1TCOB

Ternary complex of a calcineurin a fragment, calcineurin b, fkbp12 and the immunosuppressant drug fk506 (tacrolimus)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
169
structure length
169
Chain Sequence
b'GNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE PHOSPHATASE B2
publication title X-ray structure of calcineurin inhibited by the immunophilin-immunosuppressant FKBP12-FK506 complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Complex (hydrolase/isomerase)
total genus 56
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 1996-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00036 EF-hand_1 EF hand
B PF13202 EF-hand_5 EF hand
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1tcoB00
2L51A 2LUCA 3DVKA 1B8RA 4ORBB 4DUQA 1KQVA 2M7NA 1TRFA 1IQ3A 1F71A 1F55A 1FPWA 4MZJA 2KDHA 4OKHA 3DVJA 1CFCA 1S36A 2LVJA 2KI6C 1TTXA 3LL8B 1IJ6A 4IL1A 1YTZC 4PHNA 3EVVA 3I5FB 2KGRA 3JVTC 1L2OB 1FF1A 1TNQA 2WC8A 4GFTA 1ZACA 2OS8C 1RROA 3WHTB 4OVNF 5F6TA 1ZUZA 5K89A 2WCFA 4MLWA 1CM4A 1K96A 1YUTA 1D1OA 4QJ4B 1SNLA 4HSZA 3AKBA 4C0LA 3GK4X 3SG4A 1CB1A 2LNKA 3WXAA 1SMGA 2LLTA 1XK4C 2JRFA 4DIRA 2BKHB 1KFUL 1NX0A 3A4UB 3IF7A 3CTNA 1WDCB 2O60A 1A2XA 4WQ3A 2PVBA 1ALVA 1IQ5A 1VRKA 4GUKA 1BR4B 1DJXA 5CSIA 2L0PA 1F4OA 2JWWA 3ICBA 4WQ2A 1K9UA 2E30A 4BY5A 5TNCA 1CTRA 3EKHA 1SR6C 1A29A 5PALA 1R6PA 2FCEA 5D69A 1YURA 3EVRA 1A75A 2MRDA 1EG4A 2JXCA 1QV0A 1MQ1A 1YVLA 4PE7A 2KHNA 1SRAA 1J7PA 1XYDA 3OX6A 4AQJA 2AMIA 1A03A 1BR1B 4PCWA 3VRRA 1CFPA 1A75B 2L98A 3IQOA 1PK0D 4MN0A 1GGWA 1B7TZ 3QRXA 1C07A 2F3ZA 2BE6A 3I5FC 3FWCA 2ZFDA 1L2OC 1M31A 4MZKA 1N65A 3TS5B 5BPJA 5KTYA 1J7OA 3TZ1A 2BCXA 2K7CA 1EXRA 1G8IA 2K8MB 2LANA 1SYMA 2PALA 3DD4A 2H2KA 4PE4A 3VGOA 2CTNA 4ORAB 1MR8A 1Y1XA 2BCAA 1L7ZA 2NCPA 2LHIA 4A4BA 3NSLA 4JQ0D 5FYXA 3VROA 2A4JA 3KEVA 1MHOA 1SCVA 1DJYA 1NCXA 2K2AA 3DVEA 1UHHA 3MSEB 3OX5A 1TN4A 3TDUA 5JJGA 5DKQA 1JBAA 3BQ3A 1PULA 2MLFC 2JTZA 1AVSA 1OZOA 2D8NA 2JQ6A 1QLKA 1QIWA 2CNPA 2FOTA 2L5XB 3I5HC 1ZOTB 1M46A 2JXLA 4C0KA 1Y1UA 1NX1A 1WLMA 2NCOA 4U8DA 2VRGA 4YGEB 2HF5A 3PLFB 1EL4A 3C1VA 1XFZO 3CR4X 2LCPA 4I5NB 1LA0A 1LINA 5G08A 1S6JA 2AUCA 5AANA 1Y1AA 4TNCA 1EJ3A 1JC2A 4GBAA 2KAXA 1XFWO 1ZFSA 2CT9A 3BUMB 1A4PA 2ZRTA 2ISDA 1DJIA 1CFFA 1M63B 2F2OA 1BU3A 2K0JA 2L50A 2K61A 3SJSA 1S3PA 2M1UA 2WNDA 2HQ8A 5ER5A 4I5JA 2LVIA 2Y5IA 3WNXB 2I94A 2MA2A 3TS5C 2LMVA 5IBWA 4ICBA 1QVIY 1TNWA 2JTTA 2OPOA 2Q4UA 1CKKA 2OTGB 1NPQA 3OB1B 1M39A 1QVIZ 4CIDA 1PVAA 2F33A 1WY9A 3BUNB 5HYDA 1SW8A 2TN4A 4YGCB 1IGVA 4DS7A 3NSOA 1B8LA 1W7JB 4OV2A 4P5OE 1CLBA 1YX7A 5B8IB 2BBMA 1QXPA 1B9AA 1RECA 1KK7Z 2MLEC 3CR2A 4FQOA 1FW4A 3PATA 2F8PA 4YI9A 4QJ5B 2LVVA 3BUWB 2JT3A 3H4SE 1NX2A 1YUUA 4YBHB 2HETA 1YRTB 5HLOA 1QV1A 1UWOA 3SG3A 1LA3A 3GK2A 4PALA 4QJ3B 1TOPA 2WORA 5D7FA 1WRKA 4F0ZB 1S5GY 2WCBA 3DF0A 1UP5A 3BOWB 2M1KB 3LLEA 1NIWA 4UPGA 5CPVA 2LMTA 4YGAA 1S5GZ 4N1GA 2KNEA 3ZNIA 1J7QA 1S6CA 1UUSA 1WLZA 1OE9B 3OB2B 2E6WA 3DF0B 1DTLA 4PHMA 1LVCD 4USLA 2PMYA 1KSOA 2ZN9A 3I5HB 1JSAA 2JPTA 3PFVA 4YGDB 2EC6C 2KYCA 4GPLB 1AJ5A 2L2EA 1CMGA 1SK6D 2LP2A 1B8CA 1DT7B 1K93D 3CGAA 1FI5A 1CDMA 2OTGC 1UURA 1YR5A 1B7TY 2LC5A 2MJWB 4YGBB 2KI6D 5AXIA 3WHUB 1KK8B 4ZCVA 1G4YR 4N5XA 1CLMA 5CSFA 1KFXL 1UHNA 3LK0A 4GGFC 1K95A 1YVHA 1MXEA 2AAOA 5CSJA 4NDBA 4L9MA 4NQGA 1V1FA 1M45A 3VRNA 3CLNA 1JUOA 5HLVA 1CLLA 1YX8A 2P6BB 1XVJA 3JTDB 2RGIA 2R2IA 1H8BA 2GV5A 4HREE 2BCBA 4CFQA 1AP4A 1HT9A 1TCOB 1RTP1 4YRUA 2B1UA 1QS7A 4AOMA 1WRLA 1KFUS 1DF0A 1UHKA 5AERA 1JF2A 1TCFA 5GQQC 4P2YB 1IKUA 2F3YA 1XFXO 5AFPA 2CCMA 4ZCUA 1YRUB 4CLNA 1JFJA 1DF0B 1PALA 3PALA 2KBMA 1HQVA 4N1FA 2ZKMX 2LP3A 2LHLA 4GAOA 2WOSA 1MWNA 3PSRA 4MRXA 2JNFA 1OZSA 1SKTA 1YUSA 1QIVA 4C0JA 1J7RA 2BECA 4AQIA 1F70A 2KBIA 1MF8B 5HKYA 2M9GA 1V1GA 1DJZA 1KK8C 3ZWHA 1RFJA 4DRWA 4GGNA 3SIBA 2LLUA 4CFRA 1U5IA 1KQMB 2GGZA 1XFVO 3FWBA 2JT8A 4WRIA 4MVFA 4ORCB 2QPTA 3A8RA 5HKWA 4OCIA 1W7IB 1ODBA 1B1GA 2EC6B 5DKRA 2LMUA 2NXQA 3EK7A 1U5IB 1ZMZA 1XO5A 4M2OA 5I2LA 1X02A 2JT0A 3JTDC 4GGFA 1IRJA 2PRUA 2V53A 5JOLA 2M49B 1NP8A 1NCZA 2ZRSA 4I5KA 1DGVA 2JNXA 4MRYA 4NDCA 3CR5X 2O5GA 2COLB 2M29A 1S26D 2EGDA 1K2HA 5KU1A 5AEQA 2JU0A 1C7VA 1GQMA 1KK7Y 1DJWA 2NZ0A 1B47A 2BBNA 2SCPA 2JULA 3NSKA 1EH2A 1F8HA 1E8AA 2NLNA 1QX7A 2ZNDA 3PN7C 1J1DA 2HQWA 3AAKA 1C7WA 5ER4X 1OSAA 4MZLA 3FS7A 3AAJA 1TIZA 2HPSA 1NSHA 2EHBA 4R1EA 2WCEA 2MAZA 1ALWA 2BE4A 2ZNEA 3BOWA 1QX5B 4HRHA 1XA5A 3SG6A 3SIAA 3O6BA 1RK9A 2BL0B 5I8NA 2L4IA 4FTGA 3IQQA 1EG3A 1TNPA 1QX2A 3SG2A 3KPXA 4Q04A 5J3XA 1CDPA 2L4HA 1BF5A 2CXJA 3VRQA 1BOCA 2LE9B 4BY4A 1SCMC 1G33A 4PHKA 1KQMC 3OP0A 3OHMB 1Y6WA 1RWYA 1K9PA 2M8UA 3D0YA 1BG1A 1NX3A 4XJKA 2I7AA 2KSPA 4PE0A 3FIAA 3RLZA 1KWOB 1IWQA 1SL7A 1J55A 4DCKA 1S1EA 3EK8A 3GOFA 2PSRA 4PDZA 4NDDA 3D0YB 1CNPA 2KI4C 1DVIA 2JC2A 3HCMA 4XJKB 1N0YA 3KF9A 1QJTA 2M7LA 2KFGA 1MUXA 2LV7A 4JWQA 1NUBA 2K7BA 1UHJA 1PRWA 4GNKB 1GJYA 1IG5A 3GK1A 2KQYA 3I5GB 1TNXA 2FJUB 2IS9A 4HRGA 5I2OA 1IH0A 2LLSA 1PVBA 1AJ4A 1JFKA 1OOJA 1Q80A 3E3RA 4MEWA 1SL9A 2JZIA 2MBXA 1PSRA 2M97A 3EVUA 3BYAA 3SG5A 4CPVA 1XFUO 1R2UA 2G2BA 1CM1A 3D10A 1CDLA 1BJFA 1LXFC 1KCYA 3KO0A 3NSIA 5HKZA 1SBJA 2H61A 1B4CA 1K8UA 1MXLC 2BL0C 1AUIB 2GGMA 2KFHA 2KGBC 2KOTA 3VRPA 3LK1A 3O4YA 5KSZA 1XFYO 1OMDA 3TUYB 2Y1NA 2LM5A 3I5IB 3PN7B 1FI6A 4I5LB 1F4QA 1GGZA 3EK4A 2Y1MA 1K9KA 2PASA 3LCPC 2LVKA 2CBLA 1S6IA 4A4CA 1N2DA 3SG7A 3EKJA 2JOJA 1NWDA 5I2QA 1KWOC 1NYAA 5DKNA 4D1EA 4ETOA 3CZTX 1SL8A 2K7OA 3RM1A 1OMVA 4YI8A 1CFDA 4XYNA 1J1EA 4MBEA 1WDCC 2LAPA 2BKIB 3CS1A 3JVTB 3M0WA 1KFXS 2I18A 4MSPA 1SCMB 3BXKA 1BODA 1JWDA 2OS8B 1DGUA 2QACA 1LKJA 1QATA 3PM8A 1XK4A 1CMFA 1PSBA 2K2FA 1KSMA 3I5GC 1AHRA 2KAYA 3KHEA 4OR9B 1JF0A 1H4BA 2FCDA 4JPZB 3TDZA 1F54A 2KFFA 1NCYA 3TDIA 4M2PA 1AK8A 2K7DA 1BMOA 3DVMA 3F45A 1DMOA 1OMRA 5CSNA 2Y4QA 2F2PA 1WRZA 2KI4B 2KYFA 1IJ5A 1DJHA 1K90D 4E68A 2MHHA 3HX4A 3NXAA 2LUXA 4PE1A 1SY9A 2M3WA 1K94A 3BUOB 1BT6A 1QLSA 1Y0VH 1QASA 2I2RE 3CWGA 3TUYC 2KAVA 1UHIA 3I5IC 1DJGA 1RJVA 1SR6B 2G9BA 2H61C 2KQ6A 2ZN8A 3AKAA 1FBVA 4PHJA 4M2QA 1BLQA 1CDNA 2Q91A 3K21A 3O78A 3O2PA 1SPYA 1OQPA 1QTXA 3BUXB 2M0RA 2SASA 2DOQA
chains in the Genus database with same CATH superfamily
2L51A 2LUCA 3EG5B 3B6XA 3DVKA 1B8RA 4ORBB 4DUQA 1KQVA 2M7NA 1TRFA 1IQ3A 1F71A 1F55A 2GTEA 1FPWA 4MZJA 2KDHA 4OKHA 3DVJA 1CFCA 1S36A 2LVJA 2KI6C 1TTXA 3LL8B 1IJ6A 4IL1A 3L4LA 1YTZC 4PHNA 3EVVA 3I5FB 2KGRA 3JVTC 1L2OB 1FF1A 1TNQA 2WC8A 3R72A 4GFTA 1ZACA 2OS8C 2WCJA 1RROA 3WHTB 4OVNF 5F6TA 1ZUZA 5K89A 2WCFA 4MLWA 1CM4A 1K96A 1YUTA 1D1OA 4QJ4B 1SNLA 1Z2CB 4HSZA 3AKBA 4C0LA 2QDIA 3GK4X 3SG4A 1CB1A 2LNKA 3WXAA 1SMGA 2LLTA 1XK4C 2JRFA 4DIRA 2BKHB 1KFUL 1OW4A 1NX0A 3A4UB 3IF7A 3CTNA 4JD9A 4KYNA 1WDCB 2O60A 3SS3A 1A2XA 4WQ3A 2PVBA 1ALVA 1IQ5A 1VRKA 4GUKA 1BR4B 1DJXA 5CSIA 2BAPA 2L0PA 1F4OA 2JWWA 3ICBA 4WQ2A 1K9UA 2E30A 4OZDA 4BY5A 5TNCA 1CTRA 3EKHA 1SR6C 1A29A 3CABA 5PALA 1R6PA 3S0AA 2FCEA 5D69A 1YURA 3EVRA 1A75A 2MRDA 1EG4A 2JXCA 1QV0A 1MQ1A 1YVLA 4PE7A 2KHNA 1SRAA 3R1OA 3CYZA 1J7PA 2L5YA 1XYDA 3OX6A 4AQJA 2AMIA 1A03A 1BR1B 4PCWA 3VRRA 1CFPA 1A75B 2L98A 2QEBA 3IQOA 1PK0D 4MN0A 1GGWA 1B7TZ 3QRXA 1C07A 5I94A 2P70A 2F3ZA 2BE6A 3I5FC 3FWCA 2ZFDA 1L2OC 1M31A 4MZKA 1N65A 3TS5B 5BPJA 5KTYA 1J7OA 3TZ1A 2BCXA 2K7CA 1EXRA 1G8IA 2K8MB 2L2CA 1SYMA 2LANA 2PALA 3D73A 3DD4A 2H2KA 3L4AA 4PE4A 3VGOA 2CTNA 4ORAB 3S0EA 1MR8A 1Y1XA 3Q8IA 2BCAA 1L7ZA 4PT1A 2NCPA 2LHIA 1GM0A 4A4BA 3NSLA 4JQ0D 5FYXA 3VROA 2A4JA 3KEVA 1MHOA 1SCVA 1DJYA 1NCXA 2K2AA 3DVEA 1UHHA 3MSEB 3OX5A 1TN4A 3TDUA 5JJGA 5DKQA 1JBAA 3BQ3A 1PULA 3BFBA 2MLFC 2JTZA 1AVSA 1OZOA 2D8NA 2JQ6A 1QLKA 1QIWA 2CNPA 2FOTA 2L5XB 3I5HC 1ZOTB 1M46A 2JXLA 4C0KA 2YGUA 1Y1UA 1NX1A 1WLMA 2NCOA 4U8DA 2VRGA 4YGEB 2HF5A 3PLFB 1EL4A 1TWOA 1XFZO 3C1VA 3CR4X 2LCPA 4I5NB 5HL1A 1LA0A 1LINA 1TUZA 5G08A 3DYEA 1S6JA 2AUCA 2QEOA 5AANA 1Y1AA 4TNCA 1EJ3A 2WCMA 4GBAA 2KAXA 1XFWO 1JC2A 1ZFSA 2CT9A 3SJSA 3BUMB 1A4PA 2ZRTA 2ISDA 1DJIA 2QEHA 1CFFA 2BNXA 1M63B 2F2OA 1BU3A 2K0JA 1DQEA 1T14A 2K61A 1S3PA 2L50A 1OOHA 2M1UA 2HQ8A 2WNDA 3O4XA 5ER5A 4I5JA 2LVIA 2Y5IA 3WNXB 2I94A 2MA2A 3TS5C 2LMVA 5IBWA 3K1EA 1OOIX 4ICBA 1QVIY 1TNWA 2JTTA 1C3ZA 2OPOA 2Q4UA 1CKKA 2OTGB 1NPQA 3OB1B 1M39A 1QVIZ 4CIDA 1PVAA 4INXA 2F33A 1WY9A 3BUNB 5HYDA 1SW8A 2TN4A 4YGCB 1IGVA 4DS7A 3NSOA 3B7AA 3R1VA 1B8LA 1W7JB 4OV2A 4P5OE 1CLBA 1YX7A 2KLDA 2BBMA 1QXPA 1B9AA 5B8IB 1RECA 1KK7Z 2MLEC 3CR2A 4FQOA 3D77A 1FW4A 3PATA 4JKTA 1ORGA 2F8PA 2ERBA 4YI9A 4QJ5B 2LVVA 3BUWB 2JT3A 3H4SE 1NX2A 1YUUA 4YBHB 2HETA 1YRTB 5HLOA 1QV1A 1UWOA 3CZ1A 3SG3A 2WCHA 1LA3A 3GK2A 4PALA 4QJ3B 1DEKA 1TOPA 2WORA 3PM2A 1WRKA 5D7FA 4F0ZB 1S5GY 2WCBA 3DF0A 1UP5A 3BOWB 2M1KB 3LLEA 1NIWA 4UPGA 5CPVA 2LMTA 4F7FA 4YGAA 1S5GZ 4N1GA 2KNEA 3ZNIA 3FE8A 1S6CA 1J7QA 1UUSA 1WLZA 1OE9B 3OB2B 1W9ZA 2E6WA 1DTLA 3DF0B 1LVCD 3D74A 2PMYA 4PHMA 1KSOA 1XFRA 4USLA 2ZN9A 3I5HB 1QWVA 3DXLA 3N7HA 2JPTA 1JSAA 1IIOA 3PFVA 4YGDB 2EC6C 2KYCA 4GPLB 1DELA 1AJ5A 3CDNA 2L2EA 1CMGA 1SK6D 2LP2A 1B8CA 1DT7B 1K93D 3CGAA 1FI5A 2WC6A 1CDMA 2OTGC 1UURA 1YR5A 1B7TY 2LC5A 2MJWB 4YGBB 2KI6D 5AXIA 3WHUB 1KK8B 4ZCVA 1G4YR 4N5XA 1CLMA 1OOGA 5CSFA 1DC1A 1KFXL 1UHNA 3LK0A 4GGFC 1K95A 1YVHA 1MXEA 2AAOA 3FE6A 5CSJA 4NDBA 2H8VA 4L9MA 4NQGA 1V1FA 1M45A 2FJYA 3CLNA 1JUOA 5HLVA 3VRNA 1CLLA 1YX8A 2P6BB 1XVJA 3JTDB 2RGIA 2R2IA 1H8BA 3RZSA 2GV5A 4HREE 2BCBA 4CFQA 1AP4A 1HT9A 1TCOB 1RTP1 4YRUA 2B1UA 1QS7A 4AOMA 1WRLA 1KFUS 1OOFA 3S0FA 1DF0A 5FI2A 1UHKA 5AERA 1JF2A 1TCFA 5GQQC 4P2YB 1IKUA 2KPHA 2F3YA 1XFXO 2WC5A 2CCMA 3B87A 4ZCUA 3S0GA 5AFPA 1YRUB 4CLNA 1JFJA 3CZ2A 1DF0B 1PALA 3PALA 2KBMA 1HQVA 4N1FA 2ZKMX 2LP3A 2LHLA 4GAOA 2WOSA 1MWNA 2KLEA 3PSRA 2JNFA 4MRXA 1OZSA 1SKTA 1YUSA 1QIVA 4C0JA 1J7RA 2BECA 3DZTA 4AQIA 1F70A 2KBIA 1MF8B 5HKYA 2M9GA 1V1GA 3D76A 3CZ0A 4INWA 1DJZA 1KK8C 3ZWHA 3FE9A 1C3YA 1RFJA 4DRWA 4GGNA 3SIBA 2LLUA 4CFRA 3B88A 2PQLA 1U5IA 1KQMB 2GGZA 5FI7A 1XFVO 3FWBA 2JT8A 4WRIA 4MVFA 4ORCB 2QPTA 3A8RA 5HKWA 4OCIA 1W7IB 1ODBA 1B1GA 2EC6B 5DKRA 2LMUA 2NXQA 3EK7A 1U5IB 1ZMZA 1XO5A 4M2OA 5I2LA 1X02A 2JT0A 3JTDC 4FQTA 1IRJA 2PRUA 2V53A 4GGFA 5JOLA 2M49B 1NP8A 1NCZA 2ZRSA 4I5KA 1DGVA 2JNXA 4MRYA 4NDCA 3CR5X 2O5GA 2COLB 2M29A 1S26D 2EGDA 3SS5A 5KU1A 1K2HA 5AEQA 2JU0A 1C7VA 1GQMA 1KK7Y 1DJWA 2NZ0A 1B47A 2BBNA 2SCPA 2JULA 3NSKA 3UO9A 1EH2A 1F8HA 1E8AA 2NLNA 1QX7A 2ZNDA 3PN7C 1J1DA 2HQWA 3AAKA 1C7WA 5D3OA 5DICA 1OSAA 5ER4X 4MZLA 3FS7A 3AAJA 1TIZA 2HPSA 1NSHA 3VB1A 2EHBA 3NGVA 4R1EA 2WCEA 2MAZA 1ALWA 2BE4A 2ZNEA 3BOWA 1QX5B 4HRHA 1XA5A 3SG6A 3SIAA 3O6BA 1RK9A 2BL0B 5I8NA 2L4IA 4FTGA 3IQQA 2QEVA 1EG3A 1TNPA 1QX2A 3SG2A 3KPXA 4Q04A 5J3XA 1CDPA 2L4HA 1BF5A 3IVTA 2CXJA 3VRQA 1BOCA 2LE9B 4BY4A 1SCMC 3V2LA 1G33A 4PHKA 1KQMC 3OP0A 3OHMB 1Y6WA 1RWYA 1K9PA 2M8UA 3D0YA 3NHIA 3L47A 1BG1A 1NX3A 4XJKA 3R1PA 2I7AA 2JPOA 2KSPA 4PE0A 3FIAA 3RLZA 3D78A 1KWOB 1IWQA 1SL7A 2WCLA 1J55A 4DCKA 2PYQA 1S1EA 3EK8A 3GOFA 2PSRA 3DY9A 4PDZA 1P28A 4NDDA 3D0YB 1CNPA 2KI4C 1DVIA 2JC2A 3HCMA 4XJKB 1N0YA 3KF9A 1QJTA 2M7LA 2KFGA 1MUXA 2LV7A 4JWQA 1NUBA 2K7BA 1UHJA 1PRWA 4GNKB 1GJYA 1IG5A 3GK1A 4IJ7A 2KQYA 3I5GB 1TNXA 2FJUB 2IS9A 4HRGA 5I2OA 1IH0A 2LLSA 1PVBA 1AJ4A 1JFKA 1OOJA 1Q80A 3E3RA 4MEWA 1SL9A 2JZIA 2P71A 1PSRA 5FI6A 2MBXA 2M97A 3EVUA 3BYAA 1TUJA 3SG5A 4CPVA 1XFUO 5EL2A 1R2UA 2G2BA 1CM1A 3D10A 1CDLA 1BJFA 1LXFC 1KCYA 3KO0A 3NSIA 5HKZA 1SBJA 2H61A 1B4CA 1K8UA 1MXLC 2BL0C 1AUIB 2GGMA 2KFHA 2KGBC 2KOTA 3VRPA 3LK1A 3O4YA 5KSZA 1XFYO 1OMDA 3TUYB 2Y1NA 2LM5A 3I5IB 2WCKA 3PN7B 1FI6A 4I5LB 1F4QA 1GGZA 3EK4A 2Y1MA 1K9KA 3B86A 2PASA 3LCPC 2LVKA 3SS4A 2CBLA 3NHTA 3PJIA 1S6IA 4A4CA 1N2DA 3BFHA 3SG7A 3EKJA 3S0BA 2JOJA 1NWDA 5I2QA 1KWOC 1NYAA 5DKNA 3UNWA 3BJHA 4D1EA 3CZTX 1SL8A 2K7OA 3RM1A 4ETOA 1OMVA 4YI8A 1CFDA 4XYNA 3OGNA 1J1EA 4MBEA 1WDCC 2LAPA 2BKIB 3CS1A 3JVTB 3M0WA 1KFXS 2I18A 4MSPA 1SCMB 3BXKA 1BODA 1JWDA 2OS8B 1DGUA 2QACA 1LKJA 1QATA 3PM8A 1XK4A 1LS8A 1PSBA 2K2FA 1CMFA 1KSMA 3I5GC 1AHRA 2KAYA 3KHEA 4OR9B 1JF0A 1H4BA 2FCDA 4JPZB 2K60A 3TDZA 1F54A 2KFFA 1NCYA 3TDIA 4M2PA 1AK8A 3S0DA 2K7DA 3D75A 1BMOA 3DVMA 3F45A 1DMOA 1OMRA 5CSNA 2Y4QA 2F2PA 1WRZA 2KI4B 2KYFA 1IJ5A 1DJHA 1K90D 4E68A 2MHHA 3HX4A 3NXAA 2LUXA 4PE1A 1SY9A 2M3WA 1K94A 3BUOB 1BT6A 1QLSA 1Y0VH 1QASA 2I2RE 3CWGA 3TUYC 2KAVA 1UHIA 3I5IC 3OBVA 1DJGA 1RJVA 1SR6B 1Z4HA 2G9BA 2H61C 2KQ6A 2ZN8A 1FBVA 3AKAA 4M2QA 4PHJA 1BLQA 1CDNA 2Q91A 3K21A 3O78A 3O2PA 1SPYA 1OQPA 1QTXA 1SSEB 2M0RA 2SASA 3BFAA 3BUXB 2DOQA 3QMEA
chains in the Genus database with same CATH topology
2L51A 2LUCA 3DVKA 1B8RA 4ORBB 4DUQA 1KQVA 2M7NA 1TRFA 1IQ3A 1F71A 1F55A 1FPWA 4MZJA 2KDHA 4OKHA 3DVJA 1CFCA 1S36A 2LVJA 2KI6C 1TTXA 3LL8B 1IJ6A 4IL1A 1YTZC 4PHNA 3EVVA 3I5FB 2KGRA 3JVTC 1L2OB 1FF1A 1TNQA 2WC8A 4GFTA 1ZACA 2OS8C 1RROA 3WHTB 4OVNF 5F6TA 1ZUZA 5K89A 2WCFA 4MLWA 1CM4A 1K96A 1YUTA 1D1OA 4QJ4B 1SNLA 4HSZA 3AKBA 4C0LA 3GK4X 3SG4A 1CB1A 2LNKA 3WXAA 1SMGA 2LLTA 1XK4C 2JRFA 4DIRA 2BKHB 1KFUL 1NX0A 3A4UB 3IF7A 3CTNA 1WDCB 2O60A 1A2XA 4WQ3A 2PVBA 1ALVA 1IQ5A 1VRKA 4GUKA 1BR4B 1DJXA 5CSIA 2L0PA 1F4OA 2JWWA 3ICBA 4WQ2A 1K9UA 2E30A 4BY5A 5TNCA 1CTRA 3EKHA 1SR6C 1A29A 5PALA 1R6PA 2FCEA 5D69A 1YURA 3EVRA 1A75A 2MRDA 1EG4A 2JXCA 1QV0A 1MQ1A 1YVLA 4PE7A 2KHNA 1SRAA 1J7PA 1XYDA 3OX6A 4AQJA 2AMIA 1A03A 1BR1B 4PCWA 3VRRA 1CFPA 1A75B 2L98A 3IQOA 1PK0D 4MN0A 1GGWA 1B7TZ 3QRXA 1C07A 2F3ZA 2BE6A 3I5FC 3FWCA 2ZFDA 1L2OC 1M31A 4MZKA 1N65A 3TS5B 5BPJA 5KTYA 1J7OA 3TZ1A 2BCXA 2K7CA 1EXRA 1G8IA 2K8MB 2LANA 1SYMA 2PALA 3DD4A 2H2KA 4PE4A 3VGOA 2CTNA 4ORAB 1MR8A 1Y1XA 2BCAA 1L7ZA 2NCPA 2LHIA 4A4BA 3NSLA 4JQ0D 5FYXA 3VROA 2A4JA 3KEVA 1MHOA 1SCVA 1DJYA 1NCXA 2K2AA 3DVEA 1UHHA 3MSEB 3OX5A 1TN4A 3TDUA 5JJGA 5DKQA 1JBAA 3BQ3A 1PULA 2MLFC 2JTZA 1AVSA 1OZOA 2D8NA 2JQ6A 1QLKA 1QIWA 2CNPA 2FOTA 2L5XB 3I5HC 1ZOTB 1M46A 2JXLA 4C0KA 1Y1UA 1NX1A 1WLMA 2NCOA 4U8DA 2VRGA 4YGEB 2HF5A 3PLFB 1EL4A 3C1VA 1XFZO 3CR4X 2LCPA 4I5NB 1LA0A 1LINA 5G08A 1S6JA 2AUCA 5AANA 1Y1AA 4TNCA 1EJ3A 1JC2A 4GBAA 2KAXA 1XFWO 1ZFSA 2CT9A 3BUMB 1A4PA 2ZRTA 2ISDA 1DJIA 1CFFA 1M63B 2F2OA 1BU3A 2K0JA 2L50A 2K61A 3SJSA 1S3PA 2M1UA 2WNDA 2HQ8A 5ER5A 4I5JA 2LVIA 2Y5IA 3WNXB 2I94A 2MA2A 3TS5C 2LMVA 5IBWA 4ICBA 1QVIY 1TNWA 2JTTA 2OPOA 2Q4UA 1CKKA 2OTGB 1NPQA 3OB1B 1M39A 1QVIZ 4CIDA 1PVAA 2F33A 1WY9A 3BUNB 5HYDA 1SW8A 2TN4A 4YGCB 1IGVA 4DS7A 3NSOA 1B8LA 1W7JB 4OV2A 4P5OE 1CLBA 1YX7A 5B8IB 2BBMA 1QXPA 1B9AA 1RECA 1KK7Z 2MLEC 3CR2A 4FQOA 1FW4A 3PATA 2F8PA 4YI9A 4QJ5B 2LVVA 3BUWB 2JT3A 3H4SE 1NX2A 1YUUA 4YBHB 2HETA 1YRTB 5HLOA 1QV1A 1UWOA 3SG3A 1LA3A 3GK2A 4PALA 4QJ3B 1TOPA 2WORA 5D7FA 1WRKA 4F0ZB 1S5GY 2WCBA 3DF0A 1UP5A 3BOWB 2M1KB 3LLEA 1NIWA 4UPGA 5CPVA 2LMTA 4YGAA 1S5GZ 4N1GA 2KNEA 3ZNIA 1J7QA 1S6CA 1UUSA 1WLZA 1OE9B 3OB2B 2E6WA 3DF0B 1DTLA 4PHMA 1LVCD 4USLA 2PMYA 1KSOA 2ZN9A 3I5HB 1JSAA 2JPTA 3PFVA 4YGDB 2EC6C 2KYCA 4GPLB 1AJ5A 2L2EA 1CMGA 1SK6D 2LP2A 1B8CA 1DT7B 1K93D 3CGAA 1FI5A 1CDMA 2OTGC 1UURA 1YR5A 1B7TY 2LC5A 2MJWB 4YGBB 2KI6D 5AXIA 3WHUB 1KK8B 4ZCVA 1G4YR 4N5XA 1CLMA 5CSFA 1KFXL 1UHNA 3LK0A 4GGFC 1K95A 1YVHA 1MXEA 2AAOA 5CSJA 4NDBA 4L9MA 4NQGA 1V1FA 1M45A 3VRNA 3CLNA 1JUOA 5HLVA 1CLLA 1YX8A 2P6BB 1XVJA 3JTDB 2RGIA 2R2IA 1H8BA 2GV5A 4HREE 2BCBA 4CFQA 1AP4A 1HT9A 1TCOB 1RTP1 4YRUA 2B1UA 1QS7A 4AOMA 1WRLA 1KFUS 1DF0A 1UHKA 5AERA 1JF2A 1TCFA 5GQQC 4P2YB 1IKUA 2F3YA 1XFXO 5AFPA 2CCMA 4ZCUA 1YRUB 4CLNA 1JFJA 1DF0B 1PALA 3PALA 2KBMA 1HQVA 4N1FA 2ZKMX 2LP3A 2LHLA 4GAOA 2WOSA 1MWNA 3PSRA 4MRXA 2JNFA 1OZSA 1SKTA 1YUSA 1QIVA 4C0JA 1J7RA 2BECA 4AQIA 1F70A 2KBIA 1MF8B 5HKYA 2M9GA 1V1GA 1DJZA 1KK8C 3ZWHA 1RFJA 4DRWA 4GGNA 3SIBA 2LLUA 4CFRA 1U5IA 1KQMB 2GGZA 1XFVO 3FWBA 2JT8A 4WRIA 4MVFA 4ORCB 2QPTA 3A8RA 5HKWA 4OCIA 1W7IB 1ODBA 1B1GA 2EC6B 5DKRA 2LMUA 2NXQA 3EK7A 1U5IB 1ZMZA 1XO5A 4M2OA 5I2LA 1X02A 2JT0A 3JTDC 4GGFA 1IRJA 2PRUA 2V53A 5JOLA 2M49B 1NP8A 1NCZA 2ZRSA 4I5KA 1DGVA 2JNXA 4MRYA 4NDCA 3CR5X 2O5GA 2COLB 2M29A 1S26D 2EGDA 1K2HA 5KU1A 5AEQA 2JU0A 1C7VA 1GQMA 1KK7Y 1DJWA 2NZ0A 1B47A 2BBNA 2SCPA 2JULA 3NSKA 1EH2A 1F8HA 1E8AA 2NLNA 1QX7A 2ZNDA 3PN7C 1J1DA 2HQWA 3AAKA 1C7WA 5ER4X 1OSAA 4MZLA 3FS7A 3AAJA 1TIZA 2HPSA 1NSHA 2EHBA 4R1EA 2WCEA 2MAZA 1ALWA 2BE4A 2ZNEA 3BOWA 1QX5B 4HRHA 1XA5A 3SG6A 3SIAA 3O6BA 1RK9A 2BL0B 5I8NA 2L4IA 4FTGA 3IQQA 1EG3A 1TNPA 1QX2A 3SG2A 3KPXA 4Q04A 5J3XA 1CDPA 2L4HA 1BF5A 2CXJA 3VRQA 1BOCA 2LE9B 4BY4A 1SCMC 1G33A 4PHKA 1KQMC 3OP0A 3OHMB 1Y6WA 1RWYA 1K9PA 2M8UA 3D0YA 1BG1A 1NX3A 4XJKA 2I7AA 2KSPA 4PE0A 3FIAA 3RLZA 1KWOB 1IWQA 1SL7A 1J55A 4DCKA 1S1EA 3EK8A 3GOFA 2PSRA 4PDZA 4NDDA 3D0YB 1CNPA 2KI4C 1DVIA 2JC2A 3HCMA 4XJKB 1N0YA 3KF9A 1QJTA 2M7LA 2KFGA 1MUXA 2LV7A 4JWQA 1NUBA 2K7BA 1UHJA 1PRWA 4GNKB 1GJYA 1IG5A 3GK1A 2KQYA 3I5GB 1TNXA 2FJUB 2IS9A 4HRGA 5I2OA 1IH0A 2LLSA 1PVBA 1AJ4A 1JFKA 1OOJA 1Q80A 3E3RA 4MEWA 1SL9A 2JZIA 2MBXA 1PSRA 2M97A 3EVUA 3BYAA 3SG5A 4CPVA 1XFUO 1R2UA 2G2BA 1CM1A 3D10A 1CDLA 1BJFA 1LXFC 1KCYA 3KO0A 3NSIA 5HKZA 1SBJA 2H61A 1B4CA 1K8UA 1MXLC 2BL0C 1AUIB 2GGMA 2KFHA 2KGBC 2KOTA 3VRPA 3LK1A 3O4YA 5KSZA 1XFYO 1OMDA 3TUYB 2Y1NA 2LM5A 3I5IB 3PN7B 1FI6A 4I5LB 1F4QA 1GGZA 3EK4A 2Y1MA 1K9KA 2PASA 3LCPC 2LVKA 2CBLA 1S6IA 4A4CA 1N2DA 3SG7A 3EKJA 2JOJA 1NWDA 5I2QA 1KWOC 1NYAA 5DKNA 4D1EA 4ETOA 3CZTX 1SL8A 2K7OA 3RM1A 1OMVA 4YI8A 1CFDA 4XYNA 1J1EA 4MBEA 1WDCC 2LAPA 2BKIB 3CS1A 3JVTB 3M0WA 1KFXS 2I18A 4MSPA 1SCMB 3BXKA 1BODA 1JWDA 2OS8B 1DGUA 2QACA 1LKJA 1QATA 3PM8A 1XK4A 1CMFA 1PSBA 2K2FA 1KSMA 3I5GC 1AHRA 2KAYA 3KHEA 4OR9B 1JF0A 1H4BA 2FCDA 4JPZB 3TDZA 1F54A 2KFFA 1NCYA 3TDIA 4M2PA 1AK8A 2K7DA 1BMOA 3DVMA 3F45A 1DMOA 1OMRA 5CSNA 2Y4QA 2F2PA 1WRZA 2KI4B 2KYFA 1IJ5A 1DJHA 1K90D 4E68A 2MHHA 3HX4A 3NXAA 2LUXA 4PE1A 1SY9A 2M3WA 1K94A 3BUOB 1BT6A 1QLSA 1Y0VH 1QASA 2I2RE 3CWGA 3TUYC 2KAVA 1UHIA 3I5IC 1DJGA 1RJVA 1SR6B 2G9BA 2H61C 2KQ6A 2ZN8A 3AKAA 1FBVA 4PHJA 4M2QA 1BLQA 1CDNA 2Q91A 3K21A 3O78A 3O2PA 1SPYA 1OQPA 1QTXA 3BUXB 2M0RA 2SASA 2DOQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L51 A;  2LUC A;  3DVK A;  1B8R A;  4ORB B;  4DUQ A;  1KQV A;  2M7N A;  1TRF A;  1IQ3 A;  1F71 A;  1F55 A;  1FPW A;  4MZJ A;  2KDH A;  4OKH A;  3DVJ A;  1CFC A;  1S36 A;  2LVJ A;  2KI6 C;  1TTX A;  3LL8 B;  1IJ6 A;  4IL1 A;  1YTZ C;  4PHN A;  3EVV A;  3I5F B;  2KGR A;  3JVT C;  1L2O B;  1FF1 A;  1TNQ A;  2WC8 A;  4GFT A;  1ZAC A;  2OS8 C;  1RRO A;  3WHT B;  4OVN F;  5F6T A;  1ZUZ A;  5K89 A;  2WCF A;  4MLW A;  1CM4 A;  1K96 A;  1YUT A;  1D1O A;  4QJ4 B;  1SNL A;  4HSZ A;  3AKB A;  4C0L A;  3GK4 X;  3SG4 A;  1CB1 A;  2LNK A;  3WXA A;  1SMG A;  2LLT A;  1XK4 C;  2JRF A;  4DIR A;  2BKH B;  1KFU L;  1NX0 A;  3A4U B;  3IF7 A;  3CTN A;  1WDC B;  2O60 A;  1A2X A;  4WQ3 A;  2PVB A;  1ALV A;  1IQ5 A;  1VRK A;  4GUK A;  1BR4 B;  1DJX A;  5CSI A;  2L0P A;  1F4O A;  2JWW A;  3ICB A;  4WQ2 A;  1K9U A;  2E30 A;  4BY5 A;  5TNC A;  1CTR A;  3EKH A;  1SR6 C;  1A29 A;  5PAL A;  1R6P A;  2FCE A;  5D69 A;  1YUR A;  3EVR A;  1A75 A;  2MRD A;  1EG4 A;  2JXC A;  1QV0 A;  1MQ1 A;  1YVL A;  4PE7 A;  2KHN A;  1SRA A;  1J7P A;  1XYD A;  3OX6 A;  4AQJ A;  2AMI A;  1A03 A;  1BR1 B;  4PCW A;  3VRR A;  1CFP A;  1A75 B;  2L98 A;  3IQO A;  1PK0 D;  4MN0 A;  1GGW A;  1B7T Z;  3QRX A;  1C07 A;  2F3Z A;  2BE6 A;  3I5F C;  3FWC A;  2ZFD A;  1L2O C;  1M31 A;  4MZK A;  1N65 A;  3TS5 B;  5BPJ A;  5KTY A;  1J7O A;  3TZ1 A;  2BCX A;  2K7C A;  1EXR A;  1G8I A;  2K8M B;  2LAN A;  1SYM A;  2PAL A;  3DD4 A;  2H2K A;  4PE4 A;  3VGO A;  2CTN A;  4ORA B;  1MR8 A;  1Y1X A;  2BCA A;  1L7Z A;  2NCP A;  2LHI A;  4A4B A;  3NSL A;  4JQ0 D;  5FYX A;  3VRO A;  2A4J A;  3KEV A;  1MHO A;  1SCV A;  1DJY A;  1NCX A;  2K2A A;  3DVE A;  1UHH A;  3MSE B;  3OX5 A;  1TN4 A;  3TDU A;  5JJG A;  5DKQ A;  1JBA A;  3BQ3 A;  1PUL A;  2MLF C;  2JTZ A;  1AVS A;  1OZO A;  2D8N A;  2JQ6 A;  1QLK A;  1QIW A;  2CNP A;  2FOT A;  2L5X B;  3I5H C;  1ZOT B;  1M46 A;  2JXL A;  4C0K A;  1Y1U A;  1NX1 A;  1WLM A;  2NCO A;  4U8D A;  2VRG A;  4YGE B;  2HF5 A;  3PLF B;  1EL4 A;  3C1V A;  1XFZ O;  3CR4 X;  2LCP A;  4I5N B;  1LA0 A;  1LIN A;  5G08 A;  1S6J A;  2AUC A;  5AAN A;  1Y1A A;  4TNC A;  1EJ3 A;  1JC2 A;  4GBA A;  2KAX A;  1XFW O;  1ZFS A;  2CT9 A;  3BUM B;  1A4P A;  2ZRT A;  2ISD A;  1DJI A;  1CFF A;  1M63 B;  2F2O A;  1BU3 A;  2K0J A;  2L50 A;  2K61 A;  3SJS A;  1S3P A;  2M1U A;  2WND A;  2HQ8 A;  5ER5 A;  4I5J A;  2LVI A;  2Y5I A;  3WNX B;  2I94 A;  2MA2 A;  3TS5 C;  2LMV A;  5IBW A;  4ICB A;  1QVI Y;  1TNW A;  2JTT A;  2OPO A;  2Q4U A;  1CKK A;  2OTG B;  1NPQ A;  3OB1 B;  1M39 A;  1QVI Z;  4CID A;  1PVA A;  2F33 A;  1WY9 A;  3BUN B;  5HYD A;  1SW8 A;  2TN4 A;  4YGC B;  1IGV A;  4DS7 A;  3NSO A;  1B8L A;  1W7J B;  4OV2 A;  4P5O E;  1CLB A;  1YX7 A;  5B8I B;  2BBM A;  1QXP A;  1B9A A;  1REC A;  1KK7 Z;  2MLE C;  3CR2 A;  4FQO A;  1FW4 A;  3PAT A;  2F8P A;  4YI9 A;  4QJ5 B;  2LVV A;  3BUW B;  2JT3 A;  3H4S E;  1NX2 A;  1YUU A;  4YBH B;  2HET A;  1YRT B;  5HLO A;  1QV1 A;  1UWO A;  3SG3 A;  1LA3 A;  3GK2 A;  4PAL A;  4QJ3 B;  1TOP A;  2WOR A;  5D7F A;  1WRK A;  4F0Z B;  1S5G Y;  2WCB A;  3DF0 A;  1UP5 A;  3BOW B;  2M1K B;  3LLE A;  1NIW A;  4UPG A;  5CPV A;  2LMT A;  4YGA A;  1S5G Z;  4N1G A;  2KNE A;  3ZNI A;  1J7Q A;  1S6C A;  1UUS A;  1WLZ A;  1OE9 B;  3OB2 B;  2E6W A;  3DF0 B;  1DTL A;  4PHM A;  1LVC D;  4USL A;  2PMY A;  1KSO A;  2ZN9 A;  3I5H B;  1JSA A;  2JPT A;  3PFV A;  4YGD B;  2EC6 C;  2KYC A;  4GPL B;  1AJ5 A;  2L2E A;  1CMG A;  1SK6 D;  2LP2 A;  1B8C A;  1DT7 B;  1K93 D;  3CGA A;  1FI5 A;  1CDM A;  2OTG C;  1UUR A;  1YR5 A;  1B7T Y;  2LC5 A;  2MJW B;  4YGB B;  2KI6 D;  5AXI A;  3WHU B;  1KK8 B;  4ZCV A;  1G4Y R;  4N5X A;  1CLM A;  5CSF A;  1KFX L;  1UHN A;  3LK0 A;  4GGF C;  1K95 A;  1YVH A;  1MXE A;  2AAO A;  5CSJ A;  4NDB A;  4L9M A;  4NQG A;  1V1F A;  1M45 A;  3VRN A;  3CLN A;  1JUO A;  5HLV A;  1CLL A;  1YX8 A;  2P6B B;  1XVJ A;  3JTD B;  2RGI A;  2R2I A;  1H8B A;  2GV5 A;  4HRE E;  2BCB A;  4CFQ A;  1AP4 A;  1HT9 A;  1TCO B;  1RTP 1;  4YRU A;  2B1U A;  1QS7 A;  4AOM A;  1WRL A;  1KFU S;  1DF0 A;  1UHK A;  5AER A;  1JF2 A;  1TCF A;  5GQQ C;  4P2Y B;  1IKU A;  2F3Y A;  1XFX O;  5AFP A;  2CCM A;  4ZCU A;  1YRU B;  4CLN A;  1JFJ A;  1DF0 B;  1PAL A;  3PAL A;  2KBM A;  1HQV A;  4N1F A;  2ZKM X;  2LP3 A;  2LHL A;  4GAO A;  2WOS A;  1MWN A;  3PSR A;  4MRX A;  2JNF A;  1OZS A;  1SKT A;  1YUS A;  1QIV A;  4C0J A;  1J7R A;  2BEC A;  4AQI A;  1F70 A;  2KBI A;  1MF8 B;  5HKY A;  2M9G A;  1V1G A;  1DJZ A;  1KK8 C;  3ZWH A;  1RFJ A;  4DRW A;  4GGN A;  3SIB A;  2LLU A;  4CFR A;  1U5I A;  1KQM B;  2GGZ A;  1XFV O;  3FWB A;  2JT8 A;  4WRI A;  4MVF A;  4ORC B;  2QPT A;  3A8R A;  5HKW A;  4OCI A;  1W7I B;  1ODB A;  1B1G A;  2EC6 B;  5DKR A;  2LMU A;  2NXQ A;  3EK7 A;  1U5I B;  1ZMZ A;  1XO5 A;  4M2O A;  5I2L A;  1X02 A;  2JT0 A;  3JTD C;  4GGF A;  1IRJ A;  2PRU A;  2V53 A;  5JOL A;  2M49 B;  1NP8 A;  1NCZ A;  2ZRS A;  4I5K A;  1DGV A;  2JNX A;  4MRY A;  4NDC A;  3CR5 X;  2O5G A;  2COL B;  2M29 A;  1S26 D;  2EGD A;  1K2H A;  5KU1 A;  5AEQ A;  2JU0 A;  1C7V A;  1GQM A;  1KK7 Y;  1DJW A;  2NZ0 A;  1B47 A;  2BBN A;  2SCP A;  2JUL A;  3NSK A;  1EH2 A;  1F8H A;  1E8A A;  2NLN A;  1QX7 A;  2ZND A;  3PN7 C;  1J1D A;  2HQW A;  3AAK A;  1C7W A;  5ER4 X;  1OSA A;  4MZL A;  3FS7 A;  3AAJ A;  1TIZ A;  2HPS A;  1NSH A;  2EHB A;  4R1E A;  2WCE A;  2MAZ A;  1ALW A;  2BE4 A;  2ZNE A;  3BOW A;  1QX5 B;  4HRH A;  1XA5 A;  3SG6 A;  3SIA A;  3O6B A;  1RK9 A;  2BL0 B;  5I8N A;  2L4I A;  4FTG A;  3IQQ A;  1EG3 A;  1TNP A;  1QX2 A;  3SG2 A;  3KPX A;  4Q04 A;  5J3X A;  1CDP A;  2L4H A;  1BF5 A;  2CXJ A;  3VRQ A;  1BOC A;  2LE9 B;  4BY4 A;  1SCM C;  1G33 A;  4PHK A;  1KQM C;  3OP0 A;  3OHM B;  1Y6W A;  1RWY A;  1K9P A;  2M8U A;  3D0Y A;  1BG1 A;  1NX3 A;  4XJK A;  2I7A A;  2KSP A;  4PE0 A;  3FIA A;  3RLZ A;  1KWO B;  1IWQ A;  1SL7 A;  1J55 A;  4DCK A;  1S1E A;  3EK8 A;  3GOF A;  2PSR A;  4PDZ A;  4NDD A;  3D0Y B;  1CNP A;  2KI4 C;  1DVI A;  2JC2 A;  3HCM A;  4XJK B;  1N0Y A;  3KF9 A;  1QJT A;  2M7L A;  2KFG A;  1MUX A;  2LV7 A;  4JWQ A;  1NUB A;  2K7B A;  1UHJ A;  1PRW A;  4GNK B;  1GJY A;  1IG5 A;  3GK1 A;  2KQY A;  3I5G B;  1TNX A;  2FJU B;  2IS9 A;  4HRG A;  5I2O A;  1IH0 A;  2LLS A;  1PVB A;  1AJ4 A;  1JFK A;  1OOJ A;  1Q80 A;  3E3R A;  4MEW A;  1SL9 A;  2JZI A;  2MBX A;  1PSR A;  2M97 A;  3EVU A;  3BYA A;  3SG5 A;  4CPV A;  1XFU O;  1R2U A;  2G2B A;  1CM1 A;  3D10 A;  1CDL A;  1BJF A;  1LXF C;  1KCY A;  3KO0 A;  3NSI A;  5HKZ A;  1SBJ A;  2H61 A;  1B4C A;  1K8U A;  1MXL C;  2BL0 C;  1AUI B;  2GGM A;  2KFH A;  2KGB C;  2KOT A;  3VRP A;  3LK1 A;  3O4Y A;  5KSZ A;  1XFY O;  1OMD A;  3TUY B;  2Y1N A;  2LM5 A;  3I5I B;  3PN7 B;  1FI6 A;  4I5L B;  1F4Q A;  1GGZ A;  3EK4 A;  2Y1M A;  1K9K A;  2PAS A;  3LCP C;  2LVK A;  2CBL A;  1S6I A;  4A4C A;  1N2D A;  3SG7 A;  3EKJ A;  2JOJ A;  1NWD A;  5I2Q A;  1KWO C;  1NYA A;  5DKN A;  4D1E A;  4ETO A;  3CZT X;  1SL8 A;  2K7O A;  3RM1 A;  1OMV A;  4YI8 A;  1CFD A;  4XYN A;  1J1E A;  4MBE A;  1WDC C;  2LAP A;  2BKI B;  3CS1 A;  3JVT B;  3M0W A;  1KFX S;  2I18 A;  4MSP A;  1SCM B;  3BXK A;  1BOD A;  1JWD A;  2OS8 B;  1DGU A;  2QAC A;  1LKJ A;  1QAT A;  3PM8 A;  1XK4 A;  1CMF A;  1PSB A;  2K2F A;  1KSM A;  3I5G C;  1AHR A;  2KAY A;  3KHE A;  4OR9 B;  1JF0 A;  1H4B A;  2FCD A;  4JPZ B;  3TDZ A;  1F54 A;  2KFF A;  1NCY A;  3TDI A;  4M2P A;  1AK8 A;  2K7D A;  1BMO A;  3DVM A;  3F45 A;  1DMO A;  1OMR A;  5CSN A;  2Y4Q A;  2F2P A;  1WRZ A;  2KI4 B;  2KYF A;  1IJ5 A;  1DJH A;  1K90 D;  4E68 A;  2MHH A;  3HX4 A;  3NXA A;  2LUX A;  4PE1 A;  1SY9 A;  2M3W A;  1K94 A;  3BUO B;  1BT6 A;  1QLS A;  1Y0V H;  1QAS A;  2I2R E;  3CWG A;  3TUY C;  2KAV A;  1UHI A;  3I5I C;  1DJG A;  1RJV A;  1SR6 B;  2G9B A;  2H61 C;  2KQ6 A;  2ZN8 A;  3AKA A;  1FBV A;  4PHJ A;  4M2Q A;  1BLQ A;  1CDN A;  2Q91 A;  3K21 A;  3O78 A;  3O2P A;  1SPY A;  1OQP A;  1QTX A;  3BUX B;  2M0R A;  2SAS A;  2DOQ A; 
#chains in the Genus database with same CATH topology
 2L51 A;  2LUC A;  3EG5 B;  3B6X A;  3DVK A;  1B8R A;  4ORB B;  4DUQ A;  1KQV A;  2M7N A;  1TRF A;  1IQ3 A;  1F71 A;  1F55 A;  2GTE A;  1FPW A;  4MZJ A;  2KDH A;  4OKH A;  3DVJ A;  1CFC A;  1S36 A;  2LVJ A;  2KI6 C;  1TTX A;  3LL8 B;  1IJ6 A;  4IL1 A;  3L4L A;  1YTZ C;  4PHN A;  3EVV A;  3I5F B;  2KGR A;  3JVT C;  1L2O B;  1FF1 A;  1TNQ A;  2WC8 A;  3R72 A;  4GFT A;  1ZAC A;  2OS8 C;  2WCJ A;  1RRO A;  3WHT B;  4OVN F;  5F6T A;  1ZUZ A;  5K89 A;  2WCF A;  4MLW A;  1CM4 A;  1K96 A;  1YUT A;  1D1O A;  4QJ4 B;  1SNL A;  1Z2C B;  4HSZ A;  3AKB A;  4C0L A;  2QDI A;  3GK4 X;  3SG4 A;  1CB1 A;  2LNK A;  3WXA A;  1SMG A;  2LLT A;  1XK4 C;  2JRF A;  4DIR A;  2BKH B;  1KFU L;  1OW4 A;  1NX0 A;  3A4U B;  3IF7 A;  3CTN A;  4JD9 A;  4KYN A;  1WDC B;  2O60 A;  3SS3 A;  1A2X A;  4WQ3 A;  2PVB A;  1ALV A;  1IQ5 A;  1VRK A;  4GUK A;  1BR4 B;  1DJX A;  5CSI A;  2BAP A;  2L0P A;  1F4O A;  2JWW A;  3ICB A;  4WQ2 A;  1K9U A;  2E30 A;  4OZD A;  4BY5 A;  5TNC A;  1CTR A;  3EKH A;  1SR6 C;  1A29 A;  3CAB A;  5PAL A;  1R6P A;  3S0A A;  2FCE A;  5D69 A;  1YUR A;  3EVR A;  1A75 A;  2MRD A;  1EG4 A;  2JXC A;  1QV0 A;  1MQ1 A;  1YVL A;  4PE7 A;  2KHN A;  1SRA A;  3R1O A;  3CYZ A;  1J7P A;  2L5Y A;  1XYD A;  3OX6 A;  4AQJ A;  2AMI A;  1A03 A;  1BR1 B;  4PCW A;  3VRR A;  1CFP A;  1A75 B;  2L98 A;  2QEB A;  3IQO A;  1PK0 D;  4MN0 A;  1GGW A;  1B7T Z;  3QRX A;  1C07 A;  5I94 A;  2P70 A;  2F3Z A;  2BE6 A;  3I5F C;  3FWC A;  2ZFD A;  1L2O C;  1M31 A;  4MZK A;  1N65 A;  3TS5 B;  5BPJ A;  5KTY A;  1J7O A;  3TZ1 A;  2BCX A;  2K7C A;  1EXR A;  1G8I A;  2K8M B;  2L2C A;  1SYM A;  2LAN A;  2PAL A;  3D73 A;  3DD4 A;  2H2K A;  3L4A A;  4PE4 A;  3VGO A;  2CTN A;  4ORA B;  3S0E A;  1MR8 A;  1Y1X A;  3Q8I A;  2BCA A;  1L7Z A;  4PT1 A;  2NCP A;  2LHI A;  1GM0 A;  4A4B A;  3NSL A;  4JQ0 D;  5FYX A;  3VRO A;  2A4J A;  3KEV A;  1MHO A;  1SCV A;  1DJY A;  1NCX A;  2K2A A;  3DVE A;  1UHH A;  3MSE B;  3OX5 A;  1TN4 A;  3TDU A;  5JJG A;  5DKQ A;  1JBA A;  3BQ3 A;  1PUL A;  3BFB A;  2MLF C;  2JTZ A;  1AVS A;  1OZO A;  2D8N A;  2JQ6 A;  1QLK A;  1QIW A;  2CNP A;  2FOT A;  2L5X B;  3I5H C;  1ZOT B;  1M46 A;  2JXL A;  4C0K A;  2YGU A;  1Y1U A;  1NX1 A;  1WLM A;  2NCO A;  4U8D A;  2VRG A;  4YGE B;  2HF5 A;  3PLF B;  1EL4 A;  1TWO A;  1XFZ O;  3C1V A;  3CR4 X;  2LCP A;  4I5N B;  5HL1 A;  1LA0 A;  1LIN A;  1TUZ A;  5G08 A;  3DYE A;  1S6J A;  2AUC A;  2QEO A;  5AAN A;  1Y1A A;  4TNC A;  1EJ3 A;  2WCM A;  4GBA A;  2KAX A;  1XFW O;  1JC2 A;  1ZFS A;  2CT9 A;  3SJS A;  3BUM B;  1A4P A;  2ZRT A;  2ISD A;  1DJI A;  2QEH A;  1CFF A;  2BNX A;  1M63 B;  2F2O A;  1BU3 A;  2K0J A;  1DQE A;  1T14 A;  2K61 A;  1S3P A;  2L50 A;  1OOH A;  2M1U A;  2HQ8 A;  2WND A;  3O4X A;  5ER5 A;  4I5J A;  2LVI A;  2Y5I A;  3WNX B;  2I94 A;  2MA2 A;  3TS5 C;  2LMV A;  5IBW A;  3K1E A;  1OOI X;  4ICB A;  1QVI Y;  1TNW A;  2JTT A;  1C3Z A;  2OPO A;  2Q4U A;  1CKK A;  2OTG B;  1NPQ A;  3OB1 B;  1M39 A;  1QVI Z;  4CID A;  1PVA A;  4INX A;  2F33 A;  1WY9 A;  3BUN B;  5HYD A;  1SW8 A;  2TN4 A;  4YGC B;  1IGV A;  4DS7 A;  3NSO A;  3B7A A;  3R1V A;  1B8L A;  1W7J B;  4OV2 A;  4P5O E;  1CLB A;  1YX7 A;  2KLD A;  2BBM A;  1QXP A;  1B9A A;  5B8I B;  1REC A;  1KK7 Z;  2MLE C;  3CR2 A;  4FQO A;  3D77 A;  1FW4 A;  3PAT A;  4JKT A;  1ORG A;  2F8P A;  2ERB A;  4YI9 A;  4QJ5 B;  2LVV A;  3BUW B;  2JT3 A;  3H4S E;  1NX2 A;  1YUU A;  4YBH B;  2HET A;  1YRT B;  5HLO A;  1QV1 A;  1UWO A;  3CZ1 A;  3SG3 A;  2WCH A;  1LA3 A;  3GK2 A;  4PAL A;  4QJ3 B;  1DEK A;  1TOP A;  2WOR A;  3PM2 A;  1WRK A;  5D7F A;  4F0Z B;  1S5G Y;  2WCB A;  3DF0 A;  1UP5 A;  3BOW B;  2M1K B;  3LLE A;  1NIW A;  4UPG A;  5CPV A;  2LMT A;  4F7F A;  4YGA A;  1S5G Z;  4N1G A;  2KNE A;  3ZNI A;  3FE8 A;  1S6C A;  1J7Q A;  1UUS A;  1WLZ A;  1OE9 B;  3OB2 B;  1W9Z A;  2E6W A;  1DTL A;  3DF0 B;  1LVC D;  3D74 A;  2PMY A;  4PHM A;  1KSO A;  1XFR A;  4USL A;  2ZN9 A;  3I5H B;  1QWV A;  3DXL A;  3N7H A;  2JPT A;  1JSA A;  1IIO A;  3PFV A;  4YGD B;  2EC6 C;  2KYC A;  4GPL B;  1DEL A;  1AJ5 A;  3CDN A;  2L2E A;  1CMG A;  1SK6 D;  2LP2 A;  1B8C A;  1DT7 B;  1K93 D;  3CGA A;  1FI5 A;  2WC6 A;  1CDM A;  2OTG C;  1UUR A;  1YR5 A;  1B7T Y;  2LC5 A;  2MJW B;  4YGB B;  2KI6 D;  5AXI A;  3WHU B;  1KK8 B;  4ZCV A;  1G4Y R;  4N5X A;  1CLM A;  1OOG A;  5CSF A;  1DC1 A;  1KFX L;  1UHN A;  3LK0 A;  4GGF C;  1K95 A;  1YVH A;  1MXE A;  2AAO A;  3FE6 A;  5CSJ A;  4NDB A;  2H8V A;  4L9M A;  4NQG A;  1V1F A;  1M45 A;  2FJY A;  3CLN A;  1JUO A;  5HLV A;  3VRN A;  1CLL A;  1YX8 A;  2P6B B;  1XVJ A;  3JTD B;  2RGI A;  2R2I A;  1H8B A;  3RZS A;  2GV5 A;  4HRE E;  2BCB A;  4CFQ A;  1AP4 A;  1HT9 A;  1TCO B;  1RTP 1;  4YRU A;  2B1U A;  1QS7 A;  4AOM A;  1WRL A;  1KFU S;  1OOF A;  3S0F A;  1DF0 A;  5FI2 A;  1UHK A;  5AER A;  1JF2 A;  1TCF A;  5GQQ C;  4P2Y B;  1IKU A;  2KPH A;  2F3Y A;  1XFX O;  2WC5 A;  2CCM A;  3B87 A;  4ZCU A;  3S0G A;  5AFP A;  1YRU B;  4CLN A;  1JFJ A;  3CZ2 A;  1DF0 B;  1PAL A;  3PAL A;  2KBM A;  1HQV A;  4N1F A;  2ZKM X;  2LP3 A;  2LHL A;  4GAO A;  2WOS A;  1MWN A;  2KLE A;  3PSR A;  2JNF A;  4MRX A;  1OZS A;  1SKT A;  1YUS A;  1QIV A;  4C0J A;  1J7R A;  2BEC A;  3DZT A;  4AQI A;  1F70 A;  2KBI A;  1MF8 B;  5HKY A;  2M9G A;  1V1G A;  3D76 A;  3CZ0 A;  4INW A;  1DJZ A;  1KK8 C;  3ZWH A;  3FE9 A;  1C3Y A;  1RFJ A;  4DRW A;  4GGN A;  3SIB A;  2LLU A;  4CFR A;  3B88 A;  2PQL A;  1U5I A;  1KQM B;  2GGZ A;  5FI7 A;  1XFV O;  3FWB A;  2JT8 A;  4WRI A;  4MVF A;  4ORC B;  2QPT A;  3A8R A;  5HKW A;  4OCI A;  1W7I B;  1ODB A;  1B1G A;  2EC6 B;  5DKR A;  2LMU A;  2NXQ A;  3EK7 A;  1U5I B;  1ZMZ A;  1XO5 A;  4M2O A;  5I2L A;  1X02 A;  2JT0 A;  3JTD C;  4FQT A;  1IRJ A;  2PRU A;  2V53 A;  4GGF A;  5JOL A;  2M49 B;  1NP8 A;  1NCZ A;  2ZRS A;  4I5K A;  1DGV A;  2JNX A;  4MRY A;  4NDC A;  3CR5 X;  2O5G A;  2COL B;  2M29 A;  1S26 D;  2EGD A;  3SS5 A;  5KU1 A;  1K2H A;  5AEQ A;  2JU0 A;  1C7V A;  1GQM A;  1KK7 Y;  1DJW A;  2NZ0 A;  1B47 A;  2BBN A;  2SCP A;  2JUL A;  3NSK A;  3UO9 A;  1EH2 A;  1F8H A;  1E8A A;  2NLN A;  1QX7 A;  2ZND A;  3PN7 C;  1J1D A;  2HQW A;  3AAK A;  1C7W A;  5D3O A;  5DIC A;  1OSA A;  5ER4 X;  4MZL A;  3FS7 A;  3AAJ A;  1TIZ A;  2HPS A;  1NSH A;  3VB1 A;  2EHB A;  3NGV A;  4R1E A;  2WCE A;  2MAZ A;  1ALW A;  2BE4 A;  2ZNE A;  3BOW A;  1QX5 B;  4HRH A;  1XA5 A;  3SG6 A;  3SIA A;  3O6B A;  1RK9 A;  2BL0 B;  5I8N A;  2L4I A;  4FTG A;  3IQQ A;  2QEV A;  1EG3 A;  1TNP A;  1QX2 A;  3SG2 A;  3KPX A;  4Q04 A;  5J3X A;  1CDP A;  2L4H A;  1BF5 A;  3IVT A;  2CXJ A;  3VRQ A;  1BOC A;  2LE9 B;  4BY4 A;  1SCM C;  3V2L A;  1G33 A;  4PHK A;  1KQM C;  3OP0 A;  3OHM B;  1Y6W A;  1RWY A;  1K9P A;  2M8U A;  3D0Y A;  3NHI A;  3L47 A;  1BG1 A;  1NX3 A;  4XJK A;  3R1P A;  2I7A A;  2JPO A;  2KSP A;  4PE0 A;  3FIA A;  3RLZ A;  3D78 A;  1KWO B;  1IWQ A;  1SL7 A;  2WCL A;  1J55 A;  4DCK A;  2PYQ A;  1S1E A;  3EK8 A;  3GOF A;  2PSR A;  3DY9 A;  4PDZ A;  1P28 A;  4NDD A;  3D0Y B;  1CNP A;  2KI4 C;  1DVI A;  2JC2 A;  3HCM A;  4XJK B;  1N0Y A;  3KF9 A;  1QJT A;  2M7L A;  2KFG A;  1MUX A;  2LV7 A;  4JWQ A;  1NUB A;  2K7B A;  1UHJ A;  1PRW A;  4GNK B;  1GJY A;  1IG5 A;  3GK1 A;  4IJ7 A;  2KQY A;  3I5G B;  1TNX A;  2FJU B;  2IS9 A;  4HRG A;  5I2O A;  1IH0 A;  2LLS A;  1PVB A;  1AJ4 A;  1JFK A;  1OOJ A;  1Q80 A;  3E3R A;  4MEW A;  1SL9 A;  2JZI A;  2P71 A;  1PSR A;  5FI6 A;  2MBX A;  2M97 A;  3EVU A;  3BYA A;  1TUJ A;  3SG5 A;  4CPV A;  1XFU O;  5EL2 A;  1R2U A;  2G2B A;  1CM1 A;  3D10 A;  1CDL A;  1BJF A;  1LXF C;  1KCY A;  3KO0 A;  3NSI A;  5HKZ A;  1SBJ A;  2H61 A;  1B4C A;  1K8U A;  1MXL C;  2BL0 C;  1AUI B;  2GGM A;  2KFH A;  2KGB C;  2KOT A;  3VRP A;  3LK1 A;  3O4Y A;  5KSZ A;  1XFY O;  1OMD A;  3TUY B;  2Y1N A;  2LM5 A;  3I5I B;  2WCK A;  3PN7 B;  1FI6 A;  4I5L B;  1F4Q A;  1GGZ A;  3EK4 A;  2Y1M A;  1K9K A;  3B86 A;  2PAS A;  3LCP C;  2LVK A;  3SS4 A;  2CBL A;  3NHT A;  3PJI A;  1S6I A;  4A4C A;  1N2D A;  3BFH A;  3SG7 A;  3EKJ A;  3S0B A;  2JOJ A;  1NWD A;  5I2Q A;  1KWO C;  1NYA A;  5DKN A;  3UNW A;  3BJH A;  4D1E A;  3CZT X;  1SL8 A;  2K7O A;  3RM1 A;  4ETO A;  1OMV A;  4YI8 A;  1CFD A;  4XYN A;  3OGN A;  1J1E A;  4MBE A;  1WDC C;  2LAP A;  2BKI B;  3CS1 A;  3JVT B;  3M0W A;  1KFX S;  2I18 A;  4MSP A;  1SCM B;  3BXK A;  1BOD A;  1JWD A;  2OS8 B;  1DGU A;  2QAC A;  1LKJ A;  1QAT A;  3PM8 A;  1XK4 A;  1LS8 A;  1PSB A;  2K2F A;  1CMF A;  1KSM A;  3I5G C;  1AHR A;  2KAY A;  3KHE A;  4OR9 B;  1JF0 A;  1H4B A;  2FCD A;  4JPZ B;  2K60 A;  3TDZ A;  1F54 A;  2KFF A;  1NCY A;  3TDI A;  4M2P A;  1AK8 A;  3S0D A;  2K7D A;  3D75 A;  1BMO A;  3DVM A;  3F45 A;  1DMO A;  1OMR A;  5CSN A;  2Y4Q A;  2F2P A;  1WRZ A;  2KI4 B;  2KYF A;  1IJ5 A;  1DJH A;  1K90 D;  4E68 A;  2MHH A;  3HX4 A;  3NXA A;  2LUX A;  4PE1 A;  1SY9 A;  2M3W A;  1K94 A;  3BUO B;  1BT6 A;  1QLS A;  1Y0V H;  1QAS A;  2I2R E;  3CWG A;  3TUY C;  2KAV A;  1UHI A;  3I5I C;  3OBV A;  1DJG A;  1RJV A;  1SR6 B;  1Z4H A;  2G9B A;  2H61 C;  2KQ6 A;  2ZN8 A;  1FBV A;  3AKA A;  4M2Q A;  4PHJ A;  1BLQ A;  1CDN A;  2Q91 A;  3K21 A;  3O78 A;  3O2P A;  1SPY A;  1OQP A;  1QTX A;  1SSE B;  2M0R A;  2SAS A;  3BFA A;  3BUX B;  2DOQ A;  3QME A; 
#chains in the Genus database with same CATH homology
 2L51 A;  2LUC A;  3DVK A;  1B8R A;  4ORB B;  4DUQ A;  1KQV A;  2M7N A;  1TRF A;  1IQ3 A;  1F71 A;  1F55 A;  1FPW A;  4MZJ A;  2KDH A;  4OKH A;  3DVJ A;  1CFC A;  1S36 A;  2LVJ A;  2KI6 C;  1TTX A;  3LL8 B;  1IJ6 A;  4IL1 A;  1YTZ C;  4PHN A;  3EVV A;  3I5F B;  2KGR A;  3JVT C;  1L2O B;  1FF1 A;  1TNQ A;  2WC8 A;  4GFT A;  1ZAC A;  2OS8 C;  1RRO A;  3WHT B;  4OVN F;  5F6T A;  1ZUZ A;  5K89 A;  2WCF A;  4MLW A;  1CM4 A;  1K96 A;  1YUT A;  1D1O A;  4QJ4 B;  1SNL A;  4HSZ A;  3AKB A;  4C0L A;  3GK4 X;  3SG4 A;  1CB1 A;  2LNK A;  3WXA A;  1SMG A;  2LLT A;  1XK4 C;  2JRF A;  4DIR A;  2BKH B;  1KFU L;  1NX0 A;  3A4U B;  3IF7 A;  3CTN A;  1WDC B;  2O60 A;  1A2X A;  4WQ3 A;  2PVB A;  1ALV A;  1IQ5 A;  1VRK A;  4GUK A;  1BR4 B;  1DJX A;  5CSI A;  2L0P A;  1F4O A;  2JWW A;  3ICB A;  4WQ2 A;  1K9U A;  2E30 A;  4BY5 A;  5TNC A;  1CTR A;  3EKH A;  1SR6 C;  1A29 A;  5PAL A;  1R6P A;  2FCE A;  5D69 A;  1YUR A;  3EVR A;  1A75 A;  2MRD A;  1EG4 A;  2JXC A;  1QV0 A;  1MQ1 A;  1YVL A;  4PE7 A;  2KHN A;  1SRA A;  1J7P A;  1XYD A;  3OX6 A;  4AQJ A;  2AMI A;  1A03 A;  1BR1 B;  4PCW A;  3VRR A;  1CFP A;  1A75 B;  2L98 A;  3IQO A;  1PK0 D;  4MN0 A;  1GGW A;  1B7T Z;  3QRX A;  1C07 A;  2F3Z A;  2BE6 A;  3I5F C;  3FWC A;  2ZFD A;  1L2O C;  1M31 A;  4MZK A;  1N65 A;  3TS5 B;  5BPJ A;  5KTY A;  1J7O A;  3TZ1 A;  2BCX A;  2K7C A;  1EXR A;  1G8I A;  2K8M B;  2LAN A;  1SYM A;  2PAL A;  3DD4 A;  2H2K A;  4PE4 A;  3VGO A;  2CTN A;  4ORA B;  1MR8 A;  1Y1X A;  2BCA A;  1L7Z A;  2NCP A;  2LHI A;  4A4B A;  3NSL A;  4JQ0 D;  5FYX A;  3VRO A;  2A4J A;  3KEV A;  1MHO A;  1SCV A;  1DJY A;  1NCX A;  2K2A A;  3DVE A;  1UHH A;  3MSE B;  3OX5 A;  1TN4 A;  3TDU A;  5JJG A;  5DKQ A;  1JBA A;  3BQ3 A;  1PUL A;  2MLF C;  2JTZ A;  1AVS A;  1OZO A;  2D8N A;  2JQ6 A;  1QLK A;  1QIW A;  2CNP A;  2FOT A;  2L5X B;  3I5H C;  1ZOT B;  1M46 A;  2JXL A;  4C0K A;  1Y1U A;  1NX1 A;  1WLM A;  2NCO A;  4U8D A;  2VRG A;  4YGE B;  2HF5 A;  3PLF B;  1EL4 A;  3C1V A;  1XFZ O;  3CR4 X;  2LCP A;  4I5N B;  1LA0 A;  1LIN A;  5G08 A;  1S6J A;  2AUC A;  5AAN A;  1Y1A A;  4TNC A;  1EJ3 A;  1JC2 A;  4GBA A;  2KAX A;  1XFW O;  1ZFS A;  2CT9 A;  3BUM B;  1A4P A;  2ZRT A;  2ISD A;  1DJI A;  1CFF A;  1M63 B;  2F2O A;  1BU3 A;  2K0J A;  2L50 A;  2K61 A;  3SJS A;  1S3P A;  2M1U A;  2WND A;  2HQ8 A;  5ER5 A;  4I5J A;  2LVI A;  2Y5I A;  3WNX B;  2I94 A;  2MA2 A;  3TS5 C;  2LMV A;  5IBW A;  4ICB A;  1QVI Y;  1TNW A;  2JTT A;  2OPO A;  2Q4U A;  1CKK A;  2OTG B;  1NPQ A;  3OB1 B;  1M39 A;  1QVI Z;  4CID A;  1PVA A;  2F33 A;  1WY9 A;  3BUN B;  5HYD A;  1SW8 A;  2TN4 A;  4YGC B;  1IGV A;  4DS7 A;  3NSO A;  1B8L A;  1W7J B;  4OV2 A;  4P5O E;  1CLB A;  1YX7 A;  5B8I B;  2BBM A;  1QXP A;  1B9A A;  1REC A;  1KK7 Z;  2MLE C;  3CR2 A;  4FQO A;  1FW4 A;  3PAT A;  2F8P A;  4YI9 A;  4QJ5 B;  2LVV A;  3BUW B;  2JT3 A;  3H4S E;  1NX2 A;  1YUU A;  4YBH B;  2HET A;  1YRT B;  5HLO A;  1QV1 A;  1UWO A;  3SG3 A;  1LA3 A;  3GK2 A;  4PAL A;  4QJ3 B;  1TOP A;  2WOR A;  5D7F A;  1WRK A;  4F0Z B;  1S5G Y;  2WCB A;  3DF0 A;  1UP5 A;  3BOW B;  2M1K B;  3LLE A;  1NIW A;  4UPG A;  5CPV A;  2LMT A;  4YGA A;  1S5G Z;  4N1G A;  2KNE A;  3ZNI A;  1J7Q A;  1S6C A;  1UUS A;  1WLZ A;  1OE9 B;  3OB2 B;  2E6W A;  3DF0 B;  1DTL A;  4PHM A;  1LVC D;  4USL A;  2PMY A;  1KSO A;  2ZN9 A;  3I5H B;  1JSA A;  2JPT A;  3PFV A;  4YGD B;  2EC6 C;  2KYC A;  4GPL B;  1AJ5 A;  2L2E A;  1CMG A;  1SK6 D;  2LP2 A;  1B8C A;  1DT7 B;  1K93 D;  3CGA A;  1FI5 A;  1CDM A;  2OTG C;  1UUR A;  1YR5 A;  1B7T Y;  2LC5 A;  2MJW B;  4YGB B;  2KI6 D;  5AXI A;  3WHU B;  1KK8 B;  4ZCV A;  1G4Y R;  4N5X A;  1CLM A;  5CSF A;  1KFX L;  1UHN A;  3LK0 A;  4GGF C;  1K95 A;  1YVH A;  1MXE A;  2AAO A;  5CSJ A;  4NDB A;  4L9M A;  4NQG A;  1V1F A;  1M45 A;  3VRN A;  3CLN A;  1JUO A;  5HLV A;  1CLL A;  1YX8 A;  2P6B B;  1XVJ A;  3JTD B;  2RGI A;  2R2I A;  1H8B A;  2GV5 A;  4HRE E;  2BCB A;  4CFQ A;  1AP4 A;  1HT9 A;  1TCO B;  1RTP 1;  4YRU A;  2B1U A;  1QS7 A;  4AOM A;  1WRL A;  1KFU S;  1DF0 A;  1UHK A;  5AER A;  1JF2 A;  1TCF A;  5GQQ C;  4P2Y B;  1IKU A;  2F3Y A;  1XFX O;  5AFP A;  2CCM A;  4ZCU A;  1YRU B;  4CLN A;  1JFJ A;  1DF0 B;  1PAL A;  3PAL A;  2KBM A;  1HQV A;  4N1F A;  2ZKM X;  2LP3 A;  2LHL A;  4GAO A;  2WOS A;  1MWN A;  3PSR A;  4MRX A;  2JNF A;  1OZS A;  1SKT A;  1YUS A;  1QIV A;  4C0J A;  1J7R A;  2BEC A;  4AQI A;  1F70 A;  2KBI A;  1MF8 B;  5HKY A;  2M9G A;  1V1G A;  1DJZ A;  1KK8 C;  3ZWH A;  1RFJ A;  4DRW A;  4GGN A;  3SIB A;  2LLU A;  4CFR A;  1U5I A;  1KQM B;  2GGZ A;  1XFV O;  3FWB A;  2JT8 A;  4WRI A;  4MVF A;  4ORC B;  2QPT A;  3A8R A;  5HKW A;  4OCI A;  1W7I B;  1ODB A;  1B1G A;  2EC6 B;  5DKR A;  2LMU A;  2NXQ A;  3EK7 A;  1U5I B;  1ZMZ A;  1XO5 A;  4M2O A;  5I2L A;  1X02 A;  2JT0 A;  3JTD C;  4GGF A;  1IRJ A;  2PRU A;  2V53 A;  5JOL A;  2M49 B;  1NP8 A;  1NCZ A;  2ZRS A;  4I5K A;  1DGV A;  2JNX A;  4MRY A;  4NDC A;  3CR5 X;  2O5G A;  2COL B;  2M29 A;  1S26 D;  2EGD A;  1K2H A;  5KU1 A;  5AEQ A;  2JU0 A;  1C7V A;  1GQM A;  1KK7 Y;  1DJW A;  2NZ0 A;  1B47 A;  2BBN A;  2SCP A;  2JUL A;  3NSK A;  1EH2 A;  1F8H A;  1E8A A;  2NLN A;  1QX7 A;  2ZND A;  3PN7 C;  1J1D A;  2HQW A;  3AAK A;  1C7W A;  5ER4 X;  1OSA A;  4MZL A;  3FS7 A;  3AAJ A;  1TIZ A;  2HPS A;  1NSH A;  2EHB A;  4R1E A;  2WCE A;  2MAZ A;  1ALW A;  2BE4 A;  2ZNE A;  3BOW A;  1QX5 B;  4HRH A;  1XA5 A;  3SG6 A;  3SIA A;  3O6B A;  1RK9 A;  2BL0 B;  5I8N A;  2L4I A;  4FTG A;  3IQQ A;  1EG3 A;  1TNP A;  1QX2 A;  3SG2 A;  3KPX A;  4Q04 A;  5J3X A;  1CDP A;  2L4H A;  1BF5 A;  2CXJ A;  3VRQ A;  1BOC A;  2LE9 B;  4BY4 A;  1SCM C;  1G33 A;  4PHK A;  1KQM C;  3OP0 A;  3OHM B;  1Y6W A;  1RWY A;  1K9P A;  2M8U A;  3D0Y A;  1BG1 A;  1NX3 A;  4XJK A;  2I7A A;  2KSP A;  4PE0 A;  3FIA A;  3RLZ A;  1KWO B;  1IWQ A;  1SL7 A;  1J55 A;  4DCK A;  1S1E A;  3EK8 A;  3GOF A;  2PSR A;  4PDZ A;  4NDD A;  3D0Y B;  1CNP A;  2KI4 C;  1DVI A;  2JC2 A;  3HCM A;  4XJK B;  1N0Y A;  3KF9 A;  1QJT A;  2M7L A;  2KFG A;  1MUX A;  2LV7 A;  4JWQ A;  1NUB A;  2K7B A;  1UHJ A;  1PRW A;  4GNK B;  1GJY A;  1IG5 A;  3GK1 A;  2KQY A;  3I5G B;  1TNX A;  2FJU B;  2IS9 A;  4HRG A;  5I2O A;  1IH0 A;  2LLS A;  1PVB A;  1AJ4 A;  1JFK A;  1OOJ A;  1Q80 A;  3E3R A;  4MEW A;  1SL9 A;  2JZI A;  2MBX A;  1PSR A;  2M97 A;  3EVU A;  3BYA A;  3SG5 A;  4CPV A;  1XFU O;  1R2U A;  2G2B A;  1CM1 A;  3D10 A;  1CDL A;  1BJF A;  1LXF C;  1KCY A;  3KO0 A;  3NSI A;  5HKZ A;  1SBJ A;  2H61 A;  1B4C A;  1K8U A;  1MXL C;  2BL0 C;  1AUI B;  2GGM A;  2KFH A;  2KGB C;  2KOT A;  3VRP A;  3LK1 A;  3O4Y A;  5KSZ A;  1XFY O;  1OMD A;  3TUY B;  2Y1N A;  2LM5 A;  3I5I B;  3PN7 B;  1FI6 A;  4I5L B;  1F4Q A;  1GGZ A;  3EK4 A;  2Y1M A;  1K9K A;  2PAS A;  3LCP C;  2LVK A;  2CBL A;  1S6I A;  4A4C A;  1N2D A;  3SG7 A;  3EKJ A;  2JOJ A;  1NWD A;  5I2Q A;  1KWO C;  1NYA A;  5DKN A;  4D1E A;  4ETO A;  3CZT X;  1SL8 A;  2K7O A;  3RM1 A;  1OMV A;  4YI8 A;  1CFD A;  4XYN A;  1J1E A;  4MBE A;  1WDC C;  2LAP A;  2BKI B;  3CS1 A;  3JVT B;  3M0W A;  1KFX S;  2I18 A;  4MSP A;  1SCM B;  3BXK A;  1BOD A;  1JWD A;  2OS8 B;  1DGU A;  2QAC A;  1LKJ A;  1QAT A;  3PM8 A;  1XK4 A;  1CMF A;  1PSB A;  2K2F A;  1KSM A;  3I5G C;  1AHR A;  2KAY A;  3KHE A;  4OR9 B;  1JF0 A;  1H4B A;  2FCD A;  4JPZ B;  3TDZ A;  1F54 A;  2KFF A;  1NCY A;  3TDI A;  4M2P A;  1AK8 A;  2K7D A;  1BMO A;  3DVM A;  3F45 A;  1DMO A;  1OMR A;  5CSN A;  2Y4Q A;  2F2P A;  1WRZ A;  2KI4 B;  2KYF A;  1IJ5 A;  1DJH A;  1K90 D;  4E68 A;  2MHH A;  3HX4 A;  3NXA A;  2LUX A;  4PE1 A;  1SY9 A;  2M3W A;  1K94 A;  3BUO B;  1BT6 A;  1QLS A;  1Y0V H;  1QAS A;  2I2R E;  3CWG A;  3TUY C;  2KAV A;  1UHI A;  3I5I C;  1DJG A;  1RJV A;  1SR6 B;  2G9B A;  2H61 C;  2KQ6 A;  2ZN8 A;  3AKA A;  1FBV A;  4PHJ A;  4M2Q A;  1BLQ A;  1CDN A;  2Q91 A;  3K21 A;  3O78 A;  3O2P A;  1SPY A;  1OQP A;  1QTX A;  3BUX B;  2M0R A;  2SAS A;  2DOQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...