1F4QA 2LUXA 4P2YB 3FWCA 1BOCA 3C1VA 1JFKA 1SYMA 1NCXA 2YGUA 2BCXA 2O5GA 3H4SE 1Y0VH 1XO5A 3SG2A 3SS3A 1TRFA 2M7NA 1M39A 1UURA 1K96A 3R1PA 3SS5A 1DJXA 1IH0A 2NCPA 2NLNA 1E8AA 3D77A 1TOPA 3JTDB 3KPXA 2JTZA 1KFUS 1QXPA 5DKRA 3IQOA 2MBXA 1RJVA 5BPJA 1UUSA 2BL0C 1BR4B 3TDZA 4A4BA 1CKKA 2KYCA 3A4UB 3NXAA 3QMEA 1FI6A 1TNPA 4I5JA 5I94A 1F71A 2WC5A 1HT9A 5G08A 2CBLA 3RLZA 2ISDA 3I5HB 5DKQA 1OE9B 1R6PA 1JF2A 4WQ3A 2HPSA 2L5YA 2QEVA 4DCKA 2I2RE 3DVJA 1KK8C 3BUOB 1CM4A 4C0JA 3R72A 4YI8A 1DEKA 5DICA 1EG3A 1AHRA 3WNXB 3FE6A 1RFJA 4QJ5B 1NX3A 2KDHA 4GGFA 4C0LA 1MR8A 1C07A 1OZSA 1TN4A 1B7TY 2Y1NA 3VGOA 5AERA 3I5GC 3K1EA 3PM2A 1FBVA 2ZRSA 1F55A 3BOWB 1A03A 1CMGA 1WLZA 3GK1A 4N5XA 4I5NB 5I2LA 2WCMA 3TS5B 5J3XA 2IS9A 2ZN8A 1TTXA 1B9AA 1YX8A 1NIWA 1H4BA 4JPZB 3CZ1A 1X02A 5CSNA 2Y1MA 3O4XA 1SSEB 2RGIA 2SASA 2WCBA 4DRWA 2KQ6A 4PALA 4GAOA 2BBNA 1WDCB 1TNQA 2B1UA 3CZ2A 4N1FA 5HLVA 3D73A 4D1EA 2I18A 1Y1UA 3BQ3A 4FQTA 2V53A 3S0FA 1DJYA 1QASA 2EGDA 1BJFA 1SRAA 1B8CA 2K7DA 3BUMB 3CYZA 3PSRA 3SG5A 2WOSA 1Z4HA 3TZ1A 2K61A 1B4CA 1IIOA 4PHJA 1KWOB 1S6IA 2Q4UA 1T14A 4HRHA 2GTEA 2JZIA 3F45A 1W9ZA 1Y1AA 2I7AA 1J7QA 3NSLA 2M3WA 2LHLA 3OX5A 1EH2A 1IJ6A 1DMOA 4HSZA 4ORAB 1S6CA 1J7PA 2KFGA 3VROA 4GGFC 3EVVA 1ALVA 2PVBA 2M49B 4BY4A 2KGRA 1RWYA 1NPQA 2GGMA 3DD4A 4GFTA 2K2FA 2NCOA 1CFPA 4M2OA 2K7OA 1Q80A 2QACA 2L4HA 3I5IB 4XJKB 3RZSA 2Y5IA 2LE9B 3DY9A 5HKWA 3DF0B 1GJYA 1A75B 1OMDA 5HKYA 1L7ZA 2JC2A 1F70A 1XFVO 3R1VA 1SR6C 1NYAA 2LVKA 1BODA 1KSOA 1CNPA 4PHKA 2JXCA 3L4AA 1KSMA 4A4CA 3O4YA 3GK4X 2E30A 3KO0A 3PJIA 5ER5A 1QVIY 1Y1XA 5CSJA 4JWQA 1QV1A 5IBWA 5ER4X 1TUJA 3A8RA 2KQYA 1TIZA 4DS7A 4BY5A 5K89A 1NSHA 1SCMB 3AKBA 3O78A 2CCMA 1CLBA 1TUZA 3OHMB 3SG6A 1W7IB 2QEOA 3OB1B 2JRFA 2BE6A 4GNKB 5AANA 1OOHA 1CFFA 1S3PA 1KQVA 2G2BA 1PVAA 2KSPA 1QLSA 2KLEA 3BUXB 2KOTA 2E6WA 3CWGA 4NQGA 4OKHA 2PASA 1N0YA 2AMIA 4OV2A 5KSZA 1LKJA 1DT7B 2CNPA 5KU1A 2LC5A 1AK8A 3LCPC 3NGVA 2KBIA 1KFXL 1S5GY 4AQJA 1IGVA 5EL2A 3NSIA 2LANA 5D3OA 3CR5X 1JWDA 1B7TZ 3DF0A 1BF5A 1SNLA 1V1GA 3S0BA 1A75A 4CIDA 1NCYA 2F8PA 2JT8A 2M29A 4USLA 4C0KA 1FPWA 2MLEC 1C3ZA 1N65A 1XA5A 1ZACA 1GM0A 4R1EA 1WRLA 2PYQA 3OX6A 2JXLA 1L2OB 1QLKA 2K0JA 2KI4C 4PDZA 4YBHB 2LVIA 1QJTA 2K7BA 3JVTC 4NDBA 1BT6A 1CDNA 1MQ1A 3NSOA 1XYDA 2FJYA 4Q04A 1HQVA 2M0RA 3M0WA 4QJ4B 3TUYC 1UHIA 1PRWA 2D8NA 1EL4A 1KWOC 3LL8B 1PK0D 2CT9A 1A4PA 1G4YR 4PE1A 1KK7Z 4INXA 1K9PA 1G8IA 1SKTA 3PN7C 3KHEA 2WCLA 2TN4A 3BXKA 1IQ3A 3VB1A 4IL1A 2JPOA 2A4JA 1SCVA 1XVJA 3LK1A 3LLEA 4YGCB 2DOQA 1K9KA 1UP5A 1CDMA 3OBVA 4F0ZB 5CSIA 5AFPA 2QEBA 1DJGA 4PE4A 2JTTA 3D0YA 1BU3A 1OSAA 4MZJA 3HCMA 2L2CA 2OS8B 5HKZA 1EG4A 3CLNA 5JJGA 5F6TA 1YUTA 1QX5B 2JU0A 1M63B 2ZKMX 1K94A 3FE8A 1LVCD 3I5FC 1J1DA 1OQPA 4PE0A 4YGEB 1DELA 3WXAA 1M45A 2JNXA 1ZMZA 2LV7A 4ICBA 2NXQA 3DVKA 2HF5A 1EJ3A 1KK7Y 4JQ0D 1KQMB 5DKNA 1SL7A 1WY9A 2FCDA 4CLNA 4ORCB 4CFQA 1KCYA 1IWQA 2P6BB 3EVUA 2BKIB 3OP0A 1J7RA 1QVIZ 1XK4A 3SG7A 5I8NA 1CB1A 1DJHA 2KNEA 3UNWA 1V1FA 3DXLA 1LA3A 2WORA 1TNXA 5FI2A 3S0DA 1BMOA 5FI7A 4U8DA 3UO9A 3BFBA 3SIBA 1FW4A 2EC6C 1OOGA 1JC2A 4MZKA 2ZNEA 1YTZC 2BL0B 3NSKA 1DTLA 4F7FA 3OB2B 2ZN9A 4MSPA 1BLQA 3AKAA 3RM1A 4FTGA 1XFUO 2GV5A 1ZOTB 2OTGC 2ZFDA 2ZNDA 2GGZA 2M9GA 1KK8B 2KLDA 2F2PA 2F33A 3CABA 1K8UA 3BOWA 1TCOB 1C3YA 1FI5A 1UHKA 5HLOA 1ALWA 4MN0A 3DVMA 2PALA 2WCFA 1OMVA 2BKHB 4L9MA 5B8IB 1D1OA 4OR9B 5AEQA 2QDIA 2VRGA 1S5GZ 3I5GB 1FF1A 1IJ5A 1K95A 2LLSA 3JTDC 1K2HA 2LVVA 1YVLA 4HREE 3CZ0A 3KF9A 4JD9A 3VRPA 4AOMA 2BBMA 2BECA 1LINA 5PALA 4NDCA 2MRDA 3QRXA 1DF0B 1DQEA 3D10A 3VRNA 2QPTA 1JFJA 1Y6WA 3D75A 2JOJA 3ZWHA 2H8VA 4MRXA 4OCIA 1MXLC 1BR1B 1S26D 1SMGA 3EK4A 1QIWA 3I5HC 1S6JA 2BCAA 2FOTA 3R1OA 1MUXA 2P71A 1B1GA 3B88A 3K21A 5D7FA 3D74A 1SPYA 2JWWA 4MRYA 1CLMA 4TNCA 3BFHA 4NDDA 2BE4A 1ZFSA 1YX7A 2SCPA 4QJ3B 4GUKA 3ICBA 1XFXO 2M1KB 3AAJA 3DVEA 1QTXA 1IQ5A 2KAYA 2MAZA 4PHNA 1CDLA 4MLWA 2M1UA 1S1EA 2M97A 5KTYA 1DJZA 3CZTX 3B87A 4ZCVA 2BAPA 4WQ2A 4XJKA 1VRKA 1F4OA 3S0GA 1JF0A 3DZTA 3TS5C 1EXRA 1B8RA 1M46A 2WC8A 2JT3A 4JKTA 2LMUA 2P70A 4PE7A 1R2UA 3EKHA 5JOLA 4DIRA 1WLMA 2KFFA 3CR2A 2NZ0A 1YURA 1WDCC 3BUWB 1AUIB 2L0PA 2H61A 2MLFC 4CFRA 3IF7A 2PRUA 2ZRTA 3D76A 1J7OA 1OMRA 1Z2CB 3PALA 1YUSA 3IQQA 2M7LA 4YI9A 2WCJA 1KQMC 2PQLA 1OW4A 3L47A 1PSRA 1OZOA 1SR6B 3BJHA 1H8BA 2L51A 1SY9A 1NUBA 1P28A 4ORBB 2JNFA 1RK9A 3FE9A 1DF0A 3FIAA 2EHBA 4IJ7A 1QWVA 1QX2A 2BNXA 3PLFB 1DGVA 4OZDA 4ETOA 5HL1A 2CXJA 5HYDA 5FI6A 1KFXS 2JT0A 4MBEA 2F3ZA 1W7JB 2WCEA 3PM8A 1IKUA 2PSRA 1PVBA 2KGBC 1CFCA 1YVHA 3AAKA 3OGNA 2Y4QA 1NX0A 4MEWA 1QS7A 3I5IC 3N7HA 3SIAA 3BUNB 1JUOA 4M2PA 5CPVA 2L4IA 3WHTB 3ZNIA 2CTNA 2LMTA 1GGWA 1NX1A 1J1EA 5D69A 4AQIA 1MF8B 2LLUA 1F8HA 1QV0A 1UWOA 1XFZO 1U5IB 1CDPA 1WRKA 2K7CA 3L4LA 2COLB 1M31A 1NWDA 2KHNA 1SL8A 1AVSA 2KPHA 4OVNF 4GGNA 4YGDB 3SJSA 1CLLA 2H61C 2HQWA 3IVTA 1SBJA 2LAPA 3EK8A 1A29A 2LP2A 1YUUA
chains in the Genus database with same CATH topology
4DUQA 2MA2A 2WNDA 2Q91A 5TNCA 3TDIA 1YR5A 5I2QA 4I5KA 1DJWA 5CSFA 4YGAA 1UHNA 2O60A 4PHMA 1SCMC 3EK7A 1K90D 1CTRA 1PSBA 2K2AA 2LLTA 2M8UA 3PATA 1JSAA 1G33A 4YRUA 1SW8A 4FQOA 1UHJA 4CPVA 1RTP1 4I5LB 1IRJA 4MVFA 1DJIA 2I94A 2MJWB 3KEVA 1CMFA 2KI4B 1TCFA 1J55A 1WRZA 3BYAA 3JVTB 1YRTB 3O6BA 5I2OA 3TUYB 1ZUZA 2L2EA 2LMVA 2LNKA 4WRIA 2KI6C 1DVIA 2R2IA 1PULA 2JULA 1MXEA 2L50A 2F2OA 3PN7B 4GPLB 2HQ8A 5GQQC 4P5OE 1N2DA 5AXIA 1CFDA 1RROA 1B47A 4M2QA 4YGBB 1MHOA 1GQMA 1LA0A 5FYXA 1TNWA 3CS1A 1U5IA 1OOJA 3WHUB 2PMYA 3CTNA 1L2OC 1QATA 2AUCA 2LP3A 2LM5A 1XK4C 2H2KA 4UPGA 1GGZA 2FCEA 2LVJA 3EVRA 3I5FB 4XYNA 3VRQA 2BCBA 1JBAA 1A2XA 3E3RA 3O2PA 1F54A 1DGUA 3GOFA 4E68A 1LXFC 2KYFA 3CGAA 4ZCUA 4N1GA 1K9UA 1AP4A 1CM1A 2KFHA 1UHHA 1C7WA 2HETA 4GBAA 1NCZA 1QIVA 1SL9A 1B8LA 1BG1A 2AAOA 4MZLA 1XFWO 2L98A 3FWBA 3SG3A 2F3YA 3VRRA 3MSEB 1BF5A 3SG4A 2KAXA 2G9BA 1KFUL 2L5XB 3HX4A 1NX2A 3PFVA 2LHIA 1RECA 2OPOA 2MHHA 2OS8C 2FJUB 1SK6D 1QX7A 1YRUB 2EC6B 2JPTA 2LUCA 2JQ6A 1IG5A 3EKJA 3FS7A 1S36A 3CR4X 3D0YB 2LCPA 1AJ4A 1ODBA 1NP8A 2K8MB 2KI6D 2KBMA 1C7VA 1AJ5A 4PCWA 3GK2A 1K93D 2OTGB 2KAVA 3LK0A 1PALA 4HRGA 3TDUA 1XFYO 1MWNA 1F4QA 2LUXA 4P2YB 3FWCA 1BOCA 3C1VA 1JFKA 1SYMA 1NCXA 3SG2A 2BCXA 2O5GA 3H4SE 1Y0VH 1XO5A 1TRFA 2M7NA 1M39A 1UURA 1K96A 1DJXA 1IH0A 2NCPA 2NLNA 1E8AA 3JTDB 1TOPA 3KPXA 2JTZA 1KFUS 1QXPA 5DKRA 3IQOA 2MBXA 1RJVA 5BPJA 1UUSA 2BL0C 1BR4B 3TDZA 4A4BA 1CKKA 2KYCA 3A4UB 3NXAA 1FI6A 1TNPA 4I5JA 1F71A 1HT9A 5G08A 2CBLA 3RLZA 2ISDA 3I5HB 5DKQA 1OE9B 1R6PA 1JF2A 4WQ3A 2HPSA 4DCKA 2I2RE 3DVJA 1KK8C 3BUOB 1CM4A 4C0JA 4YI8A 1EG3A 1AHRA 3WNXB 1RFJA 4QJ5B 1NX3A 2KDHA 4GGFA 4C0LA 1MR8A 1C07A 1OZSA 1TN4A 1B7TY 2Y1NA 3VGOA 5AERA 3I5GC 1FBVA 2ZRSA 1F55A 3BOWB 1A03A 1CMGA 1WLZA 3GK1A 4N5XA 4I5NB 5I2LA 3TS5B 5J3XA 2IS9A 2ZN8A 1TTXA 1B9AA 1YX8A 1NIWA 1H4BA 4JPZB 1X02A 5CSNA 2Y1MA 2RGIA 2SASA 2WCBA 4DRWA 2KQ6A 4PALA 4GAOA 2BBNA 1WDCB 1TNQA 2B1UA 4N1FA 5HLVA 4D1EA 2I18A 1Y1UA 3BQ3A 2V53A 1DJYA 1QASA 2EGDA 1BJFA 1SRAA 1B8CA 2K7DA 3BUMB 3PSRA 3SG5A 3TZ1A 2WOSA 1B4CA 2K61A 4PHJA 1KWOB 1S6IA 2Q4UA 4HRHA 2JZIA 3F45A 1Y1AA 2I7AA 1J7QA 3NSLA 2M3WA 2LHLA 3OX5A 1EH2A 1IJ6A 1DMOA 4HSZA 4ORAB 1S6CA 1J7PA 2KFGA 3VROA 4GGFC 3EVVA 1ALVA 2PVBA 2M49B 4BY4A 2KGRA 1RWYA 1NPQA 2GGMA 3DD4A 4GFTA 2K2FA 2NCOA 1CFPA 4M2OA 2K7OA 1Q80A 2QACA 2L4HA 3I5IB 4XJKB 2Y5IA 2LE9B 5HKWA 3DF0B 1GJYA 1A75B 1OMDA 5HKYA 1L7ZA 2JC2A 1F70A 1XFVO 1SR6C 1NYAA 2LVKA 1BODA 1KSOA 1CNPA 4PHKA 2JXCA 1KSMA 4A4CA 3O4YA 3GK4X 2E30A 3KO0A 5ER5A 1QVIY 1Y1XA 5CSJA 4JWQA 1QV1A 5IBWA 5ER4X 3A8RA 2KQYA 1TIZA 4DS7A 4BY5A 5K89A 1NSHA 1SCMB 3AKBA 3O78A 2CCMA 1CLBA 3OHMB 3SG6A 1W7IB 3OB1B 2JRFA 2BE6A 4GNKB 5AANA 1CFFA 1S3PA 1KQVA 2G2BA 1PVAA 2KSPA 1QLSA 3BUXB 2KOTA 2E6WA 3CWGA 4NQGA 4OKHA 2PASA 1N0YA 2AMIA 4OV2A 5KSZA 1LKJA 1DT7B 2CNPA 5KU1A 2LC5A 1AK8A 3LCPC 2KBIA 1KFXL 1S5GY 4AQJA 1IGVA 3NSIA 2LANA 1JWDA 3CR5X 1B7TZ 3DF0A 1SNLA 1V1GA 4CIDA 1A75A 1NCYA 2F8PA 2JT8A 2M29A 4USLA 4C0KA 1FPWA 2MLEC 1N65A 1XA5A 1ZACA 4R1EA 1WRLA 3OX6A 2JXLA 1L2OB 1QLKA 2K0JA 2KI4C 4PDZA 4YBHB 2LVIA 1QJTA 2K7BA 3JVTC 4NDBA 1BT6A 1CDNA 1MQ1A 3NSOA 1XYDA 4Q04A 3TUYC 1HQVA 2M0RA 3M0WA 4QJ4B 1UHIA 1PRWA 2D8NA 1EL4A 1KWOC 3LL8B 1PK0D 2CT9A 1A4PA 1G4YR 4PE1A 1KK7Z 1K9PA 1G8IA 1SKTA 3PN7C 3KHEA 3BXKA 2TN4A 1IQ3A 4IL1A 2A4JA 1SCVA 1XVJA 3LK1A 3LLEA 4YGCB 2DOQA 1K9KA 1UP5A 1CDMA 4F0ZB 5CSIA 5AFPA 1DJGA 4PE4A 2JTTA 3D0YA 1BU3A 1OSAA 4MZJA 3HCMA 2OS8B 5HKZA 1EG4A 3CLNA 5JJGA 5F6TA 1YUTA 1QX5B 2JU0A 1M63B 2ZKMX 1K94A 1LVCD 3I5FC 1J1DA 1OQPA 4PE0A 4YGEB 3WXAA 1M45A 2JNXA 1ZMZA 2LV7A 4ICBA 2NXQA 3DVKA 2HF5A 1EJ3A 1KK7Y 4JQ0D 1KQMB 5DKNA 1SL7A 1WY9A 2FCDA 4CLNA 4ORCB 4CFQA 1IWQA 2P6BB 3EVUA 2BKIB 3OP0A 1J7RA 1QVIZ 1XK4A 3SG7A 5I8NA 1CB1A 1DJHA 2KNEA 1V1FA 1LA3A 2WORA 1TNXA 1BMOA 4U8DA 3SIBA 1FW4A 2EC6C 1JC2A 4MZKA 2ZNEA 1YTZC 2BL0B 3NSKA 1DTLA 3OB2B 2ZN9A 4MSPA 1BLQA 3AKAA 3RM1A 4FTGA 1XFUO 2GV5A 1ZOTB 2OTGC 2ZFDA 2ZNDA 2GGZA 2M9GA 1KK8B 2F2PA 2F33A 1K8UA 3BOWA 1TCOB 1FI5A 1UHKA 5HLOA 1ALWA 4MN0A 3DVMA 2PALA 2WCFA 1OMVA 2BKHB 4L9MA 5B8IB 1D1OA 4OR9B 5AEQA 2VRGA 1S5GZ 3I5GB 1FF1A 1IJ5A 1K95A 2LLSA 3JTDC 1K2HA 2LVVA 1YVLA 4HREE 3KF9A 3VRPA 4AOMA 2BBMA 2BECA 1LINA 5PALA 4NDCA 2MRDA 3QRXA 1DF0B 3VRNA 3D10A 1JFJA 2QPTA 1Y6WA 3ZWHA 2JOJA 4MRXA 4OCIA 1MXLC 1BR1B 1S26D 1SMGA 3EK4A 1QIWA 3I5HC 1S6JA 2BCAA 2FOTA 1MUXA 1B1GA 3K21A 5D7FA 1SPYA 2JWWA 4MRYA 1CLMA 4TNCA 4NDDA 2BE4A 1ZFSA 1YX7A 2SCPA 4QJ3B 4GUKA 3ICBA 1XFXO 2M1KB 3AAJA 3DVEA 1QTXA 1IQ5A 2KAYA 2MAZA 4PHNA 1CDLA 4MLWA 2M1UA 1S1EA 2M97A 5KTYA 1DJZA 3CZTX 4ZCVA 4WQ2A 4XJKA 1VRKA 1F4OA 1JF0A 3TS5C 1EXRA 1B8RA 1M46A 2WC8A 2JT3A 2LMUA 4PE7A 1R2UA 3EKHA 5JOLA 4DIRA 1WLMA 2KFFA 3CR2A 2NZ0A 1YURA 1WDCC 3BUWB 1AUIB 2L0PA 2H61A 2MLFC 4CFRA 3IF7A 2PRUA 2ZRTA 1J7OA 1OMRA 3PALA 1YUSA 3IQQA 2M7LA 4YI9A 1KQMC 1PSRA 1OZOA 1SR6B 1H8BA 2L51A 1SY9A 1NUBA 4ORBB 2JNFA 1RK9A 1DF0A 3FIAA 2EHBA 4ETOA 1QX2A 3PLFB 1DGVA 2CXJA 5HYDA 1KFXS 2JT0A 4MBEA 2F3ZA 1W7JB 2WCEA 3PM8A 1IKUA 2PSRA 1PVBA 2KGBC 1CFCA 1YVHA 3AAKA 2Y4QA 1NX0A 4MEWA 1QS7A 3I5IC 3SIAA 3BUNB 1JUOA 4M2PA 5CPVA 2L4IA 3WHTB 3ZNIA 2CTNA 2LMTA 1GGWA 1NX1A 1J1EA 5D69A 4AQIA 1MF8B 2LLUA 1F8HA 1QV0A 1UWOA 1XFZO 1U5IB 1CDPA 1WRKA 2K7CA 1KCYA 2COLB 1M31A 1NWDA 2KHNA 1SL8A 1AVSA 4YGDB 4OVNF 4GGNA 3SJSA 1CLLA 2H61C 2HQWA 1SBJA 2LAPA 3EK8A 1A29A 2LP2A 1YUUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUQ A;  2MA2 A;  2WND A;  2Q91 A;  5TNC A;  3TDI A;  1YR5 A;  5I2Q A;  4I5K A;  1DJW A;  5CSF A;  4YGA A;  1UHN A;  2O60 A;  4PHM A;  1SCM C;  3EK7 A;  1K90 D;  1CTR A;  1PSB A;  2K2A A;  2LLT A;  2M8U A;  3PAT A;  1JSA A;  1G33 A;  4YRU A;  1SW8 A;  4FQO A;  1UHJ A;  4CPV A;  1RTP 1;  4I5L B;  1IRJ A;  4MVF A;  1DJI A;  2I94 A;  2MJW B;  3KEV A;  1CMF A;  2KI4 B;  1TCF A;  1J55 A;  1WRZ A;  3BYA A;  3JVT B;  1YRT B;  3O6B A;  5I2O A;  3TUY B;  1ZUZ A;  2L2E A;  2LMV A;  2LNK A;  4WRI A;  2KI6 C;  1DVI A;  2R2I A;  1PUL A;  2JUL A;  1MXE A;  2L50 A;  2F2O A;  3PN7 B;  4GPL B;  2HQ8 A;  5GQQ C;  4P5O E;  1N2D A;  5AXI A;  1CFD A;  1RRO A;  1B47 A;  4M2Q A;  4YGB B;  1MHO A;  1GQM A;  1LA0 A;  5FYX A;  1TNW A;  3CS1 A;  1U5I A;  1OOJ A;  3WHU B;  2PMY A;  3CTN A;  1L2O C;  1QAT A;  2AUC A;  2LP3 A;  2LM5 A;  1XK4 C;  2H2K A;  4UPG A;  1GGZ A;  2FCE A;  2LVJ A;  3EVR A;  3I5F B;  4XYN A;  3VRQ A;  2BCB A;  1JBA A;  1A2X A;  3E3R A;  3O2P A;  1F54 A;  1DGU A;  3GOF A;  4E68 A;  1LXF C;  2KYF A;  3CGA A;  4ZCU A;  4N1G A;  1K9U A;  1AP4 A;  1CM1 A;  2KFH A;  1UHH A;  1C7W A;  2HET A;  4GBA A;  1NCZ A;  1QIV A;  1SL9 A;  1B8L A;  1BG1 A;  2AAO A;  4MZL A;  1XFW O;  2L98 A;  3FWB A;  3SG3 A;  2F3Y A;  3VRR A;  3MSE B;  1BF5 A;  3SG4 A;  2KAX A;  2G9B A;  1KFU L;  2L5X B;  3HX4 A;  1NX2 A;  3PFV A;  2LHI A;  1REC A;  2OPO A;  2MHH A;  2OS8 C;  2FJU B;  1SK6 D;  1QX7 A;  1YRU B;  2EC6 B;  2JPT A;  2LUC A;  2JQ6 A;  1IG5 A;  3EKJ A;  3FS7 A;  1S36 A;  3CR4 X;  3D0Y B;  2LCP A;  1AJ4 A;  1ODB A;  1NP8 A;  2K8M B;  2KI6 D;  2KBM A;  1C7V A;  1AJ5 A;  4PCW A;  3GK2 A;  1K93 D;  2OTG B;  2KAV A;  3LK0 A;  1PAL A;  4HRG A;  3TDU A;  1XFY O;  1MWN A;  1F4Q A;  2LUX A;  4P2Y B;  3FWC A;  1BOC A;  3C1V A;  1JFK A;  1SYM A;  1NCX A;  3SG2 A;  2BCX A;  2O5G A;  3H4S E;  1Y0V H;  1XO5 A;  1TRF A;  2M7N A;  1M39 A;  1UUR A;  1K96 A;  1DJX A;  1IH0 A;  2NCP A;  2NLN A;  1E8A A;  3JTD B;  1TOP A;  3KPX A;  2JTZ A;  1KFU S;  1QXP A;  5DKR A;  3IQO A;  2MBX A;  1RJV A;  5BPJ A;  1UUS A;  2BL0 C;  1BR4 B;  3TDZ A;  4A4B A;  1CKK A;  2KYC A;  3A4U B;  3NXA A;  1FI6 A;  1TNP A;  4I5J A;  1F71 A;  1HT9 A;  5G08 A;  2CBL A;  3RLZ A;  2ISD A;  3I5H B;  5DKQ A;  1OE9 B;  1R6P A;  1JF2 A;  4WQ3 A;  2HPS A;  4DCK A;  2I2R E;  3DVJ A;  1KK8 C;  3BUO B;  1CM4 A;  4C0J A;  4YI8 A;  1EG3 A;  1AHR A;  3WNX B;  1RFJ A;  4QJ5 B;  1NX3 A;  2KDH A;  4GGF A;  4C0L A;  1MR8 A;  1C07 A;  1OZS A;  1TN4 A;  1B7T Y;  2Y1N A;  3VGO A;  5AER A;  3I5G C;  1FBV A;  2ZRS A;  1F55 A;  3BOW B;  1A03 A;  1CMG A;  1WLZ A;  3GK1 A;  4N5X A;  4I5N B;  5I2L A;  3TS5 B;  5J3X A;  2IS9 A;  2ZN8 A;  1TTX A;  1B9A A;  1YX8 A;  1NIW A;  1H4B A;  4JPZ B;  1X02 A;  5CSN A;  2Y1M A;  2RGI A;  2SAS A;  2WCB A;  4DRW A;  2KQ6 A;  4PAL A;  4GAO A;  2BBN A;  1WDC B;  1TNQ A;  2B1U A;  4N1F A;  5HLV A;  4D1E A;  2I18 A;  1Y1U A;  3BQ3 A;  2V53 A;  1DJY A;  1QAS A;  2EGD A;  1BJF A;  1SRA A;  1B8C A;  2K7D A;  3BUM B;  3PSR A;  3SG5 A;  3TZ1 A;  2WOS A;  1B4C A;  2K61 A;  4PHJ A;  1KWO B;  1S6I A;  2Q4U A;  4HRH A;  2JZI A;  3F45 A;  1Y1A A;  2I7A A;  1J7Q A;  3NSL A;  2M3W A;  2LHL A;  3OX5 A;  1EH2 A;  1IJ6 A;  1DMO A;  4HSZ A;  4ORA B;  1S6C A;  1J7P A;  2KFG A;  3VRO A;  4GGF C;  3EVV A;  1ALV A;  2PVB A;  2M49 B;  4BY4 A;  2KGR A;  1RWY A;  1NPQ A;  2GGM A;  3DD4 A;  4GFT A;  2K2F A;  2NCO A;  1CFP A;  4M2O A;  2K7O A;  1Q80 A;  2QAC A;  2L4H A;  3I5I B;  4XJK B;  2Y5I A;  2LE9 B;  5HKW A;  3DF0 B;  1GJY A;  1A75 B;  1OMD A;  5HKY A;  1L7Z A;  2JC2 A;  1F70 A;  1XFV O;  1SR6 C;  1NYA A;  2LVK A;  1BOD A;  1KSO A;  1CNP A;  4PHK A;  2JXC A;  1KSM A;  4A4C A;  3O4Y A;  3GK4 X;  2E30 A;  3KO0 A;  5ER5 A;  1QVI Y;  1Y1X A;  5CSJ A;  4JWQ A;  1QV1 A;  5IBW A;  5ER4 X;  3A8R A;  2KQY A;  1TIZ A;  4DS7 A;  4BY5 A;  5K89 A;  1NSH A;  1SCM B;  3AKB A;  3O78 A;  2CCM A;  1CLB A;  3OHM B;  3SG6 A;  1W7I B;  3OB1 B;  2JRF A;  2BE6 A;  4GNK B;  5AAN A;  1CFF A;  1S3P A;  1KQV A;  2G2B A;  1PVA A;  2KSP A;  1QLS A;  3BUX B;  2KOT A;  2E6W A;  3CWG A;  4NQG A;  4OKH A;  2PAS A;  1N0Y A;  2AMI A;  4OV2 A;  5KSZ A;  1LKJ A;  1DT7 B;  2CNP A;  5KU1 A;  2LC5 A;  1AK8 A;  3LCP C;  2KBI A;  1KFX L;  1S5G Y;  4AQJ A;  1IGV A;  3NSI A;  2LAN A;  1JWD A;  3CR5 X;  1B7T Z;  3DF0 A;  1SNL A;  1V1G A;  4CID A;  1A75 A;  1NCY A;  2F8P A;  2JT8 A;  2M29 A;  4USL A;  4C0K A;  1FPW A;  2MLE C;  1N65 A;  1XA5 A;  1ZAC A;  4R1E A;  1WRL A;  3OX6 A;  2JXL A;  1L2O B;  1QLK A;  2K0J A;  2KI4 C;  4PDZ A;  4YBH B;  2LVI A;  1QJT A;  2K7B A;  3JVT C;  4NDB A;  1BT6 A;  1CDN A;  1MQ1 A;  3NSO A;  1XYD A;  4Q04 A;  3TUY C;  1HQV A;  2M0R A;  3M0W A;  4QJ4 B;  1UHI A;  1PRW A;  2D8N A;  1EL4 A;  1KWO C;  3LL8 B;  1PK0 D;  2CT9 A;  1A4P A;  1G4Y R;  4PE1 A;  1KK7 Z;  1K9P A;  1G8I A;  1SKT A;  3PN7 C;  3KHE A;  3BXK A;  2TN4 A;  1IQ3 A;  4IL1 A;  2A4J A;  1SCV A;  1XVJ A;  3LK1 A;  3LLE A;  4YGC B;  2DOQ A;  1K9K A;  1UP5 A;  1CDM A;  4F0Z B;  5CSI A;  5AFP A;  1DJG A;  4PE4 A;  2JTT A;  3D0Y A;  1BU3 A;  1OSA A;  4MZJ A;  3HCM A;  2OS8 B;  5HKZ A;  1EG4 A;  3CLN A;  5JJG A;  5F6T A;  1YUT A;  1QX5 B;  2JU0 A;  1M63 B;  2ZKM X;  1K94 A;  1LVC D;  3I5F C;  1J1D A;  1OQP A;  4PE0 A;  4YGE B;  3WXA A;  1M45 A;  2JNX A;  1ZMZ A;  2LV7 A;  4ICB A;  2NXQ A;  3DVK A;  2HF5 A;  1EJ3 A;  1KK7 Y;  4JQ0 D;  1KQM B;  5DKN A;  1SL7 A;  1WY9 A;  2FCD A;  4CLN A;  4ORC B;  4CFQ A;  1IWQ A;  2P6B B;  3EVU A;  2BKI B;  3OP0 A;  1J7R A;  1QVI Z;  1XK4 A;  3SG7 A;  5I8N A;  1CB1 A;  1DJH A;  2KNE A;  1V1F A;  1LA3 A;  2WOR A;  1TNX A;  1BMO A;  4U8D A;  3SIB A;  1FW4 A;  2EC6 C;  1JC2 A;  4MZK A;  2ZNE A;  1YTZ C;  2BL0 B;  3NSK A;  1DTL A;  3OB2 B;  2ZN9 A;  4MSP A;  1BLQ A;  3AKA A;  3RM1 A;  4FTG A;  1XFU O;  2GV5 A;  1ZOT B;  2OTG C;  2ZFD A;  2ZND A;  2GGZ A;  2M9G A;  1KK8 B;  2F2P A;  2F33 A;  1K8U A;  3BOW A;  1TCO B;  1FI5 A;  1UHK A;  5HLO A;  1ALW A;  4MN0 A;  3DVM A;  2PAL A;  2WCF A;  1OMV A;  2BKH B;  4L9M A;  5B8I B;  1D1O A;  4OR9 B;  5AEQ A;  2VRG A;  1S5G Z;  3I5G B;  1FF1 A;  1IJ5 A;  1K95 A;  2LLS A;  3JTD C;  1K2H A;  2LVV A;  1YVL A;  4HRE E;  3KF9 A;  3VRP A;  4AOM A;  2BBM A;  2BEC A;  1LIN A;  5PAL A;  4NDC A;  2MRD A;  3QRX A;  1DF0 B;  3VRN A;  3D10 A;  1JFJ A;  2QPT A;  1Y6W A;  3ZWH A;  2JOJ A;  4MRX A;  4OCI A;  1MXL C;  1BR1 B;  1S26 D;  1SMG A;  3EK4 A;  1QIW A;  3I5H C;  1S6J A;  2BCA A;  2FOT A;  1MUX A;  1B1G A;  3K21 A;  5D7F A;  1SPY A;  2JWW A;  4MRY A;  1CLM A;  4TNC A;  4NDD A;  2BE4 A;  1ZFS A;  1YX7 A;  2SCP A;  4QJ3 B;  4GUK A;  3ICB A;  1XFX O;  2M1K B;  3AAJ A;  3DVE A;  1QTX A;  1IQ5 A;  2KAY A;  2MAZ A;  4PHN A;  1CDL A;  4MLW A;  2M1U A;  1S1E A;  2M97 A;  5KTY A;  1DJZ A;  3CZT X;  4ZCV A;  4WQ2 A;  4XJK A;  1VRK A;  1F4O A;  1JF0 A;  3TS5 C;  1EXR A;  1B8R A;  1M46 A;  2WC8 A;  2JT3 A;  2LMU A;  4PE7 A;  1R2U A;  3EKH A;  5JOL A;  4DIR A;  1WLM A;  2KFF A;  3CR2 A;  2NZ0 A;  1YUR A;  1WDC C;  3BUW B;  1AUI B;  2L0P A;  2H61 A;  2MLF C;  4CFR A;  3IF7 A;  2PRU A;  2ZRT A;  1J7O A;  1OMR A;  3PAL A;  1YUS A;  3IQQ A;  2M7L A;  4YI9 A;  1KQM C;  1PSR A;  1OZO A;  1SR6 B;  1H8B A;  2L51 A;  1SY9 A;  1NUB A;  4ORB B;  2JNF A;  1RK9 A;  1DF0 A;  3FIA A;  2EHB A;  4ETO A;  1QX2 A;  3PLF B;  1DGV A;  2CXJ A;  5HYD A;  1KFX S;  2JT0 A;  4MBE A;  2F3Z A;  1W7J B;  2WCE A;  3PM8 A;  1IKU A;  2PSR A;  1PVB A;  2KGB C;  1CFC A;  1YVH A;  3AAK A;  2Y4Q A;  1NX0 A;  4MEW A;  1QS7 A;  3I5I C;  3SIA A;  3BUN B;  1JUO A;  4M2P A;  5CPV A;  2L4I A;  3WHT B;  3ZNI A;  2CTN A;  2LMT A;  1GGW A;  1NX1 A;  1J1E A;  5D69 A;  4AQI A;  1MF8 B;  2LLU A;  1F8H A;  1QV0 A;  1UWO A;  1XFZ O;  1U5I B;  1CDP A;  1WRK A;  2K7C A;  1KCY A;  2COL B;  1M31 A;  1NWD A;  2KHN A;  1SL8 A;  1AVS A;  4YGD B;  4OVN F;  4GGN A;  3SJS A;  1CLL A;  2H61 C;  2HQW A;  1SBJ A;  2LAP A;  3EK8 A;  1A29 A;  2LP2 A;  1YUU A; 
#chains in the Genus database with same CATH topology
 4DUQ A;  1LS8 A;  2ERB A;  2MA2 A;  2Q91 A;  2WC6 A;  2WND A;  1YR5 A;  5TNC A;  3TDI A;  5I2Q A;  4I5K A;  1DJW A;  5CSF A;  4YGA A;  1UHN A;  2O60 A;  3B86 A;  4PHM A;  1SCM C;  3EK7 A;  4INW A;  1K90 D;  1CTR A;  1PSB A;  1TWO A;  2K2A A;  2LLT A;  2M8U A;  3PAT A;  1JSA A;  1OOI X;  1G33 A;  4YRU A;  1SW8 A;  4FQO A;  1UHJ A;  4CPV A;  1RTP 1;  4I5L B;  1IRJ A;  4MVF A;  1DJI A;  2I94 A;  2MJW B;  3KEV A;  1CMF A;  2KI4 B;  1TCF A;  3S0E A;  1J55 A;  1WRZ A;  3BYA A;  3JVT B;  1YRT B;  3O6B A;  5I2O A;  3TUY B;  1ZUZ A;  2L2E A;  2LMV A;  2LNK A;  4WRI A;  2KI6 C;  1DVI A;  2R2I A;  1PUL A;  2JUL A;  1MXE A;  2L50 A;  2F2O A;  3V2L A;  1DC1 A;  3PN7 B;  4GPL B;  2HQ8 A;  5GQQ C;  4P5O E;  1N2D A;  5AXI A;  1CFD A;  1RRO A;  1B47 A;  4M2Q A;  3NHI A;  3S0A A;  4YGB B;  1MHO A;  1GQM A;  1LA0 A;  5FYX A;  1TNW A;  3CS1 A;  1U5I A;  1OOJ A;  3WHU B;  2PMY A;  3DYE A;  3BFA A;  3CTN A;  1L2O C;  1QAT A;  2AUC A;  2LP3 A;  2LM5 A;  1XK4 C;  2H2K A;  4UPG A;  1GGZ A;  2FCE A;  2LVJ A;  3EVR A;  3I5F B;  4KYN A;  4XYN A;  3VRQ A;  2K60 A;  4PT1 A;  2BCB A;  1JBA A;  1A2X A;  3E3R A;  3O2P A;  1F54 A;  1DGU A;  3GOF A;  4E68 A;  1LXF C;  2KYF A;  3CGA A;  4ZCU A;  4N1G A;  1K9U A;  1AP4 A;  1CM1 A;  2KFH A;  3D78 A;  1UHH A;  1C7W A;  2HET A;  4GBA A;  1NCZ A;  1QIV A;  1SL9 A;  1B8L A;  1BG1 A;  2AAO A;  1ORG A;  4MZL A;  1XFW O;  1XFR A;  2L98 A;  1OOF A;  3FWB A;  3SG3 A;  2F3Y A;  3VRR A;  3MSE B;  3Q8I A;  3SG4 A;  2KAX A;  2G9B A;  1KFU L;  2L5X B;  3EG5 B;  1NX2 A;  3HX4 A;  2LHI A;  3B6X A;  3PFV A;  1REC A;  2OPO A;  2MHH A;  2OS8 C;  2FJU B;  1SK6 D;  1QX7 A;  3SS4 A;  1YRU B;  2EC6 B;  2JPT A;  2LUC A;  2WCK A;  2JQ6 A;  1IG5 A;  3EKJ A;  3FS7 A;  1S36 A;  3CR4 X;  3D0Y B;  2WCH A;  2LCP A;  1AJ4 A;  1ODB A;  1NP8 A;  2K8M B;  2KI6 D;  3CDN A;  3B7A A;  2KBM A;  1C7V A;  1AJ5 A;  4PCW A;  3GK2 A;  1K93 D;  2OTG B;  2KAV A;  2QEH A;  1PAL A;  3LK0 A;  3NHT A;  4HRG A;  3TDU A;  1XFY O;  1MWN A;  1F4Q A;  2LUX A;  4P2Y B;  3FWC A;  1BOC A;  3C1V A;  1JFK A;  1SYM A;  1NCX A;  2YGU A;  2BCX A;  2O5G A;  3H4S E;  1Y0V H;  1XO5 A;  3SG2 A;  3SS3 A;  1TRF A;  2M7N A;  1M39 A;  1UUR A;  1K96 A;  3R1P A;  3SS5 A;  1DJX A;  1IH0 A;  2NCP A;  2NLN A;  1E8A A;  3D77 A;  1TOP A;  3JTD B;  3KPX A;  2JTZ A;  1KFU S;  1QXP A;  5DKR A;  3IQO A;  2MBX A;  1RJV A;  5BPJ A;  1UUS A;  2BL0 C;  1BR4 B;  3TDZ A;  4A4B A;  1CKK A;  2KYC A;  3A4U B;  3NXA A;  3QME A;  1FI6 A;  1TNP A;  4I5J A;  5I94 A;  1F71 A;  2WC5 A;  1HT9 A;  5G08 A;  2CBL A;  3RLZ A;  2ISD A;  3I5H B;  5DKQ A;  1OE9 B;  1R6P A;  1JF2 A;  4WQ3 A;  2HPS A;  2L5Y A;  2QEV A;  4DCK A;  2I2R E;  3DVJ A;  1KK8 C;  3BUO B;  1CM4 A;  4C0J A;  3R72 A;  4YI8 A;  1DEK A;  5DIC A;  1EG3 A;  1AHR A;  3WNX B;  3FE6 A;  1RFJ A;  4QJ5 B;  1NX3 A;  2KDH A;  4GGF A;  4C0L A;  1MR8 A;  1C07 A;  1OZS A;  1TN4 A;  1B7T Y;  2Y1N A;  3VGO A;  5AER A;  3I5G C;  3K1E A;  3PM2 A;  1FBV A;  2ZRS A;  1F55 A;  3BOW B;  1A03 A;  1CMG A;  1WLZ A;  3GK1 A;  4N5X A;  4I5N B;  5I2L A;  2WCM A;  3TS5 B;  5J3X A;  2IS9 A;  2ZN8 A;  1TTX A;  1B9A A;  1YX8 A;  1NIW A;  1H4B A;  4JPZ B;  3CZ1 A;  1X02 A;  5CSN A;  2Y1M A;  3O4X A;  1SSE B;  2RGI A;  2SAS A;  2WCB A;  4DRW A;  2KQ6 A;  4PAL A;  4GAO A;  2BBN A;  1WDC B;  1TNQ A;  2B1U A;  3CZ2 A;  4N1F A;  5HLV A;  3D73 A;  4D1E A;  2I18 A;  1Y1U A;  3BQ3 A;  4FQT A;  2V53 A;  3S0F A;  1DJY A;  1QAS A;  2EGD A;  1BJF A;  1SRA A;  1B8C A;  2K7D A;  3BUM B;  3CYZ A;  3PSR A;  3SG5 A;  2WOS A;  1Z4H A;  3TZ1 A;  2K61 A;  1B4C A;  1IIO A;  4PHJ A;  1KWO B;  1S6I A;  2Q4U A;  1T14 A;  4HRH A;  2GTE A;  2JZI A;  3F45 A;  1W9Z A;  1Y1A A;  2I7A A;  1J7Q A;  3NSL A;  2M3W A;  2LHL A;  3OX5 A;  1EH2 A;  1IJ6 A;  1DMO A;  4HSZ A;  4ORA B;  1S6C A;  1J7P A;  2KFG A;  3VRO A;  4GGF C;  3EVV A;  1ALV A;  2PVB A;  2M49 B;  4BY4 A;  2KGR A;  1RWY A;  1NPQ A;  2GGM A;  3DD4 A;  4GFT A;  2K2F A;  2NCO A;  1CFP A;  4M2O A;  2K7O A;  1Q80 A;  2QAC A;  2L4H A;  3I5I B;  4XJK B;  3RZS A;  2Y5I A;  2LE9 B;  3DY9 A;  5HKW A;  3DF0 B;  1GJY A;  1A75 B;  1OMD A;  5HKY A;  1L7Z A;  2JC2 A;  1F70 A;  1XFV O;  3R1V A;  1SR6 C;  1NYA A;  2LVK A;  1BOD A;  1KSO A;  1CNP A;  4PHK A;  2JXC A;  3L4A A;  1KSM A;  4A4C A;  3O4Y A;  3GK4 X;  2E30 A;  3KO0 A;  3PJI A;  5ER5 A;  1QVI Y;  1Y1X A;  5CSJ A;  4JWQ A;  1QV1 A;  5IBW A;  5ER4 X;  1TUJ A;  3A8R A;  2KQY A;  1TIZ A;  4DS7 A;  4BY5 A;  5K89 A;  1NSH A;  1SCM B;  3AKB A;  3O78 A;  2CCM A;  1CLB A;  1TUZ A;  3OHM B;  3SG6 A;  1W7I B;  2QEO A;  3OB1 B;  2JRF A;  2BE6 A;  4GNK B;  5AAN A;  1OOH A;  1CFF A;  1S3P A;  1KQV A;  2G2B A;  1PVA A;  2KSP A;  1QLS A;  2KLE A;  3BUX B;  2KOT A;  2E6W A;  3CWG A;  4NQG A;  4OKH A;  2PAS A;  1N0Y A;  2AMI A;  4OV2 A;  5KSZ A;  1LKJ A;  1DT7 B;  2CNP A;  5KU1 A;  2LC5 A;  1AK8 A;  3LCP C;  3NGV A;  2KBI A;  1KFX L;  1S5G Y;  4AQJ A;  1IGV A;  5EL2 A;  3NSI A;  2LAN A;  5D3O A;  3CR5 X;  1JWD A;  1B7T Z;  3DF0 A;  1BF5 A;  1SNL A;  1V1G A;  3S0B A;  1A75 A;  4CID A;  1NCY A;  2F8P A;  2JT8 A;  2M29 A;  4USL A;  4C0K A;  1FPW A;  2MLE C;  1C3Z A;  1N65 A;  1XA5 A;  1ZAC A;  1GM0 A;  4R1E A;  1WRL A;  2PYQ A;  3OX6 A;  2JXL A;  1L2O B;  1QLK A;  2K0J A;  2KI4 C;  4PDZ A;  4YBH B;  2LVI A;  1QJT A;  2K7B A;  3JVT C;  4NDB A;  1BT6 A;  1CDN A;  1MQ1 A;  3NSO A;  1XYD A;  2FJY A;  4Q04 A;  1HQV A;  2M0R A;  3M0W A;  4QJ4 B;  3TUY C;  1UHI A;  1PRW A;  2D8N A;  1EL4 A;  1KWO C;  3LL8 B;  1PK0 D;  2CT9 A;  1A4P A;  1G4Y R;  4PE1 A;  1KK7 Z;  4INX A;  1K9P A;  1G8I A;  1SKT A;  3PN7 C;  3KHE A;  2WCL A;  2TN4 A;  3BXK A;  1IQ3 A;  3VB1 A;  4IL1 A;  2JPO A;  2A4J A;  1SCV A;  1XVJ A;  3LK1 A;  3LLE A;  4YGC B;  2DOQ A;  1K9K A;  1UP5 A;  1CDM A;  3OBV A;  4F0Z B;  5CSI A;  5AFP A;  2QEB A;  1DJG A;  4PE4 A;  2JTT A;  3D0Y A;  1BU3 A;  1OSA A;  4MZJ A;  3HCM A;  2L2C A;  2OS8 B;  5HKZ A;  1EG4 A;  3CLN A;  5JJG A;  5F6T A;  1YUT A;  1QX5 B;  2JU0 A;  1M63 B;  2ZKM X;  1K94 A;  3FE8 A;  1LVC D;  3I5F C;  1J1D A;  1OQP A;  4PE0 A;  4YGE B;  1DEL A;  3WXA A;  1M45 A;  2JNX A;  1ZMZ A;  2LV7 A;  4ICB A;  2NXQ A;  3DVK A;  2HF5 A;  1EJ3 A;  1KK7 Y;  4JQ0 D;  1KQM B;  5DKN A;  1SL7 A;  1WY9 A;  2FCD A;  4CLN A;  4ORC B;  4CFQ A;  1KCY A;  1IWQ A;  2P6B B;  3EVU A;  2BKI B;  3OP0 A;  1J7R A;  1QVI Z;  1XK4 A;  3SG7 A;  5I8N A;  1CB1 A;  1DJH A;  2KNE A;  3UNW A;  1V1F A;  3DXL A;  1LA3 A;  2WOR A;  1TNX A;  5FI2 A;  3S0D A;  1BMO A;  5FI7 A;  4U8D A;  3UO9 A;  3BFB A;  3SIB A;  1FW4 A;  2EC6 C;  1OOG A;  1JC2 A;  4MZK A;  2ZNE A;  1YTZ C;  2BL0 B;  3NSK A;  1DTL A;  4F7F A;  3OB2 B;  2ZN9 A;  4MSP A;  1BLQ A;  3AKA A;  3RM1 A;  4FTG A;  1XFU O;  2GV5 A;  1ZOT B;  2OTG C;  2ZFD A;  2ZND A;  2GGZ A;  2M9G A;  1KK8 B;  2KLD A;  2F2P A;  2F33 A;  3CAB A;  1K8U A;  3BOW A;  1TCO B;  1C3Y A;  1FI5 A;  1UHK A;  5HLO A;  1ALW A;  4MN0 A;  3DVM A;  2PAL A;  2WCF A;  1OMV A;  2BKH B;  4L9M A;  5B8I B;  1D1O A;  4OR9 B;  5AEQ A;  2QDI A;  2VRG A;  1S5G Z;  3I5G B;  1FF1 A;  1IJ5 A;  1K95 A;  2LLS A;  3JTD C;  1K2H A;  2LVV A;  1YVL A;  4HRE E;  3CZ0 A;  3KF9 A;  4JD9 A;  3VRP A;  4AOM A;  2BBM A;  2BEC A;  1LIN A;  5PAL A;  4NDC A;  2MRD A;  3QRX A;  1DF0 B;  1DQE A;  3D10 A;  3VRN A;  2QPT A;  1JFJ A;  1Y6W A;  3D75 A;  2JOJ A;  3ZWH A;  2H8V A;  4MRX A;  4OCI A;  1MXL C;  1BR1 B;  1S26 D;  1SMG A;  3EK4 A;  1QIW A;  3I5H C;  1S6J A;  2BCA A;  2FOT A;  3R1O A;  1MUX A;  2P71 A;  1B1G A;  3B88 A;  3K21 A;  5D7F A;  3D74 A;  1SPY A;  2JWW A;  4MRY A;  1CLM A;  4TNC A;  3BFH A;  4NDD A;  2BE4 A;  1ZFS A;  1YX7 A;  2SCP A;  4QJ3 B;  4GUK A;  3ICB A;  1XFX O;  2M1K B;  3AAJ A;  3DVE A;  1QTX A;  1IQ5 A;  2KAY A;  2MAZ A;  4PHN A;  1CDL A;  4MLW A;  2M1U A;  1S1E A;  2M97 A;  5KTY A;  1DJZ A;  3CZT X;  3B87 A;  4ZCV A;  2BAP A;  4WQ2 A;  4XJK A;  1VRK A;  1F4O A;  3S0G A;  1JF0 A;  3DZT A;  3TS5 C;  1EXR A;  1B8R A;  1M46 A;  2WC8 A;  2JT3 A;  4JKT A;  2LMU A;  2P70 A;  4PE7 A;  1R2U A;  3EKH A;  5JOL A;  4DIR A;  1WLM A;  2KFF A;  3CR2 A;  2NZ0 A;  1YUR A;  1WDC C;  3BUW B;  1AUI B;  2L0P A;  2H61 A;  2MLF C;  4CFR A;  3IF7 A;  2PRU A;  2ZRT A;  3D76 A;  1J7O A;  1OMR A;  1Z2C B;  3PAL A;  1YUS A;  3IQQ A;  2M7L A;  4YI9 A;  2WCJ A;  1KQM C;  2PQL A;  1OW4 A;  3L47 A;  1PSR A;  1OZO A;  1SR6 B;  3BJH A;  1H8B A;  2L51 A;  1SY9 A;  1NUB A;  1P28 A;  4ORB B;  2JNF A;  1RK9 A;  3FE9 A;  1DF0 A;  3FIA A;  2EHB A;  4IJ7 A;  1QWV A;  1QX2 A;  2BNX A;  3PLF B;  1DGV A;  4OZD A;  4ETO A;  5HL1 A;  2CXJ A;  5HYD A;  5FI6 A;  1KFX S;  2JT0 A;  4MBE A;  2F3Z A;  1W7J B;  2WCE A;  3PM8 A;  1IKU A;  2PSR A;  1PVB A;  2KGB C;  1CFC A;  1YVH A;  3AAK A;  3OGN A;  2Y4Q A;  1NX0 A;  4MEW A;  1QS7 A;  3I5I C;  3N7H A;  3SIA A;  3BUN B;  1JUO A;  4M2P A;  5CPV A;  2L4I A;  3WHT B;  3ZNI A;  2CTN A;  2LMT A;  1GGW A;  1NX1 A;  1J1E A;  5D69 A;  4AQI A;  1MF8 B;  2LLU A;  1F8H A;  1QV0 A;  1UWO A;  1XFZ O;  1U5I B;  1CDP A;  1WRK A;  2K7C A;  3L4L A;  2COL B;  1M31 A;  1NWD A;  2KHN A;  1SL8 A;  1AVS A;  2KPH A;  4OVN F;  4GGN A;  4YGD B;  3SJS A;  1CLL A;  2H61 C;  2HQW A;  3IVT A;  1SBJ A;  2LAP A;  3EK8 A;  1A29 A;  2LP2 A;  1YUU A; 
#chains in the Genus database with same CATH homology
 4DUQ A;  2MA2 A;  2WND A;  2Q91 A;  5TNC A;  3TDI A;  1YR5 A;  5I2Q A;  4I5K A;  1DJW A;  5CSF A;  4YGA A;  1UHN A;  2O60 A;  4PHM A;  1SCM C;  3EK7 A;  1K90 D;  1CTR A;  1PSB A;  2K2A A;  2LLT A;  2M8U A;  3PAT A;  1JSA A;  1G33 A;  4YRU A;  1SW8 A;  4FQO A;  1UHJ A;  4CPV A;  1RTP 1;  4I5L B;  1IRJ A;  4MVF A;  1DJI A;  2I94 A;  2MJW B;  3KEV A;  1CMF A;  2KI4 B;  1TCF A;  1J55 A;  1WRZ A;  3BYA A;  3JVT B;  1YRT B;  3O6B A;  5I2O A;  3TUY B;  1ZUZ A;  2L2E A;  2LMV A;  2LNK A;  4WRI A;  2KI6 C;  1DVI A;  2R2I A;  1PUL A;  2JUL A;  1MXE A;  2L50 A;  2F2O A;  3PN7 B;  4GPL B;  2HQ8 A;  5GQQ C;  4P5O E;  1N2D A;  5AXI A;  1CFD A;  1RRO A;  1B47 A;  4M2Q A;  4YGB B;  1MHO A;  1GQM A;  1LA0 A;  5FYX A;  1TNW A;  3CS1 A;  1U5I A;  1OOJ A;  3WHU B;  2PMY A;  3CTN A;  1L2O C;  1QAT A;  2AUC A;  2LP3 A;  2LM5 A;  1XK4 C;  2H2K A;  4UPG A;  1GGZ A;  2FCE A;  2LVJ A;  3EVR A;  3I5F B;  4XYN A;  3VRQ A;  2BCB A;  1JBA A;  1A2X A;  3E3R A;  3O2P A;  1F54 A;  1DGU A;  3GOF A;  4E68 A;  1LXF C;  2KYF A;  3CGA A;  4ZCU A;  4N1G A;  1K9U A;  1AP4 A;  1CM1 A;  2KFH A;  1UHH A;  1C7W A;  2HET A;  4GBA A;  1NCZ A;  1QIV A;  1SL9 A;  1B8L A;  1BG1 A;  2AAO A;  4MZL A;  1XFW O;  2L98 A;  3FWB A;  3SG3 A;  2F3Y A;  3VRR A;  3MSE B;  1BF5 A;  3SG4 A;  2KAX A;  2G9B A;  1KFU L;  2L5X B;  3HX4 A;  1NX2 A;  3PFV A;  2LHI A;  1REC A;  2OPO A;  2MHH A;  2OS8 C;  2FJU B;  1SK6 D;  1QX7 A;  1YRU B;  2EC6 B;  2JPT A;  2LUC A;  2JQ6 A;  1IG5 A;  3EKJ A;  3FS7 A;  1S36 A;  3CR4 X;  3D0Y B;  2LCP A;  1AJ4 A;  1ODB A;  1NP8 A;  2K8M B;  2KI6 D;  2KBM A;  1C7V A;  1AJ5 A;  4PCW A;  3GK2 A;  1K93 D;  2OTG B;  2KAV A;  3LK0 A;  1PAL A;  4HRG A;  3TDU A;  1XFY O;  1MWN A;  1F4Q A;  2LUX A;  4P2Y B;  3FWC A;  1BOC A;  3C1V A;  1JFK A;  1SYM A;  1NCX A;  3SG2 A;  2BCX A;  2O5G A;  3H4S E;  1Y0V H;  1XO5 A;  1TRF A;  2M7N A;  1M39 A;  1UUR A;  1K96 A;  1DJX A;  1IH0 A;  2NCP A;  2NLN A;  1E8A A;  3JTD B;  1TOP A;  3KPX A;  2JTZ A;  1KFU S;  1QXP A;  5DKR A;  3IQO A;  2MBX A;  1RJV A;  5BPJ A;  1UUS A;  2BL0 C;  1BR4 B;  3TDZ A;  4A4B A;  1CKK A;  2KYC A;  3A4U B;  3NXA A;  1FI6 A;  1TNP A;  4I5J A;  1F71 A;  1HT9 A;  5G08 A;  2CBL A;  3RLZ A;  2ISD A;  3I5H B;  5DKQ A;  1OE9 B;  1R6P A;  1JF2 A;  4WQ3 A;  2HPS A;  4DCK A;  2I2R E;  3DVJ A;  1KK8 C;  3BUO B;  1CM4 A;  4C0J A;  4YI8 A;  1EG3 A;  1AHR A;  3WNX B;  1RFJ A;  4QJ5 B;  1NX3 A;  2KDH A;  4GGF A;  4C0L A;  1MR8 A;  1C07 A;  1OZS A;  1TN4 A;  1B7T Y;  2Y1N A;  3VGO A;  5AER A;  3I5G C;  1FBV A;  2ZRS A;  1F55 A;  3BOW B;  1A03 A;  1CMG A;  1WLZ A;  3GK1 A;  4N5X A;  4I5N B;  5I2L A;  3TS5 B;  5J3X A;  2IS9 A;  2ZN8 A;  1TTX A;  1B9A A;  1YX8 A;  1NIW A;  1H4B A;  4JPZ B;  1X02 A;  5CSN A;  2Y1M A;  2RGI A;  2SAS A;  2WCB A;  4DRW A;  2KQ6 A;  4PAL A;  4GAO A;  2BBN A;  1WDC B;  1TNQ A;  2B1U A;  4N1F A;  5HLV A;  4D1E A;  2I18 A;  1Y1U A;  3BQ3 A;  2V53 A;  1DJY A;  1QAS A;  2EGD A;  1BJF A;  1SRA A;  1B8C A;  2K7D A;  3BUM B;  3PSR A;  3SG5 A;  3TZ1 A;  2WOS A;  1B4C A;  2K61 A;  4PHJ A;  1KWO B;  1S6I A;  2Q4U A;  4HRH A;  2JZI A;  3F45 A;  1Y1A A;  2I7A A;  1J7Q A;  3NSL A;  2M3W A;  2LHL A;  3OX5 A;  1EH2 A;  1IJ6 A;  1DMO A;  4HSZ A;  4ORA B;  1S6C A;  1J7P A;  2KFG A;  3VRO A;  4GGF C;  3EVV A;  1ALV A;  2PVB A;  2M49 B;  4BY4 A;  2KGR A;  1RWY A;  1NPQ A;  2GGM A;  3DD4 A;  4GFT A;  2K2F A;  2NCO A;  1CFP A;  4M2O A;  2K7O A;  1Q80 A;  2QAC A;  2L4H A;  3I5I B;  4XJK B;  2Y5I A;  2LE9 B;  5HKW A;  3DF0 B;  1GJY A;  1A75 B;  1OMD A;  5HKY A;  1L7Z A;  2JC2 A;  1F70 A;  1XFV O;  1SR6 C;  1NYA A;  2LVK A;  1BOD A;  1KSO A;  1CNP A;  4PHK A;  2JXC A;  1KSM A;  4A4C A;  3O4Y A;  3GK4 X;  2E30 A;  3KO0 A;  5ER5 A;  1QVI Y;  1Y1X A;  5CSJ A;  4JWQ A;  1QV1 A;  5IBW A;  5ER4 X;  3A8R A;  2KQY A;  1TIZ A;  4DS7 A;  4BY5 A;  5K89 A;  1NSH A;  1SCM B;  3AKB A;  3O78 A;  2CCM A;  1CLB A;  3OHM B;  3SG6 A;  1W7I B;  3OB1 B;  2JRF A;  2BE6 A;  4GNK B;  5AAN A;  1CFF A;  1S3P A;  1KQV A;  2G2B A;  1PVA A;  2KSP A;  1QLS A;  3BUX B;  2KOT A;  2E6W A;  3CWG A;  4NQG A;  4OKH A;  2PAS A;  1N0Y A;  2AMI A;  4OV2 A;  5KSZ A;  1LKJ A;  1DT7 B;  2CNP A;  5KU1 A;  2LC5 A;  1AK8 A;  3LCP C;  2KBI A;  1KFX L;  1S5G Y;  4AQJ A;  1IGV A;  3NSI A;  2LAN A;  1JWD A;  3CR5 X;  1B7T Z;  3DF0 A;  1SNL A;  1V1G A;  4CID A;  1A75 A;  1NCY A;  2F8P A;  2JT8 A;  2M29 A;  4USL A;  4C0K A;  1FPW A;  2MLE C;  1N65 A;  1XA5 A;  1ZAC A;  4R1E A;  1WRL A;  3OX6 A;  2JXL A;  1L2O B;  1QLK A;  2K0J A;  2KI4 C;  4PDZ A;  4YBH B;  2LVI A;  1QJT A;  2K7B A;  3JVT C;  4NDB A;  1BT6 A;  1CDN A;  1MQ1 A;  3NSO A;  1XYD A;  4Q04 A;  3TUY C;  1HQV A;  2M0R A;  3M0W A;  4QJ4 B;  1UHI A;  1PRW A;  2D8N A;  1EL4 A;  1KWO C;  3LL8 B;  1PK0 D;  2CT9 A;  1A4P A;  1G4Y R;  4PE1 A;  1KK7 Z;  1K9P A;  1G8I A;  1SKT A;  3PN7 C;  3KHE A;  3BXK A;  2TN4 A;  1IQ3 A;  4IL1 A;  2A4J A;  1SCV A;  1XVJ A;  3LK1 A;  3LLE A;  4YGC B;  2DOQ A;  1K9K A;  1UP5 A;  1CDM A;  4F0Z B;  5CSI A;  5AFP A;  1DJG A;  4PE4 A;  2JTT A;  3D0Y A;  1BU3 A;  1OSA A;  4MZJ A;  3HCM A;  2OS8 B;  5HKZ A;  1EG4 A;  3CLN A;  5JJG A;  5F6T A;  1YUT A;  1QX5 B;  2JU0 A;  1M63 B;  2ZKM X;  1K94 A;  1LVC D;  3I5F C;  1J1D A;  1OQP A;  4PE0 A;  4YGE B;  3WXA A;  1M45 A;  2JNX A;  1ZMZ A;  2LV7 A;  4ICB A;  2NXQ A;  3DVK A;  2HF5 A;  1EJ3 A;  1KK7 Y;  4JQ0 D;  1KQM B;  5DKN A;  1SL7 A;  1WY9 A;  2FCD A;  4CLN A;  4ORC B;  4CFQ A;  1IWQ A;  2P6B B;  3EVU A;  2BKI B;  3OP0 A;  1J7R A;  1QVI Z;  1XK4 A;  3SG7 A;  5I8N A;  1CB1 A;  1DJH A;  2KNE A;  1V1F A;  1LA3 A;  2WOR A;  1TNX A;  1BMO A;  4U8D A;  3SIB A;  1FW4 A;  2EC6 C;  1JC2 A;  4MZK A;  2ZNE A;  1YTZ C;  2BL0 B;  3NSK A;  1DTL A;  3OB2 B;  2ZN9 A;  4MSP A;  1BLQ A;  3AKA A;  3RM1 A;  4FTG A;  1XFU O;  2GV5 A;  1ZOT B;  2OTG C;  2ZFD A;  2ZND A;  2GGZ A;  2M9G A;  1KK8 B;  2F2P A;  2F33 A;  1K8U A;  3BOW A;  1TCO B;  1FI5 A;  1UHK A;  5HLO A;  1ALW A;  4MN0 A;  3DVM A;  2PAL A;  2WCF A;  1OMV A;  2BKH B;  4L9M A;  5B8I B;  1D1O A;  4OR9 B;  5AEQ A;  2VRG A;  1S5G Z;  3I5G B;  1FF1 A;  1IJ5 A;  1K95 A;  2LLS A;  3JTD C;  1K2H A;  2LVV A;  1YVL A;  4HRE E;  3KF9 A;  3VRP A;  4AOM A;  2BBM A;  2BEC A;  1LIN A;  5PAL A;  4NDC A;  2MRD A;  3QRX A;  1DF0 B;  3VRN A;  3D10 A;  1JFJ A;  2QPT A;  1Y6W A;  3ZWH A;  2JOJ A;  4MRX A;  4OCI A;  1MXL C;  1BR1 B;  1S26 D;  1SMG A;  3EK4 A;  1QIW A;  3I5H C;  1S6J A;  2BCA A;  2FOT A;  1MUX A;  1B1G A;  3K21 A;  5D7F A;  1SPY A;  2JWW A;  4MRY A;  1CLM A;  4TNC A;  4NDD A;  2BE4 A;  1ZFS A;  1YX7 A;  2SCP A;  4QJ3 B;  4GUK A;  3ICB A;  1XFX O;  2M1K B;  3AAJ A;  3DVE A;  1QTX A;  1IQ5 A;  2KAY A;  2MAZ A;  4PHN A;  1CDL A;  4MLW A;  2M1U A;  1S1E A;  2M97 A;  5KTY A;  1DJZ A;  3CZT X;  4ZCV A;  4WQ2 A;  4XJK A;  1VRK A;  1F4O A;  1JF0 A;  3TS5 C;  1EXR A;  1B8R A;  1M46 A;  2WC8 A;  2JT3 A;  2LMU A;  4PE7 A;  1R2U A;  3EKH A;  5JOL A;  4DIR A;  1WLM A;  2KFF A;  3CR2 A;  2NZ0 A;  1YUR A;  1WDC C;  3BUW B;  1AUI B;  2L0P A;  2H61 A;  2MLF C;  4CFR A;  3IF7 A;  2PRU A;  2ZRT A;  1J7O A;  1OMR A;  3PAL A;  1YUS A;  3IQQ A;  2M7L A;  4YI9 A;  1KQM C;  1PSR A;  1OZO A;  1SR6 B;  1H8B A;  2L51 A;  1SY9 A;  1NUB A;  4ORB B;  2JNF A;  1RK9 A;  1DF0 A;  3FIA A;  2EHB A;  4ETO A;  1QX2 A;  3PLF B;  1DGV A;  2CXJ A;  5HYD A;  1KFX S;  2JT0 A;  4MBE A;  2F3Z A;  1W7J B;  2WCE A;  3PM8 A;  1IKU A;  2PSR A;  1PVB A;  2KGB C;  1CFC A;  1YVH A;  3AAK A;  2Y4Q A;  1NX0 A;  4MEW A;  1QS7 A;  3I5I C;  3SIA A;  3BUN B;  1JUO A;  4M2P A;  5CPV A;  2L4I A;  3WHT B;  3ZNI A;  2CTN A;  2LMT A;  1GGW A;  1NX1 A;  1J1E A;  5D69 A;  4AQI A;  1MF8 B;  2LLU A;  1F8H A;  1QV0 A;  1UWO A;  1XFZ O;  1U5I B;  1CDP A;  1WRK A;  2K7C A;  1KCY A;  2COL B;  1M31 A;  1NWD A;  2KHN A;  1SL8 A;  1AVS A;  4YGD B;  4OVN F;  4GGN A;  3SJS A;  1CLL A;  2H61 C;  2HQW A;  1SBJ A;  2LAP A;  3EK8 A;  1A29 A;  2LP2 A;  1YUU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...