4WQ2A

Human calpain pef(s) with (z)-3-(6-bromondol-3-yl)-2-mercaptoacrylic acid bound
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
173
structure length
173
Chain Sequence
EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformationally restricted calpain inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Calpain small subunit 1
total genus 68
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4wq2A00
3GK2A 1SKTA 4R1EA 4ETOA 1VRKA 2M0RA 1DJXA 1Y1XA 3I5FC 2KAVA 2ZN8A 1XFWO 1DTLA 2FCDA 3DVEA 5KSZA 2K7DA 1F4QA 3LK0A 1QX7A 1LA3A 1B9AA 2MLFC 2H2KA 3PALA 5ER4X 4ICBA 4PE0A 1NCYA 4N1GA 4USLA 1MXLC 1G4YR 5DKQA 1F55A 1IGVA 2CCMA 3FWCA 1UP5A 4PE4A 4DCKA 2KFGA 1CLBA 1NP8A 4D1EA 4P5OE 5K89A 1M63B 1MXEA 1LA0A 3VGOA 3NSKA 4GGFC 1UURA 3DVMA 4NDCA 3DVJA 2FCEA 1YX7A 1SBJA 2Y1MA 2O60A 2JNFA 1S6IA 1XK4C 1XFXO 2JZIA 3KPXA 4FTGA 4OV2A 3MSEB 1IJ5A 3BOWA 2I94A 2KNEA 4JPZB 1BG1A 2MHHA 4MZLA 3SG5A 1CM1A 1K95A 2JTZA 3KEVA 3I5GB 3O78A 3BUXB 1SL8A 1GGZA 2JWWA 5ER5A 5HKWA 4M2QA 1QTXA 4DS7A 1S36A 1QIVA 2WNDA 2K8MB 4C0LA 1UHKA 2CXJA 1MQ1A 3CZTX 1QV1A 3KHEA 5TNCA 2M97A 2FOTA 4ORCB 3BXKA 3TUYC 4PCWA 2WORA 4I5KA 1MUXA 2K7BA 2KGBC 1QLKA 2L2EA 2HPSA 2B1UA 3GOFA 1WRLA 2LHIA 2L4IA 2BE4A 3NSLA 3PSRA 4HRGA 1UHIA 2ZNEA 2FJUB 2L5XB 2JRFA 2VRGA 2I18A 1NX0A 3CGAA 1K93D 3EK8A 2KGRA 1C07A 1BMOA 1K9KA 3PN7B 2LC5A 4PHJA 1NUBA 1WLMA 1J1DA 1N0YA 1XFVO 5I2QA 2KQYA 1KSOA 1KQMB 4L9MA 2NZ0A 4GNKB 5KTYA 4NDBA 3E3RA 1Y0VH 2L0PA 2K7CA 2ZRTA 4NDDA 1RWYA 2D8NA 3DVKA 1A75A 5AEQA 1JFJA 3CTNA 1KFXL 3OB1B 1OE9B 3CR5X 5B8IB 3ZWHA 1EJ3A 1QS7A 3SG2A 4PHKA 2LMVA 4HSZA 1QX2A 2MRDA 2LVJA 5CSFA 2LLSA 2BBNA 4I5JA 3OHMB 1Y1UA 2PVBA 2Y1NA 3TUYB 2DOQA 2V53A 2PALA 2L51A 5I8NA 3IF7A 1NCZA 1QLSA 3BUWB 1ZMZA 1L7ZA 1IQ3A 1CFCA 4PHMA 1MF8B 2WCBA 1F70A 2AMIA 1G8IA 3PATA 1ZUZA 1DVIA 4OR9B 2PMYA 3TDIA 1KQVA 2BCXA 1EG3A 1GJYA 1H8BA 4F0ZB 2E30A 5J3XA 2IS9A 3I5GC 4JQ0D 1WRKA 1J7PA 4OVNF 2L4HA 1CDLA 2LNKA 2P6BB 1SRAA 1B7TY 1N65A 1X02A 2ZKMX 3VRPA 2I7AA 1ALVA 1QATA 2E6WA 3BUNB 1EXRA 5HLOA 2LUXA 4ZCVA 1NWDA 4C0JA 1CFDA 2M7LA 1SW8A 1TRFA 4BY4A 1KWOC 4AQJA 5HKZA 4YGCB 1MHOA 1F4OA 2JT3A 3NSOA 1QVIY 1L2OC 1CDPA 2I2RE 4YI8A 3TDUA 1RROA 1KFXS 2H61A 3BQ3A 4OKHA 2MBXA 3F45A 2L50A 1PSBA 1RTP1 2JXLA 3CR2A 3OP0A 1YURA 1K94A 1J7OA 1A4PA 1SYMA 2WC8A 3GK1A 3TZ1A 3O2PA 1BT6A 1MWNA 3K21A 4M2OA 5I2OA 1BODA 1NX1A 1TN4A 3C1VA 1CNPA 3VRNA 1ALWA 1AUIB 1OMVA 3EVUA 2K2AA 3EK7A 2BE6A 1LXFC 3HX4A 3A4UB 2COLB 3JTDC 2LM5A 3GK4X 1NPQA 4E68A 1IJ6A 2NXQA 3KF9A 2JQ6A 1UHHA 4PDZA 1AJ5A 1E8AA 1Q80A 1SL7A 3NXAA 5DKRA 1CFPA 3BUMB 4CPVA 3CR4X 3PLFB 2JOJA 1HT9A 2MJWB 1TIZA 3CLNA 4MSPA 2LE9B 2LANA 5AXIA 4N5XA 1U5IA 2KFHA 3EKHA 1OSAA 1KFUL 1R2UA 1RJVA 1A03A 1RECA 3VRRA 2WCFA 2CT9A 1BLQA 2F3ZA 3BYAA 2RGIA 2JPTA 1A75B 2JTTA 4OCIA 4N1FA 4YBHB 2LP3A 2LMTA 5PALA 2AUCA 1DJIA 2AAOA 4CFQA 1JF0A 4GPLB 2Q4UA 2CNPA 1IQ5A 4GFTA 1WY9A 1WLZA 3IQQA 1XFZO 5D7FA 1KK7Z 1OZSA 2PRUA 1PULA 2KYCA 5CPVA 1ZOTB 1TTXA 5KU1A 3H4SE 1A2XA 2K7OA 2GGZA 3TS5B 1SPYA 1LINA 1K9UA 1V1FA 2NCOA 3SJSA 2BECA 1K96A 3AAKA 1C7WA 2BKHB 4CFRA 2A4JA 1CMFA 2LAPA 3I5HB 4XYNA 3RM1A 4PHNA 3LLEA 3TS5C 2KI4B 1CB1A 1F71A 3TDZA 1AK8A 1KCYA 1JSAA 2MAZA 4FQOA 4Q04A 4DUQA 5D69A 1R6PA 1WDCC 2PASA 1YUTA 1B8RA 2JT0A 3FIAA 1XA5A 3O6BA 4PE1A 2M29A 2LVIA 3SIAA 3O4YA 1Y1AA 1SMGA 4WRIA 4I5NB 3RLZA 1TOPA 3BOWB 4WQ2A 5JOLA 1YRTB 1IG5A 1N2DA 1FW4A 5HYDA 3LL8B 3JVTB 2M1KB 1S5GZ 1UWOA 1G33A 1NYAA 1FPWA 1QJTA 4HREE 4NQGA 4DRWA 3EVVA 1QV0A 1J1EA 1JUOA 2LVVA 4GUKA 5F6TA 2KSPA 4GGNA 1KK7Y 1CDNA 1LKJA 1DJYA 3EK4A 3SG4A 1SK6D 2LLUA 1BR4B 2MLEC 4MZJA 3LCPC 1UHNA 2BL0C 2F3YA 4CIDA 4MEWA 1BOCA 3LK1A 1BF5A 1DGUA 2EHBA 1F8HA 4XJKB 1TNWA 3I5IB 2M1UA 2ZNDA 1M39A 5G08A 2R2IA 1SCMB 2EC6B 3A8RA 1CTRA 1K8UA 1CKKA 2F2OA 1EL4A 2PSRA 2KOTA 1CLMA 1OZOA 2L98A 1ODBA 4PALA 2LUCA 3SG3A 2K2FA 1C7VA 1KK8B 1OQPA 2BCAA 3OB2B 1IRJA 2HETA 4QJ5B 4YGAA 1TCOB 2KAXA 1JBAA 1XFUO 3M0WA 4I5LB 1D1OA 4ZCUA 2OS8B 1B8CA 1RK9A 1BJFA 4YGDB 1OMDA 5FYXA 3AKBA 3WXAA 3FS7A 1L2OB 1MR8A 3DD4A 2CBLA 1TNQA 1WRZA 1YX8A 5AERA 3BUOB 1K2HA 1B47A 1UHJA 2GGMA 1W7JB 1KWOB 2OTGC 3EKJA 4GBAA 5GQQC 1SR6C 1XK4A 2KFFA 5HKYA 2QACA 1EH2A 1IH0A 2QPTA 2ZFDA 1DF0A 1YUSA 3D10A 1SR6B 2HQWA 1TNPA 1CFFA 2OTGB 2G9BA 3DF0A 3PM8A 3WHUB 2Y5IA 1CM4A 1HQVA 1BU3A 1TNXA 1QVIZ 2NLNA 3D0YA 2KI6D 2LVKA 3PFVA 2HF5A 2ISDA 1XVJA 2LV7A 3CWGA 3ICBA 1F54A 1H4BA 1DJGA 1S3PA 4TNCA 5I2LA 1Y6WA 1U5IB 3AAJA 3IQOA 2OS8C 4ORAB 1OOJA 1PRWA 4CLNA 2LLTA 1AP4A 2BBMA 4UPGA 2M49B 2KI6C 1FBVA 1K90D 3HCMA 1J7RA 1KK8C 4BY5A 3WNXB 4U8DA 2JNXA 4YI9A 1NSHA 2ZN9A 4MLWA 3KO0A 5IBWA 2Q91A 1A29A 1LVCD 1S6JA 1SCMC 1B8LA 2EC6C 3ZNIA 1AVSA 4MRXA 3I5IC 2LHLA 1DJHA 1M31A 1YUUA 4YRUA 4MZKA 4MVFA 2OPOA 1M45A 2BL0B 5AFPA 1SL9A 1BR1B 1J55A 3EVRA 1XO5A 1B4CA 1NX2A 1CLLA 3OX6A 1QXPA 1KQMC 1SNLA 2O5GA 3AKAA 1TCFA 3NSIA 3VRQA 2Y4QA 1KFUS 3PN7C 2H61C 3JVTC 2BCBA 4MRYA 1S1EA 1K9PA 4IL1A 1B7TZ 1V1GA 2JXCA 4HRHA 2JU0A 4AQIA 1SCVA 3QRXA 1FF1A 4AOMA 4JWQA 3DF0B 2LMUA 2KHNA 3WHTB 4A4CA 1DF0B 2LCPA 5JJGA 1WDCB 1NCXA 1YTZC 2KYFA 4PE7A 4GGFA 1CMGA 2GV5A 2KI4C 1RFJA 1UUSA 2TN4A 1GQMA 2KDHA 3I5HC 1GGWA 2HQ8A 3FWBA 2LP2A 2NCPA 1AJ4A 1IWQA 2JULA 2K61A 5BPJA 2KQ6A 1DGVA 2K0JA 5CSJA 2KBIA 2SCPA 3SG7A 2WOSA 2F8PA 1JF2A 1J7QA 1NX3A 4DIRA 1S26D 2KAYA 1DT7B 1QX5B 4M2PA 1XFYO 1PK0D 2EGDA 1PVBA 4QJ3B 2M9GA 1DMOA 1YVHA 1OMRA 2JC2A 1W7IB 2CTNA 1PALA 4YGBB 1FI6A 1YVLA 1XYDA 1IKUA 3D0YB 1EG4A 1QIWA 2JT8A 4MBEA 1JWDA 1FI5A 4P2YB 4A4BA 1ZACA 1NIWA 1YRUB 3SIBA 3OX5A 4ORBB 1DJWA 1PSRA 5CSNA 3SG6A 5AANA 1AHRA 5HLVA 1QASA 2M8UA 2ZRSA 1SY9A 2SASA 4WQ3A 4YGEB 2M3WA 3I5FB 1M46A 3CS1A 2WCEA 2BKIB 2F33A 2MA2A 4XJKA 1B1GA 1S5GY 2G2BA 1ZFSA 2M7NA 1CDMA 4QJ4B 2KBMA 1YR5A 1JC2A 4GAOA 1KSMA 1PVAA 5DKNA 2F2PA 3JTDB 5CSIA 4C0KA 1JFKA 1DJZA 3VROA 1S6CA 4MN0A
chains in the Genus database with same CATH superfamily
1T14A 3GK2A 1SKTA 4R1EA 4ETOA 1VRKA 2M0RA 1DJXA 1Y1XA 3I5FC 2KAVA 1OOIX 2ZN8A 1XFWO 1DTLA 2FCDA 3DVEA 5KSZA 2K7DA 1OOHA 3D73A 1F4QA 3LK0A 1QX7A 3FE9A 1LA3A 1B9AA 2MLFC 3CYZA 2H2KA 3PALA 5ER4X 3SS5A 4ICBA 4PE0A 1NCYA 4N1GA 4USLA 1MXLC 1G4YR 5DKQA 1F55A 2KLDA 1IGVA 1TUJA 2CCMA 1UP5A 3CZ0A 3FWCA 2KFGA 4PE4A 4DCKA 1NP8A 4D1EA 1CLBA 4P5OE 5K89A 1M63B 1MXEA 3DZTA 1LA0A 3VGOA 3NSKA 4GGFC 1UURA 3DVMA 2FJYA 3DVJA 3D74A 4NDCA 2FCEA 1YX7A 1SBJA 2Y1MA 2O60A 2JNFA 1S6IA 1XK4C 1XFXO 2JZIA 3B87A 3KPXA 4FTGA 4OV2A 3MSEB 2P71A 5D3OA 1IJ5A 3BOWA 1OOGA 2I94A 2KNEA 4JPZB 1BG1A 2MHHA 4MZLA 3SG5A 1CM1A 1K95A 2JTZA 3KEVA 3I5GB 3O78A 2KPHA 3BUXB 1SL8A 1GGZA 2JWWA 5ER5A 5HKWA 4M2QA 1QTXA 4DS7A 1S36A 1QIVA 2WNDA 2K8MB 4C0LA 1UHKA 2CXJA 2PYQA 1MQ1A 3CZTX 1QV1A 3KHEA 5TNCA 2M97A 2FOTA 4ORCB 3BXKA 3TUYC 4PCWA 2WORA 4I5KA 1MUXA 2K7BA 2KGBC 1QLKA 2L2EA 2HPSA 2B1UA 3GOFA 1WRLA 1IIOA 2LHIA 3SS3A 3FE8A 2L4IA 2BE4A 3NSLA 3PSRA 4HRGA 1UHIA 2ZNEA 2FJUB 2L5XB 2JRFA 2VRGA 2I18A 1NX0A 3CGAA 1K93D 3EK8A 2KGRA 1C07A 1BMOA 1K9KA 3PN7B 2LC5A 4PHJA 1NUBA 1WLMA 1J1DA 1N0YA 1XFVO 5I2QA 2KQYA 1KSOA 1KQMB 1QWVA 3NHIA 4L9MA 2NZ0A 4GNKB 5KTYA 2WCJA 4NDBA 3E3RA 1Y0VH 2L0PA 2K7CA 2ZRTA 4NDDA 1RWYA 2D8NA 3DVKA 1A75A 5AEQA 1JFJA 3CTNA 1KFXL 3OB1B 2GTEA 1OE9B 3CR5X 5B8IB 3BFHA 3ZWHA 1EJ3A 1QS7A 3SG2A 4PHKA 2LMVA 1ORGA 4HSZA 1QX2A 3K1EA 2MRDA 2LVJA 1DQEA 5CSFA 2LLSA 2BBNA 4I5JA 3OHMB 1Y1UA 2PVBA 2Y1NA 3TUYB 2DOQA 2V53A 2PALA 1XFRA 2L51A 5I8NA 3IF7A 1NCZA 1QLSA 3BUWB 1ZMZA 1L7ZA 1IQ3A 1CFCA 4PHMA 1MF8B 2WCBA 1F70A 2AMIA 1G8IA 3PATA 1ZUZA 1DVIA 4OR9B 2PMYA 3TDIA 1KQVA 2BCXA 1EG3A 1GJYA 1H8BA 4F0ZB 2E30A 5EL2A 5J3XA 1P28A 2IS9A 3I5GC 4JQ0D 1WRKA 3R72A 1J7PA 4OVNF 2L4HA 1CDLA 2LNKA 2P6BB 1SRAA 1B7TY 2L2CA 1N65A 1X02A 2ZKMX 3VRPA 2I7AA 1ALVA 1QATA 2E6WA 3BUNB 1EXRA 5HLOA 2LUXA 4ZCVA 1NWDA 4C0JA 1CFDA 2M7LA 1SW8A 1TRFA 4BY4A 1KWOC 4AQJA 1DC1A 2WCKA 4F7FA 5HKZA 4YGCB 3L4AA 1MHOA 1F4OA 2JT3A 3NSOA 1QVIY 1L2OC 1CDPA 2I2RE 4YI8A 3TDUA 1RROA 1KFXS 2H61A 1TUZA 3BQ3A 4OKHA 3CZ1A 2MBXA 3BJHA 2L50A 3F45A 1PSBA 1RTP1 2JXLA 3CR2A 3OP0A 3R1OA 1YURA 1K94A 1J7OA 1A4PA 1SYMA 2WC8A 3GK1A 3TZ1A 3O2PA 3B7AA 1BT6A 1MWNA 2H8VA 3K21A 4M2OA 5I2OA 1NX1A 1TN4A 1BODA 3C1VA 3D76A 1CNPA 3VRNA 3L47A 2QEVA 3DY9A 1ALWA 1AUIB 1OMVA 3EVUA 2K2AA 3EK7A 2BE6A 1LXFC 3HX4A 3A4UB 2COLB 3JTDC 2LM5A 3RZSA 3GK4X 1NPQA 4E68A 1DELA 1IJ6A 2NXQA 3KF9A 2JQ6A 1UHHA 4PDZA 1AJ5A 1E8AA 1Q80A 1SL7A 3NXAA 5DKRA 5FI7A 3BUMB 4CPVA 3CR4X 1CFPA 3PLFB 2JOJA 1HT9A 2MJWB 1TIZA 3CLNA 4MSPA 2LE9B 2LANA 2PQLA 5AXIA 4N5XA 1U5IA 3PJIA 2KFHA 3EKHA 1OSAA 1KFUL 1R2UA 1RJVA 1A03A 1RECA 3VRRA 2WCFA 2CT9A 2KLEA 1BLQA 2F3ZA 3BYAA 2RGIA 2JPTA 1A75B 2JTTA 4OCIA 4N1FA 4YBHB 2LP3A 2LMTA 5PALA 4PT1A 2AUCA 1DJIA 2AAOA 4CFQA 1JF0A 3FE6A 4GPLB 2Q4UA 3S0EA 3QMEA 1DEKA 2CNPA 1IQ5A 4GFTA 1WY9A 1WLZA 3IQQA 1XFZO 5D7FA 1KK7Z 3S0GA 1OZSA 2PRUA 1PULA 3EG5B 5FI6A 2KYCA 2QDIA 5CPVA 1ZOTB 1TTXA 1C3YA 5KU1A 3H4SE 1A2XA 2K7OA 2GGZA 3TS5B 1SPYA 1LINA 1K9UA 1V1FA 2NCOA 3SS4A 1W9ZA 3SJSA 4JKTA 2BECA 3D77A 1K96A 3AAKA 1C7WA 2BKHB 4CFRA 2A4JA 1CMFA 2LAPA 3I5HB 4XYNA 3RM1A 4PHNA 3LLEA 1LS8A 2KI4B 3TS5C 1CB1A 1F71A 3TDZA 1AK8A 1KCYA 1JSAA 2MAZA 4FQOA 4Q04A 4DUQA 5D69A 1R6PA 1WDCC 2PASA 1YUTA 3B6XA 1B8RA 2JT0A 3FIAA 1XA5A 4KYNA 3O6BA 4PE1A 2M29A 2LVIA 3SIAA 3O4YA 1Y1AA 1SMGA 4WRIA 4I5NB 3S0FA 3RLZA 1TOPA 3BOWB 4WQ2A 5JOLA 1YRTB 1IG5A 1N2DA 1FW4A 5HYDA 3LL8B 3JVTB 2M1KB 1S5GZ 1UWOA 1G33A 1NYAA 1Z2CB 2BNXA 1QJTA 4HREE 4NQGA 4DRWA 1FPWA 3EVVA 1QV0A 1J1EA 1JUOA 2LVVA 4GUKA 5F6TA 2KSPA 4GGNA 1KK7Y 1CDNA 3OGNA 1LKJA 1C3ZA 2K60A 1DJYA 3EK4A 3SG4A 1SK6D 2LLUA 1BR4B 2MLEC 4MZJA 2QEOA 3LCPC 1UHNA 2BL0C 2F3YA 4CIDA 4MEWA 1BOCA 3LK1A 3S0AA 1BF5A 1DGUA 2EHBA 1F8HA 4XJKB 1TNWA 3I5IB 2M1UA 2ZNDA 3BFAA 1M39A 5G08A 3DXLA 3V2LA 2R2IA 1SCMB 2EC6B 3VB1A 3A8RA 1CTRA 1K8UA 1CKKA 2F2OA 1EL4A 2PSRA 2KOTA 1CLMA 1OZOA 1SSEB 1ODBA 1OW4A 2L98A 4PALA 2LUCA 3SG3A 2K2FA 1C7VA 1KK8B 1OQPA 2BCAA 3OB2B 1IRJA 2HETA 4QJ5B 4YGAA 1TCOB 2KAXA 1JBAA 1XFUO 3M0WA 4I5LB 1D1OA 4ZCUA 2OS8B 1B8CA 1RK9A 1BJFA 4YGDB 1OMDA 5FYXA 3AKBA 3WXAA 3FS7A 1L2OB 3CZ2A 3DYEA 1MR8A 3DD4A 3IVTA 2CBLA 1TNQA 1WRZA 1YX8A 2WCHA 3BUOB 5AERA 1B47A 1UHJA 1K2HA 3CABA 2GGMA 1W7JB 1KWOB 2OTGC 3EKJA 4GBAA 5GQQC 1SR6C 1XK4A 2KFFA 3R1PA 2QACA 5HKYA 1EH2A 1IH0A 2QPTA 2ZFDA 1DF0A 1YUSA 1GM0A 3B86A 3O4XA 3D10A 1SR6B 2HQWA 1TNPA 1CFFA 2OTGB 2G9BA 3DF0A 3PM8A 3WHUB 2Y5IA 1CM4A 1HQVA 3D75A 1BU3A 1TNXA 1QVIZ 2NLNA 3D0YA 2KI6D 2LVKA 3PFVA 2HF5A 4INXA 2ISDA 1XVJA 2LV7A 3CWGA 2P70A 3ICBA 1F54A 4OZDA 1DJGA 1S3PA 4TNCA 5I2LA 1Y6WA 1H4BA 5HL1A 1U5IB 3AAJA 3IQOA 2OS8C 4ORAB 1OOJA 3UNWA 2JPOA 2WC6A 1PRWA 4CLNA 2LLTA 1AP4A 5DICA 2BBMA 4UPGA 2M49B 2KI6C 1FBVA 1K90D 3HCMA 1J7RA 1KK8C 2QEBA 3N7HA 3WNXB 4BY5A 4U8DA 2JNXA 4YI9A 1NSHA 3S0BA 2ZN9A 4MLWA 3KO0A 5IBWA 2Q91A 1A29A 1LVCD 1S6JA 1SCMC 1B8LA 2EC6C 3ZNIA 1AVSA 4MRXA 3I5IC 2LHLA 1DJHA 1M31A 1YUUA 4YRUA 4MZKA 4MVFA 2OPOA 1M45A 2BL0B 5AFPA 1SL9A 1BR1B 1J55A 3EVRA 1XO5A 1B4CA 1NX2A 2WC5A 1CLLA 3OX6A 1QXPA 1KQMC 1SNLA 2O5GA 3AKAA 1TCFA 3NSIA 3VRQA 2Y4QA 1KFUS 3PN7C 2H61C 3JVTC 2BCBA 4MRYA 1S1EA 1K9PA 4IL1A 1B7TZ 1V1GA 2JXCA 3Q8IA 2JU0A 3CDNA 4HRHA 4AQIA 1SCVA 4INWA 2BAPA 3QRXA 2WCMA 1FF1A 4AOMA 4JWQA 1TWOA 3DF0B 2LMUA 2KHNA 2ERBA 3WHTB 4A4CA 1DF0B 2LCPA 5JJGA 1WDCB 1NCXA 1YTZC 2KYFA 4PE7A 4GGFA 1CMGA 2GV5A 2KI4C 1RFJA 1UUSA 2TN4A 1GQMA 2KDHA 3I5HC 4JD9A 1GGWA 2HQ8A 3FWBA 1Z4HA 2LP2A 2NCPA 1AJ4A 3L4LA 1IWQA 2JULA 2K61A 1OOFA 5BPJA 2KQ6A 1DGVA 2K0JA 5CSJA 2KBIA 2SCPA 5FI2A 2WOSA 3SG7A 2F8PA 1JF2A 5I94A 1J7QA 1NX3A 4DIRA 1S26D 2KAYA 1DT7B 1QX5B 4M2PA 1XFYO 1PK0D 2EGDA 1PVBA 4QJ3B 2M9GA 1DMOA 1YVHA 1OMRA 2JC2A 1W7IB 2CTNA 1PALA 4YGBB 1FI6A 1YVLA 4FQTA 1XYDA 1IKUA 3B88A 3D0YB 2L5YA 2WCLA 1EG4A 3NHTA 3R1VA 1QIWA 2JT8A 4MBEA 1JWDA 1FI5A 4P2YB 3PM2A 4A4BA 1ZACA 1NIWA 1YRUB 3S0DA 3SIBA 3OX5A 4ORBB 1DJWA 1PSRA 5CSNA 3D78A 5AANA 3SG6A 3NGVA 1AHRA 2QEHA 5HLVA 1QASA 2M8UA 4IJ7A 2ZRSA 1SY9A 2SASA 4WQ3A 3UO9A 4YGEB 2M3WA 3I5FB 1M46A 3CS1A 2WCEA 2BKIB 2F33A 2MA2A 4XJKA 1B1GA 1S5GY 2G2BA 1ZFSA 2M7NA 3BFBA 1CDMA 4QJ4B 2KBMA 1YR5A 1JC2A 4GAOA 1KSMA 1PVAA 5DKNA 2F2PA 3JTDB 5CSIA 4C0KA 1JFKA 1DJZA 3OBVA 2YGUA 3VROA 1S6CA 4MN0A
chains in the Genus database with same CATH topology
3GK2A 1SKTA 4R1EA 4ETOA 1VRKA 2M0RA 1DJXA 1Y1XA 3I5FC 2KAVA 2ZN8A 1XFWO 1DTLA 2FCDA 3DVEA 5KSZA 2K7DA 1F4QA 3LK0A 1QX7A 1LA3A 1B9AA 2MLFC 2H2KA 3PALA 5ER4X 4ICBA 4PE0A 1NCYA 4N1GA 4USLA 1MXLC 1G4YR 5DKQA 1F55A 1IGVA 2CCMA 3FWCA 1UP5A 4PE4A 4DCKA 2KFGA 1CLBA 1NP8A 4D1EA 4P5OE 5K89A 1M63B 1MXEA 1LA0A 3VGOA 3NSKA 4GGFC 1UURA 3DVMA 4NDCA 3DVJA 2FCEA 1YX7A 1SBJA 2Y1MA 2O60A 2JNFA 1S6IA 1XK4C 1XFXO 2JZIA 3KPXA 4FTGA 4OV2A 3MSEB 1IJ5A 3BOWA 2I94A 2KNEA 4JPZB 1BG1A 2MHHA 4MZLA 3SG5A 1CM1A 1K95A 2JTZA 3KEVA 3I5GB 3O78A 3BUXB 1SL8A 1GGZA 2JWWA 5ER5A 5HKWA 4M2QA 1QTXA 4DS7A 1S36A 1QIVA 2WNDA 2K8MB 4C0LA 1UHKA 2CXJA 1MQ1A 3CZTX 1QV1A 3KHEA 5TNCA 2M97A 2FOTA 4ORCB 3BXKA 3TUYC 4PCWA 2WORA 4I5KA 1MUXA 2K7BA 2KGBC 1QLKA 2L2EA 2HPSA 2B1UA 3GOFA 1WRLA 2LHIA 2L4IA 2BE4A 3NSLA 3PSRA 4HRGA 1UHIA 2ZNEA 2FJUB 2L5XB 2JRFA 2VRGA 2I18A 1NX0A 3CGAA 1K93D 3EK8A 2KGRA 1C07A 1BMOA 1K9KA 3PN7B 2LC5A 4PHJA 1NUBA 1WLMA 1J1DA 1N0YA 1XFVO 5I2QA 2KQYA 1KSOA 1KQMB 4L9MA 2NZ0A 4GNKB 5KTYA 4NDBA 3E3RA 1Y0VH 2L0PA 2K7CA 2ZRTA 4NDDA 1RWYA 2D8NA 3DVKA 1A75A 5AEQA 1JFJA 3CTNA 1KFXL 3OB1B 1OE9B 3CR5X 5B8IB 3ZWHA 1EJ3A 1QS7A 3SG2A 4PHKA 2LMVA 4HSZA 1QX2A 2MRDA 2LVJA 5CSFA 2LLSA 2BBNA 4I5JA 3OHMB 1Y1UA 2PVBA 2Y1NA 3TUYB 2DOQA 2V53A 2PALA 2L51A 5I8NA 3IF7A 1NCZA 1QLSA 3BUWB 1ZMZA 1L7ZA 1IQ3A 1CFCA 4PHMA 1MF8B 2WCBA 1F70A 2AMIA 1G8IA 3PATA 1ZUZA 1DVIA 4OR9B 2PMYA 3TDIA 1KQVA 2BCXA 1EG3A 1GJYA 1H8BA 4F0ZB 2E30A 5J3XA 2IS9A 3I5GC 4JQ0D 1WRKA 1J7PA 4OVNF 2L4HA 1CDLA 2LNKA 2P6BB 1SRAA 1B7TY 1N65A 1X02A 2ZKMX 3VRPA 2I7AA 1ALVA 1QATA 2E6WA 3BUNB 1EXRA 5HLOA 2LUXA 4ZCVA 1NWDA 4C0JA 1CFDA 2M7LA 1SW8A 1TRFA 4BY4A 1KWOC 4AQJA 5HKZA 4YGCB 1MHOA 1F4OA 2JT3A 3NSOA 1QVIY 1L2OC 1CDPA 2I2RE 4YI8A 3TDUA 1RROA 1KFXS 2H61A 3BQ3A 4OKHA 2MBXA 3F45A 2L50A 1PSBA 1RTP1 2JXLA 3CR2A 3OP0A 1YURA 1K94A 1J7OA 1A4PA 1SYMA 2WC8A 3GK1A 3TZ1A 3O2PA 1BT6A 1MWNA 3K21A 4M2OA 5I2OA 1BODA 1NX1A 1TN4A 3C1VA 1CNPA 3VRNA 1ALWA 1AUIB 1OMVA 3EVUA 2K2AA 3EK7A 2BE6A 1LXFC 3HX4A 3A4UB 2COLB 3JTDC 2LM5A 3GK4X 1NPQA 4E68A 1IJ6A 2NXQA 3KF9A 2JQ6A 1UHHA 4PDZA 1AJ5A 1E8AA 1Q80A 1SL7A 3NXAA 5DKRA 1CFPA 3BUMB 4CPVA 3CR4X 3PLFB 2JOJA 1HT9A 2MJWB 1TIZA 3CLNA 4MSPA 2LE9B 2LANA 5AXIA 4N5XA 1U5IA 2KFHA 3EKHA 1OSAA 1KFUL 1R2UA 1RJVA 1A03A 1RECA 3VRRA 2WCFA 2CT9A 1BLQA 2F3ZA 3BYAA 2RGIA 2JPTA 1A75B 2JTTA 4OCIA 4N1FA 4YBHB 2LP3A 2LMTA 5PALA 2AUCA 1DJIA 2AAOA 4CFQA 1JF0A 4GPLB 2Q4UA 2CNPA 1IQ5A 4GFTA 1WY9A 1WLZA 3IQQA 1XFZO 5D7FA 1KK7Z 1OZSA 2PRUA 1PULA 2KYCA 5CPVA 1ZOTB 1TTXA 5KU1A 3H4SE 1A2XA 2K7OA 2GGZA 3TS5B 1SPYA 1LINA 1K9UA 1V1FA 2NCOA 3SJSA 2BECA 1K96A 3AAKA 1C7WA 2BKHB 4CFRA 2A4JA 1CMFA 2LAPA 3I5HB 4XYNA 3RM1A 4PHNA 3LLEA 3TS5C 2KI4B 1CB1A 1F71A 3TDZA 1AK8A 1KCYA 1JSAA 2MAZA 4FQOA 4Q04A 4DUQA 5D69A 1R6PA 1WDCC 2PASA 1YUTA 1B8RA 2JT0A 3FIAA 1XA5A 3O6BA 4PE1A 2M29A 2LVIA 3SIAA 3O4YA 1Y1AA 1SMGA 4WRIA 4I5NB 3RLZA 1TOPA 3BOWB 4WQ2A 5JOLA 1YRTB 1IG5A 1N2DA 1FW4A 5HYDA 3LL8B 3JVTB 2M1KB 1S5GZ 1UWOA 1G33A 1NYAA 1FPWA 1QJTA 4HREE 4NQGA 4DRWA 3EVVA 1QV0A 1J1EA 1JUOA 2LVVA 4GUKA 5F6TA 2KSPA 4GGNA 1KK7Y 1CDNA 1LKJA 1DJYA 3EK4A 3SG4A 1SK6D 2LLUA 1BR4B 2MLEC 4MZJA 3LCPC 1UHNA 2BL0C 2F3YA 4CIDA 4MEWA 1BOCA 3LK1A 1BF5A 1DGUA 2EHBA 1F8HA 4XJKB 1TNWA 3I5IB 2M1UA 2ZNDA 1M39A 5G08A 2R2IA 1SCMB 2EC6B 3A8RA 1CTRA 1K8UA 1CKKA 2F2OA 1EL4A 2PSRA 2KOTA 1CLMA 1OZOA 2L98A 1ODBA 4PALA 2LUCA 3SG3A 2K2FA 1C7VA 1KK8B 1OQPA 2BCAA 3OB2B 1IRJA 2HETA 4QJ5B 4YGAA 1TCOB 2KAXA 1JBAA 1XFUO 3M0WA 4I5LB 1D1OA 4ZCUA 2OS8B 1B8CA 1RK9A 1BJFA 4YGDB 1OMDA 5FYXA 3AKBA 3WXAA 3FS7A 1L2OB 1MR8A 3DD4A 2CBLA 1TNQA 1WRZA 1YX8A 5AERA 3BUOB 1K2HA 1B47A 1UHJA 2GGMA 1W7JB 1KWOB 2OTGC 3EKJA 4GBAA 5GQQC 1SR6C 1XK4A 2KFFA 5HKYA 2QACA 1EH2A 1IH0A 2QPTA 2ZFDA 1DF0A 1YUSA 3D10A 1SR6B 2HQWA 1TNPA 1CFFA 2OTGB 2G9BA 3DF0A 3PM8A 3WHUB 2Y5IA 1CM4A 1HQVA 1BU3A 1TNXA 1QVIZ 2NLNA 3D0YA 2KI6D 2LVKA 3PFVA 2HF5A 2ISDA 1XVJA 2LV7A 3CWGA 3ICBA 1F54A 1H4BA 1DJGA 1S3PA 4TNCA 5I2LA 1Y6WA 1U5IB 3AAJA 3IQOA 2OS8C 4ORAB 1OOJA 1PRWA 4CLNA 2LLTA 1AP4A 2BBMA 4UPGA 2M49B 2KI6C 1FBVA 1K90D 3HCMA 1J7RA 1KK8C 4BY5A 3WNXB 4U8DA 2JNXA 4YI9A 1NSHA 2ZN9A 4MLWA 3KO0A 5IBWA 2Q91A 1A29A 1LVCD 1S6JA 1SCMC 1B8LA 2EC6C 3ZNIA 1AVSA 4MRXA 3I5IC 2LHLA 1DJHA 1M31A 1YUUA 4YRUA 4MZKA 4MVFA 2OPOA 1M45A 2BL0B 5AFPA 1SL9A 1BR1B 1J55A 3EVRA 1XO5A 1B4CA 1NX2A 1CLLA 3OX6A 1QXPA 1KQMC 1SNLA 2O5GA 3AKAA 1TCFA 3NSIA 3VRQA 2Y4QA 1KFUS 3PN7C 2H61C 3JVTC 2BCBA 4MRYA 1S1EA 1K9PA 4IL1A 1B7TZ 1V1GA 2JXCA 4HRHA 2JU0A 4AQIA 1SCVA 3QRXA 1FF1A 4AOMA 4JWQA 3DF0B 2LMUA 2KHNA 3WHTB 4A4CA 1DF0B 2LCPA 5JJGA 1WDCB 1NCXA 1YTZC 2KYFA 4PE7A 4GGFA 1CMGA 2GV5A 2KI4C 1RFJA 1UUSA 2TN4A 1GQMA 2KDHA 3I5HC 1GGWA 2HQ8A 3FWBA 2LP2A 2NCPA 1AJ4A 1IWQA 2JULA 2K61A 5BPJA 2KQ6A 1DGVA 2K0JA 5CSJA 2KBIA 2SCPA 3SG7A 2WOSA 2F8PA 1JF2A 1J7QA 1NX3A 4DIRA 1S26D 2KAYA 1DT7B 1QX5B 4M2PA 1XFYO 1PK0D 2EGDA 1PVBA 4QJ3B 2M9GA 1DMOA 1YVHA 1OMRA 2JC2A 1W7IB 2CTNA 1PALA 4YGBB 1FI6A 1YVLA 1XYDA 1IKUA 3D0YB 1EG4A 1QIWA 2JT8A 4MBEA 1JWDA 1FI5A 4P2YB 4A4BA 1ZACA 1NIWA 1YRUB 3SIBA 3OX5A 4ORBB 1DJWA 1PSRA 5CSNA 3SG6A 5AANA 1AHRA 5HLVA 1QASA 2M8UA 2ZRSA 1SY9A 2SASA 4WQ3A 4YGEB 2M3WA 3I5FB 1M46A 3CS1A 2WCEA 2BKIB 2F33A 2MA2A 4XJKA 1B1GA 1S5GY 2G2BA 1ZFSA 2M7NA 1CDMA 4QJ4B 2KBMA 1YR5A 1JC2A 4GAOA 1KSMA 1PVAA 5DKNA 2F2PA 3JTDB 5CSIA 4C0KA 1JFKA 1DJZA 3VROA 1S6CA 4MN0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GK2 A;  1SKT A;  4R1E A;  4ETO A;  1VRK A;  2M0R A;  1DJX A;  1Y1X A;  3I5F C;  2KAV A;  2ZN8 A;  1XFW O;  1DTL A;  2FCD A;  3DVE A;  5KSZ A;  2K7D A;  1F4Q A;  3LK0 A;  1QX7 A;  1LA3 A;  1B9A A;  2MLF C;  2H2K A;  3PAL A;  5ER4 X;  4ICB A;  4PE0 A;  1NCY A;  4N1G A;  4USL A;  1MXL C;  1G4Y R;  5DKQ A;  1F55 A;  1IGV A;  2CCM A;  3FWC A;  1UP5 A;  4PE4 A;  4DCK A;  2KFG A;  1CLB A;  1NP8 A;  4D1E A;  4P5O E;  5K89 A;  1M63 B;  1MXE A;  1LA0 A;  3VGO A;  3NSK A;  4GGF C;  1UUR A;  3DVM A;  4NDC A;  3DVJ A;  2FCE A;  1YX7 A;  1SBJ A;  2Y1M A;  2O60 A;  2JNF A;  1S6I A;  1XK4 C;  1XFX O;  2JZI A;  3KPX A;  4FTG A;  4OV2 A;  3MSE B;  1IJ5 A;  3BOW A;  2I94 A;  2KNE A;  4JPZ B;  1BG1 A;  2MHH A;  4MZL A;  3SG5 A;  1CM1 A;  1K95 A;  2JTZ A;  3KEV A;  3I5G B;  3O78 A;  3BUX B;  1SL8 A;  1GGZ A;  2JWW A;  5ER5 A;  5HKW A;  4M2Q A;  1QTX A;  4DS7 A;  1S36 A;  1QIV A;  2WND A;  2K8M B;  4C0L A;  1UHK A;  2CXJ A;  1MQ1 A;  3CZT X;  1QV1 A;  3KHE A;  5TNC A;  2M97 A;  2FOT A;  4ORC B;  3BXK A;  3TUY C;  4PCW A;  2WOR A;  4I5K A;  1MUX A;  2K7B A;  2KGB C;  1QLK A;  2L2E A;  2HPS A;  2B1U A;  3GOF A;  1WRL A;  2LHI A;  2L4I A;  2BE4 A;  3NSL A;  3PSR A;  4HRG A;  1UHI A;  2ZNE A;  2FJU B;  2L5X B;  2JRF A;  2VRG A;  2I18 A;  1NX0 A;  3CGA A;  1K93 D;  3EK8 A;  2KGR A;  1C07 A;  1BMO A;  1K9K A;  3PN7 B;  2LC5 A;  4PHJ A;  1NUB A;  1WLM A;  1J1D A;  1N0Y A;  1XFV O;  5I2Q A;  2KQY A;  1KSO A;  1KQM B;  4L9M A;  2NZ0 A;  4GNK B;  5KTY A;  4NDB A;  3E3R A;  1Y0V H;  2L0P A;  2K7C A;  2ZRT A;  4NDD A;  1RWY A;  2D8N A;  3DVK A;  1A75 A;  5AEQ A;  1JFJ A;  3CTN A;  1KFX L;  3OB1 B;  1OE9 B;  3CR5 X;  5B8I B;  3ZWH A;  1EJ3 A;  1QS7 A;  3SG2 A;  4PHK A;  2LMV A;  4HSZ A;  1QX2 A;  2MRD A;  2LVJ A;  5CSF A;  2LLS A;  2BBN A;  4I5J A;  3OHM B;  1Y1U A;  2PVB A;  2Y1N A;  3TUY B;  2DOQ A;  2V53 A;  2PAL A;  2L51 A;  5I8N A;  3IF7 A;  1NCZ A;  1QLS A;  3BUW B;  1ZMZ A;  1L7Z A;  1IQ3 A;  1CFC A;  4PHM A;  1MF8 B;  2WCB A;  1F70 A;  2AMI A;  1G8I A;  3PAT A;  1ZUZ A;  1DVI A;  4OR9 B;  2PMY A;  3TDI A;  1KQV A;  2BCX A;  1EG3 A;  1GJY A;  1H8B A;  4F0Z B;  2E30 A;  5J3X A;  2IS9 A;  3I5G C;  4JQ0 D;  1WRK A;  1J7P A;  4OVN F;  2L4H A;  1CDL A;  2LNK A;  2P6B B;  1SRA A;  1B7T Y;  1N65 A;  1X02 A;  2ZKM X;  3VRP A;  2I7A A;  1ALV A;  1QAT A;  2E6W A;  3BUN B;  1EXR A;  5HLO A;  2LUX A;  4ZCV A;  1NWD A;  4C0J A;  1CFD A;  2M7L A;  1SW8 A;  1TRF A;  4BY4 A;  1KWO C;  4AQJ A;  5HKZ A;  4YGC B;  1MHO A;  1F4O A;  2JT3 A;  3NSO A;  1QVI Y;  1L2O C;  1CDP A;  2I2R E;  4YI8 A;  3TDU A;  1RRO A;  1KFX S;  2H61 A;  3BQ3 A;  4OKH A;  2MBX A;  3F45 A;  2L50 A;  1PSB A;  1RTP 1;  2JXL A;  3CR2 A;  3OP0 A;  1YUR A;  1K94 A;  1J7O A;  1A4P A;  1SYM A;  2WC8 A;  3GK1 A;  3TZ1 A;  3O2P A;  1BT6 A;  1MWN A;  3K21 A;  4M2O A;  5I2O A;  1BOD A;  1NX1 A;  1TN4 A;  3C1V A;  1CNP A;  3VRN A;  1ALW A;  1AUI B;  1OMV A;  3EVU A;  2K2A A;  3EK7 A;  2BE6 A;  1LXF C;  3HX4 A;  3A4U B;  2COL B;  3JTD C;  2LM5 A;  3GK4 X;  1NPQ A;  4E68 A;  1IJ6 A;  2NXQ A;  3KF9 A;  2JQ6 A;  1UHH A;  4PDZ A;  1AJ5 A;  1E8A A;  1Q80 A;  1SL7 A;  3NXA A;  5DKR A;  1CFP A;  3BUM B;  4CPV A;  3CR4 X;  3PLF B;  2JOJ A;  1HT9 A;  2MJW B;  1TIZ A;  3CLN A;  4MSP A;  2LE9 B;  2LAN A;  5AXI A;  4N5X A;  1U5I A;  2KFH A;  3EKH A;  1OSA A;  1KFU L;  1R2U A;  1RJV A;  1A03 A;  1REC A;  3VRR A;  2WCF A;  2CT9 A;  1BLQ A;  2F3Z A;  3BYA A;  2RGI A;  2JPT A;  1A75 B;  2JTT A;  4OCI A;  4N1F A;  4YBH B;  2LP3 A;  2LMT A;  5PAL A;  2AUC A;  1DJI A;  2AAO A;  4CFQ A;  1JF0 A;  4GPL B;  2Q4U A;  2CNP A;  1IQ5 A;  4GFT A;  1WY9 A;  1WLZ A;  3IQQ A;  1XFZ O;  5D7F A;  1KK7 Z;  1OZS A;  2PRU A;  1PUL A;  2KYC A;  5CPV A;  1ZOT B;  1TTX A;  5KU1 A;  3H4S E;  1A2X A;  2K7O A;  2GGZ A;  3TS5 B;  1SPY A;  1LIN A;  1K9U A;  1V1F A;  2NCO A;  3SJS A;  2BEC A;  1K96 A;  3AAK A;  1C7W A;  2BKH B;  4CFR A;  2A4J A;  1CMF A;  2LAP A;  3I5H B;  4XYN A;  3RM1 A;  4PHN A;  3LLE A;  3TS5 C;  2KI4 B;  1CB1 A;  1F71 A;  3TDZ A;  1AK8 A;  1KCY A;  1JSA A;  2MAZ A;  4FQO A;  4Q04 A;  4DUQ A;  5D69 A;  1R6P A;  1WDC C;  2PAS A;  1YUT A;  1B8R A;  2JT0 A;  3FIA A;  1XA5 A;  3O6B A;  4PE1 A;  2M29 A;  2LVI A;  3SIA A;  3O4Y A;  1Y1A A;  1SMG A;  4WRI A;  4I5N B;  3RLZ A;  1TOP A;  3BOW B;  4WQ2 A;  5JOL A;  1YRT B;  1IG5 A;  1N2D A;  1FW4 A;  5HYD A;  3LL8 B;  3JVT B;  2M1K B;  1S5G Z;  1UWO A;  1G33 A;  1NYA A;  1FPW A;  1QJT A;  4HRE E;  4NQG A;  4DRW A;  3EVV A;  1QV0 A;  1J1E A;  1JUO A;  2LVV A;  4GUK A;  5F6T A;  2KSP A;  4GGN A;  1KK7 Y;  1CDN A;  1LKJ A;  1DJY A;  3EK4 A;  3SG4 A;  1SK6 D;  2LLU A;  1BR4 B;  2MLE C;  4MZJ A;  3LCP C;  1UHN A;  2BL0 C;  2F3Y A;  4CID A;  4MEW A;  1BOC A;  3LK1 A;  1BF5 A;  1DGU A;  2EHB A;  1F8H A;  4XJK B;  1TNW A;  3I5I B;  2M1U A;  2ZND A;  1M39 A;  5G08 A;  2R2I A;  1SCM B;  2EC6 B;  3A8R A;  1CTR A;  1K8U A;  1CKK A;  2F2O A;  1EL4 A;  2PSR A;  2KOT A;  1CLM A;  1OZO A;  2L98 A;  1ODB A;  4PAL A;  2LUC A;  3SG3 A;  2K2F A;  1C7V A;  1KK8 B;  1OQP A;  2BCA A;  3OB2 B;  1IRJ A;  2HET A;  4QJ5 B;  4YGA A;  1TCO B;  2KAX A;  1JBA A;  1XFU O;  3M0W A;  4I5L B;  1D1O A;  4ZCU A;  2OS8 B;  1B8C A;  1RK9 A;  1BJF A;  4YGD B;  1OMD A;  5FYX A;  3AKB A;  3WXA A;  3FS7 A;  1L2O B;  1MR8 A;  3DD4 A;  2CBL A;  1TNQ A;  1WRZ A;  1YX8 A;  5AER A;  3BUO B;  1K2H A;  1B47 A;  1UHJ A;  2GGM A;  1W7J B;  1KWO B;  2OTG C;  3EKJ A;  4GBA A;  5GQQ C;  1SR6 C;  1XK4 A;  2KFF A;  5HKY A;  2QAC A;  1EH2 A;  1IH0 A;  2QPT A;  2ZFD A;  1DF0 A;  1YUS A;  3D10 A;  1SR6 B;  2HQW A;  1TNP A;  1CFF A;  2OTG B;  2G9B A;  3DF0 A;  3PM8 A;  3WHU B;  2Y5I A;  1CM4 A;  1HQV A;  1BU3 A;  1TNX A;  1QVI Z;  2NLN A;  3D0Y A;  2KI6 D;  2LVK A;  3PFV A;  2HF5 A;  2ISD A;  1XVJ A;  2LV7 A;  3CWG A;  3ICB A;  1F54 A;  1H4B A;  1DJG A;  1S3P A;  4TNC A;  5I2L A;  1Y6W A;  1U5I B;  3AAJ A;  3IQO A;  2OS8 C;  4ORA B;  1OOJ A;  1PRW A;  4CLN A;  2LLT A;  1AP4 A;  2BBM A;  4UPG A;  2M49 B;  2KI6 C;  1FBV A;  1K90 D;  3HCM A;  1J7R A;  1KK8 C;  4BY5 A;  3WNX B;  4U8D A;  2JNX A;  4YI9 A;  1NSH A;  2ZN9 A;  4MLW A;  3KO0 A;  5IBW A;  2Q91 A;  1A29 A;  1LVC D;  1S6J A;  1SCM C;  1B8L A;  2EC6 C;  3ZNI A;  1AVS A;  4MRX A;  3I5I C;  2LHL A;  1DJH A;  1M31 A;  1YUU A;  4YRU A;  4MZK A;  4MVF A;  2OPO A;  1M45 A;  2BL0 B;  5AFP A;  1SL9 A;  1BR1 B;  1J55 A;  3EVR A;  1XO5 A;  1B4C A;  1NX2 A;  1CLL A;  3OX6 A;  1QXP A;  1KQM C;  1SNL A;  2O5G A;  3AKA A;  1TCF A;  3NSI A;  3VRQ A;  2Y4Q A;  1KFU S;  3PN7 C;  2H61 C;  3JVT C;  2BCB A;  4MRY A;  1S1E A;  1K9P A;  4IL1 A;  1B7T Z;  1V1G A;  2JXC A;  4HRH A;  2JU0 A;  4AQI A;  1SCV A;  3QRX A;  1FF1 A;  4AOM A;  4JWQ A;  3DF0 B;  2LMU A;  2KHN A;  3WHT B;  4A4C A;  1DF0 B;  2LCP A;  5JJG A;  1WDC B;  1NCX A;  1YTZ C;  2KYF A;  4PE7 A;  4GGF A;  1CMG A;  2GV5 A;  2KI4 C;  1RFJ A;  1UUS A;  2TN4 A;  1GQM A;  2KDH A;  3I5H C;  1GGW A;  2HQ8 A;  3FWB A;  2LP2 A;  2NCP A;  1AJ4 A;  1IWQ A;  2JUL A;  2K61 A;  5BPJ A;  2KQ6 A;  1DGV A;  2K0J A;  5CSJ A;  2KBI A;  2SCP A;  3SG7 A;  2WOS A;  2F8P A;  1JF2 A;  1J7Q A;  1NX3 A;  4DIR A;  1S26 D;  2KAY A;  1DT7 B;  1QX5 B;  4M2P A;  1XFY O;  1PK0 D;  2EGD A;  1PVB A;  4QJ3 B;  2M9G A;  1DMO A;  1YVH A;  1OMR A;  2JC2 A;  1W7I B;  2CTN A;  1PAL A;  4YGB B;  1FI6 A;  1YVL A;  1XYD A;  1IKU A;  3D0Y B;  1EG4 A;  1QIW A;  2JT8 A;  4MBE A;  1JWD A;  1FI5 A;  4P2Y B;  4A4B A;  1ZAC A;  1NIW A;  1YRU B;  3SIB A;  3OX5 A;  4ORB B;  1DJW A;  1PSR A;  5CSN A;  3SG6 A;  5AAN A;  1AHR A;  5HLV A;  1QAS A;  2M8U A;  2ZRS A;  1SY9 A;  2SAS A;  4WQ3 A;  4YGE B;  2M3W A;  3I5F B;  1M46 A;  3CS1 A;  2WCE A;  2BKI B;  2F33 A;  2MA2 A;  4XJK A;  1B1G A;  1S5G Y;  2G2B A;  1ZFS A;  2M7N A;  1CDM A;  4QJ4 B;  2KBM A;  1YR5 A;  1JC2 A;  4GAO A;  1KSM A;  1PVA A;  5DKN A;  2F2P A;  3JTD B;  5CSI A;  4C0K A;  1JFK A;  1DJZ A;  3VRO A;  1S6C A;  4MN0 A; 
#chains in the Genus database with same CATH topology
 1T14 A;  3GK2 A;  1SKT A;  4R1E A;  4ETO A;  1VRK A;  2M0R A;  1DJX A;  1Y1X A;  3I5F C;  2KAV A;  1OOI X;  2ZN8 A;  1XFW O;  1DTL A;  2FCD A;  3DVE A;  5KSZ A;  2K7D A;  1OOH A;  3D73 A;  1F4Q A;  3LK0 A;  1QX7 A;  3FE9 A;  1LA3 A;  1B9A A;  2MLF C;  3CYZ A;  2H2K A;  3PAL A;  5ER4 X;  3SS5 A;  4ICB A;  4PE0 A;  1NCY A;  4N1G A;  4USL A;  1MXL C;  1G4Y R;  5DKQ A;  1F55 A;  2KLD A;  1IGV A;  1TUJ A;  2CCM A;  1UP5 A;  3CZ0 A;  3FWC A;  2KFG A;  4PE4 A;  4DCK A;  1NP8 A;  4D1E A;  1CLB A;  4P5O E;  5K89 A;  1M63 B;  1MXE A;  3DZT A;  1LA0 A;  3VGO A;  3NSK A;  4GGF C;  1UUR A;  3DVM A;  2FJY A;  3DVJ A;  3D74 A;  4NDC A;  2FCE A;  1YX7 A;  1SBJ A;  2Y1M A;  2O60 A;  2JNF A;  1S6I A;  1XK4 C;  1XFX O;  2JZI A;  3B87 A;  3KPX A;  4FTG A;  4OV2 A;  3MSE B;  2P71 A;  5D3O A;  1IJ5 A;  3BOW A;  1OOG A;  2I94 A;  2KNE A;  4JPZ B;  1BG1 A;  2MHH A;  4MZL A;  3SG5 A;  1CM1 A;  1K95 A;  2JTZ A;  3KEV A;  3I5G B;  3O78 A;  2KPH A;  3BUX B;  1SL8 A;  1GGZ A;  2JWW A;  5ER5 A;  5HKW A;  4M2Q A;  1QTX A;  4DS7 A;  1S36 A;  1QIV A;  2WND A;  2K8M B;  4C0L A;  1UHK A;  2CXJ A;  2PYQ A;  1MQ1 A;  3CZT X;  1QV1 A;  3KHE A;  5TNC A;  2M97 A;  2FOT A;  4ORC B;  3BXK A;  3TUY C;  4PCW A;  2WOR A;  4I5K A;  1MUX A;  2K7B A;  2KGB C;  1QLK A;  2L2E A;  2HPS A;  2B1U A;  3GOF A;  1WRL A;  1IIO A;  2LHI A;  3SS3 A;  3FE8 A;  2L4I A;  2BE4 A;  3NSL A;  3PSR A;  4HRG A;  1UHI A;  2ZNE A;  2FJU B;  2L5X B;  2JRF A;  2VRG A;  2I18 A;  1NX0 A;  3CGA A;  1K93 D;  3EK8 A;  2KGR A;  1C07 A;  1BMO A;  1K9K A;  3PN7 B;  2LC5 A;  4PHJ A;  1NUB A;  1WLM A;  1J1D A;  1N0Y A;  1XFV O;  5I2Q A;  2KQY A;  1KSO A;  1KQM B;  1QWV A;  3NHI A;  4L9M A;  2NZ0 A;  4GNK B;  5KTY A;  2WCJ A;  4NDB A;  3E3R A;  1Y0V H;  2L0P A;  2K7C A;  2ZRT A;  4NDD A;  1RWY A;  2D8N A;  3DVK A;  1A75 A;  5AEQ A;  1JFJ A;  3CTN A;  1KFX L;  3OB1 B;  2GTE A;  1OE9 B;  3CR5 X;  5B8I B;  3BFH A;  3ZWH A;  1EJ3 A;  1QS7 A;  3SG2 A;  4PHK A;  2LMV A;  1ORG A;  4HSZ A;  1QX2 A;  3K1E A;  2MRD A;  2LVJ A;  1DQE A;  5CSF A;  2LLS A;  2BBN A;  4I5J A;  3OHM B;  1Y1U A;  2PVB A;  2Y1N A;  3TUY B;  2DOQ A;  2V53 A;  2PAL A;  1XFR A;  2L51 A;  5I8N A;  3IF7 A;  1NCZ A;  1QLS A;  3BUW B;  1ZMZ A;  1L7Z A;  1IQ3 A;  1CFC A;  4PHM A;  1MF8 B;  2WCB A;  1F70 A;  2AMI A;  1G8I A;  3PAT A;  1ZUZ A;  1DVI A;  4OR9 B;  2PMY A;  3TDI A;  1KQV A;  2BCX A;  1EG3 A;  1GJY A;  1H8B A;  4F0Z B;  2E30 A;  5EL2 A;  5J3X A;  1P28 A;  2IS9 A;  3I5G C;  4JQ0 D;  1WRK A;  3R72 A;  1J7P A;  4OVN F;  2L4H A;  1CDL A;  2LNK A;  2P6B B;  1SRA A;  1B7T Y;  2L2C A;  1N65 A;  1X02 A;  2ZKM X;  3VRP A;  2I7A A;  1ALV A;  1QAT A;  2E6W A;  3BUN B;  1EXR A;  5HLO A;  2LUX A;  4ZCV A;  1NWD A;  4C0J A;  1CFD A;  2M7L A;  1SW8 A;  1TRF A;  4BY4 A;  1KWO C;  4AQJ A;  1DC1 A;  2WCK A;  4F7F A;  5HKZ A;  4YGC B;  3L4A A;  1MHO A;  1F4O A;  2JT3 A;  3NSO A;  1QVI Y;  1L2O C;  1CDP A;  2I2R E;  4YI8 A;  3TDU A;  1RRO A;  1KFX S;  2H61 A;  1TUZ A;  3BQ3 A;  4OKH A;  3CZ1 A;  2MBX A;  3BJH A;  2L50 A;  3F45 A;  1PSB A;  1RTP 1;  2JXL A;  3CR2 A;  3OP0 A;  3R1O A;  1YUR A;  1K94 A;  1J7O A;  1A4P A;  1SYM A;  2WC8 A;  3GK1 A;  3TZ1 A;  3O2P A;  3B7A A;  1BT6 A;  1MWN A;  2H8V A;  3K21 A;  4M2O A;  5I2O A;  1NX1 A;  1TN4 A;  1BOD A;  3C1V A;  3D76 A;  1CNP A;  3VRN A;  3L47 A;  2QEV A;  3DY9 A;  1ALW A;  1AUI B;  1OMV A;  3EVU A;  2K2A A;  3EK7 A;  2BE6 A;  1LXF C;  3HX4 A;  3A4U B;  2COL B;  3JTD C;  2LM5 A;  3RZS A;  3GK4 X;  1NPQ A;  4E68 A;  1DEL A;  1IJ6 A;  2NXQ A;  3KF9 A;  2JQ6 A;  1UHH A;  4PDZ A;  1AJ5 A;  1E8A A;  1Q80 A;  1SL7 A;  3NXA A;  5DKR A;  5FI7 A;  3BUM B;  4CPV A;  3CR4 X;  1CFP A;  3PLF B;  2JOJ A;  1HT9 A;  2MJW B;  1TIZ A;  3CLN A;  4MSP A;  2LE9 B;  2LAN A;  2PQL A;  5AXI A;  4N5X A;  1U5I A;  3PJI A;  2KFH A;  3EKH A;  1OSA A;  1KFU L;  1R2U A;  1RJV A;  1A03 A;  1REC A;  3VRR A;  2WCF A;  2CT9 A;  2KLE A;  1BLQ A;  2F3Z A;  3BYA A;  2RGI A;  2JPT A;  1A75 B;  2JTT A;  4OCI A;  4N1F A;  4YBH B;  2LP3 A;  2LMT A;  5PAL A;  4PT1 A;  2AUC A;  1DJI A;  2AAO A;  4CFQ A;  1JF0 A;  3FE6 A;  4GPL B;  2Q4U A;  3S0E A;  3QME A;  1DEK A;  2CNP A;  1IQ5 A;  4GFT A;  1WY9 A;  1WLZ A;  3IQQ A;  1XFZ O;  5D7F A;  1KK7 Z;  3S0G A;  1OZS A;  2PRU A;  1PUL A;  3EG5 B;  5FI6 A;  2KYC A;  2QDI A;  5CPV A;  1ZOT B;  1TTX A;  1C3Y A;  5KU1 A;  3H4S E;  1A2X A;  2K7O A;  2GGZ A;  3TS5 B;  1SPY A;  1LIN A;  1K9U A;  1V1F A;  2NCO A;  3SS4 A;  1W9Z A;  3SJS A;  4JKT A;  2BEC A;  3D77 A;  1K96 A;  3AAK A;  1C7W A;  2BKH B;  4CFR A;  2A4J A;  1CMF A;  2LAP A;  3I5H B;  4XYN A;  3RM1 A;  4PHN A;  3LLE A;  1LS8 A;  2KI4 B;  3TS5 C;  1CB1 A;  1F71 A;  3TDZ A;  1AK8 A;  1KCY A;  1JSA A;  2MAZ A;  4FQO A;  4Q04 A;  4DUQ A;  5D69 A;  1R6P A;  1WDC C;  2PAS A;  1YUT A;  3B6X A;  1B8R A;  2JT0 A;  3FIA A;  1XA5 A;  4KYN A;  3O6B A;  4PE1 A;  2M29 A;  2LVI A;  3SIA A;  3O4Y A;  1Y1A A;  1SMG A;  4WRI A;  4I5N B;  3S0F A;  3RLZ A;  1TOP A;  3BOW B;  4WQ2 A;  5JOL A;  1YRT B;  1IG5 A;  1N2D A;  1FW4 A;  5HYD A;  3LL8 B;  3JVT B;  2M1K B;  1S5G Z;  1UWO A;  1G33 A;  1NYA A;  1Z2C B;  2BNX A;  1QJT A;  4HRE E;  4NQG A;  4DRW A;  1FPW A;  3EVV A;  1QV0 A;  1J1E A;  1JUO A;  2LVV A;  4GUK A;  5F6T A;  2KSP A;  4GGN A;  1KK7 Y;  1CDN A;  3OGN A;  1LKJ A;  1C3Z A;  2K60 A;  1DJY A;  3EK4 A;  3SG4 A;  1SK6 D;  2LLU A;  1BR4 B;  2MLE C;  4MZJ A;  2QEO A;  3LCP C;  1UHN A;  2BL0 C;  2F3Y A;  4CID A;  4MEW A;  1BOC A;  3LK1 A;  3S0A A;  1BF5 A;  1DGU A;  2EHB A;  1F8H A;  4XJK B;  1TNW A;  3I5I B;  2M1U A;  2ZND A;  3BFA A;  1M39 A;  5G08 A;  3DXL A;  3V2L A;  2R2I A;  1SCM B;  2EC6 B;  3VB1 A;  3A8R A;  1CTR A;  1K8U A;  1CKK A;  2F2O A;  1EL4 A;  2PSR A;  2KOT A;  1CLM A;  1OZO A;  1SSE B;  1ODB A;  1OW4 A;  2L98 A;  4PAL A;  2LUC A;  3SG3 A;  2K2F A;  1C7V A;  1KK8 B;  1OQP A;  2BCA A;  3OB2 B;  1IRJ A;  2HET A;  4QJ5 B;  4YGA A;  1TCO B;  2KAX A;  1JBA A;  1XFU O;  3M0W A;  4I5L B;  1D1O A;  4ZCU A;  2OS8 B;  1B8C A;  1RK9 A;  1BJF A;  4YGD B;  1OMD A;  5FYX A;  3AKB A;  3WXA A;  3FS7 A;  1L2O B;  3CZ2 A;  3DYE A;  1MR8 A;  3DD4 A;  3IVT A;  2CBL A;  1TNQ A;  1WRZ A;  1YX8 A;  2WCH A;  3BUO B;  5AER A;  1B47 A;  1UHJ A;  1K2H A;  3CAB A;  2GGM A;  1W7J B;  1KWO B;  2OTG C;  3EKJ A;  4GBA A;  5GQQ C;  1SR6 C;  1XK4 A;  2KFF A;  3R1P A;  2QAC A;  5HKY A;  1EH2 A;  1IH0 A;  2QPT A;  2ZFD A;  1DF0 A;  1YUS A;  1GM0 A;  3B86 A;  3O4X A;  3D10 A;  1SR6 B;  2HQW A;  1TNP A;  1CFF A;  2OTG B;  2G9B A;  3DF0 A;  3PM8 A;  3WHU B;  2Y5I A;  1CM4 A;  1HQV A;  3D75 A;  1BU3 A;  1TNX A;  1QVI Z;  2NLN A;  3D0Y A;  2KI6 D;  2LVK A;  3PFV A;  2HF5 A;  4INX A;  2ISD A;  1XVJ A;  2LV7 A;  3CWG A;  2P70 A;  3ICB A;  1F54 A;  4OZD A;  1DJG A;  1S3P A;  4TNC A;  5I2L A;  1Y6W A;  1H4B A;  5HL1 A;  1U5I B;  3AAJ A;  3IQO A;  2OS8 C;  4ORA B;  1OOJ A;  3UNW A;  2JPO A;  2WC6 A;  1PRW A;  4CLN A;  2LLT A;  1AP4 A;  5DIC A;  2BBM A;  4UPG A;  2M49 B;  2KI6 C;  1FBV A;  1K90 D;  3HCM A;  1J7R A;  1KK8 C;  2QEB A;  3N7H A;  3WNX B;  4BY5 A;  4U8D A;  2JNX A;  4YI9 A;  1NSH A;  3S0B A;  2ZN9 A;  4MLW A;  3KO0 A;  5IBW A;  2Q91 A;  1A29 A;  1LVC D;  1S6J A;  1SCM C;  1B8L A;  2EC6 C;  3ZNI A;  1AVS A;  4MRX A;  3I5I C;  2LHL A;  1DJH A;  1M31 A;  1YUU A;  4YRU A;  4MZK A;  4MVF A;  2OPO A;  1M45 A;  2BL0 B;  5AFP A;  1SL9 A;  1BR1 B;  1J55 A;  3EVR A;  1XO5 A;  1B4C A;  1NX2 A;  2WC5 A;  1CLL A;  3OX6 A;  1QXP A;  1KQM C;  1SNL A;  2O5G A;  3AKA A;  1TCF A;  3NSI A;  3VRQ A;  2Y4Q A;  1KFU S;  3PN7 C;  2H61 C;  3JVT C;  2BCB A;  4MRY A;  1S1E A;  1K9P A;  4IL1 A;  1B7T Z;  1V1G A;  2JXC A;  3Q8I A;  2JU0 A;  3CDN A;  4HRH A;  4AQI A;  1SCV A;  4INW A;  2BAP A;  3QRX A;  2WCM A;  1FF1 A;  4AOM A;  4JWQ A;  1TWO A;  3DF0 B;  2LMU A;  2KHN A;  2ERB A;  3WHT B;  4A4C A;  1DF0 B;  2LCP A;  5JJG A;  1WDC B;  1NCX A;  1YTZ C;  2KYF A;  4PE7 A;  4GGF A;  1CMG A;  2GV5 A;  2KI4 C;  1RFJ A;  1UUS A;  2TN4 A;  1GQM A;  2KDH A;  3I5H C;  4JD9 A;  1GGW A;  2HQ8 A;  3FWB A;  1Z4H A;  2LP2 A;  2NCP A;  1AJ4 A;  3L4L A;  1IWQ A;  2JUL A;  2K61 A;  1OOF A;  5BPJ A;  2KQ6 A;  1DGV A;  2K0J A;  5CSJ A;  2KBI A;  2SCP A;  5FI2 A;  2WOS A;  3SG7 A;  2F8P A;  1JF2 A;  5I94 A;  1J7Q A;  1NX3 A;  4DIR A;  1S26 D;  2KAY A;  1DT7 B;  1QX5 B;  4M2P A;  1XFY O;  1PK0 D;  2EGD A;  1PVB A;  4QJ3 B;  2M9G A;  1DMO A;  1YVH A;  1OMR A;  2JC2 A;  1W7I B;  2CTN A;  1PAL A;  4YGB B;  1FI6 A;  1YVL A;  4FQT A;  1XYD A;  1IKU A;  3B88 A;  3D0Y B;  2L5Y A;  2WCL A;  1EG4 A;  3NHT A;  3R1V A;  1QIW A;  2JT8 A;  4MBE A;  1JWD A;  1FI5 A;  4P2Y B;  3PM2 A;  4A4B A;  1ZAC A;  1NIW A;  1YRU B;  3S0D A;  3SIB A;  3OX5 A;  4ORB B;  1DJW A;  1PSR A;  5CSN A;  3D78 A;  5AAN A;  3SG6 A;  3NGV A;  1AHR A;  2QEH A;  5HLV A;  1QAS A;  2M8U A;  4IJ7 A;  2ZRS A;  1SY9 A;  2SAS A;  4WQ3 A;  3UO9 A;  4YGE B;  2M3W A;  3I5F B;  1M46 A;  3CS1 A;  2WCE A;  2BKI B;  2F33 A;  2MA2 A;  4XJK A;  1B1G A;  1S5G Y;  2G2B A;  1ZFS A;  2M7N A;  3BFB A;  1CDM A;  4QJ4 B;  2KBM A;  1YR5 A;  1JC2 A;  4GAO A;  1KSM A;  1PVA A;  5DKN A;  2F2P A;  3JTD B;  5CSI A;  4C0K A;  1JFK A;  1DJZ A;  3OBV A;  2YGU A;  3VRO A;  1S6C A;  4MN0 A; 
#chains in the Genus database with same CATH homology
 3GK2 A;  1SKT A;  4R1E A;  4ETO A;  1VRK A;  2M0R A;  1DJX A;  1Y1X A;  3I5F C;  2KAV A;  2ZN8 A;  1XFW O;  1DTL A;  2FCD A;  3DVE A;  5KSZ A;  2K7D A;  1F4Q A;  3LK0 A;  1QX7 A;  1LA3 A;  1B9A A;  2MLF C;  2H2K A;  3PAL A;  5ER4 X;  4ICB A;  4PE0 A;  1NCY A;  4N1G A;  4USL A;  1MXL C;  1G4Y R;  5DKQ A;  1F55 A;  1IGV A;  2CCM A;  3FWC A;  1UP5 A;  4PE4 A;  4DCK A;  2KFG A;  1CLB A;  1NP8 A;  4D1E A;  4P5O E;  5K89 A;  1M63 B;  1MXE A;  1LA0 A;  3VGO A;  3NSK A;  4GGF C;  1UUR A;  3DVM A;  4NDC A;  3DVJ A;  2FCE A;  1YX7 A;  1SBJ A;  2Y1M A;  2O60 A;  2JNF A;  1S6I A;  1XK4 C;  1XFX O;  2JZI A;  3KPX A;  4FTG A;  4OV2 A;  3MSE B;  1IJ5 A;  3BOW A;  2I94 A;  2KNE A;  4JPZ B;  1BG1 A;  2MHH A;  4MZL A;  3SG5 A;  1CM1 A;  1K95 A;  2JTZ A;  3KEV A;  3I5G B;  3O78 A;  3BUX B;  1SL8 A;  1GGZ A;  2JWW A;  5ER5 A;  5HKW A;  4M2Q A;  1QTX A;  4DS7 A;  1S36 A;  1QIV A;  2WND A;  2K8M B;  4C0L A;  1UHK A;  2CXJ A;  1MQ1 A;  3CZT X;  1QV1 A;  3KHE A;  5TNC A;  2M97 A;  2FOT A;  4ORC B;  3BXK A;  3TUY C;  4PCW A;  2WOR A;  4I5K A;  1MUX A;  2K7B A;  2KGB C;  1QLK A;  2L2E A;  2HPS A;  2B1U A;  3GOF A;  1WRL A;  2LHI A;  2L4I A;  2BE4 A;  3NSL A;  3PSR A;  4HRG A;  1UHI A;  2ZNE A;  2FJU B;  2L5X B;  2JRF A;  2VRG A;  2I18 A;  1NX0 A;  3CGA A;  1K93 D;  3EK8 A;  2KGR A;  1C07 A;  1BMO A;  1K9K A;  3PN7 B;  2LC5 A;  4PHJ A;  1NUB A;  1WLM A;  1J1D A;  1N0Y A;  1XFV O;  5I2Q A;  2KQY A;  1KSO A;  1KQM B;  4L9M A;  2NZ0 A;  4GNK B;  5KTY A;  4NDB A;  3E3R A;  1Y0V H;  2L0P A;  2K7C A;  2ZRT A;  4NDD A;  1RWY A;  2D8N A;  3DVK A;  1A75 A;  5AEQ A;  1JFJ A;  3CTN A;  1KFX L;  3OB1 B;  1OE9 B;  3CR5 X;  5B8I B;  3ZWH A;  1EJ3 A;  1QS7 A;  3SG2 A;  4PHK A;  2LMV A;  4HSZ A;  1QX2 A;  2MRD A;  2LVJ A;  5CSF A;  2LLS A;  2BBN A;  4I5J A;  3OHM B;  1Y1U A;  2PVB A;  2Y1N A;  3TUY B;  2DOQ A;  2V53 A;  2PAL A;  2L51 A;  5I8N A;  3IF7 A;  1NCZ A;  1QLS A;  3BUW B;  1ZMZ A;  1L7Z A;  1IQ3 A;  1CFC A;  4PHM A;  1MF8 B;  2WCB A;  1F70 A;  2AMI A;  1G8I A;  3PAT A;  1ZUZ A;  1DVI A;  4OR9 B;  2PMY A;  3TDI A;  1KQV A;  2BCX A;  1EG3 A;  1GJY A;  1H8B A;  4F0Z B;  2E30 A;  5J3X A;  2IS9 A;  3I5G C;  4JQ0 D;  1WRK A;  1J7P A;  4OVN F;  2L4H A;  1CDL A;  2LNK A;  2P6B B;  1SRA A;  1B7T Y;  1N65 A;  1X02 A;  2ZKM X;  3VRP A;  2I7A A;  1ALV A;  1QAT A;  2E6W A;  3BUN B;  1EXR A;  5HLO A;  2LUX A;  4ZCV A;  1NWD A;  4C0J A;  1CFD A;  2M7L A;  1SW8 A;  1TRF A;  4BY4 A;  1KWO C;  4AQJ A;  5HKZ A;  4YGC B;  1MHO A;  1F4O A;  2JT3 A;  3NSO A;  1QVI Y;  1L2O C;  1CDP A;  2I2R E;  4YI8 A;  3TDU A;  1RRO A;  1KFX S;  2H61 A;  3BQ3 A;  4OKH A;  2MBX A;  3F45 A;  2L50 A;  1PSB A;  1RTP 1;  2JXL A;  3CR2 A;  3OP0 A;  1YUR A;  1K94 A;  1J7O A;  1A4P A;  1SYM A;  2WC8 A;  3GK1 A;  3TZ1 A;  3O2P A;  1BT6 A;  1MWN A;  3K21 A;  4M2O A;  5I2O A;  1BOD A;  1NX1 A;  1TN4 A;  3C1V A;  1CNP A;  3VRN A;  1ALW A;  1AUI B;  1OMV A;  3EVU A;  2K2A A;  3EK7 A;  2BE6 A;  1LXF C;  3HX4 A;  3A4U B;  2COL B;  3JTD C;  2LM5 A;  3GK4 X;  1NPQ A;  4E68 A;  1IJ6 A;  2NXQ A;  3KF9 A;  2JQ6 A;  1UHH A;  4PDZ A;  1AJ5 A;  1E8A A;  1Q80 A;  1SL7 A;  3NXA A;  5DKR A;  1CFP A;  3BUM B;  4CPV A;  3CR4 X;  3PLF B;  2JOJ A;  1HT9 A;  2MJW B;  1TIZ A;  3CLN A;  4MSP A;  2LE9 B;  2LAN A;  5AXI A;  4N5X A;  1U5I A;  2KFH A;  3EKH A;  1OSA A;  1KFU L;  1R2U A;  1RJV A;  1A03 A;  1REC A;  3VRR A;  2WCF A;  2CT9 A;  1BLQ A;  2F3Z A;  3BYA A;  2RGI A;  2JPT A;  1A75 B;  2JTT A;  4OCI A;  4N1F A;  4YBH B;  2LP3 A;  2LMT A;  5PAL A;  2AUC A;  1DJI A;  2AAO A;  4CFQ A;  1JF0 A;  4GPL B;  2Q4U A;  2CNP A;  1IQ5 A;  4GFT A;  1WY9 A;  1WLZ A;  3IQQ A;  1XFZ O;  5D7F A;  1KK7 Z;  1OZS A;  2PRU A;  1PUL A;  2KYC A;  5CPV A;  1ZOT B;  1TTX A;  5KU1 A;  3H4S E;  1A2X A;  2K7O A;  2GGZ A;  3TS5 B;  1SPY A;  1LIN A;  1K9U A;  1V1F A;  2NCO A;  3SJS A;  2BEC A;  1K96 A;  3AAK A;  1C7W A;  2BKH B;  4CFR A;  2A4J A;  1CMF A;  2LAP A;  3I5H B;  4XYN A;  3RM1 A;  4PHN A;  3LLE A;  3TS5 C;  2KI4 B;  1CB1 A;  1F71 A;  3TDZ A;  1AK8 A;  1KCY A;  1JSA A;  2MAZ A;  4FQO A;  4Q04 A;  4DUQ A;  5D69 A;  1R6P A;  1WDC C;  2PAS A;  1YUT A;  1B8R A;  2JT0 A;  3FIA A;  1XA5 A;  3O6B A;  4PE1 A;  2M29 A;  2LVI A;  3SIA A;  3O4Y A;  1Y1A A;  1SMG A;  4WRI A;  4I5N B;  3RLZ A;  1TOP A;  3BOW B;  4WQ2 A;  5JOL A;  1YRT B;  1IG5 A;  1N2D A;  1FW4 A;  5HYD A;  3LL8 B;  3JVT B;  2M1K B;  1S5G Z;  1UWO A;  1G33 A;  1NYA A;  1FPW A;  1QJT A;  4HRE E;  4NQG A;  4DRW A;  3EVV A;  1QV0 A;  1J1E A;  1JUO A;  2LVV A;  4GUK A;  5F6T A;  2KSP A;  4GGN A;  1KK7 Y;  1CDN A;  1LKJ A;  1DJY A;  3EK4 A;  3SG4 A;  1SK6 D;  2LLU A;  1BR4 B;  2MLE C;  4MZJ A;  3LCP C;  1UHN A;  2BL0 C;  2F3Y A;  4CID A;  4MEW A;  1BOC A;  3LK1 A;  1BF5 A;  1DGU A;  2EHB A;  1F8H A;  4XJK B;  1TNW A;  3I5I B;  2M1U A;  2ZND A;  1M39 A;  5G08 A;  2R2I A;  1SCM B;  2EC6 B;  3A8R A;  1CTR A;  1K8U A;  1CKK A;  2F2O A;  1EL4 A;  2PSR A;  2KOT A;  1CLM A;  1OZO A;  2L98 A;  1ODB A;  4PAL A;  2LUC A;  3SG3 A;  2K2F A;  1C7V A;  1KK8 B;  1OQP A;  2BCA A;  3OB2 B;  1IRJ A;  2HET A;  4QJ5 B;  4YGA A;  1TCO B;  2KAX A;  1JBA A;  1XFU O;  3M0W A;  4I5L B;  1D1O A;  4ZCU A;  2OS8 B;  1B8C A;  1RK9 A;  1BJF A;  4YGD B;  1OMD A;  5FYX A;  3AKB A;  3WXA A;  3FS7 A;  1L2O B;  1MR8 A;  3DD4 A;  2CBL A;  1TNQ A;  1WRZ A;  1YX8 A;  5AER A;  3BUO B;  1K2H A;  1B47 A;  1UHJ A;  2GGM A;  1W7J B;  1KWO B;  2OTG C;  3EKJ A;  4GBA A;  5GQQ C;  1SR6 C;  1XK4 A;  2KFF A;  5HKY A;  2QAC A;  1EH2 A;  1IH0 A;  2QPT A;  2ZFD A;  1DF0 A;  1YUS A;  3D10 A;  1SR6 B;  2HQW A;  1TNP A;  1CFF A;  2OTG B;  2G9B A;  3DF0 A;  3PM8 A;  3WHU B;  2Y5I A;  1CM4 A;  1HQV A;  1BU3 A;  1TNX A;  1QVI Z;  2NLN A;  3D0Y A;  2KI6 D;  2LVK A;  3PFV A;  2HF5 A;  2ISD A;  1XVJ A;  2LV7 A;  3CWG A;  3ICB A;  1F54 A;  1H4B A;  1DJG A;  1S3P A;  4TNC A;  5I2L A;  1Y6W A;  1U5I B;  3AAJ A;  3IQO A;  2OS8 C;  4ORA B;  1OOJ A;  1PRW A;  4CLN A;  2LLT A;  1AP4 A;  2BBM A;  4UPG A;  2M49 B;  2KI6 C;  1FBV A;  1K90 D;  3HCM A;  1J7R A;  1KK8 C;  4BY5 A;  3WNX B;  4U8D A;  2JNX A;  4YI9 A;  1NSH A;  2ZN9 A;  4MLW A;  3KO0 A;  5IBW A;  2Q91 A;  1A29 A;  1LVC D;  1S6J A;  1SCM C;  1B8L A;  2EC6 C;  3ZNI A;  1AVS A;  4MRX A;  3I5I C;  2LHL A;  1DJH A;  1M31 A;  1YUU A;  4YRU A;  4MZK A;  4MVF A;  2OPO A;  1M45 A;  2BL0 B;  5AFP A;  1SL9 A;  1BR1 B;  1J55 A;  3EVR A;  1XO5 A;  1B4C A;  1NX2 A;  1CLL A;  3OX6 A;  1QXP A;  1KQM C;  1SNL A;  2O5G A;  3AKA A;  1TCF A;  3NSI A;  3VRQ A;  2Y4Q A;  1KFU S;  3PN7 C;  2H61 C;  3JVT C;  2BCB A;  4MRY A;  1S1E A;  1K9P A;  4IL1 A;  1B7T Z;  1V1G A;  2JXC A;  4HRH A;  2JU0 A;  4AQI A;  1SCV A;  3QRX A;  1FF1 A;  4AOM A;  4JWQ A;  3DF0 B;  2LMU A;  2KHN A;  3WHT B;  4A4C A;  1DF0 B;  2LCP A;  5JJG A;  1WDC B;  1NCX A;  1YTZ C;  2KYF A;  4PE7 A;  4GGF A;  1CMG A;  2GV5 A;  2KI4 C;  1RFJ A;  1UUS A;  2TN4 A;  1GQM A;  2KDH A;  3I5H C;  1GGW A;  2HQ8 A;  3FWB A;  2LP2 A;  2NCP A;  1AJ4 A;  1IWQ A;  2JUL A;  2K61 A;  5BPJ A;  2KQ6 A;  1DGV A;  2K0J A;  5CSJ A;  2KBI A;  2SCP A;  3SG7 A;  2WOS A;  2F8P A;  1JF2 A;  1J7Q A;  1NX3 A;  4DIR A;  1S26 D;  2KAY A;  1DT7 B;  1QX5 B;  4M2P A;  1XFY O;  1PK0 D;  2EGD A;  1PVB A;  4QJ3 B;  2M9G A;  1DMO A;  1YVH A;  1OMR A;  2JC2 A;  1W7I B;  2CTN A;  1PAL A;  4YGB B;  1FI6 A;  1YVL A;  1XYD A;  1IKU A;  3D0Y B;  1EG4 A;  1QIW A;  2JT8 A;  4MBE A;  1JWD A;  1FI5 A;  4P2Y B;  4A4B A;  1ZAC A;  1NIW A;  1YRU B;  3SIB A;  3OX5 A;  4ORB B;  1DJW A;  1PSR A;  5CSN A;  3SG6 A;  5AAN A;  1AHR A;  5HLV A;  1QAS A;  2M8U A;  2ZRS A;  1SY9 A;  2SAS A;  4WQ3 A;  4YGE B;  2M3W A;  3I5F B;  1M46 A;  3CS1 A;  2WCE A;  2BKI B;  2F33 A;  2MA2 A;  4XJK A;  1B1G A;  1S5G Y;  2G2B A;  1ZFS A;  2M7N A;  1CDM A;  4QJ4 B;  2KBM A;  1YR5 A;  1JC2 A;  4GAO A;  1KSM A;  1PVA A;  5DKN A;  2F2P A;  3JTD B;  5CSI A;  4C0K A;  1JFK A;  1DJZ A;  3VRO A;  1S6C A;  4MN0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...