1TCOB

Ternary complex of a calcineurin a fragment, calcineurin b, fkbp12 and the immunosuppressant drug fk506 (tacrolimus)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
169
structure length
169
Chain Sequence
GNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE PHOSPHATASE B2
publication title X-ray structure of calcineurin inhibited by the immunophilin-immunosuppressant FKBP12-FK506 complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Complex (hydrolase/isomerase)
total genus 56
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 1996-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00036 EF-hand_1 EF hand
B PF13202 EF-hand_5 EF hand
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1tcoB00
3EKHA 1YVHA 4I5LB 2GGZA 1KWOC 1L7ZA 1M39A 1S6JA 2LUXA 3PSRA 5DKQA 4ZCVA 3IQOA 1FPWA 1AVSA 1QIWA 1B9AA 2MJWB 1PSRA 3NSLA 3VGOA 2BBNA 1WY9A 2K2AA 5AEQA 1EG4A 3ICBA 2LP3A 3GK4X 1XA5A 3LK1A 1HT9A 2ZNEA 2LV7A 4N5XA 2LM5A 1Y0VH 1XFWO 5AXIA 2MA2A 1LVCD 2PASA 2JNXA 2HQ8A 1FI5A 1B1GA 2JU0A 3HCMA 3D0YA 3LL8B 4GAOA 3SG4A 1DMOA 3I5HC 3BXKA 1MF8B 1PVBA 1QLSA 4GGFA 2M1UA 3KF9A 1PRWA 2BCAA 1ZFSA 2M7NA 1NSHA 1YRUB 5JOLA 2E6WA 4XJKB 3IF7A 2LANA 1KFUL 3CWGA 1L2OB 1CFPA 1JBAA 1GGZA 1H8BA 4YI8A 1RECA 4WQ2A 1F8HA 4MVFA 1BG1A 1W7IB 4ORCB 2B1UA 4MBEA 2JC2A 4OV2A 1DJGA 5F6TA 1XYDA 4MEWA 1GJYA 1NX1A 1CKKA 1QASA 1QV1A 4MN0A 2LLTA 3WNXB 4F0ZB 1IJ6A 1J1EA 1RWYA 3RM1A 3AAKA 1AK8A 1N65A 2LVKA 2ZFDA 2G2BA 1HQVA 2H61C 1WRZA 1NUBA 1UHJA 2F2OA 2L50A 3A8RA 1TRFA 4TNCA 2KFGA 2KGBC 3O6BA 1OOJA 1S5GY 1QV0A 1QVIY 1FW4A 1K95A 2KQ6A 3SG3A 4I5KA 1IG5A 2K7OA 1DT7B 2JXLA 5GQQC 3I5IB 5HYDA 1KK8C 4MZLA 2LE9B 4CFQA 4PHNA 1PALA 2V53A 1DJWA 2Y5IA 2KAYA 3EVVA 1KCYA 5FYXA 1NX0A 3HX4A 1TNQA 1SYMA 2JZIA 1DJYA 2JQ6A 4HSZA 5K89A 1IKUA 1QX5B 3WHTB 2FJUB 3TS5B 3DD4A 1KK7Y 1YRTB 5JJGA 4P5OE 4AOMA 1YURA 2HPSA 1DGUA 2ZRSA 2ZRTA 2LCPA 3IQQA 1M46A 2EC6C 3TDUA 2KI4C 2KGRA 2JOJA 2MAZA 4HRHA 1J7OA 2LVIA 2HF5A 4HREE 4PE7A 2LP2A 4PDZA 1F70A 1EXRA 2EGDA 1AUIB 2MHHA 4FQOA 2JT0A 1SL8A 3O4YA 3NSIA 5HKWA 2O60A 3BYAA 1BODA 1XFXO 2GGMA 2KI6D 3PM8A 3I5FC 3I5HB 1QX2A 1MQ1A 4ORBB 3D0YB 4GUKA 4C0JA 4GBAA 3OX6A 1QX7A 2JWWA 3PATA 3I5GC 4AQJA 1C7VA 1SY9A 1B4CA 1H4BA 2OS8C 3LCPC 3K21A 2G9BA 3WHUB 1FBVA 1MHOA 3DVJA 3VRQA 3JTDC 2BCBA 3SJSA 4GPLB 4JPZB 3M0WA 1KQMB 2KDHA 1YVLA 3KEVA 1ZOTB 3SIBA 5HLVA 1LA3A 1KFXL 1DJZA 1J7RA 1B8RA 3VRNA 1MXEA 1Q80A 4NQGA 2ZNDA 1OMRA 3PFVA 2KAXA 2JPTA 2ZN8A 2QACA 4NDBA 1DJIA 1G4YR 1LXFC 1NWDA 5KU1A 3OB1B 4ZCUA 2CT9A 1JSAA 5I2LA 1RROA 1TN4A 4NDDA 1TOPA 3SG2A 3CR2A 2F8PA 2WCBA 5AERA 1PSBA 1CDMA 1XK4C 4YBHB 1EH2A 2WCEA 2BE4A 1SBJA 3TZ1A 1IQ3A 1Y6WA 5I8NA 1SL7A 1IWQA 2PRUA 2NZ0A 3GK2A 4GFTA 1QS7A 1J7PA 1K9PA 1KSOA 2F2PA 5HLOA 1C07A 5J3XA 1S6IA 4PE1A 1OE9B 1C7WA 1IGVA 4AQIA 1WLMA 2CTNA 3D10A 1SL9A 3JVTC 4YGCB 2M0RA 2WOSA 4CPVA 3SG7A 5AANA 4N1FA 5HKZA 2JXCA 3TDZA 2L5XB 2NCPA 1CFFA 1YR5A 1AJ5A 1WRLA 2LLSA 5CPVA 4BY5A 2EC6B 2EHBA 2M97A 2SCPA 3AKAA 3KHEA 4JWQA 3CR4X 1JF0A 1WLZA 2VRGA 2H61A 2HETA 1DF0A 3NXAA 2JT8A 1CDPA 3O78A 1QXPA 1X02A 2TN4A 5KSZA 1CTRA 3ZNIA 2O5GA 5IBWA 1F54A 3C1VA 2LMTA 1DJXA 1S6CA 3CTNA 3I5FB 1JWDA 2NCOA 2AMIA 1SNLA 4M2PA 2COLB 1XO5A 1TCOB 1DTLA 2KBMA 2JT3A 1U5IB 1LA0A 1NP8A 2K0JA 2KFFA 3I5GB 1SMGA 2NXQA 3GK1A 4MZJA 4GGNA 2F3YA 5CSIA 2LUCA 4OCIA 1QTXA 1SCMC 1IH0A 2M7LA 4Q04A 1NCYA 2K7CA 1XFYO 3CZTX 2LC5A 2F3ZA 2I2RE 3FWCA 2L98A 2A4JA 1CFDA 2BKHB 2I94A 2K61A 2ZKMX 3A4UB 1AHRA 2KFHA 1JFJA 3LK0A 3VRPA 1XVJA 2Y1MA 4CFRA 2KYCA 1RFJA 1KWOB 1OZSA 1TNXA 1UHHA 2CXJA 2D8NA 1NPQA 1OQPA 3BUMB 5ER5A 1EL4A 1SR6C 2OTGC 1B47A 3VRRA 1PVAA 1K96A 1KFXS 1S5GZ 1JFKA 1ZACA 2PSRA 4PHJA 1QVIZ 2M8UA 3DF0A 1K9UA 1UUSA 1Y1XA 3CGAA 2OPOA 5DKNA 1BJFA 2MLEC 1F4QA 1K9KA 3QRXA 2PMYA 2LLUA 2KI6C 2K8MB 4U8DA 2I18A 1ODBA 1U5IA 3BUOB 1J1DA 1ALWA 2Q91A 4WQ3A 4DCKA 2LMVA 1OSAA 2LVVA 1A2XA 2KSPA 3JVTB 3BUXB 3SG6A 2FCEA 2ISDA 4MRXA 1KK7Z 1D1OA 1LINA 1K2HA 1CDNA 3MSEB 2BCXA 2PALA 4QJ3B 1XFVO 4MRYA 5D69A 3BOWB 2M49B 4PALA 1UHIA 2BL0C 1S26D 1CM1A 4ORAB 4ETOA 3CLNA 1K90D 4PHKA 3KO0A 1KFUS 2WORA 2KQYA 1CB1A 5CSNA 1JUOA 1LKJA 1OMVA 1YUUA 2M29A 4A4CA 4QJ5B 2AUCA 1A75B 1JC2A 1DF0B 1RJVA 2L51A 5TNCA 1K93D 1YUSA 1YX8A 3H4SE 2FCDA 4OVNF 1CMFA 1XK4A 1K94A 1S36A 2DOQA 5G08A 1AP4A 2H2KA 2KOTA 4PCWA 2Q4UA 4MSPA 3EK7A 1FI6A 5B8IB 3TDIA 1XFUO 1KK8B 2L4IA 1QATA 1WDCC 1YTZC 1SCMB 1F55A 5ER4X 1GQMA 1TNPA 1F4OA 3EVRA 3PN7C 1S3PA 1G8IA 4BY4A 1A03A 3FS7A 1IQ5A 4GNKB 1OZOA 4DIRA 1CLMA 5BPJA 1KQVA 1DGVA 2KYFA 2M1KB 5CSJA 1BT6A 3BOWA 1SCVA 1FF1A 1B7TY 4DUQA 3AAJA 4CIDA 1UHNA 2JRFA 2ZN9A 1PULA 2M9GA 3OP0A 4IL1A 2HQWA 4OKHA 4PE4A 2AAOA 1M31A 3OB2B 1SR6B 1B8CA 2OTGB 4ICBA 4I5NB 4M2QA 3TUYC 1CFCA 2BBMA 2K7BA 3BQ3A 2KI4B 4XYNA 1TNWA 4E68A 1TTXA 3VROA 1A75A 3DVEA 1RTP1 1NCXA 1QIVA 1W7JB 1NX3A 1SW8A 2LHIA 2GV5A 2R2IA 1UHKA 1BMOA 3EK4A 4I5JA 5KTYA 1NX2A 3OX5A 4N1GA 4YGAA 1V1FA 2MRDA 1EG3A 2BECA 3DF0B 1J7QA 2RGIA 4GGFC 4WRIA 3PLFB 1YUTA 4DRWA 1Y1AA 2JNFA 1PK0D 1QJTA 4R1EA 1TIZA 2MBXA 1R2UA 1KQMC 3RLZA 2L2EA 2OS8B 3O2PA 1B7TZ 3LLEA 2KBIA 3SIAA 1RK9A 3AKBA 3BUNB 1MXLC 1V1GA 2E30A 2K7DA 3JTDB 4C0KA 3CS1A 1MUXA 1NCZA 2BL0B 2L4HA 2QPTA 1BLQA 4NDCA 1NYAA 1YX7A 4C0LA 2KNEA 2LAPA 3WXAA 4JQ0D 2MLFC 2CCMA 4DS7A 1BOCA 4OR9B 5DKRA 1OMDA 3DVMA 1WRKA 4PHMA 1QLKA 1KSMA 4USLA 3F45A 3FWBA 5I2QA 3NSOA 3BUWB 2LHLA 2KAVA 4YRUA 2P6BB 1N2DA 1F71A 2JULA 4XJKA 1BU3A 3CR5X 1UURA 1M45A 4MLWA 2K2FA 3EKJA 1G33A 1CMGA 1WDCB 3EVUA 4YGEB 3NSKA 1L2OC 1AJ4A 1J55A 1SKTA 3PN7B 1UP5A 1R6PA 1TCFA 1A29A 1B8LA 2SASA 1CNPA 1ZUZA 1IRJA 1S1EA 1BR4B 5I2OA 2JTTA 1IJ5A 4CLNA 2LVJA 1CDLA 1Y1UA 1MR8A 3TUYB 2FOTA 3PALA 5D7FA 2WCFA 2LMUA 1NIWA 1VRKA 2BKIB 1N0YA 4YI9A 1GGWA 4M2OA 1K8UA 1DVIA 4UPGA 1E8AA 4D1EA 3GOFA 2CBLA 1CLLA 1JF2A 2M3WA 4HRGA 1XFZO 4FTGA 2BE6A 2WC8A 4P2YB 3SG5A 4YGBB 1CLBA 1EJ3A 2Y1NA 2JTZA 2L0PA 2I7AA 1ALVA 1BR1B 3FIAA 3E3RA 3I5IC 4YGDB 1A4PA 1CM4A 5HKYA 2NLNA 2IS9A 2WNDA 4A4BA 2LNKA 2F33A 2CNPA 3EK8A 1SRAA 1UWOA 1ZMZA 4L9MA 4QJ4B 4MZKA 1M63B 5AFPA 1SPYA 2Y4QA 3OHMB 2PVBA 1BF5A 5CSFA 4PE0A 1DJHA 5PALA 3ZWHA 1MWNA 1SK6D 3DVKA 3TS5C 3KPXA 2KHNA
chains in the Genus database with same CATH superfamily
3EKHA 1YVHA 4I5LB 2GGZA 1KWOC 1L7ZA 1M39A 1S6JA 2LUXA 3PSRA 5DKQA 4ZCVA 3IQOA 1FPWA 1AVSA 1QIWA 1B9AA 2MJWB 1PSRA 3DYEA 3NSLA 3VGOA 1OW4A 2BBNA 1WY9A 2K2AA 5AEQA 1EG4A 3ICBA 5I94A 2LP3A 3GK4X 1XA5A 3LK1A 1HT9A 2ZNEA 2LV7A 4N5XA 2LM5A 1Y0VH 1XFWO 5AXIA 2MA2A 1DQEA 1QWVA 1LVCD 2PASA 4F7FA 2PYQA 2JNXA 2HQ8A 3S0GA 1B1GA 1OOHA 2JU0A 3D0YA 3HCMA 1FI5A 3LL8B 1TWOA 4GAOA 5DICA 3SG4A 3UNWA 1DMOA 3I5HC 3BXKA 1MF8B 1PVBA 1QLSA 4GGFA 2M1UA 3KF9A 3R1OA 1PRWA 2BCAA 1ZFSA 2M7NA 1NSHA 1YRUB 3CZ0A 5JOLA 2E6WA 4XJKB 3IF7A 2LANA 1KFUL 3CWGA 1L2OB 1C3YA 1CFPA 1GGZA 1JBAA 1H8BA 4YI8A 1RECA 3O4XA 3L4LA 4WQ2A 1F8HA 4MVFA 1BG1A 1W7IB 4ORCB 2B1UA 4MBEA 2JC2A 4OV2A 1DJGA 5F6TA 1XYDA 4MEWA 1GJYA 1NX1A 3OBVA 1CKKA 1QASA 1QV1A 4MN0A 2LLTA 3WNXB 4F0ZB 3DXLA 3B86A 1IJ6A 1J1EA 1RWYA 3RM1A 3AAKA 1AK8A 1N65A 2LVKA 2ZFDA 2QDIA 2G2BA 1HQVA 2H61C 1WRZA 1DELA 1NUBA 1UHJA 2F2OA 2L50A 3A8RA 1TRFA 4TNCA 2KFGA 2KGBC 3O6BA 3IVTA 1OOJA 1S5GY 2YGUA 1QV0A 1QVIY 1FW4A 1K95A 2KQ6A 3SG3A 4I5KA 1IG5A 1IIOA 1Z2CB 2K7OA 1DT7B 2JXLA 5GQQC 3I5IB 5HYDA 1KK8C 4MZLA 3QMEA 2LE9B 4CFQA 4PHNA 2WCLA 1PALA 2V53A 1DJWA 2Y5IA 2KAYA 3EVVA 1KCYA 5FYXA 1NX0A 3HX4A 1TNQA 1SYMA 2JZIA 1DJYA 2JQ6A 4HSZA 5K89A 1IKUA 1GM0A 1QX5B 3BJHA 3WHTB 2FJUB 3TS5B 3DD4A 1KK7Y 1YRTB 5JJGA 4P5OE 4AOMA 1YURA 2HPSA 1DGUA 2ZRSA 2ZRTA 2LCPA 3IQQA 1M46A 2EC6C 4JD9A 3TDUA 2KI4C 2KGRA 2JOJA 2MAZA 4HRHA 1J7OA 2LVIA 2HF5A 4HREE 4PE7A 2LP2A 4PDZA 1F70A 1EXRA 2EGDA 1AUIB 2MHHA 4FQOA 2JT0A 1SL8A 3O4YA 3D74A 3NSIA 3BFAA 5HKWA 2O60A 3BYAA 1BODA 1XFXO 2GGMA 2KI6D 3PM8A 3I5FC 3I5HB 1QX2A 1MQ1A 2QEVA 4ORBB 3D0YB 4GUKA 4C0JA 4GBAA 3OX6A 1QX7A 2JWWA 1XFRA 3PATA 3I5GC 4AQJA 1C7VA 1SY9A 3CYZA 2KPHA 1B4CA 1H4BA 2OS8C 3LCPC 2FJYA 3K21A 2G9BA 3WHUB 1FBVA 2L5YA 1MHOA 3DVJA 3VRQA 3JTDC 2BCBA 3SJSA 4GPLB 2QEOA 4JPZB 3M0WA 2WC5A 1KQMB 2KDHA 1YVLA 3KEVA 1ZOTB 3SIBA 5HLVA 1LA3A 1KFXL 1DJZA 3L4AA 1J7RA 1B8RA 3VRNA 1MXEA 1Q80A 4NQGA 2ZNDA 1OMRA 3PFVA 2KAXA 2JPTA 2ZN8A 2QACA 2H8VA 1DJIA 4NDBA 2PQLA 1G4YR 1LXFC 1NWDA 5KU1A 3OB1B 4ZCUA 2CT9A 1JSAA 5I2LA 1RROA 1TN4A 4NDDA 1TOPA 3SG2A 3CR2A 2F8PA 2WCBA 5AERA 1PSBA 1CDMA 1XK4C 4YBHB 1EH2A 2WCEA 3OGNA 2BE4A 1SBJA 3TZ1A 1IQ3A 1Y6WA 5I8NA 1SL7A 1IWQA 2PRUA 2NZ0A 3GK2A 4GFTA 1QS7A 5EL2A 1K9PA 1KSOA 2F2PA 5HLOA 1J7PA 3SS5A 1C07A 5J3XA 1S6IA 4PE1A 1OE9B 1C7WA 1IGVA 4AQIA 1WLMA 2CTNA 3D10A 1SL9A 3JVTC 4YGCB 2M0RA 3S0EA 2WOSA 4CPVA 3SG7A 5AANA 2P70A 4N1FA 5HKZA 2JXCA 3TDZA 2L5XB 2NCPA 1CFFA 1LS8A 2BAPA 1YR5A 1AJ5A 1WRLA 2LLSA 5CPVA 4BY5A 2EC6B 2EHBA 2M97A 2SCPA 3AKAA 3KHEA 4JWQA 1OOGA 1JF0A 1WLZA 2VRGA 3CR4X 3BFBA 2H61A 2HETA 1DF0A 3NXAA 2JT8A 1CDPA 3O78A 1QXPA 1X02A 1ORGA 2TN4A 3NHTA 5KSZA 1CTRA 3NGVA 3ZNIA 2O5GA 5IBWA 1F54A 3C1VA 3VB1A 2LMTA 1DJXA 1S6CA 3CTNA 3I5FB 1JWDA 2NCOA 3R1VA 2AMIA 1SNLA 4M2PA 2COLB 4JKTA 1XO5A 1TCOB 1DTLA 2KBMA 4IJ7A 2JT3A 1U5IB 1LA0A 1NP8A 2K0JA 2KFFA 3I5GB 1SMGA 2NXQA 3GK1A 4MZJA 5D3OA 4GGNA 2F3YA 5CSIA 2LUCA 4KYNA 4OCIA 1QTXA 3SS3A 1SCMC 1IH0A 2M7LA 3D78A 4Q04A 1NCYA 2K7CA 1XFYO 3CZTX 3S0AA 2LC5A 2F3ZA 2I2RE 3FWCA 2L98A 2A4JA 1CFDA 2BKHB 2I94A 2K61A 2ZKMX 3R1PA 3A4UB 1AHRA 2KFHA 1JFJA 3LK0A 2QEHA 3VRPA 1XVJA 2Y1MA 4CFRA 2KYCA 1RFJA 1KWOB 1OOIX 1OZSA 1TNXA 1UHHA 2CXJA 2D8NA 1NPQA 1OQPA 3BUMB 5ER5A 1EL4A 1SR6C 2OTGC 1B47A 3VRRA 3B88A 1PVAA 1K96A 1KFXS 1S5GZ 1JFKA 1ZACA 2PSRA 4PHJA 3S0FA 4INWA 1QVIZ 2M8UA 3K1EA 1OOFA 3DF0A 1K9UA 1UUSA 1Y1XA 3CGAA 1DEKA 2OPOA 5DKNA 1BJFA 3B87A 2JPOA 2MLEC 1F4QA 1K9KA 3QRXA 2PMYA 3CZ1A 2LLUA 2KI6C 2K8MB 4U8DA 3D73A 2I18A 1ODBA 1U5IA 3BUOB 1J1DA 1ALWA 2Q91A 4WQ3A 3FE8A 3R72A 2LMVA 4PT1A 4DCKA 1OSAA 2LVVA 3BFHA 5FI7A 1A2XA 2KSPA 3JVTB 3BUXB 3SG6A 2FCEA 2ISDA 4MRXA 1KK7Z 1D1OA 1LINA 1K2HA 1CDNA 3Q8IA 3MSEB 2BCXA 2PALA 4QJ3B 2WCJA 1XFVO 4MRYA 5D69A 3BOWB 2M49B 4PALA 1UHIA 2BL0C 1Z4HA 2P71A 1S26D 1CM1A 2L2CA 4ORAB 3CLNA 1K90D 4PHKA 3KO0A 1KFUS 4ETOA 2WORA 2KQYA 5FI2A 1CB1A 5CSNA 1JUOA 1LKJA 1OMVA 1YUUA 2M29A 4A4CA 4QJ5B 1TUJA 2AUCA 1A75B 1JC2A 1DF0B 1RJVA 2L51A 3EG5B 5TNCA 3B6XA 1K93D 1YUSA 1YX8A 3H4SE 2FCDA 2KLEA 4OVNF 3S0DA 1CMFA 1XK4A 1K94A 1S36A 2DOQA 5G08A 4OZDA 1AP4A 2H2KA 2KOTA 4PCWA 2Q4UA 4MSPA 3EK7A 1FI6A 2WCMA 5B8IB 3TDIA 2WCHA 1XFUO 1KK8B 2L4IA 1QATA 1WDCC 1TUZA 1YTZC 1SCMB 1F55A 5ER4X 3S0BA 1GQMA 1TNPA 1F4OA 3EVRA 3PN7C 1S3PA 1G8IA 4BY4A 1A03A 3FS7A 1IQ5A 4GNKB 1OZOA 4DIRA 1CLMA 5BPJA 1KQVA 1DGVA 2KYFA 2M1KB 5CSJA 1BT6A 3BOWA 1SCVA 1FF1A 1B7TY 4DUQA 3AAJA 4CIDA 3CABA 1UHNA 2JRFA 2ZN9A 3B7AA 1PULA 2M9GA 3OP0A 4IL1A 2HQWA 4OKHA 4PE4A 2AAOA 1M31A 3OB2B 1SR6B 1B8CA 2OTGB 4ICBA 4I5NB 3L47A 4M2QA 3TUYC 1CFCA 2BBMA 2K7BA 3FE9A 3BQ3A 2KI4B 3NHIA 1TNWA 4XYNA 1TTXA 3VROA 4E68A 1A75A 3DVEA 1RTP1 1NCXA 1QIVA 1W7JB 3PJIA 1NX3A 1SW8A 2LHIA 2GV5A 2R2IA 1UHKA 1BMOA 3EK4A 3D77A 4I5JA 1NX2A 3OX5A 4N1GA 4INXA 4YGAA 5KTYA 1V1FA 2MRDA 1EG3A 2BECA 3DF0B 1J7QA 2RGIA 4GGFC 3D75A 4WRIA 1W9ZA 3PLFB 1YUTA 2QEBA 4DRWA 1Y1AA 2WC6A 2JNFA 3V2LA 1PK0D 1QJTA 4R1EA 1TIZA 2MBXA 1DC1A 1R2UA 1KQMC 3RLZA 2L2EA 2OS8B 3O2PA 1B7TZ 1P28A 3LLEA 2KBIA 4FQTA 3SIAA 1RK9A 3AKBA 3BUNB 3SS4A 1MXLC 1T14A 1V1GA 2E30A 2K7DA 3JTDB 4C0KA 3CS1A 1MUXA 1NCZA 2BL0B 3DY9A 2L4HA 2QPTA 2K60A 1BLQA 3CDNA 4NDCA 1NYAA 1YX7A 4C0LA 2KNEA 2LAPA 3WXAA 4JQ0D 2MLFC 3D76A 2CCMA 3RZSA 4DS7A 1BOCA 4OR9B 5DKRA 1OMDA 3DVMA 1WRKA 3PM2A 4PHMA 1QLKA 1KSMA 3CZ2A 4USLA 3F45A 3FWBA 5I2QA 3NSOA 3BUWB 2LHLA 2KAVA 4YRUA 2P6BB 1N2DA 1F71A 2JULA 4XJKA 1BU3A 3CR5X 1UURA 1M45A 4MLWA 2K2FA 3EKJA 1G33A 1CMGA 1WDCB 3EVUA 4YGEB 3NSKA 1L2OC 1AJ4A 1J55A 1SKTA 3PN7B 1UP5A 1R6PA 1TCFA 1A29A 1B8LA 2GTEA 2SASA 1CNPA 1ZUZA 1IRJA 1S1EA 1BR4B 5I2OA 5FI6A 2JTTA 1IJ5A 3FE6A 2ERBA 4CLNA 2LVJA 2WCKA 1CDLA 1Y1UA 1MR8A 3TUYB 2FOTA 3PALA 5D7FA 2WCFA 2LMUA 1NIWA 1VRKA 2BKIB 1N0YA 3N7HA 4YI9A 1GGWA 4M2OA 1K8UA 1DVIA 4UPGA 1E8AA 4D1EA 3GOFA 2CBLA 1CLLA 1JF2A 2M3WA 4HRGA 1XFZO 4FTGA 2BE6A 2WC8A 4P2YB 3SG5A 4YGBB 1CLBA 1EJ3A 2Y1NA 2JTZA 1C3ZA 2I7AA 2L0PA 3DZTA 1ALVA 1BR1B 3FIAA 3E3RA 3I5IC 4YGDB 1A4PA 1CM4A 5HKYA 2NLNA 2IS9A 2WNDA 4A4BA 2LNKA 3UO9A 2F33A 2CNPA 5HL1A 3EK8A 2BNXA 1SRAA 1UWOA 1SSEB 1ZMZA 4L9MA 4QJ4B 4MZKA 1M63B 2KLDA 5AFPA 1SPYA 2Y4QA 3OHMB 2PVBA 1BF5A 5CSFA 4PE0A 1DJHA 5PALA 3ZWHA 1MWNA 1SK6D 3DVKA 3TS5C 3KPXA 2KHNA
chains in the Genus database with same CATH topology
3EKHA 1YVHA 4I5LB 2GGZA 1KWOC 1L7ZA 1M39A 1S6JA 2LUXA 3PSRA 5DKQA 4ZCVA 3IQOA 1FPWA 1AVSA 1QIWA 1B9AA 2MJWB 1PSRA 3NSLA 3VGOA 2BBNA 1WY9A 2K2AA 5AEQA 1EG4A 3ICBA 2LP3A 3GK4X 1XA5A 3LK1A 1HT9A 2ZNEA 2LV7A 4N5XA 2LM5A 1Y0VH 1XFWO 5AXIA 2MA2A 1LVCD 2PASA 2JNXA 2HQ8A 1FI5A 1B1GA 2JU0A 3HCMA 3D0YA 3LL8B 4GAOA 3SG4A 1DMOA 3I5HC 3BXKA 1MF8B 1PVBA 1QLSA 4GGFA 2M1UA 3KF9A 1PRWA 2BCAA 1ZFSA 2M7NA 1NSHA 1YRUB 5JOLA 2E6WA 4XJKB 3IF7A 2LANA 1KFUL 3CWGA 1L2OB 1CFPA 1JBAA 1GGZA 1H8BA 4YI8A 1RECA 4WQ2A 1F8HA 4MVFA 1BG1A 1W7IB 4ORCB 2B1UA 4MBEA 2JC2A 4OV2A 1DJGA 5F6TA 1XYDA 4MEWA 1GJYA 1NX1A 1CKKA 1QASA 1QV1A 4MN0A 2LLTA 3WNXB 4F0ZB 1IJ6A 1J1EA 1RWYA 3RM1A 3AAKA 1AK8A 1N65A 2LVKA 2ZFDA 2G2BA 1HQVA 2H61C 1WRZA 1NUBA 1UHJA 2F2OA 2L50A 3A8RA 1TRFA 4TNCA 2KFGA 2KGBC 3O6BA 1OOJA 1S5GY 1QV0A 1QVIY 1FW4A 1K95A 2KQ6A 3SG3A 4I5KA 1IG5A 2K7OA 1DT7B 2JXLA 5GQQC 3I5IB 5HYDA 1KK8C 4MZLA 2LE9B 4CFQA 4PHNA 1PALA 2V53A 1DJWA 2Y5IA 2KAYA 3EVVA 1KCYA 5FYXA 1NX0A 3HX4A 1TNQA 1SYMA 2JZIA 1DJYA 2JQ6A 4HSZA 5K89A 1IKUA 1QX5B 3WHTB 2FJUB 3TS5B 3DD4A 1KK7Y 1YRTB 5JJGA 4P5OE 4AOMA 1YURA 2HPSA 1DGUA 2ZRSA 2ZRTA 2LCPA 3IQQA 1M46A 2EC6C 3TDUA 2KI4C 2KGRA 2JOJA 2MAZA 4HRHA 1J7OA 2LVIA 2HF5A 4HREE 4PE7A 2LP2A 4PDZA 1F70A 1EXRA 2EGDA 1AUIB 2MHHA 4FQOA 2JT0A 1SL8A 3O4YA 3NSIA 5HKWA 2O60A 3BYAA 1BODA 1XFXO 2GGMA 2KI6D 3PM8A 3I5FC 3I5HB 1QX2A 1MQ1A 4ORBB 3D0YB 4GUKA 4C0JA 4GBAA 3OX6A 1QX7A 2JWWA 3PATA 3I5GC 4AQJA 1C7VA 1SY9A 1B4CA 1H4BA 2OS8C 3LCPC 3K21A 2G9BA 3WHUB 1FBVA 1MHOA 3DVJA 3VRQA 3JTDC 2BCBA 3SJSA 4GPLB 4JPZB 3M0WA 1KQMB 2KDHA 1YVLA 3KEVA 1ZOTB 3SIBA 5HLVA 1LA3A 1KFXL 1DJZA 1J7RA 1B8RA 3VRNA 1MXEA 1Q80A 4NQGA 2ZNDA 1OMRA 3PFVA 2KAXA 2JPTA 2ZN8A 2QACA 4NDBA 1DJIA 1G4YR 1LXFC 1NWDA 5KU1A 3OB1B 4ZCUA 2CT9A 1JSAA 5I2LA 1RROA 1TN4A 4NDDA 1TOPA 3SG2A 3CR2A 2F8PA 2WCBA 5AERA 1PSBA 1CDMA 1XK4C 4YBHB 1EH2A 2WCEA 2BE4A 1SBJA 3TZ1A 1IQ3A 1Y6WA 5I8NA 1SL7A 1IWQA 2PRUA 2NZ0A 3GK2A 4GFTA 1QS7A 1J7PA 1K9PA 1KSOA 2F2PA 5HLOA 1C07A 5J3XA 1S6IA 4PE1A 1OE9B 1C7WA 1IGVA 4AQIA 1WLMA 2CTNA 3D10A 1SL9A 3JVTC 4YGCB 2M0RA 2WOSA 4CPVA 3SG7A 5AANA 4N1FA 5HKZA 2JXCA 3TDZA 2L5XB 2NCPA 1CFFA 1YR5A 1AJ5A 1WRLA 2LLSA 5CPVA 4BY5A 2EC6B 2EHBA 2M97A 2SCPA 3AKAA 3KHEA 4JWQA 3CR4X 1JF0A 1WLZA 2VRGA 2H61A 2HETA 1DF0A 3NXAA 2JT8A 1CDPA 3O78A 1QXPA 1X02A 2TN4A 5KSZA 1CTRA 3ZNIA 2O5GA 5IBWA 1F54A 3C1VA 2LMTA 1DJXA 1S6CA 3CTNA 3I5FB 1JWDA 2NCOA 2AMIA 1SNLA 4M2PA 2COLB 1XO5A 1TCOB 1DTLA 2KBMA 2JT3A 1U5IB 1LA0A 1NP8A 2K0JA 2KFFA 3I5GB 1SMGA 2NXQA 3GK1A 4MZJA 4GGNA 2F3YA 5CSIA 2LUCA 4OCIA 1QTXA 1SCMC 1IH0A 2M7LA 4Q04A 1NCYA 2K7CA 1XFYO 3CZTX 2LC5A 2F3ZA 2I2RE 3FWCA 2L98A 2A4JA 1CFDA 2BKHB 2I94A 2K61A 2ZKMX 3A4UB 1AHRA 2KFHA 1JFJA 3LK0A 3VRPA 1XVJA 2Y1MA 4CFRA 2KYCA 1RFJA 1KWOB 1OZSA 1TNXA 1UHHA 2CXJA 2D8NA 1NPQA 1OQPA 3BUMB 5ER5A 1EL4A 1SR6C 2OTGC 1B47A 3VRRA 1PVAA 1K96A 1KFXS 1S5GZ 1JFKA 1ZACA 2PSRA 4PHJA 1QVIZ 2M8UA 3DF0A 1K9UA 1UUSA 1Y1XA 3CGAA 2OPOA 5DKNA 1BJFA 2MLEC 1F4QA 1K9KA 3QRXA 2PMYA 2LLUA 2KI6C 2K8MB 4U8DA 2I18A 1ODBA 1U5IA 3BUOB 1J1DA 1ALWA 2Q91A 4WQ3A 4DCKA 2LMVA 1OSAA 2LVVA 1A2XA 2KSPA 3JVTB 3BUXB 3SG6A 2FCEA 2ISDA 4MRXA 1KK7Z 1D1OA 1LINA 1K2HA 1CDNA 3MSEB 2BCXA 2PALA 4QJ3B 1XFVO 4MRYA 5D69A 3BOWB 2M49B 4PALA 1UHIA 2BL0C 1S26D 1CM1A 4ORAB 4ETOA 3CLNA 1K90D 4PHKA 3KO0A 1KFUS 2WORA 2KQYA 1CB1A 5CSNA 1JUOA 1LKJA 1OMVA 1YUUA 2M29A 4A4CA 4QJ5B 2AUCA 1A75B 1JC2A 1DF0B 1RJVA 2L51A 5TNCA 1K93D 1YUSA 1YX8A 3H4SE 2FCDA 4OVNF 1CMFA 1XK4A 1K94A 1S36A 2DOQA 5G08A 1AP4A 2H2KA 2KOTA 4PCWA 2Q4UA 4MSPA 3EK7A 1FI6A 5B8IB 3TDIA 1XFUO 1KK8B 2L4IA 1QATA 1WDCC 1YTZC 1SCMB 1F55A 5ER4X 1GQMA 1TNPA 1F4OA 3EVRA 3PN7C 1S3PA 1G8IA 4BY4A 1A03A 3FS7A 1IQ5A 4GNKB 1OZOA 4DIRA 1CLMA 5BPJA 1KQVA 1DGVA 2KYFA 2M1KB 5CSJA 1BT6A 3BOWA 1SCVA 1FF1A 1B7TY 4DUQA 3AAJA 4CIDA 1UHNA 2JRFA 2ZN9A 1PULA 2M9GA 3OP0A 4IL1A 2HQWA 4OKHA 4PE4A 2AAOA 1M31A 3OB2B 1SR6B 1B8CA 2OTGB 4ICBA 4I5NB 4M2QA 3TUYC 1CFCA 2BBMA 2K7BA 3BQ3A 2KI4B 4XYNA 1TNWA 4E68A 1TTXA 3VROA 1A75A 3DVEA 1RTP1 1NCXA 1QIVA 1W7JB 1NX3A 1SW8A 2LHIA 2GV5A 2R2IA 1UHKA 1BMOA 3EK4A 4I5JA 5KTYA 1NX2A 3OX5A 4N1GA 4YGAA 1V1FA 2MRDA 1EG3A 2BECA 3DF0B 1J7QA 2RGIA 4GGFC 4WRIA 3PLFB 1YUTA 4DRWA 1Y1AA 2JNFA 1PK0D 1QJTA 4R1EA 1TIZA 2MBXA 1R2UA 1KQMC 3RLZA 2L2EA 2OS8B 3O2PA 1B7TZ 3LLEA 2KBIA 3SIAA 1RK9A 3AKBA 3BUNB 1MXLC 1V1GA 2E30A 2K7DA 3JTDB 4C0KA 3CS1A 1MUXA 1NCZA 2BL0B 2L4HA 2QPTA 1BLQA 4NDCA 1NYAA 1YX7A 4C0LA 2KNEA 2LAPA 3WXAA 4JQ0D 2MLFC 2CCMA 4DS7A 1BOCA 4OR9B 5DKRA 1OMDA 3DVMA 1WRKA 4PHMA 1QLKA 1KSMA 4USLA 3F45A 3FWBA 5I2QA 3NSOA 3BUWB 2LHLA 2KAVA 4YRUA 2P6BB 1N2DA 1F71A 2JULA 4XJKA 1BU3A 3CR5X 1UURA 1M45A 4MLWA 2K2FA 3EKJA 1G33A 1CMGA 1WDCB 3EVUA 4YGEB 3NSKA 1L2OC 1AJ4A 1J55A 1SKTA 3PN7B 1UP5A 1R6PA 1TCFA 1A29A 1B8LA 2SASA 1CNPA 1ZUZA 1IRJA 1S1EA 1BR4B 5I2OA 2JTTA 1IJ5A 4CLNA 2LVJA 1CDLA 1Y1UA 1MR8A 3TUYB 2FOTA 3PALA 5D7FA 2WCFA 2LMUA 1NIWA 1VRKA 2BKIB 1N0YA 4YI9A 1GGWA 4M2OA 1K8UA 1DVIA 4UPGA 1E8AA 4D1EA 3GOFA 2CBLA 1CLLA 1JF2A 2M3WA 4HRGA 1XFZO 4FTGA 2BE6A 2WC8A 4P2YB 3SG5A 4YGBB 1CLBA 1EJ3A 2Y1NA 2JTZA 2L0PA 2I7AA 1ALVA 1BR1B 3FIAA 3E3RA 3I5IC 4YGDB 1A4PA 1CM4A 5HKYA 2NLNA 2IS9A 2WNDA 4A4BA 2LNKA 2F33A 2CNPA 3EK8A 1SRAA 1UWOA 1ZMZA 4L9MA 4QJ4B 4MZKA 1M63B 5AFPA 1SPYA 2Y4QA 3OHMB 2PVBA 1BF5A 5CSFA 4PE0A 1DJHA 5PALA 3ZWHA 1MWNA 1SK6D 3DVKA 3TS5C 3KPXA 2KHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EKH A;  1YVH A;  4I5L B;  2GGZ A;  1KWO C;  1L7Z A;  1M39 A;  1S6J A;  2LUX A;  3PSR A;  5DKQ A;  4ZCV A;  3IQO A;  1FPW A;  1AVS A;  1QIW A;  1B9A A;  2MJW B;  1PSR A;  3NSL A;  3VGO A;  2BBN A;  1WY9 A;  2K2A A;  5AEQ A;  1EG4 A;  3ICB A;  2LP3 A;  3GK4 X;  1XA5 A;  3LK1 A;  1HT9 A;  2ZNE A;  2LV7 A;  4N5X A;  2LM5 A;  1Y0V H;  1XFW O;  5AXI A;  2MA2 A;  1LVC D;  2PAS A;  2JNX A;  2HQ8 A;  1FI5 A;  1B1G A;  2JU0 A;  3HCM A;  3D0Y A;  3LL8 B;  4GAO A;  3SG4 A;  1DMO A;  3I5H C;  3BXK A;  1MF8 B;  1PVB A;  1QLS A;  4GGF A;  2M1U A;  3KF9 A;  1PRW A;  2BCA A;  1ZFS A;  2M7N A;  1NSH A;  1YRU B;  5JOL A;  2E6W A;  4XJK B;  3IF7 A;  2LAN A;  1KFU L;  3CWG A;  1L2O B;  1CFP A;  1JBA A;  1GGZ A;  1H8B A;  4YI8 A;  1REC A;  4WQ2 A;  1F8H A;  4MVF A;  1BG1 A;  1W7I B;  4ORC B;  2B1U A;  4MBE A;  2JC2 A;  4OV2 A;  1DJG A;  5F6T A;  1XYD A;  4MEW A;  1GJY A;  1NX1 A;  1CKK A;  1QAS A;  1QV1 A;  4MN0 A;  2LLT A;  3WNX B;  4F0Z B;  1IJ6 A;  1J1E A;  1RWY A;  3RM1 A;  3AAK A;  1AK8 A;  1N65 A;  2LVK A;  2ZFD A;  2G2B A;  1HQV A;  2H61 C;  1WRZ A;  1NUB A;  1UHJ A;  2F2O A;  2L50 A;  3A8R A;  1TRF A;  4TNC A;  2KFG A;  2KGB C;  3O6B A;  1OOJ A;  1S5G Y;  1QV0 A;  1QVI Y;  1FW4 A;  1K95 A;  2KQ6 A;  3SG3 A;  4I5K A;  1IG5 A;  2K7O A;  1DT7 B;  2JXL A;  5GQQ C;  3I5I B;  5HYD A;  1KK8 C;  4MZL A;  2LE9 B;  4CFQ A;  4PHN A;  1PAL A;  2V53 A;  1DJW A;  2Y5I A;  2KAY A;  3EVV A;  1KCY A;  5FYX A;  1NX0 A;  3HX4 A;  1TNQ A;  1SYM A;  2JZI A;  1DJY A;  2JQ6 A;  4HSZ A;  5K89 A;  1IKU A;  1QX5 B;  3WHT B;  2FJU B;  3TS5 B;  3DD4 A;  1KK7 Y;  1YRT B;  5JJG A;  4P5O E;  4AOM A;  1YUR A;  2HPS A;  1DGU A;  2ZRS A;  2ZRT A;  2LCP A;  3IQQ A;  1M46 A;  2EC6 C;  3TDU A;  2KI4 C;  2KGR A;  2JOJ A;  2MAZ A;  4HRH A;  1J7O A;  2LVI A;  2HF5 A;  4HRE E;  4PE7 A;  2LP2 A;  4PDZ A;  1F70 A;  1EXR A;  2EGD A;  1AUI B;  2MHH A;  4FQO A;  2JT0 A;  1SL8 A;  3O4Y A;  3NSI A;  5HKW A;  2O60 A;  3BYA A;  1BOD A;  1XFX O;  2GGM A;  2KI6 D;  3PM8 A;  3I5F C;  3I5H B;  1QX2 A;  1MQ1 A;  4ORB B;  3D0Y B;  4GUK A;  4C0J A;  4GBA A;  3OX6 A;  1QX7 A;  2JWW A;  3PAT A;  3I5G C;  4AQJ A;  1C7V A;  1SY9 A;  1B4C A;  1H4B A;  2OS8 C;  3LCP C;  3K21 A;  2G9B A;  3WHU B;  1FBV A;  1MHO A;  3DVJ A;  3VRQ A;  3JTD C;  2BCB A;  3SJS A;  4GPL B;  4JPZ B;  3M0W A;  1KQM B;  2KDH A;  1YVL A;  3KEV A;  1ZOT B;  3SIB A;  5HLV A;  1LA3 A;  1KFX L;  1DJZ A;  1J7R A;  1B8R A;  3VRN A;  1MXE A;  1Q80 A;  4NQG A;  2ZND A;  1OMR A;  3PFV A;  2KAX A;  2JPT A;  2ZN8 A;  2QAC A;  4NDB A;  1DJI A;  1G4Y R;  1LXF C;  1NWD A;  5KU1 A;  3OB1 B;  4ZCU A;  2CT9 A;  1JSA A;  5I2L A;  1RRO A;  1TN4 A;  4NDD A;  1TOP A;  3SG2 A;  3CR2 A;  2F8P A;  2WCB A;  5AER A;  1PSB A;  1CDM A;  1XK4 C;  4YBH B;  1EH2 A;  2WCE A;  2BE4 A;  1SBJ A;  3TZ1 A;  1IQ3 A;  1Y6W A;  5I8N A;  1SL7 A;  1IWQ A;  2PRU A;  2NZ0 A;  3GK2 A;  4GFT A;  1QS7 A;  1J7P A;  1K9P A;  1KSO A;  2F2P A;  5HLO A;  1C07 A;  5J3X A;  1S6I A;  4PE1 A;  1OE9 B;  1C7W A;  1IGV A;  4AQI A;  1WLM A;  2CTN A;  3D10 A;  1SL9 A;  3JVT C;  4YGC B;  2M0R A;  2WOS A;  4CPV A;  3SG7 A;  5AAN A;  4N1F A;  5HKZ A;  2JXC A;  3TDZ A;  2L5X B;  2NCP A;  1CFF A;  1YR5 A;  1AJ5 A;  1WRL A;  2LLS A;  5CPV A;  4BY5 A;  2EC6 B;  2EHB A;  2M97 A;  2SCP A;  3AKA A;  3KHE A;  4JWQ A;  3CR4 X;  1JF0 A;  1WLZ A;  2VRG A;  2H61 A;  2HET A;  1DF0 A;  3NXA A;  2JT8 A;  1CDP A;  3O78 A;  1QXP A;  1X02 A;  2TN4 A;  5KSZ A;  1CTR A;  3ZNI A;  2O5G A;  5IBW A;  1F54 A;  3C1V A;  2LMT A;  1DJX A;  1S6C A;  3CTN A;  3I5F B;  1JWD A;  2NCO A;  2AMI A;  1SNL A;  4M2P A;  2COL B;  1XO5 A;  1TCO B;  1DTL A;  2KBM A;  2JT3 A;  1U5I B;  1LA0 A;  1NP8 A;  2K0J A;  2KFF A;  3I5G B;  1SMG A;  2NXQ A;  3GK1 A;  4MZJ A;  4GGN A;  2F3Y A;  5CSI A;  2LUC A;  4OCI A;  1QTX A;  1SCM C;  1IH0 A;  2M7L A;  4Q04 A;  1NCY A;  2K7C A;  1XFY O;  3CZT X;  2LC5 A;  2F3Z A;  2I2R E;  3FWC A;  2L98 A;  2A4J A;  1CFD A;  2BKH B;  2I94 A;  2K61 A;  2ZKM X;  3A4U B;  1AHR A;  2KFH A;  1JFJ A;  3LK0 A;  3VRP A;  1XVJ A;  2Y1M A;  4CFR A;  2KYC A;  1RFJ A;  1KWO B;  1OZS A;  1TNX A;  1UHH A;  2CXJ A;  2D8N A;  1NPQ A;  1OQP A;  3BUM B;  5ER5 A;  1EL4 A;  1SR6 C;  2OTG C;  1B47 A;  3VRR A;  1PVA A;  1K96 A;  1KFX S;  1S5G Z;  1JFK A;  1ZAC A;  2PSR A;  4PHJ A;  1QVI Z;  2M8U A;  3DF0 A;  1K9U A;  1UUS A;  1Y1X A;  3CGA A;  2OPO A;  5DKN A;  1BJF A;  2MLE C;  1F4Q A;  1K9K A;  3QRX A;  2PMY A;  2LLU A;  2KI6 C;  2K8M B;  4U8D A;  2I18 A;  1ODB A;  1U5I A;  3BUO B;  1J1D A;  1ALW A;  2Q91 A;  4WQ3 A;  4DCK A;  2LMV A;  1OSA A;  2LVV A;  1A2X A;  2KSP A;  3JVT B;  3BUX B;  3SG6 A;  2FCE A;  2ISD A;  4MRX A;  1KK7 Z;  1D1O A;  1LIN A;  1K2H A;  1CDN A;  3MSE B;  2BCX A;  2PAL A;  4QJ3 B;  1XFV O;  4MRY A;  5D69 A;  3BOW B;  2M49 B;  4PAL A;  1UHI A;  2BL0 C;  1S26 D;  1CM1 A;  4ORA B;  4ETO A;  3CLN A;  1K90 D;  4PHK A;  3KO0 A;  1KFU S;  2WOR A;  2KQY A;  1CB1 A;  5CSN A;  1JUO A;  1LKJ A;  1OMV A;  1YUU A;  2M29 A;  4A4C A;  4QJ5 B;  2AUC A;  1A75 B;  1JC2 A;  1DF0 B;  1RJV A;  2L51 A;  5TNC A;  1K93 D;  1YUS A;  1YX8 A;  3H4S E;  2FCD A;  4OVN F;  1CMF A;  1XK4 A;  1K94 A;  1S36 A;  2DOQ A;  5G08 A;  1AP4 A;  2H2K A;  2KOT A;  4PCW A;  2Q4U A;  4MSP A;  3EK7 A;  1FI6 A;  5B8I B;  3TDI A;  1XFU O;  1KK8 B;  2L4I A;  1QAT A;  1WDC C;  1YTZ C;  1SCM B;  1F55 A;  5ER4 X;  1GQM A;  1TNP A;  1F4O A;  3EVR A;  3PN7 C;  1S3P A;  1G8I A;  4BY4 A;  1A03 A;  3FS7 A;  1IQ5 A;  4GNK B;  1OZO A;  4DIR A;  1CLM A;  5BPJ A;  1KQV A;  1DGV A;  2KYF A;  2M1K B;  5CSJ A;  1BT6 A;  3BOW A;  1SCV A;  1FF1 A;  1B7T Y;  4DUQ A;  3AAJ A;  4CID A;  1UHN A;  2JRF A;  2ZN9 A;  1PUL A;  2M9G A;  3OP0 A;  4IL1 A;  2HQW A;  4OKH A;  4PE4 A;  2AAO A;  1M31 A;  3OB2 B;  1SR6 B;  1B8C A;  2OTG B;  4ICB A;  4I5N B;  4M2Q A;  3TUY C;  1CFC A;  2BBM A;  2K7B A;  3BQ3 A;  2KI4 B;  4XYN A;  1TNW A;  4E68 A;  1TTX A;  3VRO A;  1A75 A;  3DVE A;  1RTP 1;  1NCX A;  1QIV A;  1W7J B;  1NX3 A;  1SW8 A;  2LHI A;  2GV5 A;  2R2I A;  1UHK A;  1BMO A;  3EK4 A;  4I5J A;  5KTY A;  1NX2 A;  3OX5 A;  4N1G A;  4YGA A;  1V1F A;  2MRD A;  1EG3 A;  2BEC A;  3DF0 B;  1J7Q A;  2RGI A;  4GGF C;  4WRI A;  3PLF B;  1YUT A;  4DRW A;  1Y1A A;  2JNF A;  1PK0 D;  1QJT A;  4R1E A;  1TIZ A;  2MBX A;  1R2U A;  1KQM C;  3RLZ A;  2L2E A;  2OS8 B;  3O2P A;  1B7T Z;  3LLE A;  2KBI A;  3SIA A;  1RK9 A;  3AKB A;  3BUN B;  1MXL C;  1V1G A;  2E30 A;  2K7D A;  3JTD B;  4C0K A;  3CS1 A;  1MUX A;  1NCZ A;  2BL0 B;  2L4H A;  2QPT A;  1BLQ A;  4NDC A;  1NYA A;  1YX7 A;  4C0L A;  2KNE A;  2LAP A;  3WXA A;  4JQ0 D;  2MLF C;  2CCM A;  4DS7 A;  1BOC A;  4OR9 B;  5DKR A;  1OMD A;  3DVM A;  1WRK A;  4PHM A;  1QLK A;  1KSM A;  4USL A;  3F45 A;  3FWB A;  5I2Q A;  3NSO A;  3BUW B;  2LHL A;  2KAV A;  4YRU A;  2P6B B;  1N2D A;  1F71 A;  2JUL A;  4XJK A;  1BU3 A;  3CR5 X;  1UUR A;  1M45 A;  4MLW A;  2K2F A;  3EKJ A;  1G33 A;  1CMG A;  1WDC B;  3EVU A;  4YGE B;  3NSK A;  1L2O C;  1AJ4 A;  1J55 A;  1SKT A;  3PN7 B;  1UP5 A;  1R6P A;  1TCF A;  1A29 A;  1B8L A;  2SAS A;  1CNP A;  1ZUZ A;  1IRJ A;  1S1E A;  1BR4 B;  5I2O A;  2JTT A;  1IJ5 A;  4CLN A;  2LVJ A;  1CDL A;  1Y1U A;  1MR8 A;  3TUY B;  2FOT A;  3PAL A;  5D7F A;  2WCF A;  2LMU A;  1NIW A;  1VRK A;  2BKI B;  1N0Y A;  4YI9 A;  1GGW A;  4M2O A;  1K8U A;  1DVI A;  4UPG A;  1E8A A;  4D1E A;  3GOF A;  2CBL A;  1CLL A;  1JF2 A;  2M3W A;  4HRG A;  1XFZ O;  4FTG A;  2BE6 A;  2WC8 A;  4P2Y B;  3SG5 A;  4YGB B;  1CLB A;  1EJ3 A;  2Y1N A;  2JTZ A;  2L0P A;  2I7A A;  1ALV A;  1BR1 B;  3FIA A;  3E3R A;  3I5I C;  4YGD B;  1A4P A;  1CM4 A;  5HKY A;  2NLN A;  2IS9 A;  2WND A;  4A4B A;  2LNK A;  2F33 A;  2CNP A;  3EK8 A;  1SRA A;  1UWO A;  1ZMZ A;  4L9M A;  4QJ4 B;  4MZK A;  1M63 B;  5AFP A;  1SPY A;  2Y4Q A;  3OHM B;  2PVB A;  1BF5 A;  5CSF A;  4PE0 A;  1DJH A;  5PAL A;  3ZWH A;  1MWN A;  1SK6 D;  3DVK A;  3TS5 C;  3KPX A;  2KHN A; 
#chains in the Genus database with same CATH topology
 3EKH A;  1YVH A;  4I5L B;  2GGZ A;  1KWO C;  1L7Z A;  1M39 A;  1S6J A;  2LUX A;  3PSR A;  5DKQ A;  4ZCV A;  3IQO A;  1FPW A;  1AVS A;  1QIW A;  1B9A A;  2MJW B;  1PSR A;  3DYE A;  3NSL A;  3VGO A;  1OW4 A;  2BBN A;  1WY9 A;  2K2A A;  5AEQ A;  1EG4 A;  3ICB A;  5I94 A;  2LP3 A;  3GK4 X;  1XA5 A;  3LK1 A;  1HT9 A;  2ZNE A;  2LV7 A;  4N5X A;  2LM5 A;  1Y0V H;  1XFW O;  5AXI A;  2MA2 A;  1DQE A;  1QWV A;  1LVC D;  2PAS A;  4F7F A;  2PYQ A;  2JNX A;  2HQ8 A;  3S0G A;  1B1G A;  1OOH A;  2JU0 A;  3D0Y A;  3HCM A;  1FI5 A;  3LL8 B;  1TWO A;  4GAO A;  5DIC A;  3SG4 A;  3UNW A;  1DMO A;  3I5H C;  3BXK A;  1MF8 B;  1PVB A;  1QLS A;  4GGF A;  2M1U A;  3KF9 A;  3R1O A;  1PRW A;  2BCA A;  1ZFS A;  2M7N A;  1NSH A;  1YRU B;  3CZ0 A;  5JOL A;  2E6W A;  4XJK B;  3IF7 A;  2LAN A;  1KFU L;  3CWG A;  1L2O B;  1C3Y A;  1CFP A;  1GGZ A;  1JBA A;  1H8B A;  4YI8 A;  1REC A;  3O4X A;  3L4L A;  4WQ2 A;  1F8H A;  4MVF A;  1BG1 A;  1W7I B;  4ORC B;  2B1U A;  4MBE A;  2JC2 A;  4OV2 A;  1DJG A;  5F6T A;  1XYD A;  4MEW A;  1GJY A;  1NX1 A;  3OBV A;  1CKK A;  1QAS A;  1QV1 A;  4MN0 A;  2LLT A;  3WNX B;  4F0Z B;  3DXL A;  3B86 A;  1IJ6 A;  1J1E A;  1RWY A;  3RM1 A;  3AAK A;  1AK8 A;  1N65 A;  2LVK A;  2ZFD A;  2QDI A;  2G2B A;  1HQV A;  2H61 C;  1WRZ A;  1DEL A;  1NUB A;  1UHJ A;  2F2O A;  2L50 A;  3A8R A;  1TRF A;  4TNC A;  2KFG A;  2KGB C;  3O6B A;  3IVT A;  1OOJ A;  1S5G Y;  2YGU A;  1QV0 A;  1QVI Y;  1FW4 A;  1K95 A;  2KQ6 A;  3SG3 A;  4I5K A;  1IG5 A;  1IIO A;  1Z2C B;  2K7O A;  1DT7 B;  2JXL A;  5GQQ C;  3I5I B;  5HYD A;  1KK8 C;  4MZL A;  3QME A;  2LE9 B;  4CFQ A;  4PHN A;  2WCL A;  1PAL A;  2V53 A;  1DJW A;  2Y5I A;  2KAY A;  3EVV A;  1KCY A;  5FYX A;  1NX0 A;  3HX4 A;  1TNQ A;  1SYM A;  2JZI A;  1DJY A;  2JQ6 A;  4HSZ A;  5K89 A;  1IKU A;  1GM0 A;  1QX5 B;  3BJH A;  3WHT B;  2FJU B;  3TS5 B;  3DD4 A;  1KK7 Y;  1YRT B;  5JJG A;  4P5O E;  4AOM A;  1YUR A;  2HPS A;  1DGU A;  2ZRS A;  2ZRT A;  2LCP A;  3IQQ A;  1M46 A;  2EC6 C;  4JD9 A;  3TDU A;  2KI4 C;  2KGR A;  2JOJ A;  2MAZ A;  4HRH A;  1J7O A;  2LVI A;  2HF5 A;  4HRE E;  4PE7 A;  2LP2 A;  4PDZ A;  1F70 A;  1EXR A;  2EGD A;  1AUI B;  2MHH A;  4FQO A;  2JT0 A;  1SL8 A;  3O4Y A;  3D74 A;  3NSI A;  3BFA A;  5HKW A;  2O60 A;  3BYA A;  1BOD A;  1XFX O;  2GGM A;  2KI6 D;  3PM8 A;  3I5F C;  3I5H B;  1QX2 A;  1MQ1 A;  2QEV A;  4ORB B;  3D0Y B;  4GUK A;  4C0J A;  4GBA A;  3OX6 A;  1QX7 A;  2JWW A;  1XFR A;  3PAT A;  3I5G C;  4AQJ A;  1C7V A;  1SY9 A;  3CYZ A;  2KPH A;  1B4C A;  1H4B A;  2OS8 C;  3LCP C;  2FJY A;  3K21 A;  2G9B A;  3WHU B;  1FBV A;  2L5Y A;  1MHO A;  3DVJ A;  3VRQ A;  3JTD C;  2BCB A;  3SJS A;  4GPL B;  2QEO A;  4JPZ B;  3M0W A;  2WC5 A;  1KQM B;  2KDH A;  1YVL A;  3KEV A;  1ZOT B;  3SIB A;  5HLV A;  1LA3 A;  1KFX L;  1DJZ A;  3L4A A;  1J7R A;  1B8R A;  3VRN A;  1MXE A;  1Q80 A;  4NQG A;  2ZND A;  1OMR A;  3PFV A;  2KAX A;  2JPT A;  2ZN8 A;  2QAC A;  2H8V A;  1DJI A;  4NDB A;  2PQL A;  1G4Y R;  1LXF C;  1NWD A;  5KU1 A;  3OB1 B;  4ZCU A;  2CT9 A;  1JSA A;  5I2L A;  1RRO A;  1TN4 A;  4NDD A;  1TOP A;  3SG2 A;  3CR2 A;  2F8P A;  2WCB A;  5AER A;  1PSB A;  1CDM A;  1XK4 C;  4YBH B;  1EH2 A;  2WCE A;  3OGN A;  2BE4 A;  1SBJ A;  3TZ1 A;  1IQ3 A;  1Y6W A;  5I8N A;  1SL7 A;  1IWQ A;  2PRU A;  2NZ0 A;  3GK2 A;  4GFT A;  1QS7 A;  5EL2 A;  1K9P A;  1KSO A;  2F2P A;  5HLO A;  1J7P A;  3SS5 A;  1C07 A;  5J3X A;  1S6I A;  4PE1 A;  1OE9 B;  1C7W A;  1IGV A;  4AQI A;  1WLM A;  2CTN A;  3D10 A;  1SL9 A;  3JVT C;  4YGC B;  2M0R A;  3S0E A;  2WOS A;  4CPV A;  3SG7 A;  5AAN A;  2P70 A;  4N1F A;  5HKZ A;  2JXC A;  3TDZ A;  2L5X B;  2NCP A;  1CFF A;  1LS8 A;  2BAP A;  1YR5 A;  1AJ5 A;  1WRL A;  2LLS A;  5CPV A;  4BY5 A;  2EC6 B;  2EHB A;  2M97 A;  2SCP A;  3AKA A;  3KHE A;  4JWQ A;  1OOG A;  1JF0 A;  1WLZ A;  2VRG A;  3CR4 X;  3BFB A;  2H61 A;  2HET A;  1DF0 A;  3NXA A;  2JT8 A;  1CDP A;  3O78 A;  1QXP A;  1X02 A;  1ORG A;  2TN4 A;  3NHT A;  5KSZ A;  1CTR A;  3NGV A;  3ZNI A;  2O5G A;  5IBW A;  1F54 A;  3C1V A;  3VB1 A;  2LMT A;  1DJX A;  1S6C A;  3CTN A;  3I5F B;  1JWD A;  2NCO A;  3R1V A;  2AMI A;  1SNL A;  4M2P A;  2COL B;  4JKT A;  1XO5 A;  1TCO B;  1DTL A;  2KBM A;  4IJ7 A;  2JT3 A;  1U5I B;  1LA0 A;  1NP8 A;  2K0J A;  2KFF A;  3I5G B;  1SMG A;  2NXQ A;  3GK1 A;  4MZJ A;  5D3O A;  4GGN A;  2F3Y A;  5CSI A;  2LUC A;  4KYN A;  4OCI A;  1QTX A;  3SS3 A;  1SCM C;  1IH0 A;  2M7L A;  3D78 A;  4Q04 A;  1NCY A;  2K7C A;  1XFY O;  3CZT X;  3S0A A;  2LC5 A;  2F3Z A;  2I2R E;  3FWC A;  2L98 A;  2A4J A;  1CFD A;  2BKH B;  2I94 A;  2K61 A;  2ZKM X;  3R1P A;  3A4U B;  1AHR A;  2KFH A;  1JFJ A;  3LK0 A;  2QEH A;  3VRP A;  1XVJ A;  2Y1M A;  4CFR A;  2KYC A;  1RFJ A;  1KWO B;  1OOI X;  1OZS A;  1TNX A;  1UHH A;  2CXJ A;  2D8N A;  1NPQ A;  1OQP A;  3BUM B;  5ER5 A;  1EL4 A;  1SR6 C;  2OTG C;  1B47 A;  3VRR A;  3B88 A;  1PVA A;  1K96 A;  1KFX S;  1S5G Z;  1JFK A;  1ZAC A;  2PSR A;  4PHJ A;  3S0F A;  4INW A;  1QVI Z;  2M8U A;  3K1E A;  1OOF A;  3DF0 A;  1K9U A;  1UUS A;  1Y1X A;  3CGA A;  1DEK A;  2OPO A;  5DKN A;  1BJF A;  3B87 A;  2JPO A;  2MLE C;  1F4Q A;  1K9K A;  3QRX A;  2PMY A;  3CZ1 A;  2LLU A;  2KI6 C;  2K8M B;  4U8D A;  3D73 A;  2I18 A;  1ODB A;  1U5I A;  3BUO B;  1J1D A;  1ALW A;  2Q91 A;  4WQ3 A;  3FE8 A;  3R72 A;  2LMV A;  4PT1 A;  4DCK A;  1OSA A;  2LVV A;  3BFH A;  5FI7 A;  1A2X A;  2KSP A;  3JVT B;  3BUX B;  3SG6 A;  2FCE A;  2ISD A;  4MRX A;  1KK7 Z;  1D1O A;  1LIN A;  1K2H A;  1CDN A;  3Q8I A;  3MSE B;  2BCX A;  2PAL A;  4QJ3 B;  2WCJ A;  1XFV O;  4MRY A;  5D69 A;  3BOW B;  2M49 B;  4PAL A;  1UHI A;  2BL0 C;  1Z4H A;  2P71 A;  1S26 D;  1CM1 A;  2L2C A;  4ORA B;  3CLN A;  1K90 D;  4PHK A;  3KO0 A;  1KFU S;  4ETO A;  2WOR A;  2KQY A;  5FI2 A;  1CB1 A;  5CSN A;  1JUO A;  1LKJ A;  1OMV A;  1YUU A;  2M29 A;  4A4C A;  4QJ5 B;  1TUJ A;  2AUC A;  1A75 B;  1JC2 A;  1DF0 B;  1RJV A;  2L51 A;  3EG5 B;  5TNC A;  3B6X A;  1K93 D;  1YUS A;  1YX8 A;  3H4S E;  2FCD A;  2KLE A;  4OVN F;  3S0D A;  1CMF A;  1XK4 A;  1K94 A;  1S36 A;  2DOQ A;  5G08 A;  4OZD A;  1AP4 A;  2H2K A;  2KOT A;  4PCW A;  2Q4U A;  4MSP A;  3EK7 A;  1FI6 A;  2WCM A;  5B8I B;  3TDI A;  2WCH A;  1XFU O;  1KK8 B;  2L4I A;  1QAT A;  1WDC C;  1TUZ A;  1YTZ C;  1SCM B;  1F55 A;  5ER4 X;  3S0B A;  1GQM A;  1TNP A;  1F4O A;  3EVR A;  3PN7 C;  1S3P A;  1G8I A;  4BY4 A;  1A03 A;  3FS7 A;  1IQ5 A;  4GNK B;  1OZO A;  4DIR A;  1CLM A;  5BPJ A;  1KQV A;  1DGV A;  2KYF A;  2M1K B;  5CSJ A;  1BT6 A;  3BOW A;  1SCV A;  1FF1 A;  1B7T Y;  4DUQ A;  3AAJ A;  4CID A;  3CAB A;  1UHN A;  2JRF A;  2ZN9 A;  3B7A A;  1PUL A;  2M9G A;  3OP0 A;  4IL1 A;  2HQW A;  4OKH A;  4PE4 A;  2AAO A;  1M31 A;  3OB2 B;  1SR6 B;  1B8C A;  2OTG B;  4ICB A;  4I5N B;  3L47 A;  4M2Q A;  3TUY C;  1CFC A;  2BBM A;  2K7B A;  3FE9 A;  3BQ3 A;  2KI4 B;  3NHI A;  1TNW A;  4XYN A;  1TTX A;  3VRO A;  4E68 A;  1A75 A;  3DVE A;  1RTP 1;  1NCX A;  1QIV A;  1W7J B;  3PJI A;  1NX3 A;  1SW8 A;  2LHI A;  2GV5 A;  2R2I A;  1UHK A;  1BMO A;  3EK4 A;  3D77 A;  4I5J A;  1NX2 A;  3OX5 A;  4N1G A;  4INX A;  4YGA A;  5KTY A;  1V1F A;  2MRD A;  1EG3 A;  2BEC A;  3DF0 B;  1J7Q A;  2RGI A;  4GGF C;  3D75 A;  4WRI A;  1W9Z A;  3PLF B;  1YUT A;  2QEB A;  4DRW A;  1Y1A A;  2WC6 A;  2JNF A;  3V2L A;  1PK0 D;  1QJT A;  4R1E A;  1TIZ A;  2MBX A;  1DC1 A;  1R2U A;  1KQM C;  3RLZ A;  2L2E A;  2OS8 B;  3O2P A;  1B7T Z;  1P28 A;  3LLE A;  2KBI A;  4FQT A;  3SIA A;  1RK9 A;  3AKB A;  3BUN B;  3SS4 A;  1MXL C;  1T14 A;  1V1G A;  2E30 A;  2K7D A;  3JTD B;  4C0K A;  3CS1 A;  1MUX A;  1NCZ A;  2BL0 B;  3DY9 A;  2L4H A;  2QPT A;  2K60 A;  1BLQ A;  3CDN A;  4NDC A;  1NYA A;  1YX7 A;  4C0L A;  2KNE A;  2LAP A;  3WXA A;  4JQ0 D;  2MLF C;  3D76 A;  2CCM A;  3RZS A;  4DS7 A;  1BOC A;  4OR9 B;  5DKR A;  1OMD A;  3DVM A;  1WRK A;  3PM2 A;  4PHM A;  1QLK A;  1KSM A;  3CZ2 A;  4USL A;  3F45 A;  3FWB A;  5I2Q A;  3NSO A;  3BUW B;  2LHL A;  2KAV A;  4YRU A;  2P6B B;  1N2D A;  1F71 A;  2JUL A;  4XJK A;  1BU3 A;  3CR5 X;  1UUR A;  1M45 A;  4MLW A;  2K2F A;  3EKJ A;  1G33 A;  1CMG A;  1WDC B;  3EVU A;  4YGE B;  3NSK A;  1L2O C;  1AJ4 A;  1J55 A;  1SKT A;  3PN7 B;  1UP5 A;  1R6P A;  1TCF A;  1A29 A;  1B8L A;  2GTE A;  2SAS A;  1CNP A;  1ZUZ A;  1IRJ A;  1S1E A;  1BR4 B;  5I2O A;  5FI6 A;  2JTT A;  1IJ5 A;  3FE6 A;  2ERB A;  4CLN A;  2LVJ A;  2WCK A;  1CDL A;  1Y1U A;  1MR8 A;  3TUY B;  2FOT A;  3PAL A;  5D7F A;  2WCF A;  2LMU A;  1NIW A;  1VRK A;  2BKI B;  1N0Y A;  3N7H A;  4YI9 A;  1GGW A;  4M2O A;  1K8U A;  1DVI A;  4UPG A;  1E8A A;  4D1E A;  3GOF A;  2CBL A;  1CLL A;  1JF2 A;  2M3W A;  4HRG A;  1XFZ O;  4FTG A;  2BE6 A;  2WC8 A;  4P2Y B;  3SG5 A;  4YGB B;  1CLB A;  1EJ3 A;  2Y1N A;  2JTZ A;  1C3Z A;  2I7A A;  2L0P A;  3DZT A;  1ALV A;  1BR1 B;  3FIA A;  3E3R A;  3I5I C;  4YGD B;  1A4P A;  1CM4 A;  5HKY A;  2NLN A;  2IS9 A;  2WND A;  4A4B A;  2LNK A;  3UO9 A;  2F33 A;  2CNP A;  5HL1 A;  3EK8 A;  2BNX A;  1SRA A;  1UWO A;  1SSE B;  1ZMZ A;  4L9M A;  4QJ4 B;  4MZK A;  1M63 B;  2KLD A;  5AFP A;  1SPY A;  2Y4Q A;  3OHM B;  2PVB A;  1BF5 A;  5CSF A;  4PE0 A;  1DJH A;  5PAL A;  3ZWH A;  1MWN A;  1SK6 D;  3DVK A;  3TS5 C;  3KPX A;  2KHN A; 
#chains in the Genus database with same CATH homology
 3EKH A;  1YVH A;  4I5L B;  2GGZ A;  1KWO C;  1L7Z A;  1M39 A;  1S6J A;  2LUX A;  3PSR A;  5DKQ A;  4ZCV A;  3IQO A;  1FPW A;  1AVS A;  1QIW A;  1B9A A;  2MJW B;  1PSR A;  3NSL A;  3VGO A;  2BBN A;  1WY9 A;  2K2A A;  5AEQ A;  1EG4 A;  3ICB A;  2LP3 A;  3GK4 X;  1XA5 A;  3LK1 A;  1HT9 A;  2ZNE A;  2LV7 A;  4N5X A;  2LM5 A;  1Y0V H;  1XFW O;  5AXI A;  2MA2 A;  1LVC D;  2PAS A;  2JNX A;  2HQ8 A;  1FI5 A;  1B1G A;  2JU0 A;  3HCM A;  3D0Y A;  3LL8 B;  4GAO A;  3SG4 A;  1DMO A;  3I5H C;  3BXK A;  1MF8 B;  1PVB A;  1QLS A;  4GGF A;  2M1U A;  3KF9 A;  1PRW A;  2BCA A;  1ZFS A;  2M7N A;  1NSH A;  1YRU B;  5JOL A;  2E6W A;  4XJK B;  3IF7 A;  2LAN A;  1KFU L;  3CWG A;  1L2O B;  1CFP A;  1JBA A;  1GGZ A;  1H8B A;  4YI8 A;  1REC A;  4WQ2 A;  1F8H A;  4MVF A;  1BG1 A;  1W7I B;  4ORC B;  2B1U A;  4MBE A;  2JC2 A;  4OV2 A;  1DJG A;  5F6T A;  1XYD A;  4MEW A;  1GJY A;  1NX1 A;  1CKK A;  1QAS A;  1QV1 A;  4MN0 A;  2LLT A;  3WNX B;  4F0Z B;  1IJ6 A;  1J1E A;  1RWY A;  3RM1 A;  3AAK A;  1AK8 A;  1N65 A;  2LVK A;  2ZFD A;  2G2B A;  1HQV A;  2H61 C;  1WRZ A;  1NUB A;  1UHJ A;  2F2O A;  2L50 A;  3A8R A;  1TRF A;  4TNC A;  2KFG A;  2KGB C;  3O6B A;  1OOJ A;  1S5G Y;  1QV0 A;  1QVI Y;  1FW4 A;  1K95 A;  2KQ6 A;  3SG3 A;  4I5K A;  1IG5 A;  2K7O A;  1DT7 B;  2JXL A;  5GQQ C;  3I5I B;  5HYD A;  1KK8 C;  4MZL A;  2LE9 B;  4CFQ A;  4PHN A;  1PAL A;  2V53 A;  1DJW A;  2Y5I A;  2KAY A;  3EVV A;  1KCY A;  5FYX A;  1NX0 A;  3HX4 A;  1TNQ A;  1SYM A;  2JZI A;  1DJY A;  2JQ6 A;  4HSZ A;  5K89 A;  1IKU A;  1QX5 B;  3WHT B;  2FJU B;  3TS5 B;  3DD4 A;  1KK7 Y;  1YRT B;  5JJG A;  4P5O E;  4AOM A;  1YUR A;  2HPS A;  1DGU A;  2ZRS A;  2ZRT A;  2LCP A;  3IQQ A;  1M46 A;  2EC6 C;  3TDU A;  2KI4 C;  2KGR A;  2JOJ A;  2MAZ A;  4HRH A;  1J7O A;  2LVI A;  2HF5 A;  4HRE E;  4PE7 A;  2LP2 A;  4PDZ A;  1F70 A;  1EXR A;  2EGD A;  1AUI B;  2MHH A;  4FQO A;  2JT0 A;  1SL8 A;  3O4Y A;  3NSI A;  5HKW A;  2O60 A;  3BYA A;  1BOD A;  1XFX O;  2GGM A;  2KI6 D;  3PM8 A;  3I5F C;  3I5H B;  1QX2 A;  1MQ1 A;  4ORB B;  3D0Y B;  4GUK A;  4C0J A;  4GBA A;  3OX6 A;  1QX7 A;  2JWW A;  3PAT A;  3I5G C;  4AQJ A;  1C7V A;  1SY9 A;  1B4C A;  1H4B A;  2OS8 C;  3LCP C;  3K21 A;  2G9B A;  3WHU B;  1FBV A;  1MHO A;  3DVJ A;  3VRQ A;  3JTD C;  2BCB A;  3SJS A;  4GPL B;  4JPZ B;  3M0W A;  1KQM B;  2KDH A;  1YVL A;  3KEV A;  1ZOT B;  3SIB A;  5HLV A;  1LA3 A;  1KFX L;  1DJZ A;  1J7R A;  1B8R A;  3VRN A;  1MXE A;  1Q80 A;  4NQG A;  2ZND A;  1OMR A;  3PFV A;  2KAX A;  2JPT A;  2ZN8 A;  2QAC A;  4NDB A;  1DJI A;  1G4Y R;  1LXF C;  1NWD A;  5KU1 A;  3OB1 B;  4ZCU A;  2CT9 A;  1JSA A;  5I2L A;  1RRO A;  1TN4 A;  4NDD A;  1TOP A;  3SG2 A;  3CR2 A;  2F8P A;  2WCB A;  5AER A;  1PSB A;  1CDM A;  1XK4 C;  4YBH B;  1EH2 A;  2WCE A;  2BE4 A;  1SBJ A;  3TZ1 A;  1IQ3 A;  1Y6W A;  5I8N A;  1SL7 A;  1IWQ A;  2PRU A;  2NZ0 A;  3GK2 A;  4GFT A;  1QS7 A;  1J7P A;  1K9P A;  1KSO A;  2F2P A;  5HLO A;  1C07 A;  5J3X A;  1S6I A;  4PE1 A;  1OE9 B;  1C7W A;  1IGV A;  4AQI A;  1WLM A;  2CTN A;  3D10 A;  1SL9 A;  3JVT C;  4YGC B;  2M0R A;  2WOS A;  4CPV A;  3SG7 A;  5AAN A;  4N1F A;  5HKZ A;  2JXC A;  3TDZ A;  2L5X B;  2NCP A;  1CFF A;  1YR5 A;  1AJ5 A;  1WRL A;  2LLS A;  5CPV A;  4BY5 A;  2EC6 B;  2EHB A;  2M97 A;  2SCP A;  3AKA A;  3KHE A;  4JWQ A;  3CR4 X;  1JF0 A;  1WLZ A;  2VRG A;  2H61 A;  2HET A;  1DF0 A;  3NXA A;  2JT8 A;  1CDP A;  3O78 A;  1QXP A;  1X02 A;  2TN4 A;  5KSZ A;  1CTR A;  3ZNI A;  2O5G A;  5IBW A;  1F54 A;  3C1V A;  2LMT A;  1DJX A;  1S6C A;  3CTN A;  3I5F B;  1JWD A;  2NCO A;  2AMI A;  1SNL A;  4M2P A;  2COL B;  1XO5 A;  1TCO B;  1DTL A;  2KBM A;  2JT3 A;  1U5I B;  1LA0 A;  1NP8 A;  2K0J A;  2KFF A;  3I5G B;  1SMG A;  2NXQ A;  3GK1 A;  4MZJ A;  4GGN A;  2F3Y A;  5CSI A;  2LUC A;  4OCI A;  1QTX A;  1SCM C;  1IH0 A;  2M7L A;  4Q04 A;  1NCY A;  2K7C A;  1XFY O;  3CZT X;  2LC5 A;  2F3Z A;  2I2R E;  3FWC A;  2L98 A;  2A4J A;  1CFD A;  2BKH B;  2I94 A;  2K61 A;  2ZKM X;  3A4U B;  1AHR A;  2KFH A;  1JFJ A;  3LK0 A;  3VRP A;  1XVJ A;  2Y1M A;  4CFR A;  2KYC A;  1RFJ A;  1KWO B;  1OZS A;  1TNX A;  1UHH A;  2CXJ A;  2D8N A;  1NPQ A;  1OQP A;  3BUM B;  5ER5 A;  1EL4 A;  1SR6 C;  2OTG C;  1B47 A;  3VRR A;  1PVA A;  1K96 A;  1KFX S;  1S5G Z;  1JFK A;  1ZAC A;  2PSR A;  4PHJ A;  1QVI Z;  2M8U A;  3DF0 A;  1K9U A;  1UUS A;  1Y1X A;  3CGA A;  2OPO A;  5DKN A;  1BJF A;  2MLE C;  1F4Q A;  1K9K A;  3QRX A;  2PMY A;  2LLU A;  2KI6 C;  2K8M B;  4U8D A;  2I18 A;  1ODB A;  1U5I A;  3BUO B;  1J1D A;  1ALW A;  2Q91 A;  4WQ3 A;  4DCK A;  2LMV A;  1OSA A;  2LVV A;  1A2X A;  2KSP A;  3JVT B;  3BUX B;  3SG6 A;  2FCE A;  2ISD A;  4MRX A;  1KK7 Z;  1D1O A;  1LIN A;  1K2H A;  1CDN A;  3MSE B;  2BCX A;  2PAL A;  4QJ3 B;  1XFV O;  4MRY A;  5D69 A;  3BOW B;  2M49 B;  4PAL A;  1UHI A;  2BL0 C;  1S26 D;  1CM1 A;  4ORA B;  4ETO A;  3CLN A;  1K90 D;  4PHK A;  3KO0 A;  1KFU S;  2WOR A;  2KQY A;  1CB1 A;  5CSN A;  1JUO A;  1LKJ A;  1OMV A;  1YUU A;  2M29 A;  4A4C A;  4QJ5 B;  2AUC A;  1A75 B;  1JC2 A;  1DF0 B;  1RJV A;  2L51 A;  5TNC A;  1K93 D;  1YUS A;  1YX8 A;  3H4S E;  2FCD A;  4OVN F;  1CMF A;  1XK4 A;  1K94 A;  1S36 A;  2DOQ A;  5G08 A;  1AP4 A;  2H2K A;  2KOT A;  4PCW A;  2Q4U A;  4MSP A;  3EK7 A;  1FI6 A;  5B8I B;  3TDI A;  1XFU O;  1KK8 B;  2L4I A;  1QAT A;  1WDC C;  1YTZ C;  1SCM B;  1F55 A;  5ER4 X;  1GQM A;  1TNP A;  1F4O A;  3EVR A;  3PN7 C;  1S3P A;  1G8I A;  4BY4 A;  1A03 A;  3FS7 A;  1IQ5 A;  4GNK B;  1OZO A;  4DIR A;  1CLM A;  5BPJ A;  1KQV A;  1DGV A;  2KYF A;  2M1K B;  5CSJ A;  1BT6 A;  3BOW A;  1SCV A;  1FF1 A;  1B7T Y;  4DUQ A;  3AAJ A;  4CID A;  1UHN A;  2JRF A;  2ZN9 A;  1PUL A;  2M9G A;  3OP0 A;  4IL1 A;  2HQW A;  4OKH A;  4PE4 A;  2AAO A;  1M31 A;  3OB2 B;  1SR6 B;  1B8C A;  2OTG B;  4ICB A;  4I5N B;  4M2Q A;  3TUY C;  1CFC A;  2BBM A;  2K7B A;  3BQ3 A;  2KI4 B;  4XYN A;  1TNW A;  4E68 A;  1TTX A;  3VRO A;  1A75 A;  3DVE A;  1RTP 1;  1NCX A;  1QIV A;  1W7J B;  1NX3 A;  1SW8 A;  2LHI A;  2GV5 A;  2R2I A;  1UHK A;  1BMO A;  3EK4 A;  4I5J A;  5KTY A;  1NX2 A;  3OX5 A;  4N1G A;  4YGA A;  1V1F A;  2MRD A;  1EG3 A;  2BEC A;  3DF0 B;  1J7Q A;  2RGI A;  4GGF C;  4WRI A;  3PLF B;  1YUT A;  4DRW A;  1Y1A A;  2JNF A;  1PK0 D;  1QJT A;  4R1E A;  1TIZ A;  2MBX A;  1R2U A;  1KQM C;  3RLZ A;  2L2E A;  2OS8 B;  3O2P A;  1B7T Z;  3LLE A;  2KBI A;  3SIA A;  1RK9 A;  3AKB A;  3BUN B;  1MXL C;  1V1G A;  2E30 A;  2K7D A;  3JTD B;  4C0K A;  3CS1 A;  1MUX A;  1NCZ A;  2BL0 B;  2L4H A;  2QPT A;  1BLQ A;  4NDC A;  1NYA A;  1YX7 A;  4C0L A;  2KNE A;  2LAP A;  3WXA A;  4JQ0 D;  2MLF C;  2CCM A;  4DS7 A;  1BOC A;  4OR9 B;  5DKR A;  1OMD A;  3DVM A;  1WRK A;  4PHM A;  1QLK A;  1KSM A;  4USL A;  3F45 A;  3FWB A;  5I2Q A;  3NSO A;  3BUW B;  2LHL A;  2KAV A;  4YRU A;  2P6B B;  1N2D A;  1F71 A;  2JUL A;  4XJK A;  1BU3 A;  3CR5 X;  1UUR A;  1M45 A;  4MLW A;  2K2F A;  3EKJ A;  1G33 A;  1CMG A;  1WDC B;  3EVU A;  4YGE B;  3NSK A;  1L2O C;  1AJ4 A;  1J55 A;  1SKT A;  3PN7 B;  1UP5 A;  1R6P A;  1TCF A;  1A29 A;  1B8L A;  2SAS A;  1CNP A;  1ZUZ A;  1IRJ A;  1S1E A;  1BR4 B;  5I2O A;  2JTT A;  1IJ5 A;  4CLN A;  2LVJ A;  1CDL A;  1Y1U A;  1MR8 A;  3TUY B;  2FOT A;  3PAL A;  5D7F A;  2WCF A;  2LMU A;  1NIW A;  1VRK A;  2BKI B;  1N0Y A;  4YI9 A;  1GGW A;  4M2O A;  1K8U A;  1DVI A;  4UPG A;  1E8A A;  4D1E A;  3GOF A;  2CBL A;  1CLL A;  1JF2 A;  2M3W A;  4HRG A;  1XFZ O;  4FTG A;  2BE6 A;  2WC8 A;  4P2Y B;  3SG5 A;  4YGB B;  1CLB A;  1EJ3 A;  2Y1N A;  2JTZ A;  2L0P A;  2I7A A;  1ALV A;  1BR1 B;  3FIA A;  3E3R A;  3I5I C;  4YGD B;  1A4P A;  1CM4 A;  5HKY A;  2NLN A;  2IS9 A;  2WND A;  4A4B A;  2LNK A;  2F33 A;  2CNP A;  3EK8 A;  1SRA A;  1UWO A;  1ZMZ A;  4L9M A;  4QJ4 B;  4MZK A;  1M63 B;  5AFP A;  1SPY A;  2Y4Q A;  3OHM B;  2PVB A;  1BF5 A;  5CSF A;  4PE0 A;  1DJH A;  5PAL A;  3ZWH A;  1MWN A;  1SK6 D;  3DVK A;  3TS5 C;  3KPX A;  2KHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...