5B8IB

Crystal structure of calcineurin a and calcineurin b in complex with fkbp12 and fk506 from coccidioides immitis rs
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
171
structure length
171
Chain Sequence
MSSQVLNDIVSGSNFDHEEVDRLWKRFMKLDRDKSGTIERDEFLSLPQVSSNPLSTRMIAIFDEDGGGDVDFQEFVSGLSAFSSKGNKEEKLRFAFKVYDIDRDGFISNGELFIVLKMMVGSNLKDMQLQQIVDKTIMEADLDGDGRISFEEFTRMVENTDVSMSMTLDQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein phosphatase
publication title Crystal structure of Calcineurin A and Calcineurin B in complex with FKBP12 and FK506 from Coccidioides immitis RS
rcsb
source organism Coccidioides immitis (strain rs)
molecule tags Hydrolase
total genus 67
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2015-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13202 EF-hand_5 EF hand
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5b8iB00
1A03A 4XJKB 1JSAA 1DJIA 2ZNEA 3VROA 3FIAA 2LCPA 1ZOTB 2WOSA 2AUCA 3K21A 2JC2A 3PFVA 4OV2A 1IQ5A 1PRWA 2SCPA 1LVCD 3JTDC 4UPGA 1TTXA 3CLNA 1YX8A 1MHOA 4AQJA 3BUMB 2D8NA 1CLMA 3PLFB 2WCBA 2KFGA 1H4BA 1LXFC 1KWOB 1MUXA 1PULA 1YVLA 1A4PA 2KDHA 2AMIA 3BQ3A 1JFJA 3SG7A 5CSJA 1DJWA 1JF0A 1UUSA 1SK6D 2CXJA 2KAVA 3GK1A 4HREE 3CGAA 3RLZA 1DJGA 3FS7A 1J7RA 1F4QA 3PATA 5DKQA 4I5NB 3AKBA 1PK0D 1TCOB 4YBHB 1XK4C 4N5XA 1SKTA 4AOMA 3C1VA 2FOTA 1QJTA 1UWOA 4MEWA 3CZTX 3FWBA 2JRFA 5HLVA 5I8NA 4PE1A 4AQIA 2COLB 1F8HA 1WRKA 4HSZA 5JOLA 2KYFA 1TNWA 4JQ0D 4GPLB 4M2OA 2Y1MA 5KTYA 2KGBC 2L98A 1BU3A 3LCPC 4MSPA 3CR5X 3AAKA 5KSZA 1W7IB 4OKHA 1BT6A 4E68A 2JWWA 2KI4B 1AK8A 2LMTA 2L2EA 3BOWA 2G9BA 4MVFA 3OP0A 1OZSA 3CWGA 4Q04A 1CNPA 2F2OA 2E30A 4PHNA 2LVVA 2MBXA 2KQYA 1BF5A 1IG5A 1BODA 5HKYA 2HQWA 2L4HA 2KYCA 1NCXA 1QX5B 5PALA 4DS7A 2EGDA 4MZJA 1GQMA 1A2XA 5DKNA 1EH2A 2O5GA 1KCYA 3NXAA 3CTNA 4GFTA 1ODBA 2JT8A 2LNKA 3DVMA 3PN7B 1DTLA 2JT0A 3DVKA 4MZLA 2MJWB 2KI4C 1VRKA 1E8AA 1NX3A 2LLSA 2Y1NA 4YGDB 1F71A 1FI6A 2QACA 1JFKA 1MR8A 2PSRA 3GK2A 2K2FA 2Q91A 1NX1A 4XYNA 4GNKB 2Q4UA 4QJ3B 1RK9A 4ORBB 2M49B 4YI8A 1S1EA 2HF5A 2NZ0A 1MF8B 3TUYB 4CLNA 4BY4A 1XK4A 4GGFC 3VRRA 1L2OB 1TOPA 2L51A 4OVNF 3PN7C 2FCEA 2LMUA 2LLUA 2KFFA 4MZKA 2L4IA 1KFUS 3LLEA 4U8DA 1QV0A 2MHHA 1MWNA 2I7AA 3SIAA 2WC8A 1JUOA 2NCOA 5I2QA 1BR4B 1SW8A 3JTDB 5HYDA 1K94A 4GBAA 2LHIA 3SIBA 1KSMA 1DJZA 1QVIY 1AJ5A 3TUYC 2PRUA 1M31A 1DF0B 1Y1UA 1L2OC 5HKZA 3TDZA 3I5FC 4A4BA 1U5IB 1IJ6A 4I5LB 2JOJA 3O78A 1DT7B 1G33A 1S6JA 2K7BA 1XFYO 3IF7A 1XO5A 2ZKMX 1F54A 1CDMA 1MXLC 1AVSA 1KFXL 2BKIB 2KBIA 1H8BA 3OHMB 1MQ1A 5FYXA 3TS5B 3SG5A 2LVIA 2JXCA 2M9GA 3DD4A 4GGNA 2BCBA 4MRXA 4DRWA 1SYMA 4DUQA 1PVBA 1RFJA 2K7DA 3CS1A 2BCXA 2I2RE 2PALA 1TCFA 1K93D 3LK0A 3ICBA 2K7CA 1IQ3A 4ZCVA 2V53A 1HT9A 3H4SE 1YRTB 3IQOA 3LL8B 1SNLA 4MBEA 1XFXO 3NSIA 2BBMA 4QJ4B 3EKHA 1KK7Y 4GAOA 1B7TY 2LAPA 3AKAA 2K2AA 2VRGA 1CTRA 2H61A 3BXKA 4NDDA 1BR1B 3TS5C 1B9AA 4YRUA 2LLTA 2LUXA 3OB1B 1OMDA 1QIVA 1YTZC 3D10A 1A75B 3JVTB 3OB2B 1UHJA 5D69A 1M63B 1S5GY 3WXAA 1TNQA 2BE4A 2F3YA 2SASA 2ISDA 1QIWA 3CR4X 1V1FA 3TZ1A 1Y1AA 1YRUB 1BJFA 1QVIZ 3O4YA 1YUTA 2PVBA 1F55A 1JF2A 4M2PA 5CSFA 1OQPA 4R1EA 1WY9A 5BPJA 2MAZA 5AFPA 4WQ2A 1UHNA 4YGEB 5I2LA 1RROA 1SCVA 1R6PA 2JTZA 2KHNA 1DGUA 2JULA 2LP3A 1WDCB 4PE0A 1FPWA 1A29A 3D0YB 3JVTC 1QTXA 1LA3A 1S36A 2K61A 5HKWA 3BUNB 1CB1A 2F8PA 2M0RA 1PSBA 2PMYA 2M29A 4PHMA 1B47A 5IBWA 2KFHA 3KEVA 4DIRA 1J7QA 3O6BA 1B8CA 3ZNIA 3I5HB 4MRYA 4NQGA 3DVEA 2AAOA 1AP4A 2KSPA 2KNEA 3BUWB 2L0PA 1L7ZA 1IKUA 1NUBA 3WNXB 1NX0A 2K8MB 3HX4A 1BMOA 3QRXA 3EVVA 4N1FA 3PM8A 1KK7Z 3WHTB 3EK7A 1WDCC 3CR2A 4JWQA 1B7TZ 4PDZA 1TNXA 3PALA 1KSOA 2GV5A 2JXLA 2Y4QA 2ZRSA 1CFPA 4OCIA 1AJ4A 2OTGB 2GGZA 1U5IA 1ZACA 4JPZB 2ZN8A 4XJKA 4CIDA 1J55A 2M7NA 1ALVA 1S5GZ 1PSRA 4FTGA 2ZFDA 3KO0A 3I5HC 1EXRA 3DVJA 3E3RA 1YR5A 4DCKA 2FCDA 2L5XB 1CMGA 1G4YR 1IJ5A 4F0ZB 1SBJA 1WRLA 1M39A 1RJVA 2CT9A 2A4JA 1CDPA 5B8IB 2M3WA 1DMOA 3I5FB 1XFVO 2KOTA 1YX7A 4TNCA 1FF1A 1DJYA 2E6WA 3KF9A 3M0WA 4WRIA 2OTGC 1TIZA 3BYAA 4YGAA 3ZWHA 1WLMA 2DOQA 5I2OA 1KQVA 3EK8A 2B1UA 4PHJA 1B4CA 2H2KA 1FW4A 1GJYA 4L9MA 1DJHA 1DVIA 2BE6A 2HQ8A 2K7OA 3VRNA 2LM5A 2EC6B 3DF0B 3VRPA 1SL9A 3BUOB 1ZMZA 3TDUA 1D1OA 2IS9A 3EKJA 2KGRA 5HLOA 1JWDA 1J1DA 2I94A 3KPXA 1RTP1 1CMFA 1K90D 5ER4X 2Y5IA 3I5GB 1TRFA 4FQOA 1UHIA 5CSIA 1CFCA 1CFFA 1CKKA 1M45A 3TDIA 1Y6WA 1KFXS 1SL7A 3RM1A 1WRZA 3FWCA 3GK4X 3WHUB 4USLA 2LVKA 1S26D 2MRDA 1CLLA 1SMGA 2KAYA 1M46A 2EC6C 1EJ3A 3O2PA 4CFQA 2KQ6A 1EG3A 1S3PA 3VRQA 1NCYA 2GGMA 1DGVA 2OS8B 1CLBA 5AANA 3EVUA 3D0YA 3GOFA 1ZFSA 1SPYA 2BL0B 2MLFC 1KQMB 3I5GC 4CFRA 2KBMA 5GQQC 3A8RA 1B1GA 5D7FA 1QX7A 2LHLA 1FI5A 4BY5A 2M97A 1QASA 3OX5A 1AHRA 2LE9B 2ZRTA 1KK8B 2BECA 1SCMB 2JNFA 4M2QA 4PE4A 1SR6B 2JZIA 1ZUZA 2NXQA 1N0YA 5F6TA 1QXPA 1BLQA 5CPVA 4PHKA 4C0JA 1Y1XA 2KAXA 2OS8C 4YI9A 2F3ZA 2CCMA 2MA2A 1LKJA 4GGFA 1K95A 1SRAA 1OOJA 2MLEC 2LC5A 3AAJA 1N65A 2BL0C 3A4UB 2LMVA 1K9UA 1UP5A 1KQMC 2P6BB 2JTTA 3KHEA 3MSEB 1NWDA 2K0JA 1GGZA 4PE7A 1F70A 3NSLA 2CBLA 1CM1A 2HETA 2JU0A 2ZN9A 3IQQA 4NDCA 4D1EA 1KK8C 1YUSA 2KI6C 1NPQA 1IRJA 3SJSA 1G8IA 2ZNDA 1K8UA 3LK1A 1SCMC 1JBAA 4YGBB 1SR6C 1N2DA 5K89A 3SG2A 4QJ5B 1QLKA 1LA0A 1F4OA 1PVAA 1XFZO 1BG1A 2BCAA 2JQ6A 2L50A 1QV1A 2CNPA 1KWOC 2WNDA 4GUKA 2BKHB 1HQVA 1LINA 1RWYA 5CSNA 1RECA 2G2BA 2M1UA 5AEQA 1UURA 3EVRA 2BBNA 4PCWA 4IL1A 1S6IA 4ORCB 3SG6A 5KU1A 2LUCA 1QS7A 1NX2A 4ZCUA 2M1KB 1YVHA 3DF0A 4P2YB 3NSKA 4HRGA 2LP2A 1B8LA 1R2UA 2EHBA 2RGIA 2WORA 1XVJA 1GGWA 2JNXA 3I5IB 1DF0A 2R2IA 2M8UA 3EK4A 2JT3A 4N1GA 4PALA 4C0KA 1ALWA 1CDLA 1XYDA 2NLNA 1NCZA 4OR9B 1CFDA 2QPTA 1SL8A 2I18A 1QX2A 4WQ3A 1S6CA 1IGVA 2LVJA 1C07A 1OSAA 1X02A 5ER5A 2WCEA 4I5KA 4MN0A 4NDBA 1QATA 1DJXA 1BOCA 1OZOA 1J1EA 1PALA 2FJUB 1UHKA 5DKRA 1IWQA 4CPVA 4ETOA 1IH0A 1YUUA 2WCFA 2LANA 2OPOA 3I5IC 1CM4A 2F33A 4ICBA 1K9KA 1K96A 2F2PA 1V1GA 1EG4A 1WLZA 1AUIB 2H61C 3NSOA 4P5OE 1J7OA 2NCPA 1C7VA 1NIWA 3BUXB 2KI6D 5TNCA 5J3XA 4YGCB 1W7JB 3OX6A 3F45A 1FBVA 1A75A 1Q80A 2O60A 2CTNA 1C7WA 1XFWO 5G08A 1CDNA 1NYAA 3BOWB 1XA5A 5JJGA 5AXIA 1UHHA 1TNPA 1QLSA 4C0LA 1B8RA 1KFUL 2JPTA 5AERA 3PSRA 1K2HA 1J7PA 1TN4A 3HCMA 3SG4A 1SY9A 4A4CA 1MXEA 4I5JA 1NSHA 4ORAB 1OMRA 1YURA 1JC2A 2LV7A 4MLWA 2M7LA 3SG3A 1K9PA 1NP8A 1Y0VH 2PASA 4HRHA 1OMVA 2TN4A 1XFUO 1OE9B 3VGOA 1EL4A 2HPSA
chains in the Genus database with same CATH superfamily
1A03A 4XJKB 2L5YA 1JSAA 1DJIA 2ZNEA 3VROA 3FIAA 2LCPA 1ZOTB 5EL2A 2WOSA 2AUCA 3K21A 2JC2A 3PFVA 4OV2A 1IQ5A 1PRWA 2SCPA 1LVCD 3JTDC 3IVTA 1TTXA 4UPGA 3CLNA 1YX8A 4KYNA 1MHOA 3NHIA 3BUMB 4AQJA 2D8NA 1CLMA 3PLFB 5FI6A 2WCBA 2KFGA 1H4BA 1LXFC 1KWOB 1MUXA 1PULA 1YVLA 1A4PA 2KDHA 2AMIA 3BQ3A 1JFJA 3S0BA 3SG7A 5CSJA 1DJWA 1JF0A 1UUSA 2KPHA 1SK6D 2CXJA 2KAVA 3GK1A 4HREE 3CGAA 3RLZA 2WCMA 1DJGA 3FS7A 1J7RA 1F4QA 3PATA 5DKQA 4I5NB 3AKBA 1PK0D 1TCOB 4YBHB 1XK4C 4N5XA 1SKTA 2P71A 4AOMA 3C1VA 2FOTA 1QJTA 1UWOA 4MEWA 3CZTX 3FWBA 4OZDA 2JRFA 5HLVA 5I8NA 4INXA 4PE1A 4AQIA 2COLB 1F8HA 1WRKA 4HSZA 5JOLA 2KYFA 1TNWA 4JQ0D 4GPLB 4M2OA 2QDIA 2Y1MA 2H8VA 3OBVA 5KTYA 2KGBC 2L98A 2KLEA 3D73A 1BU3A 3LCPC 4MSPA 3CR5X 3AAKA 5KSZA 1W7IB 4OKHA 1BT6A 4E68A 2JWWA 2KI4B 1AK8A 2LMTA 2L2EA 3BOWA 2G9BA 4MVFA 3OP0A 1OZSA 3CWGA 4Q04A 1CNPA 2F2OA 2E30A 4PHNA 2LVVA 2MBXA 2KQYA 1BF5A 1IG5A 1BODA 5HKYA 2HQWA 3B88A 2L4HA 2KYCA 1NCXA 1QX5B 5PALA 4DS7A 2EGDA 4MZJA 1GQMA 1A2XA 5DKNA 1EH2A 3S0FA 2O5GA 1KCYA 3NXAA 3CTNA 4GFTA 1ODBA 5FI2A 2JT8A 3R1VA 1IIOA 2LNKA 3DVMA 3PN7B 3DYEA 3S0DA 1DTLA 1C3YA 2JT0A 3DVKA 4MZLA 2MJWB 2KI4C 1VRKA 1E8AA 1NX3A 2LLSA 2Y1NA 4YGDB 1F71A 1FI6A 2QACA 1JFKA 1MR8A 2PSRA 3GK2A 1GM0A 2YGUA 2K2FA 2Q91A 2QEVA 1NX1A 4XYNA 4GNKB 2Q4UA 4QJ3B 1RK9A 4ORBB 2M49B 4YI8A 1S1EA 2HF5A 2NZ0A 1MF8B 3TUYB 1Z2CB 1LS8A 4CLNA 3OGNA 4BY4A 1XK4A 4GGFC 3VRRA 1L2OB 1TOPA 3NGVA 2L51A 4OVNF 3PN7C 2FCEA 2LMUA 2LLUA 5D3OA 2KFFA 4JKTA 4MZKA 2L4IA 1KFUS 3LLEA 4U8DA 1DC1A 1QV0A 2MHHA 3DZTA 1MWNA 2I7AA 3L47A 3SIAA 2WC8A 1JUOA 3FE8A 2NCOA 5I2QA 1BR4B 1SW8A 3JTDB 5HYDA 1K94A 4GBAA 1DQEA 2PQLA 2K60A 2LHIA 3D74A 1KSMA 3SIBA 1DJZA 1QVIY 1AJ5A 3TUYC 2PRUA 1M31A 1DF0B 1Y1UA 1L2OC 5HKZA 3TDZA 3I5FC 4A4BA 3CDNA 1U5IB 1IJ6A 2ERBA 4I5LB 2JOJA 3O78A 1DT7B 1G33A 1S6JA 2K7BA 1XFYO 3IF7A 1XO5A 2ZKMX 1F54A 1CDMA 1MXLC 1AVSA 1KFXL 2BKIB 2KBIA 1H8BA 3OHMB 1MQ1A 5FYXA 3TS5B 3SG5A 2LVIA 3VB1A 2JXCA 2M9GA 3DD4A 4GGNA 2BCBA 4MRXA 4DRWA 1SYMA 4DUQA 1PVBA 1RFJA 2K7DA 3CS1A 2BCXA 2I2RE 2PALA 1TCFA 1K93D 3LK0A 3ICBA 2K7CA 1IQ3A 4ZCVA 2V53A 1HT9A 3H4SE 2WC5A 1YRTB 1OOIX 3IQOA 3LL8B 1SNLA 4MBEA 3B6XA 1XFXO 3NSIA 2BBMA 4QJ4B 3EKHA 1KK7Y 4GAOA 1B7TY 2LAPA 3AKAA 2K2AA 2VRGA 1CTRA 2H61A 3BXKA 1OOFA 4NDDA 2WCHA 3PJIA 1BR1B 3TS5C 3B86A 1B9AA 4YRUA 2LLTA 2LUXA 3OB1B 1OMDA 1QIVA 1YTZC 3D10A 1A75B 3BFAA 3JVTB 3OB2B 1UHJA 5D69A 3PM2A 1M63B 1S5GY 3WXAA 3QMEA 1TNQA 2BE4A 2F3YA 3Q8IA 3R72A 2SASA 2ISDA 1QIWA 3CR4X 1V1FA 3TZ1A 1Y1AA 2L2CA 1YRUB 1BJFA 1QVIZ 2KLDA 3O4YA 1YUTA 2PVBA 1F55A 1JF2A 4M2PA 5CSFA 1OQPA 4R1EA 1WY9A 5BPJA 2MAZA 5AFPA 4WQ2A 1UHNA 4IJ7A 4YGEB 5I2LA 1RROA 1SCVA 1R6PA 2JTZA 2KHNA 1DGUA 2JULA 2LP3A 1WDCB 4PE0A 1FPWA 1A29A 3D0YB 1Z4HA 1QTXA 1LA3A 1S36A 2K61A 3JVTC 3BUNB 5HKWA 1CB1A 2F8PA 2M0RA 3V2LA 1PSBA 2PMYA 3BFHA 2M29A 4PHMA 1TUZA 3S0AA 1B47A 5IBWA 2KFHA 3KEVA 3S0GA 4DIRA 1J7QA 2BAPA 3O6BA 1B8CA 3ZNIA 3I5HB 4MRYA 4NQGA 3DVEA 2AAOA 1AP4A 2KSPA 2KNEA 3BUWB 2L0PA 1L7ZA 1IKUA 1NUBA 3WNXB 1NX0A 2K8MB 3SS3A 3HX4A 1BMOA 3QRXA 3EVVA 4N1FA 3L4AA 3PM8A 1KK7Z 3WHTB 3EK7A 1WDCC 3CR2A 4JWQA 1B7TZ 4PDZA 1TNXA 3PALA 3BFBA 1KSOA 2GV5A 2JXLA 2Y4QA 2ZRSA 1CFPA 4OCIA 1AJ4A 2OTGB 2GGZA 5DICA 3CZ1A 1U5IA 1ZACA 4JPZB 2ZN8A 4XJKA 4CIDA 1J55A 2M7NA 1ALVA 1S5GZ 1PSRA 2WCLA 4FTGA 2ZFDA 3KO0A 3I5HC 1EXRA 3DVJA 3E3RA 1YR5A 4DCKA 2FCDA 2L5XB 1CMGA 1G4YR 1IJ5A 4F0ZB 1SBJA 1WRLA 1M39A 1RJVA 2CT9A 2A4JA 1CDPA 5B8IB 2M3WA 3R1OA 2GTEA 5FI7A 1DMOA 1P28A 1XFVO 3I5FB 2KOTA 1YX7A 3FE6A 4TNCA 1FF1A 1DJYA 2E6WA 3KF9A 3M0WA 4WRIA 2OTGC 1TIZA 3BYAA 4YGAA 3ZWHA 1WLMA 2DOQA 5I2OA 1KQVA 3EK8A 2B1UA 4PHJA 1B4CA 2H2KA 1FW4A 1GJYA 4L9MA 1DJHA 1DVIA 2BE6A 2HQ8A 2K7OA 3VRNA 2LM5A 2EC6B 3UNWA 3DF0B 3VRPA 1SL9A 3BUOB 1ZMZA 3TDUA 1D1OA 2IS9A 3N7HA 3EKJA 3CZ2A 3EG5B 2KGRA 5HLOA 1JWDA 1J1DA 2I94A 3KPXA 1RTP1 5I94A 1CMFA 1K90D 4FQTA 5ER4X 1OW4A 2Y5IA 3I5GB 1TRFA 4FQOA 1QWVA 1UHIA 5CSIA 1CFCA 1CFFA 1CKKA 3SS4A 1M45A 3TDIA 1Y6WA 4F7FA 1KFXS 1SL7A 3R1PA 1WRZA 3FWCA 3RM1A 3GK4X 3WHUB 4USLA 2LVKA 1S26D 2MRDA 1CLLA 1SMGA 2KAYA 3DXLA 1M46A 2EC6C 1EJ3A 3O2PA 4CFQA 2KQ6A 1EG3A 1S3PA 3VRQA 1NCYA 2WC6A 2GGMA 1DGVA 2OS8B 1CLBA 5AANA 3EVUA 3D0YA 3GOFA 1ORGA 1ZFSA 1SPYA 2BL0B 2MLFC 1KQMB 3I5GC 4CFRA 1C3ZA 2KBMA 5GQQC 3RZSA 3A8RA 1B1GA 5D7FA 1QX7A 2WCKA 4PT1A 2LHLA 3B87A 1FI5A 4BY5A 2M97A 1QASA 3OX5A 1AHRA 2LE9B 2ZRTA 3DY9A 1KK8B 3D78A 2BECA 1SCMB 2JNFA 4M2QA 4PE4A 1SR6B 2JZIA 1ZUZA 2NXQA 2PYQA 1N0YA 2QEHA 1QXPA 5F6TA 1BLQA 5CPVA 1TWOA 1XFRA 4PHKA 4C0JA 1Y1XA 2JPOA 2KAXA 2OS8C 4YI9A 2F3ZA 2CCMA 2MA2A 1LKJA 4GGFA 1K95A 1SRAA 1OOJA 2MLEC 2LC5A 3AAJA 1N65A 2BL0C 3A4UB 2LMVA 1K9UA 1UP5A 1KQMC 2P6BB 2JTTA 3KHEA 3K1EA 3MSEB 1NWDA 2K0JA 1GGZA 4PE7A 1F70A 3NSLA 2CBLA 1CM1A 2HETA 2JU0A 2ZN9A 3IQQA 4NDCA 4D1EA 1KK8C 1YUSA 2KI6C 1NPQA 1IRJA 3S0EA 3SJSA 1G8IA 2ZNDA 1K8UA 3O4XA 3LK1A 1SCMC 1JBAA 4YGBB 1SR6C 1N2DA 5K89A 3SG2A 4QJ5B 3CABA 1OOHA 1QLKA 1LA0A 1F4OA 1PVAA 1XFZO 1BG1A 1TUJA 2BCAA 2P70A 2JQ6A 2L50A 2QEBA 1QV1A 2CNPA 1KWOC 2WNDA 4GUKA 2BKHB 1HQVA 1LINA 1RWYA 5CSNA 1RECA 2G2BA 2M1UA 5AEQA 1UURA 3EVRA 2BBNA 4PCWA 4IL1A 1S6IA 4ORCB 3SG6A 5KU1A 2LUCA 1QS7A 1NX2A 4ZCUA 2M1KB 1YVHA 3DF0A 4P2YB 3NSKA 4HRGA 2LP2A 1B8LA 1R2UA 2EHBA 2RGIA 2WORA 1XVJA 1GGWA 2JNXA 3I5IB 2WCJA 1DF0A 2R2IA 2M8UA 3EK4A 2JT3A 4N1GA 4PALA 4C0KA 1ALWA 1CDLA 1XYDA 2NLNA 3B7AA 5HL1A 1NCZA 4OR9B 3SS5A 1CFDA 2FJYA 2QPTA 1SL8A 2I18A 1QX2A 4WQ3A 1S6CA 1IGVA 2LVJA 1C07A 1OSAA 1X02A 5ER5A 2WCEA 4I5KA 4MN0A 4NDBA 1QATA 2QEOA 1DJXA 1BOCA 1OZOA 1W9ZA 1J1EA 1PALA 2FJUB 1UHKA 5DKRA 3D76A 1IWQA 4CPVA 4ETOA 1IH0A 1YUUA 2WCFA 2LANA 2OPOA 3NHTA 3I5IC 1CM4A 1T14A 1OOGA 2F33A 4ICBA 4JD9A 1K9KA 3L4LA 1K96A 2F2PA 1V1GA 1EG4A 1WLZA 1AUIB 2BNXA 2H61C 3NSOA 4P5OE 1J7OA 2NCPA 1C7VA 1NIWA 3BUXB 2KI6D 5TNCA 5J3XA 4YGCB 1DEKA 1W7JB 3OX6A 3F45A 1FBVA 3UO9A 1A75A 1Q80A 2O60A 2CTNA 1SSEB 1C7WA 1XFWO 5G08A 1CDNA 3BJHA 1NYAA 3BOWB 1XA5A 5JJGA 3CZ0A 5AXIA 1UHHA 1DELA 1TNPA 3CYZA 1QLSA 3D75A 4C0LA 1B8RA 1KFUL 2JPTA 5AERA 3PSRA 1K2HA 1J7PA 1TN4A 3HCMA 3SG4A 1SY9A 4A4CA 1MXEA 4I5JA 1NSHA 3FE9A 1OMRA 1YURA 4ORAB 2LV7A 4MLWA 2M7LA 1JC2A 3SG3A 1K9PA 1NP8A 1Y0VH 2PASA 4HRHA 1OMVA 4INWA 2TN4A 3D77A 1XFUO 1OE9B 3VGOA 1EL4A 2HPSA
chains in the Genus database with same CATH topology
1A03A 4XJKB 1JSAA 1DJIA 2ZNEA 3VROA 3FIAA 2LCPA 1ZOTB 2WOSA 2AUCA 3K21A 2JC2A 3PFVA 4OV2A 1IQ5A 1PRWA 2SCPA 1LVCD 3JTDC 4UPGA 1TTXA 3CLNA 1YX8A 1MHOA 4AQJA 3BUMB 2D8NA 1CLMA 3PLFB 2WCBA 2KFGA 1H4BA 1LXFC 1KWOB 1MUXA 1PULA 1YVLA 1A4PA 2KDHA 2AMIA 3BQ3A 1JFJA 3SG7A 5CSJA 1DJWA 1JF0A 1UUSA 1SK6D 2CXJA 2KAVA 3GK1A 4HREE 3CGAA 3RLZA 1DJGA 3FS7A 1J7RA 1F4QA 3PATA 5DKQA 4I5NB 3AKBA 1PK0D 1TCOB 4YBHB 1XK4C 4N5XA 1SKTA 4AOMA 3C1VA 2FOTA 1QJTA 1UWOA 4MEWA 3CZTX 3FWBA 2JRFA 5HLVA 5I8NA 4PE1A 4AQIA 2COLB 1F8HA 1WRKA 4HSZA 5JOLA 2KYFA 1TNWA 4JQ0D 4GPLB 4M2OA 2Y1MA 5KTYA 2KGBC 2L98A 1BU3A 3LCPC 4MSPA 3CR5X 3AAKA 5KSZA 1W7IB 4OKHA 1BT6A 4E68A 2JWWA 2KI4B 1AK8A 2LMTA 2L2EA 3BOWA 2G9BA 4MVFA 3OP0A 1OZSA 3CWGA 4Q04A 1CNPA 2F2OA 2E30A 4PHNA 2LVVA 2MBXA 2KQYA 1BF5A 1IG5A 1BODA 5HKYA 2HQWA 2L4HA 2KYCA 1NCXA 1QX5B 5PALA 4DS7A 2EGDA 4MZJA 1GQMA 1A2XA 5DKNA 1EH2A 2O5GA 1KCYA 3NXAA 3CTNA 4GFTA 1ODBA 2JT8A 2LNKA 3DVMA 3PN7B 1DTLA 2JT0A 3DVKA 4MZLA 2MJWB 2KI4C 1VRKA 1E8AA 1NX3A 2LLSA 2Y1NA 4YGDB 1F71A 1FI6A 2QACA 1JFKA 1MR8A 2PSRA 3GK2A 2K2FA 2Q91A 1NX1A 4XYNA 4GNKB 2Q4UA 4QJ3B 1RK9A 4ORBB 2M49B 4YI8A 1S1EA 2HF5A 2NZ0A 1MF8B 3TUYB 4CLNA 4BY4A 1XK4A 4GGFC 3VRRA 1L2OB 1TOPA 2L51A 4OVNF 3PN7C 2FCEA 2LMUA 2LLUA 2KFFA 4MZKA 2L4IA 1KFUS 3LLEA 4U8DA 1QV0A 2MHHA 1MWNA 2I7AA 3SIAA 2WC8A 1JUOA 2NCOA 5I2QA 1BR4B 1SW8A 3JTDB 5HYDA 1K94A 4GBAA 2LHIA 3SIBA 1KSMA 1DJZA 1QVIY 1AJ5A 3TUYC 2PRUA 1M31A 1DF0B 1Y1UA 1L2OC 5HKZA 3TDZA 3I5FC 4A4BA 1U5IB 1IJ6A 4I5LB 2JOJA 3O78A 1DT7B 1G33A 1S6JA 2K7BA 1XFYO 3IF7A 1XO5A 2ZKMX 1F54A 1CDMA 1MXLC 1AVSA 1KFXL 2BKIB 2KBIA 1H8BA 3OHMB 1MQ1A 5FYXA 3TS5B 3SG5A 2LVIA 2JXCA 2M9GA 3DD4A 4GGNA 2BCBA 4MRXA 4DRWA 1SYMA 4DUQA 1PVBA 1RFJA 2K7DA 3CS1A 2BCXA 2I2RE 2PALA 1TCFA 1K93D 3LK0A 3ICBA 2K7CA 1IQ3A 4ZCVA 2V53A 1HT9A 3H4SE 1YRTB 3IQOA 3LL8B 1SNLA 4MBEA 1XFXO 3NSIA 2BBMA 4QJ4B 3EKHA 1KK7Y 4GAOA 1B7TY 2LAPA 3AKAA 2K2AA 2VRGA 1CTRA 2H61A 3BXKA 4NDDA 1BR1B 3TS5C 1B9AA 4YRUA 2LLTA 2LUXA 3OB1B 1OMDA 1QIVA 1YTZC 3D10A 1A75B 3JVTB 3OB2B 1UHJA 5D69A 1M63B 1S5GY 3WXAA 1TNQA 2BE4A 2F3YA 2SASA 2ISDA 1QIWA 3CR4X 1V1FA 3TZ1A 1Y1AA 1YRUB 1BJFA 1QVIZ 3O4YA 1YUTA 2PVBA 1F55A 1JF2A 4M2PA 5CSFA 1OQPA 4R1EA 1WY9A 5BPJA 2MAZA 5AFPA 4WQ2A 1UHNA 4YGEB 5I2LA 1RROA 1SCVA 1R6PA 2JTZA 2KHNA 1DGUA 2JULA 2LP3A 1WDCB 4PE0A 1FPWA 1A29A 3D0YB 3JVTC 1QTXA 1LA3A 1S36A 2K61A 5HKWA 3BUNB 1CB1A 2F8PA 2M0RA 1PSBA 2PMYA 2M29A 4PHMA 1B47A 5IBWA 2KFHA 3KEVA 4DIRA 1J7QA 3O6BA 1B8CA 3ZNIA 3I5HB 4MRYA 4NQGA 3DVEA 2AAOA 1AP4A 2KSPA 2KNEA 3BUWB 2L0PA 1L7ZA 1IKUA 1NUBA 3WNXB 1NX0A 2K8MB 3HX4A 1BMOA 3QRXA 3EVVA 4N1FA 3PM8A 1KK7Z 3WHTB 3EK7A 1WDCC 3CR2A 4JWQA 1B7TZ 4PDZA 1TNXA 3PALA 1KSOA 2GV5A 2JXLA 2Y4QA 2ZRSA 1CFPA 4OCIA 1AJ4A 2OTGB 2GGZA 1U5IA 1ZACA 4JPZB 2ZN8A 4XJKA 4CIDA 1J55A 2M7NA 1ALVA 1S5GZ 1PSRA 4FTGA 2ZFDA 3KO0A 3I5HC 1EXRA 3DVJA 3E3RA 1YR5A 4DCKA 2FCDA 2L5XB 1CMGA 1G4YR 1IJ5A 4F0ZB 1SBJA 1WRLA 1M39A 1RJVA 2CT9A 2A4JA 1CDPA 5B8IB 2M3WA 1DMOA 3I5FB 1XFVO 2KOTA 1YX7A 4TNCA 1FF1A 1DJYA 2E6WA 3KF9A 3M0WA 4WRIA 2OTGC 1TIZA 3BYAA 4YGAA 3ZWHA 1WLMA 2DOQA 5I2OA 1KQVA 3EK8A 2B1UA 4PHJA 1B4CA 2H2KA 1FW4A 1GJYA 4L9MA 1DJHA 1DVIA 2BE6A 2HQ8A 2K7OA 3VRNA 2LM5A 2EC6B 3DF0B 3VRPA 1SL9A 3BUOB 1ZMZA 3TDUA 1D1OA 2IS9A 3EKJA 2KGRA 5HLOA 1JWDA 1J1DA 2I94A 3KPXA 1RTP1 1CMFA 1K90D 5ER4X 2Y5IA 3I5GB 1TRFA 4FQOA 1UHIA 5CSIA 1CFCA 1CFFA 1CKKA 1M45A 3TDIA 1Y6WA 1KFXS 1SL7A 3RM1A 1WRZA 3FWCA 3GK4X 3WHUB 4USLA 2LVKA 1S26D 2MRDA 1CLLA 1SMGA 2KAYA 1M46A 2EC6C 1EJ3A 3O2PA 4CFQA 2KQ6A 1EG3A 1S3PA 3VRQA 1NCYA 2GGMA 1DGVA 2OS8B 1CLBA 5AANA 3EVUA 3D0YA 3GOFA 1ZFSA 1SPYA 2BL0B 2MLFC 1KQMB 3I5GC 4CFRA 2KBMA 5GQQC 3A8RA 1B1GA 5D7FA 1QX7A 2LHLA 1FI5A 4BY5A 2M97A 1QASA 3OX5A 1AHRA 2LE9B 2ZRTA 1KK8B 2BECA 1SCMB 2JNFA 4M2QA 4PE4A 1SR6B 2JZIA 1ZUZA 2NXQA 1N0YA 5F6TA 1QXPA 1BLQA 5CPVA 4PHKA 4C0JA 1Y1XA 2KAXA 2OS8C 4YI9A 2F3ZA 2CCMA 2MA2A 1LKJA 4GGFA 1K95A 1SRAA 1OOJA 2MLEC 2LC5A 3AAJA 1N65A 2BL0C 3A4UB 2LMVA 1K9UA 1UP5A 1KQMC 2P6BB 2JTTA 3KHEA 3MSEB 1NWDA 2K0JA 1GGZA 4PE7A 1F70A 3NSLA 2CBLA 1CM1A 2HETA 2JU0A 2ZN9A 3IQQA 4NDCA 4D1EA 1KK8C 1YUSA 2KI6C 1NPQA 1IRJA 3SJSA 1G8IA 2ZNDA 1K8UA 3LK1A 1SCMC 1JBAA 4YGBB 1SR6C 1N2DA 5K89A 3SG2A 4QJ5B 1QLKA 1LA0A 1F4OA 1PVAA 1XFZO 1BG1A 2BCAA 2JQ6A 2L50A 1QV1A 2CNPA 1KWOC 2WNDA 4GUKA 2BKHB 1HQVA 1LINA 1RWYA 5CSNA 1RECA 2G2BA 2M1UA 5AEQA 1UURA 3EVRA 2BBNA 4PCWA 4IL1A 1S6IA 4ORCB 3SG6A 5KU1A 2LUCA 1QS7A 1NX2A 4ZCUA 2M1KB 1YVHA 3DF0A 4P2YB 3NSKA 4HRGA 2LP2A 1B8LA 1R2UA 2EHBA 2RGIA 2WORA 1XVJA 1GGWA 2JNXA 3I5IB 1DF0A 2R2IA 2M8UA 3EK4A 2JT3A 4N1GA 4PALA 4C0KA 1ALWA 1CDLA 1XYDA 2NLNA 1NCZA 4OR9B 1CFDA 2QPTA 1SL8A 2I18A 1QX2A 4WQ3A 1S6CA 1IGVA 2LVJA 1C07A 1OSAA 1X02A 5ER5A 2WCEA 4I5KA 4MN0A 4NDBA 1QATA 1DJXA 1BOCA 1OZOA 1J1EA 1PALA 2FJUB 1UHKA 5DKRA 1IWQA 4CPVA 4ETOA 1IH0A 1YUUA 2WCFA 2LANA 2OPOA 3I5IC 1CM4A 2F33A 4ICBA 1K9KA 1K96A 2F2PA 1V1GA 1EG4A 1WLZA 1AUIB 2H61C 3NSOA 4P5OE 1J7OA 2NCPA 1C7VA 1NIWA 3BUXB 2KI6D 5TNCA 5J3XA 4YGCB 1W7JB 3OX6A 3F45A 1FBVA 1A75A 1Q80A 2O60A 2CTNA 1C7WA 1XFWO 5G08A 1CDNA 1NYAA 3BOWB 1XA5A 5JJGA 5AXIA 1UHHA 1TNPA 1QLSA 4C0LA 1B8RA 1KFUL 2JPTA 5AERA 3PSRA 1K2HA 1J7PA 1TN4A 3HCMA 3SG4A 1SY9A 4A4CA 1MXEA 4I5JA 1NSHA 4ORAB 1OMRA 1YURA 1JC2A 2LV7A 4MLWA 2M7LA 3SG3A 1K9PA 1NP8A 1Y0VH 2PASA 4HRHA 1OMVA 2TN4A 1XFUO 1OE9B 3VGOA 1EL4A 2HPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A03 A;  4XJK B;  1JSA A;  1DJI A;  2ZNE A;  3VRO A;  3FIA A;  2LCP A;  1ZOT B;  2WOS A;  2AUC A;  3K21 A;  2JC2 A;  3PFV A;  4OV2 A;  1IQ5 A;  1PRW A;  2SCP A;  1LVC D;  3JTD C;  4UPG A;  1TTX A;  3CLN A;  1YX8 A;  1MHO A;  4AQJ A;  3BUM B;  2D8N A;  1CLM A;  3PLF B;  2WCB A;  2KFG A;  1H4B A;  1LXF C;  1KWO B;  1MUX A;  1PUL A;  1YVL A;  1A4P A;  2KDH A;  2AMI A;  3BQ3 A;  1JFJ A;  3SG7 A;  5CSJ A;  1DJW A;  1JF0 A;  1UUS A;  1SK6 D;  2CXJ A;  2KAV A;  3GK1 A;  4HRE E;  3CGA A;  3RLZ A;  1DJG A;  3FS7 A;  1J7R A;  1F4Q A;  3PAT A;  5DKQ A;  4I5N B;  3AKB A;  1PK0 D;  1TCO B;  4YBH B;  1XK4 C;  4N5X A;  1SKT A;  4AOM A;  3C1V A;  2FOT A;  1QJT A;  1UWO A;  4MEW A;  3CZT X;  3FWB A;  2JRF A;  5HLV A;  5I8N A;  4PE1 A;  4AQI A;  2COL B;  1F8H A;  1WRK A;  4HSZ A;  5JOL A;  2KYF A;  1TNW A;  4JQ0 D;  4GPL B;  4M2O A;  2Y1M A;  5KTY A;  2KGB C;  2L98 A;  1BU3 A;  3LCP C;  4MSP A;  3CR5 X;  3AAK A;  5KSZ A;  1W7I B;  4OKH A;  1BT6 A;  4E68 A;  2JWW A;  2KI4 B;  1AK8 A;  2LMT A;  2L2E A;  3BOW A;  2G9B A;  4MVF A;  3OP0 A;  1OZS A;  3CWG A;  4Q04 A;  1CNP A;  2F2O A;  2E30 A;  4PHN A;  2LVV A;  2MBX A;  2KQY A;  1BF5 A;  1IG5 A;  1BOD A;  5HKY A;  2HQW A;  2L4H A;  2KYC A;  1NCX A;  1QX5 B;  5PAL A;  4DS7 A;  2EGD A;  4MZJ A;  1GQM A;  1A2X A;  5DKN A;  1EH2 A;  2O5G A;  1KCY A;  3NXA A;  3CTN A;  4GFT A;  1ODB A;  2JT8 A;  2LNK A;  3DVM A;  3PN7 B;  1DTL A;  2JT0 A;  3DVK A;  4MZL A;  2MJW B;  2KI4 C;  1VRK A;  1E8A A;  1NX3 A;  2LLS A;  2Y1N A;  4YGD B;  1F71 A;  1FI6 A;  2QAC A;  1JFK A;  1MR8 A;  2PSR A;  3GK2 A;  2K2F A;  2Q91 A;  1NX1 A;  4XYN A;  4GNK B;  2Q4U A;  4QJ3 B;  1RK9 A;  4ORB B;  2M49 B;  4YI8 A;  1S1E A;  2HF5 A;  2NZ0 A;  1MF8 B;  3TUY B;  4CLN A;  4BY4 A;  1XK4 A;  4GGF C;  3VRR A;  1L2O B;  1TOP A;  2L51 A;  4OVN F;  3PN7 C;  2FCE A;  2LMU A;  2LLU A;  2KFF A;  4MZK A;  2L4I A;  1KFU S;  3LLE A;  4U8D A;  1QV0 A;  2MHH A;  1MWN A;  2I7A A;  3SIA A;  2WC8 A;  1JUO A;  2NCO A;  5I2Q A;  1BR4 B;  1SW8 A;  3JTD B;  5HYD A;  1K94 A;  4GBA A;  2LHI A;  3SIB A;  1KSM A;  1DJZ A;  1QVI Y;  1AJ5 A;  3TUY C;  2PRU A;  1M31 A;  1DF0 B;  1Y1U A;  1L2O C;  5HKZ A;  3TDZ A;  3I5F C;  4A4B A;  1U5I B;  1IJ6 A;  4I5L B;  2JOJ A;  3O78 A;  1DT7 B;  1G33 A;  1S6J A;  2K7B A;  1XFY O;  3IF7 A;  1XO5 A;  2ZKM X;  1F54 A;  1CDM A;  1MXL C;  1AVS A;  1KFX L;  2BKI B;  2KBI A;  1H8B A;  3OHM B;  1MQ1 A;  5FYX A;  3TS5 B;  3SG5 A;  2LVI A;  2JXC A;  2M9G A;  3DD4 A;  4GGN A;  2BCB A;  4MRX A;  4DRW A;  1SYM A;  4DUQ A;  1PVB A;  1RFJ A;  2K7D A;  3CS1 A;  2BCX A;  2I2R E;  2PAL A;  1TCF A;  1K93 D;  3LK0 A;  3ICB A;  2K7C A;  1IQ3 A;  4ZCV A;  2V53 A;  1HT9 A;  3H4S E;  1YRT B;  3IQO A;  3LL8 B;  1SNL A;  4MBE A;  1XFX O;  3NSI A;  2BBM A;  4QJ4 B;  3EKH A;  1KK7 Y;  4GAO A;  1B7T Y;  2LAP A;  3AKA A;  2K2A A;  2VRG A;  1CTR A;  2H61 A;  3BXK A;  4NDD A;  1BR1 B;  3TS5 C;  1B9A A;  4YRU A;  2LLT A;  2LUX A;  3OB1 B;  1OMD A;  1QIV A;  1YTZ C;  3D10 A;  1A75 B;  3JVT B;  3OB2 B;  1UHJ A;  5D69 A;  1M63 B;  1S5G Y;  3WXA A;  1TNQ A;  2BE4 A;  2F3Y A;  2SAS A;  2ISD A;  1QIW A;  3CR4 X;  1V1F A;  3TZ1 A;  1Y1A A;  1YRU B;  1BJF A;  1QVI Z;  3O4Y A;  1YUT A;  2PVB A;  1F55 A;  1JF2 A;  4M2P A;  5CSF A;  1OQP A;  4R1E A;  1WY9 A;  5BPJ A;  2MAZ A;  5AFP A;  4WQ2 A;  1UHN A;  4YGE B;  5I2L A;  1RRO A;  1SCV A;  1R6P A;  2JTZ A;  2KHN A;  1DGU A;  2JUL A;  2LP3 A;  1WDC B;  4PE0 A;  1FPW A;  1A29 A;  3D0Y B;  3JVT C;  1QTX A;  1LA3 A;  1S36 A;  2K61 A;  5HKW A;  3BUN B;  1CB1 A;  2F8P A;  2M0R A;  1PSB A;  2PMY A;  2M29 A;  4PHM A;  1B47 A;  5IBW A;  2KFH A;  3KEV A;  4DIR A;  1J7Q A;  3O6B A;  1B8C A;  3ZNI A;  3I5H B;  4MRY A;  4NQG A;  3DVE A;  2AAO A;  1AP4 A;  2KSP A;  2KNE A;  3BUW B;  2L0P A;  1L7Z A;  1IKU A;  1NUB A;  3WNX B;  1NX0 A;  2K8M B;  3HX4 A;  1BMO A;  3QRX A;  3EVV A;  4N1F A;  3PM8 A;  1KK7 Z;  3WHT B;  3EK7 A;  1WDC C;  3CR2 A;  4JWQ A;  1B7T Z;  4PDZ A;  1TNX A;  3PAL A;  1KSO A;  2GV5 A;  2JXL A;  2Y4Q A;  2ZRS A;  1CFP A;  4OCI A;  1AJ4 A;  2OTG B;  2GGZ A;  1U5I A;  1ZAC A;  4JPZ B;  2ZN8 A;  4XJK A;  4CID A;  1J55 A;  2M7N A;  1ALV A;  1S5G Z;  1PSR A;  4FTG A;  2ZFD A;  3KO0 A;  3I5H C;  1EXR A;  3DVJ A;  3E3R A;  1YR5 A;  4DCK A;  2FCD A;  2L5X B;  1CMG A;  1G4Y R;  1IJ5 A;  4F0Z B;  1SBJ A;  1WRL A;  1M39 A;  1RJV A;  2CT9 A;  2A4J A;  1CDP A;  5B8I B;  2M3W A;  1DMO A;  3I5F B;  1XFV O;  2KOT A;  1YX7 A;  4TNC A;  1FF1 A;  1DJY A;  2E6W A;  3KF9 A;  3M0W A;  4WRI A;  2OTG C;  1TIZ A;  3BYA A;  4YGA A;  3ZWH A;  1WLM A;  2DOQ A;  5I2O A;  1KQV A;  3EK8 A;  2B1U A;  4PHJ A;  1B4C A;  2H2K A;  1FW4 A;  1GJY A;  4L9M A;  1DJH A;  1DVI A;  2BE6 A;  2HQ8 A;  2K7O A;  3VRN A;  2LM5 A;  2EC6 B;  3DF0 B;  3VRP A;  1SL9 A;  3BUO B;  1ZMZ A;  3TDU A;  1D1O A;  2IS9 A;  3EKJ A;  2KGR A;  5HLO A;  1JWD A;  1J1D A;  2I94 A;  3KPX A;  1RTP 1;  1CMF A;  1K90 D;  5ER4 X;  2Y5I A;  3I5G B;  1TRF A;  4FQO A;  1UHI A;  5CSI A;  1CFC A;  1CFF A;  1CKK A;  1M45 A;  3TDI A;  1Y6W A;  1KFX S;  1SL7 A;  3RM1 A;  1WRZ A;  3FWC A;  3GK4 X;  3WHU B;  4USL A;  2LVK A;  1S26 D;  2MRD A;  1CLL A;  1SMG A;  2KAY A;  1M46 A;  2EC6 C;  1EJ3 A;  3O2P A;  4CFQ A;  2KQ6 A;  1EG3 A;  1S3P A;  3VRQ A;  1NCY A;  2GGM A;  1DGV A;  2OS8 B;  1CLB A;  5AAN A;  3EVU A;  3D0Y A;  3GOF A;  1ZFS A;  1SPY A;  2BL0 B;  2MLF C;  1KQM B;  3I5G C;  4CFR A;  2KBM A;  5GQQ C;  3A8R A;  1B1G A;  5D7F A;  1QX7 A;  2LHL A;  1FI5 A;  4BY5 A;  2M97 A;  1QAS A;  3OX5 A;  1AHR A;  2LE9 B;  2ZRT A;  1KK8 B;  2BEC A;  1SCM B;  2JNF A;  4M2Q A;  4PE4 A;  1SR6 B;  2JZI A;  1ZUZ A;  2NXQ A;  1N0Y A;  5F6T A;  1QXP A;  1BLQ A;  5CPV A;  4PHK A;  4C0J A;  1Y1X A;  2KAX A;  2OS8 C;  4YI9 A;  2F3Z A;  2CCM A;  2MA2 A;  1LKJ A;  4GGF A;  1K95 A;  1SRA A;  1OOJ A;  2MLE C;  2LC5 A;  3AAJ A;  1N65 A;  2BL0 C;  3A4U B;  2LMV A;  1K9U A;  1UP5 A;  1KQM C;  2P6B B;  2JTT A;  3KHE A;  3MSE B;  1NWD A;  2K0J A;  1GGZ A;  4PE7 A;  1F70 A;  3NSL A;  2CBL A;  1CM1 A;  2HET A;  2JU0 A;  2ZN9 A;  3IQQ A;  4NDC A;  4D1E A;  1KK8 C;  1YUS A;  2KI6 C;  1NPQ A;  1IRJ A;  3SJS A;  1G8I A;  2ZND A;  1K8U A;  3LK1 A;  1SCM C;  1JBA A;  4YGB B;  1SR6 C;  1N2D A;  5K89 A;  3SG2 A;  4QJ5 B;  1QLK A;  1LA0 A;  1F4O A;  1PVA A;  1XFZ O;  1BG1 A;  2BCA A;  2JQ6 A;  2L50 A;  1QV1 A;  2CNP A;  1KWO C;  2WND A;  4GUK A;  2BKH B;  1HQV A;  1LIN A;  1RWY A;  5CSN A;  1REC A;  2G2B A;  2M1U A;  5AEQ A;  1UUR A;  3EVR A;  2BBN A;  4PCW A;  4IL1 A;  1S6I A;  4ORC B;  3SG6 A;  5KU1 A;  2LUC A;  1QS7 A;  1NX2 A;  4ZCU A;  2M1K B;  1YVH A;  3DF0 A;  4P2Y B;  3NSK A;  4HRG A;  2LP2 A;  1B8L A;  1R2U A;  2EHB A;  2RGI A;  2WOR A;  1XVJ A;  1GGW A;  2JNX A;  3I5I B;  1DF0 A;  2R2I A;  2M8U A;  3EK4 A;  2JT3 A;  4N1G A;  4PAL A;  4C0K A;  1ALW A;  1CDL A;  1XYD A;  2NLN A;  1NCZ A;  4OR9 B;  1CFD A;  2QPT A;  1SL8 A;  2I18 A;  1QX2 A;  4WQ3 A;  1S6C A;  1IGV A;  2LVJ A;  1C07 A;  1OSA A;  1X02 A;  5ER5 A;  2WCE A;  4I5K A;  4MN0 A;  4NDB A;  1QAT A;  1DJX A;  1BOC A;  1OZO A;  1J1E A;  1PAL A;  2FJU B;  1UHK A;  5DKR A;  1IWQ A;  4CPV A;  4ETO A;  1IH0 A;  1YUU A;  2WCF A;  2LAN A;  2OPO A;  3I5I C;  1CM4 A;  2F33 A;  4ICB A;  1K9K A;  1K96 A;  2F2P A;  1V1G A;  1EG4 A;  1WLZ A;  1AUI B;  2H61 C;  3NSO A;  4P5O E;  1J7O A;  2NCP A;  1C7V A;  1NIW A;  3BUX B;  2KI6 D;  5TNC A;  5J3X A;  4YGC B;  1W7J B;  3OX6 A;  3F45 A;  1FBV A;  1A75 A;  1Q80 A;  2O60 A;  2CTN A;  1C7W A;  1XFW O;  5G08 A;  1CDN A;  1NYA A;  3BOW B;  1XA5 A;  5JJG A;  5AXI A;  1UHH A;  1TNP A;  1QLS A;  4C0L A;  1B8R A;  1KFU L;  2JPT A;  5AER A;  3PSR A;  1K2H A;  1J7P A;  1TN4 A;  3HCM A;  3SG4 A;  1SY9 A;  4A4C A;  1MXE A;  4I5J A;  1NSH A;  4ORA B;  1OMR A;  1YUR A;  1JC2 A;  2LV7 A;  4MLW A;  2M7L A;  3SG3 A;  1K9P A;  1NP8 A;  1Y0V H;  2PAS A;  4HRH A;  1OMV A;  2TN4 A;  1XFU O;  1OE9 B;  3VGO A;  1EL4 A;  2HPS A; 
#chains in the Genus database with same CATH topology
 1A03 A;  4XJK B;  2L5Y A;  1JSA A;  1DJI A;  2ZNE A;  3VRO A;  3FIA A;  2LCP A;  1ZOT B;  5EL2 A;  2WOS A;  2AUC A;  3K21 A;  2JC2 A;  3PFV A;  4OV2 A;  1IQ5 A;  1PRW A;  2SCP A;  1LVC D;  3JTD C;  3IVT A;  1TTX A;  4UPG A;  3CLN A;  1YX8 A;  4KYN A;  1MHO A;  3NHI A;  3BUM B;  4AQJ A;  2D8N A;  1CLM A;  3PLF B;  5FI6 A;  2WCB A;  2KFG A;  1H4B A;  1LXF C;  1KWO B;  1MUX A;  1PUL A;  1YVL A;  1A4P A;  2KDH A;  2AMI A;  3BQ3 A;  1JFJ A;  3S0B A;  3SG7 A;  5CSJ A;  1DJW A;  1JF0 A;  1UUS A;  2KPH A;  1SK6 D;  2CXJ A;  2KAV A;  3GK1 A;  4HRE E;  3CGA A;  3RLZ A;  2WCM A;  1DJG A;  3FS7 A;  1J7R A;  1F4Q A;  3PAT A;  5DKQ A;  4I5N B;  3AKB A;  1PK0 D;  1TCO B;  4YBH B;  1XK4 C;  4N5X A;  1SKT A;  2P71 A;  4AOM A;  3C1V A;  2FOT A;  1QJT A;  1UWO A;  4MEW A;  3CZT X;  3FWB A;  4OZD A;  2JRF A;  5HLV A;  5I8N A;  4INX A;  4PE1 A;  4AQI A;  2COL B;  1F8H A;  1WRK A;  4HSZ A;  5JOL A;  2KYF A;  1TNW A;  4JQ0 D;  4GPL B;  4M2O A;  2QDI A;  2Y1M A;  2H8V A;  3OBV A;  5KTY A;  2KGB C;  2L98 A;  2KLE A;  3D73 A;  1BU3 A;  3LCP C;  4MSP A;  3CR5 X;  3AAK A;  5KSZ A;  1W7I B;  4OKH A;  1BT6 A;  4E68 A;  2JWW A;  2KI4 B;  1AK8 A;  2LMT A;  2L2E A;  3BOW A;  2G9B A;  4MVF A;  3OP0 A;  1OZS A;  3CWG A;  4Q04 A;  1CNP A;  2F2O A;  2E30 A;  4PHN A;  2LVV A;  2MBX A;  2KQY A;  1BF5 A;  1IG5 A;  1BOD A;  5HKY A;  2HQW A;  3B88 A;  2L4H A;  2KYC A;  1NCX A;  1QX5 B;  5PAL A;  4DS7 A;  2EGD A;  4MZJ A;  1GQM A;  1A2X A;  5DKN A;  1EH2 A;  3S0F A;  2O5G A;  1KCY A;  3NXA A;  3CTN A;  4GFT A;  1ODB A;  5FI2 A;  2JT8 A;  3R1V A;  1IIO A;  2LNK A;  3DVM A;  3PN7 B;  3DYE A;  3S0D A;  1DTL A;  1C3Y A;  2JT0 A;  3DVK A;  4MZL A;  2MJW B;  2KI4 C;  1VRK A;  1E8A A;  1NX3 A;  2LLS A;  2Y1N A;  4YGD B;  1F71 A;  1FI6 A;  2QAC A;  1JFK A;  1MR8 A;  2PSR A;  3GK2 A;  1GM0 A;  2YGU A;  2K2F A;  2Q91 A;  2QEV A;  1NX1 A;  4XYN A;  4GNK B;  2Q4U A;  4QJ3 B;  1RK9 A;  4ORB B;  2M49 B;  4YI8 A;  1S1E A;  2HF5 A;  2NZ0 A;  1MF8 B;  3TUY B;  1Z2C B;  1LS8 A;  4CLN A;  3OGN A;  4BY4 A;  1XK4 A;  4GGF C;  3VRR A;  1L2O B;  1TOP A;  3NGV A;  2L51 A;  4OVN F;  3PN7 C;  2FCE A;  2LMU A;  2LLU A;  5D3O A;  2KFF A;  4JKT A;  4MZK A;  2L4I A;  1KFU S;  3LLE A;  4U8D A;  1DC1 A;  1QV0 A;  2MHH A;  3DZT A;  1MWN A;  2I7A A;  3L47 A;  3SIA A;  2WC8 A;  1JUO A;  3FE8 A;  2NCO A;  5I2Q A;  1BR4 B;  1SW8 A;  3JTD B;  5HYD A;  1K94 A;  4GBA A;  1DQE A;  2PQL A;  2K60 A;  2LHI A;  3D74 A;  1KSM A;  3SIB A;  1DJZ A;  1QVI Y;  1AJ5 A;  3TUY C;  2PRU A;  1M31 A;  1DF0 B;  1Y1U A;  1L2O C;  5HKZ A;  3TDZ A;  3I5F C;  4A4B A;  3CDN A;  1U5I B;  1IJ6 A;  2ERB A;  4I5L B;  2JOJ A;  3O78 A;  1DT7 B;  1G33 A;  1S6J A;  2K7B A;  1XFY O;  3IF7 A;  1XO5 A;  2ZKM X;  1F54 A;  1CDM A;  1MXL C;  1AVS A;  1KFX L;  2BKI B;  2KBI A;  1H8B A;  3OHM B;  1MQ1 A;  5FYX A;  3TS5 B;  3SG5 A;  2LVI A;  3VB1 A;  2JXC A;  2M9G A;  3DD4 A;  4GGN A;  2BCB A;  4MRX A;  4DRW A;  1SYM A;  4DUQ A;  1PVB A;  1RFJ A;  2K7D A;  3CS1 A;  2BCX A;  2I2R E;  2PAL A;  1TCF A;  1K93 D;  3LK0 A;  3ICB A;  2K7C A;  1IQ3 A;  4ZCV A;  2V53 A;  1HT9 A;  3H4S E;  2WC5 A;  1YRT B;  1OOI X;  3IQO A;  3LL8 B;  1SNL A;  4MBE A;  3B6X A;  1XFX O;  3NSI A;  2BBM A;  4QJ4 B;  3EKH A;  1KK7 Y;  4GAO A;  1B7T Y;  2LAP A;  3AKA A;  2K2A A;  2VRG A;  1CTR A;  2H61 A;  3BXK A;  1OOF A;  4NDD A;  2WCH A;  3PJI A;  1BR1 B;  3TS5 C;  3B86 A;  1B9A A;  4YRU A;  2LLT A;  2LUX A;  3OB1 B;  1OMD A;  1QIV A;  1YTZ C;  3D10 A;  1A75 B;  3BFA A;  3JVT B;  3OB2 B;  1UHJ A;  5D69 A;  3PM2 A;  1M63 B;  1S5G Y;  3WXA A;  3QME A;  1TNQ A;  2BE4 A;  2F3Y A;  3Q8I A;  3R72 A;  2SAS A;  2ISD A;  1QIW A;  3CR4 X;  1V1F A;  3TZ1 A;  1Y1A A;  2L2C A;  1YRU B;  1BJF A;  1QVI Z;  2KLD A;  3O4Y A;  1YUT A;  2PVB A;  1F55 A;  1JF2 A;  4M2P A;  5CSF A;  1OQP A;  4R1E A;  1WY9 A;  5BPJ A;  2MAZ A;  5AFP A;  4WQ2 A;  1UHN A;  4IJ7 A;  4YGE B;  5I2L A;  1RRO A;  1SCV A;  1R6P A;  2JTZ A;  2KHN A;  1DGU A;  2JUL A;  2LP3 A;  1WDC B;  4PE0 A;  1FPW A;  1A29 A;  3D0Y B;  1Z4H A;  1QTX A;  1LA3 A;  1S36 A;  2K61 A;  3JVT C;  3BUN B;  5HKW A;  1CB1 A;  2F8P A;  2M0R A;  3V2L A;  1PSB A;  2PMY A;  3BFH A;  2M29 A;  4PHM A;  1TUZ A;  3S0A A;  1B47 A;  5IBW A;  2KFH A;  3KEV A;  3S0G A;  4DIR A;  1J7Q A;  2BAP A;  3O6B A;  1B8C A;  3ZNI A;  3I5H B;  4MRY A;  4NQG A;  3DVE A;  2AAO A;  1AP4 A;  2KSP A;  2KNE A;  3BUW B;  2L0P A;  1L7Z A;  1IKU A;  1NUB A;  3WNX B;  1NX0 A;  2K8M B;  3SS3 A;  3HX4 A;  1BMO A;  3QRX A;  3EVV A;  4N1F A;  3L4A A;  3PM8 A;  1KK7 Z;  3WHT B;  3EK7 A;  1WDC C;  3CR2 A;  4JWQ A;  1B7T Z;  4PDZ A;  1TNX A;  3PAL A;  3BFB A;  1KSO A;  2GV5 A;  2JXL A;  2Y4Q A;  2ZRS A;  1CFP A;  4OCI A;  1AJ4 A;  2OTG B;  2GGZ A;  5DIC A;  3CZ1 A;  1U5I A;  1ZAC A;  4JPZ B;  2ZN8 A;  4XJK A;  4CID A;  1J55 A;  2M7N A;  1ALV A;  1S5G Z;  1PSR A;  2WCL A;  4FTG A;  2ZFD A;  3KO0 A;  3I5H C;  1EXR A;  3DVJ A;  3E3R A;  1YR5 A;  4DCK A;  2FCD A;  2L5X B;  1CMG A;  1G4Y R;  1IJ5 A;  4F0Z B;  1SBJ A;  1WRL A;  1M39 A;  1RJV A;  2CT9 A;  2A4J A;  1CDP A;  5B8I B;  2M3W A;  3R1O A;  2GTE A;  5FI7 A;  1DMO A;  1P28 A;  1XFV O;  3I5F B;  2KOT A;  1YX7 A;  3FE6 A;  4TNC A;  1FF1 A;  1DJY A;  2E6W A;  3KF9 A;  3M0W A;  4WRI A;  2OTG C;  1TIZ A;  3BYA A;  4YGA A;  3ZWH A;  1WLM A;  2DOQ A;  5I2O A;  1KQV A;  3EK8 A;  2B1U A;  4PHJ A;  1B4C A;  2H2K A;  1FW4 A;  1GJY A;  4L9M A;  1DJH A;  1DVI A;  2BE6 A;  2HQ8 A;  2K7O A;  3VRN A;  2LM5 A;  2EC6 B;  3UNW A;  3DF0 B;  3VRP A;  1SL9 A;  3BUO B;  1ZMZ A;  3TDU A;  1D1O A;  2IS9 A;  3N7H A;  3EKJ A;  3CZ2 A;  3EG5 B;  2KGR A;  5HLO A;  1JWD A;  1J1D A;  2I94 A;  3KPX A;  1RTP 1;  5I94 A;  1CMF A;  1K90 D;  4FQT A;  5ER4 X;  1OW4 A;  2Y5I A;  3I5G B;  1TRF A;  4FQO A;  1QWV A;  1UHI A;  5CSI A;  1CFC A;  1CFF A;  1CKK A;  3SS4 A;  1M45 A;  3TDI A;  1Y6W A;  4F7F A;  1KFX S;  1SL7 A;  3R1P A;  1WRZ A;  3FWC A;  3RM1 A;  3GK4 X;  3WHU B;  4USL A;  2LVK A;  1S26 D;  2MRD A;  1CLL A;  1SMG A;  2KAY A;  3DXL A;  1M46 A;  2EC6 C;  1EJ3 A;  3O2P A;  4CFQ A;  2KQ6 A;  1EG3 A;  1S3P A;  3VRQ A;  1NCY A;  2WC6 A;  2GGM A;  1DGV A;  2OS8 B;  1CLB A;  5AAN A;  3EVU A;  3D0Y A;  3GOF A;  1ORG A;  1ZFS A;  1SPY A;  2BL0 B;  2MLF C;  1KQM B;  3I5G C;  4CFR A;  1C3Z A;  2KBM A;  5GQQ C;  3RZS A;  3A8R A;  1B1G A;  5D7F A;  1QX7 A;  2WCK A;  4PT1 A;  2LHL A;  3B87 A;  1FI5 A;  4BY5 A;  2M97 A;  1QAS A;  3OX5 A;  1AHR A;  2LE9 B;  2ZRT A;  3DY9 A;  1KK8 B;  3D78 A;  2BEC A;  1SCM B;  2JNF A;  4M2Q A;  4PE4 A;  1SR6 B;  2JZI A;  1ZUZ A;  2NXQ A;  2PYQ A;  1N0Y A;  2QEH A;  1QXP A;  5F6T A;  1BLQ A;  5CPV A;  1TWO A;  1XFR A;  4PHK A;  4C0J A;  1Y1X A;  2JPO A;  2KAX A;  2OS8 C;  4YI9 A;  2F3Z A;  2CCM A;  2MA2 A;  1LKJ A;  4GGF A;  1K95 A;  1SRA A;  1OOJ A;  2MLE C;  2LC5 A;  3AAJ A;  1N65 A;  2BL0 C;  3A4U B;  2LMV A;  1K9U A;  1UP5 A;  1KQM C;  2P6B B;  2JTT A;  3KHE A;  3K1E A;  3MSE B;  1NWD A;  2K0J A;  1GGZ A;  4PE7 A;  1F70 A;  3NSL A;  2CBL A;  1CM1 A;  2HET A;  2JU0 A;  2ZN9 A;  3IQQ A;  4NDC A;  4D1E A;  1KK8 C;  1YUS A;  2KI6 C;  1NPQ A;  1IRJ A;  3S0E A;  3SJS A;  1G8I A;  2ZND A;  1K8U A;  3O4X A;  3LK1 A;  1SCM C;  1JBA A;  4YGB B;  1SR6 C;  1N2D A;  5K89 A;  3SG2 A;  4QJ5 B;  3CAB A;  1OOH A;  1QLK A;  1LA0 A;  1F4O A;  1PVA A;  1XFZ O;  1BG1 A;  1TUJ A;  2BCA A;  2P70 A;  2JQ6 A;  2L50 A;  2QEB A;  1QV1 A;  2CNP A;  1KWO C;  2WND A;  4GUK A;  2BKH B;  1HQV A;  1LIN A;  1RWY A;  5CSN A;  1REC A;  2G2B A;  2M1U A;  5AEQ A;  1UUR A;  3EVR A;  2BBN A;  4PCW A;  4IL1 A;  1S6I A;  4ORC B;  3SG6 A;  5KU1 A;  2LUC A;  1QS7 A;  1NX2 A;  4ZCU A;  2M1K B;  1YVH A;  3DF0 A;  4P2Y B;  3NSK A;  4HRG A;  2LP2 A;  1B8L A;  1R2U A;  2EHB A;  2RGI A;  2WOR A;  1XVJ A;  1GGW A;  2JNX A;  3I5I B;  2WCJ A;  1DF0 A;  2R2I A;  2M8U A;  3EK4 A;  2JT3 A;  4N1G A;  4PAL A;  4C0K A;  1ALW A;  1CDL A;  1XYD A;  2NLN A;  3B7A A;  5HL1 A;  1NCZ A;  4OR9 B;  3SS5 A;  1CFD A;  2FJY A;  2QPT A;  1SL8 A;  2I18 A;  1QX2 A;  4WQ3 A;  1S6C A;  1IGV A;  2LVJ A;  1C07 A;  1OSA A;  1X02 A;  5ER5 A;  2WCE A;  4I5K A;  4MN0 A;  4NDB A;  1QAT A;  2QEO A;  1DJX A;  1BOC A;  1OZO A;  1W9Z A;  1J1E A;  1PAL A;  2FJU B;  1UHK A;  5DKR A;  3D76 A;  1IWQ A;  4CPV A;  4ETO A;  1IH0 A;  1YUU A;  2WCF A;  2LAN A;  2OPO A;  3NHT A;  3I5I C;  1CM4 A;  1T14 A;  1OOG A;  2F33 A;  4ICB A;  4JD9 A;  1K9K A;  3L4L A;  1K96 A;  2F2P A;  1V1G A;  1EG4 A;  1WLZ A;  1AUI B;  2BNX A;  2H61 C;  3NSO A;  4P5O E;  1J7O A;  2NCP A;  1C7V A;  1NIW A;  3BUX B;  2KI6 D;  5TNC A;  5J3X A;  4YGC B;  1DEK A;  1W7J B;  3OX6 A;  3F45 A;  1FBV A;  3UO9 A;  1A75 A;  1Q80 A;  2O60 A;  2CTN A;  1SSE B;  1C7W A;  1XFW O;  5G08 A;  1CDN A;  3BJH A;  1NYA A;  3BOW B;  1XA5 A;  5JJG A;  3CZ0 A;  5AXI A;  1UHH A;  1DEL A;  1TNP A;  3CYZ A;  1QLS A;  3D75 A;  4C0L A;  1B8R A;  1KFU L;  2JPT A;  5AER A;  3PSR A;  1K2H A;  1J7P A;  1TN4 A;  3HCM A;  3SG4 A;  1SY9 A;  4A4C A;  1MXE A;  4I5J A;  1NSH A;  3FE9 A;  1OMR A;  1YUR A;  4ORA B;  2LV7 A;  4MLW A;  2M7L A;  1JC2 A;  3SG3 A;  1K9P A;  1NP8 A;  1Y0V H;  2PAS A;  4HRH A;  1OMV A;  4INW A;  2TN4 A;  3D77 A;  1XFU O;  1OE9 B;  3VGO A;  1EL4 A;  2HPS A; 
#chains in the Genus database with same CATH homology
 1A03 A;  4XJK B;  1JSA A;  1DJI A;  2ZNE A;  3VRO A;  3FIA A;  2LCP A;  1ZOT B;  2WOS A;  2AUC A;  3K21 A;  2JC2 A;  3PFV A;  4OV2 A;  1IQ5 A;  1PRW A;  2SCP A;  1LVC D;  3JTD C;  4UPG A;  1TTX A;  3CLN A;  1YX8 A;  1MHO A;  4AQJ A;  3BUM B;  2D8N A;  1CLM A;  3PLF B;  2WCB A;  2KFG A;  1H4B A;  1LXF C;  1KWO B;  1MUX A;  1PUL A;  1YVL A;  1A4P A;  2KDH A;  2AMI A;  3BQ3 A;  1JFJ A;  3SG7 A;  5CSJ A;  1DJW A;  1JF0 A;  1UUS A;  1SK6 D;  2CXJ A;  2KAV A;  3GK1 A;  4HRE E;  3CGA A;  3RLZ A;  1DJG A;  3FS7 A;  1J7R A;  1F4Q A;  3PAT A;  5DKQ A;  4I5N B;  3AKB A;  1PK0 D;  1TCO B;  4YBH B;  1XK4 C;  4N5X A;  1SKT A;  4AOM A;  3C1V A;  2FOT A;  1QJT A;  1UWO A;  4MEW A;  3CZT X;  3FWB A;  2JRF A;  5HLV A;  5I8N A;  4PE1 A;  4AQI A;  2COL B;  1F8H A;  1WRK A;  4HSZ A;  5JOL A;  2KYF A;  1TNW A;  4JQ0 D;  4GPL B;  4M2O A;  2Y1M A;  5KTY A;  2KGB C;  2L98 A;  1BU3 A;  3LCP C;  4MSP A;  3CR5 X;  3AAK A;  5KSZ A;  1W7I B;  4OKH A;  1BT6 A;  4E68 A;  2JWW A;  2KI4 B;  1AK8 A;  2LMT A;  2L2E A;  3BOW A;  2G9B A;  4MVF A;  3OP0 A;  1OZS A;  3CWG A;  4Q04 A;  1CNP A;  2F2O A;  2E30 A;  4PHN A;  2LVV A;  2MBX A;  2KQY A;  1BF5 A;  1IG5 A;  1BOD A;  5HKY A;  2HQW A;  2L4H A;  2KYC A;  1NCX A;  1QX5 B;  5PAL A;  4DS7 A;  2EGD A;  4MZJ A;  1GQM A;  1A2X A;  5DKN A;  1EH2 A;  2O5G A;  1KCY A;  3NXA A;  3CTN A;  4GFT A;  1ODB A;  2JT8 A;  2LNK A;  3DVM A;  3PN7 B;  1DTL A;  2JT0 A;  3DVK A;  4MZL A;  2MJW B;  2KI4 C;  1VRK A;  1E8A A;  1NX3 A;  2LLS A;  2Y1N A;  4YGD B;  1F71 A;  1FI6 A;  2QAC A;  1JFK A;  1MR8 A;  2PSR A;  3GK2 A;  2K2F A;  2Q91 A;  1NX1 A;  4XYN A;  4GNK B;  2Q4U A;  4QJ3 B;  1RK9 A;  4ORB B;  2M49 B;  4YI8 A;  1S1E A;  2HF5 A;  2NZ0 A;  1MF8 B;  3TUY B;  4CLN A;  4BY4 A;  1XK4 A;  4GGF C;  3VRR A;  1L2O B;  1TOP A;  2L51 A;  4OVN F;  3PN7 C;  2FCE A;  2LMU A;  2LLU A;  2KFF A;  4MZK A;  2L4I A;  1KFU S;  3LLE A;  4U8D A;  1QV0 A;  2MHH A;  1MWN A;  2I7A A;  3SIA A;  2WC8 A;  1JUO A;  2NCO A;  5I2Q A;  1BR4 B;  1SW8 A;  3JTD B;  5HYD A;  1K94 A;  4GBA A;  2LHI A;  3SIB A;  1KSM A;  1DJZ A;  1QVI Y;  1AJ5 A;  3TUY C;  2PRU A;  1M31 A;  1DF0 B;  1Y1U A;  1L2O C;  5HKZ A;  3TDZ A;  3I5F C;  4A4B A;  1U5I B;  1IJ6 A;  4I5L B;  2JOJ A;  3O78 A;  1DT7 B;  1G33 A;  1S6J A;  2K7B A;  1XFY O;  3IF7 A;  1XO5 A;  2ZKM X;  1F54 A;  1CDM A;  1MXL C;  1AVS A;  1KFX L;  2BKI B;  2KBI A;  1H8B A;  3OHM B;  1MQ1 A;  5FYX A;  3TS5 B;  3SG5 A;  2LVI A;  2JXC A;  2M9G A;  3DD4 A;  4GGN A;  2BCB A;  4MRX A;  4DRW A;  1SYM A;  4DUQ A;  1PVB A;  1RFJ A;  2K7D A;  3CS1 A;  2BCX A;  2I2R E;  2PAL A;  1TCF A;  1K93 D;  3LK0 A;  3ICB A;  2K7C A;  1IQ3 A;  4ZCV A;  2V53 A;  1HT9 A;  3H4S E;  1YRT B;  3IQO A;  3LL8 B;  1SNL A;  4MBE A;  1XFX O;  3NSI A;  2BBM A;  4QJ4 B;  3EKH A;  1KK7 Y;  4GAO A;  1B7T Y;  2LAP A;  3AKA A;  2K2A A;  2VRG A;  1CTR A;  2H61 A;  3BXK A;  4NDD A;  1BR1 B;  3TS5 C;  1B9A A;  4YRU A;  2LLT A;  2LUX A;  3OB1 B;  1OMD A;  1QIV A;  1YTZ C;  3D10 A;  1A75 B;  3JVT B;  3OB2 B;  1UHJ A;  5D69 A;  1M63 B;  1S5G Y;  3WXA A;  1TNQ A;  2BE4 A;  2F3Y A;  2SAS A;  2ISD A;  1QIW A;  3CR4 X;  1V1F A;  3TZ1 A;  1Y1A A;  1YRU B;  1BJF A;  1QVI Z;  3O4Y A;  1YUT A;  2PVB A;  1F55 A;  1JF2 A;  4M2P A;  5CSF A;  1OQP A;  4R1E A;  1WY9 A;  5BPJ A;  2MAZ A;  5AFP A;  4WQ2 A;  1UHN A;  4YGE B;  5I2L A;  1RRO A;  1SCV A;  1R6P A;  2JTZ A;  2KHN A;  1DGU A;  2JUL A;  2LP3 A;  1WDC B;  4PE0 A;  1FPW A;  1A29 A;  3D0Y B;  3JVT C;  1QTX A;  1LA3 A;  1S36 A;  2K61 A;  5HKW A;  3BUN B;  1CB1 A;  2F8P A;  2M0R A;  1PSB A;  2PMY A;  2M29 A;  4PHM A;  1B47 A;  5IBW A;  2KFH A;  3KEV A;  4DIR A;  1J7Q A;  3O6B A;  1B8C A;  3ZNI A;  3I5H B;  4MRY A;  4NQG A;  3DVE A;  2AAO A;  1AP4 A;  2KSP A;  2KNE A;  3BUW B;  2L0P A;  1L7Z A;  1IKU A;  1NUB A;  3WNX B;  1NX0 A;  2K8M B;  3HX4 A;  1BMO A;  3QRX A;  3EVV A;  4N1F A;  3PM8 A;  1KK7 Z;  3WHT B;  3EK7 A;  1WDC C;  3CR2 A;  4JWQ A;  1B7T Z;  4PDZ A;  1TNX A;  3PAL A;  1KSO A;  2GV5 A;  2JXL A;  2Y4Q A;  2ZRS A;  1CFP A;  4OCI A;  1AJ4 A;  2OTG B;  2GGZ A;  1U5I A;  1ZAC A;  4JPZ B;  2ZN8 A;  4XJK A;  4CID A;  1J55 A;  2M7N A;  1ALV A;  1S5G Z;  1PSR A;  4FTG A;  2ZFD A;  3KO0 A;  3I5H C;  1EXR A;  3DVJ A;  3E3R A;  1YR5 A;  4DCK A;  2FCD A;  2L5X B;  1CMG A;  1G4Y R;  1IJ5 A;  4F0Z B;  1SBJ A;  1WRL A;  1M39 A;  1RJV A;  2CT9 A;  2A4J A;  1CDP A;  5B8I B;  2M3W A;  1DMO A;  3I5F B;  1XFV O;  2KOT A;  1YX7 A;  4TNC A;  1FF1 A;  1DJY A;  2E6W A;  3KF9 A;  3M0W A;  4WRI A;  2OTG C;  1TIZ A;  3BYA A;  4YGA A;  3ZWH A;  1WLM A;  2DOQ A;  5I2O A;  1KQV A;  3EK8 A;  2B1U A;  4PHJ A;  1B4C A;  2H2K A;  1FW4 A;  1GJY A;  4L9M A;  1DJH A;  1DVI A;  2BE6 A;  2HQ8 A;  2K7O A;  3VRN A;  2LM5 A;  2EC6 B;  3DF0 B;  3VRP A;  1SL9 A;  3BUO B;  1ZMZ A;  3TDU A;  1D1O A;  2IS9 A;  3EKJ A;  2KGR A;  5HLO A;  1JWD A;  1J1D A;  2I94 A;  3KPX A;  1RTP 1;  1CMF A;  1K90 D;  5ER4 X;  2Y5I A;  3I5G B;  1TRF A;  4FQO A;  1UHI A;  5CSI A;  1CFC A;  1CFF A;  1CKK A;  1M45 A;  3TDI A;  1Y6W A;  1KFX S;  1SL7 A;  3RM1 A;  1WRZ A;  3FWC A;  3GK4 X;  3WHU B;  4USL A;  2LVK A;  1S26 D;  2MRD A;  1CLL A;  1SMG A;  2KAY A;  1M46 A;  2EC6 C;  1EJ3 A;  3O2P A;  4CFQ A;  2KQ6 A;  1EG3 A;  1S3P A;  3VRQ A;  1NCY A;  2GGM A;  1DGV A;  2OS8 B;  1CLB A;  5AAN A;  3EVU A;  3D0Y A;  3GOF A;  1ZFS A;  1SPY A;  2BL0 B;  2MLF C;  1KQM B;  3I5G C;  4CFR A;  2KBM A;  5GQQ C;  3A8R A;  1B1G A;  5D7F A;  1QX7 A;  2LHL A;  1FI5 A;  4BY5 A;  2M97 A;  1QAS A;  3OX5 A;  1AHR A;  2LE9 B;  2ZRT A;  1KK8 B;  2BEC A;  1SCM B;  2JNF A;  4M2Q A;  4PE4 A;  1SR6 B;  2JZI A;  1ZUZ A;  2NXQ A;  1N0Y A;  5F6T A;  1QXP A;  1BLQ A;  5CPV A;  4PHK A;  4C0J A;  1Y1X A;  2KAX A;  2OS8 C;  4YI9 A;  2F3Z A;  2CCM A;  2MA2 A;  1LKJ A;  4GGF A;  1K95 A;  1SRA A;  1OOJ A;  2MLE C;  2LC5 A;  3AAJ A;  1N65 A;  2BL0 C;  3A4U B;  2LMV A;  1K9U A;  1UP5 A;  1KQM C;  2P6B B;  2JTT A;  3KHE A;  3MSE B;  1NWD A;  2K0J A;  1GGZ A;  4PE7 A;  1F70 A;  3NSL A;  2CBL A;  1CM1 A;  2HET A;  2JU0 A;  2ZN9 A;  3IQQ A;  4NDC A;  4D1E A;  1KK8 C;  1YUS A;  2KI6 C;  1NPQ A;  1IRJ A;  3SJS A;  1G8I A;  2ZND A;  1K8U A;  3LK1 A;  1SCM C;  1JBA A;  4YGB B;  1SR6 C;  1N2D A;  5K89 A;  3SG2 A;  4QJ5 B;  1QLK A;  1LA0 A;  1F4O A;  1PVA A;  1XFZ O;  1BG1 A;  2BCA A;  2JQ6 A;  2L50 A;  1QV1 A;  2CNP A;  1KWO C;  2WND A;  4GUK A;  2BKH B;  1HQV A;  1LIN A;  1RWY A;  5CSN A;  1REC A;  2G2B A;  2M1U A;  5AEQ A;  1UUR A;  3EVR A;  2BBN A;  4PCW A;  4IL1 A;  1S6I A;  4ORC B;  3SG6 A;  5KU1 A;  2LUC A;  1QS7 A;  1NX2 A;  4ZCU A;  2M1K B;  1YVH A;  3DF0 A;  4P2Y B;  3NSK A;  4HRG A;  2LP2 A;  1B8L A;  1R2U A;  2EHB A;  2RGI A;  2WOR A;  1XVJ A;  1GGW A;  2JNX A;  3I5I B;  1DF0 A;  2R2I A;  2M8U A;  3EK4 A;  2JT3 A;  4N1G A;  4PAL A;  4C0K A;  1ALW A;  1CDL A;  1XYD A;  2NLN A;  1NCZ A;  4OR9 B;  1CFD A;  2QPT A;  1SL8 A;  2I18 A;  1QX2 A;  4WQ3 A;  1S6C A;  1IGV A;  2LVJ A;  1C07 A;  1OSA A;  1X02 A;  5ER5 A;  2WCE A;  4I5K A;  4MN0 A;  4NDB A;  1QAT A;  1DJX A;  1BOC A;  1OZO A;  1J1E A;  1PAL A;  2FJU B;  1UHK A;  5DKR A;  1IWQ A;  4CPV A;  4ETO A;  1IH0 A;  1YUU A;  2WCF A;  2LAN A;  2OPO A;  3I5I C;  1CM4 A;  2F33 A;  4ICB A;  1K9K A;  1K96 A;  2F2P A;  1V1G A;  1EG4 A;  1WLZ A;  1AUI B;  2H61 C;  3NSO A;  4P5O E;  1J7O A;  2NCP A;  1C7V A;  1NIW A;  3BUX B;  2KI6 D;  5TNC A;  5J3X A;  4YGC B;  1W7J B;  3OX6 A;  3F45 A;  1FBV A;  1A75 A;  1Q80 A;  2O60 A;  2CTN A;  1C7W A;  1XFW O;  5G08 A;  1CDN A;  1NYA A;  3BOW B;  1XA5 A;  5JJG A;  5AXI A;  1UHH A;  1TNP A;  1QLS A;  4C0L A;  1B8R A;  1KFU L;  2JPT A;  5AER A;  3PSR A;  1K2H A;  1J7P A;  1TN4 A;  3HCM A;  3SG4 A;  1SY9 A;  4A4C A;  1MXE A;  4I5J A;  1NSH A;  4ORA B;  1OMR A;  1YUR A;  1JC2 A;  2LV7 A;  4MLW A;  2M7L A;  3SG3 A;  1K9P A;  1NP8 A;  1Y0V H;  2PAS A;  4HRH A;  1OMV A;  2TN4 A;  1XFU O;  1OE9 B;  3VGO A;  1EL4 A;  2HPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...