1W9ZA

Structure of bannavirus vp9
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
257
structure length
257
Chain Sequence
ALPSNVKLSKGEVEKIAVTKKEMFDELAQCNLPTIELITREHTFNGDVIRFAAWLFLMNGQKLMIANNVAVRMGMQYATNLAGNNVKITYVTSNNVVKLGHIAAGVLANPYSNKGSGLFITYEHNLISNQIETGKVCVLFITSLSTTASSTNSFAYSACSVPIEDWDFNMIKLTAETSCASLTAMTNLVNSLVPGERTRPVGLYVDIPGVTVTTSASSGSLPLTTIPAVTPLIFSAYTKQVEEVGVINTLYALSYLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure and Function of the Outer Coat Protein Vp9 of Banna Virus
pubmed doi rcsb
source organism Banna virus
molecule tags Virus coat protein
molecule keywords VP9
total genus 58
structure length 257
sequence length 257
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08978 Reoviridae_Vp9 Reoviridae VP9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.140 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 1w9zA01
1W9ZA
chains in the Genus database with same CATH superfamily
4YBHB 3OX6A 3AKBA 1YVLA 2EC6B 4ORAB 4YGAA 2M3WA 1DJXA 1JF0A 3CR4X 1F70A 1QIWA 1L7ZA 1QLKA 1SL9A 4PHJA 4E68A 3BFHA 2LUXA 4MRXA 3S0FA 1NYAA 1WRZA 3NXAA 4PALA 3JVTC 3SG2A 4N1GA 3CZ0A 4C0KA 2WCHA 5KU1A 1PSBA 4F7FA 1OOHA 1DEKA 3TUYB 2L4IA 4ETOA 1UHIA 1TIZA 1M63B 3K21A 1WLZA 3PALA 2M1UA 3VGOA 2NCOA 3B88A 3FS7A 2KYFA 4U8DA 3SG6A 1CFFA 2JTTA 4AQJA 4I5NB 2JC2A 2LLUA 1NPQA 1FI5A 3I5GC 1B9AA 5HLOA 5I2LA 3I5GB 5G08A 2O5GA 5JJGA 4QJ4B 2HQWA 2KFGA 2R2IA 1NUBA 2CNPA 2LV7A 3O4XA 4YI8A 1CLBA 1JC2A 2D8NA 2KLEA 2JOJA 3EVUA 1CMFA 1TRFA 3KF9A 1VRKA 1QJTA 1TN4A 3A4UB 3KEVA 1AUIB 1J7PA 2QDIA 3L4LA 1XFVO 3I5FC 1TUZA 2FJYA 3TDZA 2IS9A 1AP4A 3DD4A 1C7VA 1GJYA 2P70A 1BF5A 2ZN8A 2LM5A 3WHUB 4CFQA 1XFWO 3I5HC 5HKWA 3BXKA 2K7DA 1DELA 5ER4X 4MVFA 2JQ6A 2PSRA 1YURA 3CTNA 2P6BB 1BR4B 1E8AA 4OVNF 4INXA 1BU3A 1MR8A 5CSJA 4P5OE 3S0EA 2M29A 1UWOA 1S5GZ 1BOCA 4C0JA 1CDLA 2LANA 2CCMA 5CPVA 2SASA 1RECA 1TNPA 5FI2A 3TZ1A 3C1VA 1SCMC 2KI4C 3FE8A 1K94A 1K95A 3M0WA 1IQ5A 2ZKMX 1KSMA 5IBWA 4N1FA 1KQMB 1YUTA 2FCDA 5AERA 1DQEA 1SL8A 1XK4A 3O4YA 3NSOA 3PFVA 1HQVA 1SKTA 3SS5A 3UO9A 1PK0D 2JULA 2LHIA 2L4HA 2JZIA 2GGZA 2Y1NA 2ZRTA 1M31A 1PSRA 1KFUS 3RLZA 1T14A 3WHTB 1KQMC 3NHTA 1QV0A 3GK2A 4IJ7A 1S6IA 4FQOA 2LVVA 2K0JA 3B87A 1FI6A 3TDIA 2ZRSA 1CLMA 3D73A 3SJSA 5HLVA 3VRPA 1B7TY 3EKJA 2JXCA 3L47A 2M49B 1BR1B 4ORBB 3TS5C 1DVIA 1RFJA 1UHJA 2LCPA 1Y6WA 2CT9A 3A8RA 3CLNA 2LMVA 1QLSA 1K9PA 2EC6C 3DVMA 4JWQA 4DRWA 1OMDA 3BUNB 1F71A 2BKHB 2PVBA 2OTGB 2LLSA 2WNDA 3BJHA 3CR2A 2QPTA 2WCKA 2E6WA 3CGAA 1QATA 3TDUA 4F0ZB 2KHNA 2LVKA 1EL4A 5F6TA 1DC1A 1FBVA 3VRNA 1IIOA 2M7NA 1UHHA 2MLFC 2I94A 3D74A 4MZJA 2FCEA 3S0AA 2CTNA 1CB1A 1NX3A 3D0YA 2K60A 2HQ8A 1C3YA 1KK8B 1R6PA 2WC8A 2Y5IA 1LXFC 4NDDA 4ZCUA 2F3YA 1KWOC 1H4BA 3GK4X 3IQOA 1SPYA 3CS1A 2BL0C 2L5YA 3O2PA 2RGIA 1SR6B 1JF2A 1CKKA 1B47A 2B1UA 2ZN9A 5AFPA 3VRQA 2JPOA 3EG5B 4A4BA 1IJ6A 1DJYA 2KQYA 1DJHA 3BUMB 4MBEA 3BOWA 1YUUA 3DYEA 2PMYA 4PHMA 4C0LA 1JFJA 1QS7A 1TTXA 4M2OA 3BFBA 2WCLA 1S36A 3N7HA 3SS3A 2KOTA 2LHLA 1ODBA 3BUWB 1NX0A 1F54A 1ZUZA 2KAYA 1GM0A 1J1EA 2CBLA 2BE6A 1W9ZA 3BOWB 3RZSA 2WCMA 4GPLB 1IRJA 4PE7A 2K7CA 5KSZA 2H61C 1CFCA 3FWCA 2BBMA 2ISDA 2LVJA 1XK4C 5D7FA 4CLNA 1V1GA 1HT9A 4YGDB 5CSIA 1MWNA 3FIAA 1DF0A 1BODA 2NZ0A 1IKUA 2BKIB 3B7AA 2GGMA 3DY9A 4BY4A 1OOIX 4IL1A 3JVTB 1XA5A 2KSPA 4GBAA 5D69A 1RTP1 1K96A 1AVSA 1ALVA 1SNLA 3OP0A 1LA0A 1QVIZ 2EGDA 1RROA 1B7TZ 1YUSA 2WC5A 1JFKA 3DZTA 3MSEB 1CFDA 2PALA 2WCJA 5I8NA 2L50A 2QEHA 2L2CA 2PQLA 2P71A 3I5FB 2LC5A 4INWA 2JT8A 4GFTA 2G9BA 1N0YA 3NSKA 1GGZA 1K93D 4UPGA 1SL7A 1IJ5A 4D1EA 2TN4A 1JUOA 4I5KA 2O60A 2ZNEA 4ICBA 4CPVA 5BPJA 5CSNA 2CXJA 1YR5A 2KBMA 3EVRA 2F2OA 1XVJA 2MLEC 1IQ3A 1OSAA 4MSPA 2WOSA 3LK1A 1MUXA 3KO0A 2JXLA 2F2PA 5B8IB 1OZOA 2MAZA 1XFXO 1J7QA 4JQ0D 2Y4QA 3TUYC 3BFAA 1N65A 1KFUL 3EK4A 2BCXA 4HRGA 3I5HB 5AANA 1Y0VH 5I2OA 4YGBB 3D76A 5EL2A 4HRHA 1F8HA 4QJ5B 1OOGA 5ER5A 3NHIA 1CDMA 1A2XA 1K9KA 4ZCVA 5FI7A 3D75A 2K7OA 5K89A 1FF1A 4JPZB 4MRYA 1MXEA 2L0PA 4BY5A 1NSHA 4WQ3A 1M39A 2BCAA 1SY9A 1C7WA 4XYNA 2H61A 2JWWA 2H2KA 4JKTA 2AAOA 1AJ4A 4OKHA 1XFZO 2GV5A 1UURA 1UUSA 1TNWA 2I18A 3B86A 3DVJA 3LLEA 1MQ1A 4HSZA 2KNEA 2ZNDA 4M2QA 4YI9A 4GGFA 2HF5A 1M46A 4AOMA 1TNQA 2F3ZA 1BT6A 1SYMA 3DVKA 1J7RA 3SIBA 1W7JB 3K1EA 1A4PA 1RWYA 3SG4A 1BG1A 2KPHA 3BUXB 4KYNA 4DS7A 2WC6A 2LP2A 1QX5B 3BYAA 4N5XA 2L2EA 3NGVA 1NIWA 2LLTA 4PDZA 3R1VA 3RM1A 1Y1AA 4TNCA 1Q80A 5J3XA 1CDPA 2NCPA 5DKNA 3S0DA 1ALWA 1QX2A 1LKJA 1YVHA 2LVIA 2BAPA 1F4OA 1UHKA 2ZFDA 2KAVA 1J1DA 1SR6C 3OB2B 1IG5A 2Q91A 3FE9A 4PCWA 3I5IB 5GQQC 1OOJA 5DICA 1CM4A 5FI6A 2LNKA 2WCBA 3H4SE 3JTDC 2KBIA 1IH0A 1KSOA 1SK6D 3B6XA 1Z4HA 1TCFA 3OHMB 4XJKA 4P2YB 2OS8B 1XO5A 2BL0B 3SG3A 2M0RA 1IWQA 1Y1UA 1S3PA 3WNXB 1NWDA 1A75A 3LK0A 4OCIA 2HPSA 1ZFSA 4PHKA 1KQVA 2LP3A 1LA3A 2JT0A 2F8PA 4USLA 4YGEB 1BJFA 2OTGC 1C3ZA 3O78A 4PHNA 2KQ6A 1OMRA 2BNXA 3ICBA 3D78A 3AAJA 3R72A 4GNKB 4WRIA 3AAKA 3VRRA 1CLLA 2LMUA 2F33A 1K2HA 3NSIA 1F4QA 1K90D 2K8MB 2QEOA 1DF0B 1GGWA 1WRLA 1PRWA 2JPTA 4DUQA 3TS5B 3VB1A 3DVEA 1JWDA 1PULA 2MA2A 4DIRA 1KK7Y 1K8UA 1AJ5A 4NDCA 4R1EA 3IF7A 1J7OA 1X02A 1S1EA 4NDBA 3FWBA 1DGUA 1CM1A 1UP5A 1Y1XA 1OW4A 1TCOB 3PSRA 2LUCA 3S0GA 1SW8A 1L2OC 4M2PA 3CR5X 3L4AA 1C07A 3SG5A 1SBJA 3EK8A 1DGVA 1QX7A 1U5IB 3I5IC 4GUKA 2QEVA 1B8RA 1JSAA 3F45A 3SG7A 1KWOB 2BE4A 2LMTA 3IQQA 1AK8A 3PLFB 5DKQA 1ORGA 4PE4A 1D1OA 3E3RA 2AMIA 2K61A 3V2LA 3HX4A 5HYDA 1FPWA 1DJZA 5DKRA 1NCZA 2KFFA 3VROA 1BMOA 3Q8IA 1BLQA 3CZ2A 1Z2CB 1XFRA 1NCYA 3PN7C 1WDCC 3FE6A 4FTGA 2I7AA 1G4YR 3O6BA 5HL1A 3KHEA 4GGFC 2ERBA 5AEQA 1H8BA 1MF8B 1DJGA 2SCPA 1S26D 1TOPA 3BQ3A 3QRXA 3SS4A 2FJUB 2MRDA 1ZMZA 1ZACA 1SSEB 1B8CA 3QMEA 2KLDA 1KFXL 3PM2A 1B4CA 3EK7A 3PATA 1XFUO 4ORCB 5CSFA 1KFXS 4PE1A 4CIDA 1QTXA 3CWGA 3OGNA 2JNXA 3EKHA 3BUOB 2L51A 4AQIA 1K9UA 1SRAA 2MHHA 4MEWA 5I94A 4QJ3B 1QWVA 2HETA 1WDCB 2KFHA 2JT3A 3LCPC 3PM8A 1P28A 1LS8A 1AHRA 2FOTA 2QACA 4DCKA 2PYQA 1XFYO 2M8UA 4MLWA 3WXAA 4OR9B 2KYCA 1CFPA 1A03A 1NX2A 5D3OA 4JD9A 4YRUA 1DJIA 1QIVA 2COLB 3PN7B 1F55A 1DTLA 3D77A 1N2DA 1WLMA 2K2FA 1SCMB 3R1OA 1EXRA 5FYXA 2KI6D 1CTRA 3CABA 2BECA 2Q4UA 4FQTA 4HREE 3OX5A 2GTEA 1QVIY 4WQ2A 1G33A 1UHNA 4MN0A 4PT1A 1J55A 1EG3A 4OZDA 2PRUA 3CZ1A 1A29A 1L2OB 1SCVA 1MHOA 2K7BA 2OPOA 4MZLA 1JBAA 3D10A 2JTZA 2KGBC 2BBNA 2PASA 1KK7Z 1QXPA 2YGUA 1TWOA 1V1FA 1YRTB 1GQMA 3ZWHA 1IGVA 4OV2A 1S6JA 1R2UA 4NQGA 2L98A 2BCBA 2E30A 4MZKA 2AUCA 1W7IB 3IVTA 1DJWA 1CNPA 4XJKB 1ZOTB 1NP8A 1RJVA 1OZSA 4A4CA 2I2RE 1A75B 3DF0B 1CDNA 1YX8A 2JU0A 1NX1A 3PJIA 2DOQA 1YRUB 1WRKA 3S0BA 1KCYA 2A4JA 1DT7B 1DMOA 2EHBA 3DF0A 3GOFA 1PVAA 2OS8C 3EVVA 4GAOA 1EH2A 1TUJA 3JTDB 1EJ3A 3R1PA 1EG4A 4Q04A 1MXLC 4PE0A 2KDHA 2JRFA 2JNFA 2M1KB 1B8LA 1S6CA 1QV1A 3UNWA 2V53A 3AKAA 1LINA 2K2AA 5AXIA 3GK1A 2QEBA 5HKZA 1FW4A 1NCXA 5I2QA 1S5GY 4YGCB 2VRGA 1XYDA 4GGNA 1WY9A 1U5IA 5HKYA 1YTZC 3CYZA 3CZTX 3OB1B 1OQPA 4I5JA 2Y1MA 1SMGA 3CDNA 2LE9B 5PALA 1OMVA 1KK8C 2MJWB 1PALA 3LL8B 3OBVA 5JOLA 1OOFA 2G2BA 1YX7A 2LAPA 1G8IA 2NXQA 3KPXA 5TNCA 1LVCD 3DXLA 3SIAA 2H8VA 2KI4B 1B1GA 2M97A 5KTYA 3ZNIA 2KAXA 2WORA 4I5LB 2MBXA 1PVBA 1M45A 4CFRA 1QASA 3HCMA 2L5XB 2M9GA 3NSLA 1OE9B 2NLNA 2M7LA 3D0YB 1TNXA 2WCFA 1CMGA 2WCEA 1RK9A 2KI6C 4L9MA 2KGRA
chains in the Genus database with same CATH topology
2KLEA 1DC1A 5FI6A 5FI2A 3SS3A 4MEWA 5I94A 1Z2CB 4I5JA 2K60A 3KEVA 1W9ZA 2YGUA 1Z4HA 5HL1A 3OBVA 2L5YA 4KYNA 3SS4A 1DEKA 4GAOA 5D3OA 5FI7A 3SS5A 3UO9A 4I5LB 2KLDA 3IVTA 3EG5B 3PM2A 4I5NB 1DELA 4I5KA 2BAPA 3UNWA 2BNXA 4GBAA 4JKTA 4IJ7A 3O4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W9Z A; 
#chains in the Genus database with same CATH topology
 4YBH B;  3OX6 A;  3AKB A;  1YVL A;  2EC6 B;  4ORA B;  4YGA A;  2M3W A;  1DJX A;  1JF0 A;  3CR4 X;  1F70 A;  1QIW A;  1L7Z A;  1QLK A;  1SL9 A;  4PHJ A;  4E68 A;  3BFH A;  2LUX A;  4MRX A;  3S0F A;  1NYA A;  1WRZ A;  3NXA A;  4PAL A;  3JVT C;  3SG2 A;  4N1G A;  3CZ0 A;  4C0K A;  2WCH A;  5KU1 A;  1PSB A;  4F7F A;  1OOH A;  1DEK A;  3TUY B;  2L4I A;  4ETO A;  1UHI A;  1TIZ A;  1M63 B;  3K21 A;  1WLZ A;  3PAL A;  2M1U A;  3VGO A;  2NCO A;  3B88 A;  3FS7 A;  2KYF A;  4U8D A;  3SG6 A;  1CFF A;  2JTT A;  4AQJ A;  4I5N B;  2JC2 A;  2LLU A;  1NPQ A;  1FI5 A;  3I5G C;  1B9A A;  5HLO A;  5I2L A;  3I5G B;  5G08 A;  2O5G A;  5JJG A;  4QJ4 B;  2HQW A;  2KFG A;  2R2I A;  1NUB A;  2CNP A;  2LV7 A;  3O4X A;  4YI8 A;  1CLB A;  1JC2 A;  2D8N A;  2KLE A;  2JOJ A;  3EVU A;  1CMF A;  1TRF A;  3KF9 A;  1VRK A;  1QJT A;  1TN4 A;  3A4U B;  3KEV A;  1AUI B;  1J7P A;  2QDI A;  3L4L A;  1XFV O;  3I5F C;  1TUZ A;  2FJY A;  3TDZ A;  2IS9 A;  1AP4 A;  3DD4 A;  1C7V A;  1GJY A;  2P70 A;  1BF5 A;  2ZN8 A;  2LM5 A;  3WHU B;  4CFQ A;  1XFW O;  3I5H C;  5HKW A;  3BXK A;  2K7D A;  1DEL A;  5ER4 X;  4MVF A;  2JQ6 A;  2PSR A;  1YUR A;  3CTN A;  2P6B B;  1BR4 B;  1E8A A;  4OVN F;  4INX A;  1BU3 A;  1MR8 A;  5CSJ A;  4P5O E;  3S0E A;  2M29 A;  1UWO A;  1S5G Z;  1BOC A;  4C0J A;  1CDL A;  2LAN A;  2CCM A;  5CPV A;  2SAS A;  1REC A;  1TNP A;  5FI2 A;  3TZ1 A;  3C1V A;  1SCM C;  2KI4 C;  3FE8 A;  1K94 A;  1K95 A;  3M0W A;  1IQ5 A;  2ZKM X;  1KSM A;  5IBW A;  4N1F A;  1KQM B;  1YUT A;  2FCD A;  5AER A;  1DQE A;  1SL8 A;  1XK4 A;  3O4Y A;  3NSO A;  3PFV A;  1HQV A;  1SKT A;  3SS5 A;  3UO9 A;  1PK0 D;  2JUL A;  2LHI A;  2L4H A;  2JZI A;  2GGZ A;  2Y1N A;  2ZRT A;  1M31 A;  1PSR A;  1KFU S;  3RLZ A;  1T14 A;  3WHT B;  1KQM C;  3NHT A;  1QV0 A;  3GK2 A;  4IJ7 A;  1S6I A;  4FQO A;  2LVV A;  2K0J A;  3B87 A;  1FI6 A;  3TDI A;  2ZRS A;  1CLM A;  3D73 A;  3SJS A;  5HLV A;  3VRP A;  1B7T Y;  3EKJ A;  2JXC A;  3L47 A;  2M49 B;  1BR1 B;  4ORB B;  3TS5 C;  1DVI A;  1RFJ A;  1UHJ A;  2LCP A;  1Y6W A;  2CT9 A;  3A8R A;  3CLN A;  2LMV A;  1QLS A;  1K9P A;  2EC6 C;  3DVM A;  4JWQ A;  4DRW A;  1OMD A;  3BUN B;  1F71 A;  2BKH B;  2PVB A;  2OTG B;  2LLS A;  2WND A;  3BJH A;  3CR2 A;  2QPT A;  2WCK A;  2E6W A;  3CGA A;  1QAT A;  3TDU A;  4F0Z B;  2KHN A;  2LVK A;  1EL4 A;  5F6T A;  1DC1 A;  1FBV A;  3VRN A;  1IIO A;  2M7N A;  1UHH A;  2MLF C;  2I94 A;  3D74 A;  4MZJ A;  2FCE A;  3S0A A;  2CTN A;  1CB1 A;  1NX3 A;  3D0Y A;  2K60 A;  2HQ8 A;  1C3Y A;  1KK8 B;  1R6P A;  2WC8 A;  2Y5I A;  1LXF C;  4NDD A;  4ZCU A;  2F3Y A;  1KWO C;  1H4B A;  3GK4 X;  3IQO A;  1SPY A;  3CS1 A;  2BL0 C;  2L5Y A;  3O2P A;  2RGI A;  1SR6 B;  1JF2 A;  1CKK A;  1B47 A;  2B1U A;  2ZN9 A;  5AFP A;  3VRQ A;  2JPO A;  3EG5 B;  4A4B A;  1IJ6 A;  1DJY A;  2KQY A;  1DJH A;  3BUM B;  4MBE A;  3BOW A;  1YUU A;  3DYE A;  2PMY A;  4PHM A;  4C0L A;  1JFJ A;  1QS7 A;  1TTX A;  4M2O A;  3BFB A;  2WCL A;  1S36 A;  3N7H A;  3SS3 A;  2KOT A;  2LHL A;  1ODB A;  3BUW B;  1NX0 A;  1F54 A;  1ZUZ A;  2KAY A;  1GM0 A;  1J1E A;  2CBL A;  2BE6 A;  1W9Z A;  3BOW B;  3RZS A;  2WCM A;  4GPL B;  1IRJ A;  4PE7 A;  2K7C A;  5KSZ A;  2H61 C;  1CFC A;  3FWC A;  2BBM A;  2ISD A;  2LVJ A;  1XK4 C;  5D7F A;  4CLN A;  1V1G A;  1HT9 A;  4YGD B;  5CSI A;  1MWN A;  3FIA A;  1DF0 A;  1BOD A;  2NZ0 A;  1IKU A;  2BKI B;  3B7A A;  2GGM A;  3DY9 A;  4BY4 A;  1OOI X;  4IL1 A;  3JVT B;  1XA5 A;  2KSP A;  4GBA A;  5D69 A;  1RTP 1;  1K96 A;  1AVS A;  1ALV A;  1SNL A;  3OP0 A;  1LA0 A;  1QVI Z;  2EGD A;  1RRO A;  1B7T Z;  1YUS A;  2WC5 A;  1JFK A;  3DZT A;  3MSE B;  1CFD A;  2PAL A;  2WCJ A;  5I8N A;  2L50 A;  2QEH A;  2L2C A;  2PQL A;  2P71 A;  3I5F B;  2LC5 A;  4INW A;  2JT8 A;  4GFT A;  2G9B A;  1N0Y A;  3NSK A;  1GGZ A;  1K93 D;  4UPG A;  1SL7 A;  1IJ5 A;  4D1E A;  2TN4 A;  1JUO A;  4I5K A;  2O60 A;  2ZNE A;  4ICB A;  4CPV A;  5BPJ A;  5CSN A;  2CXJ A;  1YR5 A;  2KBM A;  3EVR A;  2F2O A;  1XVJ A;  2MLE C;  1IQ3 A;  1OSA A;  4MSP A;  2WOS A;  3LK1 A;  1MUX A;  3KO0 A;  2JXL A;  2F2P A;  5B8I B;  1OZO A;  2MAZ A;  1XFX O;  1J7Q A;  4JQ0 D;  2Y4Q A;  3TUY C;  3BFA A;  1N65 A;  1KFU L;  3EK4 A;  2BCX A;  4HRG A;  3I5H B;  5AAN A;  1Y0V H;  5I2O A;  4YGB B;  3D76 A;  5EL2 A;  4HRH A;  1F8H A;  4QJ5 B;  1OOG A;  5ER5 A;  3NHI A;  1CDM A;  1A2X A;  1K9K A;  4ZCV A;  5FI7 A;  3D75 A;  2K7O A;  5K89 A;  1FF1 A;  4JPZ B;  4MRY A;  1MXE A;  2L0P A;  4BY5 A;  1NSH A;  4WQ3 A;  1M39 A;  2BCA A;  1SY9 A;  1C7W A;  4XYN A;  2H61 A;  2JWW A;  2H2K A;  4JKT A;  2AAO A;  1AJ4 A;  4OKH A;  1XFZ O;  2GV5 A;  1UUR A;  1UUS A;  1TNW A;  2I18 A;  3B86 A;  3DVJ A;  3LLE A;  1MQ1 A;  4HSZ A;  2KNE A;  2ZND A;  4M2Q A;  4YI9 A;  4GGF A;  2HF5 A;  1M46 A;  4AOM A;  1TNQ A;  2F3Z A;  1BT6 A;  1SYM A;  3DVK A;  1J7R A;  3SIB A;  1W7J B;  3K1E A;  1A4P A;  1RWY A;  3SG4 A;  1BG1 A;  2KPH A;  3BUX B;  4KYN A;  4DS7 A;  2WC6 A;  2LP2 A;  1QX5 B;  3BYA A;  4N5X A;  2L2E A;  3NGV A;  1NIW A;  2LLT A;  4PDZ A;  3R1V A;  3RM1 A;  1Y1A A;  4TNC A;  1Q80 A;  5J3X A;  1CDP A;  2NCP A;  5DKN A;  3S0D A;  1ALW A;  1QX2 A;  1LKJ A;  1YVH A;  2LVI A;  2BAP A;  1F4O A;  1UHK A;  2ZFD A;  2KAV A;  1J1D A;  1SR6 C;  3OB2 B;  1IG5 A;  2Q91 A;  3FE9 A;  4PCW A;  3I5I B;  5GQQ C;  1OOJ A;  5DIC A;  1CM4 A;  5FI6 A;  2LNK A;  2WCB A;  3H4S E;  3JTD C;  2KBI A;  1IH0 A;  1KSO A;  1SK6 D;  3B6X A;  1Z4H A;  1TCF A;  3OHM B;  4XJK A;  4P2Y B;  2OS8 B;  1XO5 A;  2BL0 B;  3SG3 A;  2M0R A;  1IWQ A;  1Y1U A;  1S3P A;  3WNX B;  1NWD A;  1A75 A;  3LK0 A;  4OCI A;  2HPS A;  1ZFS A;  4PHK A;  1KQV A;  2LP3 A;  1LA3 A;  2JT0 A;  2F8P A;  4USL A;  4YGE B;  1BJF A;  2OTG C;  1C3Z A;  3O78 A;  4PHN A;  2KQ6 A;  1OMR A;  2BNX A;  3ICB A;  3D78 A;  3AAJ A;  3R72 A;  4GNK B;  4WRI A;  3AAK A;  3VRR A;  1CLL A;  2LMU A;  2F33 A;  1K2H A;  3NSI A;  1F4Q A;  1K90 D;  2K8M B;  2QEO A;  1DF0 B;  1GGW A;  1WRL A;  1PRW A;  2JPT A;  4DUQ A;  3TS5 B;  3VB1 A;  3DVE A;  1JWD A;  1PUL A;  2MA2 A;  4DIR A;  1KK7 Y;  1K8U A;  1AJ5 A;  4NDC A;  4R1E A;  3IF7 A;  1J7O A;  1X02 A;  1S1E A;  4NDB A;  3FWB A;  1DGU A;  1CM1 A;  1UP5 A;  1Y1X A;  1OW4 A;  1TCO B;  3PSR A;  2LUC A;  3S0G A;  1SW8 A;  1L2O C;  4M2P A;  3CR5 X;  3L4A A;  1C07 A;  3SG5 A;  1SBJ A;  3EK8 A;  1DGV A;  1QX7 A;  1U5I B;  3I5I C;  4GUK A;  2QEV A;  1B8R A;  1JSA A;  3F45 A;  3SG7 A;  1KWO B;  2BE4 A;  2LMT A;  3IQQ A;  1AK8 A;  3PLF B;  5DKQ A;  1ORG A;  4PE4 A;  1D1O A;  3E3R A;  2AMI A;  2K61 A;  3V2L A;  3HX4 A;  5HYD A;  1FPW A;  1DJZ A;  5DKR A;  1NCZ A;  2KFF A;  3VRO A;  1BMO A;  3Q8I A;  1BLQ A;  3CZ2 A;  1Z2C B;  1XFR A;  1NCY A;  3PN7 C;  1WDC C;  3FE6 A;  4FTG A;  2I7A A;  1G4Y R;  3O6B A;  5HL1 A;  3KHE A;  4GGF C;  2ERB A;  5AEQ A;  1H8B A;  1MF8 B;  1DJG A;  2SCP A;  1S26 D;  1TOP A;  3BQ3 A;  3QRX A;  3SS4 A;  2FJU B;  2MRD A;  1ZMZ A;  1ZAC A;  1SSE B;  1B8C A;  3QME A;  2KLD A;  1KFX L;  3PM2 A;  1B4C A;  3EK7 A;  3PAT A;  1XFU O;  4ORC B;  5CSF A;  1KFX S;  4PE1 A;  4CID A;  1QTX A;  3CWG A;  3OGN A;  2JNX A;  3EKH A;  3BUO B;  2L51 A;  4AQI A;  1K9U A;  1SRA A;  2MHH A;  4MEW A;  5I94 A;  4QJ3 B;  1QWV A;  2HET A;  1WDC B;  2KFH A;  2JT3 A;  3LCP C;  3PM8 A;  1P28 A;  1LS8 A;  1AHR A;  2FOT A;  2QAC A;  4DCK A;  2PYQ A;  1XFY O;  2M8U A;  4MLW A;  3WXA A;  4OR9 B;  2KYC A;  1CFP A;  1A03 A;  1NX2 A;  5D3O A;  4JD9 A;  4YRU A;  1DJI A;  1QIV A;  2COL B;  3PN7 B;  1F55 A;  1DTL A;  3D77 A;  1N2D A;  1WLM A;  2K2F A;  1SCM B;  3R1O A;  1EXR A;  5FYX A;  2KI6 D;  1CTR A;  3CAB A;  2BEC A;  2Q4U A;  4FQT A;  4HRE E;  3OX5 A;  2GTE A;  1QVI Y;  4WQ2 A;  1G33 A;  1UHN A;  4MN0 A;  4PT1 A;  1J55 A;  1EG3 A;  4OZD A;  2PRU A;  3CZ1 A;  1A29 A;  1L2O B;  1SCV A;  1MHO A;  2K7B A;  2OPO A;  4MZL A;  1JBA A;  3D10 A;  2JTZ A;  2KGB C;  2BBN A;  2PAS A;  1KK7 Z;  1QXP A;  2YGU A;  1TWO A;  1V1F A;  1YRT B;  1GQM A;  3ZWH A;  1IGV A;  4OV2 A;  1S6J A;  1R2U A;  4NQG A;  2L98 A;  2BCB A;  2E30 A;  4MZK A;  2AUC A;  1W7I B;  3IVT A;  1DJW A;  1CNP A;  4XJK B;  1ZOT B;  1NP8 A;  1RJV A;  1OZS A;  4A4C A;  2I2R E;  1A75 B;  3DF0 B;  1CDN A;  1YX8 A;  2JU0 A;  1NX1 A;  3PJI A;  2DOQ A;  1YRU B;  1WRK A;  3S0B A;  1KCY A;  2A4J A;  1DT7 B;  1DMO A;  2EHB A;  3DF0 A;  3GOF A;  1PVA A;  2OS8 C;  3EVV A;  4GAO A;  1EH2 A;  1TUJ A;  3JTD B;  1EJ3 A;  3R1P A;  1EG4 A;  4Q04 A;  1MXL C;  4PE0 A;  2KDH A;  2JRF A;  2JNF A;  2M1K B;  1B8L A;  1S6C A;  1QV1 A;  3UNW A;  2V53 A;  3AKA A;  1LIN A;  2K2A A;  5AXI A;  3GK1 A;  2QEB A;  5HKZ A;  1FW4 A;  1NCX A;  5I2Q A;  1S5G Y;  4YGC B;  2VRG A;  1XYD A;  4GGN A;  1WY9 A;  1U5I A;  5HKY A;  1YTZ C;  3CYZ A;  3CZT X;  3OB1 B;  1OQP A;  4I5J A;  2Y1M A;  1SMG A;  3CDN A;  2LE9 B;  5PAL A;  1OMV A;  1KK8 C;  2MJW B;  1PAL A;  3LL8 B;  3OBV A;  5JOL A;  1OOF A;  2G2B A;  1YX7 A;  2LAP A;  1G8I A;  2NXQ A;  3KPX A;  5TNC A;  1LVC D;  3DXL A;  3SIA A;  2H8V A;  2KI4 B;  1B1G A;  2M97 A;  5KTY A;  3ZNI A;  2KAX A;  2WOR A;  4I5L B;  2MBX A;  1PVB A;  1M45 A;  4CFR A;  1QAS A;  3HCM A;  2L5X B;  2M9G A;  3NSL A;  1OE9 B;  2NLN A;  2M7L A;  3D0Y B;  1TNX A;  2WCF A;  1CMG A;  2WCE A;  1RK9 A;  2KI6 C;  4L9M A;  2KGR A; 
#chains in the Genus database with same CATH homology
 2KLE A;  1DC1 A;  5FI6 A;  5FI2 A;  3SS3 A;  4MEW A;  5I94 A;  1Z2C B;  4I5J A;  2K60 A;  3KEV A;  1W9Z A;  2YGU A;  1Z4H A;  5HL1 A;  3OBV A;  2L5Y A;  4KYN A;  3SS4 A;  1DEK A;  4GAO A;  5D3O A;  5FI7 A;  3SS5 A;  3UO9 A;  4I5L B;  2KLD A;  3IVT A;  3EG5 B;  3PM2 A;  4I5N B;  1DEL A;  4I5K A;  2BAP A;  3UNW A;  2BNX A;  4GBA A;  4JKT A;  4IJ7 A;  3O4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...