4WQ2A

Human calpain pef(s) with (z)-3-(6-bromondol-3-yl)-2-mercaptoacrylic acid bound
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
173
structure length
173
Chain Sequence
EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Calpain small subunit 1
publication title Conformationally restricted calpain inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 68
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4wq2A00
3CR4X 1PK0D 3SG6A 3PLFB 1KFUS 1B4CA 4GGNA 4IL1A 3AAKA 1CB1A 1KQVA 2HPSA 3RLZA 3SJSA 2WCEA 2JOJA 1UHKA 1QX5B 1YRUB 1QVIZ 2F33A 1D1OA 5CSFA 2KGRA 1CKKA 3CGAA 1K95A 4USLA 1CDLA 2KFGA 3JVTB 4FTGA 5I8NA 1WLZA 4OR9B 4MBEA 3I5IB 4HRGA 3WHUB 2M0RA 1MWNA 5HKYA 1N65A 1Y1AA 4DUQA 1IQ5A 1CFDA 3IQQA 2JNFA 2JT0A 2LCPA 2M49B 1UURA 1PALA 2G9BA 1TNQA 5ER4X 1NCZA 1JF2A 2O60A 2KYFA 1K8UA 2JWWA 3EVRA 5I2QA 1XFVO 2OS8C 5G08A 4PE4A 1F71A 1DT7B 4CPVA 1J7RA 2ZFDA 2FOTA 2NZ0A 1GGZA 3PSRA 5D7FA 4DS7A 4ETOA 2PRUA 4GNKB 1UWOA 1ZOTB 3O6BA 1B47A 3O4YA 3DVEA 4DIRA 1QIVA 4M2QA 2KAVA 2WCBA 3D0YB 5HLVA 1G4YR 1XFWO 3BOWA 1QV1A 2ZN8A 3AKBA 3BUOB 1A29A 2M29A 4C0JA 3I5HC 1K93D 2D8NA 3TS5C 2R2IA 4CFRA 2K8MB 2JULA 1CM4A 4GBAA 4YGBB 1SRAA 2RGIA 3CR2A 5CSIA 2JXLA 4XJKA 1LVCD 2K7OA 3JTDB 3D10A 4YBHB 2M7LA 3ZNIA 4E68A 2E6WA 1NX0A 1TCFA 1FF1A 3EVUA 1DJWA 4QJ5B 4MRYA 4UPGA 5F6TA 1A4PA 1CDNA 3NSKA 1EG3A 1QLSA 3DVKA 1NUBA 3VGOA 1SK6D 1TN4A 2HQ8A 1H4BA 3HX4A 3PATA 2E30A 1AJ4A 1XA5A 2SCPA 4HSZA 1L2OB 1XK4A 2KBIA 2KHNA 1YR5A 2GGMA 1W7JB 1X02A 2CNPA 1KK7Y 4QJ4B 1ALWA 3OB1B 1A75A 1MXEA 1M31A 1FPWA 1OQPA 1SL8A 1TRFA 4N5XA 3FIAA 1OMDA 3AAJA 1BR1B 1DGVA 2BCAA 2M97A 3FS7A 2PSRA 3PFVA 1BJFA 1QV0A 1UUSA 4YGAA 4NDBA 2K0JA 1KQMC 3PN7C 1DGUA 4AQJA 2VRGA 4GFTA 5BPJA 1C07A 1TCOB 1SCMC 1NPQA 2LMTA 4HREE 2A4JA 2JC2A 2M8UA 4M2PA 3VRNA 3CS1A 5FYXA 1AJ5A 2KAXA 1F55A 2LUXA 2K7DA 2LLTA 3CWGA 3BYAA 1S6JA 2LC5A 3CTNA 1XK4C 1S3PA 1YTZC 2JXCA 1N0YA 2CTNA 4GPLB 1WLMA 3DVMA 1N2DA 2F2PA 2L2EA 2PALA 5D69A 1BU3A 1F70A 4MVFA 2LHLA 3ZWHA 2BCBA 3SIAA 1SL7A 2WNDA 2MBXA 5ER5A 4I5NB 1B8LA 4N1FA 1RFJA 4MSPA 5HLOA 2LP2A 3O78A 3VRPA 1K9KA 3HCMA 2G2BA 5KTYA 1GJYA 3M0WA 1SR6B 2COLB 2OS8B 3GK4X 3I5FC 1DJGA 5DKNA 3QRXA 1S36A 2DOQA 2NLNA 4GGFA 1MQ1A 2JT3A 2QACA 1KK8C 1K9UA 1XYDA 2PVBA 1R2UA 1K94A 1JFJA 1KWOC 2L51A 1R6PA 3DF0A 1HQVA 1XFZO 4F0ZB 2LVKA 2CCMA 1SY9A 1XVJA 3EKJA 3I5HB 2HETA 2HF5A 3TS5B 1KFXL 1ZMZA 3MSEB 2JPTA 2L98A 1AHRA 3WNXB 2L4IA 2LNKA 2L4HA 4WRIA 1JWDA 5TNCA 1CLBA 2LE9B 1IRJA 1OE9B 2LVVA 4MZJA 1IG5A 4PALA 1BF5A 1UHHA 1M39A 1F4OA 3WXAA 1SR6C 1IJ6A 1OMRA 3GK1A 1TNPA 1A2XA 3C1VA 3SG5A 3TDUA 3TDIA 1S5GZ 1WY9A 1B7TY 1W7IB 4BY4A 4MZKA 1KSOA 4GGFC 3OP0A 2K2AA 2KSPA 4C0LA 2M1UA 3NSLA 4PDZA 4BY5A 5KSZA 2P6BB 2NCOA 3E3RA 4L9MA 1KSMA 4R1EA 2WCFA 1QTXA 1QASA 1ZFSA 1RJVA 1SKTA 1RTP1 3BOWB 1NCYA 1ZUZA 3SIBA 4MN0A 1BT6A 2Y1NA 1YURA 2Y4QA 4OVNF 2KOTA 2LLUA 4N1GA 1VRKA 3F45A 2KQ6A 1SPYA 3GK2A 1LKJA 3SG3A 1GQMA 4XJKB 1JSAA 1DVIA 1K9PA 4M2OA 3SG7A 2K61A 1OZSA 4MEWA 2BBNA 1KQMB 2KBMA 3LK0A 3PN7B 1M46A 4PHKA 1J7QA 1FW4A 1IJ5A 4PCWA 3I5GC 1MHOA 1SCMB 1FBVA 1B1GA 2KNEA 3BQ3A 1WRKA 2BECA 4PHMA 4I5LB 1BOCA 2I2RE 4ZCVA 1L7ZA 2AAOA 2OPOA 4YGCB 1TNWA 1XO5A 1B8RA 4PE0A 4U8DA 5HYDA 1QX2A 2MRDA 3KF9A 2MLEC 1NX1A 2LVIA 1Y1UA 2OTGC 2JTTA 2LAPA 3SG4A 1AVSA 1A75B 5AEQA 1A03A 2ZRSA 2KI4C 3VRQA 1IGVA 2SASA 1G33A 1MUXA 3ICBA 4GAOA 2B1UA 5AXIA 1YX8A 2I7AA 1BLQA 1CMFA 3NSIA 2MA2A 3I5FB 1DMOA 2M9GA 1QXPA 2KI6D 3DVJA 2GV5A 4YI9A 1KK8B 2O5GA 3PALA 1QVIY 1JC2A 3EVVA 1TTXA 1BG1A 1KWOB 1UP5A 1PVBA 1V1FA 5CSNA 2EGDA 2WOSA 2EC6C 2MHHA 1LA3A 1Y0VH 2I94A 2QPTA 3CR5X 1U5IA 1AP4A 2KFFA 2BE4A 1PRWA 1YRTB 1SYMA 1SL9A 1UHIA 3FWBA 1BR4B 2Q91A 2BL0C 4MRXA 2F8PA 5GQQC 2F3YA 2NXQA 5JJGA 1DF0A 1OOJA 5AANA 2M3WA 3SG2A 5IBWA 1S1EA 2LP3A 1RROA 5AERA 1SNLA 2FCEA 4ORAB 1C7WA 1Q80A 4JQ0D 2Y5IA 1YX7A 2BKIB 1MR8A 3TDZA 4WQ3A 4ZCUA 4ORBB 1NX2A 1AUIB 2L0PA 1CDMA 1DJXA 3RM1A 3TUYC 1ODBA 1AK8A 1J1EA 1FI6A 1BMOA 1KK7Z 2EHBA 1M45A 4FQOA 4ICBA 1NYAA 4QJ3B 5KU1A 4MLWA 3DF0B 2F2OA 2BBMA 1DTLA 1JF0A 3OX5A 2JZIA 4P5OE 1KFXS 1BODA 1CDPA 1J7OA 2KGBC 2KQYA 2KYCA 2IS9A 1NWDA 2MJWB 4GUKA 1JFKA 1EH2A 1GGWA 1MF8B 1K96A 2BCXA 1TNXA 1PULA 1ZACA 4NDCA 1KFUL 1OSAA 2BKHB 2LMUA 1MXLC 5AFPA 1B9AA 1JBAA 1EJ3A 4NQGA 1UHJA 2CBLA 2LUCA 3I5GB 1DJZA 4YGDB 1PVAA 3VRRA 1IH0A 1XFYO 2H2KA 1QJTA 1SW8A 2CXJA 2WC8A 3DD4A 4XYNA 5J3XA 1WDCC 2ZNDA 2K2FA 2LHIA 3FWCA 3VROA 5I2LA 2LANA 2MLFC 4NDDA 1CTRA 2OTGB 2V53A 1V1GA 4HRHA 1WRZA 4OKHA 1C7VA 1NP8A 1QS7A 1B8CA 1Y1XA 1ALVA 2I18A 2HQWA 2L50A 2PMYA 1NCXA 1SCVA 1J55A 3O2PA 2KI4B 1RWYA 4P2YB 4ORCB 4AQIA 1S6IA 3OB2B 4PHJA 3EK4A 2ISDA 4CFQA 3LK1A 4YI8A 1DJHA 3KO0A 1EL4A 3D0YA 4OV2A 5B8IB 2AUCA 2BE6A 2LLSA 3BUWB 1QX7A 2LMVA 1CM1A 1YUSA 1OZOA 4I5KA 3PM8A 1NIWA 2M1KB 2ZN9A 3KPXA 3JVTC 3BXKA 1IQ3A 4TNCA 3EK8A 3I5IC 1QATA 1J7PA 1YUTA 5HKZA 1KCYA 1CMGA 2PASA 5K89A 3EKHA 1YVHA 4WQ2A 2EC6B 3CZTX 4JPZB 1F4QA 5CPVA 3AKAA 3NXAA 1NX3A 2LVJA 4C0KA 2NCPA 3A8RA 2BL0B 1LINA 4CIDA 3WHTB 4MZLA 1LXFC 1XFUO 3BUXB 5I2OA 4PE7A 1SMGA 1TOPA 3NSOA 3EK7A 1TIZA 1B7TZ 1F8HA 3KEVA 4CLNA 1CFFA 3CLNA 3GOFA 4DRWA 1G8IA 1IKUA 3OX6A 2FJUB 1FI5A 1QLKA 1WRLA 2F3ZA 2KDHA 4Q04A 1DJIA 1SBJA 1LA0A 3TUYB 3TZ1A 1CFPA 4PHNA 2JRFA 1CLMA 3H4SE 3OHMB 2ZNEA 2JT8A 4A4BA 2L5XB 4PE1A 1NSHA 2JQ6A 1RK9A 2H61A 2M7NA 3JTDC 2JNXA 4YRUA 1K90D 1U5IB 2LM5A 3LLEA 1J1DA 5DKRA 1JUOA 4OCIA 1EXRA 2KFHA 4JWQA 1DF0B 2LV7A 4DCKA 2KI6C 2Y1MA 2CT9A 1UHNA 2GGZA 1OMVA 1PSRA 5HKWA 1E8AA 2MAZA 1S5GY 2Q4UA 1IWQA 1L2OC 5PALA 4AOMA 4A4CA 4D1EA 1Y6WA 3IQOA 1H8BA 1CLLA 1M63B 2K7BA 3IF7A 2ZRTA 1YVLA 5CSJA 4YGEB 1PSBA 2KAYA 4I5JA 1QIWA 2WORA 3BUMB 1WDCB 2JTZA 2TN4A 3K21A 1CNPA 2ZKMX 1CFCA 1YUUA 3LCPC 5JOLA 3BUNB 1K2HA 2K7CA 3LL8B 1F54A 1DJYA 1HT9A 1RECA 2FCDA 2AMIA 5DKQA 1EG4A 1S26D 2H61C 3KHEA 1S6CA 2JU0A 1XFXO 3A4UB
chains in the Genus database with same CATH superfamily
1OW4A 1PK0D 3BFBA 3CR4X 3PLFB 1KFUS 3SG6A 1B4CA 4GGNA 4IL1A 3AAKA 1CB1A 1KQVA 2HPSA 3RLZA 3SJSA 2WCEA 2JOJA 1UHKA 1QX5B 1YRUB 2ERBA 1QVIZ 2F33A 1D1OA 5CSFA 2KGRA 1CKKA 3CGAA 1K95A 4USLA 4KYNA 1CDLA 2KFGA 3JVTB 4FTGA 3CZ0A 5I8NA 1WLZA 4OR9B 3VB1A 4MBEA 3I5IB 4HRGA 1DC1A 3WHUB 2M0RA 2WCHA 1MWNA 5HKYA 1N65A 1Y1AA 4DUQA 1IQ5A 1CFDA 3IQQA 2JNFA 2JT0A 2LCPA 2M49B 3R1VA 1UURA 1PALA 2BAPA 1TNQA 2G9BA 5ER4X 1NCZA 1JF2A 2O60A 2KYFA 1K8UA 2JWWA 3EVRA 5I2QA 1XFVO 2OS8C 5G08A 3D75A 2QEHA 4PE4A 1F71A 1DT7B 4CPVA 1J7RA 2ZFDA 2FOTA 2NZ0A 1GGZA 3PSRA 5D7FA 4DS7A 4ETOA 2PRUA 4GNKB 1UWOA 1ZOTB 3O6BA 1B47A 2BNXA 3O4YA 3DVEA 4DIRA 1QIVA 4M2QA 2KAVA 2WCBA 3D0YB 5HLVA 1G4YR 1XFWO 3BOWA 1QV1A 2ZN8A 3AKBA 3BUOB 1A29A 2M29A 4JKTA 4C0JA 3I5HC 1K93D 2D8NA 3TS5C 2R2IA 4CFRA 2K8MB 2JULA 1CM4A 4GBAA 4YGBB 1SRAA 2RGIA 3CR2A 5CSIA 2JXLA 3S0AA 4XJKA 2PQLA 3DY9A 1LVCD 2K60A 2K7OA 3JTDB 3D10A 3D77A 4YBHB 2M7LA 3ZNIA 4E68A 2KLEA 2E6WA 1NX0A 1TCFA 1FF1A 3EVUA 1DJWA 3SS4A 4QJ5B 2QEOA 4MRYA 4UPGA 3FE8A 5F6TA 1A4PA 1CDNA 3NSKA 1EG3A 1QLSA 3DVKA 1NUBA 3VGOA 1SK6D 1TN4A 2HQ8A 2QDIA 1H4BA 2WC6A 3HX4A 3PATA 2E30A 1AJ4A 1XA5A 2SCPA 4HSZA 1L2OB 1XK4A 2KBIA 3B7AA 2KHNA 1YR5A 2GGMA 1W7JB 1X02A 2CNPA 1KK7Y 4QJ4B 1ALWA 3OB1B 1A75A 1MXEA 1M31A 1FPWA 1OQPA 1SL8A 1TRFA 4N5XA 3FIAA 1OMDA 3AAJA 1BR1B 1DGVA 2BCAA 2M97A 3FS7A 2PSRA 3PFVA 1BJFA 1QV0A 1UUSA 4YGAA 4NDBA 2K0JA 1KQMC 3PN7C 1DGUA 4AQJA 2VRGA 4GFTA 2L2CA 5BPJA 1TCOB 1C07A 5FI6A 1SCMC 1NPQA 2LMTA 4HREE 3B86A 2A4JA 2JC2A 2M8UA 4M2PA 3VRNA 3CS1A 5FYXA 1AJ5A 2KAXA 1F55A 2LUXA 2K7DA 2LLTA 2PYQA 3CZ1A 3CWGA 2WCKA 3BYAA 1S6JA 2LC5A 3CTNA 1XK4C 1S3PA 1YTZC 2JXCA 1N0YA 2CTNA 4GPLB 1WLMA 3BJHA 3DVMA 1N2DA 2F2PA 5FI2A 2L2EA 2PALA 5D69A 1BU3A 1F70A 2P70A 4MVFA 2LHLA 3CABA 3ZWHA 2BCBA 3SIAA 1SL7A 2WNDA 2MBXA 5ER5A 4I5NB 1B8LA 3L4LA 4N1FA 1RFJA 1Z4HA 1XFRA 4MSPA 2LP2A 3O78A 5HLOA 3VRPA 1K9KA 3HCMA 2G2BA 3CDNA 5KTYA 1DEKA 1GJYA 2YGUA 3M0WA 1SR6B 2COLB 2OS8B 3GK4X 3I5FC 4FQTA 1DJGA 5DKNA 3QRXA 1S36A 2DOQA 2NLNA 4GGFA 1MQ1A 2JT3A 2QACA 1KK8C 1K9UA 1XYDA 2PVBA 1R2UA 1K94A 3CYZA 1JFJA 1KWOC 2L51A 4PT1A 5I94A 1R6PA 3DF0A 1HQVA 1XFZO 4F0ZB 2LVKA 2CCMA 1C3YA 1SY9A 1XVJA 3CZ2A 3EKJA 3I5HB 2HETA 2HF5A 3BFAA 3TS5B 1KFXL 1ZMZA 3MSEB 2JPTA 2L98A 2P71A 1AHRA 3WNXB 2L4IA 2LNKA 2L4HA 4WRIA 1JWDA 5TNCA 1CLBA 2LE9B 1IRJA 1OE9B 2LVVA 3D76A 1IG5A 4MZJA 3NGVA 4PALA 1BF5A 1UHHA 1M39A 1F4OA 3S0DA 1SR6C 1IJ6A 1OMRA 3GK1A 3WXAA 1TNPA 1A2XA 3C1VA 3SG5A 3TDUA 5HL1A 3TDIA 1S5GZ 1WY9A 1B7TY 1W7IB 4BY4A 4MZKA 3D78A 1KSOA 3DZTA 3OP0A 4GGFC 2K2AA 2KSPA 3K1EA 2M1UA 3NSLA 4PDZA 4BY5A 4C0LA 5KSZA 2P6BB 3PJIA 2NCOA 3E3RA 4L9MA 1KSMA 3B6XA 4R1EA 2WCFA 1QTXA 1QASA 1ZFSA 1RJVA 1SKTA 1RTP1 3BOWB 1NCYA 1OOIX 1ZUZA 3V2LA 3SS3A 3S0EA 3SIBA 4MN0A 1BT6A 2Y1NA 1YURA 1ORGA 2Y4QA 4OVNF 2KOTA 2LLUA 4N1GA 1VRKA 3F45A 2KQ6A 1SPYA 3GK2A 1LKJA 3SG3A 1DQEA 1GQMA 4XJKB 1JSAA 3D74A 1DVIA 1K9PA 4M2OA 3SG7A 2K61A 3NHTA 1OZSA 1P28A 4MEWA 2BBNA 1KQMB 2KBMA 3LK0A 3PN7B 1M46A 4PHKA 1J7QA 1FW4A 1IJ5A 4PCWA 3I5GC 1MHOA 1SCMB 1FBVA 1B1GA 2KNEA 3IVTA 3BQ3A 1WRKA 2BECA 4PHMA 4I5LB 1BOCA 2I2RE 4ZCVA 1L7ZA 2AAOA 3R72A 2OPOA 4YGCB 1TNWA 1XO5A 1B8RA 4INWA 4PE0A 4U8DA 5HYDA 1QX2A 2MRDA 3KF9A 2MLEC 1NX1A 2LVIA 1Y1UA 2OTGC 2JTTA 2LAPA 3SG4A 1AVSA 1A75B 5AEQA 1A03A 2ZRSA 3UNWA 2KI4C 3VRQA 1IGVA 2SASA 1G33A 1MUXA 3ICBA 4GAOA 2B1UA 4IJ7A 5AXIA 1YX8A 2I7AA 5FI7A 1BLQA 3PM2A 1CMFA 1IIOA 3NSIA 2MA2A 3I5FB 1DMOA 2M9GA 1QXPA 2KI6D 3DVJA 2GV5A 4YI9A 1KK8B 2O5GA 3PALA 1QVIY 1JC2A 3OGNA 3EVVA 1TUJA 1TTXA 1BG1A 1KWOB 1UP5A 1PVBA 1V1FA 5CSNA 1OOGA 3DYEA 2EGDA 2WOSA 2EC6C 2MHHA 1OOFA 1LA3A 1Y0VH 2I94A 2QPTA 3CR5X 1U5IA 1AP4A 3R1PA 2KFFA 2BE4A 1PRWA 1YRTB 1SYMA 1SL9A 1UHIA 3FWBA 1BR4B 2Q91A 2BL0C 4MRXA 2F8PA 5GQQC 2F3YA 2NXQA 5JJGA 1DF0A 1OOJA 3NHIA 2M3WA 1DELA 3N7HA 5AANA 3SG2A 5IBWA 1S1EA 2LP3A 1RROA 5AERA 1SNLA 2FCEA 4ORAB 1C7WA 1Q80A 3S0BA 4JQ0D 2Y5IA 1YX7A 2BKIB 2QEBA 1MR8A 3TDZA 4WQ3A 4ZCUA 4ORBB 1NX2A 1AUIB 2L0PA 1CDMA 1C3ZA 1DJXA 4JD9A 3RM1A 4F7FA 3TUYC 1ODBA 1AK8A 1J1EA 3D73A 1BMOA 5DICA 1KK7Z 1FI6A 2EHBA 1M45A 3Q8IA 4FQOA 4ICBA 1NYAA 4QJ3B 3SS5A 5KU1A 4MLWA 3DF0B 2F2OA 2BBMA 1DTLA 1JF0A 3OX5A 1LS8A 2JZIA 1KFXS 4P5OE 1CDPA 1BODA 1J7OA 1SSEB 2KGBC 2KQYA 2KYCA 2IS9A 3L47A 1NWDA 2MJWB 4GUKA 1JFKA 1EH2A 1GGWA 1MF8B 1K96A 1TNXA 2BCXA 1PULA 1ZACA 4NDCA 1KFUL 1OSAA 2BKHB 2LMUA 1MXLC 5AFPA 1B9AA 1JBAA 1EJ3A 4NQGA 1UHJA 2CBLA 2KLDA 2LUCA 3I5GB 1DJZA 4YGDB 1PVAA 3VRRA 3S0FA 1XFYO 1IH0A 2H2KA 1QJTA 1SW8A 2CXJA 2WC8A 3DD4A 4XYNA 5J3XA 1WDCC 5EL2A 2ZNDA 2K2FA 2LHIA 3FWCA 3VROA 5I2LA 2LANA 2MLFC 4NDDA 1CTRA 3UO9A 2OTGB 2V53A 1V1GA 4HRHA 1WRZA 4OKHA 1C7VA 1NP8A 1QS7A 1B8CA 1Y1XA 1ALVA 2I18A 2HQWA 2L50A 2PMYA 1NCXA 1SCVA 1J55A 3O2PA 2KI4B 1RWYA 4P2YB 4ORCB 4AQIA 1S6IA 3OB2B 4PHJA 3EK4A 2KPHA 2ISDA 4CFQA 3LK1A 4YI8A 1DJHA 3KO0A 1EL4A 3D0YA 4OV2A 5B8IB 2AUCA 2BE6A 2LLSA 1GM0A 3BUWB 1QX7A 2LMVA 1CM1A 1YUSA 1OZOA 4I5KA 3PM8A 1NIWA 2M1KB 2ZN9A 3KPXA 3JVTC 3B87A 3BXKA 1IQ3A 4TNCA 3EK8A 3I5IC 1QATA 1J7PA 1YUTA 2WCMA 2GTEA 5HKZA 1KCYA 1OOHA 1CMGA 2PASA 5K89A 3EKHA 1YVHA 3OBVA 4WQ2A 2EC6B 3CZTX 2FJYA 1F4QA 4JPZB 2QEVA 5CPVA 3AKAA 3NXAA 1NX3A 2LVJA 3O4XA 3R1OA 2H8VA 4C0KA 3FE9A 2L5YA 2NCPA 3A8RA 2BL0B 1LINA 4CIDA 3WHTB 4MZLA 1LXFC 1XFUO 3BUXB 5I2OA 4PE7A 1SMGA 1TOPA 3NSOA 3EK7A 1TIZA 1B7TZ 1F8HA 3KEVA 4CLNA 1W9ZA 1T14A 3B88A 3CLNA 3GOFA 4DRWA 1CFFA 1G8IA 1IKUA 3OX6A 4OZDA 2FJUB 1TUZA 1FI5A 1QLKA 3FE6A 2JPOA 1WRLA 2F3ZA 2KDHA 4Q04A 1DJIA 1SBJA 1LA0A 3TUYB 3TZ1A 1CFPA 4PHNA 3BFHA 2JRFA 1CLMA 3H4SE 3OHMB 2ZNEA 3L4AA 2JT8A 4A4BA 2L5XB 1QWVA 4PE1A 1NSHA 2JQ6A 1RK9A 2H61A 2M7NA 5D3OA 3JTDC 2JNXA 4YRUA 1TWOA 1K90D 2WCLA 3RZSA 1U5IB 2LM5A 3LLEA 1J1DA 5DKRA 1JUOA 4OCIA 1EXRA 2KFHA 4JWQA 1Z2CB 1DF0B 2LV7A 4DCKA 2KI6C 2Y1MA 2CT9A 2WCJA 1UHNA 2GGZA 1OMVA 1PSRA 5HKWA 1E8AA 2MAZA 1S5GY 2Q4UA 1IWQA 1L2OC 5PALA 4AOMA 4A4CA 4D1EA 1Y6WA 3QMEA 3IQOA 1H8BA 1CLLA 1M63B 2K7BA 3IF7A 2ZRTA 2WC5A 1YVLA 5CSJA 4YGEB 1PSBA 2KAYA 4I5JA 3EG5B 1QIWA 2WORA 3BUMB 1WDCB 3S0GA 2JTZA 2TN4A 3K21A 1CNPA 2ZKMX 1CFCA 1YUUA 3LCPC 5JOLA 3BUNB 1K2HA 3DXLA 2K7CA 3LL8B 4INXA 1F54A 1DJYA 1HT9A 1RECA 2FCDA 2AMIA 5DKQA 1EG4A 1S26D 2H61C 3KHEA 1S6CA 2JU0A 1XFXO 3A4UB
chains in the Genus database with same CATH topology
3CR4X 1PK0D 3SG6A 3PLFB 1KFUS 1B4CA 4GGNA 4IL1A 3AAKA 1CB1A 1KQVA 2HPSA 3RLZA 3SJSA 2WCEA 2JOJA 1UHKA 1QX5B 1YRUB 1QVIZ 2F33A 1D1OA 5CSFA 2KGRA 1CKKA 3CGAA 1K95A 4USLA 1CDLA 2KFGA 3JVTB 4FTGA 5I8NA 1WLZA 4OR9B 4MBEA 3I5IB 4HRGA 3WHUB 2M0RA 1MWNA 5HKYA 1N65A 1Y1AA 4DUQA 1IQ5A 1CFDA 3IQQA 2JNFA 2JT0A 2LCPA 2M49B 1UURA 1PALA 2G9BA 1TNQA 5ER4X 1NCZA 1JF2A 2O60A 2KYFA 1K8UA 2JWWA 3EVRA 5I2QA 1XFVO 2OS8C 5G08A 4PE4A 1F71A 1DT7B 4CPVA 1J7RA 2ZFDA 2FOTA 2NZ0A 1GGZA 3PSRA 5D7FA 4DS7A 4ETOA 2PRUA 4GNKB 1UWOA 1ZOTB 3O6BA 1B47A 3O4YA 3DVEA 4DIRA 1QIVA 4M2QA 2KAVA 2WCBA 3D0YB 5HLVA 1G4YR 1XFWO 3BOWA 1QV1A 2ZN8A 3AKBA 3BUOB 1A29A 2M29A 4C0JA 3I5HC 1K93D 2D8NA 3TS5C 2R2IA 4CFRA 2K8MB 2JULA 1CM4A 4GBAA 4YGBB 1SRAA 2RGIA 3CR2A 5CSIA 2JXLA 4XJKA 1LVCD 2K7OA 3JTDB 3D10A 4YBHB 2M7LA 3ZNIA 4E68A 2E6WA 1NX0A 1TCFA 1FF1A 3EVUA 1DJWA 4QJ5B 4MRYA 4UPGA 5F6TA 1A4PA 1CDNA 3NSKA 1EG3A 1QLSA 3DVKA 1NUBA 3VGOA 1SK6D 1TN4A 2HQ8A 1H4BA 3HX4A 3PATA 2E30A 1AJ4A 1XA5A 2SCPA 4HSZA 1L2OB 1XK4A 2KBIA 2KHNA 1YR5A 2GGMA 1W7JB 1X02A 2CNPA 1KK7Y 4QJ4B 1ALWA 3OB1B 1A75A 1MXEA 1M31A 1FPWA 1OQPA 1SL8A 1TRFA 4N5XA 3FIAA 1OMDA 3AAJA 1BR1B 1DGVA 2BCAA 2M97A 3FS7A 2PSRA 3PFVA 1BJFA 1QV0A 1UUSA 4YGAA 4NDBA 2K0JA 1KQMC 3PN7C 1DGUA 4AQJA 2VRGA 4GFTA 5BPJA 1C07A 1TCOB 1SCMC 1NPQA 2LMTA 4HREE 2A4JA 2JC2A 2M8UA 4M2PA 3VRNA 3CS1A 5FYXA 1AJ5A 2KAXA 1F55A 2LUXA 2K7DA 2LLTA 3CWGA 3BYAA 1S6JA 2LC5A 3CTNA 1XK4C 1S3PA 1YTZC 2JXCA 1N0YA 2CTNA 4GPLB 1WLMA 3DVMA 1N2DA 2F2PA 2L2EA 2PALA 5D69A 1BU3A 1F70A 4MVFA 2LHLA 3ZWHA 2BCBA 3SIAA 1SL7A 2WNDA 2MBXA 5ER5A 4I5NB 1B8LA 4N1FA 1RFJA 4MSPA 5HLOA 2LP2A 3O78A 3VRPA 1K9KA 3HCMA 2G2BA 5KTYA 1GJYA 3M0WA 1SR6B 2COLB 2OS8B 3GK4X 3I5FC 1DJGA 5DKNA 3QRXA 1S36A 2DOQA 2NLNA 4GGFA 1MQ1A 2JT3A 2QACA 1KK8C 1K9UA 1XYDA 2PVBA 1R2UA 1K94A 1JFJA 1KWOC 2L51A 1R6PA 3DF0A 1HQVA 1XFZO 4F0ZB 2LVKA 2CCMA 1SY9A 1XVJA 3EKJA 3I5HB 2HETA 2HF5A 3TS5B 1KFXL 1ZMZA 3MSEB 2JPTA 2L98A 1AHRA 3WNXB 2L4IA 2LNKA 2L4HA 4WRIA 1JWDA 5TNCA 1CLBA 2LE9B 1IRJA 1OE9B 2LVVA 4MZJA 1IG5A 4PALA 1BF5A 1UHHA 1M39A 1F4OA 3WXAA 1SR6C 1IJ6A 1OMRA 3GK1A 1TNPA 1A2XA 3C1VA 3SG5A 3TDUA 3TDIA 1S5GZ 1WY9A 1B7TY 1W7IB 4BY4A 4MZKA 1KSOA 4GGFC 3OP0A 2K2AA 2KSPA 4C0LA 2M1UA 3NSLA 4PDZA 4BY5A 5KSZA 2P6BB 2NCOA 3E3RA 4L9MA 1KSMA 4R1EA 2WCFA 1QTXA 1QASA 1ZFSA 1RJVA 1SKTA 1RTP1 3BOWB 1NCYA 1ZUZA 3SIBA 4MN0A 1BT6A 2Y1NA 1YURA 2Y4QA 4OVNF 2KOTA 2LLUA 4N1GA 1VRKA 3F45A 2KQ6A 1SPYA 3GK2A 1LKJA 3SG3A 1GQMA 4XJKB 1JSAA 1DVIA 1K9PA 4M2OA 3SG7A 2K61A 1OZSA 4MEWA 2BBNA 1KQMB 2KBMA 3LK0A 3PN7B 1M46A 4PHKA 1J7QA 1FW4A 1IJ5A 4PCWA 3I5GC 1MHOA 1SCMB 1FBVA 1B1GA 2KNEA 3BQ3A 1WRKA 2BECA 4PHMA 4I5LB 1BOCA 2I2RE 4ZCVA 1L7ZA 2AAOA 2OPOA 4YGCB 1TNWA 1XO5A 1B8RA 4PE0A 4U8DA 5HYDA 1QX2A 2MRDA 3KF9A 2MLEC 1NX1A 2LVIA 1Y1UA 2OTGC 2JTTA 2LAPA 3SG4A 1AVSA 1A75B 5AEQA 1A03A 2ZRSA 2KI4C 3VRQA 1IGVA 2SASA 1G33A 1MUXA 3ICBA 4GAOA 2B1UA 5AXIA 1YX8A 2I7AA 1BLQA 1CMFA 3NSIA 2MA2A 3I5FB 1DMOA 2M9GA 1QXPA 2KI6D 3DVJA 2GV5A 4YI9A 1KK8B 2O5GA 3PALA 1QVIY 1JC2A 3EVVA 1TTXA 1BG1A 1KWOB 1UP5A 1PVBA 1V1FA 5CSNA 2EGDA 2WOSA 2EC6C 2MHHA 1LA3A 1Y0VH 2I94A 2QPTA 3CR5X 1U5IA 1AP4A 2KFFA 2BE4A 1PRWA 1YRTB 1SYMA 1SL9A 1UHIA 3FWBA 1BR4B 2Q91A 2BL0C 4MRXA 2F8PA 5GQQC 2F3YA 2NXQA 5JJGA 1DF0A 1OOJA 5AANA 2M3WA 3SG2A 5IBWA 1S1EA 2LP3A 1RROA 5AERA 1SNLA 2FCEA 4ORAB 1C7WA 1Q80A 4JQ0D 2Y5IA 1YX7A 2BKIB 1MR8A 3TDZA 4WQ3A 4ZCUA 4ORBB 1NX2A 1AUIB 2L0PA 1CDMA 1DJXA 3RM1A 3TUYC 1ODBA 1AK8A 1J1EA 1FI6A 1BMOA 1KK7Z 2EHBA 1M45A 4FQOA 4ICBA 1NYAA 4QJ3B 5KU1A 4MLWA 3DF0B 2F2OA 2BBMA 1DTLA 1JF0A 3OX5A 2JZIA 4P5OE 1KFXS 1BODA 1CDPA 1J7OA 2KGBC 2KQYA 2KYCA 2IS9A 1NWDA 2MJWB 4GUKA 1JFKA 1EH2A 1GGWA 1MF8B 1K96A 2BCXA 1TNXA 1PULA 1ZACA 4NDCA 1KFUL 1OSAA 2BKHB 2LMUA 1MXLC 5AFPA 1B9AA 1JBAA 1EJ3A 4NQGA 1UHJA 2CBLA 2LUCA 3I5GB 1DJZA 4YGDB 1PVAA 3VRRA 1IH0A 1XFYO 2H2KA 1QJTA 1SW8A 2CXJA 2WC8A 3DD4A 4XYNA 5J3XA 1WDCC 2ZNDA 2K2FA 2LHIA 3FWCA 3VROA 5I2LA 2LANA 2MLFC 4NDDA 1CTRA 2OTGB 2V53A 1V1GA 4HRHA 1WRZA 4OKHA 1C7VA 1NP8A 1QS7A 1B8CA 1Y1XA 1ALVA 2I18A 2HQWA 2L50A 2PMYA 1NCXA 1SCVA 1J55A 3O2PA 2KI4B 1RWYA 4P2YB 4ORCB 4AQIA 1S6IA 3OB2B 4PHJA 3EK4A 2ISDA 4CFQA 3LK1A 4YI8A 1DJHA 3KO0A 1EL4A 3D0YA 4OV2A 5B8IB 2AUCA 2BE6A 2LLSA 3BUWB 1QX7A 2LMVA 1CM1A 1YUSA 1OZOA 4I5KA 3PM8A 1NIWA 2M1KB 2ZN9A 3KPXA 3JVTC 3BXKA 1IQ3A 4TNCA 3EK8A 3I5IC 1QATA 1J7PA 1YUTA 5HKZA 1KCYA 1CMGA 2PASA 5K89A 3EKHA 1YVHA 4WQ2A 2EC6B 3CZTX 4JPZB 1F4QA 5CPVA 3AKAA 3NXAA 1NX3A 2LVJA 4C0KA 2NCPA 3A8RA 2BL0B 1LINA 4CIDA 3WHTB 4MZLA 1LXFC 1XFUO 3BUXB 5I2OA 4PE7A 1SMGA 1TOPA 3NSOA 3EK7A 1TIZA 1B7TZ 1F8HA 3KEVA 4CLNA 1CFFA 3CLNA 3GOFA 4DRWA 1G8IA 1IKUA 3OX6A 2FJUB 1FI5A 1QLKA 1WRLA 2F3ZA 2KDHA 4Q04A 1DJIA 1SBJA 1LA0A 3TUYB 3TZ1A 1CFPA 4PHNA 2JRFA 1CLMA 3H4SE 3OHMB 2ZNEA 2JT8A 4A4BA 2L5XB 4PE1A 1NSHA 2JQ6A 1RK9A 2H61A 2M7NA 3JTDC 2JNXA 4YRUA 1K90D 1U5IB 2LM5A 3LLEA 1J1DA 5DKRA 1JUOA 4OCIA 1EXRA 2KFHA 4JWQA 1DF0B 2LV7A 4DCKA 2KI6C 2Y1MA 2CT9A 1UHNA 2GGZA 1OMVA 1PSRA 5HKWA 1E8AA 2MAZA 1S5GY 2Q4UA 1IWQA 1L2OC 5PALA 4AOMA 4A4CA 4D1EA 1Y6WA 3IQOA 1H8BA 1CLLA 1M63B 2K7BA 3IF7A 2ZRTA 1YVLA 5CSJA 4YGEB 1PSBA 2KAYA 4I5JA 1QIWA 2WORA 3BUMB 1WDCB 2JTZA 2TN4A 3K21A 1CNPA 2ZKMX 1CFCA 1YUUA 3LCPC 5JOLA 3BUNB 1K2HA 2K7CA 3LL8B 1F54A 1DJYA 1HT9A 1RECA 2FCDA 2AMIA 5DKQA 1EG4A 1S26D 2H61C 3KHEA 1S6CA 2JU0A 1XFXO 3A4UB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CR4 X;  1PK0 D;  3SG6 A;  3PLF B;  1KFU S;  1B4C A;  4GGN A;  4IL1 A;  3AAK A;  1CB1 A;  1KQV A;  2HPS A;  3RLZ A;  3SJS A;  2WCE A;  2JOJ A;  1UHK A;  1QX5 B;  1YRU B;  1QVI Z;  2F33 A;  1D1O A;  5CSF A;  2KGR A;  1CKK A;  3CGA A;  1K95 A;  4USL A;  1CDL A;  2KFG A;  3JVT B;  4FTG A;  5I8N A;  1WLZ A;  4OR9 B;  4MBE A;  3I5I B;  4HRG A;  3WHU B;  2M0R A;  1MWN A;  5HKY A;  1N65 A;  1Y1A A;  4DUQ A;  1IQ5 A;  1CFD A;  3IQQ A;  2JNF A;  2JT0 A;  2LCP A;  2M49 B;  1UUR A;  1PAL A;  2G9B A;  1TNQ A;  5ER4 X;  1NCZ A;  1JF2 A;  2O60 A;  2KYF A;  1K8U A;  2JWW A;  3EVR A;  5I2Q A;  1XFV O;  2OS8 C;  5G08 A;  4PE4 A;  1F71 A;  1DT7 B;  4CPV A;  1J7R A;  2ZFD A;  2FOT A;  2NZ0 A;  1GGZ A;  3PSR A;  5D7F A;  4DS7 A;  4ETO A;  2PRU A;  4GNK B;  1UWO A;  1ZOT B;  3O6B A;  1B47 A;  3O4Y A;  3DVE A;  4DIR A;  1QIV A;  4M2Q A;  2KAV A;  2WCB A;  3D0Y B;  5HLV A;  1G4Y R;  1XFW O;  3BOW A;  1QV1 A;  2ZN8 A;  3AKB A;  3BUO B;  1A29 A;  2M29 A;  4C0J A;  3I5H C;  1K93 D;  2D8N A;  3TS5 C;  2R2I A;  4CFR A;  2K8M B;  2JUL A;  1CM4 A;  4GBA A;  4YGB B;  1SRA A;  2RGI A;  3CR2 A;  5CSI A;  2JXL A;  4XJK A;  1LVC D;  2K7O A;  3JTD B;  3D10 A;  4YBH B;  2M7L A;  3ZNI A;  4E68 A;  2E6W A;  1NX0 A;  1TCF A;  1FF1 A;  3EVU A;  1DJW A;  4QJ5 B;  4MRY A;  4UPG A;  5F6T A;  1A4P A;  1CDN A;  3NSK A;  1EG3 A;  1QLS A;  3DVK A;  1NUB A;  3VGO A;  1SK6 D;  1TN4 A;  2HQ8 A;  1H4B A;  3HX4 A;  3PAT A;  2E30 A;  1AJ4 A;  1XA5 A;  2SCP A;  4HSZ A;  1L2O B;  1XK4 A;  2KBI A;  2KHN A;  1YR5 A;  2GGM A;  1W7J B;  1X02 A;  2CNP A;  1KK7 Y;  4QJ4 B;  1ALW A;  3OB1 B;  1A75 A;  1MXE A;  1M31 A;  1FPW A;  1OQP A;  1SL8 A;  1TRF A;  4N5X A;  3FIA A;  1OMD A;  3AAJ A;  1BR1 B;  1DGV A;  2BCA A;  2M97 A;  3FS7 A;  2PSR A;  3PFV A;  1BJF A;  1QV0 A;  1UUS A;  4YGA A;  4NDB A;  2K0J A;  1KQM C;  3PN7 C;  1DGU A;  4AQJ A;  2VRG A;  4GFT A;  5BPJ A;  1C07 A;  1TCO B;  1SCM C;  1NPQ A;  2LMT A;  4HRE E;  2A4J A;  2JC2 A;  2M8U A;  4M2P A;  3VRN A;  3CS1 A;  5FYX A;  1AJ5 A;  2KAX A;  1F55 A;  2LUX A;  2K7D A;  2LLT A;  3CWG A;  3BYA A;  1S6J A;  2LC5 A;  3CTN A;  1XK4 C;  1S3P A;  1YTZ C;  2JXC A;  1N0Y A;  2CTN A;  4GPL B;  1WLM A;  3DVM A;  1N2D A;  2F2P A;  2L2E A;  2PAL A;  5D69 A;  1BU3 A;  1F70 A;  4MVF A;  2LHL A;  3ZWH A;  2BCB A;  3SIA A;  1SL7 A;  2WND A;  2MBX A;  5ER5 A;  4I5N B;  1B8L A;  4N1F A;  1RFJ A;  4MSP A;  5HLO A;  2LP2 A;  3O78 A;  3VRP A;  1K9K A;  3HCM A;  2G2B A;  5KTY A;  1GJY A;  3M0W A;  1SR6 B;  2COL B;  2OS8 B;  3GK4 X;  3I5F C;  1DJG A;  5DKN A;  3QRX A;  1S36 A;  2DOQ A;  2NLN A;  4GGF A;  1MQ1 A;  2JT3 A;  2QAC A;  1KK8 C;  1K9U A;  1XYD A;  2PVB A;  1R2U A;  1K94 A;  1JFJ A;  1KWO C;  2L51 A;  1R6P A;  3DF0 A;  1HQV A;  1XFZ O;  4F0Z B;  2LVK A;  2CCM A;  1SY9 A;  1XVJ A;  3EKJ A;  3I5H B;  2HET A;  2HF5 A;  3TS5 B;  1KFX L;  1ZMZ A;  3MSE B;  2JPT A;  2L98 A;  1AHR A;  3WNX B;  2L4I A;  2LNK A;  2L4H A;  4WRI A;  1JWD A;  5TNC A;  1CLB A;  2LE9 B;  1IRJ A;  1OE9 B;  2LVV A;  4MZJ A;  1IG5 A;  4PAL A;  1BF5 A;  1UHH A;  1M39 A;  1F4O A;  3WXA A;  1SR6 C;  1IJ6 A;  1OMR A;  3GK1 A;  1TNP A;  1A2X A;  3C1V A;  3SG5 A;  3TDU A;  3TDI A;  1S5G Z;  1WY9 A;  1B7T Y;  1W7I B;  4BY4 A;  4MZK A;  1KSO A;  4GGF C;  3OP0 A;  2K2A A;  2KSP A;  4C0L A;  2M1U A;  3NSL A;  4PDZ A;  4BY5 A;  5KSZ A;  2P6B B;  2NCO A;  3E3R A;  4L9M A;  1KSM A;  4R1E A;  2WCF A;  1QTX A;  1QAS A;  1ZFS A;  1RJV A;  1SKT A;  1RTP 1;  3BOW B;  1NCY A;  1ZUZ A;  3SIB A;  4MN0 A;  1BT6 A;  2Y1N A;  1YUR A;  2Y4Q A;  4OVN F;  2KOT A;  2LLU A;  4N1G A;  1VRK A;  3F45 A;  2KQ6 A;  1SPY A;  3GK2 A;  1LKJ A;  3SG3 A;  1GQM A;  4XJK B;  1JSA A;  1DVI A;  1K9P A;  4M2O A;  3SG7 A;  2K61 A;  1OZS A;  4MEW A;  2BBN A;  1KQM B;  2KBM A;  3LK0 A;  3PN7 B;  1M46 A;  4PHK A;  1J7Q A;  1FW4 A;  1IJ5 A;  4PCW A;  3I5G C;  1MHO A;  1SCM B;  1FBV A;  1B1G A;  2KNE A;  3BQ3 A;  1WRK A;  2BEC A;  4PHM A;  4I5L B;  1BOC A;  2I2R E;  4ZCV A;  1L7Z A;  2AAO A;  2OPO A;  4YGC B;  1TNW A;  1XO5 A;  1B8R A;  4PE0 A;  4U8D A;  5HYD A;  1QX2 A;  2MRD A;  3KF9 A;  2MLE C;  1NX1 A;  2LVI A;  1Y1U A;  2OTG C;  2JTT A;  2LAP A;  3SG4 A;  1AVS A;  1A75 B;  5AEQ A;  1A03 A;  2ZRS A;  2KI4 C;  3VRQ A;  1IGV A;  2SAS A;  1G33 A;  1MUX A;  3ICB A;  4GAO A;  2B1U A;  5AXI A;  1YX8 A;  2I7A A;  1BLQ A;  1CMF A;  3NSI A;  2MA2 A;  3I5F B;  1DMO A;  2M9G A;  1QXP A;  2KI6 D;  3DVJ A;  2GV5 A;  4YI9 A;  1KK8 B;  2O5G A;  3PAL A;  1QVI Y;  1JC2 A;  3EVV A;  1TTX A;  1BG1 A;  1KWO B;  1UP5 A;  1PVB A;  1V1F A;  5CSN A;  2EGD A;  2WOS A;  2EC6 C;  2MHH A;  1LA3 A;  1Y0V H;  2I94 A;  2QPT A;  3CR5 X;  1U5I A;  1AP4 A;  2KFF A;  2BE4 A;  1PRW A;  1YRT B;  1SYM A;  1SL9 A;  1UHI A;  3FWB A;  1BR4 B;  2Q91 A;  2BL0 C;  4MRX A;  2F8P A;  5GQQ C;  2F3Y A;  2NXQ A;  5JJG A;  1DF0 A;  1OOJ A;  5AAN A;  2M3W A;  3SG2 A;  5IBW A;  1S1E A;  2LP3 A;  1RRO A;  5AER A;  1SNL A;  2FCE A;  4ORA B;  1C7W A;  1Q80 A;  4JQ0 D;  2Y5I A;  1YX7 A;  2BKI B;  1MR8 A;  3TDZ A;  4WQ3 A;  4ZCU A;  4ORB B;  1NX2 A;  1AUI B;  2L0P A;  1CDM A;  1DJX A;  3RM1 A;  3TUY C;  1ODB A;  1AK8 A;  1J1E A;  1FI6 A;  1BMO A;  1KK7 Z;  2EHB A;  1M45 A;  4FQO A;  4ICB A;  1NYA A;  4QJ3 B;  5KU1 A;  4MLW A;  3DF0 B;  2F2O A;  2BBM A;  1DTL A;  1JF0 A;  3OX5 A;  2JZI A;  4P5O E;  1KFX S;  1BOD A;  1CDP A;  1J7O A;  2KGB C;  2KQY A;  2KYC A;  2IS9 A;  1NWD A;  2MJW B;  4GUK A;  1JFK A;  1EH2 A;  1GGW A;  1MF8 B;  1K96 A;  2BCX A;  1TNX A;  1PUL A;  1ZAC A;  4NDC A;  1KFU L;  1OSA A;  2BKH B;  2LMU A;  1MXL C;  5AFP A;  1B9A A;  1JBA A;  1EJ3 A;  4NQG A;  1UHJ A;  2CBL A;  2LUC A;  3I5G B;  1DJZ A;  4YGD B;  1PVA A;  3VRR A;  1IH0 A;  1XFY O;  2H2K A;  1QJT A;  1SW8 A;  2CXJ A;  2WC8 A;  3DD4 A;  4XYN A;  5J3X A;  1WDC C;  2ZND A;  2K2F A;  2LHI A;  3FWC A;  3VRO A;  5I2L A;  2LAN A;  2MLF C;  4NDD A;  1CTR A;  2OTG B;  2V53 A;  1V1G A;  4HRH A;  1WRZ A;  4OKH A;  1C7V A;  1NP8 A;  1QS7 A;  1B8C A;  1Y1X A;  1ALV A;  2I18 A;  2HQW A;  2L50 A;  2PMY A;  1NCX A;  1SCV A;  1J55 A;  3O2P A;  2KI4 B;  1RWY A;  4P2Y B;  4ORC B;  4AQI A;  1S6I A;  3OB2 B;  4PHJ A;  3EK4 A;  2ISD A;  4CFQ A;  3LK1 A;  4YI8 A;  1DJH A;  3KO0 A;  1EL4 A;  3D0Y A;  4OV2 A;  5B8I B;  2AUC A;  2BE6 A;  2LLS A;  3BUW B;  1QX7 A;  2LMV A;  1CM1 A;  1YUS A;  1OZO A;  4I5K A;  3PM8 A;  1NIW A;  2M1K B;  2ZN9 A;  3KPX A;  3JVT C;  3BXK A;  1IQ3 A;  4TNC A;  3EK8 A;  3I5I C;  1QAT A;  1J7P A;  1YUT A;  5HKZ A;  1KCY A;  1CMG A;  2PAS A;  5K89 A;  3EKH A;  1YVH A;  4WQ2 A;  2EC6 B;  3CZT X;  4JPZ B;  1F4Q A;  5CPV A;  3AKA A;  3NXA A;  1NX3 A;  2LVJ A;  4C0K A;  2NCP A;  3A8R A;  2BL0 B;  1LIN A;  4CID A;  3WHT B;  4MZL A;  1LXF C;  1XFU O;  3BUX B;  5I2O A;  4PE7 A;  1SMG A;  1TOP A;  3NSO A;  3EK7 A;  1TIZ A;  1B7T Z;  1F8H A;  3KEV A;  4CLN A;  1CFF A;  3CLN A;  3GOF A;  4DRW A;  1G8I A;  1IKU A;  3OX6 A;  2FJU B;  1FI5 A;  1QLK A;  1WRL A;  2F3Z A;  2KDH A;  4Q04 A;  1DJI A;  1SBJ A;  1LA0 A;  3TUY B;  3TZ1 A;  1CFP A;  4PHN A;  2JRF A;  1CLM A;  3H4S E;  3OHM B;  2ZNE A;  2JT8 A;  4A4B A;  2L5X B;  4PE1 A;  1NSH A;  2JQ6 A;  1RK9 A;  2H61 A;  2M7N A;  3JTD C;  2JNX A;  4YRU A;  1K90 D;  1U5I B;  2LM5 A;  3LLE A;  1J1D A;  5DKR A;  1JUO A;  4OCI A;  1EXR A;  2KFH A;  4JWQ A;  1DF0 B;  2LV7 A;  4DCK A;  2KI6 C;  2Y1M A;  2CT9 A;  1UHN A;  2GGZ A;  1OMV A;  1PSR A;  5HKW A;  1E8A A;  2MAZ A;  1S5G Y;  2Q4U A;  1IWQ A;  1L2O C;  5PAL A;  4AOM A;  4A4C A;  4D1E A;  1Y6W A;  3IQO A;  1H8B A;  1CLL A;  1M63 B;  2K7B A;  3IF7 A;  2ZRT A;  1YVL A;  5CSJ A;  4YGE B;  1PSB A;  2KAY A;  4I5J A;  1QIW A;  2WOR A;  3BUM B;  1WDC B;  2JTZ A;  2TN4 A;  3K21 A;  1CNP A;  2ZKM X;  1CFC A;  1YUU A;  3LCP C;  5JOL A;  3BUN B;  1K2H A;  2K7C A;  3LL8 B;  1F54 A;  1DJY A;  1HT9 A;  1REC A;  2FCD A;  2AMI A;  5DKQ A;  1EG4 A;  1S26 D;  2H61 C;  3KHE A;  1S6C A;  2JU0 A;  1XFX O;  3A4U B; 
#chains in the Genus database with same CATH topology
 1OW4 A;  1PK0 D;  3BFB A;  3CR4 X;  3PLF B;  1KFU S;  3SG6 A;  1B4C A;  4GGN A;  4IL1 A;  3AAK A;  1CB1 A;  1KQV A;  2HPS A;  3RLZ A;  3SJS A;  2WCE A;  2JOJ A;  1UHK A;  1QX5 B;  1YRU B;  2ERB A;  1QVI Z;  2F33 A;  1D1O A;  5CSF A;  2KGR A;  1CKK A;  3CGA A;  1K95 A;  4USL A;  4KYN A;  1CDL A;  2KFG A;  3JVT B;  4FTG A;  3CZ0 A;  5I8N A;  1WLZ A;  4OR9 B;  3VB1 A;  4MBE A;  3I5I B;  4HRG A;  1DC1 A;  3WHU B;  2M0R A;  2WCH A;  1MWN A;  5HKY A;  1N65 A;  1Y1A A;  4DUQ A;  1IQ5 A;  1CFD A;  3IQQ A;  2JNF A;  2JT0 A;  2LCP A;  2M49 B;  3R1V A;  1UUR A;  1PAL A;  2BAP A;  1TNQ A;  2G9B A;  5ER4 X;  1NCZ A;  1JF2 A;  2O60 A;  2KYF A;  1K8U A;  2JWW A;  3EVR A;  5I2Q A;  1XFV O;  2OS8 C;  5G08 A;  3D75 A;  2QEH A;  4PE4 A;  1F71 A;  1DT7 B;  4CPV A;  1J7R A;  2ZFD A;  2FOT A;  2NZ0 A;  1GGZ A;  3PSR A;  5D7F A;  4DS7 A;  4ETO A;  2PRU A;  4GNK B;  1UWO A;  1ZOT B;  3O6B A;  1B47 A;  2BNX A;  3O4Y A;  3DVE A;  4DIR A;  1QIV A;  4M2Q A;  2KAV A;  2WCB A;  3D0Y B;  5HLV A;  1G4Y R;  1XFW O;  3BOW A;  1QV1 A;  2ZN8 A;  3AKB A;  3BUO B;  1A29 A;  2M29 A;  4JKT A;  4C0J A;  3I5H C;  1K93 D;  2D8N A;  3TS5 C;  2R2I A;  4CFR A;  2K8M B;  2JUL A;  1CM4 A;  4GBA A;  4YGB B;  1SRA A;  2RGI A;  3CR2 A;  5CSI A;  2JXL A;  3S0A A;  4XJK A;  2PQL A;  3DY9 A;  1LVC D;  2K60 A;  2K7O A;  3JTD B;  3D10 A;  3D77 A;  4YBH B;  2M7L A;  3ZNI A;  4E68 A;  2KLE A;  2E6W A;  1NX0 A;  1TCF A;  1FF1 A;  3EVU A;  1DJW A;  3SS4 A;  4QJ5 B;  2QEO A;  4MRY A;  4UPG A;  3FE8 A;  5F6T A;  1A4P A;  1CDN A;  3NSK A;  1EG3 A;  1QLS A;  3DVK A;  1NUB A;  3VGO A;  1SK6 D;  1TN4 A;  2HQ8 A;  2QDI A;  1H4B A;  2WC6 A;  3HX4 A;  3PAT A;  2E30 A;  1AJ4 A;  1XA5 A;  2SCP A;  4HSZ A;  1L2O B;  1XK4 A;  2KBI A;  3B7A A;  2KHN A;  1YR5 A;  2GGM A;  1W7J B;  1X02 A;  2CNP A;  1KK7 Y;  4QJ4 B;  1ALW A;  3OB1 B;  1A75 A;  1MXE A;  1M31 A;  1FPW A;  1OQP A;  1SL8 A;  1TRF A;  4N5X A;  3FIA A;  1OMD A;  3AAJ A;  1BR1 B;  1DGV A;  2BCA A;  2M97 A;  3FS7 A;  2PSR A;  3PFV A;  1BJF A;  1QV0 A;  1UUS A;  4YGA A;  4NDB A;  2K0J A;  1KQM C;  3PN7 C;  1DGU A;  4AQJ A;  2VRG A;  4GFT A;  2L2C A;  5BPJ A;  1TCO B;  1C07 A;  5FI6 A;  1SCM C;  1NPQ A;  2LMT A;  4HRE E;  3B86 A;  2A4J A;  2JC2 A;  2M8U A;  4M2P A;  3VRN A;  3CS1 A;  5FYX A;  1AJ5 A;  2KAX A;  1F55 A;  2LUX A;  2K7D A;  2LLT A;  2PYQ A;  3CZ1 A;  3CWG A;  2WCK A;  3BYA A;  1S6J A;  2LC5 A;  3CTN A;  1XK4 C;  1S3P A;  1YTZ C;  2JXC A;  1N0Y A;  2CTN A;  4GPL B;  1WLM A;  3BJH A;  3DVM A;  1N2D A;  2F2P A;  5FI2 A;  2L2E A;  2PAL A;  5D69 A;  1BU3 A;  1F70 A;  2P70 A;  4MVF A;  2LHL A;  3CAB A;  3ZWH A;  2BCB A;  3SIA A;  1SL7 A;  2WND A;  2MBX A;  5ER5 A;  4I5N B;  1B8L A;  3L4L A;  4N1F A;  1RFJ A;  1Z4H A;  1XFR A;  4MSP A;  2LP2 A;  3O78 A;  5HLO A;  3VRP A;  1K9K A;  3HCM A;  2G2B A;  3CDN A;  5KTY A;  1DEK A;  1GJY A;  2YGU A;  3M0W A;  1SR6 B;  2COL B;  2OS8 B;  3GK4 X;  3I5F C;  4FQT A;  1DJG A;  5DKN A;  3QRX A;  1S36 A;  2DOQ A;  2NLN A;  4GGF A;  1MQ1 A;  2JT3 A;  2QAC A;  1KK8 C;  1K9U A;  1XYD A;  2PVB A;  1R2U A;  1K94 A;  3CYZ A;  1JFJ A;  1KWO C;  2L51 A;  4PT1 A;  5I94 A;  1R6P A;  3DF0 A;  1HQV A;  1XFZ O;  4F0Z B;  2LVK A;  2CCM A;  1C3Y A;  1SY9 A;  1XVJ A;  3CZ2 A;  3EKJ A;  3I5H B;  2HET A;  2HF5 A;  3BFA A;  3TS5 B;  1KFX L;  1ZMZ A;  3MSE B;  2JPT A;  2L98 A;  2P71 A;  1AHR A;  3WNX B;  2L4I A;  2LNK A;  2L4H A;  4WRI A;  1JWD A;  5TNC A;  1CLB A;  2LE9 B;  1IRJ A;  1OE9 B;  2LVV A;  3D76 A;  1IG5 A;  4MZJ A;  3NGV A;  4PAL A;  1BF5 A;  1UHH A;  1M39 A;  1F4O A;  3S0D A;  1SR6 C;  1IJ6 A;  1OMR A;  3GK1 A;  3WXA A;  1TNP A;  1A2X A;  3C1V A;  3SG5 A;  3TDU A;  5HL1 A;  3TDI A;  1S5G Z;  1WY9 A;  1B7T Y;  1W7I B;  4BY4 A;  4MZK A;  3D78 A;  1KSO A;  3DZT A;  3OP0 A;  4GGF C;  2K2A A;  2KSP A;  3K1E A;  2M1U A;  3NSL A;  4PDZ A;  4BY5 A;  4C0L A;  5KSZ A;  2P6B B;  3PJI A;  2NCO A;  3E3R A;  4L9M A;  1KSM A;  3B6X A;  4R1E A;  2WCF A;  1QTX A;  1QAS A;  1ZFS A;  1RJV A;  1SKT A;  1RTP 1;  3BOW B;  1NCY A;  1OOI X;  1ZUZ A;  3V2L A;  3SS3 A;  3S0E A;  3SIB A;  4MN0 A;  1BT6 A;  2Y1N A;  1YUR A;  1ORG A;  2Y4Q A;  4OVN F;  2KOT A;  2LLU A;  4N1G A;  1VRK A;  3F45 A;  2KQ6 A;  1SPY A;  3GK2 A;  1LKJ A;  3SG3 A;  1DQE A;  1GQM A;  4XJK B;  1JSA A;  3D74 A;  1DVI A;  1K9P A;  4M2O A;  3SG7 A;  2K61 A;  3NHT A;  1OZS A;  1P28 A;  4MEW A;  2BBN A;  1KQM B;  2KBM A;  3LK0 A;  3PN7 B;  1M46 A;  4PHK A;  1J7Q A;  1FW4 A;  1IJ5 A;  4PCW A;  3I5G C;  1MHO A;  1SCM B;  1FBV A;  1B1G A;  2KNE A;  3IVT A;  3BQ3 A;  1WRK A;  2BEC A;  4PHM A;  4I5L B;  1BOC A;  2I2R E;  4ZCV A;  1L7Z A;  2AAO A;  3R72 A;  2OPO A;  4YGC B;  1TNW A;  1XO5 A;  1B8R A;  4INW A;  4PE0 A;  4U8D A;  5HYD A;  1QX2 A;  2MRD A;  3KF9 A;  2MLE C;  1NX1 A;  2LVI A;  1Y1U A;  2OTG C;  2JTT A;  2LAP A;  3SG4 A;  1AVS A;  1A75 B;  5AEQ A;  1A03 A;  2ZRS A;  3UNW A;  2KI4 C;  3VRQ A;  1IGV A;  2SAS A;  1G33 A;  1MUX A;  3ICB A;  4GAO A;  2B1U A;  4IJ7 A;  5AXI A;  1YX8 A;  2I7A A;  5FI7 A;  1BLQ A;  3PM2 A;  1CMF A;  1IIO A;  3NSI A;  2MA2 A;  3I5F B;  1DMO A;  2M9G A;  1QXP A;  2KI6 D;  3DVJ A;  2GV5 A;  4YI9 A;  1KK8 B;  2O5G A;  3PAL A;  1QVI Y;  1JC2 A;  3OGN A;  3EVV A;  1TUJ A;  1TTX A;  1BG1 A;  1KWO B;  1UP5 A;  1PVB A;  1V1F A;  5CSN A;  1OOG A;  3DYE A;  2EGD A;  2WOS A;  2EC6 C;  2MHH A;  1OOF A;  1LA3 A;  1Y0V H;  2I94 A;  2QPT A;  3CR5 X;  1U5I A;  1AP4 A;  3R1P A;  2KFF A;  2BE4 A;  1PRW A;  1YRT B;  1SYM A;  1SL9 A;  1UHI A;  3FWB A;  1BR4 B;  2Q91 A;  2BL0 C;  4MRX A;  2F8P A;  5GQQ C;  2F3Y A;  2NXQ A;  5JJG A;  1DF0 A;  1OOJ A;  3NHI A;  2M3W A;  1DEL A;  3N7H A;  5AAN A;  3SG2 A;  5IBW A;  1S1E A;  2LP3 A;  1RRO A;  5AER A;  1SNL A;  2FCE A;  4ORA B;  1C7W A;  1Q80 A;  3S0B A;  4JQ0 D;  2Y5I A;  1YX7 A;  2BKI B;  2QEB A;  1MR8 A;  3TDZ A;  4WQ3 A;  4ZCU A;  4ORB B;  1NX2 A;  1AUI B;  2L0P A;  1CDM A;  1C3Z A;  1DJX A;  4JD9 A;  3RM1 A;  4F7F A;  3TUY C;  1ODB A;  1AK8 A;  1J1E A;  3D73 A;  1BMO A;  5DIC A;  1KK7 Z;  1FI6 A;  2EHB A;  1M45 A;  3Q8I A;  4FQO A;  4ICB A;  1NYA A;  4QJ3 B;  3SS5 A;  5KU1 A;  4MLW A;  3DF0 B;  2F2O A;  2BBM A;  1DTL A;  1JF0 A;  3OX5 A;  1LS8 A;  2JZI A;  1KFX S;  4P5O E;  1CDP A;  1BOD A;  1J7O A;  1SSE B;  2KGB C;  2KQY A;  2KYC A;  2IS9 A;  3L47 A;  1NWD A;  2MJW B;  4GUK A;  1JFK A;  1EH2 A;  1GGW A;  1MF8 B;  1K96 A;  1TNX A;  2BCX A;  1PUL A;  1ZAC A;  4NDC A;  1KFU L;  1OSA A;  2BKH B;  2LMU A;  1MXL C;  5AFP A;  1B9A A;  1JBA A;  1EJ3 A;  4NQG A;  1UHJ A;  2CBL A;  2KLD A;  2LUC A;  3I5G B;  1DJZ A;  4YGD B;  1PVA A;  3VRR A;  3S0F A;  1XFY O;  1IH0 A;  2H2K A;  1QJT A;  1SW8 A;  2CXJ A;  2WC8 A;  3DD4 A;  4XYN A;  5J3X A;  1WDC C;  5EL2 A;  2ZND A;  2K2F A;  2LHI A;  3FWC A;  3VRO A;  5I2L A;  2LAN A;  2MLF C;  4NDD A;  1CTR A;  3UO9 A;  2OTG B;  2V53 A;  1V1G A;  4HRH A;  1WRZ A;  4OKH A;  1C7V A;  1NP8 A;  1QS7 A;  1B8C A;  1Y1X A;  1ALV A;  2I18 A;  2HQW A;  2L50 A;  2PMY A;  1NCX A;  1SCV A;  1J55 A;  3O2P A;  2KI4 B;  1RWY A;  4P2Y B;  4ORC B;  4AQI A;  1S6I A;  3OB2 B;  4PHJ A;  3EK4 A;  2KPH A;  2ISD A;  4CFQ A;  3LK1 A;  4YI8 A;  1DJH A;  3KO0 A;  1EL4 A;  3D0Y A;  4OV2 A;  5B8I B;  2AUC A;  2BE6 A;  2LLS A;  1GM0 A;  3BUW B;  1QX7 A;  2LMV A;  1CM1 A;  1YUS A;  1OZO A;  4I5K A;  3PM8 A;  1NIW A;  2M1K B;  2ZN9 A;  3KPX A;  3JVT C;  3B87 A;  3BXK A;  1IQ3 A;  4TNC A;  3EK8 A;  3I5I C;  1QAT A;  1J7P A;  1YUT A;  2WCM A;  2GTE A;  5HKZ A;  1KCY A;  1OOH A;  1CMG A;  2PAS A;  5K89 A;  3EKH A;  1YVH A;  3OBV A;  4WQ2 A;  2EC6 B;  3CZT X;  2FJY A;  1F4Q A;  4JPZ B;  2QEV A;  5CPV A;  3AKA A;  3NXA A;  1NX3 A;  2LVJ A;  3O4X A;  3R1O A;  2H8V A;  4C0K A;  3FE9 A;  2L5Y A;  2NCP A;  3A8R A;  2BL0 B;  1LIN A;  4CID A;  3WHT B;  4MZL A;  1LXF C;  1XFU O;  3BUX B;  5I2O A;  4PE7 A;  1SMG A;  1TOP A;  3NSO A;  3EK7 A;  1TIZ A;  1B7T Z;  1F8H A;  3KEV A;  4CLN A;  1W9Z A;  1T14 A;  3B88 A;  3CLN A;  3GOF A;  4DRW A;  1CFF A;  1G8I A;  1IKU A;  3OX6 A;  4OZD A;  2FJU B;  1TUZ A;  1FI5 A;  1QLK A;  3FE6 A;  2JPO A;  1WRL A;  2F3Z A;  2KDH A;  4Q04 A;  1DJI A;  1SBJ A;  1LA0 A;  3TUY B;  3TZ1 A;  1CFP A;  4PHN A;  3BFH A;  2JRF A;  1CLM A;  3H4S E;  3OHM B;  2ZNE A;  3L4A A;  2JT8 A;  4A4B A;  2L5X B;  1QWV A;  4PE1 A;  1NSH A;  2JQ6 A;  1RK9 A;  2H61 A;  2M7N A;  5D3O A;  3JTD C;  2JNX A;  4YRU A;  1TWO A;  1K90 D;  2WCL A;  3RZS A;  1U5I B;  2LM5 A;  3LLE A;  1J1D A;  5DKR A;  1JUO A;  4OCI A;  1EXR A;  2KFH A;  4JWQ A;  1Z2C B;  1DF0 B;  2LV7 A;  4DCK A;  2KI6 C;  2Y1M A;  2CT9 A;  2WCJ A;  1UHN A;  2GGZ A;  1OMV A;  1PSR A;  5HKW A;  1E8A A;  2MAZ A;  1S5G Y;  2Q4U A;  1IWQ A;  1L2O C;  5PAL A;  4AOM A;  4A4C A;  4D1E A;  1Y6W A;  3QME A;  3IQO A;  1H8B A;  1CLL A;  1M63 B;  2K7B A;  3IF7 A;  2ZRT A;  2WC5 A;  1YVL A;  5CSJ A;  4YGE B;  1PSB A;  2KAY A;  4I5J A;  3EG5 B;  1QIW A;  2WOR A;  3BUM B;  1WDC B;  3S0G A;  2JTZ A;  2TN4 A;  3K21 A;  1CNP A;  2ZKM X;  1CFC A;  1YUU A;  3LCP C;  5JOL A;  3BUN B;  1K2H A;  3DXL A;  2K7C A;  3LL8 B;  4INX A;  1F54 A;  1DJY A;  1HT9 A;  1REC A;  2FCD A;  2AMI A;  5DKQ A;  1EG4 A;  1S26 D;  2H61 C;  3KHE A;  1S6C A;  2JU0 A;  1XFX O;  3A4U B; 
#chains in the Genus database with same CATH homology
 3CR4 X;  1PK0 D;  3SG6 A;  3PLF B;  1KFU S;  1B4C A;  4GGN A;  4IL1 A;  3AAK A;  1CB1 A;  1KQV A;  2HPS A;  3RLZ A;  3SJS A;  2WCE A;  2JOJ A;  1UHK A;  1QX5 B;  1YRU B;  1QVI Z;  2F33 A;  1D1O A;  5CSF A;  2KGR A;  1CKK A;  3CGA A;  1K95 A;  4USL A;  1CDL A;  2KFG A;  3JVT B;  4FTG A;  5I8N A;  1WLZ A;  4OR9 B;  4MBE A;  3I5I B;  4HRG A;  3WHU B;  2M0R A;  1MWN A;  5HKY A;  1N65 A;  1Y1A A;  4DUQ A;  1IQ5 A;  1CFD A;  3IQQ A;  2JNF A;  2JT0 A;  2LCP A;  2M49 B;  1UUR A;  1PAL A;  2G9B A;  1TNQ A;  5ER4 X;  1NCZ A;  1JF2 A;  2O60 A;  2KYF A;  1K8U A;  2JWW A;  3EVR A;  5I2Q A;  1XFV O;  2OS8 C;  5G08 A;  4PE4 A;  1F71 A;  1DT7 B;  4CPV A;  1J7R A;  2ZFD A;  2FOT A;  2NZ0 A;  1GGZ A;  3PSR A;  5D7F A;  4DS7 A;  4ETO A;  2PRU A;  4GNK B;  1UWO A;  1ZOT B;  3O6B A;  1B47 A;  3O4Y A;  3DVE A;  4DIR A;  1QIV A;  4M2Q A;  2KAV A;  2WCB A;  3D0Y B;  5HLV A;  1G4Y R;  1XFW O;  3BOW A;  1QV1 A;  2ZN8 A;  3AKB A;  3BUO B;  1A29 A;  2M29 A;  4C0J A;  3I5H C;  1K93 D;  2D8N A;  3TS5 C;  2R2I A;  4CFR A;  2K8M B;  2JUL A;  1CM4 A;  4GBA A;  4YGB B;  1SRA A;  2RGI A;  3CR2 A;  5CSI A;  2JXL A;  4XJK A;  1LVC D;  2K7O A;  3JTD B;  3D10 A;  4YBH B;  2M7L A;  3ZNI A;  4E68 A;  2E6W A;  1NX0 A;  1TCF A;  1FF1 A;  3EVU A;  1DJW A;  4QJ5 B;  4MRY A;  4UPG A;  5F6T A;  1A4P A;  1CDN A;  3NSK A;  1EG3 A;  1QLS A;  3DVK A;  1NUB A;  3VGO A;  1SK6 D;  1TN4 A;  2HQ8 A;  1H4B A;  3HX4 A;  3PAT A;  2E30 A;  1AJ4 A;  1XA5 A;  2SCP A;  4HSZ A;  1L2O B;  1XK4 A;  2KBI A;  2KHN A;  1YR5 A;  2GGM A;  1W7J B;  1X02 A;  2CNP A;  1KK7 Y;  4QJ4 B;  1ALW A;  3OB1 B;  1A75 A;  1MXE A;  1M31 A;  1FPW A;  1OQP A;  1SL8 A;  1TRF A;  4N5X A;  3FIA A;  1OMD A;  3AAJ A;  1BR1 B;  1DGV A;  2BCA A;  2M97 A;  3FS7 A;  2PSR A;  3PFV A;  1BJF A;  1QV0 A;  1UUS A;  4YGA A;  4NDB A;  2K0J A;  1KQM C;  3PN7 C;  1DGU A;  4AQJ A;  2VRG A;  4GFT A;  5BPJ A;  1C07 A;  1TCO B;  1SCM C;  1NPQ A;  2LMT A;  4HRE E;  2A4J A;  2JC2 A;  2M8U A;  4M2P A;  3VRN A;  3CS1 A;  5FYX A;  1AJ5 A;  2KAX A;  1F55 A;  2LUX A;  2K7D A;  2LLT A;  3CWG A;  3BYA A;  1S6J A;  2LC5 A;  3CTN A;  1XK4 C;  1S3P A;  1YTZ C;  2JXC A;  1N0Y A;  2CTN A;  4GPL B;  1WLM A;  3DVM A;  1N2D A;  2F2P A;  2L2E A;  2PAL A;  5D69 A;  1BU3 A;  1F70 A;  4MVF A;  2LHL A;  3ZWH A;  2BCB A;  3SIA A;  1SL7 A;  2WND A;  2MBX A;  5ER5 A;  4I5N B;  1B8L A;  4N1F A;  1RFJ A;  4MSP A;  5HLO A;  2LP2 A;  3O78 A;  3VRP A;  1K9K A;  3HCM A;  2G2B A;  5KTY A;  1GJY A;  3M0W A;  1SR6 B;  2COL B;  2OS8 B;  3GK4 X;  3I5F C;  1DJG A;  5DKN A;  3QRX A;  1S36 A;  2DOQ A;  2NLN A;  4GGF A;  1MQ1 A;  2JT3 A;  2QAC A;  1KK8 C;  1K9U A;  1XYD A;  2PVB A;  1R2U A;  1K94 A;  1JFJ A;  1KWO C;  2L51 A;  1R6P A;  3DF0 A;  1HQV A;  1XFZ O;  4F0Z B;  2LVK A;  2CCM A;  1SY9 A;  1XVJ A;  3EKJ A;  3I5H B;  2HET A;  2HF5 A;  3TS5 B;  1KFX L;  1ZMZ A;  3MSE B;  2JPT A;  2L98 A;  1AHR A;  3WNX B;  2L4I A;  2LNK A;  2L4H A;  4WRI A;  1JWD A;  5TNC A;  1CLB A;  2LE9 B;  1IRJ A;  1OE9 B;  2LVV A;  4MZJ A;  1IG5 A;  4PAL A;  1BF5 A;  1UHH A;  1M39 A;  1F4O A;  3WXA A;  1SR6 C;  1IJ6 A;  1OMR A;  3GK1 A;  1TNP A;  1A2X A;  3C1V A;  3SG5 A;  3TDU A;  3TDI A;  1S5G Z;  1WY9 A;  1B7T Y;  1W7I B;  4BY4 A;  4MZK A;  1KSO A;  4GGF C;  3OP0 A;  2K2A A;  2KSP A;  4C0L A;  2M1U A;  3NSL A;  4PDZ A;  4BY5 A;  5KSZ A;  2P6B B;  2NCO A;  3E3R A;  4L9M A;  1KSM A;  4R1E A;  2WCF A;  1QTX A;  1QAS A;  1ZFS A;  1RJV A;  1SKT A;  1RTP 1;  3BOW B;  1NCY A;  1ZUZ A;  3SIB A;  4MN0 A;  1BT6 A;  2Y1N A;  1YUR A;  2Y4Q A;  4OVN F;  2KOT A;  2LLU A;  4N1G A;  1VRK A;  3F45 A;  2KQ6 A;  1SPY A;  3GK2 A;  1LKJ A;  3SG3 A;  1GQM A;  4XJK B;  1JSA A;  1DVI A;  1K9P A;  4M2O A;  3SG7 A;  2K61 A;  1OZS A;  4MEW A;  2BBN A;  1KQM B;  2KBM A;  3LK0 A;  3PN7 B;  1M46 A;  4PHK A;  1J7Q A;  1FW4 A;  1IJ5 A;  4PCW A;  3I5G C;  1MHO A;  1SCM B;  1FBV A;  1B1G A;  2KNE A;  3BQ3 A;  1WRK A;  2BEC A;  4PHM A;  4I5L B;  1BOC A;  2I2R E;  4ZCV A;  1L7Z A;  2AAO A;  2OPO A;  4YGC B;  1TNW A;  1XO5 A;  1B8R A;  4PE0 A;  4U8D A;  5HYD A;  1QX2 A;  2MRD A;  3KF9 A;  2MLE C;  1NX1 A;  2LVI A;  1Y1U A;  2OTG C;  2JTT A;  2LAP A;  3SG4 A;  1AVS A;  1A75 B;  5AEQ A;  1A03 A;  2ZRS A;  2KI4 C;  3VRQ A;  1IGV A;  2SAS A;  1G33 A;  1MUX A;  3ICB A;  4GAO A;  2B1U A;  5AXI A;  1YX8 A;  2I7A A;  1BLQ A;  1CMF A;  3NSI A;  2MA2 A;  3I5F B;  1DMO A;  2M9G A;  1QXP A;  2KI6 D;  3DVJ A;  2GV5 A;  4YI9 A;  1KK8 B;  2O5G A;  3PAL A;  1QVI Y;  1JC2 A;  3EVV A;  1TTX A;  1BG1 A;  1KWO B;  1UP5 A;  1PVB A;  1V1F A;  5CSN A;  2EGD A;  2WOS A;  2EC6 C;  2MHH A;  1LA3 A;  1Y0V H;  2I94 A;  2QPT A;  3CR5 X;  1U5I A;  1AP4 A;  2KFF A;  2BE4 A;  1PRW A;  1YRT B;  1SYM A;  1SL9 A;  1UHI A;  3FWB A;  1BR4 B;  2Q91 A;  2BL0 C;  4MRX A;  2F8P A;  5GQQ C;  2F3Y A;  2NXQ A;  5JJG A;  1DF0 A;  1OOJ A;  5AAN A;  2M3W A;  3SG2 A;  5IBW A;  1S1E A;  2LP3 A;  1RRO A;  5AER A;  1SNL A;  2FCE A;  4ORA B;  1C7W A;  1Q80 A;  4JQ0 D;  2Y5I A;  1YX7 A;  2BKI B;  1MR8 A;  3TDZ A;  4WQ3 A;  4ZCU A;  4ORB B;  1NX2 A;  1AUI B;  2L0P A;  1CDM A;  1DJX A;  3RM1 A;  3TUY C;  1ODB A;  1AK8 A;  1J1E A;  1FI6 A;  1BMO A;  1KK7 Z;  2EHB A;  1M45 A;  4FQO A;  4ICB A;  1NYA A;  4QJ3 B;  5KU1 A;  4MLW A;  3DF0 B;  2F2O A;  2BBM A;  1DTL A;  1JF0 A;  3OX5 A;  2JZI A;  4P5O E;  1KFX S;  1BOD A;  1CDP A;  1J7O A;  2KGB C;  2KQY A;  2KYC A;  2IS9 A;  1NWD A;  2MJW B;  4GUK A;  1JFK A;  1EH2 A;  1GGW A;  1MF8 B;  1K96 A;  2BCX A;  1TNX A;  1PUL A;  1ZAC A;  4NDC A;  1KFU L;  1OSA A;  2BKH B;  2LMU A;  1MXL C;  5AFP A;  1B9A A;  1JBA A;  1EJ3 A;  4NQG A;  1UHJ A;  2CBL A;  2LUC A;  3I5G B;  1DJZ A;  4YGD B;  1PVA A;  3VRR A;  1IH0 A;  1XFY O;  2H2K A;  1QJT A;  1SW8 A;  2CXJ A;  2WC8 A;  3DD4 A;  4XYN A;  5J3X A;  1WDC C;  2ZND A;  2K2F A;  2LHI A;  3FWC A;  3VRO A;  5I2L A;  2LAN A;  2MLF C;  4NDD A;  1CTR A;  2OTG B;  2V53 A;  1V1G A;  4HRH A;  1WRZ A;  4OKH A;  1C7V A;  1NP8 A;  1QS7 A;  1B8C A;  1Y1X A;  1ALV A;  2I18 A;  2HQW A;  2L50 A;  2PMY A;  1NCX A;  1SCV A;  1J55 A;  3O2P A;  2KI4 B;  1RWY A;  4P2Y B;  4ORC B;  4AQI A;  1S6I A;  3OB2 B;  4PHJ A;  3EK4 A;  2ISD A;  4CFQ A;  3LK1 A;  4YI8 A;  1DJH A;  3KO0 A;  1EL4 A;  3D0Y A;  4OV2 A;  5B8I B;  2AUC A;  2BE6 A;  2LLS A;  3BUW B;  1QX7 A;  2LMV A;  1CM1 A;  1YUS A;  1OZO A;  4I5K A;  3PM8 A;  1NIW A;  2M1K B;  2ZN9 A;  3KPX A;  3JVT C;  3BXK A;  1IQ3 A;  4TNC A;  3EK8 A;  3I5I C;  1QAT A;  1J7P A;  1YUT A;  5HKZ A;  1KCY A;  1CMG A;  2PAS A;  5K89 A;  3EKH A;  1YVH A;  4WQ2 A;  2EC6 B;  3CZT X;  4JPZ B;  1F4Q A;  5CPV A;  3AKA A;  3NXA A;  1NX3 A;  2LVJ A;  4C0K A;  2NCP A;  3A8R A;  2BL0 B;  1LIN A;  4CID A;  3WHT B;  4MZL A;  1LXF C;  1XFU O;  3BUX B;  5I2O A;  4PE7 A;  1SMG A;  1TOP A;  3NSO A;  3EK7 A;  1TIZ A;  1B7T Z;  1F8H A;  3KEV A;  4CLN A;  1CFF A;  3CLN A;  3GOF A;  4DRW A;  1G8I A;  1IKU A;  3OX6 A;  2FJU B;  1FI5 A;  1QLK A;  1WRL A;  2F3Z A;  2KDH A;  4Q04 A;  1DJI A;  1SBJ A;  1LA0 A;  3TUY B;  3TZ1 A;  1CFP A;  4PHN A;  2JRF A;  1CLM A;  3H4S E;  3OHM B;  2ZNE A;  2JT8 A;  4A4B A;  2L5X B;  4PE1 A;  1NSH A;  2JQ6 A;  1RK9 A;  2H61 A;  2M7N A;  3JTD C;  2JNX A;  4YRU A;  1K90 D;  1U5I B;  2LM5 A;  3LLE A;  1J1D A;  5DKR A;  1JUO A;  4OCI A;  1EXR A;  2KFH A;  4JWQ A;  1DF0 B;  2LV7 A;  4DCK A;  2KI6 C;  2Y1M A;  2CT9 A;  1UHN A;  2GGZ A;  1OMV A;  1PSR A;  5HKW A;  1E8A A;  2MAZ A;  1S5G Y;  2Q4U A;  1IWQ A;  1L2O C;  5PAL A;  4AOM A;  4A4C A;  4D1E A;  1Y6W A;  3IQO A;  1H8B A;  1CLL A;  1M63 B;  2K7B A;  3IF7 A;  2ZRT A;  1YVL A;  5CSJ A;  4YGE B;  1PSB A;  2KAY A;  4I5J A;  1QIW A;  2WOR A;  3BUM B;  1WDC B;  2JTZ A;  2TN4 A;  3K21 A;  1CNP A;  2ZKM X;  1CFC A;  1YUU A;  3LCP C;  5JOL A;  3BUN B;  1K2H A;  2K7C A;  3LL8 B;  1F54 A;  1DJY A;  1HT9 A;  1REC A;  2FCD A;  2AMI A;  5DKQ A;  1EG4 A;  1S26 D;  2H61 C;  3KHE A;  1S6C A;  2JU0 A;  1XFX O;  3A4U B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...