1TCOB

Ternary complex of a calcineurin a fragment, calcineurin b, fkbp12 and the immunosuppressant drug fk506 (tacrolimus)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
169
structure length
169
Chain Sequence
GNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (hydrolase/isomerase)
molecule keywords SERINE/THREONINE PHOSPHATASE B2
publication title X-ray structure of calcineurin inhibited by the immunophilin-immunosuppressant FKBP12-FK506 complex.
pubmed doi rcsb
source organism Bos taurus
total genus 56
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 1996-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00036 EF-hand_1 EF hand
B PF13202 EF-hand_5 EF hand
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1tcoB00
2NZ0A 3TUYB 4PDZA 5TNCA 4DIRA 1UHNA 1XYDA 3F45A 2Y4QA 1BJFA 1KSMA 4ORAB 1IGVA 1SMGA 1NCZA 1F4OA 1XFUO 3VRQA 2LHLA 1U5IB 3BUMB 1JSAA 2M97A 2L2EA 4N1FA 2ZNDA 1RK9A 1CB1A 2JRFA 3LK0A 4GFTA 1SW8A 4JPZB 4I5NB 3KF9A 3JVTC 3NXAA 1RFJA 1DF0B 3M0WA 3SG7A 3CZTX 1K93D 4GPLB 2OS8C 3EK7A 1YRUB 1J1DA 3HX4A 3IQQA 3DF0A 5CPVA 3FS7A 3FWCA 3LLEA 1W7JB 3I5HC 1A75B 2LVVA 3D10A 3I5FC 3CR4X 1FPWA 1KCYA 1V1GA 5DKNA 2LP2A 2F2PA 4U8DA 2KQYA 2GGMA 1MXLC 1J7QA 1K9PA 5KSZA 1TNXA 1CDLA 1R6PA 2F33A 1S36A 3TDIA 1JF0A 5I2OA 2K7OA 5B8IB 4GAOA 3DF0B 1J7PA 1TNPA 5AEQA 2M49B 3CLNA 1QX2A 4PE7A 3PLFB 2M7LA 4YGCB 4DUQA 2K8MB 3LL8B 1S5GY 2OTGC 2SCPA 2EHBA 2NLNA 1K90D 2SASA 4ZCUA 1BF5A 4PHNA 2G2BA 2I7AA 1S26D 4ICBA 1QTXA 3KEVA 1B8CA 4UPGA 5KTYA 1SL8A 1MHOA 2O5GA 1JWDA 3ZWHA 2PALA 2WORA 3D0YA 3WXAA 2M9GA 1J7RA 2KYCA 1IQ3A 2H61C 2M3WA 4CPVA 3E3RA 3GK2A 1A4PA 1OQPA 3FWBA 1PVAA 4BY4A 2FOTA 3SG3A 1BMOA 1K94A 1NCYA 4OV2A 4C0JA 1JFKA 1F8HA 4WQ2A 3O4YA 3SIAA 1YVHA 1KFUL 2LC5A 1QVIZ 3BYAA 2LM5A 3D0YB 5I8NA 2LE9B 2ZFDA 3FIAA 1NX1A 2JT3A 2KGBC 2HQWA 1CLLA 4R1EA 2BECA 4PHJA 2BBNA 2ZN8A 5CSNA 1J1EA 1JF2A 1Q80A 1NP8A 4PALA 4NQGA 5AXIA 5GQQC 3RLZA 1NX2A 2MLEC 5HLOA 1TRFA 1M46A 1XFVO 3NSLA 4P2YB 4PE4A 1WLZA 2FCEA 2JTZA 4MRYA 1Y1XA 1JFJA 4AOMA 1YUSA 3VROA 4ETOA 1EL4A 2AUCA 1LINA 1XFXO 4OKHA 3RM1A 3TDZA 4ORCB 2V53A 1CFPA 4MZJA 1LXFC 4GNKB 2E6WA 2CTNA 2DOQA 3DVJA 3PN7C 1KQMC 1CLMA 5FYXA 3DVMA 1EXRA 1QLKA 4I5KA 4NDDA 3DVEA 3O78A 3OHMB 3EK8A 2KSPA 3BXKA 3SG6A 2ISDA 3BQ3A 2K61A 1G8IA 1RWYA 3AAKA 2NXQA 5AFPA 4GBAA 4AQJA 4FQOA 1UHKA 4WQ3A 1FF1A 1SPYA 2F8PA 2LLSA 4I5LB 2A4JA 4JQ0D 5IBWA 3OB2B 1ALVA 2COLB 1BODA 4MZLA 3SJSA 1CDPA 3TS5B 2IS9A 1AJ5A 1UHIA 2CT9A 5BPJA 4CFRA 3I5HB 3I5FB 4PE0A 4QJ5B 1RECA 1ODBA 1V1FA 2LAPA 5ER4X 1J55A 1FBVA 4YGAA 2WCFA 2WOSA 1Y1AA 3I5GB 4YRUA 1N65A 3SIBA 1C7WA 1DGUA 2KI4B 1SCVA 3PALA 1XFWO 2F3ZA 2KQ6A 1QATA 2Y1MA 1YUUA 2EC6B 5CSIA 2LUXA 1B8RA 2H61A 3I5IB 4JWQA 5J3XA 1QVIY 2JNXA 3GK4X 4HRHA 2OTGB 1NX0A 1BG1A 4PCWA 1DJYA 3BUXB 1DJHA 1DJZA 1G33A 1QLSA 1UUSA 4MZKA 4WRIA 2KAVA 3LCPC 1TNQA 1YR5A 2JWWA 1B4CA 5CSFA 3O6BA 3A4UB 1SBJA 2K7BA 4N1GA 1CFFA 3PATA 1QIVA 1OMDA 2JQ6A 3IF7A 5AANA 3TUYC 1UWOA 3IQOA 1JBAA 1GGWA 4Q04A 1OSAA 2L4IA 2ZN9A 1AJ4A 1N2DA 1D1OA 1EG4A 2LNKA 3SG2A 2M1UA 1QJTA 2OPOA 1WDCB 2LMVA 4A4BA 1XK4A 1KWOC 1W7IB 2JZIA 3KPXA 1BOCA 3SG4A 4M2QA 2M7NA 1ZMZA 2BL0C 2JULA 1KFXS 1QASA 2KGRA 1S6JA 2L0PA 4OVNF 1L2OB 3BUNB 1QV0A 1CM1A 1M63B 1SL9A 1JUOA 4IL1A 1RROA 4XJKA 1K9UA 3NSIA 4MLWA 2K2AA 2LVJA 2L98A 1SRAA 4YI9A 3EVUA 1WLMA 1SYMA 1N0YA 1IRJA 1HQVA 1PRWA 1XVJA 5JJGA 2KI6D 4HRGA 1IKUA 4C0LA 1DVIA 3AAJA 1YX7A 4F0ZB 3JTDB 2TN4A 4XJKB 3PN7B 1AK8A 1K96A 3H4SE 3LK1A 5DKRA 2AMIA 1YRTB 3KO0A 1QX5B 1XFZO 2O60A 1OE9B 2ZRSA 1L7ZA 1QS7A 3BUWB 1EG3A 1DJXA 1PSBA 1TOPA 3EK4A 2KHNA 1FI6A 2LANA 5F6TA 3WNXB 1CKKA 2MAZA 2LMUA 3GOFA 1GQMA 3PFVA 4PHKA 2M1KB 2WCBA 2BCBA 1S6IA 2BE6A 2JC2A 1NX3A 2HQ8A 1MQ1A 1NCXA 1QXPA 1SCMB 1ALWA 2CXJA 2F3YA 1MXEA 4ZCVA 5KU1A 1B1GA 1H8BA 2MBXA 4D1EA 1OMVA 1EJ3A 4DCKA 3OB1B 1PK0D 1BT6A 3SG5A 4YBHB 1BR1B 1SL7A 3KHEA 2WCEA 2Q4UA 1JC2A 1UHJA 2M29A 1CMFA 1IJ6A 3WHUB 2WNDA 3OP0A 1H4BA 1SY9A 3NSOA 3PSRA 3ZNIA 1J7OA 1C7VA 2FJUB 3JVTB 2LMTA 1K9KA 2E30A 2MA2A 2JPTA 2MRDA 2KFHA 1SR6C 2LLUA 1FW4A 4GUKA 3EVRA 2L5XB 2OS8B 1G4YR 1KK7Y 1UURA 2KI6C 4TNCA 4XYNA 2BE4A 2RGIA 4E68A 2LUCA 2HF5A 4A4CA 3O2PA 1SK6D 1SKTA 2Q91A 2PASA 1TCFA 1BU3A 3DVKA 1ZOTB 3OX5A 3BUOB 1NIWA 3VRNA 1A2XA 1IH0A 1R2UA 4PE1A 2I94A 1WRKA 2KAXA 1OZSA 2I18A 1CLBA 1PULA 1U5IA 1E8AA 1SNLA 4YGBB 1RTP1 2JXCA 1K2HA 5ER5A 2FCDA 1TIZA 1AVSA 2KBMA 3PM8A 4C0KA 1OOJA 1KSOA 1AHRA 5DKQA 1PVBA 4CIDA 3TZ1A 1F71A 2M0RA 2B1UA 2JXLA 1ZFSA 2I2RE 2JT0A 1NWDA 1DTLA 1RJVA 2JTTA 4M2OA 1KWOB 1KK8C 2KNEA 1A75A 2JT8A 2JU0A 2K7DA 2BCXA 3CTNA 2BL0B 1KFXL 4MEWA 1AP4A 1CTRA 4CLNA 1CFCA 3MSEB 4YGEB 1B8LA 4QJ4B 3EVVA 1AUIB 4GGFC 1DJGA 1OZOA 5CSJA 2GGZA 5HKZA 4OCIA 4M2PA 1TNWA 1MF8B 2GV5A 5I2QA 4GGNA 2LCPA 4BY5A 2MJWB 3TS5C 1ZACA 1M31A 1F70A 1LA0A 1LA3A 2KDHA 2L50A 1NPQA 2Y1NA 4USLA 1TN4A 2JNFA 4MN0A 2HPSA 2M8UA 1KK7Z 1QX7A 5D69A 2HETA 4I5JA 1OMRA 3VGOA 3I5GC 2LVIA 1GJYA 1YUTA 2KI4C 1YTZC 3VRRA 2EC6C 1YURA 1X02A 1S1EA 3CR5X 1B7TY 2MLFC 4AQIA 2K2FA 1Y1UA 3CGAA 3CWGA 3ICBA 3I5IC 4NDBA 1CNPA 1XFYO 2R2IA 4FTGA 1F4QA 1HT9A 3WHTB 1PSRA 2KYFA 1DJIA 1NYAA 1F54A 3NSKA 3EKJA 5HYDA 1K8UA 2PMYA 4L9MA 2KBIA 2ZNEA 1Y6WA 4CFQA 1CFDA 2NCPA 1KQVA 4QJ3B 4DRWA 4MRXA 1EH2A 2LVKA 1S3PA 2WC8A 1TTXA 1BR4B 2QPTA 1KQMB 2ZKMX 1CM4A 5HLVA 2K7CA 4NDCA 1ZUZA 1XO5A 4HSZA 3VRPA 1WDCC 4YGDB 2MHHA 1UP5A 2G9BA 4PHMA 3OX6A 4OR9B 2LLTA 1L2OC 1TCOB 2BCAA 1YVLA 5PALA 1NUBA 1BLQA 1SR6B 1LKJA 1M39A 1WY9A 1A03A 2ZRTA 2CCMA 5K89A 2K0JA 2EGDA 2QACA 1QIWA 4HREE 3EKHA 4MSPA 1MR8A 1K95A 1B47A 1MWNA 2LHIA 3K21A 1XK4C 1VRKA 1GGZA 4MVFA 1B7TZ 1IJ5A 5D7FA 1DT7B 5JOLA 1IQ5A 5HKWA 2CBLA 3CR2A 4N5XA 1S6CA 3QRXA 2P6BB 2BKHB 4P5OE 1PALA 1KFUS 1QV1A 2BKIB 4YI8A 5I2LA 1FI5A 2NCOA 1S5GZ 3BOWA 3CS1A 3JTDC 2H2KA 3AKAA 1WRLA 4DS7A 1YX8A 1LVCD 2CNPA 1IG5A 3C1VA 4GGFA 5AERA 2LP3A 3TDUA 2AAOA 2BBMA 2Y5IA 1M45A 3GK1A 2L51A 2PVBA 2VRGA 1UHHA 1CMGA 1CDMA 2KOTA 2PRUA 5HKYA 1DGVA 1C07A 5G08A 1A29A 2PSRA 1B9AA 1KK8B 1DMOA 1WRZA 1XA5A 1IWQA 3AKBA 2D8NA 3BOWB 4MBEA 2F2OA 2KFFA 1Y0VH 3HCMA 1F55A 2L4HA 2KFGA 2KAYA 1SCMC 1MUXA 1NSHA 2JOJA 3A8RA 1DJWA 3DD4A 1CDNA 1DF0A 2LV7A 4ORBB
chains in the Genus database with same CATH superfamily
2NZ0A 3TUYB 4PDZA 5TNCA 4DIRA 1UHNA 3DYEA 3SS5A 1OOHA 1XYDA 3F45A 2Y4QA 1BJFA 3PJIA 1KSMA 4ORAB 1IGVA 1SMGA 1NCZA 1F4OA 1XFUO 3VRQA 2LHLA 1U5IB 3BUMB 1JSAA 3CZ0A 2M97A 2L2EA 3NHTA 4N1FA 2ZNDA 1RK9A 1CB1A 2JRFA 3LK0A 4GFTA 1SW8A 3FE9A 4I5NB 2ERBA 3KF9A 4JPZB 3JVTC 3NXAA 1RFJA 1DF0B 3M0WA 3SG7A 3CZTX 1K93D 4GPLB 2OS8C 3EK7A 1YRUB 1J1DA 3HX4A 3IQQA 2WCLA 3DF0A 5CPVA 3FS7A 3FWCA 3LLEA 1W7JB 3I5HC 1A75B 2LVVA 3D10A 3I5FC 3CR4X 1FPWA 1KCYA 1V1GA 5DKNA 2LP2A 2F2PA 1OOIX 3B86A 4U8DA 2KQYA 2GGMA 1MXLC 1J7QA 1K9PA 2WC6A 5KSZA 1TNXA 1Z2CB 1CDLA 1R6PA 2F33A 1S36A 3TDIA 2K60A 1JF0A 5I2OA 2K7OA 1TWOA 5B8IB 4GAOA 3DF0B 1J7PA 1TNPA 5AEQA 2M49B 3CLNA 1QX2A 4PE7A 3PLFB 2M7LA 4YGCB 4DUQA 2K8MB 3LL8B 1S5GY 2OTGC 2SCPA 2EHBA 2NLNA 1K90D 2WCKA 2SASA 4ZCUA 2L5YA 4PHNA 1BF5A 1GM0A 2G2BA 2I7AA 1S26D 4ICBA 1QTXA 3KEVA 1B8CA 4UPGA 5KTYA 1SL8A 1MHOA 2O5GA 1JWDA 2BAPA 3ZWHA 2PALA 2WORA 3D0YA 3WXAA 2M9GA 2QEVA 1J7RA 2KYCA 1IQ3A 2H61C 2M3WA 4CPVA 2BNXA 3E3RA 3GK2A 1A4PA 1OQPA 3V2LA 3FWBA 4PT1A 1PVAA 4BY4A 2FOTA 3SG3A 1BMOA 1K94A 1NCYA 4OV2A 4C0JA 1JFKA 1F8HA 4WQ2A 3O4YA 1ORGA 1YVHA 3SIAA 1KFUL 2LC5A 1QVIZ 3BYAA 2LM5A 3D0YB 5I8NA 2LE9B 2ZFDA 3FIAA 1NX1A 2JT3A 2KGBC 2HQWA 1CLLA 4R1EA 2BECA 3D74A 4PHJA 2BBNA 2ZN8A 5CSNA 1J1EA 1JF2A 1Q80A 1NP8A 4PALA 4NQGA 5AXIA 5GQQC 3RLZA 1XFRA 1NX2A 2MLEC 5HLOA 2QEOA 1C3ZA 2PQLA 1TRFA 5D3OA 1M46A 1XFVO 3NSLA 2GTEA 2QEBA 4P2YB 4PE4A 1WLZA 2FCEA 2JTZA 4MRYA 1Y1XA 1JFJA 4AOMA 1YUSA 3VROA 2QEHA 4ETOA 1EL4A 2AUCA 1LINA 1SSEB 1DQEA 1XFXO 4OKHA 3RM1A 3TDZA 3OBVA 4ORCB 2V53A 1CFPA 4MZJA 1LXFC 4GNKB 2E6WA 5I94A 2CTNA 2DOQA 3DVJA 3PN7C 1KQMC 1TUJA 1CLMA 5FYXA 3DVMA 1EXRA 1QLKA 4I5KA 4NDDA 3DVEA 3O78A 3OHMB 3EK8A 2KSPA 3BXKA 3SG6A 2QDIA 2FJYA 4FQTA 2ISDA 3BQ3A 2H8VA 2K61A 1G8IA 1RWYA 3AAKA 2NXQA 5AFPA 4GBAA 4AQJA 4FQOA 1UHKA 4WQ3A 1FF1A 1SPYA 2F8PA 2LLSA 3L47A 4I5LB 2A4JA 4JQ0D 5IBWA 3OB2B 1ALVA 2COLB 2PYQA 1BODA 4MZLA 3SJSA 1CDPA 3TS5B 2IS9A 3S0GA 1AJ5A 1UHIA 1Z4HA 2CT9A 2WCHA 5BPJA 4CFRA 3I5HB 3I5FB 4PE0A 4QJ5B 1RECA 1ODBA 1V1FA 3B88A 2LAPA 5ER4X 1J55A 1FBVA 4YGAA 2WCFA 2WOSA 1Y1AA 3I5GB 4YRUA 1N65A 3SIBA 1C7WA 1DGUA 2KI4B 1SCVA 3PALA 3S0FA 1XFWO 2F3ZA 2KQ6A 1QATA 2Y1MA 1YUUA 2EC6B 5CSIA 2LUXA 3CABA 1B8RA 2YGUA 2H61A 3I5IB 4JWQA 3D76A 1DELA 5J3XA 4INXA 1QVIY 2JNXA 3GK4X 4HRHA 2OTGB 1NX0A 1BG1A 4PCWA 1OOGA 1DJYA 3BUXB 1DJHA 1DJZA 1G33A 1QLSA 1UUSA 3S0BA 4MZKA 3CZ1A 3DY9A 4WRIA 2KAVA 3LCPC 1TNQA 1YR5A 2JWWA 1B4CA 5CSFA 3O6BA 3A4UB 1SBJA 2K7BA 4N1GA 1CFFA 3PATA 1QIVA 3NGVA 1OMDA 2JQ6A 3IF7A 5AANA 3TUYC 1UWOA 3IQOA 1JBAA 1GGWA 4Q04A 1OSAA 2L4IA 2ZN9A 1AJ4A 1N2DA 1D1OA 1EG4A 2LNKA 3SG2A 2M1UA 1QJTA 2OPOA 1WDCB 2LMVA 3B6XA 1XK4A 1KWOC 1W7IB 2JZIA 3KPXA 4A4BA 3SG4A 4M2QA 2M7NA 1ZMZA 2BL0C 2JULA 5FI2A 1KFXS 1QASA 1TUZA 2KGRA 1S6JA 2L0PA 4OVNF 1L2OB 3BUNB 1QV0A 1CM1A 1M63B 1SL9A 1JUOA 4IL1A 1RROA 3R1PA 4XJKA 1K9UA 3NSIA 3NHIA 4MLWA 2K2AA 2LVJA 2L98A 1SRAA 4YI9A 3EVUA 1WLMA 1SYMA 1N0YA 1IRJA 1HQVA 2JPOA 3EG5B 1PRWA 1XVJA 5JJGA 1DEKA 2KI6D 4HRGA 1IKUA 4C0LA 1DVIA 3AAJA 1YX7A 4F0ZB 3JTDB 2TN4A 4XJKB 3D77A 3PN7B 1AK8A 1K96A 3H4SE 3LK1A 5DKRA 2AMIA 1YRTB 3KO0A 1QX5B 1XFZO 2O60A 3S0AA 1OE9B 2ZRSA 1L7ZA 1QS7A 3BUWB 1EG3A 1DJXA 1PSBA 3R72A 1TOPA 3EK4A 2KHNA 1FI6A 2LANA 5F6TA 3WNXB 1CKKA 2KLDA 2MAZA 2LMUA 3GOFA 1GQMA 3PFVA 4PHKA 2M1KB 2WCBA 2BCBA 1S6IA 2BE6A 2WC5A 2JC2A 1NX3A 2HQ8A 1MQ1A 1NCXA 1QXPA 1SCMB 1ALWA 2CXJA 2F3YA 1MXEA 4ZCVA 3FE8A 5KU1A 1B1GA 3B7AA 1H8BA 2MBXA 4D1EA 2L2CA 1OMVA 1EJ3A 4DCKA 3OB1B 1PK0D 1BT6A 3SG5A 4YBHB 1BR1B 1SL7A 3KHEA 2WCEA 2Q4UA 1JC2A 1UHJA 3Q8IA 2M29A 1CMFA 1IJ6A 3N7HA 3WHUB 2WNDA 3OP0A 1OOFA 1H4BA 1P28A 1SY9A 3NSOA 3PSRA 3ZNIA 1J7OA 1C7VA 2FJUB 3JVTB 2LMTA 1K9KA 2E30A 2MA2A 2JPTA 2WCMA 2MRDA 3FE6A 2KFHA 1SR6C 2LLUA 3B87A 1FW4A 1CLBA 4GUKA 3EVRA 2L5XB 2OS8B 1G4YR 1KK7Y 1UURA 2KI6C 4TNCA 4XYNA 2BE4A 2RGIA 4E68A 2LUCA 2HF5A 2WCJA 4A4CA 3O2PA 1SK6D 1SKTA 2Q91A 2PASA 1TCFA 1BU3A 3SS4A 1W9ZA 3DVKA 1ZOTB 3OX5A 5FI6A 3BUOB 1NIWA 3VRNA 1A2XA 1IH0A 1R2UA 4PE1A 1IIOA 3D73A 2I94A 1WRKA 2KAXA 1OZSA 2I18A 3BFBA 1PULA 3D75A 1U5IA 1E8AA 3CYZA 1SNLA 4YGBB 1RTP1 2JXCA 1K2HA 5ER5A 2FCDA 1TIZA 1AVSA 2KBMA 3PM8A 4C0KA 1OOJA 1KSOA 1AHRA 5DKQA 1PVBA 4CIDA 3TZ1A 1F71A 4INWA 2M0RA 2B1UA 2JXLA 1ZFSA 4KYNA 2I2RE 2JT0A 4IJ7A 3BFHA 5HL1A 1NWDA 1DTLA 1RJVA 2JTTA 3OGNA 4M2OA 1KWOB 1KK8C 2KNEA 1A75A 2JT8A 2JU0A 2K7DA 2BCXA 3CTNA 2BL0B 1KFXL 4MEWA 1AP4A 1CTRA 4CLNA 1CFCA 3MSEB 4YGEB 1B8LA 4QJ4B 3EVVA 1AUIB 4GGFC 1DJGA 1OZOA 5CSJA 2GGZA 5HKZA 4OCIA 3L4AA 1TNWA 4M2PA 1MF8B 2GV5A 5I2QA 4GGNA 2LCPA 3CZ2A 4BY5A 2MJWB 3TS5C 1ZACA 1M31A 1F70A 1LA0A 1LA3A 3BJHA 2KDHA 2L50A 1NPQA 2Y1NA 4USLA 1TN4A 2JNFA 4MN0A 2HPSA 2M8UA 1KK7Z 1QX7A 5D69A 2HETA 3VB1A 4I5JA 1OMRA 3VGOA 3I5GC 2LVIA 1GJYA 1YUTA 2KI4C 1YTZC 4JD9A 3VRRA 3K1EA 2EC6C 1YURA 1X02A 3CDNA 1S1EA 3CR5X 3S0EA 1T14A 1B7TY 2MLFC 4AQIA 2K2FA 1Y1UA 3CGAA 3CWGA 3ICBA 3I5IC 4NDBA 1CNPA 1XFYO 2R2IA 4FTGA 1F4QA 1HT9A 3WHTB 1PSRA 2KYFA 1DJIA 1NYAA 1F54A 3NSKA 3EKJA 5HYDA 1K8UA 2PMYA 4L9MA 2KBIA 2ZNEA 1Y6WA 4CFQA 3QMEA 1CFDA 2NCPA 1KQVA 4QJ3B 4DRWA 4MRXA 3R1OA 1EH2A 2LVKA 1S3PA 2WC8A 1TTXA 1BR4B 2QPTA 1KQMB 3L4LA 4JKTA 2ZKMX 1CM4A 5HLVA 2K7CA 4NDCA 2P70A 1ZUZA 1XO5A 4HSZA 3UNWA 3VRPA 1WDCC 4YGDB 2MHHA 1UP5A 2G9BA 4PHMA 3OX6A 4OR9B 2LLTA 1L2OC 1TCOB 2BCAA 3O4XA 1YVLA 2KPHA 3PM2A 5PALA 1NUBA 1BLQA 1SR6B 1LKJA 1M39A 1WY9A 5EL2A 1A03A 2ZRTA 2CCMA 5K89A 2K0JA 2EGDA 2QACA 1QIWA 4HREE 3EKHA 4MSPA 1MR8A 1DC1A 1K95A 1B47A 1MWNA 2LHIA 3K21A 1XK4C 1VRKA 1LS8A 1GGZA 5DICA 4MVFA 1B7TZ 1IJ5A 5D7FA 1DT7B 5JOLA 1IQ5A 5HKWA 2CBLA 3CR2A 4N5XA 1S6CA 3RZSA 3QRXA 2P6BB 2BKHB 2KLEA 4P5OE 1PALA 1KFUS 1QV1A 2BKIB 4YI8A 5I2LA 1C3YA 2NCOA 1FI5A 1S5GZ 3BOWA 3CS1A 3D78A 3JTDC 2H2KA 3IVTA 3AKAA 1QWVA 1WRLA 3UO9A 1YX8A 1LVCD 2CNPA 1IG5A 3C1VA 4GGFA 4DS7A 5AERA 3S0DA 2LP3A 3TDUA 2AAOA 2BBMA 2Y5IA 1M45A 3GK1A 2L51A 2PVBA 3DXLA 2VRGA 1UHHA 1CMGA 1CDMA 2KOTA 2PRUA 4OZDA 5HKYA 1OW4A 1DGVA 1C07A 5G08A 1A29A 2PSRA 1B9AA 5FI7A 1KK8B 2P71A 1DMOA 1WRZA 1XA5A 1IWQA 3AKBA 3R1VA 2D8NA 3BOWB 3BFAA 4MBEA 2F2OA 1BOCA 4F7FA 2KFFA 1Y0VH 3HCMA 1F55A 2L4HA 2KFGA 2KAYA 1SCMC 1MUXA 1NSHA 2JOJA 3A8RA 1DJWA 3DD4A 3DZTA 1CDNA 1DF0A 2LV7A 4ORBB 3SS3A
chains in the Genus database with same CATH topology
2NZ0A 3TUYB 4PDZA 5TNCA 4DIRA 1UHNA 1XYDA 3F45A 2Y4QA 1BJFA 1KSMA 4ORAB 1IGVA 1SMGA 1NCZA 1F4OA 1XFUO 3VRQA 2LHLA 1U5IB 3BUMB 1JSAA 2M97A 2L2EA 4N1FA 2ZNDA 1RK9A 1CB1A 2JRFA 3LK0A 4GFTA 1SW8A 4JPZB 4I5NB 3KF9A 3JVTC 3NXAA 1RFJA 1DF0B 3M0WA 3SG7A 3CZTX 1K93D 4GPLB 2OS8C 3EK7A 1YRUB 1J1DA 3HX4A 3IQQA 3DF0A 5CPVA 3FS7A 3FWCA 3LLEA 1W7JB 3I5HC 1A75B 2LVVA 3D10A 3I5FC 3CR4X 1FPWA 1KCYA 1V1GA 5DKNA 2LP2A 2F2PA 4U8DA 2KQYA 2GGMA 1MXLC 1J7QA 1K9PA 5KSZA 1TNXA 1CDLA 1R6PA 2F33A 1S36A 3TDIA 1JF0A 5I2OA 2K7OA 5B8IB 4GAOA 3DF0B 1J7PA 1TNPA 5AEQA 2M49B 3CLNA 1QX2A 4PE7A 3PLFB 2M7LA 4YGCB 4DUQA 2K8MB 3LL8B 1S5GY 2OTGC 2SCPA 2EHBA 2NLNA 1K90D 2SASA 4ZCUA 1BF5A 4PHNA 2G2BA 2I7AA 1S26D 4ICBA 1QTXA 3KEVA 1B8CA 4UPGA 5KTYA 1SL8A 1MHOA 2O5GA 1JWDA 3ZWHA 2PALA 2WORA 3D0YA 3WXAA 2M9GA 1J7RA 2KYCA 1IQ3A 2H61C 2M3WA 4CPVA 3E3RA 3GK2A 1A4PA 1OQPA 3FWBA 1PVAA 4BY4A 2FOTA 3SG3A 1BMOA 1K94A 1NCYA 4OV2A 4C0JA 1JFKA 1F8HA 4WQ2A 3O4YA 3SIAA 1YVHA 1KFUL 2LC5A 1QVIZ 3BYAA 2LM5A 3D0YB 5I8NA 2LE9B 2ZFDA 3FIAA 1NX1A 2JT3A 2KGBC 2HQWA 1CLLA 4R1EA 2BECA 4PHJA 2BBNA 2ZN8A 5CSNA 1J1EA 1JF2A 1Q80A 1NP8A 4PALA 4NQGA 5AXIA 5GQQC 3RLZA 1NX2A 2MLEC 5HLOA 1TRFA 1M46A 1XFVO 3NSLA 4P2YB 4PE4A 1WLZA 2FCEA 2JTZA 4MRYA 1Y1XA 1JFJA 4AOMA 1YUSA 3VROA 4ETOA 1EL4A 2AUCA 1LINA 1XFXO 4OKHA 3RM1A 3TDZA 4ORCB 2V53A 1CFPA 4MZJA 1LXFC 4GNKB 2E6WA 2CTNA 2DOQA 3DVJA 3PN7C 1KQMC 1CLMA 5FYXA 3DVMA 1EXRA 1QLKA 4I5KA 4NDDA 3DVEA 3O78A 3OHMB 3EK8A 2KSPA 3BXKA 3SG6A 2ISDA 3BQ3A 2K61A 1G8IA 1RWYA 3AAKA 2NXQA 5AFPA 4GBAA 4AQJA 4FQOA 1UHKA 4WQ3A 1FF1A 1SPYA 2F8PA 2LLSA 4I5LB 2A4JA 4JQ0D 5IBWA 3OB2B 1ALVA 2COLB 1BODA 4MZLA 3SJSA 1CDPA 3TS5B 2IS9A 1AJ5A 1UHIA 2CT9A 5BPJA 4CFRA 3I5HB 3I5FB 4PE0A 4QJ5B 1RECA 1ODBA 1V1FA 2LAPA 5ER4X 1J55A 1FBVA 4YGAA 2WCFA 2WOSA 1Y1AA 3I5GB 4YRUA 1N65A 3SIBA 1C7WA 1DGUA 2KI4B 1SCVA 3PALA 1XFWO 2F3ZA 2KQ6A 1QATA 2Y1MA 1YUUA 2EC6B 5CSIA 2LUXA 1B8RA 2H61A 3I5IB 4JWQA 5J3XA 1QVIY 2JNXA 3GK4X 4HRHA 2OTGB 1NX0A 1BG1A 4PCWA 1DJYA 3BUXB 1DJHA 1DJZA 1G33A 1QLSA 1UUSA 4MZKA 4WRIA 2KAVA 3LCPC 1TNQA 1YR5A 2JWWA 1B4CA 5CSFA 3O6BA 3A4UB 1SBJA 2K7BA 4N1GA 1CFFA 3PATA 1QIVA 1OMDA 2JQ6A 3IF7A 5AANA 3TUYC 1UWOA 3IQOA 1JBAA 1GGWA 4Q04A 1OSAA 2L4IA 2ZN9A 1AJ4A 1N2DA 1D1OA 1EG4A 2LNKA 3SG2A 2M1UA 1QJTA 2OPOA 1WDCB 2LMVA 4A4BA 1XK4A 1KWOC 1W7IB 2JZIA 3KPXA 1BOCA 3SG4A 4M2QA 2M7NA 1ZMZA 2BL0C 2JULA 1KFXS 1QASA 2KGRA 1S6JA 2L0PA 4OVNF 1L2OB 3BUNB 1QV0A 1CM1A 1M63B 1SL9A 1JUOA 4IL1A 1RROA 4XJKA 1K9UA 3NSIA 4MLWA 2K2AA 2LVJA 2L98A 1SRAA 4YI9A 3EVUA 1WLMA 1SYMA 1N0YA 1IRJA 1HQVA 1PRWA 1XVJA 5JJGA 2KI6D 4HRGA 1IKUA 4C0LA 1DVIA 3AAJA 1YX7A 4F0ZB 3JTDB 2TN4A 4XJKB 3PN7B 1AK8A 1K96A 3H4SE 3LK1A 5DKRA 2AMIA 1YRTB 3KO0A 1QX5B 1XFZO 2O60A 1OE9B 2ZRSA 1L7ZA 1QS7A 3BUWB 1EG3A 1DJXA 1PSBA 1TOPA 3EK4A 2KHNA 1FI6A 2LANA 5F6TA 3WNXB 1CKKA 2MAZA 2LMUA 3GOFA 1GQMA 3PFVA 4PHKA 2M1KB 2WCBA 2BCBA 1S6IA 2BE6A 2JC2A 1NX3A 2HQ8A 1MQ1A 1NCXA 1QXPA 1SCMB 1ALWA 2CXJA 2F3YA 1MXEA 4ZCVA 5KU1A 1B1GA 1H8BA 2MBXA 4D1EA 1OMVA 1EJ3A 4DCKA 3OB1B 1PK0D 1BT6A 3SG5A 4YBHB 1BR1B 1SL7A 3KHEA 2WCEA 2Q4UA 1JC2A 1UHJA 2M29A 1CMFA 1IJ6A 3WHUB 2WNDA 3OP0A 1H4BA 1SY9A 3NSOA 3PSRA 3ZNIA 1J7OA 1C7VA 2FJUB 3JVTB 2LMTA 1K9KA 2E30A 2MA2A 2JPTA 2MRDA 2KFHA 1SR6C 2LLUA 1FW4A 4GUKA 3EVRA 2L5XB 2OS8B 1G4YR 1KK7Y 1UURA 2KI6C 4TNCA 4XYNA 2BE4A 2RGIA 4E68A 2LUCA 2HF5A 4A4CA 3O2PA 1SK6D 1SKTA 2Q91A 2PASA 1TCFA 1BU3A 3DVKA 1ZOTB 3OX5A 3BUOB 1NIWA 3VRNA 1A2XA 1IH0A 1R2UA 4PE1A 2I94A 1WRKA 2KAXA 1OZSA 2I18A 1CLBA 1PULA 1U5IA 1E8AA 1SNLA 4YGBB 1RTP1 2JXCA 1K2HA 5ER5A 2FCDA 1TIZA 1AVSA 2KBMA 3PM8A 4C0KA 1OOJA 1KSOA 1AHRA 5DKQA 1PVBA 4CIDA 3TZ1A 1F71A 2M0RA 2B1UA 2JXLA 1ZFSA 2I2RE 2JT0A 1NWDA 1DTLA 1RJVA 2JTTA 4M2OA 1KWOB 1KK8C 2KNEA 1A75A 2JT8A 2JU0A 2K7DA 2BCXA 3CTNA 2BL0B 1KFXL 4MEWA 1AP4A 1CTRA 4CLNA 1CFCA 3MSEB 4YGEB 1B8LA 4QJ4B 3EVVA 1AUIB 4GGFC 1DJGA 1OZOA 5CSJA 2GGZA 5HKZA 4OCIA 4M2PA 1TNWA 1MF8B 2GV5A 5I2QA 4GGNA 2LCPA 4BY5A 2MJWB 3TS5C 1ZACA 1M31A 1F70A 1LA0A 1LA3A 2KDHA 2L50A 1NPQA 2Y1NA 4USLA 1TN4A 2JNFA 4MN0A 2HPSA 2M8UA 1KK7Z 1QX7A 5D69A 2HETA 4I5JA 1OMRA 3VGOA 3I5GC 2LVIA 1GJYA 1YUTA 2KI4C 1YTZC 3VRRA 2EC6C 1YURA 1X02A 1S1EA 3CR5X 1B7TY 2MLFC 4AQIA 2K2FA 1Y1UA 3CGAA 3CWGA 3ICBA 3I5IC 4NDBA 1CNPA 1XFYO 2R2IA 4FTGA 1F4QA 1HT9A 3WHTB 1PSRA 2KYFA 1DJIA 1NYAA 1F54A 3NSKA 3EKJA 5HYDA 1K8UA 2PMYA 4L9MA 2KBIA 2ZNEA 1Y6WA 4CFQA 1CFDA 2NCPA 1KQVA 4QJ3B 4DRWA 4MRXA 1EH2A 2LVKA 1S3PA 2WC8A 1TTXA 1BR4B 2QPTA 1KQMB 2ZKMX 1CM4A 5HLVA 2K7CA 4NDCA 1ZUZA 1XO5A 4HSZA 3VRPA 1WDCC 4YGDB 2MHHA 1UP5A 2G9BA 4PHMA 3OX6A 4OR9B 2LLTA 1L2OC 1TCOB 2BCAA 1YVLA 5PALA 1NUBA 1BLQA 1SR6B 1LKJA 1M39A 1WY9A 1A03A 2ZRTA 2CCMA 5K89A 2K0JA 2EGDA 2QACA 1QIWA 4HREE 3EKHA 4MSPA 1MR8A 1K95A 1B47A 1MWNA 2LHIA 3K21A 1XK4C 1VRKA 1GGZA 4MVFA 1B7TZ 1IJ5A 5D7FA 1DT7B 5JOLA 1IQ5A 5HKWA 2CBLA 3CR2A 4N5XA 1S6CA 3QRXA 2P6BB 2BKHB 4P5OE 1PALA 1KFUS 1QV1A 2BKIB 4YI8A 5I2LA 1FI5A 2NCOA 1S5GZ 3BOWA 3CS1A 3JTDC 2H2KA 3AKAA 1WRLA 4DS7A 1YX8A 1LVCD 2CNPA 1IG5A 3C1VA 4GGFA 5AERA 2LP3A 3TDUA 2AAOA 2BBMA 2Y5IA 1M45A 3GK1A 2L51A 2PVBA 2VRGA 1UHHA 1CMGA 1CDMA 2KOTA 2PRUA 5HKYA 1DGVA 1C07A 5G08A 1A29A 2PSRA 1B9AA 1KK8B 1DMOA 1WRZA 1XA5A 1IWQA 3AKBA 2D8NA 3BOWB 4MBEA 2F2OA 2KFFA 1Y0VH 3HCMA 1F55A 2L4HA 2KFGA 2KAYA 1SCMC 1MUXA 1NSHA 2JOJA 3A8RA 1DJWA 3DD4A 1CDNA 1DF0A 2LV7A 4ORBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NZ0 A;  3TUY B;  4PDZ A;  5TNC A;  4DIR A;  1UHN A;  1XYD A;  3F45 A;  2Y4Q A;  1BJF A;  1KSM A;  4ORA B;  1IGV A;  1SMG A;  1NCZ A;  1F4O A;  1XFU O;  3VRQ A;  2LHL A;  1U5I B;  3BUM B;  1JSA A;  2M97 A;  2L2E A;  4N1F A;  2ZND A;  1RK9 A;  1CB1 A;  2JRF A;  3LK0 A;  4GFT A;  1SW8 A;  4JPZ B;  4I5N B;  3KF9 A;  3JVT C;  3NXA A;  1RFJ A;  1DF0 B;  3M0W A;  3SG7 A;  3CZT X;  1K93 D;  4GPL B;  2OS8 C;  3EK7 A;  1YRU B;  1J1D A;  3HX4 A;  3IQQ A;  3DF0 A;  5CPV A;  3FS7 A;  3FWC A;  3LLE A;  1W7J B;  3I5H C;  1A75 B;  2LVV A;  3D10 A;  3I5F C;  3CR4 X;  1FPW A;  1KCY A;  1V1G A;  5DKN A;  2LP2 A;  2F2P A;  4U8D A;  2KQY A;  2GGM A;  1MXL C;  1J7Q A;  1K9P A;  5KSZ A;  1TNX A;  1CDL A;  1R6P A;  2F33 A;  1S36 A;  3TDI A;  1JF0 A;  5I2O A;  2K7O A;  5B8I B;  4GAO A;  3DF0 B;  1J7P A;  1TNP A;  5AEQ A;  2M49 B;  3CLN A;  1QX2 A;  4PE7 A;  3PLF B;  2M7L A;  4YGC B;  4DUQ A;  2K8M B;  3LL8 B;  1S5G Y;  2OTG C;  2SCP A;  2EHB A;  2NLN A;  1K90 D;  2SAS A;  4ZCU A;  1BF5 A;  4PHN A;  2G2B A;  2I7A A;  1S26 D;  4ICB A;  1QTX A;  3KEV A;  1B8C A;  4UPG A;  5KTY A;  1SL8 A;  1MHO A;  2O5G A;  1JWD A;  3ZWH A;  2PAL A;  2WOR A;  3D0Y A;  3WXA A;  2M9G A;  1J7R A;  2KYC A;  1IQ3 A;  2H61 C;  2M3W A;  4CPV A;  3E3R A;  3GK2 A;  1A4P A;  1OQP A;  3FWB A;  1PVA A;  4BY4 A;  2FOT A;  3SG3 A;  1BMO A;  1K94 A;  1NCY A;  4OV2 A;  4C0J A;  1JFK A;  1F8H A;  4WQ2 A;  3O4Y A;  3SIA A;  1YVH A;  1KFU L;  2LC5 A;  1QVI Z;  3BYA A;  2LM5 A;  3D0Y B;  5I8N A;  2LE9 B;  2ZFD A;  3FIA A;  1NX1 A;  2JT3 A;  2KGB C;  2HQW A;  1CLL A;  4R1E A;  2BEC A;  4PHJ A;  2BBN A;  2ZN8 A;  5CSN A;  1J1E A;  1JF2 A;  1Q80 A;  1NP8 A;  4PAL A;  4NQG A;  5AXI A;  5GQQ C;  3RLZ A;  1NX2 A;  2MLE C;  5HLO A;  1TRF A;  1M46 A;  1XFV O;  3NSL A;  4P2Y B;  4PE4 A;  1WLZ A;  2FCE A;  2JTZ A;  4MRY A;  1Y1X A;  1JFJ A;  4AOM A;  1YUS A;  3VRO A;  4ETO A;  1EL4 A;  2AUC A;  1LIN A;  1XFX O;  4OKH A;  3RM1 A;  3TDZ A;  4ORC B;  2V53 A;  1CFP A;  4MZJ A;  1LXF C;  4GNK B;  2E6W A;  2CTN A;  2DOQ A;  3DVJ A;  3PN7 C;  1KQM C;  1CLM A;  5FYX A;  3DVM A;  1EXR A;  1QLK A;  4I5K A;  4NDD A;  3DVE A;  3O78 A;  3OHM B;  3EK8 A;  2KSP A;  3BXK A;  3SG6 A;  2ISD A;  3BQ3 A;  2K61 A;  1G8I A;  1RWY A;  3AAK A;  2NXQ A;  5AFP A;  4GBA A;  4AQJ A;  4FQO A;  1UHK A;  4WQ3 A;  1FF1 A;  1SPY A;  2F8P A;  2LLS A;  4I5L B;  2A4J A;  4JQ0 D;  5IBW A;  3OB2 B;  1ALV A;  2COL B;  1BOD A;  4MZL A;  3SJS A;  1CDP A;  3TS5 B;  2IS9 A;  1AJ5 A;  1UHI A;  2CT9 A;  5BPJ A;  4CFR A;  3I5H B;  3I5F B;  4PE0 A;  4QJ5 B;  1REC A;  1ODB A;  1V1F A;  2LAP A;  5ER4 X;  1J55 A;  1FBV A;  4YGA A;  2WCF A;  2WOS A;  1Y1A A;  3I5G B;  4YRU A;  1N65 A;  3SIB A;  1C7W A;  1DGU A;  2KI4 B;  1SCV A;  3PAL A;  1XFW O;  2F3Z A;  2KQ6 A;  1QAT A;  2Y1M A;  1YUU A;  2EC6 B;  5CSI A;  2LUX A;  1B8R A;  2H61 A;  3I5I B;  4JWQ A;  5J3X A;  1QVI Y;  2JNX A;  3GK4 X;  4HRH A;  2OTG B;  1NX0 A;  1BG1 A;  4PCW A;  1DJY A;  3BUX B;  1DJH A;  1DJZ A;  1G33 A;  1QLS A;  1UUS A;  4MZK A;  4WRI A;  2KAV A;  3LCP C;  1TNQ A;  1YR5 A;  2JWW A;  1B4C A;  5CSF A;  3O6B A;  3A4U B;  1SBJ A;  2K7B A;  4N1G A;  1CFF A;  3PAT A;  1QIV A;  1OMD A;  2JQ6 A;  3IF7 A;  5AAN A;  3TUY C;  1UWO A;  3IQO A;  1JBA A;  1GGW A;  4Q04 A;  1OSA A;  2L4I A;  2ZN9 A;  1AJ4 A;  1N2D A;  1D1O A;  1EG4 A;  2LNK A;  3SG2 A;  2M1U A;  1QJT A;  2OPO A;  1WDC B;  2LMV A;  4A4B A;  1XK4 A;  1KWO C;  1W7I B;  2JZI A;  3KPX A;  1BOC A;  3SG4 A;  4M2Q A;  2M7N A;  1ZMZ A;  2BL0 C;  2JUL A;  1KFX S;  1QAS A;  2KGR A;  1S6J A;  2L0P A;  4OVN F;  1L2O B;  3BUN B;  1QV0 A;  1CM1 A;  1M63 B;  1SL9 A;  1JUO A;  4IL1 A;  1RRO A;  4XJK A;  1K9U A;  3NSI A;  4MLW A;  2K2A A;  2LVJ A;  2L98 A;  1SRA A;  4YI9 A;  3EVU A;  1WLM A;  1SYM A;  1N0Y A;  1IRJ A;  1HQV A;  1PRW A;  1XVJ A;  5JJG A;  2KI6 D;  4HRG A;  1IKU A;  4C0L A;  1DVI A;  3AAJ A;  1YX7 A;  4F0Z B;  3JTD B;  2TN4 A;  4XJK B;  3PN7 B;  1AK8 A;  1K96 A;  3H4S E;  3LK1 A;  5DKR A;  2AMI A;  1YRT B;  3KO0 A;  1QX5 B;  1XFZ O;  2O60 A;  1OE9 B;  2ZRS A;  1L7Z A;  1QS7 A;  3BUW B;  1EG3 A;  1DJX A;  1PSB A;  1TOP A;  3EK4 A;  2KHN A;  1FI6 A;  2LAN A;  5F6T A;  3WNX B;  1CKK A;  2MAZ A;  2LMU A;  3GOF A;  1GQM A;  3PFV A;  4PHK A;  2M1K B;  2WCB A;  2BCB A;  1S6I A;  2BE6 A;  2JC2 A;  1NX3 A;  2HQ8 A;  1MQ1 A;  1NCX A;  1QXP A;  1SCM B;  1ALW A;  2CXJ A;  2F3Y A;  1MXE A;  4ZCV A;  5KU1 A;  1B1G A;  1H8B A;  2MBX A;  4D1E A;  1OMV A;  1EJ3 A;  4DCK A;  3OB1 B;  1PK0 D;  1BT6 A;  3SG5 A;  4YBH B;  1BR1 B;  1SL7 A;  3KHE A;  2WCE A;  2Q4U A;  1JC2 A;  1UHJ A;  2M29 A;  1CMF A;  1IJ6 A;  3WHU B;  2WND A;  3OP0 A;  1H4B A;  1SY9 A;  3NSO A;  3PSR A;  3ZNI A;  1J7O A;  1C7V A;  2FJU B;  3JVT B;  2LMT A;  1K9K A;  2E30 A;  2MA2 A;  2JPT A;  2MRD A;  2KFH A;  1SR6 C;  2LLU A;  1FW4 A;  4GUK A;  3EVR A;  2L5X B;  2OS8 B;  1G4Y R;  1KK7 Y;  1UUR A;  2KI6 C;  4TNC A;  4XYN A;  2BE4 A;  2RGI A;  4E68 A;  2LUC A;  2HF5 A;  4A4C A;  3O2P A;  1SK6 D;  1SKT A;  2Q91 A;  2PAS A;  1TCF A;  1BU3 A;  3DVK A;  1ZOT B;  3OX5 A;  3BUO B;  1NIW A;  3VRN A;  1A2X A;  1IH0 A;  1R2U A;  4PE1 A;  2I94 A;  1WRK A;  2KAX A;  1OZS A;  2I18 A;  1CLB A;  1PUL A;  1U5I A;  1E8A A;  1SNL A;  4YGB B;  1RTP 1;  2JXC A;  1K2H A;  5ER5 A;  2FCD A;  1TIZ A;  1AVS A;  2KBM A;  3PM8 A;  4C0K A;  1OOJ A;  1KSO A;  1AHR A;  5DKQ A;  1PVB A;  4CID A;  3TZ1 A;  1F71 A;  2M0R A;  2B1U A;  2JXL A;  1ZFS A;  2I2R E;  2JT0 A;  1NWD A;  1DTL A;  1RJV A;  2JTT A;  4M2O A;  1KWO B;  1KK8 C;  2KNE A;  1A75 A;  2JT8 A;  2JU0 A;  2K7D A;  2BCX A;  3CTN A;  2BL0 B;  1KFX L;  4MEW A;  1AP4 A;  1CTR A;  4CLN A;  1CFC A;  3MSE B;  4YGE B;  1B8L A;  4QJ4 B;  3EVV A;  1AUI B;  4GGF C;  1DJG A;  1OZO A;  5CSJ A;  2GGZ A;  5HKZ A;  4OCI A;  4M2P A;  1TNW A;  1MF8 B;  2GV5 A;  5I2Q A;  4GGN A;  2LCP A;  4BY5 A;  2MJW B;  3TS5 C;  1ZAC A;  1M31 A;  1F70 A;  1LA0 A;  1LA3 A;  2KDH A;  2L50 A;  1NPQ A;  2Y1N A;  4USL A;  1TN4 A;  2JNF A;  4MN0 A;  2HPS A;  2M8U A;  1KK7 Z;  1QX7 A;  5D69 A;  2HET A;  4I5J A;  1OMR A;  3VGO A;  3I5G C;  2LVI A;  1GJY A;  1YUT A;  2KI4 C;  1YTZ C;  3VRR A;  2EC6 C;  1YUR A;  1X02 A;  1S1E A;  3CR5 X;  1B7T Y;  2MLF C;  4AQI A;  2K2F A;  1Y1U A;  3CGA A;  3CWG A;  3ICB A;  3I5I C;  4NDB A;  1CNP A;  1XFY O;  2R2I A;  4FTG A;  1F4Q A;  1HT9 A;  3WHT B;  1PSR A;  2KYF A;  1DJI A;  1NYA A;  1F54 A;  3NSK A;  3EKJ A;  5HYD A;  1K8U A;  2PMY A;  4L9M A;  2KBI A;  2ZNE A;  1Y6W A;  4CFQ A;  1CFD A;  2NCP A;  1KQV A;  4QJ3 B;  4DRW A;  4MRX A;  1EH2 A;  2LVK A;  1S3P A;  2WC8 A;  1TTX A;  1BR4 B;  2QPT A;  1KQM B;  2ZKM X;  1CM4 A;  5HLV A;  2K7C A;  4NDC A;  1ZUZ A;  1XO5 A;  4HSZ A;  3VRP A;  1WDC C;  4YGD B;  2MHH A;  1UP5 A;  2G9B A;  4PHM A;  3OX6 A;  4OR9 B;  2LLT A;  1L2O C;  1TCO B;  2BCA A;  1YVL A;  5PAL A;  1NUB A;  1BLQ A;  1SR6 B;  1LKJ A;  1M39 A;  1WY9 A;  1A03 A;  2ZRT A;  2CCM A;  5K89 A;  2K0J A;  2EGD A;  2QAC A;  1QIW A;  4HRE E;  3EKH A;  4MSP A;  1MR8 A;  1K95 A;  1B47 A;  1MWN A;  2LHI A;  3K21 A;  1XK4 C;  1VRK A;  1GGZ A;  4MVF A;  1B7T Z;  1IJ5 A;  5D7F A;  1DT7 B;  5JOL A;  1IQ5 A;  5HKW A;  2CBL A;  3CR2 A;  4N5X A;  1S6C A;  3QRX A;  2P6B B;  2BKH B;  4P5O E;  1PAL A;  1KFU S;  1QV1 A;  2BKI B;  4YI8 A;  5I2L A;  1FI5 A;  2NCO A;  1S5G Z;  3BOW A;  3CS1 A;  3JTD C;  2H2K A;  3AKA A;  1WRL A;  4DS7 A;  1YX8 A;  1LVC D;  2CNP A;  1IG5 A;  3C1V A;  4GGF A;  5AER A;  2LP3 A;  3TDU A;  2AAO A;  2BBM A;  2Y5I A;  1M45 A;  3GK1 A;  2L51 A;  2PVB A;  2VRG A;  1UHH A;  1CMG A;  1CDM A;  2KOT A;  2PRU A;  5HKY A;  1DGV A;  1C07 A;  5G08 A;  1A29 A;  2PSR A;  1B9A A;  1KK8 B;  1DMO A;  1WRZ A;  1XA5 A;  1IWQ A;  3AKB A;  2D8N A;  3BOW B;  4MBE A;  2F2O A;  2KFF A;  1Y0V H;  3HCM A;  1F55 A;  2L4H A;  2KFG A;  2KAY A;  1SCM C;  1MUX A;  1NSH A;  2JOJ A;  3A8R A;  1DJW A;  3DD4 A;  1CDN A;  1DF0 A;  2LV7 A;  4ORB B; 
#chains in the Genus database with same CATH topology
 2NZ0 A;  3TUY B;  4PDZ A;  5TNC A;  4DIR A;  1UHN A;  3DYE A;  3SS5 A;  1OOH A;  1XYD A;  3F45 A;  2Y4Q A;  1BJF A;  3PJI A;  1KSM A;  4ORA B;  1IGV A;  1SMG A;  1NCZ A;  1F4O A;  1XFU O;  3VRQ A;  2LHL A;  1U5I B;  3BUM B;  1JSA A;  3CZ0 A;  2M97 A;  2L2E A;  3NHT A;  4N1F A;  2ZND A;  1RK9 A;  1CB1 A;  2JRF A;  3LK0 A;  4GFT A;  1SW8 A;  3FE9 A;  4I5N B;  2ERB A;  3KF9 A;  4JPZ B;  3JVT C;  3NXA A;  1RFJ A;  1DF0 B;  3M0W A;  3SG7 A;  3CZT X;  1K93 D;  4GPL B;  2OS8 C;  3EK7 A;  1YRU B;  1J1D A;  3HX4 A;  3IQQ A;  2WCL A;  3DF0 A;  5CPV A;  3FS7 A;  3FWC A;  3LLE A;  1W7J B;  3I5H C;  1A75 B;  2LVV A;  3D10 A;  3I5F C;  3CR4 X;  1FPW A;  1KCY A;  1V1G A;  5DKN A;  2LP2 A;  2F2P A;  1OOI X;  3B86 A;  4U8D A;  2KQY A;  2GGM A;  1MXL C;  1J7Q A;  1K9P A;  2WC6 A;  5KSZ A;  1TNX A;  1Z2C B;  1CDL A;  1R6P A;  2F33 A;  1S36 A;  3TDI A;  2K60 A;  1JF0 A;  5I2O A;  2K7O A;  1TWO A;  5B8I B;  4GAO A;  3DF0 B;  1J7P A;  1TNP A;  5AEQ A;  2M49 B;  3CLN A;  1QX2 A;  4PE7 A;  3PLF B;  2M7L A;  4YGC B;  4DUQ A;  2K8M B;  3LL8 B;  1S5G Y;  2OTG C;  2SCP A;  2EHB A;  2NLN A;  1K90 D;  2WCK A;  2SAS A;  4ZCU A;  2L5Y A;  4PHN A;  1BF5 A;  1GM0 A;  2G2B A;  2I7A A;  1S26 D;  4ICB A;  1QTX A;  3KEV A;  1B8C A;  4UPG A;  5KTY A;  1SL8 A;  1MHO A;  2O5G A;  1JWD A;  2BAP A;  3ZWH A;  2PAL A;  2WOR A;  3D0Y A;  3WXA A;  2M9G A;  2QEV A;  1J7R A;  2KYC A;  1IQ3 A;  2H61 C;  2M3W A;  4CPV A;  2BNX A;  3E3R A;  3GK2 A;  1A4P A;  1OQP A;  3V2L A;  3FWB A;  4PT1 A;  1PVA A;  4BY4 A;  2FOT A;  3SG3 A;  1BMO A;  1K94 A;  1NCY A;  4OV2 A;  4C0J A;  1JFK A;  1F8H A;  4WQ2 A;  3O4Y A;  1ORG A;  1YVH A;  3SIA A;  1KFU L;  2LC5 A;  1QVI Z;  3BYA A;  2LM5 A;  3D0Y B;  5I8N A;  2LE9 B;  2ZFD A;  3FIA A;  1NX1 A;  2JT3 A;  2KGB C;  2HQW A;  1CLL A;  4R1E A;  2BEC A;  3D74 A;  4PHJ A;  2BBN A;  2ZN8 A;  5CSN A;  1J1E A;  1JF2 A;  1Q80 A;  1NP8 A;  4PAL A;  4NQG A;  5AXI A;  5GQQ C;  3RLZ A;  1XFR A;  1NX2 A;  2MLE C;  5HLO A;  2QEO A;  1C3Z A;  2PQL A;  1TRF A;  5D3O A;  1M46 A;  1XFV O;  3NSL A;  2GTE A;  2QEB A;  4P2Y B;  4PE4 A;  1WLZ A;  2FCE A;  2JTZ A;  4MRY A;  1Y1X A;  1JFJ A;  4AOM A;  1YUS A;  3VRO A;  2QEH A;  4ETO A;  1EL4 A;  2AUC A;  1LIN A;  1SSE B;  1DQE A;  1XFX O;  4OKH A;  3RM1 A;  3TDZ A;  3OBV A;  4ORC B;  2V53 A;  1CFP A;  4MZJ A;  1LXF C;  4GNK B;  2E6W A;  5I94 A;  2CTN A;  2DOQ A;  3DVJ A;  3PN7 C;  1KQM C;  1TUJ A;  1CLM A;  5FYX A;  3DVM A;  1EXR A;  1QLK A;  4I5K A;  4NDD A;  3DVE A;  3O78 A;  3OHM B;  3EK8 A;  2KSP A;  3BXK A;  3SG6 A;  2QDI A;  2FJY A;  4FQT A;  2ISD A;  3BQ3 A;  2H8V A;  2K61 A;  1G8I A;  1RWY A;  3AAK A;  2NXQ A;  5AFP A;  4GBA A;  4AQJ A;  4FQO A;  1UHK A;  4WQ3 A;  1FF1 A;  1SPY A;  2F8P A;  2LLS A;  3L47 A;  4I5L B;  2A4J A;  4JQ0 D;  5IBW A;  3OB2 B;  1ALV A;  2COL B;  2PYQ A;  1BOD A;  4MZL A;  3SJS A;  1CDP A;  3TS5 B;  2IS9 A;  3S0G A;  1AJ5 A;  1UHI A;  1Z4H A;  2CT9 A;  2WCH A;  5BPJ A;  4CFR A;  3I5H B;  3I5F B;  4PE0 A;  4QJ5 B;  1REC A;  1ODB A;  1V1F A;  3B88 A;  2LAP A;  5ER4 X;  1J55 A;  1FBV A;  4YGA A;  2WCF A;  2WOS A;  1Y1A A;  3I5G B;  4YRU A;  1N65 A;  3SIB A;  1C7W A;  1DGU A;  2KI4 B;  1SCV A;  3PAL A;  3S0F A;  1XFW O;  2F3Z A;  2KQ6 A;  1QAT A;  2Y1M A;  1YUU A;  2EC6 B;  5CSI A;  2LUX A;  3CAB A;  1B8R A;  2YGU A;  2H61 A;  3I5I B;  4JWQ A;  3D76 A;  1DEL A;  5J3X A;  4INX A;  1QVI Y;  2JNX A;  3GK4 X;  4HRH A;  2OTG B;  1NX0 A;  1BG1 A;  4PCW A;  1OOG A;  1DJY A;  3BUX B;  1DJH A;  1DJZ A;  1G33 A;  1QLS A;  1UUS A;  3S0B A;  4MZK A;  3CZ1 A;  3DY9 A;  4WRI A;  2KAV A;  3LCP C;  1TNQ A;  1YR5 A;  2JWW A;  1B4C A;  5CSF A;  3O6B A;  3A4U B;  1SBJ A;  2K7B A;  4N1G A;  1CFF A;  3PAT A;  1QIV A;  3NGV A;  1OMD A;  2JQ6 A;  3IF7 A;  5AAN A;  3TUY C;  1UWO A;  3IQO A;  1JBA A;  1GGW A;  4Q04 A;  1OSA A;  2L4I A;  2ZN9 A;  1AJ4 A;  1N2D A;  1D1O A;  1EG4 A;  2LNK A;  3SG2 A;  2M1U A;  1QJT A;  2OPO A;  1WDC B;  2LMV A;  3B6X A;  1XK4 A;  1KWO C;  1W7I B;  2JZI A;  3KPX A;  4A4B A;  3SG4 A;  4M2Q A;  2M7N A;  1ZMZ A;  2BL0 C;  2JUL A;  5FI2 A;  1KFX S;  1QAS A;  1TUZ A;  2KGR A;  1S6J A;  2L0P A;  4OVN F;  1L2O B;  3BUN B;  1QV0 A;  1CM1 A;  1M63 B;  1SL9 A;  1JUO A;  4IL1 A;  1RRO A;  3R1P A;  4XJK A;  1K9U A;  3NSI A;  3NHI A;  4MLW A;  2K2A A;  2LVJ A;  2L98 A;  1SRA A;  4YI9 A;  3EVU A;  1WLM A;  1SYM A;  1N0Y A;  1IRJ A;  1HQV A;  2JPO A;  3EG5 B;  1PRW A;  1XVJ A;  5JJG A;  1DEK A;  2KI6 D;  4HRG A;  1IKU A;  4C0L A;  1DVI A;  3AAJ A;  1YX7 A;  4F0Z B;  3JTD B;  2TN4 A;  4XJK B;  3D77 A;  3PN7 B;  1AK8 A;  1K96 A;  3H4S E;  3LK1 A;  5DKR A;  2AMI A;  1YRT B;  3KO0 A;  1QX5 B;  1XFZ O;  2O60 A;  3S0A A;  1OE9 B;  2ZRS A;  1L7Z A;  1QS7 A;  3BUW B;  1EG3 A;  1DJX A;  1PSB A;  3R72 A;  1TOP A;  3EK4 A;  2KHN A;  1FI6 A;  2LAN A;  5F6T A;  3WNX B;  1CKK A;  2KLD A;  2MAZ A;  2LMU A;  3GOF A;  1GQM A;  3PFV A;  4PHK A;  2M1K B;  2WCB A;  2BCB A;  1S6I A;  2BE6 A;  2WC5 A;  2JC2 A;  1NX3 A;  2HQ8 A;  1MQ1 A;  1NCX A;  1QXP A;  1SCM B;  1ALW A;  2CXJ A;  2F3Y A;  1MXE A;  4ZCV A;  3FE8 A;  5KU1 A;  1B1G A;  3B7A A;  1H8B A;  2MBX A;  4D1E A;  2L2C A;  1OMV A;  1EJ3 A;  4DCK A;  3OB1 B;  1PK0 D;  1BT6 A;  3SG5 A;  4YBH B;  1BR1 B;  1SL7 A;  3KHE A;  2WCE A;  2Q4U A;  1JC2 A;  1UHJ A;  3Q8I A;  2M29 A;  1CMF A;  1IJ6 A;  3N7H A;  3WHU B;  2WND A;  3OP0 A;  1OOF A;  1H4B A;  1P28 A;  1SY9 A;  3NSO A;  3PSR A;  3ZNI A;  1J7O A;  1C7V A;  2FJU B;  3JVT B;  2LMT A;  1K9K A;  2E30 A;  2MA2 A;  2JPT A;  2WCM A;  2MRD A;  3FE6 A;  2KFH A;  1SR6 C;  2LLU A;  3B87 A;  1FW4 A;  1CLB A;  4GUK A;  3EVR A;  2L5X B;  2OS8 B;  1G4Y R;  1KK7 Y;  1UUR A;  2KI6 C;  4TNC A;  4XYN A;  2BE4 A;  2RGI A;  4E68 A;  2LUC A;  2HF5 A;  2WCJ A;  4A4C A;  3O2P A;  1SK6 D;  1SKT A;  2Q91 A;  2PAS A;  1TCF A;  1BU3 A;  3SS4 A;  1W9Z A;  3DVK A;  1ZOT B;  3OX5 A;  5FI6 A;  3BUO B;  1NIW A;  3VRN A;  1A2X A;  1IH0 A;  1R2U A;  4PE1 A;  1IIO A;  3D73 A;  2I94 A;  1WRK A;  2KAX A;  1OZS A;  2I18 A;  3BFB A;  1PUL A;  3D75 A;  1U5I A;  1E8A A;  3CYZ A;  1SNL A;  4YGB B;  1RTP 1;  2JXC A;  1K2H A;  5ER5 A;  2FCD A;  1TIZ A;  1AVS A;  2KBM A;  3PM8 A;  4C0K A;  1OOJ A;  1KSO A;  1AHR A;  5DKQ A;  1PVB A;  4CID A;  3TZ1 A;  1F71 A;  4INW A;  2M0R A;  2B1U A;  2JXL A;  1ZFS A;  4KYN A;  2I2R E;  2JT0 A;  4IJ7 A;  3BFH A;  5HL1 A;  1NWD A;  1DTL A;  1RJV A;  2JTT A;  3OGN A;  4M2O A;  1KWO B;  1KK8 C;  2KNE A;  1A75 A;  2JT8 A;  2JU0 A;  2K7D A;  2BCX A;  3CTN A;  2BL0 B;  1KFX L;  4MEW A;  1AP4 A;  1CTR A;  4CLN A;  1CFC A;  3MSE B;  4YGE B;  1B8L A;  4QJ4 B;  3EVV A;  1AUI B;  4GGF C;  1DJG A;  1OZO A;  5CSJ A;  2GGZ A;  5HKZ A;  4OCI A;  3L4A A;  1TNW A;  4M2P A;  1MF8 B;  2GV5 A;  5I2Q A;  4GGN A;  2LCP A;  3CZ2 A;  4BY5 A;  2MJW B;  3TS5 C;  1ZAC A;  1M31 A;  1F70 A;  1LA0 A;  1LA3 A;  3BJH A;  2KDH A;  2L50 A;  1NPQ A;  2Y1N A;  4USL A;  1TN4 A;  2JNF A;  4MN0 A;  2HPS A;  2M8U A;  1KK7 Z;  1QX7 A;  5D69 A;  2HET A;  3VB1 A;  4I5J A;  1OMR A;  3VGO A;  3I5G C;  2LVI A;  1GJY A;  1YUT A;  2KI4 C;  1YTZ C;  4JD9 A;  3VRR A;  3K1E A;  2EC6 C;  1YUR A;  1X02 A;  3CDN A;  1S1E A;  3CR5 X;  3S0E A;  1T14 A;  1B7T Y;  2MLF C;  4AQI A;  2K2F A;  1Y1U A;  3CGA A;  3CWG A;  3ICB A;  3I5I C;  4NDB A;  1CNP A;  1XFY O;  2R2I A;  4FTG A;  1F4Q A;  1HT9 A;  3WHT B;  1PSR A;  2KYF A;  1DJI A;  1NYA A;  1F54 A;  3NSK A;  3EKJ A;  5HYD A;  1K8U A;  2PMY A;  4L9M A;  2KBI A;  2ZNE A;  1Y6W A;  4CFQ A;  3QME A;  1CFD A;  2NCP A;  1KQV A;  4QJ3 B;  4DRW A;  4MRX A;  3R1O A;  1EH2 A;  2LVK A;  1S3P A;  2WC8 A;  1TTX A;  1BR4 B;  2QPT A;  1KQM B;  3L4L A;  4JKT A;  2ZKM X;  1CM4 A;  5HLV A;  2K7C A;  4NDC A;  2P70 A;  1ZUZ A;  1XO5 A;  4HSZ A;  3UNW A;  3VRP A;  1WDC C;  4YGD B;  2MHH A;  1UP5 A;  2G9B A;  4PHM A;  3OX6 A;  4OR9 B;  2LLT A;  1L2O C;  1TCO B;  2BCA A;  3O4X A;  1YVL A;  2KPH A;  3PM2 A;  5PAL A;  1NUB A;  1BLQ A;  1SR6 B;  1LKJ A;  1M39 A;  1WY9 A;  5EL2 A;  1A03 A;  2ZRT A;  2CCM A;  5K89 A;  2K0J A;  2EGD A;  2QAC A;  1QIW A;  4HRE E;  3EKH A;  4MSP A;  1MR8 A;  1DC1 A;  1K95 A;  1B47 A;  1MWN A;  2LHI A;  3K21 A;  1XK4 C;  1VRK A;  1LS8 A;  1GGZ A;  5DIC A;  4MVF A;  1B7T Z;  1IJ5 A;  5D7F A;  1DT7 B;  5JOL A;  1IQ5 A;  5HKW A;  2CBL A;  3CR2 A;  4N5X A;  1S6C A;  3RZS A;  3QRX A;  2P6B B;  2BKH B;  2KLE A;  4P5O E;  1PAL A;  1KFU S;  1QV1 A;  2BKI B;  4YI8 A;  5I2L A;  1C3Y A;  2NCO A;  1FI5 A;  1S5G Z;  3BOW A;  3CS1 A;  3D78 A;  3JTD C;  2H2K A;  3IVT A;  3AKA A;  1QWV A;  1WRL A;  3UO9 A;  1YX8 A;  1LVC D;  2CNP A;  1IG5 A;  3C1V A;  4GGF A;  4DS7 A;  5AER A;  3S0D A;  2LP3 A;  3TDU A;  2AAO A;  2BBM A;  2Y5I A;  1M45 A;  3GK1 A;  2L51 A;  2PVB A;  3DXL A;  2VRG A;  1UHH A;  1CMG A;  1CDM A;  2KOT A;  2PRU A;  4OZD A;  5HKY A;  1OW4 A;  1DGV A;  1C07 A;  5G08 A;  1A29 A;  2PSR A;  1B9A A;  5FI7 A;  1KK8 B;  2P71 A;  1DMO A;  1WRZ A;  1XA5 A;  1IWQ A;  3AKB A;  3R1V A;  2D8N A;  3BOW B;  3BFA A;  4MBE A;  2F2O A;  1BOC A;  4F7F A;  2KFF A;  1Y0V H;  3HCM A;  1F55 A;  2L4H A;  2KFG A;  2KAY A;  1SCM C;  1MUX A;  1NSH A;  2JOJ A;  3A8R A;  1DJW A;  3DD4 A;  3DZT A;  1CDN A;  1DF0 A;  2LV7 A;  4ORB B;  3SS3 A; 
#chains in the Genus database with same CATH homology
 2NZ0 A;  3TUY B;  4PDZ A;  5TNC A;  4DIR A;  1UHN A;  1XYD A;  3F45 A;  2Y4Q A;  1BJF A;  1KSM A;  4ORA B;  1IGV A;  1SMG A;  1NCZ A;  1F4O A;  1XFU O;  3VRQ A;  2LHL A;  1U5I B;  3BUM B;  1JSA A;  2M97 A;  2L2E A;  4N1F A;  2ZND A;  1RK9 A;  1CB1 A;  2JRF A;  3LK0 A;  4GFT A;  1SW8 A;  4JPZ B;  4I5N B;  3KF9 A;  3JVT C;  3NXA A;  1RFJ A;  1DF0 B;  3M0W A;  3SG7 A;  3CZT X;  1K93 D;  4GPL B;  2OS8 C;  3EK7 A;  1YRU B;  1J1D A;  3HX4 A;  3IQQ A;  3DF0 A;  5CPV A;  3FS7 A;  3FWC A;  3LLE A;  1W7J B;  3I5H C;  1A75 B;  2LVV A;  3D10 A;  3I5F C;  3CR4 X;  1FPW A;  1KCY A;  1V1G A;  5DKN A;  2LP2 A;  2F2P A;  4U8D A;  2KQY A;  2GGM A;  1MXL C;  1J7Q A;  1K9P A;  5KSZ A;  1TNX A;  1CDL A;  1R6P A;  2F33 A;  1S36 A;  3TDI A;  1JF0 A;  5I2O A;  2K7O A;  5B8I B;  4GAO A;  3DF0 B;  1J7P A;  1TNP A;  5AEQ A;  2M49 B;  3CLN A;  1QX2 A;  4PE7 A;  3PLF B;  2M7L A;  4YGC B;  4DUQ A;  2K8M B;  3LL8 B;  1S5G Y;  2OTG C;  2SCP A;  2EHB A;  2NLN A;  1K90 D;  2SAS A;  4ZCU A;  1BF5 A;  4PHN A;  2G2B A;  2I7A A;  1S26 D;  4ICB A;  1QTX A;  3KEV A;  1B8C A;  4UPG A;  5KTY A;  1SL8 A;  1MHO A;  2O5G A;  1JWD A;  3ZWH A;  2PAL A;  2WOR A;  3D0Y A;  3WXA A;  2M9G A;  1J7R A;  2KYC A;  1IQ3 A;  2H61 C;  2M3W A;  4CPV A;  3E3R A;  3GK2 A;  1A4P A;  1OQP A;  3FWB A;  1PVA A;  4BY4 A;  2FOT A;  3SG3 A;  1BMO A;  1K94 A;  1NCY A;  4OV2 A;  4C0J A;  1JFK A;  1F8H A;  4WQ2 A;  3O4Y A;  3SIA A;  1YVH A;  1KFU L;  2LC5 A;  1QVI Z;  3BYA A;  2LM5 A;  3D0Y B;  5I8N A;  2LE9 B;  2ZFD A;  3FIA A;  1NX1 A;  2JT3 A;  2KGB C;  2HQW A;  1CLL A;  4R1E A;  2BEC A;  4PHJ A;  2BBN A;  2ZN8 A;  5CSN A;  1J1E A;  1JF2 A;  1Q80 A;  1NP8 A;  4PAL A;  4NQG A;  5AXI A;  5GQQ C;  3RLZ A;  1NX2 A;  2MLE C;  5HLO A;  1TRF A;  1M46 A;  1XFV O;  3NSL A;  4P2Y B;  4PE4 A;  1WLZ A;  2FCE A;  2JTZ A;  4MRY A;  1Y1X A;  1JFJ A;  4AOM A;  1YUS A;  3VRO A;  4ETO A;  1EL4 A;  2AUC A;  1LIN A;  1XFX O;  4OKH A;  3RM1 A;  3TDZ A;  4ORC B;  2V53 A;  1CFP A;  4MZJ A;  1LXF C;  4GNK B;  2E6W A;  2CTN A;  2DOQ A;  3DVJ A;  3PN7 C;  1KQM C;  1CLM A;  5FYX A;  3DVM A;  1EXR A;  1QLK A;  4I5K A;  4NDD A;  3DVE A;  3O78 A;  3OHM B;  3EK8 A;  2KSP A;  3BXK A;  3SG6 A;  2ISD A;  3BQ3 A;  2K61 A;  1G8I A;  1RWY A;  3AAK A;  2NXQ A;  5AFP A;  4GBA A;  4AQJ A;  4FQO A;  1UHK A;  4WQ3 A;  1FF1 A;  1SPY A;  2F8P A;  2LLS A;  4I5L B;  2A4J A;  4JQ0 D;  5IBW A;  3OB2 B;  1ALV A;  2COL B;  1BOD A;  4MZL A;  3SJS A;  1CDP A;  3TS5 B;  2IS9 A;  1AJ5 A;  1UHI A;  2CT9 A;  5BPJ A;  4CFR A;  3I5H B;  3I5F B;  4PE0 A;  4QJ5 B;  1REC A;  1ODB A;  1V1F A;  2LAP A;  5ER4 X;  1J55 A;  1FBV A;  4YGA A;  2WCF A;  2WOS A;  1Y1A A;  3I5G B;  4YRU A;  1N65 A;  3SIB A;  1C7W A;  1DGU A;  2KI4 B;  1SCV A;  3PAL A;  1XFW O;  2F3Z A;  2KQ6 A;  1QAT A;  2Y1M A;  1YUU A;  2EC6 B;  5CSI A;  2LUX A;  1B8R A;  2H61 A;  3I5I B;  4JWQ A;  5J3X A;  1QVI Y;  2JNX A;  3GK4 X;  4HRH A;  2OTG B;  1NX0 A;  1BG1 A;  4PCW A;  1DJY A;  3BUX B;  1DJH A;  1DJZ A;  1G33 A;  1QLS A;  1UUS A;  4MZK A;  4WRI A;  2KAV A;  3LCP C;  1TNQ A;  1YR5 A;  2JWW A;  1B4C A;  5CSF A;  3O6B A;  3A4U B;  1SBJ A;  2K7B A;  4N1G A;  1CFF A;  3PAT A;  1QIV A;  1OMD A;  2JQ6 A;  3IF7 A;  5AAN A;  3TUY C;  1UWO A;  3IQO A;  1JBA A;  1GGW A;  4Q04 A;  1OSA A;  2L4I A;  2ZN9 A;  1AJ4 A;  1N2D A;  1D1O A;  1EG4 A;  2LNK A;  3SG2 A;  2M1U A;  1QJT A;  2OPO A;  1WDC B;  2LMV A;  4A4B A;  1XK4 A;  1KWO C;  1W7I B;  2JZI A;  3KPX A;  1BOC A;  3SG4 A;  4M2Q A;  2M7N A;  1ZMZ A;  2BL0 C;  2JUL A;  1KFX S;  1QAS A;  2KGR A;  1S6J A;  2L0P A;  4OVN F;  1L2O B;  3BUN B;  1QV0 A;  1CM1 A;  1M63 B;  1SL9 A;  1JUO A;  4IL1 A;  1RRO A;  4XJK A;  1K9U A;  3NSI A;  4MLW A;  2K2A A;  2LVJ A;  2L98 A;  1SRA A;  4YI9 A;  3EVU A;  1WLM A;  1SYM A;  1N0Y A;  1IRJ A;  1HQV A;  1PRW A;  1XVJ A;  5JJG A;  2KI6 D;  4HRG A;  1IKU A;  4C0L A;  1DVI A;  3AAJ A;  1YX7 A;  4F0Z B;  3JTD B;  2TN4 A;  4XJK B;  3PN7 B;  1AK8 A;  1K96 A;  3H4S E;  3LK1 A;  5DKR A;  2AMI A;  1YRT B;  3KO0 A;  1QX5 B;  1XFZ O;  2O60 A;  1OE9 B;  2ZRS A;  1L7Z A;  1QS7 A;  3BUW B;  1EG3 A;  1DJX A;  1PSB A;  1TOP A;  3EK4 A;  2KHN A;  1FI6 A;  2LAN A;  5F6T A;  3WNX B;  1CKK A;  2MAZ A;  2LMU A;  3GOF A;  1GQM A;  3PFV A;  4PHK A;  2M1K B;  2WCB A;  2BCB A;  1S6I A;  2BE6 A;  2JC2 A;  1NX3 A;  2HQ8 A;  1MQ1 A;  1NCX A;  1QXP A;  1SCM B;  1ALW A;  2CXJ A;  2F3Y A;  1MXE A;  4ZCV A;  5KU1 A;  1B1G A;  1H8B A;  2MBX A;  4D1E A;  1OMV A;  1EJ3 A;  4DCK A;  3OB1 B;  1PK0 D;  1BT6 A;  3SG5 A;  4YBH B;  1BR1 B;  1SL7 A;  3KHE A;  2WCE A;  2Q4U A;  1JC2 A;  1UHJ A;  2M29 A;  1CMF A;  1IJ6 A;  3WHU B;  2WND A;  3OP0 A;  1H4B A;  1SY9 A;  3NSO A;  3PSR A;  3ZNI A;  1J7O A;  1C7V A;  2FJU B;  3JVT B;  2LMT A;  1K9K A;  2E30 A;  2MA2 A;  2JPT A;  2MRD A;  2KFH A;  1SR6 C;  2LLU A;  1FW4 A;  4GUK A;  3EVR A;  2L5X B;  2OS8 B;  1G4Y R;  1KK7 Y;  1UUR A;  2KI6 C;  4TNC A;  4XYN A;  2BE4 A;  2RGI A;  4E68 A;  2LUC A;  2HF5 A;  4A4C A;  3O2P A;  1SK6 D;  1SKT A;  2Q91 A;  2PAS A;  1TCF A;  1BU3 A;  3DVK A;  1ZOT B;  3OX5 A;  3BUO B;  1NIW A;  3VRN A;  1A2X A;  1IH0 A;  1R2U A;  4PE1 A;  2I94 A;  1WRK A;  2KAX A;  1OZS A;  2I18 A;  1CLB A;  1PUL A;  1U5I A;  1E8A A;  1SNL A;  4YGB B;  1RTP 1;  2JXC A;  1K2H A;  5ER5 A;  2FCD A;  1TIZ A;  1AVS A;  2KBM A;  3PM8 A;  4C0K A;  1OOJ A;  1KSO A;  1AHR A;  5DKQ A;  1PVB A;  4CID A;  3TZ1 A;  1F71 A;  2M0R A;  2B1U A;  2JXL A;  1ZFS A;  2I2R E;  2JT0 A;  1NWD A;  1DTL A;  1RJV A;  2JTT A;  4M2O A;  1KWO B;  1KK8 C;  2KNE A;  1A75 A;  2JT8 A;  2JU0 A;  2K7D A;  2BCX A;  3CTN A;  2BL0 B;  1KFX L;  4MEW A;  1AP4 A;  1CTR A;  4CLN A;  1CFC A;  3MSE B;  4YGE B;  1B8L A;  4QJ4 B;  3EVV A;  1AUI B;  4GGF C;  1DJG A;  1OZO A;  5CSJ A;  2GGZ A;  5HKZ A;  4OCI A;  4M2P A;  1TNW A;  1MF8 B;  2GV5 A;  5I2Q A;  4GGN A;  2LCP A;  4BY5 A;  2MJW B;  3TS5 C;  1ZAC A;  1M31 A;  1F70 A;  1LA0 A;  1LA3 A;  2KDH A;  2L50 A;  1NPQ A;  2Y1N A;  4USL A;  1TN4 A;  2JNF A;  4MN0 A;  2HPS A;  2M8U A;  1KK7 Z;  1QX7 A;  5D69 A;  2HET A;  4I5J A;  1OMR A;  3VGO A;  3I5G C;  2LVI A;  1GJY A;  1YUT A;  2KI4 C;  1YTZ C;  3VRR A;  2EC6 C;  1YUR A;  1X02 A;  1S1E A;  3CR5 X;  1B7T Y;  2MLF C;  4AQI A;  2K2F A;  1Y1U A;  3CGA A;  3CWG A;  3ICB A;  3I5I C;  4NDB A;  1CNP A;  1XFY O;  2R2I A;  4FTG A;  1F4Q A;  1HT9 A;  3WHT B;  1PSR A;  2KYF A;  1DJI A;  1NYA A;  1F54 A;  3NSK A;  3EKJ A;  5HYD A;  1K8U A;  2PMY A;  4L9M A;  2KBI A;  2ZNE A;  1Y6W A;  4CFQ A;  1CFD A;  2NCP A;  1KQV A;  4QJ3 B;  4DRW A;  4MRX A;  1EH2 A;  2LVK A;  1S3P A;  2WC8 A;  1TTX A;  1BR4 B;  2QPT A;  1KQM B;  2ZKM X;  1CM4 A;  5HLV A;  2K7C A;  4NDC A;  1ZUZ A;  1XO5 A;  4HSZ A;  3VRP A;  1WDC C;  4YGD B;  2MHH A;  1UP5 A;  2G9B A;  4PHM A;  3OX6 A;  4OR9 B;  2LLT A;  1L2O C;  1TCO B;  2BCA A;  1YVL A;  5PAL A;  1NUB A;  1BLQ A;  1SR6 B;  1LKJ A;  1M39 A;  1WY9 A;  1A03 A;  2ZRT A;  2CCM A;  5K89 A;  2K0J A;  2EGD A;  2QAC A;  1QIW A;  4HRE E;  3EKH A;  4MSP A;  1MR8 A;  1K95 A;  1B47 A;  1MWN A;  2LHI A;  3K21 A;  1XK4 C;  1VRK A;  1GGZ A;  4MVF A;  1B7T Z;  1IJ5 A;  5D7F A;  1DT7 B;  5JOL A;  1IQ5 A;  5HKW A;  2CBL A;  3CR2 A;  4N5X A;  1S6C A;  3QRX A;  2P6B B;  2BKH B;  4P5O E;  1PAL A;  1KFU S;  1QV1 A;  2BKI B;  4YI8 A;  5I2L A;  1FI5 A;  2NCO A;  1S5G Z;  3BOW A;  3CS1 A;  3JTD C;  2H2K A;  3AKA A;  1WRL A;  4DS7 A;  1YX8 A;  1LVC D;  2CNP A;  1IG5 A;  3C1V A;  4GGF A;  5AER A;  2LP3 A;  3TDU A;  2AAO A;  2BBM A;  2Y5I A;  1M45 A;  3GK1 A;  2L51 A;  2PVB A;  2VRG A;  1UHH A;  1CMG A;  1CDM A;  2KOT A;  2PRU A;  5HKY A;  1DGV A;  1C07 A;  5G08 A;  1A29 A;  2PSR A;  1B9A A;  1KK8 B;  1DMO A;  1WRZ A;  1XA5 A;  1IWQ A;  3AKB A;  2D8N A;  3BOW B;  4MBE A;  2F2O A;  2KFF A;  1Y0V H;  3HCM A;  1F55 A;  2L4H A;  2KFG A;  2KAY A;  1SCM C;  1MUX A;  1NSH A;  2JOJ A;  3A8R A;  1DJW A;  3DD4 A;  1CDN A;  1DF0 A;  2LV7 A;  4ORB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...