4WQ2A

Human calpain pef(s) with (z)-3-(6-bromondol-3-yl)-2-mercaptoacrylic acid bound
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
173
structure length
173
Chain Sequence
EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calpain small subunit 1
publication title Conformationally restricted calpain inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 68
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4wq2A00
2K61A 3PM8A 2SCPA 2FCEA 2COLB 3D0YA 1UHIA 3CS1A 1SL8A 1F54A 1CDLA 3EKHA 4MZLA 1UWOA 1M31A 1DGUA 1WDCB 2D8NA 1RTP1 1CFCA 1A2XA 1Q80A 1TRFA 4MZKA 4XJKB 2JQ6A 5JJGA 1DJZA 1YURA 2PSRA 1JFJA 1S6JA 2KI4C 4NDCA 1DJHA 1QV0A 1PK0D 4YGDB 1BR1B 1BF5A 3I5FB 4IL1A 3VGOA 1AUIB 3WNXB 3OP0A 1K95A 4AQIA 1HQVA 2KHNA 2JULA 1X02A 1JUOA 3A4UB 1GGWA 3CGAA 1SRAA 5BPJA 2JWWA 5CPVA 1CDMA 1Y1UA 1DT7B 1KK7Y 1UUSA 2K7OA 1G8IA 1WRLA 3TUYB 2LMUA 4C0JA 1CDNA 4AOMA 3PLFB 1IWQA 2L0PA 2OPOA 4HRGA 2KGRA 2BCBA 2JNFA 2M0RA 1M46A 1XFZO 4F0ZB 2JOJA 4C0KA 2K8MB 2NXQA 2ZNEA 2CT9A 4USLA 1M45A 1B8RA 2NCOA 3EK8A 1CLLA 2M1KB 4HSZA 2LMVA 3FWBA 4DRWA 2LVIA 1KQVA 2KI6C 1BG1A 1KWOB 4GPLB 4DS7A 1E8AA 4WQ2A 1KK7Z 1JC2A 5KU1A 4E68A 2BE6A 1JF2A 1EL4A 1GQMA 1A75A 3I5HC 3PALA 1B4CA 4Q04A 3EK4A 3BUXB 2I2RE 3M0WA 2LLUA 1NX3A 2OTGB 3RLZA 2ZRSA 3CR5X 1XVJA 2KBMA 3PSRA 1ZMZA 2LM5A 1XFVO 1EG3A 1QTXA 4M2OA 5KTYA 2SASA 4OKHA 4GGNA 1BMOA 1N2DA 2M29A 1UHNA 1NX2A 2Y1NA 2IS9A 5AERA 2KI6D 3PN7B 1J7QA 2K2FA 2ISDA 2P6BB 1IH0A 3LL8B 1PULA 1OZSA 1V1FA 2JT8A 5AFPA 4NQGA 1OSAA 2LC5A 1XO5A 1G4YR 2JZIA 4HREE 1PVAA 1KSOA 2JC2A 3DD4A 1DTLA 2MHHA 2F2OA 2NLNA 4A4BA 1IJ6A 3IQQA 1CLBA 4PE0A 3CZTX 2KSPA 2I94A 2LLSA 1CMGA 4C0LA 1TIZA 1QJTA 4PHJA 2CBLA 2BE4A 1J55A 1K9KA 1WRKA 4MRYA 1U5IA 5I2QA 4CLNA 1WRZA 3OHMB 4PCWA 1QIWA 1MWNA 2F2PA 1W7JB 2L2EA 1S1EA 3LLEA 1WLMA 2LNKA 3O78A 1DMOA 1AJ4A 4CPVA 2E6WA 2JU0A 4FQOA 2L51A 1SY9A 1ZACA 3BOWA 1OOJA 1K90D 2CTNA 1V1GA 2I18A 3HX4A 3PATA 1J7OA 1BODA 1Y1AA 3E3RA 1C7WA 4MEWA 4CIDA 2LE9B 1A4PA 3GK4X 1F4QA 1K8UA 2GGZA 1CNPA 3I5GB 1IQ3A 1FF1A 2MJWB 5D7FA 4I5JA 4ZCVA 1QASA 5I2OA 1C07A 1XFXO 3JVTC 2WOSA 3LCPC 1KFXS 3DF0B 3BQ3A 1WLZA 5JOLA 1Y0VH 4MN0A 1CLMA 1UHHA 3TDIA 3JTDB 2O60A 2M97A 2LAPA 3CR2A 1RK9A 1YX7A 2M7NA 3ICBA 1F55A 1SCMB 2EC6C 2LCPA 2B1UA 2H2KA 1J7PA 1NYAA 2JTTA 2QPTA 3D10A 1SCVA 2ZN9A 2EHBA 4N5XA 3QRXA 2HF5A 4I5NB 2KFFA 1F71A 1CM1A 2K2AA 3DVKA 3VROA 1CKKA 1S36A 1YUTA 2FCDA 2LLTA 1QATA 4GUKA 2KQ6A 3CTNA 1NSHA 1PSRA 3A8RA 2NCPA 1PRWA 3OX6A 3SG2A 2HETA 2KI4B 2BBMA 3D0YB 1IJ5A 1ZFSA 2WNDA 4PE4A 1IG5A 1MXLC 4MSPA 2MLEC 3BUMB 5HLOA 4YI9A 5B8IB 1XA5A 4ZCUA 4MBEA 1HT9A 4XYNA 1NCZA 3F45A 1W7IB 1J1EA 1KFUS 3I5IC 1OMDA 2BL0C 3SG5A 3KF9A 1DJGA 4FTGA 4JPZB 4OCIA 1AK8A 4WRIA 2O5GA 1D1OA 4N1GA 1VRKA 3O6BA 3SIAA 3ZWHA 2MLFC 5G08A 2BKIB 1A29A 1KQMC 4P5OE 1CTRA 3BUNB 1SR6C 3EVVA 4CFRA 4QJ4B 1XFWO 1TNPA 1MQ1A 1GJYA 2A4JA 1L2OC 2BCAA 2M8UA 2PVBA 4PHMA 1F70A 1RROA 1NPQA 1TNWA 1YVLA 2JT3A 1UURA 2KOTA 5GQQC 1BOCA 1RFJA 1XK4A 3AAKA 4JWQA 4YGCB 1TCOB 3KEVA 1MHOA 1DF0A 2JNXA 3SG7A 4CFQA 1H8BA 3I5HB 2PASA 2DOQA 2Q91A 3NSOA 1JSAA 2E30A 4PALA 2F33A 1BLQA 2CNPA 1TOPA 3NSIA 5AXIA 1XK4C 1QVIY 1PALA 4ORCB 4PHNA 2PMYA 2V53A 3VRPA 1SPYA 2ZNDA 3TS5C 3EVRA 5CSIA 3PFVA 1B9AA 1A75B 2F8PA 3LK1A 1KSMA 1EXRA 1KFXL 4QJ3B 1TNXA 5DKNA 3FIAA 2LVVA 3K21A 3IQOA 1B1GA 1GGZA 4HRHA 1YX8A 1B47A 1LA0A 1SKTA 2JPTA 4OVNF 4U8DA 3GK2A 4YGBB 3SG4A 1CFPA 1TTXA 2G9BA 2ZRTA 1CFFA 4YRUA 1S6CA 3WXAA 2NZ0A 3NSKA 2CCMA 4GFTA 3CWGA 5IBWA 1QVIZ 1DGVA 5AANA 2MA2A 4YGAA 4DUQA 4QJ5B 2KAYA 5I8NA 3SG3A 4UPGA 2KQYA 1BU3A 2MAZA 1YRUB 4YI8A 3OB1B 1AHRA 1J1DA 3TZ1A 1R6PA 1NIWA 3O4YA 1M39A 2K7CA 4D1EA 1JF0A 2Y4QA 1ODBA 2PALA 1U5IB 5KSZA 4YBHB 1YUSA 3VRNA 2OS8C 1N0YA 1K9UA 5ER4X 2GV5A 1KFUL 4BY5A 1WY9A 1OMVA 1SW8A 3GOFA 3FS7A 5F6TA 1UP5A 2JT0A 1MR8A 2KAVA 3CLNA 3NXAA 3IF7A 4R1EA 1K94A 1NCYA 3BOWB 1BT6A 1LKJA 1OQPA 2AUCA 2JRFA 4MLWA 5DKQA 3JVTB 1K93D 2BKHB 1QLKA 1FW4A 3TDUA 3BUOB 4XJKA 1NP8A 4OR9B 1QS7A 2EGDA 3SJSA 1QXPA 2L4HA 2HQWA 1A03A 3KPXA 2KYFA 1AVSA 5HKWA 2QACA 1KK8C 5HLVA 2M1UA 2EC6B 1S5GY 5AEQA 1QV1A 2Y5IA 1Y6WA 2LP3A 1WDCC 1NWDA 1IKUA 4MVFA 4TNCA 1L7ZA 1FI6A 1YVHA 1CMFA 1Y1XA 1FBVA 3EVUA 3EKJA 3H4SE 1BJFA 1IGVA 4WQ3A 5FYXA 1S3PA 1EJ3A 1YRTB 2FOTA 5CSFA 3SIBA 2LV7A 2Q4UA 3I5FC 2BCXA 3OX5A 1PVBA 2K0JA 2LHIA 1OE9B 4NDBA 1QLSA 2KFGA 3AAJA 1K9PA 1S5GZ 4PDZA 1LA3A 1JBAA 1ZUZA 2TN4A 1YR5A 1KCYA 3BYAA 2H61A 2LUCA 1AJ5A 3WHTB 3I5IB 2BL0B 4ORAB 3TUYC 3FWCA 2LUXA 2AMIA 1C7VA 1DJYA 4ICBA 2VRGA 1CB1A 2HPSA 1OZOA 4M2QA 1SK6D 2L50A 1H4BA 1K2HA 1KQMB 4A4CA 1SR6B 1PSBA 1NX0A 2H61C 2WCEA 3AKBA 4M2PA 1AP4A 1DVIA 1L2OB 2M9GA 2KNEA 1DJIA 1KWOC 1IRJA 4GBAA 1BR4B 1S6IA 1NX1A 4DCKA 1F8HA 2WCBA 3WHUB 1S26D 2AAOA 4I5KA 1ZOTB 3MSEB 3TDZA 1TNQA 1RWYA 1SL7A 1B7TY 4PHKA 1QX5B 1FI5A 2OTGC 1NCXA 2LVKA 1UHKA 2L4IA 1TN4A 1DJXA 4P2YB 2CXJA 2FJUB 2LP2A 3CR4X 4N1FA 1UHJA 1DJWA 4GNKB 2PRUA 2WC8A 1M63B 2M7LA 1CFDA 2ZN8A 2GGMA 3LK0A 5HYDA 2F3YA 3BXKA 2LANA 3PN7C 5TNCA 3TS5B 3DVJA 1DF0B 4ETOA 1MUXA 2KFHA 2BBNA 2M49B 2Y1MA 4PE1A 4JQ0D 3RM1A 5HKYA 1RECA 4PE7A 2JXLA 2WORA 1JFKA 1SYMA 3KO0A 1YUUA 1B7TZ 2R2IA 3DVEA 3NSLA 3O2PA 4GGFA 2KGBC 4L9MA 1B8LA 5K89A 2K7BA 1G33A 1QX2A 1LVCD 1SL9A 1J7RA 5I2LA 1EH2A 2KYCA 1RJVA 1XFUO 1SMGA 4MRXA 5CSJA 1ALVA 4NDDA 1OMRA 2L5XB 1TCFA 1SNLA 5CSNA 1MF8B 2I7AA 1JWDA 1EG4A 4GGFC 4DIRA 1CDPA 2RGIA 1MXEA 2KDHA 2HQ8A 3GK1A 3BUWB 1N65A 2K7DA 5PALA 4OV2A 3KHEA 2LMTA 2MBXA 2G2BA 4I5LB 4BY4A 5D69A 3HCMA 3OB2B 1B8CA 3DF0A 1YTZC 2OS8B 2JTZA 1CM4A 4GAOA 2LHLA 5J3XA 2KBIA 1LXFC 1XYDA 2KAXA 2ZFDA 2LVJA 3I5GC 3ZNIA 2F3ZA 5HKZA 1K96A 1FPWA 4ORBB 2M3WA 3AKAA 5DKRA 3EK7A 1SBJA 3VRRA 2MRDA 4MZJA 1QIVA 1NUBA 2ZKMX 1LINA 3VRQA 2JXCA 3JTDC 1XFYO 1R2UA 1IQ5A 1F4OA 3DVMA 1ALWA 2BECA 2WCFA 1SCMC 4YGEB 1QX7A 3C1VA 2L98A 3SG6A 1KK8B 4AQJA 5ER5A
chains in the Genus database with same CATH superfamily
2K61A 3OGNA 3PM8A 2SCPA 2FCEA 2COLB 3D0YA 1UHIA 3CS1A 1SL8A 3D73A 3FE8A 1F54A 3PM2A 1CDLA 3EKHA 4MZLA 1UWOA 1M31A 1DGUA 1WDCB 2D8NA 1RTP1 1CFCA 1A2XA 1Q80A 1TRFA 4MZKA 4XJKB 2JQ6A 5JJGA 1DJZA 1YURA 2PSRA 1JFJA 2P70A 1S6JA 3B7AA 2BNXA 2KI4C 4NDCA 1DJHA 1QV0A 1PK0D 4YGDB 3DXLA 3UO9A 1BR1B 1BF5A 3I5FB 4IL1A 3VGOA 1AUIB 3WNXB 3OP0A 5HL1A 1K95A 4AQIA 1HQVA 2KHNA 2JULA 1X02A 1JUOA 3A4UB 1GGWA 3CGAA 1SRAA 5BPJA 2JWWA 3FE9A 3EG5B 5CPVA 1CDMA 1Y1UA 1DT7B 1KK7Y 1UUSA 2K7OA 2P71A 1G8IA 1WRLA 3S0BA 3TUYB 2LMUA 4C0JA 1CDNA 3R1PA 3CZ1A 4AOMA 3PLFB 1IWQA 2L0PA 2OPOA 4HRGA 2KGRA 2BCBA 2JNFA 2M0RA 1M46A 1XFZO 4F0ZB 2JOJA 4C0KA 2K8MB 2NXQA 2ZNEA 2CT9A 4USLA 1M45A 1B8RA 2NCOA 3EK8A 1CLLA 2M1KB 4HSZA 2LMVA 3FWBA 4DRWA 2LVIA 1KQVA 2KI6C 2YGUA 3CABA 1BG1A 1KWOB 4GPLB 4DS7A 1E8AA 4WQ2A 1KK7Z 4FQTA 2ERBA 1JC2A 5KU1A 4E68A 2BE6A 1JF2A 2WCLA 1EL4A 1GQMA 3D74A 1A75A 3I5HC 3PALA 1B4CA 3NHIA 4Q04A 3EK4A 3BUXB 2I2RE 3M0WA 2LLUA 1NX3A 2OTGB 3RLZA 2ZRSA 3CR5X 2L5YA 1XVJA 2KBMA 3PSRA 1ZMZA 1OOFA 2LM5A 1XFVO 1EG3A 1QTXA 4M2OA 5KTYA 2SASA 4OKHA 4GGNA 2WCJA 1BMOA 1N2DA 2M29A 1UHNA 1NX2A 2Y1NA 2IS9A 5AERA 2KI6D 3PN7B 1J7QA 2K2FA 2ISDA 2P6BB 1IH0A 3LL8B 1PULA 1OZSA 1V1FA 2JT8A 5AFPA 1TUJA 4NQGA 1OSAA 2LC5A 1XO5A 1G4YR 2JZIA 3B6XA 4HREE 1PVAA 3K1EA 1KSOA 2JC2A 3DD4A 4OZDA 1DTLA 2MHHA 2F2OA 2NLNA 4A4BA 1IJ6A 3IQQA 3S0FA 4PE0A 3CZTX 2KSPA 1CLBA 2I94A 2LLSA 1CMGA 4C0LA 1TIZA 1Z4HA 1QJTA 2KLDA 2PQLA 4PHJA 2CBLA 2BE4A 1J55A 1K9KA 1WRKA 4MRYA 1U5IA 5I2QA 4CLNA 1WRZA 3OHMB 4PCWA 1QIWA 1MWNA 2F2PA 1W7JB 2L2EA 1S1EA 3LLEA 1WLMA 2LNKA 3O78A 1DMOA 1AJ4A 4CPVA 2E6WA 2JU0A 4FQOA 2L51A 1SY9A 1ZACA 3BOWA 2QEVA 3VB1A 1OOJA 1K90D 2CTNA 1V1GA 2I18A 3HX4A 1DC1A 3PATA 1J7OA 1BODA 1Y1AA 3E3RA 1C7WA 4MEWA 4CIDA 3L4LA 2LE9B 1OOHA 1A4PA 3GK4X 1QWVA 1F4QA 1K8UA 2GGZA 1CNPA 3I5GB 1IQ3A 1FF1A 2JPOA 2MJWB 5D7FA 4I5JA 4ZCVA 1QASA 5I2OA 1C07A 1XFXO 3JVTC 2WOSA 3LCPC 1KFXS 3DF0B 3N7HA 3BQ3A 1WLZA 3BJHA 1Y0VH 5JOLA 4MN0A 1CLMA 1UHHA 3TDIA 3SS3A 3JTDB 2O60A 2M97A 2LAPA 3CR2A 1RK9A 3D78A 1YX7A 2M7NA 3ICBA 1F55A 1SCMB 2EC6C 4INWA 2LCPA 2B1UA 2H2KA 2PYQA 1J7PA 1NYAA 2JTTA 2QPTA 3D10A 3L47A 1SCVA 2WC6A 2ZN9A 2EHBA 1OW4A 3QRXA 4N5XA 5FI2A 2HF5A 4I5NB 2KFFA 1F71A 1CM1A 2K2AA 3DVKA 3VROA 1CKKA 1S36A 1YUTA 2FCDA 2LLTA 1QATA 4GUKA 3IVTA 2KQ6A 3CTNA 1NSHA 1PSRA 3A8RA 2NCPA 1PRWA 3OX6A 3SG2A 2HETA 2KI4B 4JKTA 2BBMA 3D0YB 1IJ5A 1ZFSA 2WNDA 4PE4A 1IG5A 1MXLC 4MSPA 2MLEC 3BUMB 3CDNA 4YI9A 5HLOA 5B8IB 1XA5A 4ZCUA 4MBEA 1HT9A 4XYNA 2GTEA 1NCZA 3F45A 3V2LA 1W7IB 1J1EA 1KFUS 3I5IC 1OMDA 2BL0C 3SG5A 3KF9A 1DJGA 4FTGA 4JPZB 4OCIA 1AK8A 4WRIA 2BAPA 2O5GA 3PJIA 1D1OA 4N1GA 5I94A 1VRKA 3O6BA 3SIAA 3ZWHA 2MLFC 5G08A 2BKIB 1A29A 1KQMC 4P5OE 1CTRA 3BUNB 1SR6C 3EVVA 4CFRA 4QJ4B 1XFWO 4INXA 1C3ZA 1TNPA 1MQ1A 1GJYA 2A4JA 1L2OC 2BCAA 2M8UA 5EL2A 1DQEA 2PVBA 3D75A 4PHMA 1RROA 1NPQA 1TNWA 1YVLA 1F70A 2JT3A 1UURA 2KOTA 5GQQC 1BOCA 1RFJA 1XK4A 3AAKA 4JWQA 3FE6A 4YGCB 1TCOB 3KEVA 1MHOA 1DF0A 2JNXA 3SG7A 4CFQA 1H8BA 3I5HB 2PASA 3QMEA 2DOQA 2Q91A 3NSOA 1JSAA 2E30A 4PALA 2F33A 1BLQA 2CNPA 1TOPA 2KPHA 1T14A 3NSIA 5AXIA 1XK4C 1SSEB 1QVIY 1PALA 4ORCB 4PHNA 2FJYA 2PMYA 2V53A 3VRPA 1SPYA 5DICA 2ZNDA 3SS5A 3TS5C 3EVRA 1DELA 1LS8A 5CSIA 3PFVA 1B9AA 1A75B 2F8PA 3LK1A 1KSMA 1EXRA 1KFXL 4QJ3B 1TNXA 5DKNA 3SS4A 3FIAA 2LVVA 3K21A 3IQOA 1B1GA 1GGZA 4HRHA 1YX8A 1B47A 1LA0A 1SKTA 2JPTA 4OVNF 3DYEA 3R1VA 4U8DA 1ORGA 3GK2A 4YGBB 3SG4A 1CFPA 1TTXA 2G9BA 2ZRTA 1CFFA 4YRUA 1S6CA 3WXAA 2NZ0A 3NSKA 2CCMA 4GFTA 3CWGA 5IBWA 1QVIZ 1DGVA 5AANA 3S0AA 2MA2A 4YGAA 4DUQA 4QJ5B 2KAYA 5I8NA 3SG3A 1TUZA 3D76A 4UPGA 2KQYA 1BU3A 2MAZA 1YRUB 3O4XA 4JD9A 3Q8IA 2KLEA 3OB1B 4YI8A 1AHRA 1J1DA 1OOIX 3L4AA 3TZ1A 1R6PA 1NIWA 3O4YA 1M39A 2K7CA 4D1EA 1JF0A 3R1OA 2Y4QA 1ODBA 3R72A 4F7FA 2PALA 1IIOA 1U5IB 5KSZA 3B88A 4YBHB 1YUSA 3VRNA 2OS8C 1N0YA 1K9UA 5ER4X 2GV5A 2QEHA 1KFUL 1W9ZA 4BY5A 1WY9A 1OMVA 1SW8A 3GOFA 3FS7A 5F6TA 1UP5A 2JT0A 1MR8A 2KAVA 3CLNA 3CYZA 3IF7A 3NXAA 4R1EA 1K94A 1NCYA 3BOWB 3OBVA 1BT6A 1LKJA 1OQPA 2AUCA 2JRFA 4MLWA 5DKQA 3JVTB 1K93D 2BKHB 1QLKA 1FW4A 3TDUA 3BUOB 4XJKA 1NP8A 4OR9B 1QS7A 2EGDA 5D3OA 3SJSA 1QXPA 2L4HA 2HQWA 1A03A 3KPXA 2KYFA 1AVSA 5HKWA 3UNWA 2QACA 1KK8C 5HLVA 2M1UA 2EC6B 1S5GY 5AEQA 1QV1A 2Y5IA 1Y6WA 2LP3A 1WDCC 1NWDA 1IKUA 1P28A 4MVFA 4TNCA 1DEKA 1L7ZA 1FI6A 1YVHA 1CMFA 1Y1XA 1FBVA 3EVUA 3S0GA 3EKJA 3H4SE 1BJFA 1IGVA 3BFAA 4WQ3A 1S3PA 1EJ3A 1YRTB 2FOTA 5CSFA 5FYXA 2LV7A 3SIBA 2Q4UA 3I5FC 4PT1A 2BCXA 3OX5A 1PVBA 2K0JA 3NGVA 2LHIA 1OE9B 4NDBA 1QLSA 2KFGA 3AAJA 1K9PA 1S5GZ 4PDZA 1LA3A 1JBAA 1ZUZA 2TN4A 1YR5A 1KCYA 3BYAA 3CZ0A 3B86A 2H61A 2LUCA 1AJ5A 3BFHA 3WHTB 3I5IB 2BL0B 4ORAB 3TUYC 3FWCA 2LUXA 2AMIA 1C7VA 3CZ2A 1DJYA 4ICBA 2VRGA 1CB1A 2HPSA 1OZOA 4M2QA 2WCKA 1SK6D 2L50A 1H4BA 1K2HA 1KQMB 4A4CA 1SR6B 1PSBA 1NX0A 2H61C 2WCEA 3AKBA 4M2PA 1AP4A 1DVIA 1L2OB 2M9GA 2KNEA 2WCMA 1DJIA 1KWOC 3B87A 1IRJA 4GBAA 1BR4B 1S6IA 1NX1A 2H8VA 4DCKA 1F8HA 2WCBA 3WHUB 1S26D 2AAOA 4I5KA 1ZOTB 3MSEB 3DY9A 3S0EA 3TDZA 1TNQA 1RWYA 1SL7A 1B7TY 4PHKA 1QX5B 1FI5A 2OTGC 3BFBA 1NCXA 2LVKA 1UHKA 2L4IA 1TN4A 1DJXA 4P2YB 2CXJA 2FJUB 2LP2A 3CR4X 4N1FA 1UHJA 1DJWA 4GNKB 2PRUA 2WC8A 1M63B 2M7LA 1CFDA 2ZN8A 2GGMA 3LK0A 5HYDA 2F3YA 3BXKA 2LANA 3PN7C 5TNCA 3TS5B 3DVJA 1DF0B 4ETOA 1MUXA 2KFHA 2BBNA 2M49B 2Y1MA 4PE1A 4JQ0D 3RM1A 4KYNA 5HKYA 1RECA 4PE7A 1C3YA 2QEBA 2JXLA 2WORA 4IJ7A 1JFKA 1SYMA 2L2CA 3KO0A 3RZSA 1YUUA 1B7TZ 2R2IA 3DVEA 3NSLA 3O2PA 4GGFA 2KGBC 4L9MA 1B8LA 5K89A 1GM0A 2K7BA 1G33A 1QX2A 1LVCD 1SL9A 1J7RA 5I2LA 1EH2A 2KYCA 1RJVA 1XFUO 1SMGA 4MRXA 5CSJA 1ALVA 4NDDA 1OMRA 2L5XB 2WCHA 3S0DA 1TCFA 1SNLA 1OOGA 5CSNA 1Z2CB 1MF8B 2I7AA 1JWDA 3NHTA 1EG4A 4GGFC 4DIRA 1CDPA 2RGIA 1MXEA 2KDHA 2HQ8A 3GK1A 3DZTA 3BUWB 1N65A 2K7DA 5PALA 2QDIA 3KHEA 2LMTA 4OV2A 1TWOA 2G2BA 4I5LB 2MBXA 4BY4A 5D69A 3HCMA 3OB2B 1B8CA 3DF0A 1YTZC 1XFRA 5FI7A 2OS8B 2JTZA 1CM4A 4GAOA 2LHLA 2K60A 5J3XA 2KBIA 1LXFC 1XYDA 2KAXA 2ZFDA 2LVJA 3I5GC 3ZNIA 2F3ZA 5HKZA 1K96A 1FPWA 4ORBB 2M3WA 3AKAA 5DKRA 3EK7A 1SBJA 3D77A 5FI6A 3VRRA 2MRDA 4MZJA 1QIVA 1NUBA 2ZKMX 1LINA 3VRQA 2JXCA 3JTDC 1XFYO 1R2UA 1IQ5A 2QEOA 2WC5A 1F4OA 3DVMA 1ALWA 2BECA 2WCFA 1SCMC 4YGEB 1QX7A 3C1VA 2L98A 3SG6A 1KK8B 4AQJA 5ER5A
chains in the Genus database with same CATH topology
2K61A 3PM8A 2SCPA 2FCEA 2COLB 3D0YA 1UHIA 3CS1A 1SL8A 1F54A 1CDLA 3EKHA 4MZLA 1UWOA 1M31A 1DGUA 1WDCB 2D8NA 1RTP1 1CFCA 1A2XA 1Q80A 1TRFA 4MZKA 4XJKB 2JQ6A 5JJGA 1DJZA 1YURA 2PSRA 1JFJA 1S6JA 2KI4C 4NDCA 1DJHA 1QV0A 1PK0D 4YGDB 1BR1B 1BF5A 3I5FB 4IL1A 3VGOA 1AUIB 3WNXB 3OP0A 1K95A 4AQIA 1HQVA 2KHNA 2JULA 1X02A 1JUOA 3A4UB 1GGWA 3CGAA 1SRAA 5BPJA 2JWWA 5CPVA 1CDMA 1Y1UA 1DT7B 1KK7Y 1UUSA 2K7OA 1G8IA 1WRLA 3TUYB 2LMUA 4C0JA 1CDNA 4AOMA 3PLFB 1IWQA 2L0PA 2OPOA 4HRGA 2KGRA 2BCBA 2JNFA 2M0RA 1M46A 1XFZO 4F0ZB 2JOJA 4C0KA 2K8MB 2NXQA 2ZNEA 2CT9A 4USLA 1M45A 1B8RA 2NCOA 3EK8A 1CLLA 2M1KB 4HSZA 2LMVA 3FWBA 4DRWA 2LVIA 1KQVA 2KI6C 1BG1A 1KWOB 4GPLB 4DS7A 1E8AA 4WQ2A 1KK7Z 1JC2A 5KU1A 4E68A 2BE6A 1JF2A 1EL4A 1GQMA 1A75A 3I5HC 3PALA 1B4CA 4Q04A 3EK4A 3BUXB 2I2RE 3M0WA 2LLUA 1NX3A 2OTGB 3RLZA 2ZRSA 3CR5X 1XVJA 2KBMA 3PSRA 1ZMZA 2LM5A 1XFVO 1EG3A 1QTXA 4M2OA 5KTYA 2SASA 4OKHA 4GGNA 1BMOA 1N2DA 2M29A 1UHNA 1NX2A 2Y1NA 2IS9A 5AERA 2KI6D 3PN7B 1J7QA 2K2FA 2ISDA 2P6BB 1IH0A 3LL8B 1PULA 1OZSA 1V1FA 2JT8A 5AFPA 4NQGA 1OSAA 2LC5A 1XO5A 1G4YR 2JZIA 4HREE 1PVAA 1KSOA 2JC2A 3DD4A 1DTLA 2MHHA 2F2OA 2NLNA 4A4BA 1IJ6A 3IQQA 1CLBA 4PE0A 3CZTX 2KSPA 2I94A 2LLSA 1CMGA 4C0LA 1TIZA 1QJTA 4PHJA 2CBLA 2BE4A 1J55A 1K9KA 1WRKA 4MRYA 1U5IA 5I2QA 4CLNA 1WRZA 3OHMB 4PCWA 1QIWA 1MWNA 2F2PA 1W7JB 2L2EA 1S1EA 3LLEA 1WLMA 2LNKA 3O78A 1DMOA 1AJ4A 4CPVA 2E6WA 2JU0A 4FQOA 2L51A 1SY9A 1ZACA 3BOWA 1OOJA 1K90D 2CTNA 1V1GA 2I18A 3HX4A 3PATA 1J7OA 1BODA 1Y1AA 3E3RA 1C7WA 4MEWA 4CIDA 2LE9B 1A4PA 3GK4X 1F4QA 1K8UA 2GGZA 1CNPA 3I5GB 1IQ3A 1FF1A 2MJWB 5D7FA 4I5JA 4ZCVA 1QASA 5I2OA 1C07A 1XFXO 3JVTC 2WOSA 3LCPC 1KFXS 3DF0B 3BQ3A 1WLZA 5JOLA 1Y0VH 4MN0A 1CLMA 1UHHA 3TDIA 3JTDB 2O60A 2M97A 2LAPA 3CR2A 1RK9A 1YX7A 2M7NA 3ICBA 1F55A 1SCMB 2EC6C 2LCPA 2B1UA 2H2KA 1J7PA 1NYAA 2JTTA 2QPTA 3D10A 1SCVA 2ZN9A 2EHBA 4N5XA 3QRXA 2HF5A 4I5NB 2KFFA 1F71A 1CM1A 2K2AA 3DVKA 3VROA 1CKKA 1S36A 1YUTA 2FCDA 2LLTA 1QATA 4GUKA 2KQ6A 3CTNA 1NSHA 1PSRA 3A8RA 2NCPA 1PRWA 3OX6A 3SG2A 2HETA 2KI4B 2BBMA 3D0YB 1IJ5A 1ZFSA 2WNDA 4PE4A 1IG5A 1MXLC 4MSPA 2MLEC 3BUMB 5HLOA 4YI9A 5B8IB 1XA5A 4ZCUA 4MBEA 1HT9A 4XYNA 1NCZA 3F45A 1W7IB 1J1EA 1KFUS 3I5IC 1OMDA 2BL0C 3SG5A 3KF9A 1DJGA 4FTGA 4JPZB 4OCIA 1AK8A 4WRIA 2O5GA 1D1OA 4N1GA 1VRKA 3O6BA 3SIAA 3ZWHA 2MLFC 5G08A 2BKIB 1A29A 1KQMC 4P5OE 1CTRA 3BUNB 1SR6C 3EVVA 4CFRA 4QJ4B 1XFWO 1TNPA 1MQ1A 1GJYA 2A4JA 1L2OC 2BCAA 2M8UA 2PVBA 4PHMA 1F70A 1RROA 1NPQA 1TNWA 1YVLA 2JT3A 1UURA 2KOTA 5GQQC 1BOCA 1RFJA 1XK4A 3AAKA 4JWQA 4YGCB 1TCOB 3KEVA 1MHOA 1DF0A 2JNXA 3SG7A 4CFQA 1H8BA 3I5HB 2PASA 2DOQA 2Q91A 3NSOA 1JSAA 2E30A 4PALA 2F33A 1BLQA 2CNPA 1TOPA 3NSIA 5AXIA 1XK4C 1QVIY 1PALA 4ORCB 4PHNA 2PMYA 2V53A 3VRPA 1SPYA 2ZNDA 3TS5C 3EVRA 5CSIA 3PFVA 1B9AA 1A75B 2F8PA 3LK1A 1KSMA 1EXRA 1KFXL 4QJ3B 1TNXA 5DKNA 3FIAA 2LVVA 3K21A 3IQOA 1B1GA 1GGZA 4HRHA 1YX8A 1B47A 1LA0A 1SKTA 2JPTA 4OVNF 4U8DA 3GK2A 4YGBB 3SG4A 1CFPA 1TTXA 2G9BA 2ZRTA 1CFFA 4YRUA 1S6CA 3WXAA 2NZ0A 3NSKA 2CCMA 4GFTA 3CWGA 5IBWA 1QVIZ 1DGVA 5AANA 2MA2A 4YGAA 4DUQA 4QJ5B 2KAYA 5I8NA 3SG3A 4UPGA 2KQYA 1BU3A 2MAZA 1YRUB 4YI8A 3OB1B 1AHRA 1J1DA 3TZ1A 1R6PA 1NIWA 3O4YA 1M39A 2K7CA 4D1EA 1JF0A 2Y4QA 1ODBA 2PALA 1U5IB 5KSZA 4YBHB 1YUSA 3VRNA 2OS8C 1N0YA 1K9UA 5ER4X 2GV5A 1KFUL 4BY5A 1WY9A 1OMVA 1SW8A 3GOFA 3FS7A 5F6TA 1UP5A 2JT0A 1MR8A 2KAVA 3CLNA 3NXAA 3IF7A 4R1EA 1K94A 1NCYA 3BOWB 1BT6A 1LKJA 1OQPA 2AUCA 2JRFA 4MLWA 5DKQA 3JVTB 1K93D 2BKHB 1QLKA 1FW4A 3TDUA 3BUOB 4XJKA 1NP8A 4OR9B 1QS7A 2EGDA 3SJSA 1QXPA 2L4HA 2HQWA 1A03A 3KPXA 2KYFA 1AVSA 5HKWA 2QACA 1KK8C 5HLVA 2M1UA 2EC6B 1S5GY 5AEQA 1QV1A 2Y5IA 1Y6WA 2LP3A 1WDCC 1NWDA 1IKUA 4MVFA 4TNCA 1L7ZA 1FI6A 1YVHA 1CMFA 1Y1XA 1FBVA 3EVUA 3EKJA 3H4SE 1BJFA 1IGVA 4WQ3A 5FYXA 1S3PA 1EJ3A 1YRTB 2FOTA 5CSFA 3SIBA 2LV7A 2Q4UA 3I5FC 2BCXA 3OX5A 1PVBA 2K0JA 2LHIA 1OE9B 4NDBA 1QLSA 2KFGA 3AAJA 1K9PA 1S5GZ 4PDZA 1LA3A 1JBAA 1ZUZA 2TN4A 1YR5A 1KCYA 3BYAA 2H61A 2LUCA 1AJ5A 3WHTB 3I5IB 2BL0B 4ORAB 3TUYC 3FWCA 2LUXA 2AMIA 1C7VA 1DJYA 4ICBA 2VRGA 1CB1A 2HPSA 1OZOA 4M2QA 1SK6D 2L50A 1H4BA 1K2HA 1KQMB 4A4CA 1SR6B 1PSBA 1NX0A 2H61C 2WCEA 3AKBA 4M2PA 1AP4A 1DVIA 1L2OB 2M9GA 2KNEA 1DJIA 1KWOC 1IRJA 4GBAA 1BR4B 1S6IA 1NX1A 4DCKA 1F8HA 2WCBA 3WHUB 1S26D 2AAOA 4I5KA 1ZOTB 3MSEB 3TDZA 1TNQA 1RWYA 1SL7A 1B7TY 4PHKA 1QX5B 1FI5A 2OTGC 1NCXA 2LVKA 1UHKA 2L4IA 1TN4A 1DJXA 4P2YB 2CXJA 2FJUB 2LP2A 3CR4X 4N1FA 1UHJA 1DJWA 4GNKB 2PRUA 2WC8A 1M63B 2M7LA 1CFDA 2ZN8A 2GGMA 3LK0A 5HYDA 2F3YA 3BXKA 2LANA 3PN7C 5TNCA 3TS5B 3DVJA 1DF0B 4ETOA 1MUXA 2KFHA 2BBNA 2M49B 2Y1MA 4PE1A 4JQ0D 3RM1A 5HKYA 1RECA 4PE7A 2JXLA 2WORA 1JFKA 1SYMA 3KO0A 1YUUA 1B7TZ 2R2IA 3DVEA 3NSLA 3O2PA 4GGFA 2KGBC 4L9MA 1B8LA 5K89A 2K7BA 1G33A 1QX2A 1LVCD 1SL9A 1J7RA 5I2LA 1EH2A 2KYCA 1RJVA 1XFUO 1SMGA 4MRXA 5CSJA 1ALVA 4NDDA 1OMRA 2L5XB 1TCFA 1SNLA 5CSNA 1MF8B 2I7AA 1JWDA 1EG4A 4GGFC 4DIRA 1CDPA 2RGIA 1MXEA 2KDHA 2HQ8A 3GK1A 3BUWB 1N65A 2K7DA 5PALA 4OV2A 3KHEA 2LMTA 2MBXA 2G2BA 4I5LB 4BY4A 5D69A 3HCMA 3OB2B 1B8CA 3DF0A 1YTZC 2OS8B 2JTZA 1CM4A 4GAOA 2LHLA 5J3XA 2KBIA 1LXFC 1XYDA 2KAXA 2ZFDA 2LVJA 3I5GC 3ZNIA 2F3ZA 5HKZA 1K96A 1FPWA 4ORBB 2M3WA 3AKAA 5DKRA 3EK7A 1SBJA 3VRRA 2MRDA 4MZJA 1QIVA 1NUBA 2ZKMX 1LINA 3VRQA 2JXCA 3JTDC 1XFYO 1R2UA 1IQ5A 1F4OA 3DVMA 1ALWA 2BECA 2WCFA 1SCMC 4YGEB 1QX7A 3C1VA 2L98A 3SG6A 1KK8B 4AQJA 5ER5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K61 A;  3PM8 A;  2SCP A;  2FCE A;  2COL B;  3D0Y A;  1UHI A;  3CS1 A;  1SL8 A;  1F54 A;  1CDL A;  3EKH A;  4MZL A;  1UWO A;  1M31 A;  1DGU A;  1WDC B;  2D8N A;  1RTP 1;  1CFC A;  1A2X A;  1Q80 A;  1TRF A;  4MZK A;  4XJK B;  2JQ6 A;  5JJG A;  1DJZ A;  1YUR A;  2PSR A;  1JFJ A;  1S6J A;  2KI4 C;  4NDC A;  1DJH A;  1QV0 A;  1PK0 D;  4YGD B;  1BR1 B;  1BF5 A;  3I5F B;  4IL1 A;  3VGO A;  1AUI B;  3WNX B;  3OP0 A;  1K95 A;  4AQI A;  1HQV A;  2KHN A;  2JUL A;  1X02 A;  1JUO A;  3A4U B;  1GGW A;  3CGA A;  1SRA A;  5BPJ A;  2JWW A;  5CPV A;  1CDM A;  1Y1U A;  1DT7 B;  1KK7 Y;  1UUS A;  2K7O A;  1G8I A;  1WRL A;  3TUY B;  2LMU A;  4C0J A;  1CDN A;  4AOM A;  3PLF B;  1IWQ A;  2L0P A;  2OPO A;  4HRG A;  2KGR A;  2BCB A;  2JNF A;  2M0R A;  1M46 A;  1XFZ O;  4F0Z B;  2JOJ A;  4C0K A;  2K8M B;  2NXQ A;  2ZNE A;  2CT9 A;  4USL A;  1M45 A;  1B8R A;  2NCO A;  3EK8 A;  1CLL A;  2M1K B;  4HSZ A;  2LMV A;  3FWB A;  4DRW A;  2LVI A;  1KQV A;  2KI6 C;  1BG1 A;  1KWO B;  4GPL B;  4DS7 A;  1E8A A;  4WQ2 A;  1KK7 Z;  1JC2 A;  5KU1 A;  4E68 A;  2BE6 A;  1JF2 A;  1EL4 A;  1GQM A;  1A75 A;  3I5H C;  3PAL A;  1B4C A;  4Q04 A;  3EK4 A;  3BUX B;  2I2R E;  3M0W A;  2LLU A;  1NX3 A;  2OTG B;  3RLZ A;  2ZRS A;  3CR5 X;  1XVJ A;  2KBM A;  3PSR A;  1ZMZ A;  2LM5 A;  1XFV O;  1EG3 A;  1QTX A;  4M2O A;  5KTY A;  2SAS A;  4OKH A;  4GGN A;  1BMO A;  1N2D A;  2M29 A;  1UHN A;  1NX2 A;  2Y1N A;  2IS9 A;  5AER A;  2KI6 D;  3PN7 B;  1J7Q A;  2K2F A;  2ISD A;  2P6B B;  1IH0 A;  3LL8 B;  1PUL A;  1OZS A;  1V1F A;  2JT8 A;  5AFP A;  4NQG A;  1OSA A;  2LC5 A;  1XO5 A;  1G4Y R;  2JZI A;  4HRE E;  1PVA A;  1KSO A;  2JC2 A;  3DD4 A;  1DTL A;  2MHH A;  2F2O A;  2NLN A;  4A4B A;  1IJ6 A;  3IQQ A;  1CLB A;  4PE0 A;  3CZT X;  2KSP A;  2I94 A;  2LLS A;  1CMG A;  4C0L A;  1TIZ A;  1QJT A;  4PHJ A;  2CBL A;  2BE4 A;  1J55 A;  1K9K A;  1WRK A;  4MRY A;  1U5I A;  5I2Q A;  4CLN A;  1WRZ A;  3OHM B;  4PCW A;  1QIW A;  1MWN A;  2F2P A;  1W7J B;  2L2E A;  1S1E A;  3LLE A;  1WLM A;  2LNK A;  3O78 A;  1DMO A;  1AJ4 A;  4CPV A;  2E6W A;  2JU0 A;  4FQO A;  2L51 A;  1SY9 A;  1ZAC A;  3BOW A;  1OOJ A;  1K90 D;  2CTN A;  1V1G A;  2I18 A;  3HX4 A;  3PAT A;  1J7O A;  1BOD A;  1Y1A A;  3E3R A;  1C7W A;  4MEW A;  4CID A;  2LE9 B;  1A4P A;  3GK4 X;  1F4Q A;  1K8U A;  2GGZ A;  1CNP A;  3I5G B;  1IQ3 A;  1FF1 A;  2MJW B;  5D7F A;  4I5J A;  4ZCV A;  1QAS A;  5I2O A;  1C07 A;  1XFX O;  3JVT C;  2WOS A;  3LCP C;  1KFX S;  3DF0 B;  3BQ3 A;  1WLZ A;  5JOL A;  1Y0V H;  4MN0 A;  1CLM A;  1UHH A;  3TDI A;  3JTD B;  2O60 A;  2M97 A;  2LAP A;  3CR2 A;  1RK9 A;  1YX7 A;  2M7N A;  3ICB A;  1F55 A;  1SCM B;  2EC6 C;  2LCP A;  2B1U A;  2H2K A;  1J7P A;  1NYA A;  2JTT A;  2QPT A;  3D10 A;  1SCV A;  2ZN9 A;  2EHB A;  4N5X A;  3QRX A;  2HF5 A;  4I5N B;  2KFF A;  1F71 A;  1CM1 A;  2K2A A;  3DVK A;  3VRO A;  1CKK A;  1S36 A;  1YUT A;  2FCD A;  2LLT A;  1QAT A;  4GUK A;  2KQ6 A;  3CTN A;  1NSH A;  1PSR A;  3A8R A;  2NCP A;  1PRW A;  3OX6 A;  3SG2 A;  2HET A;  2KI4 B;  2BBM A;  3D0Y B;  1IJ5 A;  1ZFS A;  2WND A;  4PE4 A;  1IG5 A;  1MXL C;  4MSP A;  2MLE C;  3BUM B;  5HLO A;  4YI9 A;  5B8I B;  1XA5 A;  4ZCU A;  4MBE A;  1HT9 A;  4XYN A;  1NCZ A;  3F45 A;  1W7I B;  1J1E A;  1KFU S;  3I5I C;  1OMD A;  2BL0 C;  3SG5 A;  3KF9 A;  1DJG A;  4FTG A;  4JPZ B;  4OCI A;  1AK8 A;  4WRI A;  2O5G A;  1D1O A;  4N1G A;  1VRK A;  3O6B A;  3SIA A;  3ZWH A;  2MLF C;  5G08 A;  2BKI B;  1A29 A;  1KQM C;  4P5O E;  1CTR A;  3BUN B;  1SR6 C;  3EVV A;  4CFR A;  4QJ4 B;  1XFW O;  1TNP A;  1MQ1 A;  1GJY A;  2A4J A;  1L2O C;  2BCA A;  2M8U A;  2PVB A;  4PHM A;  1F70 A;  1RRO A;  1NPQ A;  1TNW A;  1YVL A;  2JT3 A;  1UUR A;  2KOT A;  5GQQ C;  1BOC A;  1RFJ A;  1XK4 A;  3AAK A;  4JWQ A;  4YGC B;  1TCO B;  3KEV A;  1MHO A;  1DF0 A;  2JNX A;  3SG7 A;  4CFQ A;  1H8B A;  3I5H B;  2PAS A;  2DOQ A;  2Q91 A;  3NSO A;  1JSA A;  2E30 A;  4PAL A;  2F33 A;  1BLQ A;  2CNP A;  1TOP A;  3NSI A;  5AXI A;  1XK4 C;  1QVI Y;  1PAL A;  4ORC B;  4PHN A;  2PMY A;  2V53 A;  3VRP A;  1SPY A;  2ZND A;  3TS5 C;  3EVR A;  5CSI A;  3PFV A;  1B9A A;  1A75 B;  2F8P A;  3LK1 A;  1KSM A;  1EXR A;  1KFX L;  4QJ3 B;  1TNX A;  5DKN A;  3FIA A;  2LVV A;  3K21 A;  3IQO A;  1B1G A;  1GGZ A;  4HRH A;  1YX8 A;  1B47 A;  1LA0 A;  1SKT A;  2JPT A;  4OVN F;  4U8D A;  3GK2 A;  4YGB B;  3SG4 A;  1CFP A;  1TTX A;  2G9B A;  2ZRT A;  1CFF A;  4YRU A;  1S6C A;  3WXA A;  2NZ0 A;  3NSK A;  2CCM A;  4GFT A;  3CWG A;  5IBW A;  1QVI Z;  1DGV A;  5AAN A;  2MA2 A;  4YGA A;  4DUQ A;  4QJ5 B;  2KAY A;  5I8N A;  3SG3 A;  4UPG A;  2KQY A;  1BU3 A;  2MAZ A;  1YRU B;  4YI8 A;  3OB1 B;  1AHR A;  1J1D A;  3TZ1 A;  1R6P A;  1NIW A;  3O4Y A;  1M39 A;  2K7C A;  4D1E A;  1JF0 A;  2Y4Q A;  1ODB A;  2PAL A;  1U5I B;  5KSZ A;  4YBH B;  1YUS A;  3VRN A;  2OS8 C;  1N0Y A;  1K9U A;  5ER4 X;  2GV5 A;  1KFU L;  4BY5 A;  1WY9 A;  1OMV A;  1SW8 A;  3GOF A;  3FS7 A;  5F6T A;  1UP5 A;  2JT0 A;  1MR8 A;  2KAV A;  3CLN A;  3NXA A;  3IF7 A;  4R1E A;  1K94 A;  1NCY A;  3BOW B;  1BT6 A;  1LKJ A;  1OQP A;  2AUC A;  2JRF A;  4MLW A;  5DKQ A;  3JVT B;  1K93 D;  2BKH B;  1QLK A;  1FW4 A;  3TDU A;  3BUO B;  4XJK A;  1NP8 A;  4OR9 B;  1QS7 A;  2EGD A;  3SJS A;  1QXP A;  2L4H A;  2HQW A;  1A03 A;  3KPX A;  2KYF A;  1AVS A;  5HKW A;  2QAC A;  1KK8 C;  5HLV A;  2M1U A;  2EC6 B;  1S5G Y;  5AEQ A;  1QV1 A;  2Y5I A;  1Y6W A;  2LP3 A;  1WDC C;  1NWD A;  1IKU A;  4MVF A;  4TNC A;  1L7Z A;  1FI6 A;  1YVH A;  1CMF A;  1Y1X A;  1FBV A;  3EVU A;  3EKJ A;  3H4S E;  1BJF A;  1IGV A;  4WQ3 A;  5FYX A;  1S3P A;  1EJ3 A;  1YRT B;  2FOT A;  5CSF A;  3SIB A;  2LV7 A;  2Q4U A;  3I5F C;  2BCX A;  3OX5 A;  1PVB A;  2K0J A;  2LHI A;  1OE9 B;  4NDB A;  1QLS A;  2KFG A;  3AAJ A;  1K9P A;  1S5G Z;  4PDZ A;  1LA3 A;  1JBA A;  1ZUZ A;  2TN4 A;  1YR5 A;  1KCY A;  3BYA A;  2H61 A;  2LUC A;  1AJ5 A;  3WHT B;  3I5I B;  2BL0 B;  4ORA B;  3TUY C;  3FWC A;  2LUX A;  2AMI A;  1C7V A;  1DJY A;  4ICB A;  2VRG A;  1CB1 A;  2HPS A;  1OZO A;  4M2Q A;  1SK6 D;  2L50 A;  1H4B A;  1K2H A;  1KQM B;  4A4C A;  1SR6 B;  1PSB A;  1NX0 A;  2H61 C;  2WCE A;  3AKB A;  4M2P A;  1AP4 A;  1DVI A;  1L2O B;  2M9G A;  2KNE A;  1DJI A;  1KWO C;  1IRJ A;  4GBA A;  1BR4 B;  1S6I A;  1NX1 A;  4DCK A;  1F8H A;  2WCB A;  3WHU B;  1S26 D;  2AAO A;  4I5K A;  1ZOT B;  3MSE B;  3TDZ A;  1TNQ A;  1RWY A;  1SL7 A;  1B7T Y;  4PHK A;  1QX5 B;  1FI5 A;  2OTG C;  1NCX A;  2LVK A;  1UHK A;  2L4I A;  1TN4 A;  1DJX A;  4P2Y B;  2CXJ A;  2FJU B;  2LP2 A;  3CR4 X;  4N1F A;  1UHJ A;  1DJW A;  4GNK B;  2PRU A;  2WC8 A;  1M63 B;  2M7L A;  1CFD A;  2ZN8 A;  2GGM A;  3LK0 A;  5HYD A;  2F3Y A;  3BXK A;  2LAN A;  3PN7 C;  5TNC A;  3TS5 B;  3DVJ A;  1DF0 B;  4ETO A;  1MUX A;  2KFH A;  2BBN A;  2M49 B;  2Y1M A;  4PE1 A;  4JQ0 D;  3RM1 A;  5HKY A;  1REC A;  4PE7 A;  2JXL A;  2WOR A;  1JFK A;  1SYM A;  3KO0 A;  1YUU A;  1B7T Z;  2R2I A;  3DVE A;  3NSL A;  3O2P A;  4GGF A;  2KGB C;  4L9M A;  1B8L A;  5K89 A;  2K7B A;  1G33 A;  1QX2 A;  1LVC D;  1SL9 A;  1J7R A;  5I2L A;  1EH2 A;  2KYC A;  1RJV A;  1XFU O;  1SMG A;  4MRX A;  5CSJ A;  1ALV A;  4NDD A;  1OMR A;  2L5X B;  1TCF A;  1SNL A;  5CSN A;  1MF8 B;  2I7A A;  1JWD A;  1EG4 A;  4GGF C;  4DIR A;  1CDP A;  2RGI A;  1MXE A;  2KDH A;  2HQ8 A;  3GK1 A;  3BUW B;  1N65 A;  2K7D A;  5PAL A;  4OV2 A;  3KHE A;  2LMT A;  2MBX A;  2G2B A;  4I5L B;  4BY4 A;  5D69 A;  3HCM A;  3OB2 B;  1B8C A;  3DF0 A;  1YTZ C;  2OS8 B;  2JTZ A;  1CM4 A;  4GAO A;  2LHL A;  5J3X A;  2KBI A;  1LXF C;  1XYD A;  2KAX A;  2ZFD A;  2LVJ A;  3I5G C;  3ZNI A;  2F3Z A;  5HKZ A;  1K96 A;  1FPW A;  4ORB B;  2M3W A;  3AKA A;  5DKR A;  3EK7 A;  1SBJ A;  3VRR A;  2MRD A;  4MZJ A;  1QIV A;  1NUB A;  2ZKM X;  1LIN A;  3VRQ A;  2JXC A;  3JTD C;  1XFY O;  1R2U A;  1IQ5 A;  1F4O A;  3DVM A;  1ALW A;  2BEC A;  2WCF A;  1SCM C;  4YGE B;  1QX7 A;  3C1V A;  2L98 A;  3SG6 A;  1KK8 B;  4AQJ A;  5ER5 A; 
#chains in the Genus database with same CATH topology
 2K61 A;  3OGN A;  3PM8 A;  2SCP A;  2FCE A;  2COL B;  3D0Y A;  1UHI A;  3CS1 A;  1SL8 A;  3D73 A;  3FE8 A;  1F54 A;  3PM2 A;  1CDL A;  3EKH A;  4MZL A;  1UWO A;  1M31 A;  1DGU A;  1WDC B;  2D8N A;  1RTP 1;  1CFC A;  1A2X A;  1Q80 A;  1TRF A;  4MZK A;  4XJK B;  2JQ6 A;  5JJG A;  1DJZ A;  1YUR A;  2PSR A;  1JFJ A;  2P70 A;  1S6J A;  3B7A A;  2BNX A;  2KI4 C;  4NDC A;  1DJH A;  1QV0 A;  1PK0 D;  4YGD B;  3DXL A;  3UO9 A;  1BR1 B;  1BF5 A;  3I5F B;  4IL1 A;  3VGO A;  1AUI B;  3WNX B;  3OP0 A;  5HL1 A;  1K95 A;  4AQI A;  1HQV A;  2KHN A;  2JUL A;  1X02 A;  1JUO A;  3A4U B;  1GGW A;  3CGA A;  1SRA A;  5BPJ A;  2JWW A;  3FE9 A;  3EG5 B;  5CPV A;  1CDM A;  1Y1U A;  1DT7 B;  1KK7 Y;  1UUS A;  2K7O A;  2P71 A;  1G8I A;  1WRL A;  3S0B A;  3TUY B;  2LMU A;  4C0J A;  1CDN A;  3R1P A;  3CZ1 A;  4AOM A;  3PLF B;  1IWQ A;  2L0P A;  2OPO A;  4HRG A;  2KGR A;  2BCB A;  2JNF A;  2M0R A;  1M46 A;  1XFZ O;  4F0Z B;  2JOJ A;  4C0K A;  2K8M B;  2NXQ A;  2ZNE A;  2CT9 A;  4USL A;  1M45 A;  1B8R A;  2NCO A;  3EK8 A;  1CLL A;  2M1K B;  4HSZ A;  2LMV A;  3FWB A;  4DRW A;  2LVI A;  1KQV A;  2KI6 C;  2YGU A;  3CAB A;  1BG1 A;  1KWO B;  4GPL B;  4DS7 A;  1E8A A;  4WQ2 A;  1KK7 Z;  4FQT A;  2ERB A;  1JC2 A;  5KU1 A;  4E68 A;  2BE6 A;  1JF2 A;  2WCL A;  1EL4 A;  1GQM A;  3D74 A;  1A75 A;  3I5H C;  3PAL A;  1B4C A;  3NHI A;  4Q04 A;  3EK4 A;  3BUX B;  2I2R E;  3M0W A;  2LLU A;  1NX3 A;  2OTG B;  3RLZ A;  2ZRS A;  3CR5 X;  2L5Y A;  1XVJ A;  2KBM A;  3PSR A;  1ZMZ A;  1OOF A;  2LM5 A;  1XFV O;  1EG3 A;  1QTX A;  4M2O A;  5KTY A;  2SAS A;  4OKH A;  4GGN A;  2WCJ A;  1BMO A;  1N2D A;  2M29 A;  1UHN A;  1NX2 A;  2Y1N A;  2IS9 A;  5AER A;  2KI6 D;  3PN7 B;  1J7Q A;  2K2F A;  2ISD A;  2P6B B;  1IH0 A;  3LL8 B;  1PUL A;  1OZS A;  1V1F A;  2JT8 A;  5AFP A;  1TUJ A;  4NQG A;  1OSA A;  2LC5 A;  1XO5 A;  1G4Y R;  2JZI A;  3B6X A;  4HRE E;  1PVA A;  3K1E A;  1KSO A;  2JC2 A;  3DD4 A;  4OZD A;  1DTL A;  2MHH A;  2F2O A;  2NLN A;  4A4B A;  1IJ6 A;  3IQQ A;  3S0F A;  4PE0 A;  3CZT X;  2KSP A;  1CLB A;  2I94 A;  2LLS A;  1CMG A;  4C0L A;  1TIZ A;  1Z4H A;  1QJT A;  2KLD A;  2PQL A;  4PHJ A;  2CBL A;  2BE4 A;  1J55 A;  1K9K A;  1WRK A;  4MRY A;  1U5I A;  5I2Q A;  4CLN A;  1WRZ A;  3OHM B;  4PCW A;  1QIW A;  1MWN A;  2F2P A;  1W7J B;  2L2E A;  1S1E A;  3LLE A;  1WLM A;  2LNK A;  3O78 A;  1DMO A;  1AJ4 A;  4CPV A;  2E6W A;  2JU0 A;  4FQO A;  2L51 A;  1SY9 A;  1ZAC A;  3BOW A;  2QEV A;  3VB1 A;  1OOJ A;  1K90 D;  2CTN A;  1V1G A;  2I18 A;  3HX4 A;  1DC1 A;  3PAT A;  1J7O A;  1BOD A;  1Y1A A;  3E3R A;  1C7W A;  4MEW A;  4CID A;  3L4L A;  2LE9 B;  1OOH A;  1A4P A;  3GK4 X;  1QWV A;  1F4Q A;  1K8U A;  2GGZ A;  1CNP A;  3I5G B;  1IQ3 A;  1FF1 A;  2JPO A;  2MJW B;  5D7F A;  4I5J A;  4ZCV A;  1QAS A;  5I2O A;  1C07 A;  1XFX O;  3JVT C;  2WOS A;  3LCP C;  1KFX S;  3DF0 B;  3N7H A;  3BQ3 A;  1WLZ A;  3BJH A;  1Y0V H;  5JOL A;  4MN0 A;  1CLM A;  1UHH A;  3TDI A;  3SS3 A;  3JTD B;  2O60 A;  2M97 A;  2LAP A;  3CR2 A;  1RK9 A;  3D78 A;  1YX7 A;  2M7N A;  3ICB A;  1F55 A;  1SCM B;  2EC6 C;  4INW A;  2LCP A;  2B1U A;  2H2K A;  2PYQ A;  1J7P A;  1NYA A;  2JTT A;  2QPT A;  3D10 A;  3L47 A;  1SCV A;  2WC6 A;  2ZN9 A;  2EHB A;  1OW4 A;  3QRX A;  4N5X A;  5FI2 A;  2HF5 A;  4I5N B;  2KFF A;  1F71 A;  1CM1 A;  2K2A A;  3DVK A;  3VRO A;  1CKK A;  1S36 A;  1YUT A;  2FCD A;  2LLT A;  1QAT A;  4GUK A;  3IVT A;  2KQ6 A;  3CTN A;  1NSH A;  1PSR A;  3A8R A;  2NCP A;  1PRW A;  3OX6 A;  3SG2 A;  2HET A;  2KI4 B;  4JKT A;  2BBM A;  3D0Y B;  1IJ5 A;  1ZFS A;  2WND A;  4PE4 A;  1IG5 A;  1MXL C;  4MSP A;  2MLE C;  3BUM B;  3CDN A;  4YI9 A;  5HLO A;  5B8I B;  1XA5 A;  4ZCU A;  4MBE A;  1HT9 A;  4XYN A;  2GTE A;  1NCZ A;  3F45 A;  3V2L A;  1W7I B;  1J1E A;  1KFU S;  3I5I C;  1OMD A;  2BL0 C;  3SG5 A;  3KF9 A;  1DJG A;  4FTG A;  4JPZ B;  4OCI A;  1AK8 A;  4WRI A;  2BAP A;  2O5G A;  3PJI A;  1D1O A;  4N1G A;  5I94 A;  1VRK A;  3O6B A;  3SIA A;  3ZWH A;  2MLF C;  5G08 A;  2BKI B;  1A29 A;  1KQM C;  4P5O E;  1CTR A;  3BUN B;  1SR6 C;  3EVV A;  4CFR A;  4QJ4 B;  1XFW O;  4INX A;  1C3Z A;  1TNP A;  1MQ1 A;  1GJY A;  2A4J A;  1L2O C;  2BCA A;  2M8U A;  5EL2 A;  1DQE A;  2PVB A;  3D75 A;  4PHM A;  1RRO A;  1NPQ A;  1TNW A;  1YVL A;  1F70 A;  2JT3 A;  1UUR A;  2KOT A;  5GQQ C;  1BOC A;  1RFJ A;  1XK4 A;  3AAK A;  4JWQ A;  3FE6 A;  4YGC B;  1TCO B;  3KEV A;  1MHO A;  1DF0 A;  2JNX A;  3SG7 A;  4CFQ A;  1H8B A;  3I5H B;  2PAS A;  3QME A;  2DOQ A;  2Q91 A;  3NSO A;  1JSA A;  2E30 A;  4PAL A;  2F33 A;  1BLQ A;  2CNP A;  1TOP A;  2KPH A;  1T14 A;  3NSI A;  5AXI A;  1XK4 C;  1SSE B;  1QVI Y;  1PAL A;  4ORC B;  4PHN A;  2FJY A;  2PMY A;  2V53 A;  3VRP A;  1SPY A;  5DIC A;  2ZND A;  3SS5 A;  3TS5 C;  3EVR A;  1DEL A;  1LS8 A;  5CSI A;  3PFV A;  1B9A A;  1A75 B;  2F8P A;  3LK1 A;  1KSM A;  1EXR A;  1KFX L;  4QJ3 B;  1TNX A;  5DKN A;  3SS4 A;  3FIA A;  2LVV A;  3K21 A;  3IQO A;  1B1G A;  1GGZ A;  4HRH A;  1YX8 A;  1B47 A;  1LA0 A;  1SKT A;  2JPT A;  4OVN F;  3DYE A;  3R1V A;  4U8D A;  1ORG A;  3GK2 A;  4YGB B;  3SG4 A;  1CFP A;  1TTX A;  2G9B A;  2ZRT A;  1CFF A;  4YRU A;  1S6C A;  3WXA A;  2NZ0 A;  3NSK A;  2CCM A;  4GFT A;  3CWG A;  5IBW A;  1QVI Z;  1DGV A;  5AAN A;  3S0A A;  2MA2 A;  4YGA A;  4DUQ A;  4QJ5 B;  2KAY A;  5I8N A;  3SG3 A;  1TUZ A;  3D76 A;  4UPG A;  2KQY A;  1BU3 A;  2MAZ A;  1YRU B;  3O4X A;  4JD9 A;  3Q8I A;  2KLE A;  3OB1 B;  4YI8 A;  1AHR A;  1J1D A;  1OOI X;  3L4A A;  3TZ1 A;  1R6P A;  1NIW A;  3O4Y A;  1M39 A;  2K7C A;  4D1E A;  1JF0 A;  3R1O A;  2Y4Q A;  1ODB A;  3R72 A;  4F7F A;  2PAL A;  1IIO A;  1U5I B;  5KSZ A;  3B88 A;  4YBH B;  1YUS A;  3VRN A;  2OS8 C;  1N0Y A;  1K9U A;  5ER4 X;  2GV5 A;  2QEH A;  1KFU L;  1W9Z A;  4BY5 A;  1WY9 A;  1OMV A;  1SW8 A;  3GOF A;  3FS7 A;  5F6T A;  1UP5 A;  2JT0 A;  1MR8 A;  2KAV A;  3CLN A;  3CYZ A;  3IF7 A;  3NXA A;  4R1E A;  1K94 A;  1NCY A;  3BOW B;  3OBV A;  1BT6 A;  1LKJ A;  1OQP A;  2AUC A;  2JRF A;  4MLW A;  5DKQ A;  3JVT B;  1K93 D;  2BKH B;  1QLK A;  1FW4 A;  3TDU A;  3BUO B;  4XJK A;  1NP8 A;  4OR9 B;  1QS7 A;  2EGD A;  5D3O A;  3SJS A;  1QXP A;  2L4H A;  2HQW A;  1A03 A;  3KPX A;  2KYF A;  1AVS A;  5HKW A;  3UNW A;  2QAC A;  1KK8 C;  5HLV A;  2M1U A;  2EC6 B;  1S5G Y;  5AEQ A;  1QV1 A;  2Y5I A;  1Y6W A;  2LP3 A;  1WDC C;  1NWD A;  1IKU A;  1P28 A;  4MVF A;  4TNC A;  1DEK A;  1L7Z A;  1FI6 A;  1YVH A;  1CMF A;  1Y1X A;  1FBV A;  3EVU A;  3S0G A;  3EKJ A;  3H4S E;  1BJF A;  1IGV A;  3BFA A;  4WQ3 A;  1S3P A;  1EJ3 A;  1YRT B;  2FOT A;  5CSF A;  5FYX A;  2LV7 A;  3SIB A;  2Q4U A;  3I5F C;  4PT1 A;  2BCX A;  3OX5 A;  1PVB A;  2K0J A;  3NGV A;  2LHI A;  1OE9 B;  4NDB A;  1QLS A;  2KFG A;  3AAJ A;  1K9P A;  1S5G Z;  4PDZ A;  1LA3 A;  1JBA A;  1ZUZ A;  2TN4 A;  1YR5 A;  1KCY A;  3BYA A;  3CZ0 A;  3B86 A;  2H61 A;  2LUC A;  1AJ5 A;  3BFH A;  3WHT B;  3I5I B;  2BL0 B;  4ORA B;  3TUY C;  3FWC A;  2LUX A;  2AMI A;  1C7V A;  3CZ2 A;  1DJY A;  4ICB A;  2VRG A;  1CB1 A;  2HPS A;  1OZO A;  4M2Q A;  2WCK A;  1SK6 D;  2L50 A;  1H4B A;  1K2H A;  1KQM B;  4A4C A;  1SR6 B;  1PSB A;  1NX0 A;  2H61 C;  2WCE A;  3AKB A;  4M2P A;  1AP4 A;  1DVI A;  1L2O B;  2M9G A;  2KNE A;  2WCM A;  1DJI A;  1KWO C;  3B87 A;  1IRJ A;  4GBA A;  1BR4 B;  1S6I A;  1NX1 A;  2H8V A;  4DCK A;  1F8H A;  2WCB A;  3WHU B;  1S26 D;  2AAO A;  4I5K A;  1ZOT B;  3MSE B;  3DY9 A;  3S0E A;  3TDZ A;  1TNQ A;  1RWY A;  1SL7 A;  1B7T Y;  4PHK A;  1QX5 B;  1FI5 A;  2OTG C;  3BFB A;  1NCX A;  2LVK A;  1UHK A;  2L4I A;  1TN4 A;  1DJX A;  4P2Y B;  2CXJ A;  2FJU B;  2LP2 A;  3CR4 X;  4N1F A;  1UHJ A;  1DJW A;  4GNK B;  2PRU A;  2WC8 A;  1M63 B;  2M7L A;  1CFD A;  2ZN8 A;  2GGM A;  3LK0 A;  5HYD A;  2F3Y A;  3BXK A;  2LAN A;  3PN7 C;  5TNC A;  3TS5 B;  3DVJ A;  1DF0 B;  4ETO A;  1MUX A;  2KFH A;  2BBN A;  2M49 B;  2Y1M A;  4PE1 A;  4JQ0 D;  3RM1 A;  4KYN A;  5HKY A;  1REC A;  4PE7 A;  1C3Y A;  2QEB A;  2JXL A;  2WOR A;  4IJ7 A;  1JFK A;  1SYM A;  2L2C A;  3KO0 A;  3RZS A;  1YUU A;  1B7T Z;  2R2I A;  3DVE A;  3NSL A;  3O2P A;  4GGF A;  2KGB C;  4L9M A;  1B8L A;  5K89 A;  1GM0 A;  2K7B A;  1G33 A;  1QX2 A;  1LVC D;  1SL9 A;  1J7R A;  5I2L A;  1EH2 A;  2KYC A;  1RJV A;  1XFU O;  1SMG A;  4MRX A;  5CSJ A;  1ALV A;  4NDD A;  1OMR A;  2L5X B;  2WCH A;  3S0D A;  1TCF A;  1SNL A;  1OOG A;  5CSN A;  1Z2C B;  1MF8 B;  2I7A A;  1JWD A;  3NHT A;  1EG4 A;  4GGF C;  4DIR A;  1CDP A;  2RGI A;  1MXE A;  2KDH A;  2HQ8 A;  3GK1 A;  3DZT A;  3BUW B;  1N65 A;  2K7D A;  5PAL A;  2QDI A;  3KHE A;  2LMT A;  4OV2 A;  1TWO A;  2G2B A;  4I5L B;  2MBX A;  4BY4 A;  5D69 A;  3HCM A;  3OB2 B;  1B8C A;  3DF0 A;  1YTZ C;  1XFR A;  5FI7 A;  2OS8 B;  2JTZ A;  1CM4 A;  4GAO A;  2LHL A;  2K60 A;  5J3X A;  2KBI A;  1LXF C;  1XYD A;  2KAX A;  2ZFD A;  2LVJ A;  3I5G C;  3ZNI A;  2F3Z A;  5HKZ A;  1K96 A;  1FPW A;  4ORB B;  2M3W A;  3AKA A;  5DKR A;  3EK7 A;  1SBJ A;  3D77 A;  5FI6 A;  3VRR A;  2MRD A;  4MZJ A;  1QIV A;  1NUB A;  2ZKM X;  1LIN A;  3VRQ A;  2JXC A;  3JTD C;  1XFY O;  1R2U A;  1IQ5 A;  2QEO A;  2WC5 A;  1F4O A;  3DVM A;  1ALW A;  2BEC A;  2WCF A;  1SCM C;  4YGE B;  1QX7 A;  3C1V A;  2L98 A;  3SG6 A;  1KK8 B;  4AQJ A;  5ER5 A; 
#chains in the Genus database with same CATH homology
 2K61 A;  3PM8 A;  2SCP A;  2FCE A;  2COL B;  3D0Y A;  1UHI A;  3CS1 A;  1SL8 A;  1F54 A;  1CDL A;  3EKH A;  4MZL A;  1UWO A;  1M31 A;  1DGU A;  1WDC B;  2D8N A;  1RTP 1;  1CFC A;  1A2X A;  1Q80 A;  1TRF A;  4MZK A;  4XJK B;  2JQ6 A;  5JJG A;  1DJZ A;  1YUR A;  2PSR A;  1JFJ A;  1S6J A;  2KI4 C;  4NDC A;  1DJH A;  1QV0 A;  1PK0 D;  4YGD B;  1BR1 B;  1BF5 A;  3I5F B;  4IL1 A;  3VGO A;  1AUI B;  3WNX B;  3OP0 A;  1K95 A;  4AQI A;  1HQV A;  2KHN A;  2JUL A;  1X02 A;  1JUO A;  3A4U B;  1GGW A;  3CGA A;  1SRA A;  5BPJ A;  2JWW A;  5CPV A;  1CDM A;  1Y1U A;  1DT7 B;  1KK7 Y;  1UUS A;  2K7O A;  1G8I A;  1WRL A;  3TUY B;  2LMU A;  4C0J A;  1CDN A;  4AOM A;  3PLF B;  1IWQ A;  2L0P A;  2OPO A;  4HRG A;  2KGR A;  2BCB A;  2JNF A;  2M0R A;  1M46 A;  1XFZ O;  4F0Z B;  2JOJ A;  4C0K A;  2K8M B;  2NXQ A;  2ZNE A;  2CT9 A;  4USL A;  1M45 A;  1B8R A;  2NCO A;  3EK8 A;  1CLL A;  2M1K B;  4HSZ A;  2LMV A;  3FWB A;  4DRW A;  2LVI A;  1KQV A;  2KI6 C;  1BG1 A;  1KWO B;  4GPL B;  4DS7 A;  1E8A A;  4WQ2 A;  1KK7 Z;  1JC2 A;  5KU1 A;  4E68 A;  2BE6 A;  1JF2 A;  1EL4 A;  1GQM A;  1A75 A;  3I5H C;  3PAL A;  1B4C A;  4Q04 A;  3EK4 A;  3BUX B;  2I2R E;  3M0W A;  2LLU A;  1NX3 A;  2OTG B;  3RLZ A;  2ZRS A;  3CR5 X;  1XVJ A;  2KBM A;  3PSR A;  1ZMZ A;  2LM5 A;  1XFV O;  1EG3 A;  1QTX A;  4M2O A;  5KTY A;  2SAS A;  4OKH A;  4GGN A;  1BMO A;  1N2D A;  2M29 A;  1UHN A;  1NX2 A;  2Y1N A;  2IS9 A;  5AER A;  2KI6 D;  3PN7 B;  1J7Q A;  2K2F A;  2ISD A;  2P6B B;  1IH0 A;  3LL8 B;  1PUL A;  1OZS A;  1V1F A;  2JT8 A;  5AFP A;  4NQG A;  1OSA A;  2LC5 A;  1XO5 A;  1G4Y R;  2JZI A;  4HRE E;  1PVA A;  1KSO A;  2JC2 A;  3DD4 A;  1DTL A;  2MHH A;  2F2O A;  2NLN A;  4A4B A;  1IJ6 A;  3IQQ A;  1CLB A;  4PE0 A;  3CZT X;  2KSP A;  2I94 A;  2LLS A;  1CMG A;  4C0L A;  1TIZ A;  1QJT A;  4PHJ A;  2CBL A;  2BE4 A;  1J55 A;  1K9K A;  1WRK A;  4MRY A;  1U5I A;  5I2Q A;  4CLN A;  1WRZ A;  3OHM B;  4PCW A;  1QIW A;  1MWN A;  2F2P A;  1W7J B;  2L2E A;  1S1E A;  3LLE A;  1WLM A;  2LNK A;  3O78 A;  1DMO A;  1AJ4 A;  4CPV A;  2E6W A;  2JU0 A;  4FQO A;  2L51 A;  1SY9 A;  1ZAC A;  3BOW A;  1OOJ A;  1K90 D;  2CTN A;  1V1G A;  2I18 A;  3HX4 A;  3PAT A;  1J7O A;  1BOD A;  1Y1A A;  3E3R A;  1C7W A;  4MEW A;  4CID A;  2LE9 B;  1A4P A;  3GK4 X;  1F4Q A;  1K8U A;  2GGZ A;  1CNP A;  3I5G B;  1IQ3 A;  1FF1 A;  2MJW B;  5D7F A;  4I5J A;  4ZCV A;  1QAS A;  5I2O A;  1C07 A;  1XFX O;  3JVT C;  2WOS A;  3LCP C;  1KFX S;  3DF0 B;  3BQ3 A;  1WLZ A;  5JOL A;  1Y0V H;  4MN0 A;  1CLM A;  1UHH A;  3TDI A;  3JTD B;  2O60 A;  2M97 A;  2LAP A;  3CR2 A;  1RK9 A;  1YX7 A;  2M7N A;  3ICB A;  1F55 A;  1SCM B;  2EC6 C;  2LCP A;  2B1U A;  2H2K A;  1J7P A;  1NYA A;  2JTT A;  2QPT A;  3D10 A;  1SCV A;  2ZN9 A;  2EHB A;  4N5X A;  3QRX A;  2HF5 A;  4I5N B;  2KFF A;  1F71 A;  1CM1 A;  2K2A A;  3DVK A;  3VRO A;  1CKK A;  1S36 A;  1YUT A;  2FCD A;  2LLT A;  1QAT A;  4GUK A;  2KQ6 A;  3CTN A;  1NSH A;  1PSR A;  3A8R A;  2NCP A;  1PRW A;  3OX6 A;  3SG2 A;  2HET A;  2KI4 B;  2BBM A;  3D0Y B;  1IJ5 A;  1ZFS A;  2WND A;  4PE4 A;  1IG5 A;  1MXL C;  4MSP A;  2MLE C;  3BUM B;  5HLO A;  4YI9 A;  5B8I B;  1XA5 A;  4ZCU A;  4MBE A;  1HT9 A;  4XYN A;  1NCZ A;  3F45 A;  1W7I B;  1J1E A;  1KFU S;  3I5I C;  1OMD A;  2BL0 C;  3SG5 A;  3KF9 A;  1DJG A;  4FTG A;  4JPZ B;  4OCI A;  1AK8 A;  4WRI A;  2O5G A;  1D1O A;  4N1G A;  1VRK A;  3O6B A;  3SIA A;  3ZWH A;  2MLF C;  5G08 A;  2BKI B;  1A29 A;  1KQM C;  4P5O E;  1CTR A;  3BUN B;  1SR6 C;  3EVV A;  4CFR A;  4QJ4 B;  1XFW O;  1TNP A;  1MQ1 A;  1GJY A;  2A4J A;  1L2O C;  2BCA A;  2M8U A;  2PVB A;  4PHM A;  1F70 A;  1RRO A;  1NPQ A;  1TNW A;  1YVL A;  2JT3 A;  1UUR A;  2KOT A;  5GQQ C;  1BOC A;  1RFJ A;  1XK4 A;  3AAK A;  4JWQ A;  4YGC B;  1TCO B;  3KEV A;  1MHO A;  1DF0 A;  2JNX A;  3SG7 A;  4CFQ A;  1H8B A;  3I5H B;  2PAS A;  2DOQ A;  2Q91 A;  3NSO A;  1JSA A;  2E30 A;  4PAL A;  2F33 A;  1BLQ A;  2CNP A;  1TOP A;  3NSI A;  5AXI A;  1XK4 C;  1QVI Y;  1PAL A;  4ORC B;  4PHN A;  2PMY A;  2V53 A;  3VRP A;  1SPY A;  2ZND A;  3TS5 C;  3EVR A;  5CSI A;  3PFV A;  1B9A A;  1A75 B;  2F8P A;  3LK1 A;  1KSM A;  1EXR A;  1KFX L;  4QJ3 B;  1TNX A;  5DKN A;  3FIA A;  2LVV A;  3K21 A;  3IQO A;  1B1G A;  1GGZ A;  4HRH A;  1YX8 A;  1B47 A;  1LA0 A;  1SKT A;  2JPT A;  4OVN F;  4U8D A;  3GK2 A;  4YGB B;  3SG4 A;  1CFP A;  1TTX A;  2G9B A;  2ZRT A;  1CFF A;  4YRU A;  1S6C A;  3WXA A;  2NZ0 A;  3NSK A;  2CCM A;  4GFT A;  3CWG A;  5IBW A;  1QVI Z;  1DGV A;  5AAN A;  2MA2 A;  4YGA A;  4DUQ A;  4QJ5 B;  2KAY A;  5I8N A;  3SG3 A;  4UPG A;  2KQY A;  1BU3 A;  2MAZ A;  1YRU B;  4YI8 A;  3OB1 B;  1AHR A;  1J1D A;  3TZ1 A;  1R6P A;  1NIW A;  3O4Y A;  1M39 A;  2K7C A;  4D1E A;  1JF0 A;  2Y4Q A;  1ODB A;  2PAL A;  1U5I B;  5KSZ A;  4YBH B;  1YUS A;  3VRN A;  2OS8 C;  1N0Y A;  1K9U A;  5ER4 X;  2GV5 A;  1KFU L;  4BY5 A;  1WY9 A;  1OMV A;  1SW8 A;  3GOF A;  3FS7 A;  5F6T A;  1UP5 A;  2JT0 A;  1MR8 A;  2KAV A;  3CLN A;  3NXA A;  3IF7 A;  4R1E A;  1K94 A;  1NCY A;  3BOW B;  1BT6 A;  1LKJ A;  1OQP A;  2AUC A;  2JRF A;  4MLW A;  5DKQ A;  3JVT B;  1K93 D;  2BKH B;  1QLK A;  1FW4 A;  3TDU A;  3BUO B;  4XJK A;  1NP8 A;  4OR9 B;  1QS7 A;  2EGD A;  3SJS A;  1QXP A;  2L4H A;  2HQW A;  1A03 A;  3KPX A;  2KYF A;  1AVS A;  5HKW A;  2QAC A;  1KK8 C;  5HLV A;  2M1U A;  2EC6 B;  1S5G Y;  5AEQ A;  1QV1 A;  2Y5I A;  1Y6W A;  2LP3 A;  1WDC C;  1NWD A;  1IKU A;  4MVF A;  4TNC A;  1L7Z A;  1FI6 A;  1YVH A;  1CMF A;  1Y1X A;  1FBV A;  3EVU A;  3EKJ A;  3H4S E;  1BJF A;  1IGV A;  4WQ3 A;  5FYX A;  1S3P A;  1EJ3 A;  1YRT B;  2FOT A;  5CSF A;  3SIB A;  2LV7 A;  2Q4U A;  3I5F C;  2BCX A;  3OX5 A;  1PVB A;  2K0J A;  2LHI A;  1OE9 B;  4NDB A;  1QLS A;  2KFG A;  3AAJ A;  1K9P A;  1S5G Z;  4PDZ A;  1LA3 A;  1JBA A;  1ZUZ A;  2TN4 A;  1YR5 A;  1KCY A;  3BYA A;  2H61 A;  2LUC A;  1AJ5 A;  3WHT B;  3I5I B;  2BL0 B;  4ORA B;  3TUY C;  3FWC A;  2LUX A;  2AMI A;  1C7V A;  1DJY A;  4ICB A;  2VRG A;  1CB1 A;  2HPS A;  1OZO A;  4M2Q A;  1SK6 D;  2L50 A;  1H4B A;  1K2H A;  1KQM B;  4A4C A;  1SR6 B;  1PSB A;  1NX0 A;  2H61 C;  2WCE A;  3AKB A;  4M2P A;  1AP4 A;  1DVI A;  1L2O B;  2M9G A;  2KNE A;  1DJI A;  1KWO C;  1IRJ A;  4GBA A;  1BR4 B;  1S6I A;  1NX1 A;  4DCK A;  1F8H A;  2WCB A;  3WHU B;  1S26 D;  2AAO A;  4I5K A;  1ZOT B;  3MSE B;  3TDZ A;  1TNQ A;  1RWY A;  1SL7 A;  1B7T Y;  4PHK A;  1QX5 B;  1FI5 A;  2OTG C;  1NCX A;  2LVK A;  1UHK A;  2L4I A;  1TN4 A;  1DJX A;  4P2Y B;  2CXJ A;  2FJU B;  2LP2 A;  3CR4 X;  4N1F A;  1UHJ A;  1DJW A;  4GNK B;  2PRU A;  2WC8 A;  1M63 B;  2M7L A;  1CFD A;  2ZN8 A;  2GGM A;  3LK0 A;  5HYD A;  2F3Y A;  3BXK A;  2LAN A;  3PN7 C;  5TNC A;  3TS5 B;  3DVJ A;  1DF0 B;  4ETO A;  1MUX A;  2KFH A;  2BBN A;  2M49 B;  2Y1M A;  4PE1 A;  4JQ0 D;  3RM1 A;  5HKY A;  1REC A;  4PE7 A;  2JXL A;  2WOR A;  1JFK A;  1SYM A;  3KO0 A;  1YUU A;  1B7T Z;  2R2I A;  3DVE A;  3NSL A;  3O2P A;  4GGF A;  2KGB C;  4L9M A;  1B8L A;  5K89 A;  2K7B A;  1G33 A;  1QX2 A;  1LVC D;  1SL9 A;  1J7R A;  5I2L A;  1EH2 A;  2KYC A;  1RJV A;  1XFU O;  1SMG A;  4MRX A;  5CSJ A;  1ALV A;  4NDD A;  1OMR A;  2L5X B;  1TCF A;  1SNL A;  5CSN A;  1MF8 B;  2I7A A;  1JWD A;  1EG4 A;  4GGF C;  4DIR A;  1CDP A;  2RGI A;  1MXE A;  2KDH A;  2HQ8 A;  3GK1 A;  3BUW B;  1N65 A;  2K7D A;  5PAL A;  4OV2 A;  3KHE A;  2LMT A;  2MBX A;  2G2B A;  4I5L B;  4BY4 A;  5D69 A;  3HCM A;  3OB2 B;  1B8C A;  3DF0 A;  1YTZ C;  2OS8 B;  2JTZ A;  1CM4 A;  4GAO A;  2LHL A;  5J3X A;  2KBI A;  1LXF C;  1XYD A;  2KAX A;  2ZFD A;  2LVJ A;  3I5G C;  3ZNI A;  2F3Z A;  5HKZ A;  1K96 A;  1FPW A;  4ORB B;  2M3W A;  3AKA A;  5DKR A;  3EK7 A;  1SBJ A;  3VRR A;  2MRD A;  4MZJ A;  1QIV A;  1NUB A;  2ZKM X;  1LIN A;  3VRQ A;  2JXC A;  3JTD C;  1XFY O;  1R2U A;  1IQ5 A;  1F4O A;  3DVM A;  1ALW A;  2BEC A;  2WCF A;  1SCM C;  4YGE B;  1QX7 A;  3C1V A;  2L98 A;  3SG6 A;  1KK8 B;  4AQJ A;  5ER5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...