1TCOB

Ternary complex of a calcineurin a fragment, calcineurin b, fkbp12 and the immunosuppressant drug fk506 (tacrolimus)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
169
structure length
169
Chain Sequence
GNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE PHOSPHATASE B2
publication title X-ray structure of calcineurin inhibited by the immunophilin-immunosuppressant FKBP12-FK506 complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Complex (hydrolase/isomerase)
total genus 56
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 1996-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00036 EF-hand_1 EF hand
B PF13202 EF-hand_5 EF hand
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1tcoB00
2O60A 3BUNB 1L7ZA 1SL8A 4AQIA 1DVIA 1N0YA 1F4OA 1MUXA 1TIZA 1MXEA 3NSLA 1N2DA 1SK6D 5GQQC 3PATA 1QX5B 1DGUA 2NCPA 1K93D 2Y5IA 1CDNA 2WOSA 4PHNA 4E68A 2JPTA 4U8DA 1BR4B 3FIAA 2MHHA 2BBMA 3SIBA 1F4QA 3IQOA 1J7QA 2KBIA 1XFXO 2M1UA 4M2OA 3SG3A 5CPVA 1KK7Z 1Y1XA 3VRNA 1CMGA 1TCFA 2LLUA 1DJHA 2M49B 1HT9A 1PVAA 2L51A 3SG5A 3TS5B 2LVKA 2L2EA 2L4IA 1XYDA 5IBWA 2KBMA 2V53A 3EVVA 5CSFA 1OQPA 4UPGA 1TNXA 4PHMA 3BQ3A 2I94A 1YUTA 2KI6D 2LVJA 3VRPA 2WCEA 1LA3A 1KFXS 1F55A 2SCPA 1DF0A 4ETOA 1BU3A 1DJZA 1U5IB 4YGEB 4ORBB 4NQGA 1QLSA 4QJ4B 1L2OC 2LV7A 1N65A 2FCDA 4XJKA 3BOWA 4XYNA 1SR6C 4PE4A 2LUCA 1KFUL 5AERA 5HKZA 2BE6A 1PK0D 2CXJA 2HPSA 2PSRA 2E30A 2LVVA 2L4HA 1DT7B 1KWOC 3GK2A 1IKUA 3PN7C 1KQMB 1SNLA 1TRFA 1C7VA 3ZNIA 5HKWA 3NSOA 4NDBA 3FWBA 1MWNA 1XFVO 1Q80A 4MN0A 3DVJA 3SG6A 2JXLA 3M0WA 4OV2A 5JOLA 1DJYA 1LXFC 1WDCC 1B7TY 1M39A 1M31A 3NXAA 1UUSA 2LC5A 1ZUZA 4F0ZB 1J55A 1JFKA 2KNEA 1IJ6A 4WQ2A 4CFQA 1SW8A 2LUXA 1CMFA 2F2OA 2KSPA 3CR5X 2F3YA 3JVTC 1FI5A 1NPQA 2MJWB 3BUMB 1IQ5A 1CFDA 2DOQA 2PRUA 2Y1MA 3OP0A 1XK4C 3QRXA 1UHNA 1V1FA 3KO0A 1QVIY 4M2PA 1A2XA 1EG3A 1NUBA 1NCZA 5DKNA 1IGVA 4OVNF 4GAOA 4NDCA 1ALVA 3SIAA 3FS7A 2CCMA 1LA0A 5I2OA 1QX7A 1NWDA 1XK4A 1JUOA 2KAXA 1S5GZ 1QASA 3CTNA 2CTNA 2R2IA 3PLFB 1WLZA 3F45A 3BOWB 2JRFA 3GK1A 2M1KB 4MVFA 2AAOA 5ER5A 2OS8C 2ZFDA 2G9BA 2MLFC 5DKQA 3EKJA 1JFJA 4I5JA 1SCMC 3OB1B 2JWWA 1FF1A 2NLNA 1SR6B 1JBAA 1OZOA 2BCAA 4DRWA 2PALA 1U5IA 2MA2A 1FBVA 4ICBA 1M63B 3IF7A 5KTYA 1YR5A 1JSAA 2M7NA 2KFFA 1KWOB 2SASA 1J1DA 1R2UA 3PN7B 3I5FC 1S6JA 2KYFA 4BY4A 1GGWA 1NX0A 4C0JA 2ZN9A 4JWQA 4MRXA 4YGAA 3K21A 1SRAA 1M45A 4GFTA 1QIWA 1WDCB 2AUCA 1SYMA 1JF2A 1XO5A 2H61C 2I2RE 4OKHA 1G33A 1OOJA 4Q04A 1YUUA 5AANA 4HRHA 3TDUA 4YI9A 3CS1A 3I5HC 1B7TZ 2KQYA 3EKHA 1NSHA 1TN4A 1YURA 3TDIA 2KDHA 2M29A 2F3ZA 1CDLA 2PASA 3JVTB 1C7WA 2MLEC 2NXQA 3D10A 2WORA 1YVHA 2EHBA 2L50A 3SG2A 3CGAA 3EK7A 1CM1A 2M3WA 3GOFA 1S5GY 1RROA 1S36A 3NSIA 4CIDA 1XFUO 2KI6C 3PFVA 1S26D 2D8NA 1VRKA 2M0RA 4PALA 2WCBA 5BPJA 1QVIZ 4A4BA 1K90D 1QX2A 3AKBA 3TZ1A 1UHIA 1SPYA 3DVEA 4C0LA 4D1EA 1RWYA 4ORCB 1CKKA 2OPOA 1MXLC 2JULA 2LMUA 4P5OE 2KAYA 1NCXA 1EJ3A 1YRUB 1TTXA 2JTZA 4CFRA 2JZIA 3EK8A 3TDZA 2LAPA 2EC6C 3KHEA 2LMVA 2OS8B 4OCIA 1UWOA 1K8UA 1RJVA 1WRKA 1PRWA 2I7AA 3DD4A 1SCMB 2LMTA 2Q91A 4MZKA 5D69A 4YRUA 2O5GA 1AVSA 2KAVA 1IRJA 4CLNA 2F33A 4IL1A 4I5KA 1X02A 3PALA 4PDZA 4CPVA 2JOJA 1GQMA 1OE9B 3BUOB 1CLBA 3LLEA 1UHKA 2HQ8A 2I18A 4ORAB 3O4YA 1ZOTB 3I5FB 4QJ3B 1XFWO 1OMVA 4DIRA 1UP5A 1KFUS 2GGZA 2LLTA 1EXRA 1CFPA 1KSOA 2BBNA 3OX5A 1QIVA 1OMRA 1BOCA 3BUWB 2MRDA 1LKJA 1IG5A 1QJTA 1QV0A 1AP4A 2JXCA 3ZWHA 2JU0A 1K94A 2RGIA 1S1EA 2BCXA 1OZSA 2Y4QA 3I5HB 2F8PA 2ZNDA 2K2FA 1J1EA 2ZN8A 1H4BA 1WRZA 2KI4C 4P2YB 1TOPA 1IJ5A 2GV5A 1QTXA 3EVRA 2P6BB 1FW4A 2JT8A 2A4JA 1NX2A 3LCPC 1CM4A 2G2BA 2HETA 1QLKA 2IS9A 4JQ0D 5ER4X 5HLOA 1KCYA 1R6PA 2EGDA 2CNPA 2M9GA 4YGBB 5I2QA 1ZACA 1DMOA 2LM5A 2VRGA 1WY9A 4MRYA 2FCEA 2KYCA 1BODA 1S6IA 2Q4UA 1F54A 1JF0A 2EC6B 4JPZB 3WHUB 2K0JA 3A8RA 5DKRA 1YX8A 3WXAA 1Y1UA 1K95A 1YRTB 2JT3A 1L2OB 2KGRA 2MAZA 4MBEA 1ALWA 5CSJA 3SG4A 3C1VA 3CR2A 1CLLA 1UHJA 1YUSA 4HREE 1OSAA 1K96A 1Y0VH 3I5GC 1D1OA 2K2AA 1B47A 1QV1A 2TN4A 2B1UA 1MQ1A 3DVMA 4AQJA 3VGOA 1DJIA 4PHJA 3CLNA 1PSRA 2LNKA 2E6WA 1KK8C 1W7JB 1BR1B 1RFJA 4PE0A 1XVJA 4HSZA 4ZCUA 1FPWA 5D7FA 4N1FA 2BECA 2LE9B 3RM1A 2H2KA 2AMIA 3LL8B 1MHOA 1MF8B 2JC2A 1SMGA 4GGFC 2BCBA 2HF5A 3OX6A 2ISDA 2NZ0A 3TUYC 1NCYA 2PMYA 1DJXA 4YBHB 5HLVA 2H61A 1SBJA 1B8LA 1Y1AA 1TNPA 2MBXA 1F8HA 1XA5A 1S6CA 2NCOA 2M97A 3CWGA 1Y6WA 4GGFA 1BG1A 2KI4B 1V1GA 2BL0C 3RLZA 1CLMA 5F6TA 2WCFA 5TNCA 3I5IC 1GJYA 2L98A 3CZTX 2ZKMX 2JNXA 1TNQA 2LANA 1YTZC 1CDPA 5CSNA 1IWQA 1A75A 1SL7A 5HYDA 1B4CA 4PHKA 1AHRA 1NX1A 1BLQA 2ZRTA 3VRQA 4YI8A 1BT6A 4C0KA 1K9KA 2LP2A 2JTTA 1BF5A 5AFPA 2K61A 1SKTA 3E3RA 1QS7A 1SCVA 1PVBA 1OMDA 1UHHA 2GGMA 3GK4X 1BJFA 4R1EA 1KFXL 3O2PA 1JC2A 1XFZO 1RTP1 3KEVA 5CSIA 1SY9A 3AKAA 2COLB 1E8AA 5B8IB 1G4YR 1A4PA 2WC8A 3BUXB 1RK9A 4GGNA 1PULA 3DF0A 5I2LA 3I5GB 2BKIB 5I8NA 2CT9A 2K7OA 4N1GA 1EL4A 4GPLB 1J7OA 2OTGC 1IQ3A 1BMOA 2K7DA 1CNPA 2KFHA 3SJSA 4YGDB 3AAKA 1NIWA 3HCMA 1KK8B 1FI6A 3D0YA 1CDMA 2BE4A 1NP8A 1DTLA 2M8UA 3H4SE 3JTDC 4TNCA 4BY5A 1A03A 1ZMZA 1CB1A 2LLSA 4OR9B 1UURA 1A29A 3PM8A 2FJUB 2FOTA 1YVLA 1B8CA 2LHLA 3TUYB 2L5XB 4DS7A 5J3XA 1AJ5A 3EVUA 5FYXA 2BKHB 1H8BA 3LK1A 4N5XA 2JT0A 4YGCB 1J7RA 1PALA 2LHIA 4QJ5B 1K2HA 1QATA 4NDDA 1ZFSA 3WNXB 1A75B 3KF9A 2BL0B 4DUQA 4FTGA 1F70A 1LVCD 3I5IB 5KU1A 2KQ6A 5PALA 2LP3A 3ICBA 4ZCVA 2K7CA 1AUIB 3MSEB 4GBAA 1CFCA 5K89A 4WRIA 3FWCA 4MLWA 3BYAA 5HKYA 2CBLA 4GNKB 2ZNEA 4DCKA 4PCWA 1KK7Y 2QPTA 2F2PA 5AXIA 1F71A 5JJGA 1HQVA 4PE7A 1B8RA 4AOMA 1LINA 4MZJA 5G08A 1W7IB 3DF0B 1YX7A 1RECA 1NYAA 3WHTB 2WNDA 1DGVA 3A4UB 1WRLA 3BXKA 1CTRA 3DVKA 4L9MA 3TS5C 1AJ4A 1SL9A 1DF0B 1S3PA 5KSZA 3OB2B 4MEWA 5AEQA 1G8IA 2ZRSA 3AAJA 2LCPA 1CFFA 1TCOB 2L0PA 4I5NB 1QXPA 3HX4A 3D0YB 1K9UA 2JNFA 2QACA 2OTGB 1KQVA 2HQWA 4I5LB 1M46A 4FQOA 3O6BA 4USLA 4XJKB 1B1GA 1MR8A 3EK4A 1EH2A 1JWDA 1KSMA 2KFGA 1IH0A 2JQ6A 1C07A 1J7PA 1DJGA 1GGZA 1WLMA 3CR4X 3VROA 1B9AA 2K7BA 2KGBC 4PE1A 1PSBA 3SG7A 3JTDB 2PVBA 3KPXA 4MSPA 3OHMB 1XFYO 3O78A 3NSKA 4M2QA 2LVIA 4HRGA 2K8MB 1AK8A 1DJWA 4GUKA 1EG4A 3VRRA 2KOTA 3IQQA 1ODBA 1K9PA 1KQMC 4WQ3A 4MZLA 2Y1NA 1TNWA 2KHNA 3PSRA 4A4CA 3LK0A 1NX3A 2M7LA
chains in the Genus database with same CATH superfamily
2O60A 3BUNB 1L7ZA 1SL8A 4AQIA 1DVIA 1N0YA 3NHTA 1F4OA 1MUXA 1TIZA 1MXEA 2QEBA 3NSLA 1N2DA 1SK6D 5GQQC 3PATA 2QEHA 1QX5B 1DGUA 2NCPA 1K93D 2Y5IA 3L4LA 3IVTA 1CDNA 2WOSA 4IJ7A 4PHNA 4E68A 2JPTA 4U8DA 1BR4B 3FE6A 2MHHA 2BBMA 3FIAA 3SIBA 1F4QA 3IQOA 1J7QA 2KBIA 1XFXO 2M1UA 2P70A 4M2OA 5CPVA 1KK7Z 1Y1XA 3SG3A 2KPHA 1TCFA 2LLUA 1DJHA 2M49B 1HT9A 1PVAA 2L51A 3SG5A 3TS5B 2LVKA 2L2EA 2L4IA 1XYDA 5IBWA 2KBMA 2V53A 3EVVA 3R72A 5CSFA 1OQPA 4UPGA 1TNXA 4PHMA 1Z4HA 3BQ3A 1TUZA 2I94A 1YUTA 2KI6D 2LVJA 3VRPA 2WCEA 1LA3A 1KFXS 1F55A 2SCPA 1DF0A 3UNWA 3V2LA 2L5YA 4ETOA 1BU3A 1DJZA 1U5IB 4YGEB 4ORBB 1DC1A 4NQGA 1QLSA 4QJ4B 4INXA 1L2OC 2LV7A 1N65A 2FCDA 4XJKA 3BOWA 4XYNA 1SR6C 4PE4A 2LUCA 5DICA 1KFUL 3DXLA 3DY9A 5HKZA 5AERA 2BE6A 5D3OA 1PK0D 1C3ZA 2CXJA 2HPSA 2PSRA 2E30A 2LVVA 2L4HA 1DT7B 1KWOC 3GK2A 2WCMA 1IKUA 3PN7C 1KQMB 1SNLA 1QWVA 1TRFA 3O4XA 1C7VA 3ZNIA 5HKWA 3NSOA 4NDBA 3S0FA 3FWBA 1MWNA 1XFVO 1Q80A 4MN0A 3DVJA 3SG6A 2JXLA 3M0WA 4OV2A 5JOLA 1DJYA 1LXFC 1WDCC 1B7TY 1M39A 1M31A 3NXAA 1UUSA 2LC5A 2FJYA 1ZUZA 3R1OA 4F0ZB 1J55A 1JFKA 2KNEA 5FI2A 4JKTA 1IJ6A 4WQ2A 4CFQA 1SW8A 2LUXA 1CMFA 2F2OA 2KSPA 3CR5X 2F3YA 3JVTC 2PYQA 1FI5A 1NPQA 2MJWB 3BUMB 1IQ5A 1CFDA 2DOQA 2PRUA 2Y1MA 3OP0A 1XK4C 3QRXA 1UHNA 1V1FA 3KO0A 1QVIY 2WCHA 1A2XA 1EG3A 1NUBA 1NCZA 3B88A 5DKNA 1IGVA 4OVNF 4GAOA 4KYNA 1ALVA 4NDCA 3FS7A 2CCMA 1LA0A 3SIAA 1QX7A 1NWDA 5I2OA 1XFRA 1SSEB 1XK4A 2YGUA 1JUOA 2KAXA 1S5GZ 1QASA 3CTNA 2CTNA 2R2IA 3PLFB 3B7AA 1WLZA 3D78A 3F45A 3BOWB 2JRFA 3GK1A 2M1KB 4MVFA 2AAOA 5ER5A 2OS8C 3K1EA 2ZFDA 2G9BA 2MLFC 2WCLA 5DKQA 2GTEA 3EKJA 3FE8A 1JFJA 4I5JA 1SCMC 3OB1B 3FE9A 2JWWA 1FF1A 2NLNA 3CDNA 3EG5B 1SR6B 1JBAA 1OZOA 2BCAA 4DRWA 2PALA 1U5IA 2QDIA 2MA2A 3UO9A 1FBVA 4ICBA 1M63B 3IF7A 5KTYA 1YR5A 2BAPA 1JSAA 3B87A 2M7NA 2KFFA 1KWOB 2SASA 1J1DA 1R2UA 3PN7B 3I5FC 1S6JA 2KYFA 3SS5A 4BY4A 1GGWA 1NX0A 4C0JA 2ZN9A 4JWQA 4MRXA 4YGAA 3K21A 3DYEA 4FQTA 1SRAA 1M45A 4GFTA 1QIWA 1WDCB 2AUCA 1SYMA 1JF2A 1XO5A 2H61C 2I2RE 1DEKA 4OKHA 4PT1A 1G33A 1OOJA 4Q04A 1YUUA 5AANA 4HRHA 3TDUA 3CZ1A 4YI9A 3CS1A 2QEOA 3I5HC 1B7TZ 2KQYA 3EKHA 1NSHA 1TN4A 1YURA 3TDIA 2KDHA 2M29A 2JPOA 2F3ZA 1CDLA 2PASA 3JVTB 1C7WA 2MLEC 2NXQA 1DELA 2WORA 3D10A 1YVHA 2EHBA 2L50A 3SG2A 3R1PA 3CGAA 3EK7A 1CM1A 2M3WA 3GOFA 1S5GY 1RROA 3BFAA 1S36A 3NSIA 4CIDA 1XFUO 2KI6C 3PFVA 1S26D 2D8NA 1VRKA 2M0RA 4PALA 3B86A 2WCBA 3VRNA 5BPJA 1QVIZ 1ORGA 4A4BA 1K90D 1QX2A 3AKBA 3TZ1A 1UHIA 1SPYA 3DVEA 4C0LA 4D1EA 1RWYA 4ORCB 1CKKA 2OPOA 1MXLC 2JULA 2LMUA 4P5OE 2KAYA 1NCXA 1EJ3A 1YRUB 2K60A 1TTXA 2JTZA 4CFRA 2JZIA 3EK8A 3TDZA 2LAPA 2EC6C 3KHEA 2LMVA 2OS8B 4OCIA 1UWOA 1K8UA 1RJVA 1WRKA 1PRWA 2I7AA 3RZSA 3DD4A 1SCMB 2LMTA 2Q91A 4MZKA 5D69A 4YRUA 2O5GA 1AVSA 2KAVA 1IRJA 3B6XA 4CLNA 2F33A 3S0GA 4IL1A 4I5KA 1X02A 3PALA 4PDZA 4CPVA 2JOJA 1GQMA 1OE9B 3BUOB 1CLBA 3SS4A 3LLEA 1T14A 3S0DA 1UHKA 2HQ8A 2I18A 1OOIX 3O4YA 1ZOTB 3I5FB 4ORAB 2WC5A 1XFWO 4QJ3B 1OMVA 4DIRA 1UP5A 1KFUS 1OOGA 2GGZA 2LLTA 1EXRA 1CFPA 1KSOA 2BBNA 3OX5A 5FI6A 1QIVA 1OMRA 1BOCA 3BUWB 2MRDA 1TWOA 1LKJA 3CYZA 1GM0A 1IG5A 1QJTA 1QV0A 4INWA 3Q8IA 2JXCA 1AP4A 3ZWHA 3L4AA 2JU0A 1K94A 3VB1A 2RGIA 1S1EA 2BCXA 1OZSA 2Y4QA 3I5HB 2F8PA 5FI7A 2ZNDA 2K2FA 2BNXA 1J1EA 2QEVA 2ZN8A 1H4BA 1WRZA 3DZTA 2KI4C 3OBVA 2ERBA 4P2YB 1TOPA 1IJ5A 2GV5A 1QTXA 3EVRA 2P6BB 1FW4A 2JT8A 2A4JA 1NX2A 3LCPC 1CM4A 2G2BA 2HETA 2WCJA 1QLKA 2IS9A 4JQ0D 5ER4X 5HLOA 1KCYA 1R6PA 2EGDA 2CNPA 2M9GA 4YGBB 5I2QA 1ZACA 1DMOA 2LM5A 2VRGA 1WY9A 4MRYA 2FCEA 2KYCA 1BODA 1S6IA 2Q4UA 1F54A 1JF0A 2EC6B 4JPZB 3WHUB 2K0JA 3A8RA 5DKRA 1YX8A 3WXAA 1Y1UA 1K95A 1YRTB 2JT3A 1L2OB 2KGRA 2MAZA 4MBEA 1ALWA 5CSJA 3SG4A 3C1VA 3CR2A 1CLLA 1UHJA 1YUSA 4HREE 1OSAA 1K96A 1Y0VH 3I5GC 1D1OA 2K2AA 1B47A 1QV1A 2TN4A 2B1UA 1MQ1A 3DVMA 4AQJA 3VGOA 1DJIA 4PHJA 3CLNA 1PSRA 3PM2A 2LNKA 2E6WA 1KK8C 1W7JB 1BR1B 1RFJA 1TUJA 4PE0A 1XVJA 4HSZA 4ZCUA 1FPWA 3OGNA 3BFHA 5D7FA 4N1FA 2BECA 2LE9B 3RM1A 2H2KA 2AMIA 3LL8B 1OOFA 1MHOA 1MF8B 2JC2A 1SMGA 4GGFC 2BCBA 2HF5A 3OX6A 3D75A 2ISDA 2NZ0A 3S0BA 1NCYA 2PMYA 1DJXA 3TUYC 3D76A 4YBHB 5HLVA 2H61A 1SBJA 1B8LA 1Y1AA 1TNPA 2KLEA 2MBXA 1F8HA 1XA5A 1S6CA 2NCOA 2M97A 3CWGA 1Y6WA 4GGFA 1BG1A 2KI4B 5EL2A 1V1GA 2BL0C 3RLZA 1CLMA 5F6TA 2WC6A 4M2PA 2WCFA 5TNCA 3D74A 3I5IC 1GJYA 2L98A 3CZTX 3D77A 2ZKMX 2JNXA 1TNQA 2LANA 1YTZC 2KLDA 1CDPA 5CSNA 1W9ZA 1IWQA 1A75A 3CABA 1SL7A 5HYDA 1B4CA 4PHKA 1AHRA 1NX1A 1BLQA 2ZRTA 4JD9A 3VRQA 3NHIA 1BT6A 4YI8A 3S0EA 1K9KA 4C0KA 2LP2A 2JTTA 1BF5A 5AFPA 2K61A 1SKTA 3E3RA 1QS7A 1LS8A 1SCVA 1PVBA 1OMDA 1UHHA 2GGMA 3BJHA 3GK4X 1BJFA 4R1EA 1KFXL 3O2PA 1C3YA 1JC2A 1XFZO 1RTP1 3KEVA 5CSIA 1SY9A 3AKAA 2COLB 1E8AA 5B8IB 1G4YR 1A4PA 2WC8A 3BUXB 1RK9A 4GGNA 1PULA 3DF0A 5I2LA 3I5GB 2BKIB 5I8NA 2CT9A 2K7OA 4N1GA 1EL4A 5HL1A 4GPLB 1J7OA 2OTGC 1IQ3A 1BMOA 2K7DA 1CNPA 2KFHA 3SJSA 4YGDB 3S0AA 3AAKA 1NIWA 3HCMA 1KK8B 4OZDA 3N7HA 3D0YA 1CDMA 1FI6A 2BE4A 1P28A 1NP8A 1DTLA 2M8UA 3H4SE 3JTDC 4TNCA 4BY5A 1A03A 1ZMZA 1CB1A 2LLSA 4OR9B 1UURA 1A29A 3PM8A 2FJUB 2FOTA 1YVLA 1Z2CB 1B8CA 2PQLA 2LHLA 3TUYB 2L5XB 4DS7A 1CMGA 5J3XA 1AJ5A 3D73A 3EVUA 5FYXA 2BKHB 3SS3A 1H8BA 3LK1A 3BFBA 4N5XA 2JT0A 4YGCB 1J7RA 1PALA 2LHIA 4QJ5B 1K2HA 1QATA 4NDDA 1ZFSA 3WNXB 1A75B 3L47A 3KF9A 2BL0B 3QMEA 4DUQA 4FTGA 1F70A 1LVCD 3I5IB 5KU1A 2KQ6A 5PALA 2LP3A 3ICBA 4ZCVA 2K7CA 1AUIB 3MSEB 4GBAA 1CFCA 5K89A 4WRIA 1OW4A 3FWCA 4MLWA 3BYAA 5HKYA 2CBLA 4GNKB 1IIOA 2ZNEA 4DCKA 4PCWA 1KK7Y 2QPTA 2F2PA 5AXIA 1F71A 5JJGA 1HQVA 4PE7A 1B8RA 4AOMA 2H8VA 1LINA 4MZJA 5G08A 1W7IB 3DF0B 1YX7A 1RECA 1NYAA 3WHTB 2WNDA 1DGVA 3A4UB 1WRLA 3BXKA 1CTRA 3DVKA 4L9MA 3TS5C 1AJ4A 3CZ0A 3PJIA 1SL9A 1DF0B 1OOHA 1S3PA 5KSZA 1DQEA 3OB2B 4MEWA 5AEQA 1G8IA 2ZRSA 3AAJA 2LCPA 4F7FA 1CFFA 1TCOB 2L0PA 4I5NB 1QXPA 3HX4A 3D0YB 1K9UA 2JNFA 2QACA 2OTGB 1KQVA 2HQWA 2P71A 4I5LB 1M46A 4FQOA 3O6BA 4USLA 4XJKB 2WCKA 1B1GA 1MR8A 3EK4A 1EH2A 1JWDA 3NGVA 1KSMA 2KFGA 1IH0A 2JQ6A 1C07A 1J7PA 1DJGA 1GGZA 1WLMA 3CR4X 3VROA 1B9AA 2K7BA 2KGBC 4PE1A 5I94A 1PSBA 3SG7A 3JTDB 2PVBA 3KPXA 4MSPA 3OHMB 1XFYO 3O78A 3NSKA 4M2QA 2LVIA 4HRGA 2K8MB 1AK8A 1DJWA 4GUKA 1EG4A 3VRRA 2KOTA 2L2CA 3CZ2A 1ODBA 3IQQA 3R1VA 1K9PA 1KQMC 4WQ3A 4MZLA 2Y1NA 1TNWA 2KHNA 3PSRA 4A4CA 3LK0A 1NX3A 2M7LA
chains in the Genus database with same CATH topology
2O60A 3BUNB 1L7ZA 1SL8A 4AQIA 1DVIA 1N0YA 1F4OA 1MUXA 1TIZA 1MXEA 3NSLA 1N2DA 1SK6D 5GQQC 3PATA 1QX5B 1DGUA 2NCPA 1K93D 2Y5IA 1CDNA 2WOSA 4PHNA 4E68A 2JPTA 4U8DA 1BR4B 3FIAA 2MHHA 2BBMA 3SIBA 1F4QA 3IQOA 1J7QA 2KBIA 1XFXO 2M1UA 4M2OA 3SG3A 5CPVA 1KK7Z 1Y1XA 3VRNA 1CMGA 1TCFA 2LLUA 1DJHA 2M49B 1HT9A 1PVAA 2L51A 3SG5A 3TS5B 2LVKA 2L2EA 2L4IA 1XYDA 5IBWA 2KBMA 2V53A 3EVVA 5CSFA 1OQPA 4UPGA 1TNXA 4PHMA 3BQ3A 2I94A 1YUTA 2KI6D 2LVJA 3VRPA 2WCEA 1LA3A 1KFXS 1F55A 2SCPA 1DF0A 4ETOA 1BU3A 1DJZA 1U5IB 4YGEB 4ORBB 4NQGA 1QLSA 4QJ4B 1L2OC 2LV7A 1N65A 2FCDA 4XJKA 3BOWA 4XYNA 1SR6C 4PE4A 2LUCA 1KFUL 5AERA 5HKZA 2BE6A 1PK0D 2CXJA 2HPSA 2PSRA 2E30A 2LVVA 2L4HA 1DT7B 1KWOC 3GK2A 1IKUA 3PN7C 1KQMB 1SNLA 1TRFA 1C7VA 3ZNIA 5HKWA 3NSOA 4NDBA 3FWBA 1MWNA 1XFVO 1Q80A 4MN0A 3DVJA 3SG6A 2JXLA 3M0WA 4OV2A 5JOLA 1DJYA 1LXFC 1WDCC 1B7TY 1M39A 1M31A 3NXAA 1UUSA 2LC5A 1ZUZA 4F0ZB 1J55A 1JFKA 2KNEA 1IJ6A 4WQ2A 4CFQA 1SW8A 2LUXA 1CMFA 2F2OA 2KSPA 3CR5X 2F3YA 3JVTC 1FI5A 1NPQA 2MJWB 3BUMB 1IQ5A 1CFDA 2DOQA 2PRUA 2Y1MA 3OP0A 1XK4C 3QRXA 1UHNA 1V1FA 3KO0A 1QVIY 4M2PA 1A2XA 1EG3A 1NUBA 1NCZA 5DKNA 1IGVA 4OVNF 4GAOA 4NDCA 1ALVA 3SIAA 3FS7A 2CCMA 1LA0A 5I2OA 1QX7A 1NWDA 1XK4A 1JUOA 2KAXA 1S5GZ 1QASA 3CTNA 2CTNA 2R2IA 3PLFB 1WLZA 3F45A 3BOWB 2JRFA 3GK1A 2M1KB 4MVFA 2AAOA 5ER5A 2OS8C 2ZFDA 2G9BA 2MLFC 5DKQA 3EKJA 1JFJA 4I5JA 1SCMC 3OB1B 2JWWA 1FF1A 2NLNA 1SR6B 1JBAA 1OZOA 2BCAA 4DRWA 2PALA 1U5IA 2MA2A 1FBVA 4ICBA 1M63B 3IF7A 5KTYA 1YR5A 1JSAA 2M7NA 2KFFA 1KWOB 2SASA 1J1DA 1R2UA 3PN7B 3I5FC 1S6JA 2KYFA 4BY4A 1GGWA 1NX0A 4C0JA 2ZN9A 4JWQA 4MRXA 4YGAA 3K21A 1SRAA 1M45A 4GFTA 1QIWA 1WDCB 2AUCA 1SYMA 1JF2A 1XO5A 2H61C 2I2RE 4OKHA 1G33A 1OOJA 4Q04A 1YUUA 5AANA 4HRHA 3TDUA 4YI9A 3CS1A 3I5HC 1B7TZ 2KQYA 3EKHA 1NSHA 1TN4A 1YURA 3TDIA 2KDHA 2M29A 2F3ZA 1CDLA 2PASA 3JVTB 1C7WA 2MLEC 2NXQA 3D10A 2WORA 1YVHA 2EHBA 2L50A 3SG2A 3CGAA 3EK7A 1CM1A 2M3WA 3GOFA 1S5GY 1RROA 1S36A 3NSIA 4CIDA 1XFUO 2KI6C 3PFVA 1S26D 2D8NA 1VRKA 2M0RA 4PALA 2WCBA 5BPJA 1QVIZ 4A4BA 1K90D 1QX2A 3AKBA 3TZ1A 1UHIA 1SPYA 3DVEA 4C0LA 4D1EA 1RWYA 4ORCB 1CKKA 2OPOA 1MXLC 2JULA 2LMUA 4P5OE 2KAYA 1NCXA 1EJ3A 1YRUB 1TTXA 2JTZA 4CFRA 2JZIA 3EK8A 3TDZA 2LAPA 2EC6C 3KHEA 2LMVA 2OS8B 4OCIA 1UWOA 1K8UA 1RJVA 1WRKA 1PRWA 2I7AA 3DD4A 1SCMB 2LMTA 2Q91A 4MZKA 5D69A 4YRUA 2O5GA 1AVSA 2KAVA 1IRJA 4CLNA 2F33A 4IL1A 4I5KA 1X02A 3PALA 4PDZA 4CPVA 2JOJA 1GQMA 1OE9B 3BUOB 1CLBA 3LLEA 1UHKA 2HQ8A 2I18A 4ORAB 3O4YA 1ZOTB 3I5FB 4QJ3B 1XFWO 1OMVA 4DIRA 1UP5A 1KFUS 2GGZA 2LLTA 1EXRA 1CFPA 1KSOA 2BBNA 3OX5A 1QIVA 1OMRA 1BOCA 3BUWB 2MRDA 1LKJA 1IG5A 1QJTA 1QV0A 1AP4A 2JXCA 3ZWHA 2JU0A 1K94A 2RGIA 1S1EA 2BCXA 1OZSA 2Y4QA 3I5HB 2F8PA 2ZNDA 2K2FA 1J1EA 2ZN8A 1H4BA 1WRZA 2KI4C 4P2YB 1TOPA 1IJ5A 2GV5A 1QTXA 3EVRA 2P6BB 1FW4A 2JT8A 2A4JA 1NX2A 3LCPC 1CM4A 2G2BA 2HETA 1QLKA 2IS9A 4JQ0D 5ER4X 5HLOA 1KCYA 1R6PA 2EGDA 2CNPA 2M9GA 4YGBB 5I2QA 1ZACA 1DMOA 2LM5A 2VRGA 1WY9A 4MRYA 2FCEA 2KYCA 1BODA 1S6IA 2Q4UA 1F54A 1JF0A 2EC6B 4JPZB 3WHUB 2K0JA 3A8RA 5DKRA 1YX8A 3WXAA 1Y1UA 1K95A 1YRTB 2JT3A 1L2OB 2KGRA 2MAZA 4MBEA 1ALWA 5CSJA 3SG4A 3C1VA 3CR2A 1CLLA 1UHJA 1YUSA 4HREE 1OSAA 1K96A 1Y0VH 3I5GC 1D1OA 2K2AA 1B47A 1QV1A 2TN4A 2B1UA 1MQ1A 3DVMA 4AQJA 3VGOA 1DJIA 4PHJA 3CLNA 1PSRA 2LNKA 2E6WA 1KK8C 1W7JB 1BR1B 1RFJA 4PE0A 1XVJA 4HSZA 4ZCUA 1FPWA 5D7FA 4N1FA 2BECA 2LE9B 3RM1A 2H2KA 2AMIA 3LL8B 1MHOA 1MF8B 2JC2A 1SMGA 4GGFC 2BCBA 2HF5A 3OX6A 2ISDA 2NZ0A 3TUYC 1NCYA 2PMYA 1DJXA 4YBHB 5HLVA 2H61A 1SBJA 1B8LA 1Y1AA 1TNPA 2MBXA 1F8HA 1XA5A 1S6CA 2NCOA 2M97A 3CWGA 1Y6WA 4GGFA 1BG1A 2KI4B 1V1GA 2BL0C 3RLZA 1CLMA 5F6TA 2WCFA 5TNCA 3I5IC 1GJYA 2L98A 3CZTX 2ZKMX 2JNXA 1TNQA 2LANA 1YTZC 1CDPA 5CSNA 1IWQA 1A75A 1SL7A 5HYDA 1B4CA 4PHKA 1AHRA 1NX1A 1BLQA 2ZRTA 3VRQA 4YI8A 1BT6A 4C0KA 1K9KA 2LP2A 2JTTA 1BF5A 5AFPA 2K61A 1SKTA 3E3RA 1QS7A 1SCVA 1PVBA 1OMDA 1UHHA 2GGMA 3GK4X 1BJFA 4R1EA 1KFXL 3O2PA 1JC2A 1XFZO 1RTP1 3KEVA 5CSIA 1SY9A 3AKAA 2COLB 1E8AA 5B8IB 1G4YR 1A4PA 2WC8A 3BUXB 1RK9A 4GGNA 1PULA 3DF0A 5I2LA 3I5GB 2BKIB 5I8NA 2CT9A 2K7OA 4N1GA 1EL4A 4GPLB 1J7OA 2OTGC 1IQ3A 1BMOA 2K7DA 1CNPA 2KFHA 3SJSA 4YGDB 3AAKA 1NIWA 3HCMA 1KK8B 1FI6A 3D0YA 1CDMA 2BE4A 1NP8A 1DTLA 2M8UA 3H4SE 3JTDC 4TNCA 4BY5A 1A03A 1ZMZA 1CB1A 2LLSA 4OR9B 1UURA 1A29A 3PM8A 2FJUB 2FOTA 1YVLA 1B8CA 2LHLA 3TUYB 2L5XB 4DS7A 5J3XA 1AJ5A 3EVUA 5FYXA 2BKHB 1H8BA 3LK1A 4N5XA 2JT0A 4YGCB 1J7RA 1PALA 2LHIA 4QJ5B 1K2HA 1QATA 4NDDA 1ZFSA 3WNXB 1A75B 3KF9A 2BL0B 4DUQA 4FTGA 1F70A 1LVCD 3I5IB 5KU1A 2KQ6A 5PALA 2LP3A 3ICBA 4ZCVA 2K7CA 1AUIB 3MSEB 4GBAA 1CFCA 5K89A 4WRIA 3FWCA 4MLWA 3BYAA 5HKYA 2CBLA 4GNKB 2ZNEA 4DCKA 4PCWA 1KK7Y 2QPTA 2F2PA 5AXIA 1F71A 5JJGA 1HQVA 4PE7A 1B8RA 4AOMA 1LINA 4MZJA 5G08A 1W7IB 3DF0B 1YX7A 1RECA 1NYAA 3WHTB 2WNDA 1DGVA 3A4UB 1WRLA 3BXKA 1CTRA 3DVKA 4L9MA 3TS5C 1AJ4A 1SL9A 1DF0B 1S3PA 5KSZA 3OB2B 4MEWA 5AEQA 1G8IA 2ZRSA 3AAJA 2LCPA 1CFFA 1TCOB 2L0PA 4I5NB 1QXPA 3HX4A 3D0YB 1K9UA 2JNFA 2QACA 2OTGB 1KQVA 2HQWA 4I5LB 1M46A 4FQOA 3O6BA 4USLA 4XJKB 1B1GA 1MR8A 3EK4A 1EH2A 1JWDA 1KSMA 2KFGA 1IH0A 2JQ6A 1C07A 1J7PA 1DJGA 1GGZA 1WLMA 3CR4X 3VROA 1B9AA 2K7BA 2KGBC 4PE1A 1PSBA 3SG7A 3JTDB 2PVBA 3KPXA 4MSPA 3OHMB 1XFYO 3O78A 3NSKA 4M2QA 2LVIA 4HRGA 2K8MB 1AK8A 1DJWA 4GUKA 1EG4A 3VRRA 2KOTA 3IQQA 1ODBA 1K9PA 1KQMC 4WQ3A 4MZLA 2Y1NA 1TNWA 2KHNA 3PSRA 4A4CA 3LK0A 1NX3A 2M7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O60 A;  3BUN B;  1L7Z A;  1SL8 A;  4AQI A;  1DVI A;  1N0Y A;  1F4O A;  1MUX A;  1TIZ A;  1MXE A;  3NSL A;  1N2D A;  1SK6 D;  5GQQ C;  3PAT A;  1QX5 B;  1DGU A;  2NCP A;  1K93 D;  2Y5I A;  1CDN A;  2WOS A;  4PHN A;  4E68 A;  2JPT A;  4U8D A;  1BR4 B;  3FIA A;  2MHH A;  2BBM A;  3SIB A;  1F4Q A;  3IQO A;  1J7Q A;  2KBI A;  1XFX O;  2M1U A;  4M2O A;  3SG3 A;  5CPV A;  1KK7 Z;  1Y1X A;  3VRN A;  1CMG A;  1TCF A;  2LLU A;  1DJH A;  2M49 B;  1HT9 A;  1PVA A;  2L51 A;  3SG5 A;  3TS5 B;  2LVK A;  2L2E A;  2L4I A;  1XYD A;  5IBW A;  2KBM A;  2V53 A;  3EVV A;  5CSF A;  1OQP A;  4UPG A;  1TNX A;  4PHM A;  3BQ3 A;  2I94 A;  1YUT A;  2KI6 D;  2LVJ A;  3VRP A;  2WCE A;  1LA3 A;  1KFX S;  1F55 A;  2SCP A;  1DF0 A;  4ETO A;  1BU3 A;  1DJZ A;  1U5I B;  4YGE B;  4ORB B;  4NQG A;  1QLS A;  4QJ4 B;  1L2O C;  2LV7 A;  1N65 A;  2FCD A;  4XJK A;  3BOW A;  4XYN A;  1SR6 C;  4PE4 A;  2LUC A;  1KFU L;  5AER A;  5HKZ A;  2BE6 A;  1PK0 D;  2CXJ A;  2HPS A;  2PSR A;  2E30 A;  2LVV A;  2L4H A;  1DT7 B;  1KWO C;  3GK2 A;  1IKU A;  3PN7 C;  1KQM B;  1SNL A;  1TRF A;  1C7V A;  3ZNI A;  5HKW A;  3NSO A;  4NDB A;  3FWB A;  1MWN A;  1XFV O;  1Q80 A;  4MN0 A;  3DVJ A;  3SG6 A;  2JXL A;  3M0W A;  4OV2 A;  5JOL A;  1DJY A;  1LXF C;  1WDC C;  1B7T Y;  1M39 A;  1M31 A;  3NXA A;  1UUS A;  2LC5 A;  1ZUZ A;  4F0Z B;  1J55 A;  1JFK A;  2KNE A;  1IJ6 A;  4WQ2 A;  4CFQ A;  1SW8 A;  2LUX A;  1CMF A;  2F2O A;  2KSP A;  3CR5 X;  2F3Y A;  3JVT C;  1FI5 A;  1NPQ A;  2MJW B;  3BUM B;  1IQ5 A;  1CFD A;  2DOQ A;  2PRU A;  2Y1M A;  3OP0 A;  1XK4 C;  3QRX A;  1UHN A;  1V1F A;  3KO0 A;  1QVI Y;  4M2P A;  1A2X A;  1EG3 A;  1NUB A;  1NCZ A;  5DKN A;  1IGV A;  4OVN F;  4GAO A;  4NDC A;  1ALV A;  3SIA A;  3FS7 A;  2CCM A;  1LA0 A;  5I2O A;  1QX7 A;  1NWD A;  1XK4 A;  1JUO A;  2KAX A;  1S5G Z;  1QAS A;  3CTN A;  2CTN A;  2R2I A;  3PLF B;  1WLZ A;  3F45 A;  3BOW B;  2JRF A;  3GK1 A;  2M1K B;  4MVF A;  2AAO A;  5ER5 A;  2OS8 C;  2ZFD A;  2G9B A;  2MLF C;  5DKQ A;  3EKJ A;  1JFJ A;  4I5J A;  1SCM C;  3OB1 B;  2JWW A;  1FF1 A;  2NLN A;  1SR6 B;  1JBA A;  1OZO A;  2BCA A;  4DRW A;  2PAL A;  1U5I A;  2MA2 A;  1FBV A;  4ICB A;  1M63 B;  3IF7 A;  5KTY A;  1YR5 A;  1JSA A;  2M7N A;  2KFF A;  1KWO B;  2SAS A;  1J1D A;  1R2U A;  3PN7 B;  3I5F C;  1S6J A;  2KYF A;  4BY4 A;  1GGW A;  1NX0 A;  4C0J A;  2ZN9 A;  4JWQ A;  4MRX A;  4YGA A;  3K21 A;  1SRA A;  1M45 A;  4GFT A;  1QIW A;  1WDC B;  2AUC A;  1SYM A;  1JF2 A;  1XO5 A;  2H61 C;  2I2R E;  4OKH A;  1G33 A;  1OOJ A;  4Q04 A;  1YUU A;  5AAN A;  4HRH A;  3TDU A;  4YI9 A;  3CS1 A;  3I5H C;  1B7T Z;  2KQY A;  3EKH A;  1NSH A;  1TN4 A;  1YUR A;  3TDI A;  2KDH A;  2M29 A;  2F3Z A;  1CDL A;  2PAS A;  3JVT B;  1C7W A;  2MLE C;  2NXQ A;  3D10 A;  2WOR A;  1YVH A;  2EHB A;  2L50 A;  3SG2 A;  3CGA A;  3EK7 A;  1CM1 A;  2M3W A;  3GOF A;  1S5G Y;  1RRO A;  1S36 A;  3NSI A;  4CID A;  1XFU O;  2KI6 C;  3PFV A;  1S26 D;  2D8N A;  1VRK A;  2M0R A;  4PAL A;  2WCB A;  5BPJ A;  1QVI Z;  4A4B A;  1K90 D;  1QX2 A;  3AKB A;  3TZ1 A;  1UHI A;  1SPY A;  3DVE A;  4C0L A;  4D1E A;  1RWY A;  4ORC B;  1CKK A;  2OPO A;  1MXL C;  2JUL A;  2LMU A;  4P5O E;  2KAY A;  1NCX A;  1EJ3 A;  1YRU B;  1TTX A;  2JTZ A;  4CFR A;  2JZI A;  3EK8 A;  3TDZ A;  2LAP A;  2EC6 C;  3KHE A;  2LMV A;  2OS8 B;  4OCI A;  1UWO A;  1K8U A;  1RJV A;  1WRK A;  1PRW A;  2I7A A;  3DD4 A;  1SCM B;  2LMT A;  2Q91 A;  4MZK A;  5D69 A;  4YRU A;  2O5G A;  1AVS A;  2KAV A;  1IRJ A;  4CLN A;  2F33 A;  4IL1 A;  4I5K A;  1X02 A;  3PAL A;  4PDZ A;  4CPV A;  2JOJ A;  1GQM A;  1OE9 B;  3BUO B;  1CLB A;  3LLE A;  1UHK A;  2HQ8 A;  2I18 A;  4ORA B;  3O4Y A;  1ZOT B;  3I5F B;  4QJ3 B;  1XFW O;  1OMV A;  4DIR A;  1UP5 A;  1KFU S;  2GGZ A;  2LLT A;  1EXR A;  1CFP A;  1KSO A;  2BBN A;  3OX5 A;  1QIV A;  1OMR A;  1BOC A;  3BUW B;  2MRD A;  1LKJ A;  1IG5 A;  1QJT A;  1QV0 A;  1AP4 A;  2JXC A;  3ZWH A;  2JU0 A;  1K94 A;  2RGI A;  1S1E A;  2BCX A;  1OZS A;  2Y4Q A;  3I5H B;  2F8P A;  2ZND A;  2K2F A;  1J1E A;  2ZN8 A;  1H4B A;  1WRZ A;  2KI4 C;  4P2Y B;  1TOP A;  1IJ5 A;  2GV5 A;  1QTX A;  3EVR A;  2P6B B;  1FW4 A;  2JT8 A;  2A4J A;  1NX2 A;  3LCP C;  1CM4 A;  2G2B A;  2HET A;  1QLK A;  2IS9 A;  4JQ0 D;  5ER4 X;  5HLO A;  1KCY A;  1R6P A;  2EGD A;  2CNP A;  2M9G A;  4YGB B;  5I2Q A;  1ZAC A;  1DMO A;  2LM5 A;  2VRG A;  1WY9 A;  4MRY A;  2FCE A;  2KYC A;  1BOD A;  1S6I A;  2Q4U A;  1F54 A;  1JF0 A;  2EC6 B;  4JPZ B;  3WHU B;  2K0J A;  3A8R A;  5DKR A;  1YX8 A;  3WXA A;  1Y1U A;  1K95 A;  1YRT B;  2JT3 A;  1L2O B;  2KGR A;  2MAZ A;  4MBE A;  1ALW A;  5CSJ A;  3SG4 A;  3C1V A;  3CR2 A;  1CLL A;  1UHJ A;  1YUS A;  4HRE E;  1OSA A;  1K96 A;  1Y0V H;  3I5G C;  1D1O A;  2K2A A;  1B47 A;  1QV1 A;  2TN4 A;  2B1U A;  1MQ1 A;  3DVM A;  4AQJ A;  3VGO A;  1DJI A;  4PHJ A;  3CLN A;  1PSR A;  2LNK A;  2E6W A;  1KK8 C;  1W7J B;  1BR1 B;  1RFJ A;  4PE0 A;  1XVJ A;  4HSZ A;  4ZCU A;  1FPW A;  5D7F A;  4N1F A;  2BEC A;  2LE9 B;  3RM1 A;  2H2K A;  2AMI A;  3LL8 B;  1MHO A;  1MF8 B;  2JC2 A;  1SMG A;  4GGF C;  2BCB A;  2HF5 A;  3OX6 A;  2ISD A;  2NZ0 A;  3TUY C;  1NCY A;  2PMY A;  1DJX A;  4YBH B;  5HLV A;  2H61 A;  1SBJ A;  1B8L A;  1Y1A A;  1TNP A;  2MBX A;  1F8H A;  1XA5 A;  1S6C A;  2NCO A;  2M97 A;  3CWG A;  1Y6W A;  4GGF A;  1BG1 A;  2KI4 B;  1V1G A;  2BL0 C;  3RLZ A;  1CLM A;  5F6T A;  2WCF A;  5TNC A;  3I5I C;  1GJY A;  2L98 A;  3CZT X;  2ZKM X;  2JNX A;  1TNQ A;  2LAN A;  1YTZ C;  1CDP A;  5CSN A;  1IWQ A;  1A75 A;  1SL7 A;  5HYD A;  1B4C A;  4PHK A;  1AHR A;  1NX1 A;  1BLQ A;  2ZRT A;  3VRQ A;  4YI8 A;  1BT6 A;  4C0K A;  1K9K A;  2LP2 A;  2JTT A;  1BF5 A;  5AFP A;  2K61 A;  1SKT A;  3E3R A;  1QS7 A;  1SCV A;  1PVB A;  1OMD A;  1UHH A;  2GGM A;  3GK4 X;  1BJF A;  4R1E A;  1KFX L;  3O2P A;  1JC2 A;  1XFZ O;  1RTP 1;  3KEV A;  5CSI A;  1SY9 A;  3AKA A;  2COL B;  1E8A A;  5B8I B;  1G4Y R;  1A4P A;  2WC8 A;  3BUX B;  1RK9 A;  4GGN A;  1PUL A;  3DF0 A;  5I2L A;  3I5G B;  2BKI B;  5I8N A;  2CT9 A;  2K7O A;  4N1G A;  1EL4 A;  4GPL B;  1J7O A;  2OTG C;  1IQ3 A;  1BMO A;  2K7D A;  1CNP A;  2KFH A;  3SJS A;  4YGD B;  3AAK A;  1NIW A;  3HCM A;  1KK8 B;  1FI6 A;  3D0Y A;  1CDM A;  2BE4 A;  1NP8 A;  1DTL A;  2M8U A;  3H4S E;  3JTD C;  4TNC A;  4BY5 A;  1A03 A;  1ZMZ A;  1CB1 A;  2LLS A;  4OR9 B;  1UUR A;  1A29 A;  3PM8 A;  2FJU B;  2FOT A;  1YVL A;  1B8C A;  2LHL A;  3TUY B;  2L5X B;  4DS7 A;  5J3X A;  1AJ5 A;  3EVU A;  5FYX A;  2BKH B;  1H8B A;  3LK1 A;  4N5X A;  2JT0 A;  4YGC B;  1J7R A;  1PAL A;  2LHI A;  4QJ5 B;  1K2H A;  1QAT A;  4NDD A;  1ZFS A;  3WNX B;  1A75 B;  3KF9 A;  2BL0 B;  4DUQ A;  4FTG A;  1F70 A;  1LVC D;  3I5I B;  5KU1 A;  2KQ6 A;  5PAL A;  2LP3 A;  3ICB A;  4ZCV A;  2K7C A;  1AUI B;  3MSE B;  4GBA A;  1CFC A;  5K89 A;  4WRI A;  3FWC A;  4MLW A;  3BYA A;  5HKY A;  2CBL A;  4GNK B;  2ZNE A;  4DCK A;  4PCW A;  1KK7 Y;  2QPT A;  2F2P A;  5AXI A;  1F71 A;  5JJG A;  1HQV A;  4PE7 A;  1B8R A;  4AOM A;  1LIN A;  4MZJ A;  5G08 A;  1W7I B;  3DF0 B;  1YX7 A;  1REC A;  1NYA A;  3WHT B;  2WND A;  1DGV A;  3A4U B;  1WRL A;  3BXK A;  1CTR A;  3DVK A;  4L9M A;  3TS5 C;  1AJ4 A;  1SL9 A;  1DF0 B;  1S3P A;  5KSZ A;  3OB2 B;  4MEW A;  5AEQ A;  1G8I A;  2ZRS A;  3AAJ A;  2LCP A;  1CFF A;  1TCO B;  2L0P A;  4I5N B;  1QXP A;  3HX4 A;  3D0Y B;  1K9U A;  2JNF A;  2QAC A;  2OTG B;  1KQV A;  2HQW A;  4I5L B;  1M46 A;  4FQO A;  3O6B A;  4USL A;  4XJK B;  1B1G A;  1MR8 A;  3EK4 A;  1EH2 A;  1JWD A;  1KSM A;  2KFG A;  1IH0 A;  2JQ6 A;  1C07 A;  1J7P A;  1DJG A;  1GGZ A;  1WLM A;  3CR4 X;  3VRO A;  1B9A A;  2K7B A;  2KGB C;  4PE1 A;  1PSB A;  3SG7 A;  3JTD B;  2PVB A;  3KPX A;  4MSP A;  3OHM B;  1XFY O;  3O78 A;  3NSK A;  4M2Q A;  2LVI A;  4HRG A;  2K8M B;  1AK8 A;  1DJW A;  4GUK A;  1EG4 A;  3VRR A;  2KOT A;  3IQQ A;  1ODB A;  1K9P A;  1KQM C;  4WQ3 A;  4MZL A;  2Y1N A;  1TNW A;  2KHN A;  3PSR A;  4A4C A;  3LK0 A;  1NX3 A;  2M7L A; 
#chains in the Genus database with same CATH topology
 2O60 A;  3BUN B;  1L7Z A;  1SL8 A;  4AQI A;  1DVI A;  1N0Y A;  3NHT A;  1F4O A;  1MUX A;  1TIZ A;  1MXE A;  2QEB A;  3NSL A;  1N2D A;  1SK6 D;  5GQQ C;  3PAT A;  2QEH A;  1QX5 B;  1DGU A;  2NCP A;  1K93 D;  2Y5I A;  3L4L A;  3IVT A;  1CDN A;  2WOS A;  4IJ7 A;  4PHN A;  4E68 A;  2JPT A;  4U8D A;  1BR4 B;  3FE6 A;  2MHH A;  2BBM A;  3FIA A;  3SIB A;  1F4Q A;  3IQO A;  1J7Q A;  2KBI A;  1XFX O;  2M1U A;  2P70 A;  4M2O A;  5CPV A;  1KK7 Z;  1Y1X A;  3SG3 A;  2KPH A;  1TCF A;  2LLU A;  1DJH A;  2M49 B;  1HT9 A;  1PVA A;  2L51 A;  3SG5 A;  3TS5 B;  2LVK A;  2L2E A;  2L4I A;  1XYD A;  5IBW A;  2KBM A;  2V53 A;  3EVV A;  3R72 A;  5CSF A;  1OQP A;  4UPG A;  1TNX A;  4PHM A;  1Z4H A;  3BQ3 A;  1TUZ A;  2I94 A;  1YUT A;  2KI6 D;  2LVJ A;  3VRP A;  2WCE A;  1LA3 A;  1KFX S;  1F55 A;  2SCP A;  1DF0 A;  3UNW A;  3V2L A;  2L5Y A;  4ETO A;  1BU3 A;  1DJZ A;  1U5I B;  4YGE B;  4ORB B;  1DC1 A;  4NQG A;  1QLS A;  4QJ4 B;  4INX A;  1L2O C;  2LV7 A;  1N65 A;  2FCD A;  4XJK A;  3BOW A;  4XYN A;  1SR6 C;  4PE4 A;  2LUC A;  5DIC A;  1KFU L;  3DXL A;  3DY9 A;  5HKZ A;  5AER A;  2BE6 A;  5D3O A;  1PK0 D;  1C3Z A;  2CXJ A;  2HPS A;  2PSR A;  2E30 A;  2LVV A;  2L4H A;  1DT7 B;  1KWO C;  3GK2 A;  2WCM A;  1IKU A;  3PN7 C;  1KQM B;  1SNL A;  1QWV A;  1TRF A;  3O4X A;  1C7V A;  3ZNI A;  5HKW A;  3NSO A;  4NDB A;  3S0F A;  3FWB A;  1MWN A;  1XFV O;  1Q80 A;  4MN0 A;  3DVJ A;  3SG6 A;  2JXL A;  3M0W A;  4OV2 A;  5JOL A;  1DJY A;  1LXF C;  1WDC C;  1B7T Y;  1M39 A;  1M31 A;  3NXA A;  1UUS A;  2LC5 A;  2FJY A;  1ZUZ A;  3R1O A;  4F0Z B;  1J55 A;  1JFK A;  2KNE A;  5FI2 A;  4JKT A;  1IJ6 A;  4WQ2 A;  4CFQ A;  1SW8 A;  2LUX A;  1CMF A;  2F2O A;  2KSP A;  3CR5 X;  2F3Y A;  3JVT C;  2PYQ A;  1FI5 A;  1NPQ A;  2MJW B;  3BUM B;  1IQ5 A;  1CFD A;  2DOQ A;  2PRU A;  2Y1M A;  3OP0 A;  1XK4 C;  3QRX A;  1UHN A;  1V1F A;  3KO0 A;  1QVI Y;  2WCH A;  1A2X A;  1EG3 A;  1NUB A;  1NCZ A;  3B88 A;  5DKN A;  1IGV A;  4OVN F;  4GAO A;  4KYN A;  1ALV A;  4NDC A;  3FS7 A;  2CCM A;  1LA0 A;  3SIA A;  1QX7 A;  1NWD A;  5I2O A;  1XFR A;  1SSE B;  1XK4 A;  2YGU A;  1JUO A;  2KAX A;  1S5G Z;  1QAS A;  3CTN A;  2CTN A;  2R2I A;  3PLF B;  3B7A A;  1WLZ A;  3D78 A;  3F45 A;  3BOW B;  2JRF A;  3GK1 A;  2M1K B;  4MVF A;  2AAO A;  5ER5 A;  2OS8 C;  3K1E A;  2ZFD A;  2G9B A;  2MLF C;  2WCL A;  5DKQ A;  2GTE A;  3EKJ A;  3FE8 A;  1JFJ A;  4I5J A;  1SCM C;  3OB1 B;  3FE9 A;  2JWW A;  1FF1 A;  2NLN A;  3CDN A;  3EG5 B;  1SR6 B;  1JBA A;  1OZO A;  2BCA A;  4DRW A;  2PAL A;  1U5I A;  2QDI A;  2MA2 A;  3UO9 A;  1FBV A;  4ICB A;  1M63 B;  3IF7 A;  5KTY A;  1YR5 A;  2BAP A;  1JSA A;  3B87 A;  2M7N A;  2KFF A;  1KWO B;  2SAS A;  1J1D A;  1R2U A;  3PN7 B;  3I5F C;  1S6J A;  2KYF A;  3SS5 A;  4BY4 A;  1GGW A;  1NX0 A;  4C0J A;  2ZN9 A;  4JWQ A;  4MRX A;  4YGA A;  3K21 A;  3DYE A;  4FQT A;  1SRA A;  1M45 A;  4GFT A;  1QIW A;  1WDC B;  2AUC A;  1SYM A;  1JF2 A;  1XO5 A;  2H61 C;  2I2R E;  1DEK A;  4OKH A;  4PT1 A;  1G33 A;  1OOJ A;  4Q04 A;  1YUU A;  5AAN A;  4HRH A;  3TDU A;  3CZ1 A;  4YI9 A;  3CS1 A;  2QEO A;  3I5H C;  1B7T Z;  2KQY A;  3EKH A;  1NSH A;  1TN4 A;  1YUR A;  3TDI A;  2KDH A;  2M29 A;  2JPO A;  2F3Z A;  1CDL A;  2PAS A;  3JVT B;  1C7W A;  2MLE C;  2NXQ A;  1DEL A;  2WOR A;  3D10 A;  1YVH A;  2EHB A;  2L50 A;  3SG2 A;  3R1P A;  3CGA A;  3EK7 A;  1CM1 A;  2M3W A;  3GOF A;  1S5G Y;  1RRO A;  3BFA A;  1S36 A;  3NSI A;  4CID A;  1XFU O;  2KI6 C;  3PFV A;  1S26 D;  2D8N A;  1VRK A;  2M0R A;  4PAL A;  3B86 A;  2WCB A;  3VRN A;  5BPJ A;  1QVI Z;  1ORG A;  4A4B A;  1K90 D;  1QX2 A;  3AKB A;  3TZ1 A;  1UHI A;  1SPY A;  3DVE A;  4C0L A;  4D1E A;  1RWY A;  4ORC B;  1CKK A;  2OPO A;  1MXL C;  2JUL A;  2LMU A;  4P5O E;  2KAY A;  1NCX A;  1EJ3 A;  1YRU B;  2K60 A;  1TTX A;  2JTZ A;  4CFR A;  2JZI A;  3EK8 A;  3TDZ A;  2LAP A;  2EC6 C;  3KHE A;  2LMV A;  2OS8 B;  4OCI A;  1UWO A;  1K8U A;  1RJV A;  1WRK A;  1PRW A;  2I7A A;  3RZS A;  3DD4 A;  1SCM B;  2LMT A;  2Q91 A;  4MZK A;  5D69 A;  4YRU A;  2O5G A;  1AVS A;  2KAV A;  1IRJ A;  3B6X A;  4CLN A;  2F33 A;  3S0G A;  4IL1 A;  4I5K A;  1X02 A;  3PAL A;  4PDZ A;  4CPV A;  2JOJ A;  1GQM A;  1OE9 B;  3BUO B;  1CLB A;  3SS4 A;  3LLE A;  1T14 A;  3S0D A;  1UHK A;  2HQ8 A;  2I18 A;  1OOI X;  3O4Y A;  1ZOT B;  3I5F B;  4ORA B;  2WC5 A;  1XFW O;  4QJ3 B;  1OMV A;  4DIR A;  1UP5 A;  1KFU S;  1OOG A;  2GGZ A;  2LLT A;  1EXR A;  1CFP A;  1KSO A;  2BBN A;  3OX5 A;  5FI6 A;  1QIV A;  1OMR A;  1BOC A;  3BUW B;  2MRD A;  1TWO A;  1LKJ A;  3CYZ A;  1GM0 A;  1IG5 A;  1QJT A;  1QV0 A;  4INW A;  3Q8I A;  2JXC A;  1AP4 A;  3ZWH A;  3L4A A;  2JU0 A;  1K94 A;  3VB1 A;  2RGI A;  1S1E A;  2BCX A;  1OZS A;  2Y4Q A;  3I5H B;  2F8P A;  5FI7 A;  2ZND A;  2K2F A;  2BNX A;  1J1E A;  2QEV A;  2ZN8 A;  1H4B A;  1WRZ A;  3DZT A;  2KI4 C;  3OBV A;  2ERB A;  4P2Y B;  1TOP A;  1IJ5 A;  2GV5 A;  1QTX A;  3EVR A;  2P6B B;  1FW4 A;  2JT8 A;  2A4J A;  1NX2 A;  3LCP C;  1CM4 A;  2G2B A;  2HET A;  2WCJ A;  1QLK A;  2IS9 A;  4JQ0 D;  5ER4 X;  5HLO A;  1KCY A;  1R6P A;  2EGD A;  2CNP A;  2M9G A;  4YGB B;  5I2Q A;  1ZAC A;  1DMO A;  2LM5 A;  2VRG A;  1WY9 A;  4MRY A;  2FCE A;  2KYC A;  1BOD A;  1S6I A;  2Q4U A;  1F54 A;  1JF0 A;  2EC6 B;  4JPZ B;  3WHU B;  2K0J A;  3A8R A;  5DKR A;  1YX8 A;  3WXA A;  1Y1U A;  1K95 A;  1YRT B;  2JT3 A;  1L2O B;  2KGR A;  2MAZ A;  4MBE A;  1ALW A;  5CSJ A;  3SG4 A;  3C1V A;  3CR2 A;  1CLL A;  1UHJ A;  1YUS A;  4HRE E;  1OSA A;  1K96 A;  1Y0V H;  3I5G C;  1D1O A;  2K2A A;  1B47 A;  1QV1 A;  2TN4 A;  2B1U A;  1MQ1 A;  3DVM A;  4AQJ A;  3VGO A;  1DJI A;  4PHJ A;  3CLN A;  1PSR A;  3PM2 A;  2LNK A;  2E6W A;  1KK8 C;  1W7J B;  1BR1 B;  1RFJ A;  1TUJ A;  4PE0 A;  1XVJ A;  4HSZ A;  4ZCU A;  1FPW A;  3OGN A;  3BFH A;  5D7F A;  4N1F A;  2BEC A;  2LE9 B;  3RM1 A;  2H2K A;  2AMI A;  3LL8 B;  1OOF A;  1MHO A;  1MF8 B;  2JC2 A;  1SMG A;  4GGF C;  2BCB A;  2HF5 A;  3OX6 A;  3D75 A;  2ISD A;  2NZ0 A;  3S0B A;  1NCY A;  2PMY A;  1DJX A;  3TUY C;  3D76 A;  4YBH B;  5HLV A;  2H61 A;  1SBJ A;  1B8L A;  1Y1A A;  1TNP A;  2KLE A;  2MBX A;  1F8H A;  1XA5 A;  1S6C A;  2NCO A;  2M97 A;  3CWG A;  1Y6W A;  4GGF A;  1BG1 A;  2KI4 B;  5EL2 A;  1V1G A;  2BL0 C;  3RLZ A;  1CLM A;  5F6T A;  2WC6 A;  4M2P A;  2WCF A;  5TNC A;  3D74 A;  3I5I C;  1GJY A;  2L98 A;  3CZT X;  3D77 A;  2ZKM X;  2JNX A;  1TNQ A;  2LAN A;  1YTZ C;  2KLD A;  1CDP A;  5CSN A;  1W9Z A;  1IWQ A;  1A75 A;  3CAB A;  1SL7 A;  5HYD A;  1B4C A;  4PHK A;  1AHR A;  1NX1 A;  1BLQ A;  2ZRT A;  4JD9 A;  3VRQ A;  3NHI A;  1BT6 A;  4YI8 A;  3S0E A;  1K9K A;  4C0K A;  2LP2 A;  2JTT A;  1BF5 A;  5AFP A;  2K61 A;  1SKT A;  3E3R A;  1QS7 A;  1LS8 A;  1SCV A;  1PVB A;  1OMD A;  1UHH A;  2GGM A;  3BJH A;  3GK4 X;  1BJF A;  4R1E A;  1KFX L;  3O2P A;  1C3Y A;  1JC2 A;  1XFZ O;  1RTP 1;  3KEV A;  5CSI A;  1SY9 A;  3AKA A;  2COL B;  1E8A A;  5B8I B;  1G4Y R;  1A4P A;  2WC8 A;  3BUX B;  1RK9 A;  4GGN A;  1PUL A;  3DF0 A;  5I2L A;  3I5G B;  2BKI B;  5I8N A;  2CT9 A;  2K7O A;  4N1G A;  1EL4 A;  5HL1 A;  4GPL B;  1J7O A;  2OTG C;  1IQ3 A;  1BMO A;  2K7D A;  1CNP A;  2KFH A;  3SJS A;  4YGD B;  3S0A A;  3AAK A;  1NIW A;  3HCM A;  1KK8 B;  4OZD A;  3N7H A;  3D0Y A;  1CDM A;  1FI6 A;  2BE4 A;  1P28 A;  1NP8 A;  1DTL A;  2M8U A;  3H4S E;  3JTD C;  4TNC A;  4BY5 A;  1A03 A;  1ZMZ A;  1CB1 A;  2LLS A;  4OR9 B;  1UUR A;  1A29 A;  3PM8 A;  2FJU B;  2FOT A;  1YVL A;  1Z2C B;  1B8C A;  2PQL A;  2LHL A;  3TUY B;  2L5X B;  4DS7 A;  1CMG A;  5J3X A;  1AJ5 A;  3D73 A;  3EVU A;  5FYX A;  2BKH B;  3SS3 A;  1H8B A;  3LK1 A;  3BFB A;  4N5X A;  2JT0 A;  4YGC B;  1J7R A;  1PAL A;  2LHI A;  4QJ5 B;  1K2H A;  1QAT A;  4NDD A;  1ZFS A;  3WNX B;  1A75 B;  3L47 A;  3KF9 A;  2BL0 B;  3QME A;  4DUQ A;  4FTG A;  1F70 A;  1LVC D;  3I5I B;  5KU1 A;  2KQ6 A;  5PAL A;  2LP3 A;  3ICB A;  4ZCV A;  2K7C A;  1AUI B;  3MSE B;  4GBA A;  1CFC A;  5K89 A;  4WRI A;  1OW4 A;  3FWC A;  4MLW A;  3BYA A;  5HKY A;  2CBL A;  4GNK B;  1IIO A;  2ZNE A;  4DCK A;  4PCW A;  1KK7 Y;  2QPT A;  2F2P A;  5AXI A;  1F71 A;  5JJG A;  1HQV A;  4PE7 A;  1B8R A;  4AOM A;  2H8V A;  1LIN A;  4MZJ A;  5G08 A;  1W7I B;  3DF0 B;  1YX7 A;  1REC A;  1NYA A;  3WHT B;  2WND A;  1DGV A;  3A4U B;  1WRL A;  3BXK A;  1CTR A;  3DVK A;  4L9M A;  3TS5 C;  1AJ4 A;  3CZ0 A;  3PJI A;  1SL9 A;  1DF0 B;  1OOH A;  1S3P A;  5KSZ A;  1DQE A;  3OB2 B;  4MEW A;  5AEQ A;  1G8I A;  2ZRS A;  3AAJ A;  2LCP A;  4F7F A;  1CFF A;  1TCO B;  2L0P A;  4I5N B;  1QXP A;  3HX4 A;  3D0Y B;  1K9U A;  2JNF A;  2QAC A;  2OTG B;  1KQV A;  2HQW A;  2P71 A;  4I5L B;  1M46 A;  4FQO A;  3O6B A;  4USL A;  4XJK B;  2WCK A;  1B1G A;  1MR8 A;  3EK4 A;  1EH2 A;  1JWD A;  3NGV A;  1KSM A;  2KFG A;  1IH0 A;  2JQ6 A;  1C07 A;  1J7P A;  1DJG A;  1GGZ A;  1WLM A;  3CR4 X;  3VRO A;  1B9A A;  2K7B A;  2KGB C;  4PE1 A;  5I94 A;  1PSB A;  3SG7 A;  3JTD B;  2PVB A;  3KPX A;  4MSP A;  3OHM B;  1XFY O;  3O78 A;  3NSK A;  4M2Q A;  2LVI A;  4HRG A;  2K8M B;  1AK8 A;  1DJW A;  4GUK A;  1EG4 A;  3VRR A;  2KOT A;  2L2C A;  3CZ2 A;  1ODB A;  3IQQ A;  3R1V A;  1K9P A;  1KQM C;  4WQ3 A;  4MZL A;  2Y1N A;  1TNW A;  2KHN A;  3PSR A;  4A4C A;  3LK0 A;  1NX3 A;  2M7L A; 
#chains in the Genus database with same CATH homology
 2O60 A;  3BUN B;  1L7Z A;  1SL8 A;  4AQI A;  1DVI A;  1N0Y A;  1F4O A;  1MUX A;  1TIZ A;  1MXE A;  3NSL A;  1N2D A;  1SK6 D;  5GQQ C;  3PAT A;  1QX5 B;  1DGU A;  2NCP A;  1K93 D;  2Y5I A;  1CDN A;  2WOS A;  4PHN A;  4E68 A;  2JPT A;  4U8D A;  1BR4 B;  3FIA A;  2MHH A;  2BBM A;  3SIB A;  1F4Q A;  3IQO A;  1J7Q A;  2KBI A;  1XFX O;  2M1U A;  4M2O A;  3SG3 A;  5CPV A;  1KK7 Z;  1Y1X A;  3VRN A;  1CMG A;  1TCF A;  2LLU A;  1DJH A;  2M49 B;  1HT9 A;  1PVA A;  2L51 A;  3SG5 A;  3TS5 B;  2LVK A;  2L2E A;  2L4I A;  1XYD A;  5IBW A;  2KBM A;  2V53 A;  3EVV A;  5CSF A;  1OQP A;  4UPG A;  1TNX A;  4PHM A;  3BQ3 A;  2I94 A;  1YUT A;  2KI6 D;  2LVJ A;  3VRP A;  2WCE A;  1LA3 A;  1KFX S;  1F55 A;  2SCP A;  1DF0 A;  4ETO A;  1BU3 A;  1DJZ A;  1U5I B;  4YGE B;  4ORB B;  4NQG A;  1QLS A;  4QJ4 B;  1L2O C;  2LV7 A;  1N65 A;  2FCD A;  4XJK A;  3BOW A;  4XYN A;  1SR6 C;  4PE4 A;  2LUC A;  1KFU L;  5AER A;  5HKZ A;  2BE6 A;  1PK0 D;  2CXJ A;  2HPS A;  2PSR A;  2E30 A;  2LVV A;  2L4H A;  1DT7 B;  1KWO C;  3GK2 A;  1IKU A;  3PN7 C;  1KQM B;  1SNL A;  1TRF A;  1C7V A;  3ZNI A;  5HKW A;  3NSO A;  4NDB A;  3FWB A;  1MWN A;  1XFV O;  1Q80 A;  4MN0 A;  3DVJ A;  3SG6 A;  2JXL A;  3M0W A;  4OV2 A;  5JOL A;  1DJY A;  1LXF C;  1WDC C;  1B7T Y;  1M39 A;  1M31 A;  3NXA A;  1UUS A;  2LC5 A;  1ZUZ A;  4F0Z B;  1J55 A;  1JFK A;  2KNE A;  1IJ6 A;  4WQ2 A;  4CFQ A;  1SW8 A;  2LUX A;  1CMF A;  2F2O A;  2KSP A;  3CR5 X;  2F3Y A;  3JVT C;  1FI5 A;  1NPQ A;  2MJW B;  3BUM B;  1IQ5 A;  1CFD A;  2DOQ A;  2PRU A;  2Y1M A;  3OP0 A;  1XK4 C;  3QRX A;  1UHN A;  1V1F A;  3KO0 A;  1QVI Y;  4M2P A;  1A2X A;  1EG3 A;  1NUB A;  1NCZ A;  5DKN A;  1IGV A;  4OVN F;  4GAO A;  4NDC A;  1ALV A;  3SIA A;  3FS7 A;  2CCM A;  1LA0 A;  5I2O A;  1QX7 A;  1NWD A;  1XK4 A;  1JUO A;  2KAX A;  1S5G Z;  1QAS A;  3CTN A;  2CTN A;  2R2I A;  3PLF B;  1WLZ A;  3F45 A;  3BOW B;  2JRF A;  3GK1 A;  2M1K B;  4MVF A;  2AAO A;  5ER5 A;  2OS8 C;  2ZFD A;  2G9B A;  2MLF C;  5DKQ A;  3EKJ A;  1JFJ A;  4I5J A;  1SCM C;  3OB1 B;  2JWW A;  1FF1 A;  2NLN A;  1SR6 B;  1JBA A;  1OZO A;  2BCA A;  4DRW A;  2PAL A;  1U5I A;  2MA2 A;  1FBV A;  4ICB A;  1M63 B;  3IF7 A;  5KTY A;  1YR5 A;  1JSA A;  2M7N A;  2KFF A;  1KWO B;  2SAS A;  1J1D A;  1R2U A;  3PN7 B;  3I5F C;  1S6J A;  2KYF A;  4BY4 A;  1GGW A;  1NX0 A;  4C0J A;  2ZN9 A;  4JWQ A;  4MRX A;  4YGA A;  3K21 A;  1SRA A;  1M45 A;  4GFT A;  1QIW A;  1WDC B;  2AUC A;  1SYM A;  1JF2 A;  1XO5 A;  2H61 C;  2I2R E;  4OKH A;  1G33 A;  1OOJ A;  4Q04 A;  1YUU A;  5AAN A;  4HRH A;  3TDU A;  4YI9 A;  3CS1 A;  3I5H C;  1B7T Z;  2KQY A;  3EKH A;  1NSH A;  1TN4 A;  1YUR A;  3TDI A;  2KDH A;  2M29 A;  2F3Z A;  1CDL A;  2PAS A;  3JVT B;  1C7W A;  2MLE C;  2NXQ A;  3D10 A;  2WOR A;  1YVH A;  2EHB A;  2L50 A;  3SG2 A;  3CGA A;  3EK7 A;  1CM1 A;  2M3W A;  3GOF A;  1S5G Y;  1RRO A;  1S36 A;  3NSI A;  4CID A;  1XFU O;  2KI6 C;  3PFV A;  1S26 D;  2D8N A;  1VRK A;  2M0R A;  4PAL A;  2WCB A;  5BPJ A;  1QVI Z;  4A4B A;  1K90 D;  1QX2 A;  3AKB A;  3TZ1 A;  1UHI A;  1SPY A;  3DVE A;  4C0L A;  4D1E A;  1RWY A;  4ORC B;  1CKK A;  2OPO A;  1MXL C;  2JUL A;  2LMU A;  4P5O E;  2KAY A;  1NCX A;  1EJ3 A;  1YRU B;  1TTX A;  2JTZ A;  4CFR A;  2JZI A;  3EK8 A;  3TDZ A;  2LAP A;  2EC6 C;  3KHE A;  2LMV A;  2OS8 B;  4OCI A;  1UWO A;  1K8U A;  1RJV A;  1WRK A;  1PRW A;  2I7A A;  3DD4 A;  1SCM B;  2LMT A;  2Q91 A;  4MZK A;  5D69 A;  4YRU A;  2O5G A;  1AVS A;  2KAV A;  1IRJ A;  4CLN A;  2F33 A;  4IL1 A;  4I5K A;  1X02 A;  3PAL A;  4PDZ A;  4CPV A;  2JOJ A;  1GQM A;  1OE9 B;  3BUO B;  1CLB A;  3LLE A;  1UHK A;  2HQ8 A;  2I18 A;  4ORA B;  3O4Y A;  1ZOT B;  3I5F B;  4QJ3 B;  1XFW O;  1OMV A;  4DIR A;  1UP5 A;  1KFU S;  2GGZ A;  2LLT A;  1EXR A;  1CFP A;  1KSO A;  2BBN A;  3OX5 A;  1QIV A;  1OMR A;  1BOC A;  3BUW B;  2MRD A;  1LKJ A;  1IG5 A;  1QJT A;  1QV0 A;  1AP4 A;  2JXC A;  3ZWH A;  2JU0 A;  1K94 A;  2RGI A;  1S1E A;  2BCX A;  1OZS A;  2Y4Q A;  3I5H B;  2F8P A;  2ZND A;  2K2F A;  1J1E A;  2ZN8 A;  1H4B A;  1WRZ A;  2KI4 C;  4P2Y B;  1TOP A;  1IJ5 A;  2GV5 A;  1QTX A;  3EVR A;  2P6B B;  1FW4 A;  2JT8 A;  2A4J A;  1NX2 A;  3LCP C;  1CM4 A;  2G2B A;  2HET A;  1QLK A;  2IS9 A;  4JQ0 D;  5ER4 X;  5HLO A;  1KCY A;  1R6P A;  2EGD A;  2CNP A;  2M9G A;  4YGB B;  5I2Q A;  1ZAC A;  1DMO A;  2LM5 A;  2VRG A;  1WY9 A;  4MRY A;  2FCE A;  2KYC A;  1BOD A;  1S6I A;  2Q4U A;  1F54 A;  1JF0 A;  2EC6 B;  4JPZ B;  3WHU B;  2K0J A;  3A8R A;  5DKR A;  1YX8 A;  3WXA A;  1Y1U A;  1K95 A;  1YRT B;  2JT3 A;  1L2O B;  2KGR A;  2MAZ A;  4MBE A;  1ALW A;  5CSJ A;  3SG4 A;  3C1V A;  3CR2 A;  1CLL A;  1UHJ A;  1YUS A;  4HRE E;  1OSA A;  1K96 A;  1Y0V H;  3I5G C;  1D1O A;  2K2A A;  1B47 A;  1QV1 A;  2TN4 A;  2B1U A;  1MQ1 A;  3DVM A;  4AQJ A;  3VGO A;  1DJI A;  4PHJ A;  3CLN A;  1PSR A;  2LNK A;  2E6W A;  1KK8 C;  1W7J B;  1BR1 B;  1RFJ A;  4PE0 A;  1XVJ A;  4HSZ A;  4ZCU A;  1FPW A;  5D7F A;  4N1F A;  2BEC A;  2LE9 B;  3RM1 A;  2H2K A;  2AMI A;  3LL8 B;  1MHO A;  1MF8 B;  2JC2 A;  1SMG A;  4GGF C;  2BCB A;  2HF5 A;  3OX6 A;  2ISD A;  2NZ0 A;  3TUY C;  1NCY A;  2PMY A;  1DJX A;  4YBH B;  5HLV A;  2H61 A;  1SBJ A;  1B8L A;  1Y1A A;  1TNP A;  2MBX A;  1F8H A;  1XA5 A;  1S6C A;  2NCO A;  2M97 A;  3CWG A;  1Y6W A;  4GGF A;  1BG1 A;  2KI4 B;  1V1G A;  2BL0 C;  3RLZ A;  1CLM A;  5F6T A;  2WCF A;  5TNC A;  3I5I C;  1GJY A;  2L98 A;  3CZT X;  2ZKM X;  2JNX A;  1TNQ A;  2LAN A;  1YTZ C;  1CDP A;  5CSN A;  1IWQ A;  1A75 A;  1SL7 A;  5HYD A;  1B4C A;  4PHK A;  1AHR A;  1NX1 A;  1BLQ A;  2ZRT A;  3VRQ A;  4YI8 A;  1BT6 A;  4C0K A;  1K9K A;  2LP2 A;  2JTT A;  1BF5 A;  5AFP A;  2K61 A;  1SKT A;  3E3R A;  1QS7 A;  1SCV A;  1PVB A;  1OMD A;  1UHH A;  2GGM A;  3GK4 X;  1BJF A;  4R1E A;  1KFX L;  3O2P A;  1JC2 A;  1XFZ O;  1RTP 1;  3KEV A;  5CSI A;  1SY9 A;  3AKA A;  2COL B;  1E8A A;  5B8I B;  1G4Y R;  1A4P A;  2WC8 A;  3BUX B;  1RK9 A;  4GGN A;  1PUL A;  3DF0 A;  5I2L A;  3I5G B;  2BKI B;  5I8N A;  2CT9 A;  2K7O A;  4N1G A;  1EL4 A;  4GPL B;  1J7O A;  2OTG C;  1IQ3 A;  1BMO A;  2K7D A;  1CNP A;  2KFH A;  3SJS A;  4YGD B;  3AAK A;  1NIW A;  3HCM A;  1KK8 B;  1FI6 A;  3D0Y A;  1CDM A;  2BE4 A;  1NP8 A;  1DTL A;  2M8U A;  3H4S E;  3JTD C;  4TNC A;  4BY5 A;  1A03 A;  1ZMZ A;  1CB1 A;  2LLS A;  4OR9 B;  1UUR A;  1A29 A;  3PM8 A;  2FJU B;  2FOT A;  1YVL A;  1B8C A;  2LHL A;  3TUY B;  2L5X B;  4DS7 A;  5J3X A;  1AJ5 A;  3EVU A;  5FYX A;  2BKH B;  1H8B A;  3LK1 A;  4N5X A;  2JT0 A;  4YGC B;  1J7R A;  1PAL A;  2LHI A;  4QJ5 B;  1K2H A;  1QAT A;  4NDD A;  1ZFS A;  3WNX B;  1A75 B;  3KF9 A;  2BL0 B;  4DUQ A;  4FTG A;  1F70 A;  1LVC D;  3I5I B;  5KU1 A;  2KQ6 A;  5PAL A;  2LP3 A;  3ICB A;  4ZCV A;  2K7C A;  1AUI B;  3MSE B;  4GBA A;  1CFC A;  5K89 A;  4WRI A;  3FWC A;  4MLW A;  3BYA A;  5HKY A;  2CBL A;  4GNK B;  2ZNE A;  4DCK A;  4PCW A;  1KK7 Y;  2QPT A;  2F2P A;  5AXI A;  1F71 A;  5JJG A;  1HQV A;  4PE7 A;  1B8R A;  4AOM A;  1LIN A;  4MZJ A;  5G08 A;  1W7I B;  3DF0 B;  1YX7 A;  1REC A;  1NYA A;  3WHT B;  2WND A;  1DGV A;  3A4U B;  1WRL A;  3BXK A;  1CTR A;  3DVK A;  4L9M A;  3TS5 C;  1AJ4 A;  1SL9 A;  1DF0 B;  1S3P A;  5KSZ A;  3OB2 B;  4MEW A;  5AEQ A;  1G8I A;  2ZRS A;  3AAJ A;  2LCP A;  1CFF A;  1TCO B;  2L0P A;  4I5N B;  1QXP A;  3HX4 A;  3D0Y B;  1K9U A;  2JNF A;  2QAC A;  2OTG B;  1KQV A;  2HQW A;  4I5L B;  1M46 A;  4FQO A;  3O6B A;  4USL A;  4XJK B;  1B1G A;  1MR8 A;  3EK4 A;  1EH2 A;  1JWD A;  1KSM A;  2KFG A;  1IH0 A;  2JQ6 A;  1C07 A;  1J7P A;  1DJG A;  1GGZ A;  1WLM A;  3CR4 X;  3VRO A;  1B9A A;  2K7B A;  2KGB C;  4PE1 A;  1PSB A;  3SG7 A;  3JTD B;  2PVB A;  3KPX A;  4MSP A;  3OHM B;  1XFY O;  3O78 A;  3NSK A;  4M2Q A;  2LVI A;  4HRG A;  2K8M B;  1AK8 A;  1DJW A;  4GUK A;  1EG4 A;  3VRR A;  2KOT A;  3IQQ A;  1ODB A;  1K9P A;  1KQM C;  4WQ3 A;  4MZL A;  2Y1N A;  1TNW A;  2KHN A;  3PSR A;  4A4C A;  3LK0 A;  1NX3 A;  2M7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...