5B8IB

Crystal structure of calcineurin a and calcineurin b in complex with fkbp12 and fk506 from coccidioides immitis rs
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
171
structure length
171
Chain Sequence
MSSQVLNDIVSGSNFDHEEVDRLWKRFMKLDRDKSGTIERDEFLSLPQVSSNPLSTRMIAIFDEDGGGDVDFQEFVSGLSAFSSKGNKEEKLRFAFKVYDIDRDGFISNGELFIVLKMMVGSNLKDMQLQQIVDKTIMEADLDGDGRISFEEFTRMVENTDVSMSMTLDQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Serine/threonine-protein phosphatase
publication title Crystal structure of Calcineurin A and Calcineurin B in complex with FKBP12 and FK506 from Coccidioides immitis RS
rcsb
source organism Coccidioides immitis (strain rs)
total genus 67
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2015-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13202 EF-hand_5 EF hand
B PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5b8iB00
3PN7B 3JVTC 2H2KA 2NZ0A 1V1GA 1TTXA 1M46A 2MAZA 3KPXA 3QRXA 1XFYO 2JTTA 1A29A 1YRUB 2JNXA 2JT0A 2M3WA 3BUOB 3JTDB 4WQ3A 1XK4C 4PE4A 1YURA 1M31A 1WRKA 2HF5A 1WRLA 2JWWA 2RGIA 2LVIA 2KDHA 5KU1A 3OB1B 1WLZA 5DKQA 2CT9A 3GK4X 4YI8A 1K8UA 3A4UB 1F71A 1Q80A 1XO5A 2CBLA 1A75A 1X02A 4JPZB 4ORCB 3JVTB 4NDBA 2PMYA 2V53A 4MSPA 5JJGA 1SR6C 4PE0A 1CKKA 1CLMA 3BOWB 4MEWA 3TDUA 5TNCA 1YRTB 4WRIA 4XYNA 2JRFA 2JT3A 3HCMA 2L51A 2QACA 1UHJA 4MVFA 1CFFA 4C0LA 1SPYA 1K95A 3CZTX 3I5IC 1RJVA 1B1GA 1M39A 3PM8A 1IH0A 1NX1A 4NDDA 3OHMB 2LLSA 1QATA 4R1EA 1B7TY 1SR6B 2PRUA 2HQ8A 1BJFA 1XFUO 2LUXA 4DRWA 1GJYA 4A4BA 1FI5A 1NX3A 1OMDA 2JXLA 1SY9A 3I5IB 1S1EA 2OTGC 1PSRA 1MQ1A 1JFJA 2NCPA 4I5NB 1UP5A 2Q91A 2BCBA 1S26D 2F3YA 4CFQA 1YUTA 4JWQA 4YGAA 3DVJA 3RM1A 2GV5A 1KFUS 1WDCC 2K2AA 1K9UA 1TN4A 2E30A 1SYMA 2KGBC 3TZ1A 2FCEA 2Y1MA 4OVNF 3CR4X 3GOFA 1W7JB 3LL8B 5AEQA 2Y5IA 3PALA 3VROA 3VGOA 4ETOA 4YRUA 1F70A 2OTGB 1CDPA 1JC2A 4UPGA 1FPWA 5DKRA 1YX7A 2M7NA 1PSBA 1DT7B 4QJ4B 2KI6C 3O78A 1J55A 1KQMC 3LLEA 4MLWA 1NX0A 1WDCB 1K9KA 3BUXB 4YBHB 1IG5A 1U5IA 1A75B 1OE9B 3AAKA 4IL1A 1UWOA 1ALVA 2CNPA 2EHBA 2KAXA 1G33A 2COLB 2KSPA 1KFUL 4M2QA 4Q04A 3SIAA 4OR9B 1FW4A 1C7WA 2KBIA 3OB2B 4PHJA 1YVHA 1AHRA 1KK8B 4GFTA 2L98A 4GBAA 2PSRA 1N2DA 2LV7A 3H4SE 4GAOA 2MLEC 1GGZA 3BUNB 3EK8A 1YTZC 1GQMA 2NXQA 1J7RA 1WY9A 2KFGA 2KNEA 1EG4A 1NP8A 3DVEA 5ER4X 2LP2A 3KHEA 1CFCA 1K94A 5I8NA 4MZJA 1B47A 1N65A 3CR2A 3PSRA 1QIWA 1J1EA 2I18A 2NCOA 1AJ4A 1DTLA 1QLSA 1SKTA 2TN4A 1PULA 1KQVA 1FI6A 1LKJA 2KI4C 4U8DA 4XJKA 3PFVA 1NWDA 2L4HA 2M8UA 2PASA 1EH2A 1VRKA 1B8CA 1SL8A 2WC8A 3WXAA 1QLKA 2JXCA 1XFXO 3NSOA 1JUOA 1OZOA 1XA5A 3EVUA 1K90D 1ZMZA 1PVBA 2KI6D 2NLNA 1A03A 1CFPA 1DJYA 1OSAA 1CDLA 3GK2A 4AQJA 1F4OA 2KI4B 1QJTA 2HETA 2LP3A 2LANA 2KQ6A 1S5GZ 2LAPA 5AXIA 1E8AA 1NCZA 2MRDA 3OP0A 4DS7A 4QJ3B 1QTXA 1J1DA 1MUXA 1YX8A 3TUYC 1MWNA 1BR1B 4MZKA 1DF0A 1QV1A 5HLOA 1YVLA 3D0YA 4GGNA 3NSIA 3OX6A 1CB1A 3IQQA 1CLLA 1PK0D 1AJ5A 2KAVA 3D10A 4DCKA 4YGEB 1U5IB 3E3RA 1ODBA 4P2YB 2WCEA 5CPVA 3TS5B 1JF0A 1CTRA 1M63B 1BLQA 1QASA 2JPTA 4JQ0D 1OQPA 3TUYB 3M0WA 2F8PA 1MHOA 2ZKMX 2BE4A 5HKWA 1OMVA 2Y1NA 4MZLA 5CSIA 1AP4A 3DF0A 2I2RE 3CGAA 3FWCA 1XFZO 4A4CA 2F2OA 3SG2A 1GGWA 1K2HA 3HX4A 1TRFA 1QX7A 2MHHA 2JNFA 4OCIA 1IQ3A 3CS1A 5D69A 3VRQA 1R6PA 5AERA 1QV0A 3K21A 2KAYA 2K7DA 1BG1A 4I5JA 1JBAA 2K61A 1DJWA 3PATA 4XJKB 4ZCUA 1CM1A 3SG3A 3SG5A 1K96A 2KFFA 3SJSA 1IKUA 2OPOA 1CDMA 3A8RA 5I2OA 2L5XB 1SNLA 2LMVA 5IBWA 2K7OA 1HT9A 2BBNA 4M2OA 1F54A 1BF5A 5HKYA 2LNKA 1S5GY 2KYCA 1CMGA 3KEVA 1CMFA 1RWYA 1B8RA 3DVMA 4AOMA 2M49B 1KK7Z 5HLVA 4N1GA 1K9PA 3DVKA 1F55A 1C7VA 1Y1AA 1A2XA 2Y4QA 3EKHA 3TDIA 2M9GA 1D1OA 1SRAA 1UHNA 3BXKA 2FJUB 2PALA 1KK8C 2F2PA 2WCBA 1UHKA 2FCDA 4PCWA 3BYAA 3VRPA 1TNQA 2FOTA 1FBVA 1OMRA 5CSJA 1YUSA 2O60A 1DF0B 3VRRA 1EG3A 3D0YB 4FQOA 1EJ3A 1IQ5A 2BBMA 2SASA 3WNXB 1XFVO 2BKHB 1Y6WA 2BL0C 2WOSA 5I2LA 3F45A 1TCFA 1IJ6A 1J7OA 2ZN8A 1B8LA 4PHMA 2BKIB 2Q4UA 2OS8C 1KFXS 4HSZA 2LE9B 1B9AA 2K7CA 2M7LA 3CR5X 2H61A 1ZACA 2LVVA 1KSOA 4C0JA 3NSLA 1H4BA 4E68A 3IF7A 1F4QA 1WRZA 3C1VA 2LCPA 1KWOC 2JQ6A 5KTYA 5HYDA 5D7FA 2L0PA 5G08A 3LK0A 1DMOA 3DF0B 2BL0B 4PE1A 2EC6B 1XYDA 3EK7A 2HPSA 2I94A 4GNKB 4OV2A 4MRXA 3EKJA 1RK9A 2OS8B 1DJGA 1KK7Y 3CTNA 4ORBB 1WLMA 1N0YA 1S6CA 2JC2A 4GUKA 4DUQA 3KO0A 1NYAA 1KFXL 2MA2A 3AKAA 4M2PA 1V1FA 1S6JA 4N1FA 3BUMB 1G8IA 4PDZA 2LUCA 1KWOB 5I2QA 4PALA 1R2UA 2MLFC 1DJZA 2SCPA 2CTNA 3KF9A 4ZCVA 1Y1UA 2VRGA 1TIZA 1ZOTB 2JULA 1AVSA 1TNWA 1NPQA 1YUUA 5JOLA 2LVJA 1DVIA 1BU3A 2IS9A 4L9MA 1K93D 1BT6A 2BCAA 1F8HA 3TS5C 5CSNA 2LMTA 3I5HC 2L4IA 1S6IA 5AANA 2JZIA 2KOTA 2H61C 5AFPA 1LXFC 4C0KA 1SL9A 1NCXA 2JT8A 4CLNA 1UUSA 4QJ5B 2ISDA 4GGFA 1S36A 1TOPA 5BPJA 2M1UA 2ZNDA 1BOCA 2L50A 2JOJA 2JTZA 4DIRA 2R2IA 3I5HB 1NX2A 1IJ5A 1CLBA 1FF1A 1EXRA 2AUCA 1TNXA 2F33A 2LHLA 2ZRTA 2LLTA 3EK4A 3IQOA 1QVIZ 1Y1XA 1IGVA 3O6BA 3VRNA 1KCYA 2F3ZA 1ALWA 5J3XA 1LVCD 3EVVA 1JWDA 2A4JA 5ER5A 1L7ZA 2EGDA 4TNCA 1EL4A 4I5KA 1OZSA 1MF8B 2LVKA 2ZFDA 3RLZA 1YR5A 4GPLB 1DGUA 2G2BA 2L2EA 2WCFA 3AKBA 1PALA 1QXPA 4CFRA 1CDNA 1HQVA 1MXLC 2MJWB 5KSZA 3OX5A 3PLFB 4PHKA 1UHIA 2AMIA 1AK8A 1BMOA 2KBMA 1AUIB 2GGZA 4YI9A 1IWQA 5HKZA 1QX2A 2KGRA 2KYFA 5DKNA 1H8BA 4NDCA 1DJHA 1ZFSA 1J7PA 1JFKA 3NSKA 2K8MB 2LMUA 1SK6D 2ZN9A 4GGFC 3LK1A 1DGVA 3O4YA 1J7QA 4MBEA 3NXAA 2G9BA 2CCMA 2KFHA 4HREE 4AQIA 2P6BB 4MRYA 2E6WA 2BE6A 3CLNA 3FS7A 1PRWA 2K7BA 2M97A 1QVIY 1UURA 4WQ2A 1UHHA 2M29A 4HRHA 2WORA 3WHTB 4FTGA 1OOJA 2LM5A 4F0ZB 4MN0A 1SL7A 4OKHA 2EC6C 1RECA 1MR8A 3LCPC 1TCOB 5F6TA 1NIWA 3BQ3A 1PVAA 4HRGA 1JSAA 5FYXA 2K0JA 2DOQA 1M45A 2KHNA 2I7AA 1KSMA 1XVJA 1XFWO 1C07A 4USLA 2ZRSA 2KQYA 4ICBA 1JF2A 3ZNIA 4N5XA 1G4YR 4NQGA 2BECA 1RROA 4PE7A 1NSHA 1LA0A 3BOWA 3SG4A 2QPTA 1QS7A 3O2PA 1S3PA 1DJXA 1XK4A 2JU0A 1MXEA 1CNPA 3SIBA 2GGMA 4P5OE 1QX5B 3SG6A 1TNPA 3I5GC 1CFDA 3FIAA 1L2OC 4D1EA 1SCMC 2O5GA 1CM4A 2PVBA 1NCYA 3I5FC 1LA3A 5GQQC 1SBJA 3FWBA 2M1KB 1KQMB 1RTP1 2LC5A 4YGBB 1A4PA 3DD4A 1LINA 4CIDA 2K2FA 1B4CA 3CWGA 1SMGA 4ORAB 1BR4B 3PN7C 2LHIA 4BY4A 1SW8A 2CXJA 1RFJA 4YGDB 2HQWA 5K89A 3I5GB 1L2OB 1W7IB 2ZNEA 1SCMB 2B1UA 4YGCB 3AAJA 3I5FB 4BY5A 5CSFA 2WNDA 1BODA 3BUWB 5PALA 3JTDC 2MBXA 2D8NA 2BCXA 3ZWHA 4CPVA 4PHNA 5B8IB 3MSEB 3GK1A 2AAOA 3ICBA 4I5LB 1B7TZ 1Y0VH 1IRJA 1DJIA 1ZUZA 2LLUA 3TDZA 3WHUB 2M0RA 1NUBA 1SCVA 3SG7A 1QIVA 3EVRA
chains in the Genus database with same CATH superfamily
3CZ0A 3PN7B 3JVTC 4JD9A 2H2KA 2NZ0A 1V1GA 1TTXA 1M46A 2MAZA 3KPXA 3QRXA 1XFYO 2JTTA 1A29A 1YRUB 2JNXA 2JT0A 2M3WA 3BUOB 3JTDB 4WQ3A 1XK4C 4PE4A 1YURA 1M31A 1WRKA 2HF5A 1WRLA 2JWWA 2RGIA 3R1VA 2LVIA 1CNPA 2KDHA 5KU1A 3OB1B 1DQEA 1WLZA 5DKQA 2CT9A 3GK4X 4YI8A 1K8UA 3A4UB 1F71A 1Q80A 1XO5A 2CBLA 1A75A 1X02A 4JPZB 4ORCB 3JVTB 4NDBA 2PMYA 2V53A 4MSPA 5JJGA 1SR6C 4PE0A 1CKKA 1CLMA 3BOWB 4MEWA 3TDUA 5TNCA 1YRTB 4WRIA 4XYNA 2ERBA 2JRFA 2JT3A 3HCMA 2L51A 2QACA 1UHJA 4MVFA 1CFFA 4C0LA 1SPYA 1K95A 2KLDA 3CZTX 3I5IC 1RJVA 1B1GA 1M39A 3PM8A 4OZDA 1IH0A 1NX1A 4NDDA 3OHMB 2LLSA 1QATA 4R1EA 1B7TY 1SR6B 2PRUA 2HQ8A 1BJFA 1XFUO 2LUXA 4DRWA 1GJYA 4A4BA 1FI5A 1NX3A 1OMDA 2JXLA 1P28A 1SY9A 3I5IB 1S1EA 2OTGC 1PSRA 1MQ1A 3S0DA 4F7FA 1JFJA 2NCPA 4I5NB 1UP5A 2Q91A 2BCBA 1S26D 2F3YA 4CFQA 1YUTA 4JWQA 3BFBA 3SS4A 3Q8IA 4YGAA 3DVJA 3RM1A 2GV5A 1KFUS 1WDCC 2K2AA 1K9UA 1TN4A 2E30A 1SYMA 2KGBC 3TZ1A 3S0BA 2FCEA 2Y1MA 4OVNF 3CR4X 3GOFA 1W7JB 3LL8B 5AEQA 2Y5IA 3PALA 3VROA 3VGOA 4ETOA 4YRUA 1F70A 1DEKA 2OTGB 1CDPA 1JC2A 3CABA 4UPGA 1FPWA 5DKRA 1YX7A 2M7NA 3CYZA 1PSBA 1DT7B 4QJ4B 2KI6C 3O78A 1J55A 1KQMC 3B86A 3LLEA 4MLWA 1NX0A 1WDCB 1K9KA 3BUXB 4YBHB 1IG5A 2QEBA 1U5IA 1A75B 1OE9B 3AAKA 4IL1A 1UWOA 1ALVA 2CNPA 2EHBA 2KAXA 1G33A 2COLB 2KSPA 1KFUL 4M2QA 4Q04A 3SIAA 1XFRA 4OR9B 1FW4A 1C7WA 2KBIA 3OB2B 4PHJA 1YVHA 1AHRA 1KK8B 4GFTA 2L98A 4GBAA 2PSRA 1N2DA 2LV7A 2YGUA 3H4SE 2MLEC 4GAOA 1GGZA 3BUNB 3EK8A 1YTZC 1GQMA 2NXQA 1J7RA 1WY9A 2KFGA 2KNEA 1EG4A 1NP8A 3DVEA 5ER4X 2LP2A 3KHEA 3L4AA 1K94A 5I8NA 1CFCA 4MZJA 1B47A 1N65A 3CR2A 3PSRA 1QIWA 2WCMA 1J1EA 2I18A 2NCOA 1AJ4A 1DTLA 1OOHA 1QLSA 1SKTA 2TN4A 1PULA 1KQVA 1FI6A 1LKJA 3RZSA 2KI4C 4U8DA 4XJKA 3PFVA 1NWDA 2L4HA 2M8UA 2PASA 4INXA 1VRKA 1B8CA 2K60A 1SL8A 1EH2A 2QEVA 2WC8A 3WXAA 1QLKA 2JXCA 2KPHA 1XFXO 3NSOA 1JUOA 2FJYA 1OZOA 1XA5A 3EVUA 3FE9A 1K90D 1ZMZA 1PVBA 2KI6D 2NLNA 1A03A 1CFPA 1DJYA 5FI6A 1OSAA 1CDLA 3GK2A 4AQJA 1F4OA 2KI4B 1QJTA 3CZ1A 2HETA 2LP3A 2LANA 2KQ6A 1S5GZ 2LAPA 5AXIA 1E8AA 1NCZA 2MRDA 3OP0A 3B88A 4QJ3B 4DS7A 1QTXA 3S0FA 1J1DA 1MUXA 1YX8A 3TUYC 1MWNA 1BR1B 4MZKA 1DF0A 1QV1A 5HLOA 1YVLA 3D0YA 4GGNA 3NSIA 3OX6A 1CB1A 3IQQA 1CLLA 1PK0D 1C3YA 1AJ5A 2KAVA 3D10A 4DCKA 4YGEB 1T14A 1U5IB 3E3RA 1ODBA 4P2YB 5EL2A 2BNXA 2WCEA 2L5YA 5CPVA 3TS5B 1JF0A 3R1OA 1CTRA 1M63B 1BLQA 1QASA 2JPTA 1C3ZA 4JQ0D 1OQPA 3DY9A 3TUYB 3M0WA 3B7AA 2F8PA 1MHOA 2ZKMX 2BE4A 5HKWA 1OMVA 2Y1NA 3NHTA 1Z4HA 4MZLA 5CSIA 1AP4A 3DF0A 2I2RE 3CGAA 3OGNA 3FWCA 1XFZO 4A4CA 2F2OA 3SG2A 1GGWA 1K2HA 3HX4A 1TRFA 1QX7A 2MHHA 2JNFA 4OCIA 1IQ3A 3CS1A 5D69A 3VRQA 1R6PA 5AERA 1QV0A 3K21A 2KAYA 2K7DA 1BG1A 4I5JA 1JBAA 2K61A 1DJWA 3PATA 2H8VA 4XJKB 4ZCUA 1CM1A 3SG3A 3SG5A 1K96A 2KFFA 3SJSA 1IKUA 2OPOA 1CDMA 3A8RA 5I2OA 2L5XB 1SNLA 2LMVA 5IBWA 2K7OA 1HT9A 2BBNA 4M2OA 1F54A 1BF5A 5HKYA 1OOFA 3BFHA 2LNKA 1S5GY 2KYCA 1CMGA 3KEVA 1CMFA 1RWYA 1B8RA 3DVMA 3NHIA 3SS5A 2M49B 2PYQA 4AOMA 1KK7Z 3R72A 5HLVA 4N1GA 1K9PA 3DVKA 1F55A 4JKTA 1C7VA 3EG5B 1Y1AA 1A2XA 2Y4QA 3EKHA 3TDIA 2M9GA 1D1OA 1SRAA 1UHNA 3BXKA 3PJIA 2FJUB 2PALA 1KK8C 2F2PA 2WCBA 1UHKA 2FCDA 4PCWA 2WCLA 1OOGA 3BYAA 3VRPA 1TNQA 2FOTA 1FBVA 1OMRA 5I94A 5CSJA 1YUSA 2O60A 1DF0B 3CZ2A 3V2LA 1EG3A 3VRRA 3D0YB 4FQOA 1EJ3A 1IQ5A 3D73A 2BBMA 2SASA 3O4XA 3WNXB 1XFVO 2BKHB 1Y6WA 1Z2CB 2BL0C 2WOSA 5I2LA 3F45A 1TCFA 1IJ6A 1QWVA 1J7OA 2ZN8A 1B8LA 4PHMA 2BKIB 2Q4UA 2OS8C 1KFXS 4HSZA 2LE9B 1B9AA 2K7CA 4FQTA 2WCHA 3CR5X 2H61A 2M7LA 1ZACA 2LVVA 3UO9A 1KSOA 4C0JA 1W9ZA 3NSLA 3N7HA 4E68A 1H4BA 3IF7A 1F4QA 1WRZA 3C1VA 2LCPA 1KWOC 2JQ6A 5KTYA 3S0AA 5HYDA 5D7FA 3R1PA 2L0PA 5G08A 3LK0A 1DMOA 5DICA 3DF0B 2BL0B 3DYEA 4PE1A 2EC6B 1XYDA 3EK7A 2HPSA 2I94A 4GNKB 4OV2A 3D77A 4KYNA 4MRXA 3EKJA 1RK9A 2OS8B 1DJGA 1KK7Y 3CTNA 4ORBB 3DZTA 1WLMA 1N0YA 1S6CA 2QEHA 2JC2A 4GUKA 4DUQA 3KO0A 1NYAA 3D75A 3L4LA 1KFXL 2MA2A 2P70A 3AKAA 1V1FA 4M2PA 1S6JA 4N1FA 3BUMB 1G8IA 4PDZA 2LUCA 1KWOB 5I2QA 4PALA 1R2UA 2MLFC 1DJZA 3SS3A 3S0GA 2SCPA 2CTNA 3KF9A 4ZCVA 1Y1UA 2VRGA 1TIZA 1ZOTB 2JULA 2QEOA 1AVSA 1TNWA 1NPQA 1YUUA 5JOLA 2LVJA 1DVIA 1BU3A 2IS9A 4L9MA 1K93D 1BT6A 2BCAA 1F8HA 3TS5C 5CSNA 3L47A 5FI2A 2LMTA 3I5HC 1LS8A 2L4IA 1S6IA 2GTEA 5AANA 1SSEB 2JZIA 2KOTA 2H61C 5AFPA 1LXFC 2WC6A 5HL1A 3CDNA 4C0KA 1SL9A 2KLEA 1NCXA 2JT8A 3QMEA 4CLNA 1UUSA 4QJ5B 2ISDA 4GGFA 1S36A 1TOPA 5BPJA 2M1UA 2ZNDA 1BOCA 2L50A 4PT1A 2JOJA 2JTZA 4DIRA 2R2IA 3I5HB 1GM0A 1NX2A 1IJ5A 1CLBA 2PQLA 1FF1A 1EXRA 2AUCA 1TNXA 2F33A 2LHLA 2ZRTA 2LLTA 3EK4A 3IQOA 1QVIZ 1Y1XA 1IGVA 3S0EA 3O6BA 3VRNA 1KCYA 2F3ZA 3IVTA 1ALWA 2WC5A 1DC1A 5J3XA 1LVCD 3EVVA 1JWDA 2A4JA 5ER5A 1L7ZA 2EGDA 4TNCA 1EL4A 4I5KA 1OZSA 3D74A 1MF8B 2LVKA 2ZFDA 3RLZA 1YR5A 4GPLB 1DGUA 2G2BA 2L2EA 2WCFA 3AKBA 1PALA 1QXPA 4CFRA 1CDNA 2QDIA 1HQVA 1MXLC 2MJWB 5KSZA 3OX5A 3PLFB 4PHKA 1OW4A 1UHIA 2AMIA 1AK8A 1BMOA 2KBMA 1AUIB 2GGZA 4YI9A 1IWQA 5HKZA 1QX2A 2KGRA 2KYFA 5DKNA 1H8BA 2L2CA 1DJHA 1ZFSA 3D76A 1JFKA 4NDCA 1J7PA 1IIOA 3NSKA 1ORGA 2K8MB 2LMUA 1SK6D 2ZN9A 4GGFC 3LK1A 1DGVA 3O4YA 1J7QA 4MBEA 3NXAA 2G9BA 2CCMA 2KFHA 4HREE 4AQIA 2P6BB 4MRYA 2E6WA 2BE6A 3CLNA 3FS7A 1PRWA 2K7BA 1TUZA 1QVIY 1UURA 1TUJA 2M97A 4WQ2A 1UHHA 2M29A 4HRHA 3OBVA 2WORA 3K1EA 3WHTB 4FTGA 1OOJA 2LM5A 4F0ZB 4MN0A 1SL7A 4OKHA 1TWOA 2EC6C 3SG7A 1RECA 1MR8A 2P71A 3LCPC 1TCOB 5F6TA 1NIWA 3BQ3A 1PVAA 4HRGA 1JSAA 5FYXA 2K0JA 2DOQA 1M45A 2KHNA 2I7AA 1KSMA 1XVJA 1XFWO 1C07A 4USLA 2ZRSA 2KQYA 4ICBA 1JF2A 3VB1A 4N5XA 3ZNIA 1G4YR 4NQGA 2BECA 2WCKA 1RROA 4PE7A 1NSHA 1LA0A 1OOIX 3BOWA 2QPTA 3SG4A 1QS7A 3O2PA 3B87A 1S3PA 5D3OA 1DJXA 1XK4A 2JU0A 1MXEA 3B6XA 3SIBA 2GGMA 4P5OE 1QX5B 3SG6A 1TNPA 3I5GC 1CFDA 3FIAA 4INWA 1L2OC 4D1EA 1SCMC 2O5GA 1CM4A 2PVBA 1NCYA 2BAPA 3I5FC 1LA3A 1DELA 5GQQC 1SBJA 3FWBA 2M1KB 1KQMB 1RTP1 2LC5A 4YGBB 1A4PA 2JPOA 2WCJA 3BFAA 3DD4A 1LINA 4CIDA 2K2FA 1B4CA 3CWGA 3UNWA 1SMGA 3D78A 1BR4B 4ORAB 3PN7C 2LHIA 4BY4A 1SW8A 3PM2A 3BJHA 2CXJA 1RFJA 4YGDB 2HQWA 5FI7A 5K89A 3I5GB 1L2OB 1W7IB 2ZNEA 1SCMB 2B1UA 4YGCB 3AAJA 3I5FB 4BY5A 5CSFA 2WNDA 1BODA 3BUWB 5PALA 3JTDC 2MBXA 2D8NA 2BCXA 3ZWHA 4CPVA 4PHNA 5B8IB 3MSEB 3GK1A 2AAOA 3ICBA 3NGVA 4I5LB 1B7TZ 1Y0VH 1IRJA 1DJIA 1ZUZA 2LLUA 4IJ7A 3TDZA 3WHUB 3FE6A 3FE8A 2M0RA 1NUBA 1SCVA 3DXLA 1QIVA 3EVRA
chains in the Genus database with same CATH topology
3PN7B 3JVTC 2H2KA 2NZ0A 1V1GA 1TTXA 1M46A 2MAZA 3KPXA 3QRXA 1XFYO 2JTTA 1A29A 1YRUB 2JNXA 2JT0A 2M3WA 3BUOB 3JTDB 4WQ3A 1XK4C 4PE4A 1YURA 1M31A 1WRKA 2HF5A 1WRLA 2JWWA 2RGIA 2LVIA 2KDHA 5KU1A 3OB1B 1WLZA 5DKQA 2CT9A 3GK4X 4YI8A 1K8UA 3A4UB 1F71A 1Q80A 1XO5A 2CBLA 1A75A 1X02A 4JPZB 4ORCB 3JVTB 4NDBA 2PMYA 2V53A 4MSPA 5JJGA 1SR6C 4PE0A 1CKKA 1CLMA 3BOWB 4MEWA 3TDUA 5TNCA 1YRTB 4WRIA 4XYNA 2JRFA 2JT3A 3HCMA 2L51A 2QACA 1UHJA 4MVFA 1CFFA 4C0LA 1SPYA 1K95A 3CZTX 3I5IC 1RJVA 1B1GA 1M39A 3PM8A 1IH0A 1NX1A 4NDDA 3OHMB 2LLSA 1QATA 4R1EA 1B7TY 1SR6B 2PRUA 2HQ8A 1BJFA 1XFUO 2LUXA 4DRWA 1GJYA 4A4BA 1FI5A 1NX3A 1OMDA 2JXLA 1SY9A 3I5IB 1S1EA 2OTGC 1PSRA 1MQ1A 1JFJA 2NCPA 4I5NB 1UP5A 2Q91A 2BCBA 1S26D 2F3YA 4CFQA 1YUTA 4JWQA 4YGAA 3DVJA 3RM1A 2GV5A 1KFUS 1WDCC 2K2AA 1K9UA 1TN4A 2E30A 1SYMA 2KGBC 3TZ1A 2FCEA 2Y1MA 4OVNF 3CR4X 3GOFA 1W7JB 3LL8B 5AEQA 2Y5IA 3PALA 3VROA 3VGOA 4ETOA 4YRUA 1F70A 2OTGB 1CDPA 1JC2A 4UPGA 1FPWA 5DKRA 1YX7A 2M7NA 1PSBA 1DT7B 4QJ4B 2KI6C 3O78A 1J55A 1KQMC 3LLEA 4MLWA 1NX0A 1WDCB 1K9KA 3BUXB 4YBHB 1IG5A 1U5IA 1A75B 1OE9B 3AAKA 4IL1A 1UWOA 1ALVA 2CNPA 2EHBA 2KAXA 1G33A 2COLB 2KSPA 1KFUL 4M2QA 4Q04A 3SIAA 4OR9B 1FW4A 1C7WA 2KBIA 3OB2B 4PHJA 1YVHA 1AHRA 1KK8B 4GFTA 2L98A 4GBAA 2PSRA 1N2DA 2LV7A 3H4SE 4GAOA 2MLEC 1GGZA 3BUNB 3EK8A 1YTZC 1GQMA 2NXQA 1J7RA 1WY9A 2KFGA 2KNEA 1EG4A 1NP8A 3DVEA 5ER4X 2LP2A 3KHEA 1CFCA 1K94A 5I8NA 4MZJA 1B47A 1N65A 3CR2A 3PSRA 1QIWA 1J1EA 2I18A 2NCOA 1AJ4A 1DTLA 1QLSA 1SKTA 2TN4A 1PULA 1KQVA 1FI6A 1LKJA 2KI4C 4U8DA 4XJKA 3PFVA 1NWDA 2L4HA 2M8UA 2PASA 1EH2A 1VRKA 1B8CA 1SL8A 2WC8A 3WXAA 1QLKA 2JXCA 1XFXO 3NSOA 1JUOA 1OZOA 1XA5A 3EVUA 1K90D 1ZMZA 1PVBA 2KI6D 2NLNA 1A03A 1CFPA 1DJYA 1OSAA 1CDLA 3GK2A 4AQJA 1F4OA 2KI4B 1QJTA 2HETA 2LP3A 2LANA 2KQ6A 1S5GZ 2LAPA 5AXIA 1E8AA 1NCZA 2MRDA 3OP0A 4DS7A 4QJ3B 1QTXA 1J1DA 1MUXA 1YX8A 3TUYC 1MWNA 1BR1B 4MZKA 1DF0A 1QV1A 5HLOA 1YVLA 3D0YA 4GGNA 3NSIA 3OX6A 1CB1A 3IQQA 1CLLA 1PK0D 1AJ5A 2KAVA 3D10A 4DCKA 4YGEB 1U5IB 3E3RA 1ODBA 4P2YB 2WCEA 5CPVA 3TS5B 1JF0A 1CTRA 1M63B 1BLQA 1QASA 2JPTA 4JQ0D 1OQPA 3TUYB 3M0WA 2F8PA 1MHOA 2ZKMX 2BE4A 5HKWA 1OMVA 2Y1NA 4MZLA 5CSIA 1AP4A 3DF0A 2I2RE 3CGAA 3FWCA 1XFZO 4A4CA 2F2OA 3SG2A 1GGWA 1K2HA 3HX4A 1TRFA 1QX7A 2MHHA 2JNFA 4OCIA 1IQ3A 3CS1A 5D69A 3VRQA 1R6PA 5AERA 1QV0A 3K21A 2KAYA 2K7DA 1BG1A 4I5JA 1JBAA 2K61A 1DJWA 3PATA 4XJKB 4ZCUA 1CM1A 3SG3A 3SG5A 1K96A 2KFFA 3SJSA 1IKUA 2OPOA 1CDMA 3A8RA 5I2OA 2L5XB 1SNLA 2LMVA 5IBWA 2K7OA 1HT9A 2BBNA 4M2OA 1F54A 1BF5A 5HKYA 2LNKA 1S5GY 2KYCA 1CMGA 3KEVA 1CMFA 1RWYA 1B8RA 3DVMA 4AOMA 2M49B 1KK7Z 5HLVA 4N1GA 1K9PA 3DVKA 1F55A 1C7VA 1Y1AA 1A2XA 2Y4QA 3EKHA 3TDIA 2M9GA 1D1OA 1SRAA 1UHNA 3BXKA 2FJUB 2PALA 1KK8C 2F2PA 2WCBA 1UHKA 2FCDA 4PCWA 3BYAA 3VRPA 1TNQA 2FOTA 1FBVA 1OMRA 5CSJA 1YUSA 2O60A 1DF0B 3VRRA 1EG3A 3D0YB 4FQOA 1EJ3A 1IQ5A 2BBMA 2SASA 3WNXB 1XFVO 2BKHB 1Y6WA 2BL0C 2WOSA 5I2LA 3F45A 1TCFA 1IJ6A 1J7OA 2ZN8A 1B8LA 4PHMA 2BKIB 2Q4UA 2OS8C 1KFXS 4HSZA 2LE9B 1B9AA 2K7CA 2M7LA 3CR5X 2H61A 1ZACA 2LVVA 1KSOA 4C0JA 3NSLA 1H4BA 4E68A 3IF7A 1F4QA 1WRZA 3C1VA 2LCPA 1KWOC 2JQ6A 5KTYA 5HYDA 5D7FA 2L0PA 5G08A 3LK0A 1DMOA 3DF0B 2BL0B 4PE1A 2EC6B 1XYDA 3EK7A 2HPSA 2I94A 4GNKB 4OV2A 4MRXA 3EKJA 1RK9A 2OS8B 1DJGA 1KK7Y 3CTNA 4ORBB 1WLMA 1N0YA 1S6CA 2JC2A 4GUKA 4DUQA 3KO0A 1NYAA 1KFXL 2MA2A 3AKAA 4M2PA 1V1FA 1S6JA 4N1FA 3BUMB 1G8IA 4PDZA 2LUCA 1KWOB 5I2QA 4PALA 1R2UA 2MLFC 1DJZA 2SCPA 2CTNA 3KF9A 4ZCVA 1Y1UA 2VRGA 1TIZA 1ZOTB 2JULA 1AVSA 1TNWA 1NPQA 1YUUA 5JOLA 2LVJA 1DVIA 1BU3A 2IS9A 4L9MA 1K93D 1BT6A 2BCAA 1F8HA 3TS5C 5CSNA 2LMTA 3I5HC 2L4IA 1S6IA 5AANA 2JZIA 2KOTA 2H61C 5AFPA 1LXFC 4C0KA 1SL9A 1NCXA 2JT8A 4CLNA 1UUSA 4QJ5B 2ISDA 4GGFA 1S36A 1TOPA 5BPJA 2M1UA 2ZNDA 1BOCA 2L50A 2JOJA 2JTZA 4DIRA 2R2IA 3I5HB 1NX2A 1IJ5A 1CLBA 1FF1A 1EXRA 2AUCA 1TNXA 2F33A 2LHLA 2ZRTA 2LLTA 3EK4A 3IQOA 1QVIZ 1Y1XA 1IGVA 3O6BA 3VRNA 1KCYA 2F3ZA 1ALWA 5J3XA 1LVCD 3EVVA 1JWDA 2A4JA 5ER5A 1L7ZA 2EGDA 4TNCA 1EL4A 4I5KA 1OZSA 1MF8B 2LVKA 2ZFDA 3RLZA 1YR5A 4GPLB 1DGUA 2G2BA 2L2EA 2WCFA 3AKBA 1PALA 1QXPA 4CFRA 1CDNA 1HQVA 1MXLC 2MJWB 5KSZA 3OX5A 3PLFB 4PHKA 1UHIA 2AMIA 1AK8A 1BMOA 2KBMA 1AUIB 2GGZA 4YI9A 1IWQA 5HKZA 1QX2A 2KGRA 2KYFA 5DKNA 1H8BA 4NDCA 1DJHA 1ZFSA 1J7PA 1JFKA 3NSKA 2K8MB 2LMUA 1SK6D 2ZN9A 4GGFC 3LK1A 1DGVA 3O4YA 1J7QA 4MBEA 3NXAA 2G9BA 2CCMA 2KFHA 4HREE 4AQIA 2P6BB 4MRYA 2E6WA 2BE6A 3CLNA 3FS7A 1PRWA 2K7BA 2M97A 1QVIY 1UURA 4WQ2A 1UHHA 2M29A 4HRHA 2WORA 3WHTB 4FTGA 1OOJA 2LM5A 4F0ZB 4MN0A 1SL7A 4OKHA 2EC6C 1RECA 1MR8A 3LCPC 1TCOB 5F6TA 1NIWA 3BQ3A 1PVAA 4HRGA 1JSAA 5FYXA 2K0JA 2DOQA 1M45A 2KHNA 2I7AA 1KSMA 1XVJA 1XFWO 1C07A 4USLA 2ZRSA 2KQYA 4ICBA 1JF2A 3ZNIA 4N5XA 1G4YR 4NQGA 2BECA 1RROA 4PE7A 1NSHA 1LA0A 3BOWA 3SG4A 2QPTA 1QS7A 3O2PA 1S3PA 1DJXA 1XK4A 2JU0A 1MXEA 1CNPA 3SIBA 2GGMA 4P5OE 1QX5B 3SG6A 1TNPA 3I5GC 1CFDA 3FIAA 1L2OC 4D1EA 1SCMC 2O5GA 1CM4A 2PVBA 1NCYA 3I5FC 1LA3A 5GQQC 1SBJA 3FWBA 2M1KB 1KQMB 1RTP1 2LC5A 4YGBB 1A4PA 3DD4A 1LINA 4CIDA 2K2FA 1B4CA 3CWGA 1SMGA 4ORAB 1BR4B 3PN7C 2LHIA 4BY4A 1SW8A 2CXJA 1RFJA 4YGDB 2HQWA 5K89A 3I5GB 1L2OB 1W7IB 2ZNEA 1SCMB 2B1UA 4YGCB 3AAJA 3I5FB 4BY5A 5CSFA 2WNDA 1BODA 3BUWB 5PALA 3JTDC 2MBXA 2D8NA 2BCXA 3ZWHA 4CPVA 4PHNA 5B8IB 3MSEB 3GK1A 2AAOA 3ICBA 4I5LB 1B7TZ 1Y0VH 1IRJA 1DJIA 1ZUZA 2LLUA 3TDZA 3WHUB 2M0RA 1NUBA 1SCVA 3SG7A 1QIVA 3EVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PN7 B;  3JVT C;  2H2K A;  2NZ0 A;  1V1G A;  1TTX A;  1M46 A;  2MAZ A;  3KPX A;  3QRX A;  1XFY O;  2JTT A;  1A29 A;  1YRU B;  2JNX A;  2JT0 A;  2M3W A;  3BUO B;  3JTD B;  4WQ3 A;  1XK4 C;  4PE4 A;  1YUR A;  1M31 A;  1WRK A;  2HF5 A;  1WRL A;  2JWW A;  2RGI A;  2LVI A;  2KDH A;  5KU1 A;  3OB1 B;  1WLZ A;  5DKQ A;  2CT9 A;  3GK4 X;  4YI8 A;  1K8U A;  3A4U B;  1F71 A;  1Q80 A;  1XO5 A;  2CBL A;  1A75 A;  1X02 A;  4JPZ B;  4ORC B;  3JVT B;  4NDB A;  2PMY A;  2V53 A;  4MSP A;  5JJG A;  1SR6 C;  4PE0 A;  1CKK A;  1CLM A;  3BOW B;  4MEW A;  3TDU A;  5TNC A;  1YRT B;  4WRI A;  4XYN A;  2JRF A;  2JT3 A;  3HCM A;  2L51 A;  2QAC A;  1UHJ A;  4MVF A;  1CFF A;  4C0L A;  1SPY A;  1K95 A;  3CZT X;  3I5I C;  1RJV A;  1B1G A;  1M39 A;  3PM8 A;  1IH0 A;  1NX1 A;  4NDD A;  3OHM B;  2LLS A;  1QAT A;  4R1E A;  1B7T Y;  1SR6 B;  2PRU A;  2HQ8 A;  1BJF A;  1XFU O;  2LUX A;  4DRW A;  1GJY A;  4A4B A;  1FI5 A;  1NX3 A;  1OMD A;  2JXL A;  1SY9 A;  3I5I B;  1S1E A;  2OTG C;  1PSR A;  1MQ1 A;  1JFJ A;  2NCP A;  4I5N B;  1UP5 A;  2Q91 A;  2BCB A;  1S26 D;  2F3Y A;  4CFQ A;  1YUT A;  4JWQ A;  4YGA A;  3DVJ A;  3RM1 A;  2GV5 A;  1KFU S;  1WDC C;  2K2A A;  1K9U A;  1TN4 A;  2E30 A;  1SYM A;  2KGB C;  3TZ1 A;  2FCE A;  2Y1M A;  4OVN F;  3CR4 X;  3GOF A;  1W7J B;  3LL8 B;  5AEQ A;  2Y5I A;  3PAL A;  3VRO A;  3VGO A;  4ETO A;  4YRU A;  1F70 A;  2OTG B;  1CDP A;  1JC2 A;  4UPG A;  1FPW A;  5DKR A;  1YX7 A;  2M7N A;  1PSB A;  1DT7 B;  4QJ4 B;  2KI6 C;  3O78 A;  1J55 A;  1KQM C;  3LLE A;  4MLW A;  1NX0 A;  1WDC B;  1K9K A;  3BUX B;  4YBH B;  1IG5 A;  1U5I A;  1A75 B;  1OE9 B;  3AAK A;  4IL1 A;  1UWO A;  1ALV A;  2CNP A;  2EHB A;  2KAX A;  1G33 A;  2COL B;  2KSP A;  1KFU L;  4M2Q A;  4Q04 A;  3SIA A;  4OR9 B;  1FW4 A;  1C7W A;  2KBI A;  3OB2 B;  4PHJ A;  1YVH A;  1AHR A;  1KK8 B;  4GFT A;  2L98 A;  4GBA A;  2PSR A;  1N2D A;  2LV7 A;  3H4S E;  4GAO A;  2MLE C;  1GGZ A;  3BUN B;  3EK8 A;  1YTZ C;  1GQM A;  2NXQ A;  1J7R A;  1WY9 A;  2KFG A;  2KNE A;  1EG4 A;  1NP8 A;  3DVE A;  5ER4 X;  2LP2 A;  3KHE A;  1CFC A;  1K94 A;  5I8N A;  4MZJ A;  1B47 A;  1N65 A;  3CR2 A;  3PSR A;  1QIW A;  1J1E A;  2I18 A;  2NCO A;  1AJ4 A;  1DTL A;  1QLS A;  1SKT A;  2TN4 A;  1PUL A;  1KQV A;  1FI6 A;  1LKJ A;  2KI4 C;  4U8D A;  4XJK A;  3PFV A;  1NWD A;  2L4H A;  2M8U A;  2PAS A;  1EH2 A;  1VRK A;  1B8C A;  1SL8 A;  2WC8 A;  3WXA A;  1QLK A;  2JXC A;  1XFX O;  3NSO A;  1JUO A;  1OZO A;  1XA5 A;  3EVU A;  1K90 D;  1ZMZ A;  1PVB A;  2KI6 D;  2NLN A;  1A03 A;  1CFP A;  1DJY A;  1OSA A;  1CDL A;  3GK2 A;  4AQJ A;  1F4O A;  2KI4 B;  1QJT A;  2HET A;  2LP3 A;  2LAN A;  2KQ6 A;  1S5G Z;  2LAP A;  5AXI A;  1E8A A;  1NCZ A;  2MRD A;  3OP0 A;  4DS7 A;  4QJ3 B;  1QTX A;  1J1D A;  1MUX A;  1YX8 A;  3TUY C;  1MWN A;  1BR1 B;  4MZK A;  1DF0 A;  1QV1 A;  5HLO A;  1YVL A;  3D0Y A;  4GGN A;  3NSI A;  3OX6 A;  1CB1 A;  3IQQ A;  1CLL A;  1PK0 D;  1AJ5 A;  2KAV A;  3D10 A;  4DCK A;  4YGE B;  1U5I B;  3E3R A;  1ODB A;  4P2Y B;  2WCE A;  5CPV A;  3TS5 B;  1JF0 A;  1CTR A;  1M63 B;  1BLQ A;  1QAS A;  2JPT A;  4JQ0 D;  1OQP A;  3TUY B;  3M0W A;  2F8P A;  1MHO A;  2ZKM X;  2BE4 A;  5HKW A;  1OMV A;  2Y1N A;  4MZL A;  5CSI A;  1AP4 A;  3DF0 A;  2I2R E;  3CGA A;  3FWC A;  1XFZ O;  4A4C A;  2F2O A;  3SG2 A;  1GGW A;  1K2H A;  3HX4 A;  1TRF A;  1QX7 A;  2MHH A;  2JNF A;  4OCI A;  1IQ3 A;  3CS1 A;  5D69 A;  3VRQ A;  1R6P A;  5AER A;  1QV0 A;  3K21 A;  2KAY A;  2K7D A;  1BG1 A;  4I5J A;  1JBA A;  2K61 A;  1DJW A;  3PAT A;  4XJK B;  4ZCU A;  1CM1 A;  3SG3 A;  3SG5 A;  1K96 A;  2KFF A;  3SJS A;  1IKU A;  2OPO A;  1CDM A;  3A8R A;  5I2O A;  2L5X B;  1SNL A;  2LMV A;  5IBW A;  2K7O A;  1HT9 A;  2BBN A;  4M2O A;  1F54 A;  1BF5 A;  5HKY A;  2LNK A;  1S5G Y;  2KYC A;  1CMG A;  3KEV A;  1CMF A;  1RWY A;  1B8R A;  3DVM A;  4AOM A;  2M49 B;  1KK7 Z;  5HLV A;  4N1G A;  1K9P A;  3DVK A;  1F55 A;  1C7V A;  1Y1A A;  1A2X A;  2Y4Q A;  3EKH A;  3TDI A;  2M9G A;  1D1O A;  1SRA A;  1UHN A;  3BXK A;  2FJU B;  2PAL A;  1KK8 C;  2F2P A;  2WCB A;  1UHK A;  2FCD A;  4PCW A;  3BYA A;  3VRP A;  1TNQ A;  2FOT A;  1FBV A;  1OMR A;  5CSJ A;  1YUS A;  2O60 A;  1DF0 B;  3VRR A;  1EG3 A;  3D0Y B;  4FQO A;  1EJ3 A;  1IQ5 A;  2BBM A;  2SAS A;  3WNX B;  1XFV O;  2BKH B;  1Y6W A;  2BL0 C;  2WOS A;  5I2L A;  3F45 A;  1TCF A;  1IJ6 A;  1J7O A;  2ZN8 A;  1B8L A;  4PHM A;  2BKI B;  2Q4U A;  2OS8 C;  1KFX S;  4HSZ A;  2LE9 B;  1B9A A;  2K7C A;  2M7L A;  3CR5 X;  2H61 A;  1ZAC A;  2LVV A;  1KSO A;  4C0J A;  3NSL A;  1H4B A;  4E68 A;  3IF7 A;  1F4Q A;  1WRZ A;  3C1V A;  2LCP A;  1KWO C;  2JQ6 A;  5KTY A;  5HYD A;  5D7F A;  2L0P A;  5G08 A;  3LK0 A;  1DMO A;  3DF0 B;  2BL0 B;  4PE1 A;  2EC6 B;  1XYD A;  3EK7 A;  2HPS A;  2I94 A;  4GNK B;  4OV2 A;  4MRX A;  3EKJ A;  1RK9 A;  2OS8 B;  1DJG A;  1KK7 Y;  3CTN A;  4ORB B;  1WLM A;  1N0Y A;  1S6C A;  2JC2 A;  4GUK A;  4DUQ A;  3KO0 A;  1NYA A;  1KFX L;  2MA2 A;  3AKA A;  4M2P A;  1V1F A;  1S6J A;  4N1F A;  3BUM B;  1G8I A;  4PDZ A;  2LUC A;  1KWO B;  5I2Q A;  4PAL A;  1R2U A;  2MLF C;  1DJZ A;  2SCP A;  2CTN A;  3KF9 A;  4ZCV A;  1Y1U A;  2VRG A;  1TIZ A;  1ZOT B;  2JUL A;  1AVS A;  1TNW A;  1NPQ A;  1YUU A;  5JOL A;  2LVJ A;  1DVI A;  1BU3 A;  2IS9 A;  4L9M A;  1K93 D;  1BT6 A;  2BCA A;  1F8H A;  3TS5 C;  5CSN A;  2LMT A;  3I5H C;  2L4I A;  1S6I A;  5AAN A;  2JZI A;  2KOT A;  2H61 C;  5AFP A;  1LXF C;  4C0K A;  1SL9 A;  1NCX A;  2JT8 A;  4CLN A;  1UUS A;  4QJ5 B;  2ISD A;  4GGF A;  1S36 A;  1TOP A;  5BPJ A;  2M1U A;  2ZND A;  1BOC A;  2L50 A;  2JOJ A;  2JTZ A;  4DIR A;  2R2I A;  3I5H B;  1NX2 A;  1IJ5 A;  1CLB A;  1FF1 A;  1EXR A;  2AUC A;  1TNX A;  2F33 A;  2LHL A;  2ZRT A;  2LLT A;  3EK4 A;  3IQO A;  1QVI Z;  1Y1X A;  1IGV A;  3O6B A;  3VRN A;  1KCY A;  2F3Z A;  1ALW A;  5J3X A;  1LVC D;  3EVV A;  1JWD A;  2A4J A;  5ER5 A;  1L7Z A;  2EGD A;  4TNC A;  1EL4 A;  4I5K A;  1OZS A;  1MF8 B;  2LVK A;  2ZFD A;  3RLZ A;  1YR5 A;  4GPL B;  1DGU A;  2G2B A;  2L2E A;  2WCF A;  3AKB A;  1PAL A;  1QXP A;  4CFR A;  1CDN A;  1HQV A;  1MXL C;  2MJW B;  5KSZ A;  3OX5 A;  3PLF B;  4PHK A;  1UHI A;  2AMI A;  1AK8 A;  1BMO A;  2KBM A;  1AUI B;  2GGZ A;  4YI9 A;  1IWQ A;  5HKZ A;  1QX2 A;  2KGR A;  2KYF A;  5DKN A;  1H8B A;  4NDC A;  1DJH A;  1ZFS A;  1J7P A;  1JFK A;  3NSK A;  2K8M B;  2LMU A;  1SK6 D;  2ZN9 A;  4GGF C;  3LK1 A;  1DGV A;  3O4Y A;  1J7Q A;  4MBE A;  3NXA A;  2G9B A;  2CCM A;  2KFH A;  4HRE E;  4AQI A;  2P6B B;  4MRY A;  2E6W A;  2BE6 A;  3CLN A;  3FS7 A;  1PRW A;  2K7B A;  2M97 A;  1QVI Y;  1UUR A;  4WQ2 A;  1UHH A;  2M29 A;  4HRH A;  2WOR A;  3WHT B;  4FTG A;  1OOJ A;  2LM5 A;  4F0Z B;  4MN0 A;  1SL7 A;  4OKH A;  2EC6 C;  1REC A;  1MR8 A;  3LCP C;  1TCO B;  5F6T A;  1NIW A;  3BQ3 A;  1PVA A;  4HRG A;  1JSA A;  5FYX A;  2K0J A;  2DOQ A;  1M45 A;  2KHN A;  2I7A A;  1KSM A;  1XVJ A;  1XFW O;  1C07 A;  4USL A;  2ZRS A;  2KQY A;  4ICB A;  1JF2 A;  3ZNI A;  4N5X A;  1G4Y R;  4NQG A;  2BEC A;  1RRO A;  4PE7 A;  1NSH A;  1LA0 A;  3BOW A;  3SG4 A;  2QPT A;  1QS7 A;  3O2P A;  1S3P A;  1DJX A;  1XK4 A;  2JU0 A;  1MXE A;  1CNP A;  3SIB A;  2GGM A;  4P5O E;  1QX5 B;  3SG6 A;  1TNP A;  3I5G C;  1CFD A;  3FIA A;  1L2O C;  4D1E A;  1SCM C;  2O5G A;  1CM4 A;  2PVB A;  1NCY A;  3I5F C;  1LA3 A;  5GQQ C;  1SBJ A;  3FWB A;  2M1K B;  1KQM B;  1RTP 1;  2LC5 A;  4YGB B;  1A4P A;  3DD4 A;  1LIN A;  4CID A;  2K2F A;  1B4C A;  3CWG A;  1SMG A;  4ORA B;  1BR4 B;  3PN7 C;  2LHI A;  4BY4 A;  1SW8 A;  2CXJ A;  1RFJ A;  4YGD B;  2HQW A;  5K89 A;  3I5G B;  1L2O B;  1W7I B;  2ZNE A;  1SCM B;  2B1U A;  4YGC B;  3AAJ A;  3I5F B;  4BY5 A;  5CSF A;  2WND A;  1BOD A;  3BUW B;  5PAL A;  3JTD C;  2MBX A;  2D8N A;  2BCX A;  3ZWH A;  4CPV A;  4PHN A;  5B8I B;  3MSE B;  3GK1 A;  2AAO A;  3ICB A;  4I5L B;  1B7T Z;  1Y0V H;  1IRJ A;  1DJI A;  1ZUZ A;  2LLU A;  3TDZ A;  3WHU B;  2M0R A;  1NUB A;  1SCV A;  3SG7 A;  1QIV A;  3EVR A; 
#chains in the Genus database with same CATH topology
 3CZ0 A;  3PN7 B;  3JVT C;  4JD9 A;  2H2K A;  2NZ0 A;  1V1G A;  1TTX A;  1M46 A;  2MAZ A;  3KPX A;  3QRX A;  1XFY O;  2JTT A;  1A29 A;  1YRU B;  2JNX A;  2JT0 A;  2M3W A;  3BUO B;  3JTD B;  4WQ3 A;  1XK4 C;  4PE4 A;  1YUR A;  1M31 A;  1WRK A;  2HF5 A;  1WRL A;  2JWW A;  2RGI A;  3R1V A;  2LVI A;  1CNP A;  2KDH A;  5KU1 A;  3OB1 B;  1DQE A;  1WLZ A;  5DKQ A;  2CT9 A;  3GK4 X;  4YI8 A;  1K8U A;  3A4U B;  1F71 A;  1Q80 A;  1XO5 A;  2CBL A;  1A75 A;  1X02 A;  4JPZ B;  4ORC B;  3JVT B;  4NDB A;  2PMY A;  2V53 A;  4MSP A;  5JJG A;  1SR6 C;  4PE0 A;  1CKK A;  1CLM A;  3BOW B;  4MEW A;  3TDU A;  5TNC A;  1YRT B;  4WRI A;  4XYN A;  2ERB A;  2JRF A;  2JT3 A;  3HCM A;  2L51 A;  2QAC A;  1UHJ A;  4MVF A;  1CFF A;  4C0L A;  1SPY A;  1K95 A;  2KLD A;  3CZT X;  3I5I C;  1RJV A;  1B1G A;  1M39 A;  3PM8 A;  4OZD A;  1IH0 A;  1NX1 A;  4NDD A;  3OHM B;  2LLS A;  1QAT A;  4R1E A;  1B7T Y;  1SR6 B;  2PRU A;  2HQ8 A;  1BJF A;  1XFU O;  2LUX A;  4DRW A;  1GJY A;  4A4B A;  1FI5 A;  1NX3 A;  1OMD A;  2JXL A;  1P28 A;  1SY9 A;  3I5I B;  1S1E A;  2OTG C;  1PSR A;  1MQ1 A;  3S0D A;  4F7F A;  1JFJ A;  2NCP A;  4I5N B;  1UP5 A;  2Q91 A;  2BCB A;  1S26 D;  2F3Y A;  4CFQ A;  1YUT A;  4JWQ A;  3BFB A;  3SS4 A;  3Q8I A;  4YGA A;  3DVJ A;  3RM1 A;  2GV5 A;  1KFU S;  1WDC C;  2K2A A;  1K9U A;  1TN4 A;  2E30 A;  1SYM A;  2KGB C;  3TZ1 A;  3S0B A;  2FCE A;  2Y1M A;  4OVN F;  3CR4 X;  3GOF A;  1W7J B;  3LL8 B;  5AEQ A;  2Y5I A;  3PAL A;  3VRO A;  3VGO A;  4ETO A;  4YRU A;  1F70 A;  1DEK A;  2OTG B;  1CDP A;  1JC2 A;  3CAB A;  4UPG A;  1FPW A;  5DKR A;  1YX7 A;  2M7N A;  3CYZ A;  1PSB A;  1DT7 B;  4QJ4 B;  2KI6 C;  3O78 A;  1J55 A;  1KQM C;  3B86 A;  3LLE A;  4MLW A;  1NX0 A;  1WDC B;  1K9K A;  3BUX B;  4YBH B;  1IG5 A;  2QEB A;  1U5I A;  1A75 B;  1OE9 B;  3AAK A;  4IL1 A;  1UWO A;  1ALV A;  2CNP A;  2EHB A;  2KAX A;  1G33 A;  2COL B;  2KSP A;  1KFU L;  4M2Q A;  4Q04 A;  3SIA A;  1XFR A;  4OR9 B;  1FW4 A;  1C7W A;  2KBI A;  3OB2 B;  4PHJ A;  1YVH A;  1AHR A;  1KK8 B;  4GFT A;  2L98 A;  4GBA A;  2PSR A;  1N2D A;  2LV7 A;  2YGU A;  3H4S E;  2MLE C;  4GAO A;  1GGZ A;  3BUN B;  3EK8 A;  1YTZ C;  1GQM A;  2NXQ A;  1J7R A;  1WY9 A;  2KFG A;  2KNE A;  1EG4 A;  1NP8 A;  3DVE A;  5ER4 X;  2LP2 A;  3KHE A;  3L4A A;  1K94 A;  5I8N A;  1CFC A;  4MZJ A;  1B47 A;  1N65 A;  3CR2 A;  3PSR A;  1QIW A;  2WCM A;  1J1E A;  2I18 A;  2NCO A;  1AJ4 A;  1DTL A;  1OOH A;  1QLS A;  1SKT A;  2TN4 A;  1PUL A;  1KQV A;  1FI6 A;  1LKJ A;  3RZS A;  2KI4 C;  4U8D A;  4XJK A;  3PFV A;  1NWD A;  2L4H A;  2M8U A;  2PAS A;  4INX A;  1VRK A;  1B8C A;  2K60 A;  1SL8 A;  1EH2 A;  2QEV A;  2WC8 A;  3WXA A;  1QLK A;  2JXC A;  2KPH A;  1XFX O;  3NSO A;  1JUO A;  2FJY A;  1OZO A;  1XA5 A;  3EVU A;  3FE9 A;  1K90 D;  1ZMZ A;  1PVB A;  2KI6 D;  2NLN A;  1A03 A;  1CFP A;  1DJY A;  5FI6 A;  1OSA A;  1CDL A;  3GK2 A;  4AQJ A;  1F4O A;  2KI4 B;  1QJT A;  3CZ1 A;  2HET A;  2LP3 A;  2LAN A;  2KQ6 A;  1S5G Z;  2LAP A;  5AXI A;  1E8A A;  1NCZ A;  2MRD A;  3OP0 A;  3B88 A;  4QJ3 B;  4DS7 A;  1QTX A;  3S0F A;  1J1D A;  1MUX A;  1YX8 A;  3TUY C;  1MWN A;  1BR1 B;  4MZK A;  1DF0 A;  1QV1 A;  5HLO A;  1YVL A;  3D0Y A;  4GGN A;  3NSI A;  3OX6 A;  1CB1 A;  3IQQ A;  1CLL A;  1PK0 D;  1C3Y A;  1AJ5 A;  2KAV A;  3D10 A;  4DCK A;  4YGE B;  1T14 A;  1U5I B;  3E3R A;  1ODB A;  4P2Y B;  5EL2 A;  2BNX A;  2WCE A;  2L5Y A;  5CPV A;  3TS5 B;  1JF0 A;  3R1O A;  1CTR A;  1M63 B;  1BLQ A;  1QAS A;  2JPT A;  1C3Z A;  4JQ0 D;  1OQP A;  3DY9 A;  3TUY B;  3M0W A;  3B7A A;  2F8P A;  1MHO A;  2ZKM X;  2BE4 A;  5HKW A;  1OMV A;  2Y1N A;  3NHT A;  1Z4H A;  4MZL A;  5CSI A;  1AP4 A;  3DF0 A;  2I2R E;  3CGA A;  3OGN A;  3FWC A;  1XFZ O;  4A4C A;  2F2O A;  3SG2 A;  1GGW A;  1K2H A;  3HX4 A;  1TRF A;  1QX7 A;  2MHH A;  2JNF A;  4OCI A;  1IQ3 A;  3CS1 A;  5D69 A;  3VRQ A;  1R6P A;  5AER A;  1QV0 A;  3K21 A;  2KAY A;  2K7D A;  1BG1 A;  4I5J A;  1JBA A;  2K61 A;  1DJW A;  3PAT A;  2H8V A;  4XJK B;  4ZCU A;  1CM1 A;  3SG3 A;  3SG5 A;  1K96 A;  2KFF A;  3SJS A;  1IKU A;  2OPO A;  1CDM A;  3A8R A;  5I2O A;  2L5X B;  1SNL A;  2LMV A;  5IBW A;  2K7O A;  1HT9 A;  2BBN A;  4M2O A;  1F54 A;  1BF5 A;  5HKY A;  1OOF A;  3BFH A;  2LNK A;  1S5G Y;  2KYC A;  1CMG A;  3KEV A;  1CMF A;  1RWY A;  1B8R A;  3DVM A;  3NHI A;  3SS5 A;  2M49 B;  2PYQ A;  4AOM A;  1KK7 Z;  3R72 A;  5HLV A;  4N1G A;  1K9P A;  3DVK A;  1F55 A;  4JKT A;  1C7V A;  3EG5 B;  1Y1A A;  1A2X A;  2Y4Q A;  3EKH A;  3TDI A;  2M9G A;  1D1O A;  1SRA A;  1UHN A;  3BXK A;  3PJI A;  2FJU B;  2PAL A;  1KK8 C;  2F2P A;  2WCB A;  1UHK A;  2FCD A;  4PCW A;  2WCL A;  1OOG A;  3BYA A;  3VRP A;  1TNQ A;  2FOT A;  1FBV A;  1OMR A;  5I94 A;  5CSJ A;  1YUS A;  2O60 A;  1DF0 B;  3CZ2 A;  3V2L A;  1EG3 A;  3VRR A;  3D0Y B;  4FQO A;  1EJ3 A;  1IQ5 A;  3D73 A;  2BBM A;  2SAS A;  3O4X A;  3WNX B;  1XFV O;  2BKH B;  1Y6W A;  1Z2C B;  2BL0 C;  2WOS A;  5I2L A;  3F45 A;  1TCF A;  1IJ6 A;  1QWV A;  1J7O A;  2ZN8 A;  1B8L A;  4PHM A;  2BKI B;  2Q4U A;  2OS8 C;  1KFX S;  4HSZ A;  2LE9 B;  1B9A A;  2K7C A;  4FQT A;  2WCH A;  3CR5 X;  2H61 A;  2M7L A;  1ZAC A;  2LVV A;  3UO9 A;  1KSO A;  4C0J A;  1W9Z A;  3NSL A;  3N7H A;  4E68 A;  1H4B A;  3IF7 A;  1F4Q A;  1WRZ A;  3C1V A;  2LCP A;  1KWO C;  2JQ6 A;  5KTY A;  3S0A A;  5HYD A;  5D7F A;  3R1P A;  2L0P A;  5G08 A;  3LK0 A;  1DMO A;  5DIC A;  3DF0 B;  2BL0 B;  3DYE A;  4PE1 A;  2EC6 B;  1XYD A;  3EK7 A;  2HPS A;  2I94 A;  4GNK B;  4OV2 A;  3D77 A;  4KYN A;  4MRX A;  3EKJ A;  1RK9 A;  2OS8 B;  1DJG A;  1KK7 Y;  3CTN A;  4ORB B;  3DZT A;  1WLM A;  1N0Y A;  1S6C A;  2QEH A;  2JC2 A;  4GUK A;  4DUQ A;  3KO0 A;  1NYA A;  3D75 A;  3L4L A;  1KFX L;  2MA2 A;  2P70 A;  3AKA A;  1V1F A;  4M2P A;  1S6J A;  4N1F A;  3BUM B;  1G8I A;  4PDZ A;  2LUC A;  1KWO B;  5I2Q A;  4PAL A;  1R2U A;  2MLF C;  1DJZ A;  3SS3 A;  3S0G A;  2SCP A;  2CTN A;  3KF9 A;  4ZCV A;  1Y1U A;  2VRG A;  1TIZ A;  1ZOT B;  2JUL A;  2QEO A;  1AVS A;  1TNW A;  1NPQ A;  1YUU A;  5JOL A;  2LVJ A;  1DVI A;  1BU3 A;  2IS9 A;  4L9M A;  1K93 D;  1BT6 A;  2BCA A;  1F8H A;  3TS5 C;  5CSN A;  3L47 A;  5FI2 A;  2LMT A;  3I5H C;  1LS8 A;  2L4I A;  1S6I A;  2GTE A;  5AAN A;  1SSE B;  2JZI A;  2KOT A;  2H61 C;  5AFP A;  1LXF C;  2WC6 A;  5HL1 A;  3CDN A;  4C0K A;  1SL9 A;  2KLE A;  1NCX A;  2JT8 A;  3QME A;  4CLN A;  1UUS A;  4QJ5 B;  2ISD A;  4GGF A;  1S36 A;  1TOP A;  5BPJ A;  2M1U A;  2ZND A;  1BOC A;  2L50 A;  4PT1 A;  2JOJ A;  2JTZ A;  4DIR A;  2R2I A;  3I5H B;  1GM0 A;  1NX2 A;  1IJ5 A;  1CLB A;  2PQL A;  1FF1 A;  1EXR A;  2AUC A;  1TNX A;  2F33 A;  2LHL A;  2ZRT A;  2LLT A;  3EK4 A;  3IQO A;  1QVI Z;  1Y1X A;  1IGV A;  3S0E A;  3O6B A;  3VRN A;  1KCY A;  2F3Z A;  3IVT A;  1ALW A;  2WC5 A;  1DC1 A;  5J3X A;  1LVC D;  3EVV A;  1JWD A;  2A4J A;  5ER5 A;  1L7Z A;  2EGD A;  4TNC A;  1EL4 A;  4I5K A;  1OZS A;  3D74 A;  1MF8 B;  2LVK A;  2ZFD A;  3RLZ A;  1YR5 A;  4GPL B;  1DGU A;  2G2B A;  2L2E A;  2WCF A;  3AKB A;  1PAL A;  1QXP A;  4CFR A;  1CDN A;  2QDI A;  1HQV A;  1MXL C;  2MJW B;  5KSZ A;  3OX5 A;  3PLF B;  4PHK A;  1OW4 A;  1UHI A;  2AMI A;  1AK8 A;  1BMO A;  2KBM A;  1AUI B;  2GGZ A;  4YI9 A;  1IWQ A;  5HKZ A;  1QX2 A;  2KGR A;  2KYF A;  5DKN A;  1H8B A;  2L2C A;  1DJH A;  1ZFS A;  3D76 A;  1JFK A;  4NDC A;  1J7P A;  1IIO A;  3NSK A;  1ORG A;  2K8M B;  2LMU A;  1SK6 D;  2ZN9 A;  4GGF C;  3LK1 A;  1DGV A;  3O4Y A;  1J7Q A;  4MBE A;  3NXA A;  2G9B A;  2CCM A;  2KFH A;  4HRE E;  4AQI A;  2P6B B;  4MRY A;  2E6W A;  2BE6 A;  3CLN A;  3FS7 A;  1PRW A;  2K7B A;  1TUZ A;  1QVI Y;  1UUR A;  1TUJ A;  2M97 A;  4WQ2 A;  1UHH A;  2M29 A;  4HRH A;  3OBV A;  2WOR A;  3K1E A;  3WHT B;  4FTG A;  1OOJ A;  2LM5 A;  4F0Z B;  4MN0 A;  1SL7 A;  4OKH A;  1TWO A;  2EC6 C;  3SG7 A;  1REC A;  1MR8 A;  2P71 A;  3LCP C;  1TCO B;  5F6T A;  1NIW A;  3BQ3 A;  1PVA A;  4HRG A;  1JSA A;  5FYX A;  2K0J A;  2DOQ A;  1M45 A;  2KHN A;  2I7A A;  1KSM A;  1XVJ A;  1XFW O;  1C07 A;  4USL A;  2ZRS A;  2KQY A;  4ICB A;  1JF2 A;  3VB1 A;  4N5X A;  3ZNI A;  1G4Y R;  4NQG A;  2BEC A;  2WCK A;  1RRO A;  4PE7 A;  1NSH A;  1LA0 A;  1OOI X;  3BOW A;  2QPT A;  3SG4 A;  1QS7 A;  3O2P A;  3B87 A;  1S3P A;  5D3O A;  1DJX A;  1XK4 A;  2JU0 A;  1MXE A;  3B6X A;  3SIB A;  2GGM A;  4P5O E;  1QX5 B;  3SG6 A;  1TNP A;  3I5G C;  1CFD A;  3FIA A;  4INW A;  1L2O C;  4D1E A;  1SCM C;  2O5G A;  1CM4 A;  2PVB A;  1NCY A;  2BAP A;  3I5F C;  1LA3 A;  1DEL A;  5GQQ C;  1SBJ A;  3FWB A;  2M1K B;  1KQM B;  1RTP 1;  2LC5 A;  4YGB B;  1A4P A;  2JPO A;  2WCJ A;  3BFA A;  3DD4 A;  1LIN A;  4CID A;  2K2F A;  1B4C A;  3CWG A;  3UNW A;  1SMG A;  3D78 A;  1BR4 B;  4ORA B;  3PN7 C;  2LHI A;  4BY4 A;  1SW8 A;  3PM2 A;  3BJH A;  2CXJ A;  1RFJ A;  4YGD B;  2HQW A;  5FI7 A;  5K89 A;  3I5G B;  1L2O B;  1W7I B;  2ZNE A;  1SCM B;  2B1U A;  4YGC B;  3AAJ A;  3I5F B;  4BY5 A;  5CSF A;  2WND A;  1BOD A;  3BUW B;  5PAL A;  3JTD C;  2MBX A;  2D8N A;  2BCX A;  3ZWH A;  4CPV A;  4PHN A;  5B8I B;  3MSE B;  3GK1 A;  2AAO A;  3ICB A;  3NGV A;  4I5L B;  1B7T Z;  1Y0V H;  1IRJ A;  1DJI A;  1ZUZ A;  2LLU A;  4IJ7 A;  3TDZ A;  3WHU B;  3FE6 A;  3FE8 A;  2M0R A;  1NUB A;  1SCV A;  3DXL A;  1QIV A;  3EVR A; 
#chains in the Genus database with same CATH homology
 3PN7 B;  3JVT C;  2H2K A;  2NZ0 A;  1V1G A;  1TTX A;  1M46 A;  2MAZ A;  3KPX A;  3QRX A;  1XFY O;  2JTT A;  1A29 A;  1YRU B;  2JNX A;  2JT0 A;  2M3W A;  3BUO B;  3JTD B;  4WQ3 A;  1XK4 C;  4PE4 A;  1YUR A;  1M31 A;  1WRK A;  2HF5 A;  1WRL A;  2JWW A;  2RGI A;  2LVI A;  2KDH A;  5KU1 A;  3OB1 B;  1WLZ A;  5DKQ A;  2CT9 A;  3GK4 X;  4YI8 A;  1K8U A;  3A4U B;  1F71 A;  1Q80 A;  1XO5 A;  2CBL A;  1A75 A;  1X02 A;  4JPZ B;  4ORC B;  3JVT B;  4NDB A;  2PMY A;  2V53 A;  4MSP A;  5JJG A;  1SR6 C;  4PE0 A;  1CKK A;  1CLM A;  3BOW B;  4MEW A;  3TDU A;  5TNC A;  1YRT B;  4WRI A;  4XYN A;  2JRF A;  2JT3 A;  3HCM A;  2L51 A;  2QAC A;  1UHJ A;  4MVF A;  1CFF A;  4C0L A;  1SPY A;  1K95 A;  3CZT X;  3I5I C;  1RJV A;  1B1G A;  1M39 A;  3PM8 A;  1IH0 A;  1NX1 A;  4NDD A;  3OHM B;  2LLS A;  1QAT A;  4R1E A;  1B7T Y;  1SR6 B;  2PRU A;  2HQ8 A;  1BJF A;  1XFU O;  2LUX A;  4DRW A;  1GJY A;  4A4B A;  1FI5 A;  1NX3 A;  1OMD A;  2JXL A;  1SY9 A;  3I5I B;  1S1E A;  2OTG C;  1PSR A;  1MQ1 A;  1JFJ A;  2NCP A;  4I5N B;  1UP5 A;  2Q91 A;  2BCB A;  1S26 D;  2F3Y A;  4CFQ A;  1YUT A;  4JWQ A;  4YGA A;  3DVJ A;  3RM1 A;  2GV5 A;  1KFU S;  1WDC C;  2K2A A;  1K9U A;  1TN4 A;  2E30 A;  1SYM A;  2KGB C;  3TZ1 A;  2FCE A;  2Y1M A;  4OVN F;  3CR4 X;  3GOF A;  1W7J B;  3LL8 B;  5AEQ A;  2Y5I A;  3PAL A;  3VRO A;  3VGO A;  4ETO A;  4YRU A;  1F70 A;  2OTG B;  1CDP A;  1JC2 A;  4UPG A;  1FPW A;  5DKR A;  1YX7 A;  2M7N A;  1PSB A;  1DT7 B;  4QJ4 B;  2KI6 C;  3O78 A;  1J55 A;  1KQM C;  3LLE A;  4MLW A;  1NX0 A;  1WDC B;  1K9K A;  3BUX B;  4YBH B;  1IG5 A;  1U5I A;  1A75 B;  1OE9 B;  3AAK A;  4IL1 A;  1UWO A;  1ALV A;  2CNP A;  2EHB A;  2KAX A;  1G33 A;  2COL B;  2KSP A;  1KFU L;  4M2Q A;  4Q04 A;  3SIA A;  4OR9 B;  1FW4 A;  1C7W A;  2KBI A;  3OB2 B;  4PHJ A;  1YVH A;  1AHR A;  1KK8 B;  4GFT A;  2L98 A;  4GBA A;  2PSR A;  1N2D A;  2LV7 A;  3H4S E;  4GAO A;  2MLE C;  1GGZ A;  3BUN B;  3EK8 A;  1YTZ C;  1GQM A;  2NXQ A;  1J7R A;  1WY9 A;  2KFG A;  2KNE A;  1EG4 A;  1NP8 A;  3DVE A;  5ER4 X;  2LP2 A;  3KHE A;  1CFC A;  1K94 A;  5I8N A;  4MZJ A;  1B47 A;  1N65 A;  3CR2 A;  3PSR A;  1QIW A;  1J1E A;  2I18 A;  2NCO A;  1AJ4 A;  1DTL A;  1QLS A;  1SKT A;  2TN4 A;  1PUL A;  1KQV A;  1FI6 A;  1LKJ A;  2KI4 C;  4U8D A;  4XJK A;  3PFV A;  1NWD A;  2L4H A;  2M8U A;  2PAS A;  1EH2 A;  1VRK A;  1B8C A;  1SL8 A;  2WC8 A;  3WXA A;  1QLK A;  2JXC A;  1XFX O;  3NSO A;  1JUO A;  1OZO A;  1XA5 A;  3EVU A;  1K90 D;  1ZMZ A;  1PVB A;  2KI6 D;  2NLN A;  1A03 A;  1CFP A;  1DJY A;  1OSA A;  1CDL A;  3GK2 A;  4AQJ A;  1F4O A;  2KI4 B;  1QJT A;  2HET A;  2LP3 A;  2LAN A;  2KQ6 A;  1S5G Z;  2LAP A;  5AXI A;  1E8A A;  1NCZ A;  2MRD A;  3OP0 A;  4DS7 A;  4QJ3 B;  1QTX A;  1J1D A;  1MUX A;  1YX8 A;  3TUY C;  1MWN A;  1BR1 B;  4MZK A;  1DF0 A;  1QV1 A;  5HLO A;  1YVL A;  3D0Y A;  4GGN A;  3NSI A;  3OX6 A;  1CB1 A;  3IQQ A;  1CLL A;  1PK0 D;  1AJ5 A;  2KAV A;  3D10 A;  4DCK A;  4YGE B;  1U5I B;  3E3R A;  1ODB A;  4P2Y B;  2WCE A;  5CPV A;  3TS5 B;  1JF0 A;  1CTR A;  1M63 B;  1BLQ A;  1QAS A;  2JPT A;  4JQ0 D;  1OQP A;  3TUY B;  3M0W A;  2F8P A;  1MHO A;  2ZKM X;  2BE4 A;  5HKW A;  1OMV A;  2Y1N A;  4MZL A;  5CSI A;  1AP4 A;  3DF0 A;  2I2R E;  3CGA A;  3FWC A;  1XFZ O;  4A4C A;  2F2O A;  3SG2 A;  1GGW A;  1K2H A;  3HX4 A;  1TRF A;  1QX7 A;  2MHH A;  2JNF A;  4OCI A;  1IQ3 A;  3CS1 A;  5D69 A;  3VRQ A;  1R6P A;  5AER A;  1QV0 A;  3K21 A;  2KAY A;  2K7D A;  1BG1 A;  4I5J A;  1JBA A;  2K61 A;  1DJW A;  3PAT A;  4XJK B;  4ZCU A;  1CM1 A;  3SG3 A;  3SG5 A;  1K96 A;  2KFF A;  3SJS A;  1IKU A;  2OPO A;  1CDM A;  3A8R A;  5I2O A;  2L5X B;  1SNL A;  2LMV A;  5IBW A;  2K7O A;  1HT9 A;  2BBN A;  4M2O A;  1F54 A;  1BF5 A;  5HKY A;  2LNK A;  1S5G Y;  2KYC A;  1CMG A;  3KEV A;  1CMF A;  1RWY A;  1B8R A;  3DVM A;  4AOM A;  2M49 B;  1KK7 Z;  5HLV A;  4N1G A;  1K9P A;  3DVK A;  1F55 A;  1C7V A;  1Y1A A;  1A2X A;  2Y4Q A;  3EKH A;  3TDI A;  2M9G A;  1D1O A;  1SRA A;  1UHN A;  3BXK A;  2FJU B;  2PAL A;  1KK8 C;  2F2P A;  2WCB A;  1UHK A;  2FCD A;  4PCW A;  3BYA A;  3VRP A;  1TNQ A;  2FOT A;  1FBV A;  1OMR A;  5CSJ A;  1YUS A;  2O60 A;  1DF0 B;  3VRR A;  1EG3 A;  3D0Y B;  4FQO A;  1EJ3 A;  1IQ5 A;  2BBM A;  2SAS A;  3WNX B;  1XFV O;  2BKH B;  1Y6W A;  2BL0 C;  2WOS A;  5I2L A;  3F45 A;  1TCF A;  1IJ6 A;  1J7O A;  2ZN8 A;  1B8L A;  4PHM A;  2BKI B;  2Q4U A;  2OS8 C;  1KFX S;  4HSZ A;  2LE9 B;  1B9A A;  2K7C A;  2M7L A;  3CR5 X;  2H61 A;  1ZAC A;  2LVV A;  1KSO A;  4C0J A;  3NSL A;  1H4B A;  4E68 A;  3IF7 A;  1F4Q A;  1WRZ A;  3C1V A;  2LCP A;  1KWO C;  2JQ6 A;  5KTY A;  5HYD A;  5D7F A;  2L0P A;  5G08 A;  3LK0 A;  1DMO A;  3DF0 B;  2BL0 B;  4PE1 A;  2EC6 B;  1XYD A;  3EK7 A;  2HPS A;  2I94 A;  4GNK B;  4OV2 A;  4MRX A;  3EKJ A;  1RK9 A;  2OS8 B;  1DJG A;  1KK7 Y;  3CTN A;  4ORB B;  1WLM A;  1N0Y A;  1S6C A;  2JC2 A;  4GUK A;  4DUQ A;  3KO0 A;  1NYA A;  1KFX L;  2MA2 A;  3AKA A;  4M2P A;  1V1F A;  1S6J A;  4N1F A;  3BUM B;  1G8I A;  4PDZ A;  2LUC A;  1KWO B;  5I2Q A;  4PAL A;  1R2U A;  2MLF C;  1DJZ A;  2SCP A;  2CTN A;  3KF9 A;  4ZCV A;  1Y1U A;  2VRG A;  1TIZ A;  1ZOT B;  2JUL A;  1AVS A;  1TNW A;  1NPQ A;  1YUU A;  5JOL A;  2LVJ A;  1DVI A;  1BU3 A;  2IS9 A;  4L9M A;  1K93 D;  1BT6 A;  2BCA A;  1F8H A;  3TS5 C;  5CSN A;  2LMT A;  3I5H C;  2L4I A;  1S6I A;  5AAN A;  2JZI A;  2KOT A;  2H61 C;  5AFP A;  1LXF C;  4C0K A;  1SL9 A;  1NCX A;  2JT8 A;  4CLN A;  1UUS A;  4QJ5 B;  2ISD A;  4GGF A;  1S36 A;  1TOP A;  5BPJ A;  2M1U A;  2ZND A;  1BOC A;  2L50 A;  2JOJ A;  2JTZ A;  4DIR A;  2R2I A;  3I5H B;  1NX2 A;  1IJ5 A;  1CLB A;  1FF1 A;  1EXR A;  2AUC A;  1TNX A;  2F33 A;  2LHL A;  2ZRT A;  2LLT A;  3EK4 A;  3IQO A;  1QVI Z;  1Y1X A;  1IGV A;  3O6B A;  3VRN A;  1KCY A;  2F3Z A;  1ALW A;  5J3X A;  1LVC D;  3EVV A;  1JWD A;  2A4J A;  5ER5 A;  1L7Z A;  2EGD A;  4TNC A;  1EL4 A;  4I5K A;  1OZS A;  1MF8 B;  2LVK A;  2ZFD A;  3RLZ A;  1YR5 A;  4GPL B;  1DGU A;  2G2B A;  2L2E A;  2WCF A;  3AKB A;  1PAL A;  1QXP A;  4CFR A;  1CDN A;  1HQV A;  1MXL C;  2MJW B;  5KSZ A;  3OX5 A;  3PLF B;  4PHK A;  1UHI A;  2AMI A;  1AK8 A;  1BMO A;  2KBM A;  1AUI B;  2GGZ A;  4YI9 A;  1IWQ A;  5HKZ A;  1QX2 A;  2KGR A;  2KYF A;  5DKN A;  1H8B A;  4NDC A;  1DJH A;  1ZFS A;  1J7P A;  1JFK A;  3NSK A;  2K8M B;  2LMU A;  1SK6 D;  2ZN9 A;  4GGF C;  3LK1 A;  1DGV A;  3O4Y A;  1J7Q A;  4MBE A;  3NXA A;  2G9B A;  2CCM A;  2KFH A;  4HRE E;  4AQI A;  2P6B B;  4MRY A;  2E6W A;  2BE6 A;  3CLN A;  3FS7 A;  1PRW A;  2K7B A;  2M97 A;  1QVI Y;  1UUR A;  4WQ2 A;  1UHH A;  2M29 A;  4HRH A;  2WOR A;  3WHT B;  4FTG A;  1OOJ A;  2LM5 A;  4F0Z B;  4MN0 A;  1SL7 A;  4OKH A;  2EC6 C;  1REC A;  1MR8 A;  3LCP C;  1TCO B;  5F6T A;  1NIW A;  3BQ3 A;  1PVA A;  4HRG A;  1JSA A;  5FYX A;  2K0J A;  2DOQ A;  1M45 A;  2KHN A;  2I7A A;  1KSM A;  1XVJ A;  1XFW O;  1C07 A;  4USL A;  2ZRS A;  2KQY A;  4ICB A;  1JF2 A;  3ZNI A;  4N5X A;  1G4Y R;  4NQG A;  2BEC A;  1RRO A;  4PE7 A;  1NSH A;  1LA0 A;  3BOW A;  3SG4 A;  2QPT A;  1QS7 A;  3O2P A;  1S3P A;  1DJX A;  1XK4 A;  2JU0 A;  1MXE A;  1CNP A;  3SIB A;  2GGM A;  4P5O E;  1QX5 B;  3SG6 A;  1TNP A;  3I5G C;  1CFD A;  3FIA A;  1L2O C;  4D1E A;  1SCM C;  2O5G A;  1CM4 A;  2PVB A;  1NCY A;  3I5F C;  1LA3 A;  5GQQ C;  1SBJ A;  3FWB A;  2M1K B;  1KQM B;  1RTP 1;  2LC5 A;  4YGB B;  1A4P A;  3DD4 A;  1LIN A;  4CID A;  2K2F A;  1B4C A;  3CWG A;  1SMG A;  4ORA B;  1BR4 B;  3PN7 C;  2LHI A;  4BY4 A;  1SW8 A;  2CXJ A;  1RFJ A;  4YGD B;  2HQW A;  5K89 A;  3I5G B;  1L2O B;  1W7I B;  2ZNE A;  1SCM B;  2B1U A;  4YGC B;  3AAJ A;  3I5F B;  4BY5 A;  5CSF A;  2WND A;  1BOD A;  3BUW B;  5PAL A;  3JTD C;  2MBX A;  2D8N A;  2BCX A;  3ZWH A;  4CPV A;  4PHN A;  5B8I B;  3MSE B;  3GK1 A;  2AAO A;  3ICB A;  4I5L B;  1B7T Z;  1Y0V H;  1IRJ A;  1DJI A;  1ZUZ A;  2LLU A;  3TDZ A;  3WHU B;  2M0R A;  1NUB A;  1SCV A;  3SG7 A;  1QIV A;  3EVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...