2LLSA

Solution structure of human apo-s100a1 c85m
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
93
structure length
93
Chain Sequence
GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVAMNNFFWENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A1
publication title Chemical Shift Assignments and solution structure of human apo-S100A1 C85M mutant
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 34
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2llsA00
4F0ZB 1CLMA 1SRAA 2K7DA 4P2YB 2JNFA 3PFVA 2H2KA 1YUSA 5I2QA 1TN4A 1U5IB 2HQ8A 4WRIA 1SL9A 2LM5A 1B47A 1PVAA 3KPXA 2L4IA 4GAOA 5BPJA 1VRKA 1FI6A 2GV5A 1QTXA 2PSRA 1PSRA 1IG5A 1OOJA 3CGAA 1JBAA 1IJ5A 2Q4UA 1XFZO 5CSNA 1YRTB 2LMVA 1KWOC 5I2OA 1KQVA 2BE4A 1KQMB 3TS5B 1XK4C 2ZNEA 1WDCC 2PALA 3SG5A 3FIAA 1K9UA 2HF5A 4MBEA 1QVIY 1QX2A 4MSPA 1L7ZA 4PALA 1R2UA 2MLFC 2PRUA 2BE6A 2JOJA 3BOWB 3HX4A 1EXRA 1KK8B 1BLQA 1NCXA 2L2EA 4YGCB 3TDUA 1BJFA 4AQIA 1QLKA 1CMGA 2KAVA 2BKHB 1KK7Y 3WHTB 1G8IA 1GQMA 4MZJA 1CKKA 3KO0A 2SASA 1YX7A 5J3XA 3PN7B 3H4SE 3BUMB 4GUKA 2MJWB 3O2PA 3EK7A 2JTZA 1BR1B 2PMYA 1S6JA 4OVNF 2ISDA 1CNPA 1UHHA 1QV0A 1EG3A 4ORBB 3CZTX 2OS8B 3SJSA 2HETA 3I5IB 4M2PA 1XYDA 1OQPA 2LUXA 1QX7A 4GFTA 1ODBA 2AMIA 4Q04A 1QXPA 5HKYA 2L4HA 2LUCA 3IQOA 1TNXA 2M1UA 5F6TA 1KQMC 3TS5C 3NSIA 2KI6C 2B1UA 1FW4A 2LE9B 1DJZA 2LC5A 4HSZA 2WORA 1KFXL 4N1FA 1AUIB 4XJKA 4BY5A 4DUQA 5CSJA 1XFXO 1C7VA 5AXIA 2OPOA 1XFUO 3HCMA 2JZIA 2KI6D 2KSPA 2M7LA 4L9MA 1KK8C 1DVIA 4NDBA 4ZCUA 4QJ5B 4TNCA 1U5IA 1UHKA 1IGVA 1DF0A 1MXLC 1OMVA 1J7RA 5GQQC 4MLWA 2DOQA 3SG3A 1PALA 1XO5A 1A03A 2KGBC 1DJYA 1YURA 2M7NA 3BXKA 2BCAA 5D69A 1DGUA 1Y0VH 1CFDA 3PN7C 4YI9A 1CFPA 3OHMB 2BL0B 3GOFA 1OZOA 2M8UA 4FQOA 4PDZA 2TN4A 4NDCA 5HYDA 2KQYA 1XVJA 3SG7A 1S6CA 1Y1XA 4PE7A 1A75B 3I5FC 1OE9B 3LLEA 3EKJA 5AERA 2ZN9A 3A4UB 1LXFC 5DKQA 3DF0B 3C1VA 4FTGA 1CFFA 5IBWA 4PHNA 2FCEA 3EKHA 1S6IA 4PE0A 1NP8A 1K8UA 4GGFA 2JXLA 5B8IB 1W7IB 4DRWA 1SPYA 3QRXA 2WOSA 3BQ3A 2KBMA 2CXJA 2JPTA 1NIWA 3I5HB 1UHNA 1QS7A 2LAPA 1SCMB 2LVKA 2K2AA 2Y4QA 1WY9A 2NCOA 4YRUA 3D10A 5CPVA 1PSBA 3O6BA 1B8LA 2L5XB 1MWNA 4JPZB 1NX0A 5TNCA 1JSAA 1HT9A 1F4OA 1W7JB 1ZMZA 1SY9A 1S5GZ 3O4YA 1NSHA 2O5GA 1WRLA 3SIBA 1ZOTB 1S3PA 1CB1A 2JNXA 1YVLA 4GBAA 4QJ3B 3E3RA 5DKRA 1H4BA 3CR5X 1AK8A 1UUSA 1DF0B 1F4QA 1JF2A 2F33A 4C0KA 1K2HA 1QX5B 5KSZA 1Y6WA 1QATA 2I7AA 2JRFA 4N1GA 4DIRA 1B9AA 2WCFA 2F8PA 1WLMA 2I18A 4QJ4B 1MXEA 1TRFA 2L51A 3DD4A 1NX1A 3TZ1A 4MEWA 3VRPA 2R2IA 2G9BA 3CTNA 2FJUB 3MSEB 2LMTA 1BT6A 4DS7A 4MZKA 4A4CA 1LINA 3I5HC 1KFUL 1J7QA 1S26D 1IH0A 1RK9A 4IL1A 1TCFA 3I5GB 5D7FA 3SG2A 1CFCA 2L0PA 1EH2A 1B8RA 1JUOA 2G2BA 2LANA 1FBVA 1YUUA 3NXAA 2JC2A 2CBLA 4M2QA 2SCPA 1C7WA 2PVBA 3IF7A 3PLFB 3BUWB 2CCMA 2M0RA 3A8RA 1F8HA 4PHMA 1QIVA 5AEQA 2A4JA 3WXAA 1UP5A 4PCWA 1RECA 3KEVA 1A75A 4OCIA 1M46A 1YR5A 1AHRA 1L2OB 2K7OA 2KAYA 4NDDA 1NWDA 1XFVO 3DF0A 1IKUA 2BBNA 3ICBA 2GGZA 2AUCA 4UPGA 2M3WA 3SG6A 3TUYB 5K89A 2K8MB 1NCZA 1TCOB 1N0YA 1NCYA 1XFWO 1BMOA 1UURA 4I5NB 4PHJA 1F55A 1AVSA 1DJXA 4MVFA 3LL8B 2JTTA 2D8NA 4MRYA 3NSLA 2JXCA 2LP3A 2NZ0A 4XYNA 1F70A 1SMGA 1GGZA 2JU0A 4GGNA 4CPVA 5JJGA 3JTDB 4CFRA 3CWGA 1MHOA 1SKTA 2KFGA 2EC6B 1MF8B 2KNEA 5G08A 2M97A 2KGRA 3IQQA 1N65A 2K2FA 1MQ1A 3EVUA 2ZFDA 3GK1A 1GJYA 4GGFC 2QACA 4ORAB 2M49B 1KFXS 3EK8A 1UHIA 1DTLA 1UHJA 2BCXA 2COLB 3AAKA 3LK1A 2K61A 2LLTA 2KYCA 3GK4X 3OB1B 3VRRA 1CLLA 3DVJA 1SL8A 3BUOB 4YBHB 4HRGA 4YGBB 2OTGB 2EHBA 2CT9A 1HQVA 4YGAA 3BUNB 4ZCVA 3TUYC 2LP2A 1RFJA 3FS7A 1M63B 2WCBA 3FWBA 3CLNA 5AFPA 1KCYA 3DVMA 2OS8C 1ZFSA 4YGDB 3PALA 1IRJA 1WRZA 1BU3A 2LLUA 2M1KB 3BUXB 2KHNA 3I5IC 1QVIZ 2RGIA 3M0WA 1A29A 1J7OA 1CDMA 3WNXB 5HKWA 3OX5A 3CS1A 3KHEA 1SR6B 1J7PA 2JWWA 2WC8A 2Y1NA 1JC2A 4I5KA 1CDLA 1FF1A 1SL7A 3SIAA 2NXQA 2KOTA 3PATA 1B7TZ 1QLSA 1M39A 2WNDA 4OKHA 1CTRA 3PM8A 4PE1A 1RROA 1Q80A 1X02A 2MHHA 1M45A 4E68A 2VRGA 1J1DA 4AOMA 1K9KA 1FI5A 4USLA 1CLBA 3OB2B 5FYXA 1KWOB 5CSFA 1PK0D 1OZSA 2NCPA 4PHKA 1QASA 1RWYA 1TIZA 1B8CA 4CIDA 2BL0C 1WDCB 1F71A 1V1FA 2F3ZA 1MUXA 2BKIB 2P6BB 4I5JA 2LHIA 2L50A 1N2DA 1NX3A 2KQ6A 5ER4X 2MA2A 1NUBA 2JULA 1F54A 4HRHA 1JFJA 4PE4A 1BG1A 1WLZA 3EVVA 4JWQA 5JOLA 3PSRA 1LVCD 1G4YR 2Y1MA 4ETOA 3F45A 1B4CA 3EVRA 1CMFA 4DCKA 1JF0A 2FCDA 2I94A 1JWDA 2ZKMX 1K96A 1MR8A 2IS9A 3ZNIA 1SCVA 1NX2A 1R6PA 4AQJA 2BECA 1K9PA 2LV7A 3CR2A 4GPLB 1A2XA 1K90D 1ZACA 2LVJA 1SCMC 2ZRSA 1IQ3A 1KSOA 3BYAA 1ALWA 1CM4A 2H61A 3JVTB 1KFUS 2EGDA 3VRQA 4C0LA 2MLEC 4M2OA 2F2PA 3RM1A 1BOCA 1CDPA 1DJGA 2Y5IA 4WQ2A 1Y1UA 3D0YB 2F2OA 2K7CA 1EG4A 4MZLA 1K94A 4JQ0D 2KFHA 1J55A 1S1EA 3AKBA 1NPQA 1C07A 1YX8A 3VGOA 3VROA 4YI8A 1TNQA 1K93D 2NLNA 4ICBA 2WCEA 3ZWHA 3DVKA 1BODA 3WHUB 1AJ5A 4MRXA 1XFYO 2KDHA 1Y1AA 1BR4B 1SW8A 2KYFA 2LNKA 1IJ6A 1QV1A 2LLSA 2HQWA 1ALVA 1NYAA 4OV2A 1LA0A 4NQGA 3LCPC 3NSKA 4A4BA 1B7TY 2K7BA 1SK6D 4ORCB 2BBMA 1EJ3A 2KAXA 1PULA 5CSIA 1V1GA 2HPSA 1PVBA 3I5GC 5PALA 2MBXA 2JQ6A 1SYMA 5I8NA 5KU1A 3JVTC 1RTP1 4OR9B 1S5GY 1YVHA 1ZUZA 2I2RE 2ZRTA 3I5FB 1CDNA 1FPWA 2CTNA 1UWOA 1XK4A 4HREE 2KI4B 2LVVA 1JFKA 1OMRA 3AKAA 2JT8A 1OMDA 3GK2A 2M29A 2LMUA 1DJIA 3SG4A 1J1EA 1L2OC 1SNLA 2E6WA 1H8BA 1PRWA 2LVIA 1TNPA 2PASA 3TDZA 4CFQA 1D1OA 1RJVA 1S36A 5HLVA 1E8AA 1DGVA 2CNPA 2KFFA 2JT0A 5KTYA 4MN0A 2FOTA 4WQ3A 5ER5A 2JT3A 1QIWA 4YGEB 3KF9A 1YUTA 2LHLA 1XA5A 3OP0A 1YRUB 2LCPA 3JTDC 1CM1A 1TOPA 2BCBA 3OX6A 2L98A 2MRDA 5AANA 2EC6C 1LKJA 4C0JA 4BY4A 2GGMA 2F3YA 1OSAA 5DKNA 3TDIA 1IWQA 3D0YA 1KSMA 1KK7Z 2KBIA 1WRKA 1AJ4A 2QPTA 2ZNDA 1EL4A 2O60A 1DJHA 4U8DA 1G33A 1DMOA 2KI4C 3DVEA 1QJTA 2MAZA 4P5OE 4N5XA 3EK4A 1TNWA 4R1EA 1IQ5A 4D1EA 1SBJA 2H61C 3K21A 1K95A 2E30A 3BOWA 2OTGC 1YTZC 1B1GA 2Q91A 1A4PA 5HLOA 1BF5A 1DT7B 3FWCA 2K0JA 1DJWA 2M9GA 3AAJA 3LK0A 4I5LB 4CLNA 3O78A 3CR4X 1AP4A 4GNKB 3RLZA 3NSOA 5I2LA 1LA3A 2V53A 5HKZA 1TTXA 1M31A 1GGWA 1SR6C 2AAOA 2ZN8A 3VRNA 4XJKB
chains in the Genus database with same CATH superfamily
4F0ZB 2QEVA 1CLMA 1SRAA 2K7DA 4P2YB 2JNFA 3CZ0A 1DEKA 3PFVA 2H2KA 1YUSA 1DELA 1TN4A 1U5IB 2HQ8A 5I2QA 4WRIA 1SL9A 2LM5A 1B47A 3R1OA 1PVAA 3KPXA 2L4IA 4GAOA 5BPJA 3OGNA 1VRKA 1FI6A 2GV5A 1QTXA 2PSRA 1PSRA 1IG5A 1OOJA 3CGAA 1JBAA 1IJ5A 2Q4UA 1XFZO 5CSNA 1YRTB 3B86A 2LMVA 1KWOC 5I2OA 1KQVA 1LS8A 2BE4A 1KQMB 3K1EA 3TS5B 1XK4C 2ZNEA 1WDCC 2PALA 3SG5A 1C3ZA 3FIAA 1K9UA 2HF5A 4MBEA 1QVIY 3NHIA 1TUZA 1QX2A 4MSPA 1L7ZA 4PALA 1R2UA 3R1PA 2MLFC 2PRUA 2BE6A 2JOJA 3BOWB 3HX4A 1EXRA 4FQTA 1KK8B 1BLQA 1NCXA 2L2EA 4YGCB 3TDUA 1BJFA 4AQIA 1QLKA 1CMGA 2KAVA 2BKHB 1KK7Y 3WHTB 1G8IA 1GQMA 1OOGA 4MZJA 1CKKA 3KO0A 2SASA 1YX7A 3PM2A 1TUJA 5J3XA 3PN7B 3H4SE 3BUMB 3L47A 2MJWB 3O2PA 4GUKA 3EK7A 2JTZA 1BR1B 2PMYA 1S6JA 4OVNF 2ISDA 1CNPA 1UHHA 1QV0A 2WCLA 1EG3A 4ORBB 3CZTX 2OS8B 4INWA 3SJSA 2HETA 3I5IB 4M2PA 1XYDA 1OQPA 2LUXA 1QX7A 4GFTA 1ODBA 2AMIA 4Q04A 1QXPA 5HKYA 2L4HA 2LUCA 3RZSA 3IQOA 1TNXA 2M1UA 5F6TA 1KQMC 3S0BA 3TS5C 3NSIA 2WCJA 2KI6C 2B1UA 1FW4A 2LE9B 2YGUA 2KLDA 1DJZA 2LC5A 4HSZA 2WORA 3FE8A 1KFXL 3EG5B 1T14A 4N1FA 1AUIB 4XJKA 4BY5A 4DUQA 3SS3A 3NHTA 5CSJA 1XFXO 1C7VA 5AXIA 2OPOA 1XFUO 3HCMA 2JZIA 2KI6D 2KSPA 3R1VA 4L9MA 1KK8C 2M7LA 1DVIA 4NDBA 4ZCUA 4QJ5B 3VB1A 4TNCA 2KLEA 1U5IA 1UHKA 1IGVA 1DF0A 1MXLC 1OMVA 1J7RA 5GQQC 4MLWA 2DOQA 3SG3A 1PALA 1XO5A 3SS4A 1A03A 2KGBC 1DJYA 1YURA 2H8VA 2M7NA 2BCAA 3BXKA 5D69A 1DGUA 1Y0VH 1CFDA 3PN7C 4YI9A 1CFPA 3OHMB 2BL0B 3GOFA 1OZOA 2M8UA 4FQOA 4PDZA 2TN4A 4NDCA 5HYDA 2KQYA 1XVJA 3SG7A 1S6CA 1Y1XA 4PE7A 1A75B 3I5FC 1OE9B 3LLEA 3EKJA 5AERA 2ZN9A 3A4UB 1LXFC 5DKQA 3L4AA 3DF0B 3C1VA 4FTGA 4JD9A 1CFFA 1TWOA 4PHNA 5IBWA 2FCEA 3CZ1A 2QEOA 3EKHA 1S6IA 3O4XA 1NP8A 4PE0A 1K8UA 4GGFA 2JXLA 5HL1A 5B8IB 1W7IB 4DRWA 1SPYA 3QRXA 2WOSA 3BQ3A 2L2CA 2KBMA 2CXJA 2JPTA 1NIWA 3I5HB 1UHNA 1QS7A 2LAPA 1SCMB 2LVKA 2K2AA 2WC6A 2Y4QA 1WY9A 2NCOA 4YRUA 3D10A 5CPVA 1PSBA 3O6BA 1B8LA 2L5XB 1MWNA 4JPZB 1NX0A 5TNCA 2PYQA 1JSAA 1HT9A 1F4OA 1W7JB 3UO9A 1ZMZA 1SY9A 3QMEA 1S5GZ 3O4YA 1NSHA 2O5GA 1WRLA 3SIBA 1ZOTB 1S3PA 1CB1A 2JNXA 1YVLA 4GBAA 4QJ3B 3D78A 3E3RA 5DKRA 1H4BA 3CR5X 1AK8A 1UUSA 1DF0B 1DQEA 3CZ2A 1F4QA 1JF2A 2F33A 5FI7A 4C0KA 1K2HA 1QX5B 5KSZA 1Y6WA 1QATA 2I7AA 2JRFA 4N1GA 4DIRA 1B9AA 1OW4A 2WCFA 2F8PA 3S0DA 1WLMA 2I18A 4QJ4B 1MXEA 1TRFA 3PJIA 2L51A 3DD4A 1NX1A 3B6XA 3TZ1A 4MEWA 3VRPA 3S0AA 2R2IA 2G9BA 3CTNA 2FJUB 3MSEB 2LMTA 1BT6A 4DS7A 3SS5A 2L5YA 4MZKA 4A4CA 4PT1A 1LINA 3I5HC 1KFUL 1J7QA 1S26D 1IH0A 1RK9A 4IL1A 1OOHA 1TCFA 3I5GB 2KPHA 3D77A 5D7FA 3SG2A 1CFCA 2L0PA 2BNXA 1EH2A 1B8RA 1JUOA 2G2BA 2LANA 1FBVA 1YUUA 3NXAA 2JC2A 2CBLA 4M2QA 2SCPA 1C7WA 2PVBA 3IF7A 1OOFA 3PLFB 3BUWB 2CCMA 2M0RA 3A8RA 1F8HA 4PHMA 1ORGA 1QIVA 5AEQA 2A4JA 3Q8IA 3WXAA 1UP5A 4PCWA 2QEHA 1RECA 3KEVA 1A75A 4OCIA 1M46A 1YR5A 1AHRA 1L2OB 2K7OA 2KAYA 4NDDA 1NWDA 1XFVO 3DF0A 1IKUA 2BBNA 3ICBA 2GGZA 1IIOA 2AUCA 4UPGA 2M3WA 3SG6A 3TUYB 5FI6A 5K89A 2K8MB 4KYNA 1NCZA 1TCOB 1N0YA 1NCYA 1XFWO 1UURA 1BMOA 4I5NB 4PHJA 3BFAA 1F55A 1AVSA 1DJXA 4MVFA 3DY9A 3LL8B 1XFRA 2JTTA 2D8NA 4MRYA 3DZTA 3NSLA 2JXCA 2LP3A 2NZ0A 4XYNA 1F70A 1SMGA 1GGZA 2JU0A 3L4LA 4GGNA 4CPVA 5JJGA 3JTDB 4CFRA 3S0EA 3CWGA 1MHOA 1SKTA 2KFGA 2EC6B 1MF8B 2KNEA 5G08A 3D73A 2M97A 2KGRA 3IQQA 1N65A 2K2FA 1MQ1A 3EVUA 3FE6A 2ZFDA 3GK1A 1GJYA 4GGFC 2QACA 4ORAB 2M49B 1KFXS 3EK8A 1UHIA 1DTLA 1UHJA 2BCXA 2COLB 3DYEA 3AAKA 3LK1A 2K61A 2LLTA 2KYCA 3GK4X 3OB1B 3VRRA 1CLLA 3DVJA 1SL8A 3BUOB 4YBHB 2P71A 4HRGA 4YGBB 2OTGB 2EHBA 2CT9A 1HQVA 4YGAA 3BUNB 4ZCVA 3TUYC 2LP2A 1RFJA 3BFHA 3FS7A 1M63B 2WCBA 3FWBA 3CLNA 5AFPA 1KCYA 3DVMA 2OS8C 1ZFSA 4YGDB 3PALA 1IRJA 1WRZA 1BU3A 2LLUA 2M1KB 3BUXB 2KHNA 3I5IC 3CABA 1QVIZ 2RGIA 3M0WA 1A29A 5I94A 1J7OA 1CDMA 2QEBA 1Z2CB 3WNXB 5HKWA 3OX5A 3CS1A 3KHEA 1SR6B 1J7PA 2JWWA 2WC8A 2Y1NA 1JC2A 4I5KA 1CDLA 1FF1A 1SL7A 2P70A 3UNWA 3CDNA 3SIAA 2NXQA 2KOTA 3PATA 2GTEA 1B7TZ 1QLSA 1M39A 3IVTA 2WNDA 2WCKA 4OKHA 1CTRA 3PM8A 4PE1A 4INXA 1RROA 1Q80A 1X02A 2MHHA 1M45A 4E68A 2VRGA 1J1DA 3N7HA 4AOMA 1K9KA 1FI5A 4USLA 1CLBA 3OB2B 5FI2A 1KWOB 5CSFA 5FYXA 1PK0D 1OZSA 2NCPA 4PHKA 1QASA 1RWYA 1TIZA 1B8CA 4CIDA 1WDCB 2BL0C 1F71A 1V1FA 2F3ZA 1MUXA 2BAPA 2BKIB 2P6BB 4I5JA 2LHIA 2L50A 1N2DA 1NX3A 2KQ6A 5ER4X 2MA2A 1NUBA 2JULA 4JKTA 1F54A 4F7FA 4HRHA 1JFJA 4PE4A 3FE9A 1BG1A 1WLZA 3EVVA 4JWQA 5JOLA 3PSRA 1LVCD 1G4YR 2Y1MA 4ETOA 3F45A 1B4CA 3EVRA 1CMFA 4DCKA 1JF0A 2FCDA 2I94A 1JWDA 2WC5A 3OBVA 2ZKMX 1K96A 1MR8A 2IS9A 3ZNIA 1SCVA 1NX2A 1R6PA 4AQJA 2BECA 1K9PA 1SSEB 2LV7A 3CR2A 3BFBA 1A2XA 1K90D 1ZACA 2LVJA 1SCMC 2ZRSA 4GPLB 1KSOA 3BYAA 1IQ3A 2WCHA 1ALWA 1CM4A 2H61A 3JVTB 1KFUS 2EGDA 3VRQA 4C0LA 2MLEC 4M2OA 2F2PA 3RM1A 1BOCA 1CDPA 1DJGA 2Y5IA 4WQ2A 3B7AA 1Y1UA 2PQLA 3D0YB 2F2OA 2K7CA 1EG4A 3NGVA 4MZLA 1K94A 4JQ0D 2KFHA 1J55A 1S1EA 3AKBA 1NPQA 1C07A 1YX8A 3VGOA 3VROA 4YI8A 1TNQA 1K93D 2NLNA 4ICBA 2WCEA 3ZWHA 3DVKA 1BODA 3WHUB 1AJ5A 4MRXA 1XFYO 2KDHA 1Y1AA 4OZDA 1BR4B 1SW8A 2KYFA 2LNKA 1IJ6A 1QV1A 2LLSA 2HQWA 2QDIA 1ALVA 1NYAA 4OV2A 1LA0A 5EL2A 1P28A 4NQGA 3LCPC 3NSKA 3DXLA 4A4BA 1B7TY 2K7BA 1OOIX 1SK6D 4ORCB 2BBMA 1EJ3A 2KAXA 3S0FA 5D3OA 1PULA 5CSIA 1V1GA 2HPSA 1PVBA 3I5GC 5PALA 2MBXA 2JQ6A 1SYMA 1DC1A 5I8NA 3B88A 5KU1A 3JVTC 1RTP1 4OR9B 1S5GY 1YVHA 1ZUZA 2FJYA 2I2RE 2ZRTA 3I5FB 1CDNA 1FPWA 2CTNA 1QWVA 1UWOA 1W9ZA 1XK4A 2KI4B 2LVVA 4HREE 1JFKA 1OMRA 3D75A 3AKAA 2JT8A 1OMDA 3GK2A 2M29A 2LMUA 4IJ7A 1DJIA 3SG4A 1J1EA 1L2OC 5DICA 1SNLA 2E6WA 1H8BA 1PRWA 2LVIA 1TNPA 2PASA 3TDZA 3BJHA 1GM0A 4CFQA 1D1OA 3S0GA 1RJVA 1S36A 5HLVA 1E8AA 1DGVA 2CNPA 2KFFA 2JT0A 5KTYA 4MN0A 2FOTA 4WQ3A 5ER5A 2JT3A 1QIWA 4YGEB 3KF9A 1YUTA 2LHLA 1XA5A 3OP0A 1YRUB 2LCPA 3JTDC 1CM1A 1TOPA 2BCBA 3OX6A 2L98A 2MRDA 5AANA 2EC6C 1LKJA 4C0JA 4BY4A 2GGMA 2F3YA 1OSAA 5DKNA 3TDIA 1IWQA 3D0YA 1KSMA 1KK7Z 3D74A 1C3YA 2KBIA 1WRKA 1AJ4A 2K60A 2QPTA 2ZNDA 1EL4A 2O60A 1DJHA 3D76A 4U8DA 1G33A 1DMOA 2KI4C 3DVEA 1QJTA 2MAZA 4P5OE 3R72A 3EK4A 1TNWA 4N5XA 4R1EA 1IQ5A 4D1EA 1SBJA 1Z4HA 2H61C 3K21A 1K95A 2E30A 3BOWA 2OTGC 1YTZC 1B1GA 2Q91A 1A4PA 5HLOA 1BF5A 1DT7B 3FWCA 2K0JA 1DJWA 2M9GA 3AAJA 3LK0A 4I5LB 3CYZA 4CLNA 2WCMA 3V2LA 3O78A 3CR4X 1AP4A 2JPOA 4GNKB 3B87A 3RLZA 3NSOA 5I2LA 1LA3A 2V53A 5HKZA 1TTXA 1M31A 1GGWA 1SR6C 2AAOA 2ZN8A 2ERBA 3VRNA 4XJKB
chains in the Genus database with same CATH topology
4F0ZB 1CLMA 1SRAA 2K7DA 4P2YB 2JNFA 3PFVA 2H2KA 1YUSA 5I2QA 1TN4A 1U5IB 2HQ8A 4WRIA 1SL9A 2LM5A 1B47A 1PVAA 3KPXA 2L4IA 4GAOA 5BPJA 1VRKA 1FI6A 2GV5A 1QTXA 2PSRA 1PSRA 1IG5A 1OOJA 3CGAA 1JBAA 1IJ5A 2Q4UA 1XFZO 5CSNA 1YRTB 2LMVA 1KWOC 5I2OA 1KQVA 2BE4A 1KQMB 3TS5B 1XK4C 2ZNEA 1WDCC 2PALA 3SG5A 3FIAA 1K9UA 2HF5A 4MBEA 1QVIY 1QX2A 4MSPA 1L7ZA 4PALA 1R2UA 2MLFC 2PRUA 2BE6A 2JOJA 3BOWB 3HX4A 1EXRA 1KK8B 1BLQA 1NCXA 2L2EA 4YGCB 3TDUA 1BJFA 4AQIA 1QLKA 1CMGA 2KAVA 2BKHB 1KK7Y 3WHTB 1G8IA 1GQMA 4MZJA 1CKKA 3KO0A 2SASA 1YX7A 5J3XA 3PN7B 3H4SE 3BUMB 4GUKA 2MJWB 3O2PA 3EK7A 2JTZA 1BR1B 2PMYA 1S6JA 4OVNF 2ISDA 1CNPA 1UHHA 1QV0A 1EG3A 4ORBB 3CZTX 2OS8B 3SJSA 2HETA 3I5IB 4M2PA 1XYDA 1OQPA 2LUXA 1QX7A 4GFTA 1ODBA 2AMIA 4Q04A 1QXPA 5HKYA 2L4HA 2LUCA 3IQOA 1TNXA 2M1UA 5F6TA 1KQMC 3TS5C 3NSIA 2KI6C 2B1UA 1FW4A 2LE9B 1DJZA 2LC5A 4HSZA 2WORA 1KFXL 4N1FA 1AUIB 4XJKA 4BY5A 4DUQA 5CSJA 1XFXO 1C7VA 5AXIA 2OPOA 1XFUO 3HCMA 2JZIA 2KI6D 2KSPA 2M7LA 4L9MA 1KK8C 1DVIA 4NDBA 4ZCUA 4QJ5B 4TNCA 1U5IA 1UHKA 1IGVA 1DF0A 1MXLC 1OMVA 1J7RA 5GQQC 4MLWA 2DOQA 3SG3A 1PALA 1XO5A 1A03A 2KGBC 1DJYA 1YURA 2M7NA 3BXKA 2BCAA 5D69A 1DGUA 1Y0VH 1CFDA 3PN7C 4YI9A 1CFPA 3OHMB 2BL0B 3GOFA 1OZOA 2M8UA 4FQOA 4PDZA 2TN4A 4NDCA 5HYDA 2KQYA 1XVJA 3SG7A 1S6CA 1Y1XA 4PE7A 1A75B 3I5FC 1OE9B 3LLEA 3EKJA 5AERA 2ZN9A 3A4UB 1LXFC 5DKQA 3DF0B 3C1VA 4FTGA 1CFFA 5IBWA 4PHNA 2FCEA 3EKHA 1S6IA 4PE0A 1NP8A 1K8UA 4GGFA 2JXLA 5B8IB 1W7IB 4DRWA 1SPYA 3QRXA 2WOSA 3BQ3A 2KBMA 2CXJA 2JPTA 1NIWA 3I5HB 1UHNA 1QS7A 2LAPA 1SCMB 2LVKA 2K2AA 2Y4QA 1WY9A 2NCOA 4YRUA 3D10A 5CPVA 1PSBA 3O6BA 1B8LA 2L5XB 1MWNA 4JPZB 1NX0A 5TNCA 1JSAA 1HT9A 1F4OA 1W7JB 1ZMZA 1SY9A 1S5GZ 3O4YA 1NSHA 2O5GA 1WRLA 3SIBA 1ZOTB 1S3PA 1CB1A 2JNXA 1YVLA 4GBAA 4QJ3B 3E3RA 5DKRA 1H4BA 3CR5X 1AK8A 1UUSA 1DF0B 1F4QA 1JF2A 2F33A 4C0KA 1K2HA 1QX5B 5KSZA 1Y6WA 1QATA 2I7AA 2JRFA 4N1GA 4DIRA 1B9AA 2WCFA 2F8PA 1WLMA 2I18A 4QJ4B 1MXEA 1TRFA 2L51A 3DD4A 1NX1A 3TZ1A 4MEWA 3VRPA 2R2IA 2G9BA 3CTNA 2FJUB 3MSEB 2LMTA 1BT6A 4DS7A 4MZKA 4A4CA 1LINA 3I5HC 1KFUL 1J7QA 1S26D 1IH0A 1RK9A 4IL1A 1TCFA 3I5GB 5D7FA 3SG2A 1CFCA 2L0PA 1EH2A 1B8RA 1JUOA 2G2BA 2LANA 1FBVA 1YUUA 3NXAA 2JC2A 2CBLA 4M2QA 2SCPA 1C7WA 2PVBA 3IF7A 3PLFB 3BUWB 2CCMA 2M0RA 3A8RA 1F8HA 4PHMA 1QIVA 5AEQA 2A4JA 3WXAA 1UP5A 4PCWA 1RECA 3KEVA 1A75A 4OCIA 1M46A 1YR5A 1AHRA 1L2OB 2K7OA 2KAYA 4NDDA 1NWDA 1XFVO 3DF0A 1IKUA 2BBNA 3ICBA 2GGZA 2AUCA 4UPGA 2M3WA 3SG6A 3TUYB 5K89A 2K8MB 1NCZA 1TCOB 1N0YA 1NCYA 1XFWO 1BMOA 1UURA 4I5NB 4PHJA 1F55A 1AVSA 1DJXA 4MVFA 3LL8B 2JTTA 2D8NA 4MRYA 3NSLA 2JXCA 2LP3A 2NZ0A 4XYNA 1F70A 1SMGA 1GGZA 2JU0A 4GGNA 4CPVA 5JJGA 3JTDB 4CFRA 3CWGA 1MHOA 1SKTA 2KFGA 2EC6B 1MF8B 2KNEA 5G08A 2M97A 2KGRA 3IQQA 1N65A 2K2FA 1MQ1A 3EVUA 2ZFDA 3GK1A 1GJYA 4GGFC 2QACA 4ORAB 2M49B 1KFXS 3EK8A 1UHIA 1DTLA 1UHJA 2BCXA 2COLB 3AAKA 3LK1A 2K61A 2LLTA 2KYCA 3GK4X 3OB1B 3VRRA 1CLLA 3DVJA 1SL8A 3BUOB 4YBHB 4HRGA 4YGBB 2OTGB 2EHBA 2CT9A 1HQVA 4YGAA 3BUNB 4ZCVA 3TUYC 2LP2A 1RFJA 3FS7A 1M63B 2WCBA 3FWBA 3CLNA 5AFPA 1KCYA 3DVMA 2OS8C 1ZFSA 4YGDB 3PALA 1IRJA 1WRZA 1BU3A 2LLUA 2M1KB 3BUXB 2KHNA 3I5IC 1QVIZ 2RGIA 3M0WA 1A29A 1J7OA 1CDMA 3WNXB 5HKWA 3OX5A 3CS1A 3KHEA 1SR6B 1J7PA 2JWWA 2WC8A 2Y1NA 1JC2A 4I5KA 1CDLA 1FF1A 1SL7A 3SIAA 2NXQA 2KOTA 3PATA 1B7TZ 1QLSA 1M39A 2WNDA 4OKHA 1CTRA 3PM8A 4PE1A 1RROA 1Q80A 1X02A 2MHHA 1M45A 4E68A 2VRGA 1J1DA 4AOMA 1K9KA 1FI5A 4USLA 1CLBA 3OB2B 5FYXA 1KWOB 5CSFA 1PK0D 1OZSA 2NCPA 4PHKA 1QASA 1RWYA 1TIZA 1B8CA 4CIDA 2BL0C 1WDCB 1F71A 1V1FA 2F3ZA 1MUXA 2BKIB 2P6BB 4I5JA 2LHIA 2L50A 1N2DA 1NX3A 2KQ6A 5ER4X 2MA2A 1NUBA 2JULA 1F54A 4HRHA 1JFJA 4PE4A 1BG1A 1WLZA 3EVVA 4JWQA 5JOLA 3PSRA 1LVCD 1G4YR 2Y1MA 4ETOA 3F45A 1B4CA 3EVRA 1CMFA 4DCKA 1JF0A 2FCDA 2I94A 1JWDA 2ZKMX 1K96A 1MR8A 2IS9A 3ZNIA 1SCVA 1NX2A 1R6PA 4AQJA 2BECA 1K9PA 2LV7A 3CR2A 4GPLB 1A2XA 1K90D 1ZACA 2LVJA 1SCMC 2ZRSA 1IQ3A 1KSOA 3BYAA 1ALWA 1CM4A 2H61A 3JVTB 1KFUS 2EGDA 3VRQA 4C0LA 2MLEC 4M2OA 2F2PA 3RM1A 1BOCA 1CDPA 1DJGA 2Y5IA 4WQ2A 1Y1UA 3D0YB 2F2OA 2K7CA 1EG4A 4MZLA 1K94A 4JQ0D 2KFHA 1J55A 1S1EA 3AKBA 1NPQA 1C07A 1YX8A 3VGOA 3VROA 4YI8A 1TNQA 1K93D 2NLNA 4ICBA 2WCEA 3ZWHA 3DVKA 1BODA 3WHUB 1AJ5A 4MRXA 1XFYO 2KDHA 1Y1AA 1BR4B 1SW8A 2KYFA 2LNKA 1IJ6A 1QV1A 2LLSA 2HQWA 1ALVA 1NYAA 4OV2A 1LA0A 4NQGA 3LCPC 3NSKA 4A4BA 1B7TY 2K7BA 1SK6D 4ORCB 2BBMA 1EJ3A 2KAXA 1PULA 5CSIA 1V1GA 2HPSA 1PVBA 3I5GC 5PALA 2MBXA 2JQ6A 1SYMA 5I8NA 5KU1A 3JVTC 1RTP1 4OR9B 1S5GY 1YVHA 1ZUZA 2I2RE 2ZRTA 3I5FB 1CDNA 1FPWA 2CTNA 1UWOA 1XK4A 4HREE 2KI4B 2LVVA 1JFKA 1OMRA 3AKAA 2JT8A 1OMDA 3GK2A 2M29A 2LMUA 1DJIA 3SG4A 1J1EA 1L2OC 1SNLA 2E6WA 1H8BA 1PRWA 2LVIA 1TNPA 2PASA 3TDZA 4CFQA 1D1OA 1RJVA 1S36A 5HLVA 1E8AA 1DGVA 2CNPA 2KFFA 2JT0A 5KTYA 4MN0A 2FOTA 4WQ3A 5ER5A 2JT3A 1QIWA 4YGEB 3KF9A 1YUTA 2LHLA 1XA5A 3OP0A 1YRUB 2LCPA 3JTDC 1CM1A 1TOPA 2BCBA 3OX6A 2L98A 2MRDA 5AANA 2EC6C 1LKJA 4C0JA 4BY4A 2GGMA 2F3YA 1OSAA 5DKNA 3TDIA 1IWQA 3D0YA 1KSMA 1KK7Z 2KBIA 1WRKA 1AJ4A 2QPTA 2ZNDA 1EL4A 2O60A 1DJHA 4U8DA 1G33A 1DMOA 2KI4C 3DVEA 1QJTA 2MAZA 4P5OE 4N5XA 3EK4A 1TNWA 4R1EA 1IQ5A 4D1EA 1SBJA 2H61C 3K21A 1K95A 2E30A 3BOWA 2OTGC 1YTZC 1B1GA 2Q91A 1A4PA 5HLOA 1BF5A 1DT7B 3FWCA 2K0JA 1DJWA 2M9GA 3AAJA 3LK0A 4I5LB 4CLNA 3O78A 3CR4X 1AP4A 4GNKB 3RLZA 3NSOA 5I2LA 1LA3A 2V53A 5HKZA 1TTXA 1M31A 1GGWA 1SR6C 2AAOA 2ZN8A 3VRNA 4XJKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F0Z B;  1CLM A;  1SRA A;  2K7D A;  4P2Y B;  2JNF A;  3PFV A;  2H2K A;  1YUS A;  5I2Q A;  1TN4 A;  1U5I B;  2HQ8 A;  4WRI A;  1SL9 A;  2LM5 A;  1B47 A;  1PVA A;  3KPX A;  2L4I A;  4GAO A;  5BPJ A;  1VRK A;  1FI6 A;  2GV5 A;  1QTX A;  2PSR A;  1PSR A;  1IG5 A;  1OOJ A;  3CGA A;  1JBA A;  1IJ5 A;  2Q4U A;  1XFZ O;  5CSN A;  1YRT B;  2LMV A;  1KWO C;  5I2O A;  1KQV A;  2BE4 A;  1KQM B;  3TS5 B;  1XK4 C;  2ZNE A;  1WDC C;  2PAL A;  3SG5 A;  3FIA A;  1K9U A;  2HF5 A;  4MBE A;  1QVI Y;  1QX2 A;  4MSP A;  1L7Z A;  4PAL A;  1R2U A;  2MLF C;  2PRU A;  2BE6 A;  2JOJ A;  3BOW B;  3HX4 A;  1EXR A;  1KK8 B;  1BLQ A;  1NCX A;  2L2E A;  4YGC B;  3TDU A;  1BJF A;  4AQI A;  1QLK A;  1CMG A;  2KAV A;  2BKH B;  1KK7 Y;  3WHT B;  1G8I A;  1GQM A;  4MZJ A;  1CKK A;  3KO0 A;  2SAS A;  1YX7 A;  5J3X A;  3PN7 B;  3H4S E;  3BUM B;  4GUK A;  2MJW B;  3O2P A;  3EK7 A;  2JTZ A;  1BR1 B;  2PMY A;  1S6J A;  4OVN F;  2ISD A;  1CNP A;  1UHH A;  1QV0 A;  1EG3 A;  4ORB B;  3CZT X;  2OS8 B;  3SJS A;  2HET A;  3I5I B;  4M2P A;  1XYD A;  1OQP A;  2LUX A;  1QX7 A;  4GFT A;  1ODB A;  2AMI A;  4Q04 A;  1QXP A;  5HKY A;  2L4H A;  2LUC A;  3IQO A;  1TNX A;  2M1U A;  5F6T A;  1KQM C;  3TS5 C;  3NSI A;  2KI6 C;  2B1U A;  1FW4 A;  2LE9 B;  1DJZ A;  2LC5 A;  4HSZ A;  2WOR A;  1KFX L;  4N1F A;  1AUI B;  4XJK A;  4BY5 A;  4DUQ A;  5CSJ A;  1XFX O;  1C7V A;  5AXI A;  2OPO A;  1XFU O;  3HCM A;  2JZI A;  2KI6 D;  2KSP A;  2M7L A;  4L9M A;  1KK8 C;  1DVI A;  4NDB A;  4ZCU A;  4QJ5 B;  4TNC A;  1U5I A;  1UHK A;  1IGV A;  1DF0 A;  1MXL C;  1OMV A;  1J7R A;  5GQQ C;  4MLW A;  2DOQ A;  3SG3 A;  1PAL A;  1XO5 A;  1A03 A;  2KGB C;  1DJY A;  1YUR A;  2M7N A;  3BXK A;  2BCA A;  5D69 A;  1DGU A;  1Y0V H;  1CFD A;  3PN7 C;  4YI9 A;  1CFP A;  3OHM B;  2BL0 B;  3GOF A;  1OZO A;  2M8U A;  4FQO A;  4PDZ A;  2TN4 A;  4NDC A;  5HYD A;  2KQY A;  1XVJ A;  3SG7 A;  1S6C A;  1Y1X A;  4PE7 A;  1A75 B;  3I5F C;  1OE9 B;  3LLE A;  3EKJ A;  5AER A;  2ZN9 A;  3A4U B;  1LXF C;  5DKQ A;  3DF0 B;  3C1V A;  4FTG A;  1CFF A;  5IBW A;  4PHN A;  2FCE A;  3EKH A;  1S6I A;  4PE0 A;  1NP8 A;  1K8U A;  4GGF A;  2JXL A;  5B8I B;  1W7I B;  4DRW A;  1SPY A;  3QRX A;  2WOS A;  3BQ3 A;  2KBM A;  2CXJ A;  2JPT A;  1NIW A;  3I5H B;  1UHN A;  1QS7 A;  2LAP A;  1SCM B;  2LVK A;  2K2A A;  2Y4Q A;  1WY9 A;  2NCO A;  4YRU A;  3D10 A;  5CPV A;  1PSB A;  3O6B A;  1B8L A;  2L5X B;  1MWN A;  4JPZ B;  1NX0 A;  5TNC A;  1JSA A;  1HT9 A;  1F4O A;  1W7J B;  1ZMZ A;  1SY9 A;  1S5G Z;  3O4Y A;  1NSH A;  2O5G A;  1WRL A;  3SIB A;  1ZOT B;  1S3P A;  1CB1 A;  2JNX A;  1YVL A;  4GBA A;  4QJ3 B;  3E3R A;  5DKR A;  1H4B A;  3CR5 X;  1AK8 A;  1UUS A;  1DF0 B;  1F4Q A;  1JF2 A;  2F33 A;  4C0K A;  1K2H A;  1QX5 B;  5KSZ A;  1Y6W A;  1QAT A;  2I7A A;  2JRF A;  4N1G A;  4DIR A;  1B9A A;  2WCF A;  2F8P A;  1WLM A;  2I18 A;  4QJ4 B;  1MXE A;  1TRF A;  2L51 A;  3DD4 A;  1NX1 A;  3TZ1 A;  4MEW A;  3VRP A;  2R2I A;  2G9B A;  3CTN A;  2FJU B;  3MSE B;  2LMT A;  1BT6 A;  4DS7 A;  4MZK A;  4A4C A;  1LIN A;  3I5H C;  1KFU L;  1J7Q A;  1S26 D;  1IH0 A;  1RK9 A;  4IL1 A;  1TCF A;  3I5G B;  5D7F A;  3SG2 A;  1CFC A;  2L0P A;  1EH2 A;  1B8R A;  1JUO A;  2G2B A;  2LAN A;  1FBV A;  1YUU A;  3NXA A;  2JC2 A;  2CBL A;  4M2Q A;  2SCP A;  1C7W A;  2PVB A;  3IF7 A;  3PLF B;  3BUW B;  2CCM A;  2M0R A;  3A8R A;  1F8H A;  4PHM A;  1QIV A;  5AEQ A;  2A4J A;  3WXA A;  1UP5 A;  4PCW A;  1REC A;  3KEV A;  1A75 A;  4OCI A;  1M46 A;  1YR5 A;  1AHR A;  1L2O B;  2K7O A;  2KAY A;  4NDD A;  1NWD A;  1XFV O;  3DF0 A;  1IKU A;  2BBN A;  3ICB A;  2GGZ A;  2AUC A;  4UPG A;  2M3W A;  3SG6 A;  3TUY B;  5K89 A;  2K8M B;  1NCZ A;  1TCO B;  1N0Y A;  1NCY A;  1XFW O;  1BMO A;  1UUR A;  4I5N B;  4PHJ A;  1F55 A;  1AVS A;  1DJX A;  4MVF A;  3LL8 B;  2JTT A;  2D8N A;  4MRY A;  3NSL A;  2JXC A;  2LP3 A;  2NZ0 A;  4XYN A;  1F70 A;  1SMG A;  1GGZ A;  2JU0 A;  4GGN A;  4CPV A;  5JJG A;  3JTD B;  4CFR A;  3CWG A;  1MHO A;  1SKT A;  2KFG A;  2EC6 B;  1MF8 B;  2KNE A;  5G08 A;  2M97 A;  2KGR A;  3IQQ A;  1N65 A;  2K2F A;  1MQ1 A;  3EVU A;  2ZFD A;  3GK1 A;  1GJY A;  4GGF C;  2QAC A;  4ORA B;  2M49 B;  1KFX S;  3EK8 A;  1UHI A;  1DTL A;  1UHJ A;  2BCX A;  2COL B;  3AAK A;  3LK1 A;  2K61 A;  2LLT A;  2KYC A;  3GK4 X;  3OB1 B;  3VRR A;  1CLL A;  3DVJ A;  1SL8 A;  3BUO B;  4YBH B;  4HRG A;  4YGB B;  2OTG B;  2EHB A;  2CT9 A;  1HQV A;  4YGA A;  3BUN B;  4ZCV A;  3TUY C;  2LP2 A;  1RFJ A;  3FS7 A;  1M63 B;  2WCB A;  3FWB A;  3CLN A;  5AFP A;  1KCY A;  3DVM A;  2OS8 C;  1ZFS A;  4YGD B;  3PAL A;  1IRJ A;  1WRZ A;  1BU3 A;  2LLU A;  2M1K B;  3BUX B;  2KHN A;  3I5I C;  1QVI Z;  2RGI A;  3M0W A;  1A29 A;  1J7O A;  1CDM A;  3WNX B;  5HKW A;  3OX5 A;  3CS1 A;  3KHE A;  1SR6 B;  1J7P A;  2JWW A;  2WC8 A;  2Y1N A;  1JC2 A;  4I5K A;  1CDL A;  1FF1 A;  1SL7 A;  3SIA A;  2NXQ A;  2KOT A;  3PAT A;  1B7T Z;  1QLS A;  1M39 A;  2WND A;  4OKH A;  1CTR A;  3PM8 A;  4PE1 A;  1RRO A;  1Q80 A;  1X02 A;  2MHH A;  1M45 A;  4E68 A;  2VRG A;  1J1D A;  4AOM A;  1K9K A;  1FI5 A;  4USL A;  1CLB A;  3OB2 B;  5FYX A;  1KWO B;  5CSF A;  1PK0 D;  1OZS A;  2NCP A;  4PHK A;  1QAS A;  1RWY A;  1TIZ A;  1B8C A;  4CID A;  2BL0 C;  1WDC B;  1F71 A;  1V1F A;  2F3Z A;  1MUX A;  2BKI B;  2P6B B;  4I5J A;  2LHI A;  2L50 A;  1N2D A;  1NX3 A;  2KQ6 A;  5ER4 X;  2MA2 A;  1NUB A;  2JUL A;  1F54 A;  4HRH A;  1JFJ A;  4PE4 A;  1BG1 A;  1WLZ A;  3EVV A;  4JWQ A;  5JOL A;  3PSR A;  1LVC D;  1G4Y R;  2Y1M A;  4ETO A;  3F45 A;  1B4C A;  3EVR A;  1CMF A;  4DCK A;  1JF0 A;  2FCD A;  2I94 A;  1JWD A;  2ZKM X;  1K96 A;  1MR8 A;  2IS9 A;  3ZNI A;  1SCV A;  1NX2 A;  1R6P A;  4AQJ A;  2BEC A;  1K9P A;  2LV7 A;  3CR2 A;  4GPL B;  1A2X A;  1K90 D;  1ZAC A;  2LVJ A;  1SCM C;  2ZRS A;  1IQ3 A;  1KSO A;  3BYA A;  1ALW A;  1CM4 A;  2H61 A;  3JVT B;  1KFU S;  2EGD A;  3VRQ A;  4C0L A;  2MLE C;  4M2O A;  2F2P A;  3RM1 A;  1BOC A;  1CDP A;  1DJG A;  2Y5I A;  4WQ2 A;  1Y1U A;  3D0Y B;  2F2O A;  2K7C A;  1EG4 A;  4MZL A;  1K94 A;  4JQ0 D;  2KFH A;  1J55 A;  1S1E A;  3AKB A;  1NPQ A;  1C07 A;  1YX8 A;  3VGO A;  3VRO A;  4YI8 A;  1TNQ A;  1K93 D;  2NLN A;  4ICB A;  2WCE A;  3ZWH A;  3DVK A;  1BOD A;  3WHU B;  1AJ5 A;  4MRX A;  1XFY O;  2KDH A;  1Y1A A;  1BR4 B;  1SW8 A;  2KYF A;  2LNK A;  1IJ6 A;  1QV1 A;  2LLS A;  2HQW A;  1ALV A;  1NYA A;  4OV2 A;  1LA0 A;  4NQG A;  3LCP C;  3NSK A;  4A4B A;  1B7T Y;  2K7B A;  1SK6 D;  4ORC B;  2BBM A;  1EJ3 A;  2KAX A;  1PUL A;  5CSI A;  1V1G A;  2HPS A;  1PVB A;  3I5G C;  5PAL A;  2MBX A;  2JQ6 A;  1SYM A;  5I8N A;  5KU1 A;  3JVT C;  1RTP 1;  4OR9 B;  1S5G Y;  1YVH A;  1ZUZ A;  2I2R E;  2ZRT A;  3I5F B;  1CDN A;  1FPW A;  2CTN A;  1UWO A;  1XK4 A;  4HRE E;  2KI4 B;  2LVV A;  1JFK A;  1OMR A;  3AKA A;  2JT8 A;  1OMD A;  3GK2 A;  2M29 A;  2LMU A;  1DJI A;  3SG4 A;  1J1E A;  1L2O C;  1SNL A;  2E6W A;  1H8B A;  1PRW A;  2LVI A;  1TNP A;  2PAS A;  3TDZ A;  4CFQ A;  1D1O A;  1RJV A;  1S36 A;  5HLV A;  1E8A A;  1DGV A;  2CNP A;  2KFF A;  2JT0 A;  5KTY A;  4MN0 A;  2FOT A;  4WQ3 A;  5ER5 A;  2JT3 A;  1QIW A;  4YGE B;  3KF9 A;  1YUT A;  2LHL A;  1XA5 A;  3OP0 A;  1YRU B;  2LCP A;  3JTD C;  1CM1 A;  1TOP A;  2BCB A;  3OX6 A;  2L98 A;  2MRD A;  5AAN A;  2EC6 C;  1LKJ A;  4C0J A;  4BY4 A;  2GGM A;  2F3Y A;  1OSA A;  5DKN A;  3TDI A;  1IWQ A;  3D0Y A;  1KSM A;  1KK7 Z;  2KBI A;  1WRK A;  1AJ4 A;  2QPT A;  2ZND A;  1EL4 A;  2O60 A;  1DJH A;  4U8D A;  1G33 A;  1DMO A;  2KI4 C;  3DVE A;  1QJT A;  2MAZ A;  4P5O E;  4N5X A;  3EK4 A;  1TNW A;  4R1E A;  1IQ5 A;  4D1E A;  1SBJ A;  2H61 C;  3K21 A;  1K95 A;  2E30 A;  3BOW A;  2OTG C;  1YTZ C;  1B1G A;  2Q91 A;  1A4P A;  5HLO A;  1BF5 A;  1DT7 B;  3FWC A;  2K0J A;  1DJW A;  2M9G A;  3AAJ A;  3LK0 A;  4I5L B;  4CLN A;  3O78 A;  3CR4 X;  1AP4 A;  4GNK B;  3RLZ A;  3NSO A;  5I2L A;  1LA3 A;  2V53 A;  5HKZ A;  1TTX A;  1M31 A;  1GGW A;  1SR6 C;  2AAO A;  2ZN8 A;  3VRN A;  4XJK B; 
#chains in the Genus database with same CATH topology
 4F0Z B;  2QEV A;  1CLM A;  1SRA A;  2K7D A;  4P2Y B;  2JNF A;  3CZ0 A;  1DEK A;  3PFV A;  2H2K A;  1YUS A;  1DEL A;  1TN4 A;  1U5I B;  2HQ8 A;  5I2Q A;  4WRI A;  1SL9 A;  2LM5 A;  1B47 A;  3R1O A;  1PVA A;  3KPX A;  2L4I A;  4GAO A;  5BPJ A;  3OGN A;  1VRK A;  1FI6 A;  2GV5 A;  1QTX A;  2PSR A;  1PSR A;  1IG5 A;  1OOJ A;  3CGA A;  1JBA A;  1IJ5 A;  2Q4U A;  1XFZ O;  5CSN A;  1YRT B;  3B86 A;  2LMV A;  1KWO C;  5I2O A;  1KQV A;  1LS8 A;  2BE4 A;  1KQM B;  3K1E A;  3TS5 B;  1XK4 C;  2ZNE A;  1WDC C;  2PAL A;  3SG5 A;  1C3Z A;  3FIA A;  1K9U A;  2HF5 A;  4MBE A;  1QVI Y;  3NHI A;  1TUZ A;  1QX2 A;  4MSP A;  1L7Z A;  4PAL A;  1R2U A;  3R1P A;  2MLF C;  2PRU A;  2BE6 A;  2JOJ A;  3BOW B;  3HX4 A;  1EXR A;  4FQT A;  1KK8 B;  1BLQ A;  1NCX A;  2L2E A;  4YGC B;  3TDU A;  1BJF A;  4AQI A;  1QLK A;  1CMG A;  2KAV A;  2BKH B;  1KK7 Y;  3WHT B;  1G8I A;  1GQM A;  1OOG A;  4MZJ A;  1CKK A;  3KO0 A;  2SAS A;  1YX7 A;  3PM2 A;  1TUJ A;  5J3X A;  3PN7 B;  3H4S E;  3BUM B;  3L47 A;  2MJW B;  3O2P A;  4GUK A;  3EK7 A;  2JTZ A;  1BR1 B;  2PMY A;  1S6J A;  4OVN F;  2ISD A;  1CNP A;  1UHH A;  1QV0 A;  2WCL A;  1EG3 A;  4ORB B;  3CZT X;  2OS8 B;  4INW A;  3SJS A;  2HET A;  3I5I B;  4M2P A;  1XYD A;  1OQP A;  2LUX A;  1QX7 A;  4GFT A;  1ODB A;  2AMI A;  4Q04 A;  1QXP A;  5HKY A;  2L4H A;  2LUC A;  3RZS A;  3IQO A;  1TNX A;  2M1U A;  5F6T A;  1KQM C;  3S0B A;  3TS5 C;  3NSI A;  2WCJ A;  2KI6 C;  2B1U A;  1FW4 A;  2LE9 B;  2YGU A;  2KLD A;  1DJZ A;  2LC5 A;  4HSZ A;  2WOR A;  3FE8 A;  1KFX L;  3EG5 B;  1T14 A;  4N1F A;  1AUI B;  4XJK A;  4BY5 A;  4DUQ A;  3SS3 A;  3NHT A;  5CSJ A;  1XFX O;  1C7V A;  5AXI A;  2OPO A;  1XFU O;  3HCM A;  2JZI A;  2KI6 D;  2KSP A;  3R1V A;  4L9M A;  1KK8 C;  2M7L A;  1DVI A;  4NDB A;  4ZCU A;  4QJ5 B;  3VB1 A;  4TNC A;  2KLE A;  1U5I A;  1UHK A;  1IGV A;  1DF0 A;  1MXL C;  1OMV A;  1J7R A;  5GQQ C;  4MLW A;  2DOQ A;  3SG3 A;  1PAL A;  1XO5 A;  3SS4 A;  1A03 A;  2KGB C;  1DJY A;  1YUR A;  2H8V A;  2M7N A;  2BCA A;  3BXK A;  5D69 A;  1DGU A;  1Y0V H;  1CFD A;  3PN7 C;  4YI9 A;  1CFP A;  3OHM B;  2BL0 B;  3GOF A;  1OZO A;  2M8U A;  4FQO A;  4PDZ A;  2TN4 A;  4NDC A;  5HYD A;  2KQY A;  1XVJ A;  3SG7 A;  1S6C A;  1Y1X A;  4PE7 A;  1A75 B;  3I5F C;  1OE9 B;  3LLE A;  3EKJ A;  5AER A;  2ZN9 A;  3A4U B;  1LXF C;  5DKQ A;  3L4A A;  3DF0 B;  3C1V A;  4FTG A;  4JD9 A;  1CFF A;  1TWO A;  4PHN A;  5IBW A;  2FCE A;  3CZ1 A;  2QEO A;  3EKH A;  1S6I A;  3O4X A;  1NP8 A;  4PE0 A;  1K8U A;  4GGF A;  2JXL A;  5HL1 A;  5B8I B;  1W7I B;  4DRW A;  1SPY A;  3QRX A;  2WOS A;  3BQ3 A;  2L2C A;  2KBM A;  2CXJ A;  2JPT A;  1NIW A;  3I5H B;  1UHN A;  1QS7 A;  2LAP A;  1SCM B;  2LVK A;  2K2A A;  2WC6 A;  2Y4Q A;  1WY9 A;  2NCO A;  4YRU A;  3D10 A;  5CPV A;  1PSB A;  3O6B A;  1B8L A;  2L5X B;  1MWN A;  4JPZ B;  1NX0 A;  5TNC A;  2PYQ A;  1JSA A;  1HT9 A;  1F4O A;  1W7J B;  3UO9 A;  1ZMZ A;  1SY9 A;  3QME A;  1S5G Z;  3O4Y A;  1NSH A;  2O5G A;  1WRL A;  3SIB A;  1ZOT B;  1S3P A;  1CB1 A;  2JNX A;  1YVL A;  4GBA A;  4QJ3 B;  3D78 A;  3E3R A;  5DKR A;  1H4B A;  3CR5 X;  1AK8 A;  1UUS A;  1DF0 B;  1DQE A;  3CZ2 A;  1F4Q A;  1JF2 A;  2F33 A;  5FI7 A;  4C0K A;  1K2H A;  1QX5 B;  5KSZ A;  1Y6W A;  1QAT A;  2I7A A;  2JRF A;  4N1G A;  4DIR A;  1B9A A;  1OW4 A;  2WCF A;  2F8P A;  3S0D A;  1WLM A;  2I18 A;  4QJ4 B;  1MXE A;  1TRF A;  3PJI A;  2L51 A;  3DD4 A;  1NX1 A;  3B6X A;  3TZ1 A;  4MEW A;  3VRP A;  3S0A A;  2R2I A;  2G9B A;  3CTN A;  2FJU B;  3MSE B;  2LMT A;  1BT6 A;  4DS7 A;  3SS5 A;  2L5Y A;  4MZK A;  4A4C A;  4PT1 A;  1LIN A;  3I5H C;  1KFU L;  1J7Q A;  1S26 D;  1IH0 A;  1RK9 A;  4IL1 A;  1OOH A;  1TCF A;  3I5G B;  2KPH A;  3D77 A;  5D7F A;  3SG2 A;  1CFC A;  2L0P A;  2BNX A;  1EH2 A;  1B8R A;  1JUO A;  2G2B A;  2LAN A;  1FBV A;  1YUU A;  3NXA A;  2JC2 A;  2CBL A;  4M2Q A;  2SCP A;  1C7W A;  2PVB A;  3IF7 A;  1OOF A;  3PLF B;  3BUW B;  2CCM A;  2M0R A;  3A8R A;  1F8H A;  4PHM A;  1ORG A;  1QIV A;  5AEQ A;  2A4J A;  3Q8I A;  3WXA A;  1UP5 A;  4PCW A;  2QEH A;  1REC A;  3KEV A;  1A75 A;  4OCI A;  1M46 A;  1YR5 A;  1AHR A;  1L2O B;  2K7O A;  2KAY A;  4NDD A;  1NWD A;  1XFV O;  3DF0 A;  1IKU A;  2BBN A;  3ICB A;  2GGZ A;  1IIO A;  2AUC A;  4UPG A;  2M3W A;  3SG6 A;  3TUY B;  5FI6 A;  5K89 A;  2K8M B;  4KYN A;  1NCZ A;  1TCO B;  1N0Y A;  1NCY A;  1XFW O;  1UUR A;  1BMO A;  4I5N B;  4PHJ A;  3BFA A;  1F55 A;  1AVS A;  1DJX A;  4MVF A;  3DY9 A;  3LL8 B;  1XFR A;  2JTT A;  2D8N A;  4MRY A;  3DZT A;  3NSL A;  2JXC A;  2LP3 A;  2NZ0 A;  4XYN A;  1F70 A;  1SMG A;  1GGZ A;  2JU0 A;  3L4L A;  4GGN A;  4CPV A;  5JJG A;  3JTD B;  4CFR A;  3S0E A;  3CWG A;  1MHO A;  1SKT A;  2KFG A;  2EC6 B;  1MF8 B;  2KNE A;  5G08 A;  3D73 A;  2M97 A;  2KGR A;  3IQQ A;  1N65 A;  2K2F A;  1MQ1 A;  3EVU A;  3FE6 A;  2ZFD A;  3GK1 A;  1GJY A;  4GGF C;  2QAC A;  4ORA B;  2M49 B;  1KFX S;  3EK8 A;  1UHI A;  1DTL A;  1UHJ A;  2BCX A;  2COL B;  3DYE A;  3AAK A;  3LK1 A;  2K61 A;  2LLT A;  2KYC A;  3GK4 X;  3OB1 B;  3VRR A;  1CLL A;  3DVJ A;  1SL8 A;  3BUO B;  4YBH B;  2P71 A;  4HRG A;  4YGB B;  2OTG B;  2EHB A;  2CT9 A;  1HQV A;  4YGA A;  3BUN B;  4ZCV A;  3TUY C;  2LP2 A;  1RFJ A;  3BFH A;  3FS7 A;  1M63 B;  2WCB A;  3FWB A;  3CLN A;  5AFP A;  1KCY A;  3DVM A;  2OS8 C;  1ZFS A;  4YGD B;  3PAL A;  1IRJ A;  1WRZ A;  1BU3 A;  2LLU A;  2M1K B;  3BUX B;  2KHN A;  3I5I C;  3CAB A;  1QVI Z;  2RGI A;  3M0W A;  1A29 A;  5I94 A;  1J7O A;  1CDM A;  2QEB A;  1Z2C B;  3WNX B;  5HKW A;  3OX5 A;  3CS1 A;  3KHE A;  1SR6 B;  1J7P A;  2JWW A;  2WC8 A;  2Y1N A;  1JC2 A;  4I5K A;  1CDL A;  1FF1 A;  1SL7 A;  2P70 A;  3UNW A;  3CDN A;  3SIA A;  2NXQ A;  2KOT A;  3PAT A;  2GTE A;  1B7T Z;  1QLS A;  1M39 A;  3IVT A;  2WND A;  2WCK A;  4OKH A;  1CTR A;  3PM8 A;  4PE1 A;  4INX A;  1RRO A;  1Q80 A;  1X02 A;  2MHH A;  1M45 A;  4E68 A;  2VRG A;  1J1D A;  3N7H A;  4AOM A;  1K9K A;  1FI5 A;  4USL A;  1CLB A;  3OB2 B;  5FI2 A;  1KWO B;  5CSF A;  5FYX A;  1PK0 D;  1OZS A;  2NCP A;  4PHK A;  1QAS A;  1RWY A;  1TIZ A;  1B8C A;  4CID A;  1WDC B;  2BL0 C;  1F71 A;  1V1F A;  2F3Z A;  1MUX A;  2BAP A;  2BKI B;  2P6B B;  4I5J A;  2LHI A;  2L50 A;  1N2D A;  1NX3 A;  2KQ6 A;  5ER4 X;  2MA2 A;  1NUB A;  2JUL A;  4JKT A;  1F54 A;  4F7F A;  4HRH A;  1JFJ A;  4PE4 A;  3FE9 A;  1BG1 A;  1WLZ A;  3EVV A;  4JWQ A;  5JOL A;  3PSR A;  1LVC D;  1G4Y R;  2Y1M A;  4ETO A;  3F45 A;  1B4C A;  3EVR A;  1CMF A;  4DCK A;  1JF0 A;  2FCD A;  2I94 A;  1JWD A;  2WC5 A;  3OBV A;  2ZKM X;  1K96 A;  1MR8 A;  2IS9 A;  3ZNI A;  1SCV A;  1NX2 A;  1R6P A;  4AQJ A;  2BEC A;  1K9P A;  1SSE B;  2LV7 A;  3CR2 A;  3BFB A;  1A2X A;  1K90 D;  1ZAC A;  2LVJ A;  1SCM C;  2ZRS A;  4GPL B;  1KSO A;  3BYA A;  1IQ3 A;  2WCH A;  1ALW A;  1CM4 A;  2H61 A;  3JVT B;  1KFU S;  2EGD A;  3VRQ A;  4C0L A;  2MLE C;  4M2O A;  2F2P A;  3RM1 A;  1BOC A;  1CDP A;  1DJG A;  2Y5I A;  4WQ2 A;  3B7A A;  1Y1U A;  2PQL A;  3D0Y B;  2F2O A;  2K7C A;  1EG4 A;  3NGV A;  4MZL A;  1K94 A;  4JQ0 D;  2KFH A;  1J55 A;  1S1E A;  3AKB A;  1NPQ A;  1C07 A;  1YX8 A;  3VGO A;  3VRO A;  4YI8 A;  1TNQ A;  1K93 D;  2NLN A;  4ICB A;  2WCE A;  3ZWH A;  3DVK A;  1BOD A;  3WHU B;  1AJ5 A;  4MRX A;  1XFY O;  2KDH A;  1Y1A A;  4OZD A;  1BR4 B;  1SW8 A;  2KYF A;  2LNK A;  1IJ6 A;  1QV1 A;  2LLS A;  2HQW A;  2QDI A;  1ALV A;  1NYA A;  4OV2 A;  1LA0 A;  5EL2 A;  1P28 A;  4NQG A;  3LCP C;  3NSK A;  3DXL A;  4A4B A;  1B7T Y;  2K7B A;  1OOI X;  1SK6 D;  4ORC B;  2BBM A;  1EJ3 A;  2KAX A;  3S0F A;  5D3O A;  1PUL A;  5CSI A;  1V1G A;  2HPS A;  1PVB A;  3I5G C;  5PAL A;  2MBX A;  2JQ6 A;  1SYM A;  1DC1 A;  5I8N A;  3B88 A;  5KU1 A;  3JVT C;  1RTP 1;  4OR9 B;  1S5G Y;  1YVH A;  1ZUZ A;  2FJY A;  2I2R E;  2ZRT A;  3I5F B;  1CDN A;  1FPW A;  2CTN A;  1QWV A;  1UWO A;  1W9Z A;  1XK4 A;  2KI4 B;  2LVV A;  4HRE E;  1JFK A;  1OMR A;  3D75 A;  3AKA A;  2JT8 A;  1OMD A;  3GK2 A;  2M29 A;  2LMU A;  4IJ7 A;  1DJI A;  3SG4 A;  1J1E A;  1L2O C;  5DIC A;  1SNL A;  2E6W A;  1H8B A;  1PRW A;  2LVI A;  1TNP A;  2PAS A;  3TDZ A;  3BJH A;  1GM0 A;  4CFQ A;  1D1O A;  3S0G A;  1RJV A;  1S36 A;  5HLV A;  1E8A A;  1DGV A;  2CNP A;  2KFF A;  2JT0 A;  5KTY A;  4MN0 A;  2FOT A;  4WQ3 A;  5ER5 A;  2JT3 A;  1QIW A;  4YGE B;  3KF9 A;  1YUT A;  2LHL A;  1XA5 A;  3OP0 A;  1YRU B;  2LCP A;  3JTD C;  1CM1 A;  1TOP A;  2BCB A;  3OX6 A;  2L98 A;  2MRD A;  5AAN A;  2EC6 C;  1LKJ A;  4C0J A;  4BY4 A;  2GGM A;  2F3Y A;  1OSA A;  5DKN A;  3TDI A;  1IWQ A;  3D0Y A;  1KSM A;  1KK7 Z;  3D74 A;  1C3Y A;  2KBI A;  1WRK A;  1AJ4 A;  2K60 A;  2QPT A;  2ZND A;  1EL4 A;  2O60 A;  1DJH A;  3D76 A;  4U8D A;  1G33 A;  1DMO A;  2KI4 C;  3DVE A;  1QJT A;  2MAZ A;  4P5O E;  3R72 A;  3EK4 A;  1TNW A;  4N5X A;  4R1E A;  1IQ5 A;  4D1E A;  1SBJ A;  1Z4H A;  2H61 C;  3K21 A;  1K95 A;  2E30 A;  3BOW A;  2OTG C;  1YTZ C;  1B1G A;  2Q91 A;  1A4P A;  5HLO A;  1BF5 A;  1DT7 B;  3FWC A;  2K0J A;  1DJW A;  2M9G A;  3AAJ A;  3LK0 A;  4I5L B;  3CYZ A;  4CLN A;  2WCM A;  3V2L A;  3O78 A;  3CR4 X;  1AP4 A;  2JPO A;  4GNK B;  3B87 A;  3RLZ A;  3NSO A;  5I2L A;  1LA3 A;  2V53 A;  5HKZ A;  1TTX A;  1M31 A;  1GGW A;  1SR6 C;  2AAO A;  2ZN8 A;  2ERB A;  3VRN A;  4XJK B; 
#chains in the Genus database with same CATH homology
 4F0Z B;  1CLM A;  1SRA A;  2K7D A;  4P2Y B;  2JNF A;  3PFV A;  2H2K A;  1YUS A;  5I2Q A;  1TN4 A;  1U5I B;  2HQ8 A;  4WRI A;  1SL9 A;  2LM5 A;  1B47 A;  1PVA A;  3KPX A;  2L4I A;  4GAO A;  5BPJ A;  1VRK A;  1FI6 A;  2GV5 A;  1QTX A;  2PSR A;  1PSR A;  1IG5 A;  1OOJ A;  3CGA A;  1JBA A;  1IJ5 A;  2Q4U A;  1XFZ O;  5CSN A;  1YRT B;  2LMV A;  1KWO C;  5I2O A;  1KQV A;  2BE4 A;  1KQM B;  3TS5 B;  1XK4 C;  2ZNE A;  1WDC C;  2PAL A;  3SG5 A;  3FIA A;  1K9U A;  2HF5 A;  4MBE A;  1QVI Y;  1QX2 A;  4MSP A;  1L7Z A;  4PAL A;  1R2U A;  2MLF C;  2PRU A;  2BE6 A;  2JOJ A;  3BOW B;  3HX4 A;  1EXR A;  1KK8 B;  1BLQ A;  1NCX A;  2L2E A;  4YGC B;  3TDU A;  1BJF A;  4AQI A;  1QLK A;  1CMG A;  2KAV A;  2BKH B;  1KK7 Y;  3WHT B;  1G8I A;  1GQM A;  4MZJ A;  1CKK A;  3KO0 A;  2SAS A;  1YX7 A;  5J3X A;  3PN7 B;  3H4S E;  3BUM B;  4GUK A;  2MJW B;  3O2P A;  3EK7 A;  2JTZ A;  1BR1 B;  2PMY A;  1S6J A;  4OVN F;  2ISD A;  1CNP A;  1UHH A;  1QV0 A;  1EG3 A;  4ORB B;  3CZT X;  2OS8 B;  3SJS A;  2HET A;  3I5I B;  4M2P A;  1XYD A;  1OQP A;  2LUX A;  1QX7 A;  4GFT A;  1ODB A;  2AMI A;  4Q04 A;  1QXP A;  5HKY A;  2L4H A;  2LUC A;  3IQO A;  1TNX A;  2M1U A;  5F6T A;  1KQM C;  3TS5 C;  3NSI A;  2KI6 C;  2B1U A;  1FW4 A;  2LE9 B;  1DJZ A;  2LC5 A;  4HSZ A;  2WOR A;  1KFX L;  4N1F A;  1AUI B;  4XJK A;  4BY5 A;  4DUQ A;  5CSJ A;  1XFX O;  1C7V A;  5AXI A;  2OPO A;  1XFU O;  3HCM A;  2JZI A;  2KI6 D;  2KSP A;  2M7L A;  4L9M A;  1KK8 C;  1DVI A;  4NDB A;  4ZCU A;  4QJ5 B;  4TNC A;  1U5I A;  1UHK A;  1IGV A;  1DF0 A;  1MXL C;  1OMV A;  1J7R A;  5GQQ C;  4MLW A;  2DOQ A;  3SG3 A;  1PAL A;  1XO5 A;  1A03 A;  2KGB C;  1DJY A;  1YUR A;  2M7N A;  3BXK A;  2BCA A;  5D69 A;  1DGU A;  1Y0V H;  1CFD A;  3PN7 C;  4YI9 A;  1CFP A;  3OHM B;  2BL0 B;  3GOF A;  1OZO A;  2M8U A;  4FQO A;  4PDZ A;  2TN4 A;  4NDC A;  5HYD A;  2KQY A;  1XVJ A;  3SG7 A;  1S6C A;  1Y1X A;  4PE7 A;  1A75 B;  3I5F C;  1OE9 B;  3LLE A;  3EKJ A;  5AER A;  2ZN9 A;  3A4U B;  1LXF C;  5DKQ A;  3DF0 B;  3C1V A;  4FTG A;  1CFF A;  5IBW A;  4PHN A;  2FCE A;  3EKH A;  1S6I A;  4PE0 A;  1NP8 A;  1K8U A;  4GGF A;  2JXL A;  5B8I B;  1W7I B;  4DRW A;  1SPY A;  3QRX A;  2WOS A;  3BQ3 A;  2KBM A;  2CXJ A;  2JPT A;  1NIW A;  3I5H B;  1UHN A;  1QS7 A;  2LAP A;  1SCM B;  2LVK A;  2K2A A;  2Y4Q A;  1WY9 A;  2NCO A;  4YRU A;  3D10 A;  5CPV A;  1PSB A;  3O6B A;  1B8L A;  2L5X B;  1MWN A;  4JPZ B;  1NX0 A;  5TNC A;  1JSA A;  1HT9 A;  1F4O A;  1W7J B;  1ZMZ A;  1SY9 A;  1S5G Z;  3O4Y A;  1NSH A;  2O5G A;  1WRL A;  3SIB A;  1ZOT B;  1S3P A;  1CB1 A;  2JNX A;  1YVL A;  4GBA A;  4QJ3 B;  3E3R A;  5DKR A;  1H4B A;  3CR5 X;  1AK8 A;  1UUS A;  1DF0 B;  1F4Q A;  1JF2 A;  2F33 A;  4C0K A;  1K2H A;  1QX5 B;  5KSZ A;  1Y6W A;  1QAT A;  2I7A A;  2JRF A;  4N1G A;  4DIR A;  1B9A A;  2WCF A;  2F8P A;  1WLM A;  2I18 A;  4QJ4 B;  1MXE A;  1TRF A;  2L51 A;  3DD4 A;  1NX1 A;  3TZ1 A;  4MEW A;  3VRP A;  2R2I A;  2G9B A;  3CTN A;  2FJU B;  3MSE B;  2LMT A;  1BT6 A;  4DS7 A;  4MZK A;  4A4C A;  1LIN A;  3I5H C;  1KFU L;  1J7Q A;  1S26 D;  1IH0 A;  1RK9 A;  4IL1 A;  1TCF A;  3I5G B;  5D7F A;  3SG2 A;  1CFC A;  2L0P A;  1EH2 A;  1B8R A;  1JUO A;  2G2B A;  2LAN A;  1FBV A;  1YUU A;  3NXA A;  2JC2 A;  2CBL A;  4M2Q A;  2SCP A;  1C7W A;  2PVB A;  3IF7 A;  3PLF B;  3BUW B;  2CCM A;  2M0R A;  3A8R A;  1F8H A;  4PHM A;  1QIV A;  5AEQ A;  2A4J A;  3WXA A;  1UP5 A;  4PCW A;  1REC A;  3KEV A;  1A75 A;  4OCI A;  1M46 A;  1YR5 A;  1AHR A;  1L2O B;  2K7O A;  2KAY A;  4NDD A;  1NWD A;  1XFV O;  3DF0 A;  1IKU A;  2BBN A;  3ICB A;  2GGZ A;  2AUC A;  4UPG A;  2M3W A;  3SG6 A;  3TUY B;  5K89 A;  2K8M B;  1NCZ A;  1TCO B;  1N0Y A;  1NCY A;  1XFW O;  1BMO A;  1UUR A;  4I5N B;  4PHJ A;  1F55 A;  1AVS A;  1DJX A;  4MVF A;  3LL8 B;  2JTT A;  2D8N A;  4MRY A;  3NSL A;  2JXC A;  2LP3 A;  2NZ0 A;  4XYN A;  1F70 A;  1SMG A;  1GGZ A;  2JU0 A;  4GGN A;  4CPV A;  5JJG A;  3JTD B;  4CFR A;  3CWG A;  1MHO A;  1SKT A;  2KFG A;  2EC6 B;  1MF8 B;  2KNE A;  5G08 A;  2M97 A;  2KGR A;  3IQQ A;  1N65 A;  2K2F A;  1MQ1 A;  3EVU A;  2ZFD A;  3GK1 A;  1GJY A;  4GGF C;  2QAC A;  4ORA B;  2M49 B;  1KFX S;  3EK8 A;  1UHI A;  1DTL A;  1UHJ A;  2BCX A;  2COL B;  3AAK A;  3LK1 A;  2K61 A;  2LLT A;  2KYC A;  3GK4 X;  3OB1 B;  3VRR A;  1CLL A;  3DVJ A;  1SL8 A;  3BUO B;  4YBH B;  4HRG A;  4YGB B;  2OTG B;  2EHB A;  2CT9 A;  1HQV A;  4YGA A;  3BUN B;  4ZCV A;  3TUY C;  2LP2 A;  1RFJ A;  3FS7 A;  1M63 B;  2WCB A;  3FWB A;  3CLN A;  5AFP A;  1KCY A;  3DVM A;  2OS8 C;  1ZFS A;  4YGD B;  3PAL A;  1IRJ A;  1WRZ A;  1BU3 A;  2LLU A;  2M1K B;  3BUX B;  2KHN A;  3I5I C;  1QVI Z;  2RGI A;  3M0W A;  1A29 A;  1J7O A;  1CDM A;  3WNX B;  5HKW A;  3OX5 A;  3CS1 A;  3KHE A;  1SR6 B;  1J7P A;  2JWW A;  2WC8 A;  2Y1N A;  1JC2 A;  4I5K A;  1CDL A;  1FF1 A;  1SL7 A;  3SIA A;  2NXQ A;  2KOT A;  3PAT A;  1B7T Z;  1QLS A;  1M39 A;  2WND A;  4OKH A;  1CTR A;  3PM8 A;  4PE1 A;  1RRO A;  1Q80 A;  1X02 A;  2MHH A;  1M45 A;  4E68 A;  2VRG A;  1J1D A;  4AOM A;  1K9K A;  1FI5 A;  4USL A;  1CLB A;  3OB2 B;  5FYX A;  1KWO B;  5CSF A;  1PK0 D;  1OZS A;  2NCP A;  4PHK A;  1QAS A;  1RWY A;  1TIZ A;  1B8C A;  4CID A;  2BL0 C;  1WDC B;  1F71 A;  1V1F A;  2F3Z A;  1MUX A;  2BKI B;  2P6B B;  4I5J A;  2LHI A;  2L50 A;  1N2D A;  1NX3 A;  2KQ6 A;  5ER4 X;  2MA2 A;  1NUB A;  2JUL A;  1F54 A;  4HRH A;  1JFJ A;  4PE4 A;  1BG1 A;  1WLZ A;  3EVV A;  4JWQ A;  5JOL A;  3PSR A;  1LVC D;  1G4Y R;  2Y1M A;  4ETO A;  3F45 A;  1B4C A;  3EVR A;  1CMF A;  4DCK A;  1JF0 A;  2FCD A;  2I94 A;  1JWD A;  2ZKM X;  1K96 A;  1MR8 A;  2IS9 A;  3ZNI A;  1SCV A;  1NX2 A;  1R6P A;  4AQJ A;  2BEC A;  1K9P A;  2LV7 A;  3CR2 A;  4GPL B;  1A2X A;  1K90 D;  1ZAC A;  2LVJ A;  1SCM C;  2ZRS A;  1IQ3 A;  1KSO A;  3BYA A;  1ALW A;  1CM4 A;  2H61 A;  3JVT B;  1KFU S;  2EGD A;  3VRQ A;  4C0L A;  2MLE C;  4M2O A;  2F2P A;  3RM1 A;  1BOC A;  1CDP A;  1DJG A;  2Y5I A;  4WQ2 A;  1Y1U A;  3D0Y B;  2F2O A;  2K7C A;  1EG4 A;  4MZL A;  1K94 A;  4JQ0 D;  2KFH A;  1J55 A;  1S1E A;  3AKB A;  1NPQ A;  1C07 A;  1YX8 A;  3VGO A;  3VRO A;  4YI8 A;  1TNQ A;  1K93 D;  2NLN A;  4ICB A;  2WCE A;  3ZWH A;  3DVK A;  1BOD A;  3WHU B;  1AJ5 A;  4MRX A;  1XFY O;  2KDH A;  1Y1A A;  1BR4 B;  1SW8 A;  2KYF A;  2LNK A;  1IJ6 A;  1QV1 A;  2LLS A;  2HQW A;  1ALV A;  1NYA A;  4OV2 A;  1LA0 A;  4NQG A;  3LCP C;  3NSK A;  4A4B A;  1B7T Y;  2K7B A;  1SK6 D;  4ORC B;  2BBM A;  1EJ3 A;  2KAX A;  1PUL A;  5CSI A;  1V1G A;  2HPS A;  1PVB A;  3I5G C;  5PAL A;  2MBX A;  2JQ6 A;  1SYM A;  5I8N A;  5KU1 A;  3JVT C;  1RTP 1;  4OR9 B;  1S5G Y;  1YVH A;  1ZUZ A;  2I2R E;  2ZRT A;  3I5F B;  1CDN A;  1FPW A;  2CTN A;  1UWO A;  1XK4 A;  4HRE E;  2KI4 B;  2LVV A;  1JFK A;  1OMR A;  3AKA A;  2JT8 A;  1OMD A;  3GK2 A;  2M29 A;  2LMU A;  1DJI A;  3SG4 A;  1J1E A;  1L2O C;  1SNL A;  2E6W A;  1H8B A;  1PRW A;  2LVI A;  1TNP A;  2PAS A;  3TDZ A;  4CFQ A;  1D1O A;  1RJV A;  1S36 A;  5HLV A;  1E8A A;  1DGV A;  2CNP A;  2KFF A;  2JT0 A;  5KTY A;  4MN0 A;  2FOT A;  4WQ3 A;  5ER5 A;  2JT3 A;  1QIW A;  4YGE B;  3KF9 A;  1YUT A;  2LHL A;  1XA5 A;  3OP0 A;  1YRU B;  2LCP A;  3JTD C;  1CM1 A;  1TOP A;  2BCB A;  3OX6 A;  2L98 A;  2MRD A;  5AAN A;  2EC6 C;  1LKJ A;  4C0J A;  4BY4 A;  2GGM A;  2F3Y A;  1OSA A;  5DKN A;  3TDI A;  1IWQ A;  3D0Y A;  1KSM A;  1KK7 Z;  2KBI A;  1WRK A;  1AJ4 A;  2QPT A;  2ZND A;  1EL4 A;  2O60 A;  1DJH A;  4U8D A;  1G33 A;  1DMO A;  2KI4 C;  3DVE A;  1QJT A;  2MAZ A;  4P5O E;  4N5X A;  3EK4 A;  1TNW A;  4R1E A;  1IQ5 A;  4D1E A;  1SBJ A;  2H61 C;  3K21 A;  1K95 A;  2E30 A;  3BOW A;  2OTG C;  1YTZ C;  1B1G A;  2Q91 A;  1A4P A;  5HLO A;  1BF5 A;  1DT7 B;  3FWC A;  2K0J A;  1DJW A;  2M9G A;  3AAJ A;  3LK0 A;  4I5L B;  4CLN A;  3O78 A;  3CR4 X;  1AP4 A;  4GNK B;  3RLZ A;  3NSO A;  5I2L A;  1LA3 A;  2V53 A;  5HKZ A;  1TTX A;  1M31 A;  1GGW A;  1SR6 C;  2AAO A;  2ZN8 A;  3VRN A;  4XJK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...